5I9ZA

Crystal structure of ephrin a2 (epha2) receptor protein kinase with danusertib (pha739358)
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
293
structure length
273
Chain Sequence
FTTEIHPSCVTRQKVIGAGGEVYKGMLKTKEVPVAIKTLKAGYTEKQRVDFLGEAGIMGQFSHHNIIRLEGVISKYKPMMIITEYMENGALDKFLREKDGEFSVLQLVGMLRGIAAGMKYLANMNYVHRDLAARNILVNSNLVCKVSDFGLSRVLIPIRWTAPEAISYRKFTSASDVWSFGIVMWEVMTYGERPYWELSNHEVMKAINDGFRLPTPMDCPSAIYQLMMQCWQQERARRPKFADIVSILDKLIRAPDSLKTLADFDPRVSIRLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Chemical Proteomics and Structural Biology Define EPHA2 Inhibition by Clinical Kinase Drugs.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Ephrin type-A receptor 2
total genus 82
structure length 273
sequence length 293
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2016-02-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 5i9zA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 5i9zA01
2OI4X 2O3PA 2CPKE 3NIZA 3F5XA 5G1XA 2QU5A 4E26A 3KRWA 2Z7SA 3MFRA 3MVLA 2CN5A 3QWJA 3R1YA 1H00A 4GYGA 4PPCA 5CVHA 4YTIA 4RIWB 2QD9A 1LUFA 2YWPA 5TE0A 3MSSA 3WIKA 2W1FA 5LXMA 2HELA 1O6LA 4M0YA 1U54B 4C38A 4D28A 4JG8A 3A4PA 4D2SA 4JDJA 4ZMEA 2WZJA 4EBVA 3LAUA 5CF6A 4NEUA 3HRBA 3PXFA 4R5SA 3LIJA 1F3MC 4EC9A 4WNPA 2BIYA 2ZAZA 3A60A 4JRNA 4C61A 2C6MA 4DEHA 4C34A 2O8YA 3GBZA 1FGKA 3CTQA 5AR3A 2UZVA 3CKWA 3QGYA 2C6TA 1WBSA 3OOMA 1PXMA 4MEDA 3KA0A 1URWA 1ZYLA 4AAAA 4BL1A 4C59A 4F63A 2O63A 5CSPA 2X7FA 4FEXA 3ODYX 4ONAA 4W4VA 3VO3A 4NL0A 3E92A 4ZSLA 5J79A 4AZFA 3DK3A 4LGHA 3LMIA 4GSBA 3EFLA 2V22A 4X21A 4FICA 5J1WA 3PIYA 3SGCA 2OIDA 3L8PA 1REJA 3ENHA 5AV1A 4XBUA 3ANQA 3NVKI 3EOCA 3VS0A 4FR4A 1CSNA 5JH6A 2GS2A 3AG9A 4FT9A 1IA8A 4IZ7A 3R9HA 3PG1A 3QLFA 3O23A 4XX9A 4R3CA 4ZZOA 5HG7A 3PFQA 2X6EA 4RLLA 1H1RA 2JIIA 3KN5A 3U9NA 4DFNA 3FI4A 2PZYA 4ANMA 4CZUA 1ZYJA 3HVCA 3MWUA 4AXAA 4YJSA 4OAUC 3TZ9A 5E9EA 1PY5A 2ZM3A 3NYXA 4HCTA 2YM5A 2YCQA 2Y6MA 5E1SA 2IZUA 3OS3A 4WRSA 1RW8A 2XEYA 5HESA 3T3UA 3NUNA 1YXVA 2B9HA 4O7ZA 2H96A 2XKFA 3G90X 3TNWA 3MW1A 3PJCA 4Y8DA 4RGJA 1OKYA 3RK5A 2VD5A 4I0TA 5I9VA 5HNBA 3R00A 1JQHA 3QC9A 4KBAA 5M56A 3MH1A 3JYAA 5CEIA 2P2IA 5ANDA 4ZSJA 3E8NA 3EQFA 4NT4A 4QMNA 3OCTA 4HVDA 4P2KA 5KBRA 3O8PA 4E5BA 3HEGA 2RFDA 1X8BA 4ITHA 3CR0A 1QPEA 3MFSA 4RWJA 4YTCA 5HG9A 2PVKA 3RWPA 3R9RA 3EB0A 4HZSA 3NNWA 2BRBA 3DDPA 3GCSA 3FSFA 2QOCA 3B8RA 3VBTA 4CTBA 5AUUA 3U54A 5E8UA 4OAVB 4HNIA 5FEQA 2ITUA 3BYUA 2Y6OA 4I5HA 5HEZA 3W2CA 4PPAA 4RWKA 4BRXA 3D5WA 3WOWA 1YWVA 3D5UA 3FI2A 3NEWA 3FDNA 5E8SA 3BRBA 1M2QA 2R0IA 3IDPA 4JDHA 4K1BA 4CT1A 4QMTA 3CBLA 1OIRA 2FGIA 4X3FB 4O91A 4F0IA 2ETKA 3JY9A 3GCPA 3ETAA 1XH7A 1IASA 1WBWA 2BUJA 3GQLA 1A9UA 3MY0A 4RFMA 4EHEA 5JFVA 4O7TA 3VHKA 3FI3A 3RTPA 4FKWA 3F69A 3W10A 1NT2A 1DI8A 3FZOA 4QMMA 2J5EA 3WZDA 4QD6A 3OMVA 5CAOA 3Q60A 3FLWA 4FMQA 4FTQA 4FKLA 2CGVA 3N51A 3ORTA 5CF4A 5HBJA 3DPKA 4O7LA 3ODZX 1ZMUA 2VX1A 3UVRA 4C2VA 3CTHA 5T68A 2YLFA 2IW9A 4D2PA 5L6PA 3S1HA 3EQHA 1PRYA 2IG7A 4H1MA 3TKIA 4QP9A 4QNAA 3ZUVA 2W4OA 3ZYAA 4CYJA 4XG3A 4CG8A 4MK0A 5AV3A 5JGAA 1XBCA 3EMGA 3Q32A 4OTDA 4F99A 2X81A 4QP3A 2A2AA 3RPOA 5F4NA 3Q6WA 4HVHA 5CSWA 3IOPA 5M4UA 3GOKA 5KHWA 3DDQA 3DS6A 2CNUA 5C26A 3CE3A 3ELJA 3UP2A 2A0CX 4ZP5A 4BKZA 3Q52A 5KKRB 4YJRA 5HU9A 3VAPA 4X3JA 2HAKA 5EKOA 4USDA 2IVSA 4ID7A 5D7VA 4DTAA 3Q9YA 3EN4A 4BTJA 4XV9A 2WOTA 3CC6A 4J96A 4BTFA 2E9NA 2WFYA 3Q9ZA 1MRUA 4CMUA 1KSWA 4BC6A 2YISA 2B55A 3KGAA 3FKLA 4OLIA 3NYOA 3COKA 4FV6A 3TM0A 3KXXA 3U4WA 3LCKA 1OBDA 3BQRA 2XNMA 4KABA 1G3NA 3O0GA 4U44A 4D9UA 1UNHA 1W83A 4RIXA 5AP2A 4DH3A 3TUCA 1OGUA 4AOJA 3BHYA 1H01A 3Q04A 3BKBA 3QTWA 4BIBA 4FVQA 3P7CA 2PVLA 4KINA 3R01A 2Z7RA 2B1PA 4HW7A 3HV6A 3SG8A 5FBOA 2XM8A 2Z7LA 1W84A 3ZONA 3AC2A 2R3QA 2E9VA 1GOLA 3OUNB 4JX3A 4L00A 3FLYA 4APCA 3W32A 3P78A 4X6QC 3Q6UA 3K2LA 4D58A 4FEUA 4WHZA 5HIBA 3C4ZA 4FTUA 4I0RA 4JAIA 3FZ1A 3NUXA 1KE7A 4IX4A 4JJRA 1VZOA 3DTWA 3M2WA 2X2MA 4RVMA 3QX4A 3N4TA 1H07A 2W7XA 4C2WA 5AA8A 4UZDA 5A9UA 1O9UA 2OKRA 4NWMA 5IA2A 4EH3A 2BTSA 5D12A 5C4LA 2PWLA 3UG1A 3EKKA 4RWIA 3P23A 4O84A 1QPDA 4U7ZA 4YR8A 4G3GA 2HK5A 1VJYA 3PLSA 4FTLA 1LEZA 3DKFA 4IAKA 3U51A 2BHEA 1WMKA 4AA4A 3E7OA 4AW1A 2C0OA 5BYZA 4EEVA 1V0BA 2PZ5A 3KF7A 1ATPE 1Q3DA 5IMEA 5KKRC 2HW7A 2PE2A 5EYMA 3VS6A 4O7YA 3ZMMA 4I24A 3O17A 2OBJA 4XYFA 3GT8A 2NO3A 4IE9A 2W9FB 4YTHA 2J0IA 3VC4A 2C3IB 3V8SA 4WG3A 2QI8A 5HNGA 1BL6A 3DQXA 3SRVA 2YIRA 3FSKA 5DBXA 4BTMA 4EJNA 1YOJA 4IAYA 3ROYA 1XQZA 2IWIA 3D9VA 1OIYA 3O2MA 4ZY6A 5M08A 4XBRA 2W5BA 4EH8A 3E8DA 4G3EA 4KBKA 2PPQA 5ETCA 1R0PA 2ITYA 4X2FA 3PY0A 4F1OA 1UU9A 4IX6A 5IKWA 2B9FA 4FBXA 4YC8A 1M7QA 4M15A 3W1FA 3REPA 4EUTA 5FLFA 2YN8A 3P1AA 3FKNA 3U8WA 3JR1A 4D1ZA 5H2UA 4O0RA 3V5JA 3T9IA 4BGQA 5I9ZA 3I0OA 3ZBFA 5FUTA 4YUQA 4KIQA 3TZ7A 4UN0C 2UZDA 5HQ0A 4G1WA 3OXIA 3NUSA 3V3VA 3R7GA 2XK8A 3WYXA 3ORLA 3ZOSA 1OITA 4UX9A 3ANRA 1XH6A 3JPVA 3PA3A 4G16A 3SOCA 4K77A 1R0EA 4LOPA 3W8QA 2JDRA 2JEDA 1H1QA 5IH5A 1T46A 3W16A 1UA2A 3WE4A 2VGOA 4A9TA 1FOTA 2BZIB 3QXPA 5IQDA 2WIPA 2VWBA 4LV8A 5LWMA 1WVXA 1XH5A 2F4JA 2OJIA 2R3JA 4FTKA 1KWPA 4M67A 3RMFA 2E9PA 4LRMA 2WTKC 5CU4A 5DIAA 2ZDUA 5L2SA 2XNOA 3EN7A 3MBLA 3OF0A 2VV9A 2OU7A 1R39A 5BMSA 4IJPA 3EWHA 1KE9A 4IQ6A 4BDEA 2XYUA 3BHTA 4QMSA 3R9OA 4BCMA 2O65A 4A07A 2UW4A 2I0HA 4BYIA 5CF8A 3F3ZA 1PYEA 3LFBA 2IZSA 2KTYA 4O6LA 3DQWA 3ET7A 4H39A 4UXLA 4X2GA 5AM6A 5EI6A 4YJVA 3LVPA 4FIEA 5CWZA 2JKQA 4BWXA 4L7FA 4DYMA 2Q83A 4J71A 4XV2A 4Q9SA 4C58A 2QCSA 3UVPA 3BV3A 4IWPA 4PDYA 4IVBA 2WMUA 2OSCA 2P55A 4NZWB 4JT3A 2X8DA 5FTGA 4U5JA 2UZBA 3OZ6A 5AP0A 3SOAA 1FINA 5ANGA 4FG8A 4D9TA 3HAVA 5LVPA 4R8QA 3BWJA 5H8EA 5B2MA 4KUJA 5A46A 2GSFA 2UZTA 4CMOA 2YDIA 1U46A 2CHLA 1Q61A 3LFQA 3IONA 5IA5A 2WQBA 3F82A 5IQAA 2VWZA 4H1JA 3DTCA 4YJUA 3VBVA 3QQUA 4ZY5A 2IVVA 5FDPA 4E5AX 3FLNC 3W2RA 4IX5A 3A8WA 4ZEGA 3KB7A 3ZLSA 5IISA 3KMUA 5CF5A 1UNGA 1V0OA 4WNOA 3IW7A 3KKVA 4RWLA 3FLQA 4I41A 5AUXA 4C3RA 1IR3A 5HO6A 1JAMA 3ORIA 4NJDA 4M97A 4IVDA 4PQNA 4F9CA 5CZIA 4DFYA 1ZY4A 2YIXA 3HECA 2IZTA 5IH4A 2RL5A 3R0TA 4QMXA 5EYCA 3PG3A 3QZHA 1SM2A 3DB6A 1WBVA 1YI6A 4EZ7A 2W99B 2GFCA 2OICA 2XB7A 2IW8A 3U6IA 3SG9A 1ZOHA 4UB7A 4ZTSA 3VIDA 3UOKA 4IFGA 3G9NA 2JC6A 4JR3A 2ITXA 5EG3A 3PRFA 2YJSA 1XBAA 3Q5ZA 4PL5A 5AUYA 3KK8A 2VWWA 5CX9A 5EYDA 2XNEA 3DFCB 4BB4A 4EZ5A 1WAKA 3R04A 3Q2MA 3B2WA 4C33A 4B0GA 3IOKA 4G9CA 4I1ZA 3RCJA 4U41A 4YO4A 3IW5A 5CI6A 2RIOA 2RFNA 4C3PA 2JKKA 2XNNA 3QHRA 4HGSA 4K2RA 5HO8A 3MJ1A 3G6HA 4EOLA 3MFUA 4AT3A 4CZTA 3PJ2A 4GRBA 3C1XA 5LWNA 4USEA 3SXRA 3OOGA 4UMTA 1SYKA 1SNXA 1OIQA 3FXZA 3SW4A 2ACXA 1Z9XA 4R7HA 4FKUA 4IWOA 2QLQA 2BDWA 2QKWB 3RNYA 3ZM9A 1FBNA 4FKJA 3VUHA 5BQ0A 3QZFA 3HRFA 5IDPA 2UZLA 1OPKA 1FQ1B 5E1EA 3G5DA 1UVRA 2QURA 5FM2A 4CNHA 4XP2A 4FE2A 3SV0A 3AOXA 5TF9A 1J1CA 3KULA 3PP0A 4IB1A 3H3CA 4TT7A 4YPSA 1O6YA 4YJOA 5HX6A 4J99A 1IAJA 2VWXA 4ZJIA 1FPUA 3OEFX 3PVBA 4MTAA 4HGTA 5CU3A 3ZRKA 4EOKA 4F9BA 2UVYA 2YM6A 4FV9A 4EOMA 2JIUA 3F3VA 1PKGA 1YHVA 2J4ZA 2YZAA 4NM3A 1G8AA 3TI1A 4EYMA 4JQEA 2ZB1A 3AD6A 5E4HA 1W0XC 3WYYA 3ERKA 4KB8A 4MBLA 3MYGA 4QMYA 4PP7A 3UQCA 5FG8A 1U59A 2YITA 4AW2A 5G6VA 5JKGA 2ETMA 4BCOA 4N6YA 3UPZA 1H4LA 2CMWA 3QQLA 3F61A 3FUPA 5EDPA 4ALVA 3NS9A 2VTAA 3RNIA 3DFAA 4AGCA 3HDMA 5KX8A 2BALA 4BCQA 3S2PA 3HMMA 3P9JA 4KIKA 3MH3A 4Z3VA 4WBOA 1B38A 4BI0A 5LMAA 4YJNA 4E4XA 5C03A 4NYEA 2C6IA 2QOBA 4TWCA 4V05A 5M51A 5EM7A 2BRHA 4AT5A 2OG8A 3QCYA 3DAEA 5AV4A 3DCVA 5HORA 2Q0NA 3COMA 4BDBA 3E87A 5DLSA 2WKMA 4IX3A 4O0XA 3QD4A 2OK1A 4RJ6A 2C6EA 5CT0A 5HKMA 3BYVA 1H1WA 3C4EA 3KY2A 4FV2A 2C1AA 3R9NA 1URCA 5JK3A 3R71A 3BLRA 3UQGA 3CEKA 3MESA 2XNPA 2X6DA 2WQMA 4CSVA 2CJMA 4U81A 2QU6A 3QU0A 3TTIA 3FPQA 3OW4A 4RZVA 1PXNA 2OXYA 4AGUA 2XIKA 4L3JA 5GINE 4XG7A 5JZNA 1H24A 3UIXA 2CKOA 3E3BX 2WB8A 5HE2A 3CPCA 4EOQA 3GUBA 4YHTA 4YMJA 4IB5A 3DKOA 4FKRA 4U3YA 3HV3A 4APPA 2XKEA 4BDAA 4YP8A 5JMSA 2GPHA 4FVPA 1KV2A 4GYIA 2WAJA 2ZYBA 4UV0A 3VHEA 5L4QA 3CD8A 4RZWA 5CEQA 4HZRA 1YDSE 4V01A 3GCUA 4W8EA 4IM3A 1XJDA 3LFFA 4S32A 1M7NA 1WBPA 3VBXA 4EBWA 4KIKB 4EONA 5ITAA 5M53A 3I7CA 4I22A 3ALOA 3AT4A 4LFIA 4W8DA 3RPYA 3V04A 2JGZA 3A7GA 3MVJA 3QTUA 4U80A 4YURA 4Y72A 4YLLA 3NW5A 2C5NA 3HMIA 5E8VA 3BYOA 4WNMA 4L6QA 4BCNA 2RFSA 4ARKA 3NNXA 3HMOA 4R7IA 1YW2A 4ZSAA 4GU9A 2H9VA 3R63A 3CQUA 3TZ8A 4ZAUA 3PSCA 2YAKA 3ZRMA 3QTIA 1GZNA 3PXKA 4IAAA 2VWUA 2VGPA 3U55A 3G6GA 2VWVA 4C4JA 3E7VA 3ZDIA 3QTRA 5KMNA 4XP3A 1CDKA 1ZYSA 2A27A 4QTDA 5AX3A 4CCUA 1MQBA 1Q8TA 3OP5A 4D4YA 3FEGA 3UZRA 2JIVA 4FKQA 4B99A 1JKSA 3MB7A 4FTRA 3ZBXA 5DPVA 4FTIA 4RLKA 4BCPA 3TV7A 2VNYA 3UIBA 3FZRA 3UODA 2QNJA 4ANQA 2WU7A 1YXSA 1YXUA 3KRLA 3FL5A 4FF8A 4FTMA 4A06A 3R8PA 4Q9ZA 2NP8A 1PJKA 2UZNA 3TNIA 4KKGA 4PY1A 2XJ2A 5K9IA 3NWWA 2VTLA 4ZTNA 1PXLA 4JXFA 2JAVA 3OFMA 3FMEA 4GFGA 5KNJA 3DBDA 3W2QA 5AV2A 3TG1A 3GP0A 1PXOA 3ZZWA 3TNQB 5T3QA 2HWOA 1HOWA 3UNKA 4TWNA 3A7FA 2CLQA 4FV7A 1YRPA 3DBCA 4JIAA 4O0SA 1AD5A 3VJOA 5K4IA 4FZAB 4RVTA 3PZHA 4O1OA 4CQEA 2OW3A 5EW8A 3C0IA 1YDRE 4NUSA 3ZSIA 4ZTRA 1XHAA 3FMMA 5CQWA 4CFXA 4D0XA 1H08A 5EHLA 2V5QA 2IPXA 3ZLXA 4U6RA 3WZKA 4RX8A 4PP9A 2DWBA 4GJ2A 5AUWA 5GZAA 5IA3A 4YGAA 1QPJA 1H1PA 4CMTA 4NCTC 3ULZA 2W1EA 2XBAA 3CGFA 4O7RA 4MNEB 1M17A 2XIYA 3HMPA 2B9JA 2UW3A 2UZUE 4AZTA 5A6OA 1CTPE 3QUDA 4I6HA 2BVAA 2BZKB 4LOQA 5DWRA 2FSMX 1JLUE 3AQVA 3IG7A 3QA0A 3IQ7A 5J95A 5TR6A 3FBVA 4PPBA 2XNBA 4OBOA 4XNEA 3SHEA 1GJOA 1P4FA 3FMKA 3R2BA 4I92A 4TPTA 2VO6A 5CAQA 5FRIA 3MJ2A 4IVCA 2GNLA 1H0VA 3RBWA 2J50A 2WTVA 3ORNA 1YOLA 4Y5HA 4YZ9A 3WF9A 2R3RA 4TY1A 2AYPA 4GT5A 5F95A 3TZMA 4PTEA 3OBGA 2F7ZE 5HBEA 4IIRA 2WTIA 3R21A 2F7EE 3AC3A 4YC3A 1BI8A 2PYWA 4FZFB 4UZHA 4KIPA 3TNPC 2C3JA 3ZFYA 2HWPA 5JGBA 2Y0AA 4I93A 2OJ9A 3LLTA 4FKSA 4FV8A 4C8BA 5AP7A 2FSTX 3VVHA 5IQCA 4KBCA 5DEWA 4IDVA 3TJDA 5JN2A 5CAVA 4AN2A 4FSQA 1YVJA 4EOSA 3HGKA 3HNGA 3NPCA 2C68A 3O7LB 2C69A 5E7RA 4IH8A 5JRQA 2VO0A 3ZEWA 4WUNA 1YXXA 2NRUA 1L8TA 4MBJA 1J91A 4LGGA 4QMVA 4TL0A 1J7IA 3WE8A 3COHA 5BMMA 3RP9A 2YDJA 1TKIA 2R4BA 4CGAA 3AC4A 2OJJA 4FK6A 4FTNA 4KIOA 5CASA 4O7SA 2ZB0A 3C4CA 3PLAE 4PL4A 2WGJA 3L8XA 2ZDTA 2PSQA 2YAAA 3QTXA 4RRVA 5CAUA 2W1GA 2AC5A 4AW0A 4EWQA 2ITQA 4OTRA 3MPMA 5CXHA 4IC7A 2J0JA 3LPBA 5KMLA 4UMRA 4WD5A 5LJJA 2JDOA 3LFNA 3ZO1A 4A9SA 4AGWA 4DGNA 1J3HA 3PA4A 4WOVA 3GC0A 4MH7A 2KULA 5FM3A 5B2KA 4QP8A 4WSYA 3TKUA 4ASXA 3QQJA 1KE8A 3CCNA 4GUBA 1A48A 3LCTA 1SNUA 2R3PA 4V04A 3QALE 2XJ1A 4GUEA 5EM8A 3PRIA 4Z7GA 4DFUA 2R7IA 4ZS4A 3HL7A 3ALNA 1CMKE 2YJRA 3BU5A 4M68A 4P90A 4X6RA 4F7JA 3VF9A 3KXZA 2OIBA 1ZMVA 1BI7A 2EVAA 2XIRA 3LCDA 2WMVA 4GMYA 1V1KA 5KUPA 3IKAA 2UZEA 3QAME 4IB3A 1WFCA 4L42A 5KE0A 5FWKK 4GS6A 3ZLWA 5ANKA 2CN8A 3A4OX 3H0YA 1PF8A 4RIWA 2PE1A 2GNJA 5IQBA 3V51A 3DU8A 3I7BA 4DT9A 3FXWA 1QCFA 1UKHA 1UWHA 2YA9A 2B54A 3CIKA 2F2UA 3D0EA 2WTDA 5D11A 4AZWA 2J0KA 2PU8A 2WMAA 4QTEA 3PDTA 5AM7A 2UW7A 1OPJA 3A2CA 4Z9LA 5M07A 3NMUF 4ZJJA 3LXNA 2DYLA 3QWKA 5LMKA 3GQIA 4IAZA 2FSLX 5LOHA 4TYGA 2GNGA 2X2LA 3HP2A 1U54A 1FVTA 3K54A 4C02A 5I9XA 4DCAA 4FYNA 3BGZA 4RSSA 3ZM4A 4BR3A 5IEYA 4M3QA 4I4FA 4E4MA 3FJQE 3FMLA 4GJ3A 3PP1A 3DBQA 5IA4A 5L2TA 2GMXA 5JQ5A 2PVHA 3MV5A 2QR8A 5FBNC 3AGLA 1Q97A 2WD1A 4QP6A 4UMQA 4A4XA 4DEIA 4ZJVA 4ANBA 3KQ7A 3PY1A 3FKOA 3ATSA 2PUNA 3R8LA 4Q5EA 3DNEA 5HGIA 3CD3A 5EOLA 4CZYB 3LFAA 3FZSA 4YHFA 4AFEA 4FTAA 4BZOA 2QR7A 4HVSA 2VX0A 3T3VA 4JVGA 4PL3A 4DLIA 1BYGA 1AQ1A 1K3AA 4ZZNA 3TV4A 4LQMA 3D2KA 1ND4A 3C4WA 5KMJA 2BR1A 3NLBA 3LW0A 5EM5A 4EZ3A 2W1IA 2ESMA 5EI2A 5AP4A 4R78A 4NIFA 4D4RA 5K3YA 4FV5A 4UEUA 4E6DA 4MQ1A 4TYHA 2DS1A 3A61A 1LR4A 3H10A 3C5IA 3KK9A 2WO6A 2WU6A 4DC2A 4UMPA 2QODA 4X3FC 3TJCA 1SMHA 1W82A 2J5FA 3DJ7A 4FI1A 5AAEA 4QPMA 5L8KA 3WZUA 3RKBA 3FMNA 4F6SA 4BDKA 5JSMA 2YM4A 2C6KA 3QCQA 3DJ5A 3PA5A 4IEBA 3C0HA 3OXZA 4WKQA 4BZDA 3GC7A 4TYIA 2ZJWA 3FE3A 3UNJA 4GKHA 3Q53A 1ZYDA 5DR2A 5HTBA 3L8SA 1P5EA 4BI1A 4E1ZA 2PY3A 1LP4A 4HJOA 4HCUA 2JKOA 4EH5A 1YOMA 2QO7A 5DN3A 4J53A 4YBKA 4BIDA 3TT0A 3M42A 2ITTA 3D4QA 4WRGA 5CAPA 3Q5IA 3WZEA 2XK9A 1IEPA 2W4JA 4PX6A 4DH5A 4FNZA 3OBJA 4QQJA 4BDGA 4GK4A 4YLJA 4O38A 4E4LA 4DINA 5BVFA 3OWJA 5IA1A 3Q96A 2BFYA 3QQGA 3VBYA 2PMNX 3AC1A 4EI4A 1H27A 3ORPA 3GU5A 3RAWA 1LPUA 5KCVA 2I40A 2CDZA 5EI8A 4K6ZA 4LI5A 5A4EA 3P7BA 3ITZA 4EK5A 4WO5A 3W2OA 5EHYA 3MH0A 2HXQA 3QTZA 4YZNA 3KMWA 1CKIA 2JKMA 3JY0A 4Y85A 3P79A 3Q4UA 5J8IA 4EHZA 4L68A 4JG6A 2QKRA 2SRCA 4K11A 4XP0A 4AQCA 3V5PA 4Y46A 4DH1A 4BYJA 4Y73A 2PULA 2FH9A 3QZGA 4O2ZA 3R2YA 3UTOA 4UYNA 2ZV9A 5F94A 4A4OA 4F09A 3G33A 3QQKA 4G2FA 3RI1A 2ZV8A 4I6QA 4ZIMA 2PL0A 4AFJA 1OKVA 1H0WA 4RC4A 3D7TB 4FA2A 2C6OA 3W18A 1XBBA 3EQDA 2O0UA 2HIWA 4A4LA 3QD0A 5H9BA 3OUKA 3SLSA 3GOPA 3S4QA 2GS6A 4QYHA 5CSVA 2FSOX 2VTOA 3PJ8A 2BDJA 5CI7A 1ZOEA 4ZSGA 2Y8OA 3WBLA 4XOZA 5CTPA 5JRSA 3GCVA 3EL7A 4FEQA 1RDQE 3F7WA 1VYWA 3DNDA 4A9YA 2Z2WA 4IWDA 4UWCA 2YERA 4ALWA 3MY5A 4AZVA 3ZEPA 5D7AA 2ONLC 3OXTA 5KMKA 3QLGA 4BCHA 2FUMA 4YBJA 4ZTQA 4E7WA 4CRLA 4MHAA 5JFWA 1UKIA 2QOFA 4GFOA 3TN8A 5M44A 4F9WA 1O6KA 4LMUA 3FI8A 2ZOQA 4EK8A 3D83A 1NVQA 4MD7E 3POZA 4QTBA 5AP6A 4ZY4A 5LCKA 1OL6A 4I5MA 2RSVA 2JDSA 2VN9A 4NSTA 1G8SA 3EFWA 2LGCA 4E93A 2QOQA 2VTNA 1M2PA 3A62A 3R30A 4BWKA 1GIJA 3VS2A 4I21A 2EB3A 2YABA 3P5KA 1XH9A 4CFUA 3SRVB 4AACA 3LXKA 5M4FA 3ZUTA 3DXQA 1YKRA 1RQQA 5I3OA 3LFEA 4R3RA 2GS7A 4FGBA 4GV1A 4FTJA 4RJ7A 5J7BA 4PMTA 5CNNA 1FMOE 3O8TA 2C4GA 3EQCA 4GVAA 2YM8A 4YJTA 5IQHA 3VRZA 5DRDA 4FT3A 4BGHA 4CFFA 4CKRA 3R9DA 5I9WA 3AT3A 4O0WA 3BHUA 2YEXA 2BKZA 4AZEA 4USFA 4ANNA 3L9PA 3TACA 3B8QA 4JAJA 5ANJA 4BCGA 4ZLZA 3ZS5A 4BICA 4PMPA 5M09A 4FGRA 3CXWA 4QTCA 2VTHA 5HTIA 3R22A 5FDXA 3QYWA 4MXAA 4S30A 3DBEA 4H05A 1Q8WA 2W5HA 5C9CA 4JS8A 5CEOA 4FEVA 4E73A 4IM2A 4YLKA 2B0QA 4MXYA 3DBFA 5HO7A 3D5VA 5AUVA 2VU3A 2CLXA 3R8ZA 3UNZA 2V0DA 2E9OA 3VWAA 5DT0A 2UW0A 1OPLA 4KD1A 1OL2A 2BCJA 4TTHB 5ACKA 5IF1A 4QYGA 3AD4A 5L2IA 4BDJA 4E8AA 4FSYA 4YJQA 1ZMWA 3OEZA 4B8LA 1YHSA 5CU0A 5E8XA 5BVNA 1FMKA 2GNFA 1UU8A 3T9TA 3GGFA 3WZJA 1T45A 3MFTA 4FL3A 1OUKA 4FT5A 5C8NA 1IG1A 3GCQA 5TOZA 4CT2A 4D2VA 1Y8GA 2C30A 4EK3A 5K5NA 4IBMA 2XP2A 3QXOA 5AR4A 3R7UA 2XA4A 3KRRA 3UIMA 5EQEA 2EXMA 1Q62A 3MPTA 3PVWA 3BBWA 5BYLA 5HIEA 3BV2A 1M2RA 4G3CA 5LVNA 4FV3A 4RT7A 4PRJA 2J2IB 4TWOA 3VJNA 4GKIA 2DQ7X 5IMXA 4BWPA 2F7XE 2VO7A 3H30A 3RAHA 4L45A 3RK9A 3SQQA 5BPYA 3BWFA 3ZLYA 1OB3A 4E20A 3KU2A 3BGQA 3D7ZA 1MQ4A 2JAMA 4WSQA 5BUJA 2HOGA 1U4DA 2Q0BA 2UVXA 2R64A 4O22A 2QQ7A 4XCUA 4AWIA 3UE4A 4V0GB 5EK7A 1UNLA 4J97A 4YSMA 3QKMA 3QKKA 2BDFA 3MH2A 2AC3A 4MVFA 4QNYA 3DAKA 4X2NA 4G6OA 4BDFA 5HG5A 4O7WA 2EWAA 4F70A 2PZPA 3H9RA 3HYHA 2J51A 5FTQA 2GCDA 3RAIA 4FEWA 3IGGA 4JQ8A 4OT6A 3SKCA 3GU8A 4PTCA 4W9WA 3AC8A 5IEXA 3VF8A 2WHBA 2HZ4A 2WTWA 3D94A 3LCSA 4FL1A 3S95A 4FG9A 4FTOA 4FKPA 4J8NA 4OT5A 4OTPA 2W4KA 3E8EA 5FQDC 5E92A 5A4CA 1KOAA 1VR2A 2C6DA 3PTGA 4FIIA 4O81A 4FL2A 3KRJA 1NW1A 3GNIB 4FT7A 4CV8A 5EDQA 4NKSA 4JDKA 2VTIA 4EOJA 4MKCA 5AMNA 3KCKA 2UZOA 4JBQA 4QYFA 4ITJA 1PYXA 4AX8A 3L9LA 5GZ8A 1MRYA 4FUYA 5BVKA 3RHKA 1YDTE 4FKOA 1HCLA 3QYZA 2QOKA 3L9MA 1OM1A 3TIYA 5AR5A 3E63A 3OD6X 2YIQA 5L2QA 3FZTA 4HGLA 3LMHA 3TDWA 2ITZA 5C8MA 3UBDA 4EQUA 2X1NA 2BRGA 4FSNA 4BBMA 4EUUA 3I5ZA 4NW6A 5JEBA 2V7AA 2RFEA 4U0IA 3L9NA 4IANA 3IDCA 4ZZMA 2XVDA 3IW6A 5KHXA 4MD9E 3JVSA 5L3AA 1JKLA 4JNWA 5CVFA 3NUAA 3MTFA 3OY3A 4IACA 3LFDA 2JFMA 1ZYCA 3BQCA 3ZCLA 3CP9A 3OROA 4XMOA 3E93A 5CY3A 3CSVA 3D5XA 3EZRA 2WTJA 4QP2A 3ZSGA 4FKIA 1KE5A 3TIZA 4I5CA 3OTVA 2ERZE 4F0GA 3QZIA 5TKDA 4RMZA 2JBOA 1W8CA 3FHIA 4D4SA 4FUXA 4BDHA 3F9NA 4QMOA 1ZZLA 3F3WA 1YQJA 1J7LA 4DEEA 4XUFA 3ORXA 4MXCA 2VUWA 3VUDA 4F7LA 4DBNA 4IZAA 3HAMA 3NW6A 3HX4A 2HYYA 5AR8A 4XG8A 2ONLA 3C51A 4HYHA 3F5GA 5FP5A 3ZZEA 5EW3A 4J8MA 3EL8A 3G0EA 4L53A 4DGMA 3BLHA 1YWRA 2G1TA 4DHFA 1OBGA 4NW5A 2OZAA 4QMWA 3LM0A 3NVMB 1WCCA 3ZSHA 4GT4A 3G15A 5BUEA 3ZXZA 1DAWA 1P14A 1F0QA 4MAOA 5IU2A 3RCDA 3I6WA 1Z5MA 1H26A 1R1WA 2ZVAA 4X7QA 3RALA 3VUTA 5BYYA 3P0MA 4OUCA 4S33A 4EYJA 5E91A 4IMYA 3UYSA 4D5HA 2WMBA 1GIIA 3NX8A 3EZVA 2HZ0A 5AX9A 3TUBA 4OTHA 1S9IA 4W9XA 4ZK5A 2OLCA 4DN5A 1QL6A 1NY3A 4CQGA 5DG5A 3L1SA 4FYOA 5CXZA 4RJ4A 4I6FA 4RG0A 3S3IA 2QO2A 3GU6A 4JQ7A 4WUAA 1I09A 4JRVA 3EN9A 3CTJA 4M14A 4B7TA 2R3NA 2RKUA 4R1VA 4YC6A 1DI9A 4FKGA 3SD0A 2GQRA 1JKTA 2RG5A 2XYNA 3TUDA 4DFXE 5K0XA 2XF0A 3CQEA 4BFMA 3WIGA 1ERKA 4MBIA 1WVYA 1JVPP 2W1ZA 3NGAA 3R1SA 5D1JA 4BBFA 5DRBA 2YZLA 2WQEA 2FVDA 2G01A 3UIUA 5DA3A 4I6BA 1ZOGA 4IHPA 3FQEA 4AU8A 3F6XA 3RAKA 4DEGA 2R3LA 2YIYA 4L3LA 3VS3A 4DEAA 5HVKA 1APME 3P08A 2B52A 1OZ1A 2XIXA 3LLAA 5GJFA 4PUZA 3LFCA 3ACKA 2VZ6A 5LMBA 2A4LA 4AA0A 1GIHA 2I0EA 1Y8YA 3R7YA 5DE2A 4C3FA 4EJ7A 4GG7A 3PPZA 4N57A 5L6OA 2VTPA 4IW0A 4J1RA 4XHKB 4QQCA 5HI2A 4QPAA 2IO6A 3O8UA 4FKTA 3P4KA 3QRTA 2ITWA 4I94A 4WIHA 2GTNA 2WTCA 4IWQA 4M12A 5E8ZA 2X8IA 4OBPA 4QP1A 2DUVA 2W17A 4PMMA 3OC1A 4QP4A 3N9XA 3W2SA 3W2PA 4BKJA 2EXEA 4LM5A 3MPAA 3DY7A 4GH2A 2OFVA 2HY81 3V5TA 2F9GA 3MB6A 4KNBA 4U8ZA 3QQFA 2IW6A 4U40A 3R7OA 3U9CA 3BEAA 5FXRA 4YTFA 2PVYA 1REKA 3IGOA 3QUPA 3U6HA 4ASDA 3ORZA 1PMUA 5E90A 4BVUA 4XG9A 3FQSA 4I23A 1K9AA 5M57A 3EHAA 2W9ZB 4KSQA 1OL7A 5I3RA 5LVMA 2G15A 4CYIA 3GFWA 4O7VA 1P4OA 4ACDA 4AN9A 2XRWA 4B6LA 4E4NA 1Q8UA 1YWNA 4OBQA 3PE2A 4V0GA 1MUOA 3KC3A 5HIDA 3GU7A 5CEKA 4D55A 4ZSEA 3A7HA 1Y91A 4IZYA 2VTSA 3Q3BA 4YZCA 5DHJA 1KE6A 4BF2A 2R3IA 3R28A 1H1SA 3C4XA 5HVYA 5DH3A 5B2LA 2OF4A 4UYAA 1ZRZA 3CPBA 3ZUUA 2X9EA 2O5KA 3EFJA 3WF5A 1JPAA 3ENMA 3NNVA 4MQ2A 4O2PA 4I0SA 3HUCA 4O6EA 2FO0A 4D0WA 4IFCA 4DCEA 3QRKA 3LQ3A 3Q2JA 1XH4A 2I1MA 3LJ2A 3DJ6A 3QX2A 3ZU7A 4L44A 4QMQA 4MX9A 4FV0A 3VBQA 5AUTA 5ETAA 2PZIA 3AMYA 3RZBA 2R7BA 4PDPA 2XBJA 3MTLA 2GNIA 2YDKA 1WVWA 2XRUA 4P5ZA 4KKHA 5M06A 4FVRA 3LXLA 4I5PA 4ANSA 3SA0A 4LL0A 3AXWA 3ZTXA 2WEIA 3JUHA 4EH9A 2BFXA 4ASZA 4BCFA 1TVOA 4F1MA 3TCPA 2P3GX 2YHVA 3RM6A 4QRCA 5A14A 4W4WA 1EH4A 2B9IA 2OH4A 5J9YA 2JFLA 4R77A 3FAAA 2BRMA 3F7ZA 4OR5A 3OWLA 1XKKA 5HG8A 3PSBA 1P2AA 5AR2A 4B8MA 3MI9A 3DZQA 4XG4A 3Q9WA 3LJ1A 3OG7A 4PTGA 5F9EA 4AOIA 3VW6A 2Z60A 3QUEA 4JOAA 4W4YA 3ACJA 2I7QA 1TQIA 2RGPA 2YCFA 3QD3A 4HPUE 2LAVA 4F64A 3Q9XA 1Q3WA 2VTMA 1GY3A 3I60A 3O51A 2WMTA 3KEXA 4E6AA 5EQYA 4Y95A 1BX6A 4YZDA 5H8GA 3KMMA 4NFMA 2XJ0A 4NJ3A 4ZS0A 2V55A 3HKOA 4RFYA 1PXJA 3CLYA 1G5SA 3KFAA 5KO1A 4IM0A 2YM7A 4RQVA 3PY3A 4FV1A 3KRXA 2A1AB 4JLCA 5IA0A 4GIHA 4P5QA 4C57A 2HENA 5IZFA 3SW7A 4FTCA 5FP6A 4JBOA 1WZYA 4FZ6A 3CJGA 4RIXB 4DG3E 5AADA 3BEGA 3OW3A 2OJFE 5DT3A 5C8KA 3NAXA 3NSZA 4RFZA 4ITIA 5DNRA 3QRUA 4DTBA 3HRCA 1RJBA 4OGRA 5CLPA 2OZAB 4FZDB 3R8UA 5KBQA 5A6NA 2XK7A 3CJFA 4KSPA 4EH6A 2IZRA 4QYYA 2XZSA 3SXSA 4A9RA 3OWPA 3OHTA 4H3BA 4PDOA 3CKXA 3UG2A 3I4BA 4YNEA 4FTTA 1QMZA 4ENYA 5BVDA 4M7IA 3BU3A 5JZJA 5CENA 4GU6A 4EHGA 4D2RA 3THBA 3K3IA 4FT0A 4N4SA 4EWHA 4U42A 3F66A 2PMOX 4F0FA 2BILB 4JX7A 5LVLA 2ZV7A 3JXWA 4LRJA 4PMSA 5AJQA 4LUEA 4AF3A 4D1SA 4DEDA 3CQWA 4LG4A 3PVUA 1ZARA 3HA8A 3ULIA 3IECA 1PMNA 2WEVA 3GC9A 1Y6AA 3FL4A 2UW9A 2GTMA 2J6MA 2VTRA 3PXZA 4FK3A 1CKJA 2CCHA 2H6DA 5DFPA 5JGDA 3V5QA 3EQPA 4H36A 3VQUA 4LUDA 4YPDA 5ANIA 4CFNA 4EL9A 4X0MA 4DTKA 4LOOA 3W8LA 4TWPA 5IPJA 3AD5A 4BY9E 5HOAA 4Y5QA 4GK2A 3QKLA 4YU2A 5GIPE 4R7BA 3EJ1A 5D41A 2GNHA 4MXZA 2YCSA 1M52A 2UZWE 3FHRA 3F5PA 4P7EA 4AW5A 5BNJA 2CKQA 5HICA 3NIEA 3GFEA 5C4KA 2J7TA 5DEYA 4IJ9A 5CSXA 2IN6A 5CYIA 5GHVA 1WBNA 3QHWA 3FPMA 3V5WA 5J87A 1XH8A 3MA3A 2EUFB 3MIYA 5EH0A 5BVOA 4EK6A 4L01A 3VS1A 1YI3A 2NPQA 1UV5A 2PE0A 3OY1A 3UGCA 3WF6A 3FV8A 2HY0A 4L8MA 2JDVA 3BU6A 3UVQA 4ACMA 4TXCA 3LFSA 5IDNA 5HD7A 5J5TA 5EFQA 2OWBA 3QCSA 1YXTA 2PUIA 4IC8A 2PK9A 2QVSE 2YLEA 4H3PA 3GB2A 2VRXA 2WMWA 3U6JA 4HOKA 5AAGA 3DLSA 1R3CA 2J0MB 3KXHA 3NYNA 3QF9A 4OTQA 4TNBA 3DT1A 5EM6A 4PNIA 4HCVA 4RVLA 4ORKA 3WILA 3DK6A 3WI6A 1H25A 2A19B 3BHVA 1KUTA 4L7SA 5B0XA 4W4XA 5EW9A 2C5OA 5IUHA 1ZLTA 3NRMA 2X7GA 4OTGA 4EH7A 4F7NA 2XCKA 4KAOA 2XKDA 4RX7A 4AUAA 5A4QA 3UO5A 5HU3A 3VBWA 2WMXA 2C5YA 2G9XA 1NXKA 3O50A 4G17A 3KXMA 4AGDA 4CKJA 5I0BA 2BIKB 4HVGA 2QOOA 2X2KA 2Z8CA 3I0QA 3T8OA 1BKXA 4ALUA 5JFSA 4BCIA 1GZKA 4NIFB 4A7CA 4YSJA 1Q8ZA 3DKGA 3UO6A 4Z16A 5LCJA 4NM7A 4OTFA 4FC0A 4QYEA 3FMDA 4D1XA 4XG6A 2BTRA 3G0FA 2VTTA 4GL9A 2YM3A 4QT1A 4M0ZA 5I9YA 4FG7A 4RJ3A 5AWMA 4AE9A 2XK3A 3EH9A 3IDBA 4F9AA 3MDYA 3PWYA 5DYJA 3PVGA 5KZ0A 1Q8YA 2QO9A 3EN6A 5AV0A 4D2WA 2UW8A 4U9AA 5CANA 4BDDA 4LV5A 1JSUA 5HLNA 1V0PA 3R6XA 5IUGA 3TKHA 3FY2A 4BTKA 3BYSA 3Q4CA 3I81A 4F7SA 4AT4A 3LM5A 4MXXA 5CALA 1JBPE 5HX8A 1OIUA 5BVWA 3PPKA 3PXYA 4C7TA 1OECA 4J52A 3SXFA 3TV6A 4XG2A 2XS0A 3EN5A 4YHJA 1ZAOA 4O1PA 4CCBA 1JKKA 1Q99A 4AZSA 1UU7A 2G2IA 2XMYA 1OI9A 3BIZA 5HLPA 3BYMA 2QOHA 3VS5A 4G6LA 4ANLA 4ZTMA 3V8TA 4K33A 2QHMA 4S34A 5J5SA 3I6UA 2R3HA 2W1HA 2QOIA 4KRDA 4TZRA 5HD4A 2H8HA 5AP3A 3PZEA 3Q4TA 5AIRA 2WMQA 4M84A 4G34A 2BPMA 2UW6A 3EQIA 4GK3A 4WG5A 3WF7A 3RPVA 1OKWA 2J0LA 5CEMA 2I6LA 3R7EA 2J9MA 2VNWA 4RA5A 2XK4A 4F08A 5L6WL 4EOPA 4GG5A 3UZPA 3BX5A 2C3LA 3QRJA 2Y7JA 3ORKA 3O7LD 4FKVA 2PVFA 5I5ZA 5H3QA 3E8CA 4FZ7A 4RC3A 1XO2B 2F57A 3S00A 4G3DA 3CY3A 3AMBA 3OTUA 2R3MA 3RPRA 4DH8A 3VULA 4UXQA 5KMMA 4XS2A 3FZPA 4DFZE 1GZ8A 4ANOA 1Y6BA 5J1VA 2R3KA 4ERKA 5L2WA 3HV7A 3AT2A 1HCKA 1STCE 3NYVA 4BN1A 5K5XA 4FNWA 3H9OA 4HGEA 3W55A 3N4VA 5GJGA 2J90A 2JD5A 2R3GA 4GT3A 4DFLA 5F20A 3UDBA 3GC8A 4IAIA 1ZXEA 3WF8A 3BE2A 5CZHA 5A54A 3ZRLA 3L8VA 5HE3A 2VX3A 1XWSA 5DOSA 5FXQA 3U87A 2ZV2A 3V6RA 4DGOA 4FIGA 1IAHA 3DXPA 2BAJA 2ITNA 3DAJA 4FSRA 4NH1A 3KULB 4E5WA 2R3OA 4HYIA 3MA6A 3PSDA 5BVEA 3LZBA 4DF3A 1BL7A 2JLDA 4AP7A 4FSZA 4NFNA 2QC6A 4C4IA 2ZMCA 3JVRA 3QGWA 2G2HA 3ROCA 4BKYA 3TXOA 3HDNA 3ZO3A 4L52A 4X3FA 2QG7A 2XH5A 3SAYA 4NKAA 4NTSA 4RBLA 3ZH8A 4KS7A 2GQGA 5HE1A 2W1DA 4KS8A 4F4PA 1L3RE 2W05A 5DR9A 2CGUA 3POOA 4O83A 4XOYA 2X9FA 5BX0A 4O0YA 3EYHA 3ZC5A 4DE4A 3GXLA 3ORMA 1IA9A 3JS2A 3RJCA 3B2TA 4CRSA 2WNTA 3QRIA 3UOLA 4AS0A 2C5VA 4UBAA 4JIKA 3NDMA 3R8MA 4KA3A 2E2BA 1LEWA 2OXDA 3D15A 4GCJA 4XJ0A 3II5A 2OO8X 3R7IA 5K0KA 4EH4A 1AGWA 5FEEA 3QTSA 3CGOA 4FIFA 2EB2A 3DZOA 3IW4A 3UO4A 3I79A 2G2FA 4TYEA 1FVVA 4GW8A 4D2TA 4HVIA 3U4UA 2WIHA 2B53A 3K5UA 4RA4A 4DG2E 1WBOA 4AE6A 3C0GA 3NUUA 2C47A 3RVGA 4JDIA 5GZ9A 3V5LA 1MP8A 3SC1A 3MVHA 1SVHA 5HCZA 1OUYA 1RE8A 4EOIA 1ZZ2A 3ATTA 3E64A 4O21A 5GNKA 2GU8A 3LE6A 1UU3A 3RZFA 3NCZA 3BELA 1PMVA 1JSTA 3C50A 4CEGA 4DA5A 3V8WA 2BRNA 2WELA 5C27A 2GFSA 4AA5A 3R8VA 3E3PA 5BUIA 2BROA 5F1ZA 4ZTHA 2PVNA 2VTJA 3PPJA 3DK7A 4PV0A 4DAWA 5B7VA 2E9UA 4FSMA 4EORA 2PVJA 2UVZA 1B6CB 2PVRA 4HNFA 2ITPA 3SVVA 5LVOA 2Z7QA 4DGGA 4UY9A 3N4UA 4DBXA 1W7HA 3RINA 3DOGA 3DV3A 4B9DA 4TYHB 4WG4A 3TNHA 3AMAA 4PWNA 2OGVA 4L43A 3G9LX 4R3PA 3G51A 1KOBA 4MNEA 5CS6A 4MF0A 4FIHA 2BZJA 3IK3A 3PE1A 4XV3A 4TKSA 4DEBA 4MWHA 1ZY5A 1F5QA 3NZ0A 4S2ZA 4E3CA 1Q4LA 4FSWA 5JQ8A 5JT2A 4O7NA 4I20A 3BE9A 3FC1X 5M55A 5KZIA 4FSTA 4FX3A 2CNVA 3OCBA 4N70A 4NU1A 3AC5A 4EOOA 5TT7A 4L9IA 5CT7A 2WOUA 3DXNA 4OW8A 1SVGA 3NUYA 3K5VA 2BMCA 3QBNA 3MIAA 4TW9A 3COIA 3BCEA 2IVTA 3VUMA 4QOXA 3VQHA 3C7QA 5L8LA 1J1BA 3PIZA 4II5A 5AP1A 5IQEA 4BCJA 3VNTA 2HCKA 1YI4A 2X0GA 5C1QB 3D14A 2VO3A 4FNYA 3TWJA 3VUKA 4FNXA 3BPRA 3A7IA 2R0UA 2PMIA 3FC2A 1W98A 3GENA 2ITOA 2UW5A 4P4CA 4B4LA 5CVGA 4M69B 3V01A 4TN6A 2JDTA 3KVXA 3EQBA 4IXPA 4OTIA 5T6KA 4ASEA 2W06A 2XKCA 2VWIA 3KXGA 5C01A 2GHLA 2RG6A 1OKZA 4RQKA 1OMWA 3FXXA 2PTKA 4ZOGA 4CG9A 4ACCA 3NNUA 1H28A 2XUUA 3FLZA 3SX9A 3EKNA 4ZLYA 4C4FA 3VS7A 5DMZA 3UOJA 5AR7A 4RC2A 3HV4A 2X39A 5IEVA 3R1NA 5HCYA 3ID6C 2FA2A 4QMLA 4UALA 5CSHA 2UUEA 3CY2A 1DS5A 3A7JA 4JG7A 4WNKA 4YNOA 5AFVA 1BMKA 3MGYA 1MRVA 3UC3A 2PHKA 3HA6A 4EKKA 4TNDA 2BAKA 4HPTE 5CQUA 4O0UA 1YHWA 3WARA 2QLUA 4KWPA 2WQNA 3IPHA 3KL8A 3ZHPC 3DB8A 4G3FA 2VWYA 3LQ8A 4J95A 5HCXA 4BZNA 5EKNA 5HBHA 3FYKX 2JBPA 2OZOA 4C4HA 3HZTA 3HUBA 4M66A 3DGKA 2C1BA 4ZTLA 1NVRA 4AN3A 5AIKA 2Y9QA 4IZ5A 4GIIA 3I1AA 2XNGA 2YWVA 3VUIA 1TQMA 5TO8A 4YJPA 2WMSA 1Z57A 2PUUA 3DLZA 3LHJA 2CGXA 4RIYB 1PXPA 4QO9A 3G2FA 2Z02A 2REIA 2X7OA 1Y57A 2C6LA 4C0TA 4UMUA 3HP5A 5L8JA 4WA9A 5JFXA 5IQFA 2CKEA 2R5TA 4RIYA 5A3XA 4C4EA 4GVJA 5A4TA 2WPAA 2YFXA 2EXCX 2CCIA 2X4ZA 2P33A 4GFMA 1OL1A 1GZOA 2OXXA 2WMRA 3SDJA 5DT4A 4MWIA 4ERWA 2HZNA 5KMIA 3MVMA 5J7HA 4HYUA 4BHZA 5M4CA 1SZMA 4FIJA 3MN3A 4M13A 4QMUA 4BGGA 2O2UA 2X4FA 4PDSA 4TYJA 3LJ0A 5E8TA 4RX9A 3F3UA 4E6CA 2YACA 5GJDA 3F3TA 3MS9A 3HMNA 3A8XA 4TRLA 3RM7A 3PWDA 2X8EA 1DM2A 4DT8A 3O71A 2CNQA 3BZ3A 4C36A 3D2IA 1PKDA 4PF4A 4R5YA 5E8WA 3FMJA 3VN9A 2BZHB 2ZMDA 4QQ5A 4JR7A 5K4JA 3BBTB 5HVJA 2W96B 3R7VA 4C37A 2O64A 4ZMFA 3HLLA 3C4FA 4CXAA 4GEOA 5HTCA 2XEZA 4CKIA 4JBPA 4FOBA 3LMGA 3GU4A 3RHXA 3R73A 3NAYA 5D10A 4K0YA 4LL5A 3F2AA 4FV4A 5HZNA 2R9SA 2I0YA 2NRYA 4KRCA 3F2RA 1PHKA 5HNIX 3GI3A 3P7AA 1BLXA 1NVSA 4QP7A 3KCFA 4J7BA 4LRKA 4QMZA 3UC4A 3NUPA 3ZC6A 4LYNA 4XRJA 4WT6A 2V62A 1GNGA 4ACGA 3QFVA 3QTQA 4DLJA 3EIDA 5J9LA 1NA7A 2CGWA 5CNOA 3FLSA 2HW6A 4EKLA 4YO6A 4CFMA 5AP5A 3LOKA 3EQRA 4U3ZA 4Y83A 4CLIA 4H3QA 5LMKC 1U5RA 1I44A 3BGPA 3EFKA 3UYTA 4M69A 4FOCA 4E6QA 5D9HA 4S31A 3R83A 5ICPA 4NM0A 3PIXA 4IVAA 3TEIA 3HV5A 3H0ZA 2C0IA 3QD2B 5DI1A 3V6SA 1QPCA 4RJ5A 5CU6A 1FVRA 3S0OA 2R3FA 4G9RA 4MD8E 5CU2A 3D7TA 4YZMA 4F6WA 3P86A 3FMHA 5DGZA 2WXVA 4BBEA 4FODA 3Q4ZA 3QA8A 1VEBA 1JSVA 4JBVA 4DFBA 2ERKA 5H8BA 2UV2A 4K9YA 4U43A 4IAFA 1KV1A 3R02A 2WTKB 5EYKA 5AAFA 4AG8A 5AA9A 3BHHA 3RGFA 5M4IA 4XEYA 2C0TA 2OF2A 5E8YA 3FQHA 4U79A 3RWQA 4C4GA 3RK7A 4EK4A 3QCXA 4F65A 4F9YA 4AOTA 1BUHA 4MXOA 4RX5A 4Z55A 4L67A 3E88A 3FYJX 5EDRA 2Y4IC 3F5UA 3KF4A 4MF1A 3VUGA 2W5AA 4C62A 4CLJA 3EQGA 3M11A 2PVMA 5EOBA 2FB8A 4QQTA 2C5XA 1E1XA 2B7AA 3O96A 1UWJA 4G31A 4D5KA 3R1QA 5KMOA 3K3JA 3LCOA 2OJGA 1Q24A 3KREA 4XV1A 5LARA 3KXNA 3VS4A 1OL5A 2OIQA 5FXSA 3AGMA 4O96A 1JOWB 4JI9A 5FTOA 3W33A 1E9HA 2EU9A 3BLQA 2Y4PA 2VAGA 3FY0A 5AEPA 1JWHA 4N0SA 3UPXA 3ZXTA 4G6NA 4BDIA 5ETFA 3ZO2A 4QMPA 3KVWA 4MYGA 4WBBB 1ZWSA 4JL9A 5FD2A 4N6ZA 4U97A 4XRLA 4UWYA 2WQOA 1WBTA 2XCHA 2B4SB 3PUPA 5HE0A 4CD0A 1M14A 4IADA 5EQPA 3OCGA 2XM9A 4DG0E 2H34A 3UP7A 4C35A 4BDCA 2GQSA 4NCTA 4O27B 5IG1A 2GDOA 4XLVA 4O82A 3UOHA 5IQIA 2HXLA 4LGDA 1R78A 3PXRA 3F88A 2JITA 3GEQA 2ITVA 2P4IA 2R2PA 3I5NA 4G5PA 4X2JA 3C9WA 2V7OA 5HHWA 2I0VA 3UZTA 4EH2A 2CSNA 4RJ8A 3ZDUA 3ZFMA 3TTJA 4EHVA 4EQCA 1S9JA 4QPSA 3OVVA 3PXQA 4DITA 1TQPA 4OTWA 4CFVA 2PUPA 4O0VA 3IW8A 4RVKA 4D4VA 2P0CA 2YIWA 2BHHA 1CM8A 3C5UA 1CKPA 1A06A 4F6UA 1DAYA 1PMEA 4CFWA 4CVAA 2VTQA 3M1SA 3EYGA 3E5AA 4IDTA 5HLWA 5ANOA 2HZIA 4EQMA 2Y4IB 5FGKA 4HYSA 3TL8A 2BKKA 5IQGA 2ZM1A 3PYYA 3H4JA 4H58A 4K8AA 2XK6A 3QL8A 4XH6A 4PNKA 2CKPA 5CEPA 3BI6A 3DKCA 1FGIA 3FWQA 3PJ1A 5FEDA 5LQFA 2PMLX 2RF9A 4LMNA 4ENXA 2P2HA 3C13A 2NNWB 4DGLC 3LXPA 4G5JA 3OWKA 1PXIA 1OVEA 1B39A 3RPSA 2IJMA 4RIOA 4J98A 4Q5HA 3LQ5A 4DH7A 3NR9A 3VW8A 3F2NA 4O86A 4O0TA 5I4NA 4FSUA 5ETIA 4XLIA 3IO7A 3OCSA 4YZBA 4ZXTA 4I4EA 2GHMA 4KKEA 3UMWA 5A4LA 3ZFXA 3TDVA 2C3KA 4RPVA 3CS9A 4U45A 4L3PA 4Q2AA 1JNKA 3A99A 4EC8A 3GVUA 4QTAA 5DVRA 4K18A 3UMXA 3UQFA 1Q41A 2OH0E 4L46A 4MCVA 4ACHA 2FYSA 4BHNA 1H8FA 1SVEA 2GHGA 2ZM4A 1Q5KA 3KN6A 5IUIA 2OFUA 4BI2A 4BIEA 4Z7HA 3DA6A 4ZLOA 1IRKA 1U5QA 2QOLA 3QC4A 2QHNA 2W1CA 4NM5A 3LKMA 2XIZA 4MNFA 5IH6A 5J9ZA 5GIOE 5ACBC 3VRYA 1E1VA 2F2CB 1PW2A 3OT3A 4R6VA 2AUHA 1VYZA 4UWBA 3QQHA 3PJ3A 1GAGA 2F49A 3IS5A 4I3ZA 2BAQA 4M8TA 2YCRA 3ZO4A 3UJGA 4NTTA 1XR1A 3OT8A 4NK9A 2IVUA 4R1YA 4A9UA 4CTCA 5DR6A 4CV9A 5ANEA 4IB0A 2ETRA 4F1TA 5I9UA 3E62A 3H9FA 3MY1A 4X2KA 1J7UA 1K2PA 2QONA 2W0JA 5EHOA 1PXKA 2QG5A 3NCGA 5AUZA 2PZRA 3NW7A 4BCKA
chains in the Genus database with same CATH superfamily
2OI4X 2O3PA 2CPKE 3NIZA 3F5XA 5G1XA 2QU5A 4E26A 3KRWA 2Z7SA 3MFRA 3MVLA 2CN5A 3QWJA 3R1YA 1H00A 4GYGA 4PPCA 5CVHA 4YTIA 4RIWB 2QD9A 1LUFA 2YWPA 5TE0A 3MSSA 3WIKA 2W1FA 5LXMA 2HELA 1O6LA 4M0YA 1U54B 4C38A 4D28A 4JG8A 3A4PA 4D2SA 4JDJA 4ZMEA 2WZJA 4EBVA 3LAUA 5CF6A 4NEUA 3HRBA 3PXFA 4R5SA 3LIJA 1F3MC 4EC9A 4WNPA 2BIYA 2ZAZA 3A60A 4JRNA 4C61A 2C6MA 4DEHA 4C34A 2O8YA 3GBZA 1FGKA 3CTQA 5AR3A 2UZVA 3CKWA 3QGYA 2C6TA 1WBSA 3OOMA 1PXMA 4MEDA 3KA0A 1URWA 1ZYLA 4AAAA 4BL1A 4C59A 4F63A 2O63A 5CSPA 2X7FA 4FEXA 3ODYX 4ONAA 4W4VA 3VO3A 4NL0A 3E92A 4ZSLA 5J79A 4AZFA 3DK3A 4LGHA 3LMIA 4GSBA 3EFLA 2V22A 4X21A 4FICA 5J1WA 3PIYA 3SGCA 2OIDA 3L8PA 1REJA 3ENHA 5AV1A 4XBUA 3ANQA 3NVKI 3EOCA 3VS0A 4FR4A 1CSNA 5JH6A 2GS2A 3AG9A 4FT9A 1IA8A 4IZ7A 3R9HA 3PG1A 3QLFA 3O23A 4XX9A 4R3CA 4ZZOA 5HG7A 3PFQA 2X6EA 4RLLA 1H1RA 2JIIA 3KN5A 3U9NA 4DFNA 3FI4A 2PZYA 4ANMA 4CZUA 1ZYJA 3HVCA 3MWUA 4AXAA 4YJSA 4OAUC 3TZ9A 5E9EA 1PY5A 2ZM3A 3NYXA 4HCTA 2YM5A 2YCQA 2Y6MA 5E1SA 2IZUA 3OS3A 4WRSA 1RW8A 2XEYA 5HESA 3T3UA 3NUNA 1YXVA 2B9HA 4O7ZA 2H96A 2XKFA 3G90X 3TNWA 3MW1A 3PJCA 4Y8DA 4RGJA 1OKYA 3RK5A 2VD5A 4I0TA 5I9VA 5HNBA 3R00A 1JQHA 3QC9A 4KBAA 5M56A 3MH1A 3JYAA 5CEIA 2P2IA 5ANDA 4ZSJA 3E8NA 3EQFA 4NT4A 4QMNA 3OCTA 4HVDA 4P2KA 5KBRA 3W0OA 3O8PA 4E5BA 3HEGA 2RFDA 1X8BA 4ITHA 1XMMA 3CR0A 1QPEA 3MFSA 4RWJA 4YTCA 5HG9A 2PVKA 3RWPA 3R9RA 3EB0A 4HZSA 3NNWA 2BRBA 3DDPA 3GCSA 3FSFA 2QOCA 3B8RA 3VBTA 4CTBA 5AUUA 3U54A 5E8UA 4OAVB 4HNIA 5FEQA 2XALA 2ITUA 3BYUA 2Y6OA 4I5HA 5HEZA 3W2CA 4PPAA 4RWKA 4BRXA 3D5WA 3WOWA 1YWVA 3D5UA 3FI2A 3NEWA 3FDNA 5E8SA 3BRBA 1M2QA 2R0IA 3IDPA 4JDHA 4K1BA 4CT1A 1ST4A 4QMTA 3CBLA 1OIRA 2FGIA 4X3FB 4O91A 4F0IA 2ETKA 3JY9A 3GCPA 3ETAA 1XH7A 1IASA 1WBWA 2BUJA 3GQLA 1A9UA 3MY0A 4RFMA 4EHEA 5JFVA 4O7TA 3VHKA 3FI3A 3RTPA 4FKWA 3F69A 3W10A 1NT2A 1DI8A 3FZOA 4QMMA 2J5EA 3WZDA 4QD6A 3OMVA 5CAOA 3Q60A 3FLWA 4FMQA 4FTQA 4FKLA 2CGVA 3N51A 3ORTA 5CF4A 5HBJA 3DPKA 4O7LA 4AAYA 3ODZX 1ZMUA 2VX1A 3UVRA 4C2VA 3CTHA 5T68A 2YLFA 2IW9A 4D2PA 5L6PA 3S1HA 3EQHA 1PRYA 2IG7A 4H1MA 3TKIA 4QP9A 4QNAA 3ZUVA 2W4OA 3ZYAA 4CYJA 4XG3A 4CG8A 4MK0A 5AV3A 5JGAA 1XBCA 3EMGA 3Q32A 4OTDA 4F99A 2X81A 4QP3A 2A2AA 3RPOA 5F4NA 3Q6WA 4HVHA 5CSWA 3IOPA 5M4UA 3GOKA 5KHWA 3DDQA 3DS6A 2CNUA 5C26A 3CE3A 3ELJA 3UP2A 2A0CX 4ZP5A 4BKZA 3Q52A 5KKRB 4YJRA 5HU9A 3VAPA 4X3JA 2HAKA 5EKOA 4USDA 2IVSA 4ID7A 5D7VA 4DTAA 3Q9YA 3EN4A 4AXEA 4BTJA 4XV9A 2WOTA 3CC6A 4J96A 4BTFA 2E9NA 2WFYA 3Q9ZA 1MRUA 4CMUA 1KSWA 4BC6A 2YISA 2B55A 3KGAA 3FKLA 4OLIA 3NYOA 3COKA 4FV6A 3TM0A 3KXXA 4AXFA 3U4WA 3LCKA 1OBDA 3BQRA 2XNMA 4KABA 1G3NA 3O0GA 4U44A 4D9UA 1UNHA 1W83A 4RIXA 5AP2A 4DH3A 3TUCA 1OGUA 4AOJA 3BHYA 1H01A 3Q04A 3BKBA 3QTWA 4BIBA 4DHIB 4FVQA 3P7CA 2PVLA 4KINA 3R01A 2Z7RA 2B1PA 4HW7A 3ML1A 3HV6A 3SG8A 5FBOA 2XM8A 2Z7LA 1W84A 3ZONA 3AC2A 2R3QA 2E9VA 1GOLA 3OUNB 4JX3A 4L00A 3FLYA 4APCA 3W32A 3P78A 4X6QC 3Q6UA 3K2LA 4D58A 4FEUA 4WHZA 5HIBA 3C4ZA 4FTUA 4I0RA 4JAIA 3FZ1A 3NUXA 1KE7A 4IX4A 4JJRA 1VZOA 3DTWA 3M2WA 2X2MA 4RVMA 3QX4A 3N4TA 1H07A 2W7XA 4C2WA 5AA8A 4UZDA 5A9UA 1O9UA 2OKRA 4NWMA 5IA2A 4EH3A 2BTSA 5D12A 5C4LA 2PWLA 3UG1A 3EKKA 4RWIA 3P23A 4O84A 1QPDA 4U7ZA 4YR8A 4G3GA 2HK5A 1VJYA 3PLSA 4FTLA 1LEZA 3DKFA 4IAKA 3U51A 2BHEA 1WMKA 4AA4A 3E7OA 4AW1A 2C0OA 5BYZA 4EEVA 1V0BA 2PZ5A 3KF7A 1ATPE 1Q3DA 5IMEA 5KKRC 2HW7A 2PE2A 5EYMA 3VS6A 4O7YA 3ZMMA 4I24A 1TFFA 3O17A 2OBJA 4XYFA 3GT8A 2NO3A 4IE9A 2W9FB 4YTHA 2J0IA 3VC4A 2C3IB 3V8SA 4WG3A 2QI8A 5HNGA 1BL6A 3DQXA 3SRVA 2YIRA 3FSKA 5DBXA 4BTMA 4EJNA 1YOJA 4IAYA 3ROYA 1XQZA 2IWIA 3D9VA 1OIYA 3O2MA 4ZY6A 5M08A 1OGYA 4XBRA 2W5BA 4EH8A 3E8DA 4G3EA 4KBKA 2PPQA 5ETCA 1R0PA 2ITYA 4X2FA 3PY0A 4F1OA 1UU9A 4IX6A 5IKWA 2B9FA 4FBXA 4YC8A 1M7QA 4M15A 3W1FA 3REPA 4EUTA 5FLFA 2YN8A 3P1AA 3FKNA 3U8WA 3JR1A 4D1ZA 5H2UA 4O0RA 3V5JA 3T9IA 4BGQA 5I9ZA 3I0OA 3ZBFA 5FUTA 4YUQA 4KIQA 3TZ7A 4UN0C 2UZDA 5HQ0A 4AQKA 4G1WA 3OXIA 3NUSA 3V3VA 3R7GA 2XK8A 3WYXA 3ORLA 3ZOSA 1OITA 4UX9A 3ANRA 1XH6A 3JPVA 3PA3A 4G16A 3SOCA 4K77A 1R0EA 4LOPA 3W8QA 2JDRA 2JEDA 1H1QA 5IH5A 1T46A 3W16A 1UA2A 3WE4A 2VGOA 4A9TA 1FOTA 2BZIB 3QXPA 5IQDA 2WIPA 2VWBA 4LV8A 5LWMA 1WVXA 1XH5A 2F4JA 2OJIA 2R3JA 4FTKA 1KWPA 4M67A 3RMFA 2E9PA 4LRMA 2WTKC 5CU4A 5DIAA 2ZDUA 5L2SA 2XNOA 3EN7A 3MBLA 3OF0A 2VV9A 2OU7A 1R39A 5BMSA 4IJPA 3EWHA 1KE9A 4IQ6A 4BDEA 2XYUA 3BHTA 4QMSA 3R9OA 4BCMA 2O65A 4A07A 2UW4A 2I0HA 4BYIA 5CF8A 3F3ZA 1PYEA 3LFBA 2IZSA 2KTYA 4O6LA 3DQWA 3ET7A 4H39A 4UXLA 4X2GA 5AM6A 5EI6A 4YJVA 3LVPA 4FIEA 5CWZA 2JKQA 4BWXA 4L7FA 4DYMA 2Q83A 4J71A 4XV2A 4Q9SA 4C58A 2QCSA 3UVPA 3BV3A 4IWPA 4PDYA 4IVBA 2WMUA 2OSCA 2P55A 4NZWB 4JT3A 2X8DA 5FTGA 4U5JA 2UZBA 3OZ6A 5AP0A 3SOAA 1FINA 5ANGA 4DDIA 4FG8A 4D9TA 3HAVA 5LVPA 4R8QA 3BWJA 5H8EA 5B2MA 4KUJA 5A46A 2GSFA 2UZTA 4CMOA 2YDIA 1U46A 2CHLA 1Q61A 3LFQA 3IONA 5IA5A 2WQBA 3F82A 5IQAA 2VWZA 4H1JA 3DTCA 4YJUA 3VBVA 3QQUA 4ZY5A 2IVVA 5FDPA 4E5AX 3FLNC 3W2RA 4IX5A 3A8WA 4ZEGA 3KB7A 3ZLSA 5IISA 3KMUA 5CF5A 1UNGA 1V0OA 4WNOA 3IW7A 3KKVA 4RWLA 3FLQA 4I41A 5AUXA 4O4BB 4C3RA 1IR3A 5HO6A 1JAMA 3ORIA 4NJDA 4M97A 4IVDA 4PQNA 4F9CA 5CZIA 4DFYA 1ZY4A 2YIXA 3HECA 2IZTA 5IH4A 2RL5A 3R0TA 4QMXA 5EYCA 3PG3A 3QZHA 1SM2A 3DB6A 1WBVA 1YI6A 4EZ7A 2W99B 2GFCA 2OICA 2XB7A 2IW8A 3U6IA 3SG9A 1ZOHA 4UB7A 4ZTSA 3VIDA 3UOKA 4IFGA 3G9NA 2JC6A 4JR3A 2ITXA 5EG3A 3PRFA 2YJSA 1XBAA 3Q5ZA 4PL5A 5AUYA 3KK8A 2VWWA 5CX9A 5EYDA 2XNEA 3DFCB 4BB4A 4EZ5A 1WAKA 3R04A 3Q2MA 3B2WA 4C33A 4B0GA 1W2DA 3IOKA 4G9CA 4I1ZA 3RCJA 4U41A 4YO4A 3IW5A 5CI6A 2RIOA 2RFNA 4C3PA 2JKKA 2XNNA 3QHRA 4HGSA 4K2RA 5HO8A 3MJ1A 3G6HA 4EOLA 3MFUA 4AT3A 4CZTA 3PJ2A 4GRBA 3C1XA 5LWNA 4USEA 3SXRA 3OOGA 4UMTA 1SYKA 1SNXA 1OIQA 3FXZA 3SW4A 2ACXA 1Z9XA 4R7HA 4FKUA 4IWOA 2QLQA 2BDWA 2QKWB 3RNYA 3ZM9A 1FBNA 4FKJA 3VUHA 5BQ0A 3QZFA 3HRFA 5IDPA 2UZLA 1OPKA 1FQ1B 5E1EA 3G5DA 1UVRA 2QURA 5FM2A 4CNHA 4XP2A 4FE2A 3SV0A 3AOXA 5TF9A 1J1CA 3KULA 3PP0A 4IB1A 3H3CA 4TT7A 4YPSA 1O6YA 4YJOA 5HX6A 4J99A 1IAJA 2VWXA 4ZJIA 1FPUA 3OEFX 3PVBA 4MTAA 4HGTA 5CU3A 3ZRKA 4EOKA 5BV3A 4F9BA 2UVYA 2YM6A 4FV9A 4EOMA 2JIUA 3F3VA 1PKGA 1YHVA 2J4ZA 2YZAA 4NM3A 1G8AA 3TI1A 4EYMA 4JQEA 2ZB1A 3AD6A 5E4HA 1W0XC 3WYYA 3ERKA 4KB8A 4MBLA 3MYGA 4QMYA 4PP7A 3UQCA 5FG8A 1U59A 2YITA 4AW2A 5G6VA 5JKGA 2ETMA 4BCOA 4N6YA 3UPZA 1H4LA 2CMWA 3QQLA 3F61A 3FUPA 5EDPA 4ALVA 3NS9A 2VTAA 3RNIA 3DFAA 4AGCA 3HDMA 5KX8A 2BALA 4BCQA 3S2PA 3HMMA 3P9JA 4KIKA 3MH3A 4Z3VA 4WBOA 1B38A 4BI0A 5LMAA 4YJNA 4E4XA 5C03A 4NYEA 4AXCA 2C6IA 2QOBA 4TWCA 4V05A 5M51A 1G8KA 5EM7A 2BRHA 4AT5A 2OG8A 3QCYA 3DAEA 5AV4A 3DCVA 5HORA 2Q0NA 3COMA 4BDBA 3E87A 5DLSA 2WKMA 4IX3A 4O0XA 3QD4A 2OK1A 4RJ6A 2C6EA 5CT0A 5HKMA 3BYVA 1H1WA 3C4EA 3KY2A 4FV2A 2C1AA 3R9NA 1URCA 5JK3A 3R71A 3BLRA 3UQGA 2NYAA 3CEKA 3MESA 2XNPA 2X6DA 2WQMA 4CSVA 2CJMA 4U81A 2QU6A 3QU0A 3TTIA 3FPQA 3OW4A 4RZVA 1PXNA 2OXYA 4AGUA 2XIKA 4L3JA 5GINE 4XG7A 5JZNA 1H24A 3UIXA 2CKOA 3E3BX 2WB8A 5HE2A 3CPCA 4EOQA 3GUBA 4YHTA 4YMJA 4IB5A 3DKOA 4FKRA 4U3YA 3HV3A 4APPA 2XKEA 4BDAA 4YP8A 5JMSA 2GPHA 4FVPA 1KV2A 4GYIA 2WAJA 2ZYBA 4UV0A 3VHEA 5L4QA 4MUQA 3CD8A 4RZWA 5CEQA 4HZRA 1YDSE 4V01A 3GCUA 4W8EA 4IM3A 1XJDA 3LFFA 4S32A 1M7NA 1WBPA 3VBXA 4EBWA 4KIKB 4EONA 5ITAA 5M53A 3I7CA 4I22A 3ALOA 3AT4A 4LFIA 4W8DA 3RPYA 3V04A 2JGZA 3A7GA 3MVJA 3QTUA 4U80A 4YURA 4Y72A 4YLLA 3NW5A 2C5NA 3HMIA 5E8VA 3BYOA 4WNMA 4L6QA 4BCNA 2RFSA 4ARKA 3NNXA 3HMOA 4R7IA 1YW2A 4ZSAA 4GU9A 2H9VA 3R63A 3CQUA 3TZ8A 4ZAUA 3PSCA 2YAKA 3ZRMA 1XMLA 3QTIA 1GZNA 3PXKA 4IAAA 2VWUA 2VGPA 3U55A 3G6GA 2VWVA 4C4JA 3E7VA 3ZDIA 3QTRA 5KMNA 4XP3A 1CDKA 1ZYSA 2A27A 4QTDA 5AX3A 4CCUA 1MQBA 1Q8TA 3OP5A 4D4YA 3FEGA 3UZRA 2JIVA 4FKQA 4B99A 1JKSA 3MB7A 4FTRA 3ZBXA 5DPVA 4FTIA 4RLKA 4BCPA 3TV7A 2VNYA 2X0QA 3FZRA 3UIBA 3UODA 2QNJA 4ANQA 2WU7A 1YXSA 1YXUA 3KRLA 3FL5A 4FF8A 4FTMA 4A06A 3R8PA 4Q9ZA 2NP8A 1PJKA 2UZNA 3TNIA 4KKGA 4PY1A 2XJ2A 5K9IA 3NWWA 2VTLA 4ZTNA 1PXLA 4JXFA 2JAVA 3OFMA 3FMEA 4GFGA 5KNJA 3DBDA 3W2QA 5AV2A 3TG1A 3GP0A 1PXOA 3ZZWA 3TNQB 5T3QA 2HWOA 1HOWA 3UNKA 4TWNA 3A7FA 2CLQA 4FV7A 1YRPA 3DBCA 4JIAA 4O0SA 1AD5A 3VJOA 5K4IA 4FZAB 4RVTA 3PZHA 4O1OA 4CQEA 2OW3A 5EW8A 3C0IA 1YDRE 4NUSA 3ZSIA 4ZTRA 1XHAA 3FMMA 5CQWA 4CFXA 4D0XA 1H08A 5EHLA 2V5QA 2IPXA 3ZLXA 4U6RA 3WZKA 4RX8A 4PP9A 2DWBA 4GJ2A 5AUWA 5GZAA 5IA3A 4YGAA 1QPJA 1H1PA 4CMTA 4NCTC 3ULZA 2W1EA 2XBAA 3CGFA 4O7RA 4MNEB 1M17A 2XIYA 3HMPA 2B9JA 2UW3A 2UZUE 4AZTA 5A6OA 1CTPE 3QUDA 4I6HA 2BVAA 2BZKB 4LOQA 5DWRA 2FSMX 1JLUE 3AQVA 3IG7A 3QA0A 3IQ7A 5J95A 5TR6A 3FBVA 4PPBA 2XNBA 4OBOA 4XNEA 3SHEA 1GJOA 1P4FA 3FMKA 3R2BA 4I92A 4TPTA 2VO6A 5CAQA 5FRIA 3MJ2A 4IVCA 2GNLA 1H0VA 3RBWA 2J50A 2WTVA 3ORNA 1YOLA 4Y5HA 4YZ9A 3WF9A 2R3RA 4TY1A 2AYPA 4GT5A 5F95A 3TZMA 4PTEA 3OBGA 2F7ZE 5HBEA 4IIRA 2WTIA 3R21A 2F7EE 3AC3A 4YC3A 1BI8A 2PYWA 4FZFB 4UZHA 4KIPA 3TNPC 2C3JA 3ZFYA 2HWPA 5JGBA 2Y0AA 4I93A 2OJ9A 3LLTA 4FKSA 4FV8A 4C8BA 5AP7A 2FSTX 3VVHA 5IQCA 4KBCA 5DEWA 4IDVA 3TJDA 5JN2A 5CAVA 4AN2A 4FSQA 1YVJA 4EOSA 3HGKA 3HNGA 3NPCA 2C68A 3O7LB 2C69A 5E7RA 4IH8A 5JRQA 2VO0A 3ZEWA 4WUNA 1YXXA 2NRUA 1L8TA 4MBJA 1J91A 4LGGA 4QMVA 4TL0A 1J7IA 3WE8A 3COHA 5BMMA 3RP9A 2YDJA 1TKIA 2R4BA 4CGAA 3AC4A 2OJJA 4FK6A 4FTNA 4KIOA 5CASA 4O7SA 2ZB0A 3C4CA 3PLAE 4PL4A 2WGJA 3L8XA 2ZDTA 2PSQA 2YAAA 3QTXA 4RRVA 5CAUA 2W1GA 2AC5A 4AW0A 4EWQA 2ITQA 2X0PA 3MPMA 4OTRA 5CXHA 4IC7A 2J0JA 3LPBA 5KMLA 4UMRA 4WD5A 5LJJA 2JDOA 3LFNA 3ZO1A 4A9SA 4AGWA 4DGNA 1J3HA 3PA4A 4WOVA 3GC0A 4MH7A 2KULA 5FM3A 5B2KA 4QP8A 4WSYA 3TKUA 4ASXA 3QQJA 1KE8A 3CCNA 4GUBA 1A48A 3LCTA 1SNUA 2R3PA 4V04A 3QALE 2XJ1A 4GUEA 5EM8A 3PRIA 4Z7GA 4DFUA 2R7IA 4ZS4A 3HL7A 3ALNA 1CMKE 2YJRA 3BU5A 4M68A 4P90A 4X6RA 4F7JA 3VF9A 3KXZA 2OIBA 1ZMVA 1BI7A 2EVAA 2XIRA 3LCDA 3UDZA 2WMVA 4GMYA 1V1KA 5KUPA 3IKAA 2UZEA 3QAME 4IB3A 1WFCA 4L42A 5KE0A 5FWKK 4GS6A 3ZLWA 5ANKA 2CN8A 3A4OX 3H0YA 1PF8A 4RIWA 2PE1A 2GNJA 4O4FA 5IQBA 3V51A 3DU8A 3I7BA 4DT9A 3FXWA 1QCFA 1UKHA 1UWHA 2YA9A 2B54A 3CIKA 2F2UA 3D0EA 2WTDA 5D11A 4AZWA 2J0KA 2PU8A 2WMAA 4QTEA 3PDTA 5AM7A 2UW7A 1OPJA 3A2CA 4Z9LA 5M07A 3NMUF 4ZJJA 3LXNA 2DYLA 3QWKA 5LMKA 3GQIA 4IAZA 2FSLX 5LOHA 4TYGA 2GNGA 2X2LA 3HP2A 1U54A 1FVTA 3K54A 4C02A 5I9XA 4DCAA 4FYNA 3BGZA 4RSSA 3ZM4A 4BR3A 5IEYA 3O5AA 4M3QA 4I4FA 4E4MA 3FJQE 3FMLA 4GJ3A 3PP1A 3DBQA 5IA4A 5L2TA 2GMXA 5JQ5A 2PVHA 3MV5A 2QR8A 5FBNC 3AGLA 1Q97A 2WD1A 4QP6A 4UMQA 4A4XA 4DEIA 4ZJVA 4ANBA 3KQ7A 3PY1A 3FKOA 3ATSA 2PUNA 3R8LA 4Q5EA 3DNEA 5HGIA 3CD3A 5EOLA 4CZYB 3LFAA 3FZSA 4YHFA 4AFEA 4FTAA 4BZOA 2QR7A 4HVSA 2VX0A 3T3VA 4JVGA 4PL3A 4DLIA 1BYGA 1AQ1A 1K3AA 4ZZNA 3TV4A 4LQMA 3D2KA 1ND4A 3C4WA 4DHJA 5KMJA 2BR1A 3NLBA 3LW0A 5EM5A 4EZ3A 2W1IA 2ESMA 5EI2A 5AP4A 4R78A 4NIFA 4D4RA 5K3YA 4FV5A 4UEUA 4E6DA 4MQ1A 4TYHA 2DS1A 3A61A 1LR4A 3H10A 3C5IA 2A98A 3KK9A 2WO6A 2WU6A 4DC2A 4UMPA 2QODA 4X3FC 3TJCA 1SMHA 1W82A 2J5FA 3DJ7A 4FI1A 5AAEA 4QPMA 3W0QA 5L8KA 3WZUA 3RKBA 3FMNA 4F6SA 4BDKA 5JSMA 2YM4A 2C6KA 3QCQA 3DJ5A 3PA5A 4IEBA 3C0HA 3OXZA 4WKQA 4BZDA 3GC7A 4TYIA 2ZJWA 3FE3A 3UNJA 4GKHA 3Q53A 1ZYDA 5DR2A 5HTBA 3L8SA 1P5EA 1W2FA 4BI1A 4E1ZA 2PY3A 1LP4A 4HJOA 4HCUA 2JKOA 4EH5A 1YOMA 2QO7A 5DN3A 4J53A 4YBKA 4BIDA 4DDGA 3TT0A 3M42A 2ITTA 3D4QA 4WRGA 5CAPA 3Q5IA 3WZEA 2XK9A 1IEPA 2W4JA 4PX6A 4DH5A 4FNZA 3OBJA 4QQJA 4BDGA 4GK4A 4YLJA 4O38A 4E4LA 4DINA 5BVFA 3OWJA 5IA1A 3Q96A 2BFYA 3QQGA 3VBYA 2PMNX 3AC1A 4EI4A 1H27A 3ORPA 3GU5A 3RAWA 1LPUA 5KCVA 2I40A 2CDZA 5EI8A 4K6ZA 4LI5A 5A4EA 3P7BA 3ITZA 4EK5A 4WO5A 3W2OA 5EHYA 3MH0A 2HXQA 3QTZA 4YZNA 3KMWA 1CKIA 2JKMA 3JY0A 4Y85A 3P79A 3Q4UA 5J8IA 4I6LA 4EHZA 4L68A 4JG6A 2QKRA 2SRCA 4K11A 4XP0A 4AQCA 3V5PA 4Y46A 4DH1A 4BYJA 4Y73A 2PULA 2FH9A 2X0OA 3QZGA 4O2ZA 3R2YA 3UTOA 4UYNA 2ZV9A 5F94A 4A4OA 4F09A 3G33A 3QQKA 4G2FA 3RI1A 2ZV8A 4I6QA 4ZIMA 2PL0A 4AFJA 1OKVA 1H0WA 4RC4A 3D7TB 4FA2A 2C6OA 3W18A 1XBBA 3EQDA 2O0UA 2HIWA 4A4LA 3QD0A 5H9BA 3OUKA 3SLSA 3GOPA 3S4QA 2GS6A 4QYHA 5CSVA 3W0SA 2FSOX 2VTOA 3PJ8A 2BDJA 5CI7A 1ZOEA 4ZSGA 2Y8OA 3WBLA 4XOZA 5CTPA 5JRSA 3GCVA 3EL7A 4FEQA 1RDQE 3F7WA 1VYWA 3DNDA 4A9YA 2Z2WA 4IWDA 4UWCA 2YERA 4FRFA 3MY5A 4ALWA 4AZVA 3ZEPA 5D7AA 2ONLC 3OXTA 5KMKA 3QLGA 4BCHA 2FUMA 4YBJA 4ZTQA 4E7WA 4CRLA 4MHAA 5JFWA 1UKIA 2QOFA 4GFOA 3TN8A 5M44A 4F9WA 1O6KA 4LMUA 3FI8A 2ZOQA 4EK8A 3D83A 1NVQA 4MD7E 3POZA 4QTBA 5AP6A 4ZY4A 4LDTA 5LCKA 1OL6A 4I5MA 2RSVA 2JDSA 2VN9A 4NSTA 1G8SA 3EFWA 2LGCA 4E93A 2QOQA 2VTNA 1M2PA 3A62A 3R30A 4BWKA 1GIJA 3VS2A 4I21A 2EB3A 2YABA 3P5KA 1XH9A 4CFUA 3SRVB 4AACA 3TMOA 3LXKA 5M4FA 3ZUTA 3DXQA 1YKRA 1RQQA 5I3OA 3LFEA 4R3RA 2GS7A 4FGBA 4GV1A 4FTJA 4RJ7A 5J7BA 4PMTA 5CNNA 1FMOE 3O8TA 2C4GA 3EQCA 4GVAA 2YM8A 4YJTA 5IQHA 3VRZA 5DRDA 4FT3A 3UDTA 4BGHA 4CFFA 4CKRA 3R9DA 5I9WA 3AT3A 4O0WA 3VONA 3BHUA 2YEXA 2BKZA 4AZEA 4USFA 4ANNA 3L9PA 3TACA 1W2CA 3B8QA 4JAJA 5ANJA 4BCGA 4ZLZA 3ZS5A 4BICA 4PMPA 5M09A 4FGRA 3CXWA 4QTCA 2VTHA 5HTIA 3R22A 5FDXA 3QYWA 4MXAA 4S30A 3DBEA 4H05A 1Q8WA 2W5HA 5C9CA 4JS8A 5CEOA 4FEVA 4E73A 4IM2A 4YLKA 2B0QA 4MXYA 3DBFA 5HO7A 3D5VA 5AUVA 2VU3A 3KIOC 2CLXA 3R8ZA 3UNZA 2V0DA 2E9OA 3VWAA 5DT0A 2UW0A 1OPLA 4KD1A 1OL2A 2BCJA 4TTHB 5ACKA 5IF1A 4QYGA 3AD4A 2IEWA 5L2IA 4BDJA 4E8AA 4FSYA 4YJQA 1ZMWA 3OEZA 4B8LA 1YHSA 5CU0A 5E8XA 5BVNA 1FMKA 2GNFA 1UU8A 3T9TA 3GGFA 3WZJA 1T45A 3MFTA 4FL3A 1OUKA 4FT5A 5C8NA 1IG1A 3GCQA 5TOZA 4CT2A 4D2VA 4F78A 1Y8GA 2C30A 4EK3A 5K5NA 4IBMA 2XP2A 3QXOA 5AR4A 3R7UA 2XA4A 3KRRA 3UIMA 5EQEA 2EXMA 1Q62A 3MPTA 3PVWA 3BBWA 5BYLA 5HIEA 3BV2A 1M2RA 4G3CA 5LVNA 4FV3A 4RT7A 4PRJA 2J2IB 4TWOA 3VJNA 4GKIA 2DQ7X 5IMXA 4BWPA 2F7XE 2VO7A 3H30A 3RAHA 4L45A 3RK9A 3SQQA 5BPYA 3BWFA 3ZLYA 1OB3A 4E20A 3KU2A 3BGQA 3D7ZA 1MQ4A 2JAMA 4WSQA 5BUJA 2HOGA 1U4DA 2Q0BA 2UVXA 2R64A 4O22A 2QQ7A 4XCUA 4AWIA 3UE4A 4V0GB 4O4CA 1UNLA 5EK7A 4J97A 4YSMA 3QKMA 3QKKA 2BDFA 3MH2A 2AC3A 4MVFA 4QNYA <