5I9ZA

Crystal structure of ephrin a2 (epha2) receptor protein kinase with danusertib (pha739358)
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
293
structure length
273
Chain Sequence
FTTEIHPSCVTRQKVIGAGGEVYKGMLKTKEVPVAIKTLKAGYTEKQRVDFLGEAGIMGQFSHHNIIRLEGVISKYKPMMIITEYMENGALDKFLREKDGEFSVLQLVGMLRGIAAGMKYLANMNYVHRDLAARNILVNSNLVCKVSDFGLSRVLIPIRWTAPEAISYRKFTSASDVWSFGIVMWEVMTYGERPYWELSNHEVMKAINDGFRLPTPMDCPSAIYQLMMQCWQQERARRPKFADIVSILDKLIRAPDSLKTLADFDPRVSIRLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords Ephrin type-A receptor 2
publication title Chemical Proteomics and Structural Biology Define EPHA2 Inhibition by Clinical Kinase Drugs.
pubmed doi rcsb
source organism Homo sapiens
total genus 82
structure length 273
sequence length 293
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2016-02-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 5i9zA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 5i9zA01
2XKCA 3Q52A 4IMYA 4V0GA 3NCGA 4C3PA 2C5YA 5ETCA 5BMMA 5E8UA 4RWKA 2VUWA 4QQJA 3E3BX 5DR9A 3FBVA 5FM3A 4UWCA 4YJRA 4BCPA 4DG2E 5LWNA 3CCNA 3HGKA 2ZJWA 4M66A 4JRNA 5TT7A 1ZLTA 1QL6A 2W1ZA 3BU5A 3AC1A 3DBEA 4W4WA 4AGDA 4EZ3A 3HMNA 1E1XA 4EZ5A 3D7ZA 2YDKA 3AGMA 4B7TA 3FKNA 5HVJA 2ZV7A 5AFVA 2WQBA 5AEPA 4M8TA 3R2YA 4FSQA 3WZJA 5B0XA 2JAVA 2PUUA 2W9ZB 2XM9A 3R8VA 3LCTA 2FSMX 3PVGA 2CKQA 2FYSA 2BPMA 3UG1A 1FQ1B 4M97A 5EM7A 5FTQA 3KULA 3OWKA 3MFUA 4L67A 3F2AA 1W0XC 2WMAA 4Y5QA 4XBRA 3UOKA 3SG9A 4QTAA 3R7YA 3ZRKA 3T8OA 4O0VA 3TJCA 3CS9A 3TZMA 4YJUA 3VQHA 1KE8A 4N6YA 5A6OA 1JQHA 3UO6A 5HTIA 4ZK5A 1SNXA 2B52A 3O2MA 4C8BA 3U4WA 5IMEA 4CRSA 5GZ8A 5HLNA 2VTAA 1WBVA 3UMXA 3DLZA 1OGUA 2JAMA 2CGWA 4P5QA 4QMNA 4ZJJA 3O8TA 4V04A 3KMUA 4ZTLA 4UWBA 4NK9A 3DGKA 3VBQA 4EH5A 4H3QA 3E64A 3FYKX 5AMNA 2PYWA 4A9YA 3EQBA 3HNGA 4O38A 3ZRMA 3DOGA 4XP0A 2WEIA 3KKVA 4IZ5A 5AV2A 5L8JA 4DT8A 4UYNA 3QUDA 5A4CA 3R71A 4LOOA 1PXNA 3EFLA 3LXLA 1SZMA 2UZUE 2OJ9A 4B4LA 3HMIA 3I0OA 4I0RA 4RPVA 4EK4A 2C0TA 3OW4A 5AV0A 2C3JA 3C7QA 2ITYA 3PYYA 1XH4A 4U7ZA 3WYXA 5FDPA 3NIEA 4BIDA 3FZTA 4RSSA 4CXAA 4RGJA 3R9RA 2XMYA 2GHLA 1IA9A 3I1AA 3FMDA 3O71A 4O0RA 2ESMA 3NW7A 4DGNA 3F3UA 5K5XA 4PTGA 1UU8A 4JBVA 5LOHA 4DHFA 2ONLC 4IBMA 3K3IA 4QP8A 4CFXA 3TTIA 2XA4A 3DK3A 4FIIA 4UV0A 2X7OA 5M09A 3FYJX 1OKYA 3WILA 2BFYA 3A60A 3D5UA 3QGWA 3W2QA 3BEGA 5JGAA 4FMQA 1UU3A 4H1MA 3QCSA 5JFWA 2Z8CA 4CFFA 2PVHA 4O7TA 3BEAA 2WMSA 4NJDA 3ZYAA 5CI6A 4WNOA 5CEQA 3W8LA 2YM4A 5KBRA 3ALNA 1MUOA 3A8XA 4MD7E 1WBWA 3PY0A 5KMLA 5JFVA 3KU2A 4XX9A 3QAME 4P2KA 3S3IA 5HD4A 4B99A 4RIXA 4HNFA 1W84A 4BI2A 5GJGA 5FXRA 2J5FA 2IN6A 2BHEA 2VRXA 2XZSA 2XJ1A 4LGHA 1PHKA 5FG8A 5FXQA 1OL5A 2YM5A 3EN5A 3PPJA 3VHEA 3HECA 5C4LA 4O82A 4ORKA 4IX4A 4M69A 5AM7A 2ZB0A 3EN6A 3BQRA 1RQQA 3KXZA 4N70A 5E90A 2W1HA 4R7HA 2C6KA 2W96B 5AAFA 1OPJA 1JBPE 1Q8WA 3IG7A 4CSVA 1R3CA 2C1BA 3NUSA 4WIHA 5J1VA 3ORXA 4L68A 4DFZE 3F82A 4IE9A 4D55A 1NVSA 3RP9A 4BCJA 4D4RA 3FI4A 1U59A 4G3FA 2XNBA 5DI1A 2Q0NA 2QG7A 2X9EA 5DEYA 1OUKA 3EL8A 2WMXA 3E88A 1ZOGA 2BFXA 3H0YA 2OIQA 5BVNA 2PU8A 4YO4A 2HZIA 2ZB1A 4QP1A 5AUWA 5B7VA 3UODA 3U54A 1LEWA 2QOIA 3BRBA 5HO8A 3ZLSA 3PSDA 4QYEA 4ZTHA 3VUKA 4NL0A 1JSTA 1AGWA 4MTAA 4ZSJA 5HD7A 3NNXA 5DOSA 3MN3A 5IQIA 1W98A 3WIKA 3EB0A 4EKLA 3LFCA 3OXTA 5HLWA 3FHRA 3O8PA 3UOLA 4X3FB 2C3KA 4O0SA 2Y8OA 5LVMA 2OZAB 4NTSA 1IA8A 4E93A 5HORA 3D0EA 4HGTA 4FGRA 3UVPA 2XYUA 1ND4A 4A4XA 5JEBA 3BIZA 3OROA 2PZRA 3LM0A 4J96A 2J0MB 3R1QA 5BNJA 3KB7A 1FBNA 2W7XA 3LCOA 4G6NA 4I6HA 5KZIA 4DC2A 3GC9A 3PDTA 4RA4A 2ZM1A 3PG1A 2C30A 3FLYA 4U6RA 5BVFA 4KWPA 3ZHPC 4JBPA 5AADA 4A4LA 2CGUA 5AV1A 4ANBA 2FSTX 4O21A 1UU9A 1V0PA 3VUDA 4CFWA 2CCIA 5KBQA 4L7FA 3ETAA 4TYEA 3WYYA 1LUFA 4XRLA 5C27A 4EK3A 4UWYA 2R64A 5BVKA 1M52A 3EQHA 5KMJA 1T45A 2OKRA 4MNFA 3NW5A 3P9JA 1XQZA 5JZNA 4FR4A 3G2FA 3DKOA 1SVGA 4WUAA 4UMTA 3GNIB 4UX9A 4KIOA 1HCLA 4X3FA 4D2PA 3F5GA 3QQHA 4AWIA 4BB4A 3B2TA 3MSSA 5GZAA 2YIRA 5D12A 4EH6A 1M17A 1P2AA 3D9VA 4L6QA 2Z02A 3HA8A 4L3JA 4U41A 4BCMA 2FUMA 3P7BA 5CY3A 5HZNA 3O7LB 3AMAA 2FVDA 1H07A 3EFJA 4YSMA 4F7NA 2IVVA 1R1WA 3ULZA 4FKVA 4WA9A 3RMFA 4GJ3A 2YCFA 4FSWA 4U42A 2I7QA 2PMLX 4ANOA 3VIDA 3QGYA 4IAIA 4EHGA 1IG1A 4Y73A 3R8LA 3DJ5A 1PXPA 2HIWA 5HLPA 5EH0A 1FMOE 2PZYA 3R73A 5AX9A 3JVSA 1B6CB 2BRHA 2XKFA 3PUPA 4C35A 3LW0A 3KREA 3DKFA 3PRFA 4YP8A 2J90A 4E8AA 1OL6A 3QCYA 4G6OA 4IDVA 4JR3A 5ANIA 4ITJA 5DHJA 4A07A 3MPTA 2IVSA 2XCKA 5BYYA 1ZYLA 3U9NA 3UPXA 2XJ2A 5KNJA 4S30A 2HXLA 1PXKA 1URWA 1CKIA 4HPTE 5BYLA 1OPKA 2ITOA 2HYYA 3DU8A 2JLDA 2JIIA 3EWHA 4YJTA 2JIUA 4MYGA 4FV9A 3W32A 2QO9A 3EYGA 4FSUA 5BQ0A 2FSLX 5IPJA 1Y8YA 5JFXA 1JNKA 4C0TA 3R8UA 5J9ZA 4MQ2A 5AR8A 5DE2A 3GU7A 2CNVA 2WTKC 4D1ZA 3GCQA 1OKZA 1Q41A 1XBBA 4RIYA 5EK7A 4KIKA 2OXDA 1BLXA 3ZDIA 3PA3A 2W5HA 2EUFB 3LCSA 5HCXA 4ANSA 4F6WA 4LRKA 2XIYA 2EVAA 3GEQA 3E5AA 4IDTA 3ZFMA 4C57A 3VS1A 4EK6A 3ZM9A 5J5SA 4NYEA 1YVJA 2YHVA 4RJ6A 4C7TA 4DH7A 5AWMA 2PZ5A 5BVWA 4ZAUA 4HCUA 2WTJA 4RFMA 1QPCA 5HEZA 2NRYA 5TE0A 3ZO2A 3U51A 4NJ3A 4E20A 4W4VA 4WG5A 4I93A 2VO0A 3GCVA 2GNGA 1WAKA 3MJ2A 4FKLA 4XBUA 4UXLA 3ALOA 4FTTA 2PSQA 1OIRA 3KN5A 3PJ1A 1KV2A 4NIFB 5AP2A 2A19B 4GUBA 2A0CX 5AR2A 4KS7A 4KIPA 5CSHA 4BZNA 4PPBA 2PVYA 5I4NA 2YIWA 4AZSA 3NUUA 2X6EA 3LFSA 4QQCA 4UALA 4I0TA 4WUNA 4LM5A 4FX3A 2FSOX 4FV6A 5CI7A 3V5JA 2CN8A 5EKNA 3TDWA 4FYOA 3SC1A 3IW4A 3RAHA 3UVQA 5IQCA 3CTHA 2H8HA 3QX4A 2C3IB 2YM7A 5L2WA 3ORLA 3EN9A 5DT0A 4CLIA 3NRMA 4LMUA 4DEEA 3R28A 1BYGA 1ERKA 2VTRA 4PY1A 5A4LA 4NT4A 4CKIA 4IX5A 1J91A 4EQCA 2ETKA 3NMUF 4R77A 3UGCA 5CNNA 4XG4A 3V5PA 3LJ2A 4J99A 2X0GA 4EEVA 5JT2A 5EI6A 4FK3A 5HNGA 1KE7A 3F5XA 4EOPA 2XNEA 2AC3A 3G51A 2HY0A 4FSYA 4BHZA 1OIYA 4MXYA 1R0PA 4WNMA 5I9YA 4G6LA 2C6EA 1NXKA 4IACA 3TN8A 4GV1A 5JK3A 1ZOHA 2WO6A 4HYIA 2C69A 2OXYA 4FT0A 3PY1A 4EOQA 4BBMA 3I81A 4G5JA 2XNGA 2VTQA 2XRUA 1LP4A 3MTLA 4YZCA 4J7BA 4MF0A 5DG5A 4EOOA 2UW3A 3Q96A 4HGLA 3ZCLA 1CMKE 2RF9A 3PRIA 4DH8A 3UVRA 4D1SA 4F4PA 3NUAA 1Y6AA 2ZAZA 4M68A 3TTJA 4BDKA 3BLHA 3QCXA 4FT5A 5L2IA 3CQUA 2EB3A 3V51A 3TM0A 3UJGA 1WBTA 2QNJA 4BCGA 3FE3A 3BI6A 3N4UA 4AG8A 4PMSA 5HTCA 3FZ1A 3H9OA 5JRSA 3DA6A 1H0VA 3O7LD 3SDJA 4YUQA 2NNWB 5J95A 1YKRA 5HCYA 3UYSA 5C9CA 3SLSA 2IVUA 5E8XA 4GKHA 4DYMA 4GSBA 3WZDA 2WQOA 2QOCA 4Y95A 2YZLA 3CR0A 4NZWB 4I6FA 2PMNX 5AV3A 3TKHA 4D0XA 3NAYA 5CSPA 1JSVA 3I6WA 1Q24A 2X81A 4P4CA 4OBPA 4RIOA 4E6AA 4IEBA 2R3HA 4EQMA 4QMQA 5JFSA 2RFDA 4ASDA 3I6UA 4TKSA 2GNFA 5D10A 4ARKA 4L53A 1URCA 2GNIA 2QLUA 4BTKA 3N4TA 1F0QA 2QLQA 4MK0A 4G16A 4X6RA 3EQDA 4QMYA 4U0IA 1E1VA 5M4CA 1J7IA 3FKOA 5L2SA 4TWPA 5EW8A 3BGPA 4QMTA 4EJNA 2GFSA 2Z7LA 2ONLA 4C59A 4H39A 3SRVB 5A46A 4QRCA 4JXFA 3WIGA 2RFNA 2F7EE 4O0YA 4WSYA 3EZVA 3FY2A 3H0ZA 2RSVA 4P5ZA 4BF2A 3IPHA 4QO9A 4D58A 4QP3A 3OF0A 4ZSLA 4W8EA 1IASA 3HRBA 2BMCA 2XK4A 3IONA 4Y72A 3R6XA 3FC2A 2A27A 3QRIA 4L43A 4BTFA 5T6KA 4D0WA 3NW6A 3HV4A 3Q9ZA 1FVVA 4PUZA 4F64A 3ANQA 4ZY4A 3HV7A 1DAWA 1F3MC 2NPQA 3RM7A 3S4QA 4CFUA 4NFMA 4DBNA 3HAVA 4IM2A 1OECA 2XK8A 4LRMA 3BU6A 3HRFA 3RCJA 2ITTA 4ZLOA 4PX6A 5BYZA 1VJYA 2YISA 4F6UA 4APCA 2R3OA 3C1XA 2YN8A 2XK3A 3BV2A 4RVKA 4XS2A 5HBHA 4AOJA 5HI2A 1XH6A 3RALA 2YM8A 4WNKA 4O7NA 3KL8A 4RIWA 3SRVA 3RPSA 4AOTA 3VO3A 2WB8A 3FMNA 3MPMA 2X2MA 4HVHA 2F2CB 3ZEWA 3AC8A 3BX5A 5CEOA 5IA4A 3CE3A 3W55A 2WU7A 4X6QC 1OKWA 3DB6A 3GGFA 1ZMVA 4JVGA 2XVDA 2XKDA 3FUPA 3QD0A 4LMNA 5HG8A 1H08A 4MXXA 2P55A 2JDRA 3ULIA 4TTHB 5LWMA 2JD5A 3KRRA 4FKWA 4AW0A 4CQGA 3JVRA 5EYMA 3AQVA 4RMZA 3P79A 3ZRLA 2X4ZA 5ICPA 3WZEA 3KXMA 4QMZA 1AD5A 1O6LA 4WBOA 4F63A 1G8AA 3F2NA 4U9AA 4FTCA 3E7OA 3IGGA 3FPQA 4ACMA 3FMJA 4I20A 1U5QA 4YZMA 2GMXA 5LMBA 4FEXA 1P14A 4HYUA 4MKCA 3QFVA 5FEQA 3ZO3A 3VQUA 1MP8A 4FVRA 3MPAA 3W18A 4D1XA 4YMJA 1H1SA 3AMYA 4D2TA 5D7AA 2VAGA 5DYJA 3AG9A 1YOLA 4QP7A 3BHVA 3PXZA 4FTQA 4DGGA 4FVPA 4IVDA 1IAHA 1Y6BA 4GT4A 2ITWA 3BHHA 2IW6A 4RVTA 3DJ7A 2Y9QA 4G17A 2OFUA 3SA0A 4GT3A 4D5HA 2GNLA 1J7UA 2BAJA 4U43A 1QPJA 4TYHB 3KVXA 3PZEA 5M4FA 2W17A 3UO4A 4GYIA 4C38A 1OI9A 3W8QA 2CPKE 2BAKA 2VD5A 2VNWA 5CF6A 5GIOE 5J9LA 4ZOGA 3UIXA 4OT5A 2W1EA 2B0QA 4QNAA 4QTCA 2GTMA 3BYUA 3NR9A 4QYYA 1YXSA 4FICA 4AA4A 3QF9A 4FKOA 4MBIA 4QOXA 3TWJA 5CF5A 3Q9WA 3L8PA 1UKHA 3QU0A 4JQ7A 5IA0A 1XHAA 3ZMMA 5K4JA 4BWXA 5F4NA 3LMIA 4FTNA 3RPOA 5FWKK 4LGDA 5CU3A 5A6NA 1GZOA 1GNGA 3ZC6A 3S1HA 2X7FA 5EG3A 4QTDA 2VWYA 3QX2A 4TWOA 4FG8A 1W7HA 3PVBA 3GUBA 4N0SA 2C6LA 2ZV2A 4WO5A 5IH4A 3MFRA 4X7QA 3F7WA 3ID6C 1H01A 5FXSA 3FLSA 3GI3A 5AUYA 3C4WA 4A9TA 4TL0A 2GTNA 3O8UA 2F4JA 2BHHA 4YTFA 3KN6A 3PIYA 3O51A 2HCKA 4X2FA 4FSNA 3ZLXA 3WF7A 4O81A 4MQ1A 4QMPA 4AACA 4YGAA 5I3RA 2X39A 3CPCA 4O0UA 3L1SA 2R3JA 4H58A 5DT3A 3RAWA 4PDYA 2WZJA 3EQCA 4ASXA 4BDAA 3R9NA 4AU8A 1MQBA 4X2NA 5JZJA 4BZDA 3OBGA 4M0ZA 3LLTA 1W83A 2J51A 4QPAA 3ZUUA 4OTFA 3DBCA 4AP7A 4R7BA 3QWKA 3G15A 4HVGA 4F0GA 5HHWA 3FWQA 5IQGA 3TKUA 1FOTA 5J7BA 4N57A 4ZSEA 3RHXA 1VYWA 4XP3A 4JG8A 2ITXA 5BUEA 3FMLA 4V01A 2QOLA 2YAAA 3QRUA 4IB3A 3ACJA 2Q0BA 4IJPA 1OUYA 4RVLA 3HRCA 5EM5A 1ZARA 4O1OA 3NNWA 2I1MA 1UNGA 2OICA 3PJCA 5E8SA 3RVGA 3SHEA 3S00A 2CLQA 2VZ6A 5HBJA 4E73A 4V0GB 4KBCA 4ANMA 4FV7A 3V3VA 2CMWA 2LGCA 5M4IA 2R3RA 2OG8A 2ACXA 5CF4A 2DQ7X 2VX1A 4FG7A 5E1SA 4EL9A 3KF4A 3R8PA 2QKRA 4RA5A 1WVYA 5FQDC 4F7SA 4YC8A 5I9UA 1YI4A 3BYSA 5KMMA 3MIAA 2IZSA 1OIUA 5BUIA 5IQAA 3OCTA 4Z3VA 1JPAA 3QTZA 4BR3A 4OBOA 4BDDA 4LYNA 2DUVA 3IQ7A 2QOKA 3A7GA 4FNXA 4L9IA 4R8QA 5DWRA 3VUGA 2XBAA 5J7HA 5CALA 1SVHA 4W4YA 5FRIA 3Q6WA 3D14A 4IAFA 4OTDA 2O64A 4YHJA 3QRTA 3GP0A 1RJBA 3AC3A 3C4FA 1DI8A 5JH6A 5AP5A 4QMWA 1YDTE 5GHVA 5CVHA 3QQLA 5C03A 4C3RA 5IDPA 3PIZA 2R3LA 3E63A 4E6CA 3Q2MA 3HZTA 2H34A 1Y57A 4DEHA 3KULB 1YXTA 4NWMA 3VNTA 4MWIA 1YW2A 5CAPA 4BDJA 2B55A 5C4KA 3QTWA 1I09A 3C4CA 4BHNA 4U44A 3SW7A 2OO8X 3AGLA 4TPTA 4XV9A 5D11A 4CT1A 4CG9A 5IUIA 1CDKA 3G9NA 3C13A 3H10A 3OP5A 4E6DA 1Q97A 2C6IA 2GSFA 5D1JA 2CKPA 4C58A 3TIYA 3AC2A 3U87A 2F57A 3OVVA 2VV9A 4S2ZA 3MWUA 3VBYA 3C4ZA 1IRKA 4EHZA 3NEWA 4M13A 4AW2A 4WHZA 4LL5A 2C5VA 2OSCA 4GK3A 4D2RA 3I7BA 4XHKB 5HCZA 2C5XA 2JGZA 4PQNA 1H1RA 3Q60A 5GIPE 1WFCA 3OWJA 4BCIA 3MVLA 4MF1A 4J98A 3BELA 3D83A 4AZWA 2GQGA 3ZH8A 1R78A 2R3KA 1YWNA 2IZUA 4XV3A 4JDHA 4C62A 2EXMA 2HW7A 3D7TA 3LJ1A 3RPYA 4EH4A 3FXXA 4G3EA 4I92A 3BGZA 3KF7A 3EN7A 3L8XA 3QTSA 1UNHA 4FKIA 3BZ3A 4FV4A 3KCKA 4WKQA 5CSWA 5EOLA 4AA0A 3RK5A 4IC7A 3TI1A 4FTJA 3BQCA 3RPRA 2P4IA 3IECA 3V5LA 1DAYA 3LQ5A 4EBVA 3JUHA 3QCQA 2RL5A 2XM8A 4FNWA 5HVYA 3QZFA 2E9UA 3DV3A 1KOAA 3EQIA 3OOMA 4KKGA 4O0XA 3QQJA 2ITVA 4C33A 3DPKA 4DGOA 2JBOA 2BIKB 3P5KA 4YZ9A 3LMHA 3DXQA 4JR7A 2X9FA 4CEGA 2W9FB 2UZEA 3BWJA 3F3WA 4AN2A 4CVAA 3G5DA 2W99B 4IB5A 4M12A 4C2VA 3CJFA 3RHKA 1OKVA 3OG7A 5GINE 4K33A 5KKRB 2VTIA 1QCFA 4UMQA 4D5KA 5TO8A 5JQ5A 5HICA 3CGFA 3EL7A 1PMNA 4AGUA 5M06A 4E5AX 1XJDA 4J53A 4OTPA 3RGFA 4RIXB 4E6QA 4E3CA 5IF1A 3TV7A 4AZTA 3FQSA 2GHGA 4KRCA 4U3YA 3LIJA 4K18A 5E7RA 5B2KA 5F9EA 4Z55A 4X2JA 4FL2A 3KRLA 4OR5A 3R9HA 3OTVA 3PWDA 3L9LA 4M69B 5AX3A 2R3GA 4AGWA 3M42A 2PVJA 4G3DA 2BTRA 4IAZA 4S33A 3G0EA 3SX9A 4FVQA 4MHAA 4PRJA 4X21A 4EOSA 5HE2A 2ETRA 3HL7A 4TNBA 4FYNA 5ACKA 3QXPA 3CSVA 1KE5A 4QP6A 4NM3A 1OB3A 5KZ0A 4JAJA 3OUNB 3BV3A 1G8SA 1MQ4A 2CDZA 3PXQA 2PWLA 3IDCA 4EH2A 4EOKA 4XLIA 3LFEA 4GIIA 1PF8A 2IWIA 2E2BA 4ZLZA 3QUPA 3PXYA 4KIQA 4BGGA 3R22A 4F9AA 5B2MA 3P7CA 2YLFA 1PXOA 3BGQA 5J1WA 4WNPA 5FEEA 2WMBA 2GFCA 1Q61A 3E92A 3CD8A 3ZSGA 3I7CA 3KGAA 4MEDA 1H8FA 3NX8A 3PA4A 2PUPA 3RZFA 1U54A 2CCHA 4O0TA 4MVFA 4QQ5A 4GU9A 1I44A 3HP5A 2V7AA 4L01A 3EFKA 5HESA 3FEGA 1W82A 3WARA 4E7WA 2R7BA 4GEOA 2OJGA 5AUXA 4YJQA 2R9SA 4IADA 4CMTA 2VTHA 3VJOA 3LCKA 2VWZA 4K2RA 4GW8A 5EM6A 3T9IA 5G6VA 2PUNA 2OH4A 3I79A 3QL8A 4FC0A 3EN4A 4BL1A 4LOPA 3BHTA 2AUHA 2C4GA 3H9RA 4IW0A 3V8WA 4CZUA 5D7VA 4DEAA 4FF8A 4CMUA 4FEUA 1MRVA 4BBFA 3QQGA 1ZYSA 2Y4IC 4FV5A 5ACBC 3RKBA 3PXRA 5EKOA 3TUDA 3LMGA 4DAWA 5DMZA 4H05A 2O8YA 4IFCA 3VUHA 3OTUA 1IAJA 2WEVA 3BHYA 3EIDA 1CKPA 3QQKA 1SNUA 1YI6A 1YOJA 4YO6A 4QYFA 4ZEGA 1UV5A 3VWAA 3DK6A 3GFEA 4UEUA 4F0IA 2JDTA 2W0JA 3S2PA 5C8NA 4K6ZA 2WFYA 4MNEA 3W2SA 4EH9A 4S34A 5CNOA 1XH7A 3Q4UA 3A7HA 4FIEA 3AT2A 3CQWA 3WZUA 3BU3A 4G5PA 2XKEA 4YC6A 4TYJA 3LFQA 2CGVA 5HG5A 3UC4A 2AC5A 4LUDA 5CF8A 3EQRA 3HDNA 3ZZWA 4NU1A 4O86A 4YC3A 4ANQA 1UA2A 3VS0A 4ZSAA 4HNIA 2JIVA 2JC6A 4KSPA 3LHJA 4BDBA 1PJKA 3GQIA 4WOVA 3MDYA 5CEIA 1Q8TA 3B8RA 4B0GA 2F9GA 4BC6A 5LCJA 3Q4ZA 2C6OA 4M0YA 5ETFA 2HZ0A 1YXUA 3U55A 4BN1A 5TOZA 4IXPA 4RC2A 2BCJA 1YHWA 3AC5A 4L44A 2GDOA 4OAUC 3N4VA 4Q5EA 4LQMA 4U81A 4DFNA 2FO0A 4YJSA 4YJPA 3VS3A 1NVQA 3PIXA 4O2PA 4RWJA 5EQYA 4ACHA 3MY5A 3D2IA 3MFSA 3QYZA 5CEPA 4FSRA 3A99A 4F9BA 5IZFA 4I41A 2RFEA 3QKKA 2QOBA 3NNUA 4USFA 1WMKA 2WMWA 4ZZMA 4YTIA 2R3QA 4W8DA 3ZEPA 5DBXA 3V6SA 3ANRA 3O17A 2ITZA 2VWIA 2WIPA 1OL1A 1Q62A 3BHUA 3D5VA 3M1SA 4FOBA 4DEGA 5IH6A 3AD4A 4FTOA 4RIYB 5CENA 5KUPA 3PVUA 4KIKB 2JITA 3ZU7A 4AF3A 3TL8A 5HE1A 3NDMA 4I3ZA 1Q99A 3ITZA 2XIZA 3FI8A 1WBSA 4H1JA 4IVCA 5C8KA 1OL7A 3MS9A 5AAEA 3E8CA 1YQJA 3BLQA 3IW5A 3ORZA 5LVNA 2R0UA 5HO7A 1GZNA 2A2AA 3DLSA 4QQTA 1HOWA 4O22A 4IZ7A 1GIHA 3OEFX 3COHA 3MTFA 4F1TA 2IJMA 2QQ7A 3FY0A 3HAMA 5F95A 3BYOA 1NW1A 3DFCB 4FTKA 4FV2A 3W1FA 3BPRA 3DDQA 4ZTRA 2E9OA 5M07A 4FIFA 3FXWA 4IM0A 4FZFB 3TEIA 5AP4A 1SM2A 4OTGA 5BVDA 4WT6A 2C6TA 3F3ZA 4NFNA 4OTRA 4QMOA 3NSZA 3FL5A 3TDVA 2PY3A 2GQSA 1LR4A 3AD6A 3TV4A 4MXZA 5K4IA 3QA8A 5EHOA 2J5EA 4PDPA 2Y0AA 3PSCA 3UO5A 2FB8A 2IPXA 3COIA 4LFIA 3R04A 3VC4A 2VO6A 3BLRA 2OGVA 3E62A 1LPUA 3QKLA 3R1SA 2R0IA 2Y4PA 4CNHA 4D4YA 3V5QA 4HZRA 4EYMA 5FTGA 5CU2A 5KX8A 4AGCA 2CNQA 4EH8A 5I9VA 2WQNA 3OXIA 4FTMA 4GG7A 4XYFA 4EI4A 5AR7A 3OWPA 5CYIA 2QHNA 4K9YA 2WOUA 4LI5A 4QMUA 4PWNA 3FXZA 4OTIA 1H4LA 2BRNA 3FSKA 3O96A 3GBZA 3RBWA 3QTQA 3L9NA 3POOA 2R5TA 2NO3A 4DINA 4ERKA 3GCSA 4J71A 3QRJA 5A4EA 4ZSGA 5EDPA 4IX6A 5CU0A 4F65A 2GPHA 4GYGA 4OUCA 4RX8A 2NP8A 1Q3DA 5FP6A 3ELJA 3Q53A 4TZRA 3IOPA 4D2WA 5IA2A 3C4EA 5HNIX 2G2HA 4J95A 4W4XA 2XF0A 5DLSA 2YDJA 4FV3A 1L3RE 1GZKA 1BL7A 3AOXA 3Q04A 4JJRA 4CMOA 1DI9A 1P4FA 1WBPA 4EC8A 4R78A 5AR5A 3RWPA 2HWOA 3QZGA 1YHSA 5EM8A 1SYKA 3CLYA 5AP3A 1A06A 4DTKA 4QTEA 3W2CA 3KA0A 2G9XA 3A7JA 3CKWA 3VS7A 4RC3A 4YLLA 4JQEA 3S95A 3QA0A 2XBJA 3VVHA 3R63A 2VX3A 3ZS5A 5KMKA 1JSUA 4B8MA 5EYKA 5FGKA 4FZDB 4OTQA 2QO2A 1ZMWA 4DGLC 3HV5A 4FUYA 3E8EA 3LLAA 5F20A 5BVEA 4DCEA 4UY9A 4QTBA 1WBOA 4R1VA 4GS6A 5EHYA 1RDQE 4RT7A 3DZOA 3W10A 4UZDA 2JEDA 5JKGA 2HXQA 3U9CA 3QLFA 4FKQA 2X2LA 4GJ2A 2AYPA 5AUZA 5HTBA 4RJ8A 4E4LA 5AM6A 4FSTA 4KBKA 5H8EA 4RZWA 4ZY6A 3R02A 1PRYA 3N51A 2F7XE 1MRUA 3OXZA 4RJ3A 4RQVA 3FMKA 3NAXA 4Y85A 5DFPA 4C4JA 4F08A 4UMPA 4JI9A 3RTPA 5IU2A 2QOOA 3UPZA 2YERA 4DLIA 1XH8A 3UQFA 3ET7A 4TN6A 4FBXA 4ZZNA 2Z60A 4I4EA 3RINA 3A4OX 4J52A 1OMWA 4X2GA 2JBPA 3TV6A 4JX3A 3PE1A 4O7WA 4JG6A 3OFMA 1H0WA 3HUBA 3ZSIA 4IANA 3ATTA 2UW5A 4FUXA 5LMKC 4ASEA 4U3ZA 3TXOA 1FGKA 3F6XA 4O7YA 4YJNA 3UZTA 4EOMA 5IEYA 3FC1X 4DFLA 3TNWA 2BUJA 4ZJVA 2YLEA 3O50A 5IISA 5K5NA 1PYXA 4J97A 2BDJA 1FVRA 3B8QA 3EHAA 4NCTC 5K0KA 4HVDA 3FMEA 2BR1A 4IH8A 3FLQA 4ANNA 1ZZ2A 1TQIA 1M14A 2WTVA 2Z7RA 3EKKA 1OM1A 1ZZLA 5CLPA 3D5XA 4M84A 3U6JA 2ETMA 1KWPA 1P5EA 5AP1A 3PP1A 2RG5A 3WZKA 4NEUA 2W1IA 3OCBA 2JDOA 5H9BA 2X8DA 1H1PA 1PXLA 3NYVA 4RIWB 4RWLA 4W9XA 5AR4A 4BCQA 5CU6A 4I0SA 4HYSA 4FI1A 4BCFA 1Q5KA 3PWYA 4QPSA 5L2QA 1OBGA 3VUIA 3RJCA 3LFAA 2XB7A 3W33A 3QXOA 4BZOA 2SRCA 5F94A 3VULA 4DA5A 4G1WA 3RAIA 3DAKA 3TJDA 5AP6A 2P2IA 4XMOA 2CLXA 2BZKB 4YZDA 4KA3A 3IDPA 4ZXTA 3ZTXA 5JGDA 5FBNC 4D2SA 4K1BA 5M57A 4M14A 3EZRA 4MX9A 1EH4A 2ITUA 3RI1A 2UZTA 5M51A 2OBJA 5AIRA 2HAKA 4PTEA 4JAIA 4Z16A 4JQ8A 2B9JA 4L52A 4ZTNA 5BUJA 3IK3A 2I0EA 4AQCA 2VWBA 5IA3A 4RLLA 5EHLA 4GFMA 1PY5A 4N6ZA 3ENMA 1PKDA 4ASZA 5D41A 3TACA 4EOLA 1VZOA 1IEPA 3AMBA 1BKXA 2CN5A 4HCVA 4MD8E 2OWBA 2R4BA 3L8VA 2DWBA 5CZHA 4DH3A 3MV5A 1ATPE 1APME 4FE2A 3QTRA 3MA6A 4QMSA 4DFUA 1JKTA 4GU6A 2QO7A 4U45A 3JR1A 5DA3A 3DBFA 2OJIA 3OBJA 2YAKA 4IB0A 5E9EA 2V0DA 2ERZE 5IA1A 3VF9A 3ZDUA 4EK5A 5L4QA 3IGOA 4XG6A 3SKCA 4AAAA 3LQ3A 1XH9A 4G2FA 2R3NA 2Z7SA 4E5BA 2QVSE 2Q83A 4M3QA 5L6WL 4NH1A 4RQKA 4YHTA 5J8IA 5M44A 3CP9A 2E9NA 2VWUA 3F9NA 3LE6A 3ORNA 3OY3A 4FKSA 5ETAA 3V6RA 2WXVA 2XNNA 4GL9A 1YDRE 1H27A 1XBAA 3UOJA 2JKQA 3KRXA 4FNZA 5L8KA 3WBLA 3UMWA 2ZDUA 2BZJA 5IQHA 2PE1A 2B7AA 3C9WA 3PY3A 3VRZA 4QMVA 4AT5A 4F09A 1FGIA 3G90X 5I9XA 1BMKA 3D15A 3FLZA 3NUXA 4YJVA 4ZJIA 3F66A 4K8AA 3ZONA 4DEIA 4FEWA 2GS6A 4PNIA 2YCSA 3E93A 2XEZA 5H8GA 3AT4A 2WQEA 1O6KA 4E4MA 3E8NA 4AX8A 3R0TA 3OEZA 4ONAA 1XWSA 4R3PA 3G9LX 4EOIA 3DY7A 2ERKA 2P3GX 3ENHA 1DS5A 2PVLA 4Z9LA 4D9UA 5IQDA 2W06A 2W5BA 2J0IA 3HMOA 4A9SA 3VS4A 3SD0A 3VJNA 3HKOA 5CASA 3NWWA 1UWHA 1KE6A 3Q4TA 1ZY5A 4KBAA 3LQ8A 2X6DA 2G01A 4EH3A 5J79A 2R3MA 3PA5A 3M2WA 5LCKA 4DGMA 2QONA 4H3PA 3KXXA 4PDSA 2BROA 4L3PA 2UVYA 3FL4A 4LRJA 3RM6A 3V5TA 3IW7A 4PPAA 3V04A 5FLFA 2NRUA 4HCTA 1K2PA 1ZMUA 3LCDA 2QOQA 4K11A 1BL6A 5E8YA 3R7IA 3F5UA 1YXXA 3VS2A 3Q5ZA 4PPCA 4YU2A 4ZZOA 3A62A 5CSXA 2OXXA 3KY2A 4JX7A 4ENXA 4G3CA 4QT1A 4R3RA 4PMMA 2YIQA 4R5YA 5E91A 4CFVA 4EQUA 4XG3A 5F1ZA 1YDSE 3EOCA 3HA6A 4IB1A 4YZNA 4IVBA 4WSQA 1H00A 1JWHA 3IKAA 4FT7A 5FEDA 5AA8A 2WNTA 3QRKA 4FIJA 4OLIA 2WTKB 3LJ0A 2OJJA 5CEMA 2OI4X 3MJ1A 3ORIA 3P23A 4QYHA 3FLNC 4AE9A 3F69A 5EW9A 1A9UA 4TNDA 4IAAA 2W4OA 2HW6A 3GB2A 4YBKA 3KRWA 4P90A 5CT0A 4GCJA 4A06A 3DXNA 3QQFA 3DKCA 4Q9SA 2BTSA 4M15A 4GKIA 3SXRA 3BE2A 4BCOA 4KABA 4QYGA 2XK9A 4AN9A 3AT3A 2B4SB 3ZLYA 4BGQA 2IG7A 3VBWA 3Q6UA 2OIDA 3R7UA 4HGEA 1SMHA 4DBXA 1M2PA 2VWWA 5BPYA 4YSJA 3GU6A 3CQEA 4JIKA 1JKKA 4CV8A 4IWDA 2WIHA 4U8ZA 3C50A 1S9IA 5EI2A 4ZTMA 2J7TA 4RG0A 3A4PA 4U80A 3HYHA 4J8NA 4YZBA 4II5A 4CTBA 5KMNA 1FPUA 3KVWA 4AUAA 3P4KA 3PXKA 1ZYCA 4FT9A 4RWIA 2H6DA 3HEGA 5EDRA 5IEXA 2PVKA 3WE8A 3WOWA 4BKZA 4DITA 2DYLA 4JS8A 2A4LA 2YDIA 2QG5A 3UTOA 4JT3A 2HY81 3R83A 3U6IA 2E9VA 3MH2A 4KUJA 3P1AA 4TRLA 3SOAA 3HV3A 3OHTA 1E9HA 2B9FA 4JDJA 4IZAA 1Q8YA 3ZXTA 4LV5A 5IMXA 2G2IA 2PMIA 4HOKA 5ITAA 4RRVA 3FPMA 2QD9A 2XJ0A 4O6LA 4U40A 3R7OA 5CTPA 3MH0A 3LPBA 3DK7A 5LVPA 3TUBA 3OY1A 4UB7A 1YWVA 2WELA 4MBJA 1GOLA 4FTUA 5HO6A 4DFBA 2XK6A 4FKRA 1PXJA 4X2KA 5JGBA 5HE0A 2UZVA 3NVKI 3EQGA 2KTYA 2WD1A 4R1YA 2UW7A 1G5SA 3LXPA 3DZQA 4JL9A 1VR2A 3D7TB 4E4XA 2V62A 2XEYA 3P78A 4IWOA 2WU6A 5LJJA 4J8MA 3ROYA 4DN5A 4Q9ZA 2P2HA 1DM2A 3IW8A 2J0LA 2O5KA 4RFZA 5M08A 3V5WA 4QMMA 2HK5A 4A9UA 1J1BA 4USEA 2YWVA 3Q9YA 1XBCA 3WF8A 3H30A 4R6VA 1L8TA 1JVPP 3FV8A 5CZIA 2YM6A 2C47A 4LOQA 4V05A 4Q2AA 2OF2A 1J1CA 2RG6A 3DTWA 3LZBA 2YJSA 2G2FA 2WMUA 2I40A 1JKLA 3NIZA 1X8BA 3MY1A 4FTLA 3UP7A 2JKKA 4L42A 2CKOA 3KXHA 4HVSA 1JOWB 3ZC5A 3KXNA 2VWXA 5M4UA 2ZV9A 5CX9A 5M53A 3F61A 1GAGA 3P86A 5AJQA 2C68A 3PJ2A 2GNHA 4LGGA 4FKPA 5E92A 5ETIA 4K0YA 2EB2A 4AA5A 4XCUA 3NLBA 1YRPA 3MESA 2FH9A 2JKMA 4TWNA 1H28A 2IW8A 4XNEA 4CFNA 2WMVA 2IO6A 3FMMA 3I5ZA 2VTNA 2R3PA 4DH5A 3OW3A 5CWZA 1NT2A 2UW8A 4XUFA 2C6DA 5E8WA 3C0HA 4NSTA 3OS3A 4U79A 5IEVA 4NW5A 2XCHA 2YFXA 5KMIA 3GU4A 4HYHA 3R8MA 3UNZA 4YPDA 3U8WA 4PF4A 2OJFE 5GZ9A 4S31A 4IAYA 2C0OA 3E7VA 4C36A 3OZ6A 2BAQA 4CYIA 4HJOA 4EONA 4G9CA 4BYJA 4FKGA 3ZM4A 1CM8A 3R00A 2BRMA 4HPUE 2OF4A 2YA9A 4GG5A 1J7LA 4EWHA 4I6BA 4YTHA 4BDIA 2C3LA 5IQFA 4I23A 1YXVA 2VGPA 5CXHA 4A9RA 3PFQA 4CGAA 3REPA 5BX0A 3CEKA 2RKUA 2B54A 3UQCA 5G1XA 5CAUA 5HU3A 5LMKA 3G0FA 2BZHB 3SQQA 1TVOA 4ENYA 4UMUA 3C5IA 4UBAA 3R9DA 1K3AA 5DH3A 3II5A 4NCTA 3RNIA 3CY2A 2W5AA 4WBBB 4ACGA 2WKMA 3D5WA 1Z5MA 4L8MA 1OITA 3CTJA 4E4NA 1U54B 2VTJA 3AC4A 3KEXA 1KV1A 4F9CA 2WMQA 3ORMA 2LAVA 3MBLA 3TZ8A 4EUUA 2OFVA 4C02A 2Y7JA 1YWRA 4I4FA 3QUEA 2Z7QA 4NM0A 5I9ZA 4ANLA 2P33A 4USDA 5GNKA 1QMZA 4MXAA 2ZOQA 3SOCA 3QALE 3KK8A 3R1YA 3TIZA 4XEYA 4KNBA 1REJA 5FD2A 3PZHA 4F7JA 3S0OA 5E8ZA 5EFQA 4NKSA 4FIHA 2H9VA 3QTUA 3R8ZA 5HX6A 4I6QA 5CS6A 3QTIA 4DEDA 2GNJA 3DNEA 3UZRA 3CTQA 3EQPA 3N9XA 4Z7HA 2J0JA 5KMOA 4DH1A 3FMHA 3LVPA 1H25A 2IW9A 4AZVA 4O6EA 5DT4A 2QURA 2XIXA 2ITPA 2GQRA 2PULA 3TT0A 3OD6X 2HWPA 2VN9A 3PLSA 3TKIA 4ZP5A 4YJOA 3PPZA 2YZAA 4C61A 3L9PA 2ZMDA 3UG2A 1V1KA 3NYOA 3FI3A 4MNEB 3FSFA 4C4HA 3OMVA 3BYMA 1UU7A 1WBNA 1YOMA 4PMPA 2H96A 1R0EA 3CPBA 2XUUA 3G33A 3SW4A 5BVOA 3P0MA 3TUCA 3LM5A 4C4FA 5LMAA 4LL0A 4EK8A 2WQMA 1VYZA 4I5HA 3TNQB 4FZ7A 2C6MA 3R1NA 4IZYA 4CZYB 4TY1A 1Y91A 1FINA 2UZLA 3Q5IA 2O2UA 3CC6A 2UUEA 3QD3A 4AT3A 4BICA 5IG1A 5AP7A 3BBWA 5C8MA 1OBDA 3QKMA 1Z57A 3TNIA 2O3PA 5A14A 2BKZA 5H8BA 5JMSA 2PUIA 4P7EA 4YR8A 5AV4A 5K3YA 4UN0C 3Q3BA 2J0KA 3AXWA 1OL2A 3A8WA 4I24A 4EHVA 2BRBA 4IAKA 4QMLA 3OCGA 5EI8A 2UV2A 3KC3A 2CGXA 3MY0A 1TQMA 3QQUA 3SVVA 1NY3A 3R01A 3ZUTA 3DBDA 2RGPA 4O2ZA 5JQ8A 4AXAA 2J4ZA 3ODZX 4YHFA 4GT5A 1GY3A 3MB6A 3NCZA 3ORPA 5GJDA 2Y6MA 4C37A 3Q2JA 3FLWA 1SVEA 3VRYA 5DRDA 1FVTA 4QNYA 4KD1A 3NNVA 2PL0A 4GRBA 4IQ6A 1O9UA 2YJRA 3F2RA 2XK7A 2EU9A 2YCQA 3KMMA 3PJ8A 4IWPA 1CKJA 3ZUVA 4NM7A 5I0BA 3C51A 3Q9XA 2VTLA 5HNBA 3LFDA 4O0WA 4DG0E 1H1QA 3PP0A 3FDNA 4ITHA 4QP9A 3GC0A 3D94A 3F7ZA 2YITA 4AOIA 3SAYA 5AUTA 1UWJA 3I0QA 3VF8A 2YCRA 4DT9A 4BBEA 4DFYA 2V22A 5AA9A 1U46A 1J3HA 4XV2A 1W8CA 4FODA 4NM5A 4PDOA 4YBJA 4HZSA 3ZXZA 5DR6A 5IUHA 5KCVA 4KAOA 4G34A 4UXQA 4IJ9A 2YWPA 3PE2A 4AE6A 5TKDA 2ZYBA 5EDQA 3MH3A 1PMEA 5ANGA 4C4GA 3UNJA 2C5OA 3UIBA 3L9MA 3C0IA 4W9WA 3DAJA 4BDEA 4XLVA 2EXCX 3KXGA 4GVJA 2BZIB 4AFEA 3K3JA 4HW7A 2W1DA 4BYIA 3OCSA 3VBXA 3KRJA 5A4QA 4H36A 2X8EA 4F6SA 5FBOA 1QPDA 5HIEA 2QU6A 3PXFA 4FT3A 1FMKA 4RX9A 5KHWA 2UZNA 5L6OA 2W1GA 2UZWE 3CGOA 2J2IB 4QP4A 5FP5A 2ZVAA 5I9WA 3GT8A 3KFAA 4CG8A 5EOBA 5EQEA 4IC8A 2V55A 3PLAE 3THBA 4O83A 3DBQA 4L46A 4Y5HA 2YIXA 3O23A 1PMVA 2BDFA 2REIA 5JN2A 4YNEA 3FQEA 2IVTA 5AAGA 4FK6A 5KE0A 3RZBA 3CKXA 2XP2A 3E3PA 4YPSA 4ACCA 5E8TA 4BI1A 4RFYA 5A9UA 2CHLA 3EFWA 3ZBXA 4DF3A 2OZAA 2BALA 3MA3A 5ANEA 4F99A 4MWHA 4ZTQA 4MBLA 3K54A 1XO2B 2GS7A 3H3CA 5TR6A 1MRYA 1BUHA 1XR1A 2BDWA 3QLGA 3KCFA 4TW9A 4PL4A 5EQPA 4ID7A 4D4VA 3A7FA 4O91A 5AP0A 3O0GA 1T46A 1WVXA 3JY9A 1ZOEA 4FOCA 2CJMA 4IHPA 4O27B 2PHKA 3HP2A 3QC9A 5IKWA 4CKRA 3LFNA 1PXIA 3FHIA 5HOAA 4FZ6A 2UVXA 4PP9A 4O84A 3MW1A 2UW9A 3SG8A 3W2OA 3VHKA 2JFMA 2X2KA 4XJ0A 4BY9E 1TKIA 3F3VA 2C0IA 4IM3A 2VTTA 3H9FA 3MVMA 3UIMA 3QYWA 2QHMA 4QD6A 4XRJA 2GHMA 3G6HA 5LARA 4MXOA 2YABA 3GXLA 2HZNA 5EYCA 2DS1A 4ZTSA 4EJ7A 2PPQA 3IO7A 4XG2A 4BKYA 1ZAOA 4CV9A 2JFLA 4F70A 4FL3A 3D4QA 5CVGA 5E4HA 4AS0A 2QR8A 3GVUA 3NUYA 4C2WA 4EZ7A 4FA2A 5BMSA 5CAOA 1UKIA 4AN3A 2G15A 3CBLA 3ZO1A 3ZO4A 3DXPA 1PXMA 3DB8A 3T3VA 5CT7A 3P7AA 3OWLA 3QHWA 4BDFA 5L6PA 3QTXA 3GQLA 3OT3A 1ZWSA 4C4EA 4Y8DA 3NS9A 3TZ9A 4ZS0A 2JDVA 2W1CA 1H26A 5CVFA 5D9HA 3TG1A 3LAUA 4JBQA 4Y83A 5HG7A 1GZ8A 5IH5A 4RJ7A 4F0FA 4EH7A 1JKSA 4RJ4A 4BCNA 1Q3WA 4R5SA 2HZ4A 4FKTA 2PVFA 3CD3A 4KB8A 4XH6A 4XOYA 4BDHA 5AUUA 5ANOA 3W2RA 4L3LA 4K77A 4G3GA 4FTRA 4GK4A 2VX0A 4JRVA 3UQGA 5HG9A 2UZOA 1B38A 2YM3A 2PVRA 2I0YA 5CAVA 3VAPA 1ZRZA 2W05A 5DN3A 4TWCA 4FKUA 4BIBA 3ZZEA 3UE4A 4O96A 5DEWA 5I3OA 2YACA 4I5CA 5ANDA 2UW4A 5CAQA 4FKJA 3HMPA 3T9TA 4E1ZA 5LXMA 3ORKA 4FNYA 3RNYA 2WTCA 3PSBA 3T3UA 4AZEA 4BDCA 1LEZA 5HQ0A 5TF9A 3FQHA 4WRGA 4ALVA 3E8DA 5AUVA 2OH0E 2X1NA 3MVHA 4PP7A 2WPAA 5C1QB 1PW2A 5B2LA 1BI8A 3DJ6A 2QCSA 5ANJA 3RCDA 4C4IA 4YTCA 3D2KA 1KSWA 3VN9A 5CQUA 5DIAA 3GFWA 5FDXA 3LFBA 2O65A 4H3BA 3SV0A 3VW8A 4RBLA 3DNDA 3JS2A 3P08A 4LUEA 5EW3A 3NYXA 4G31A 4YNOA 5ANKA 5HVKA 5M55A 4CCBA 3U4UA 4EKKA 3ZLWA 3FZPA 4N4SA 1KUTA 1YI3A 1JAMA 5H2UA 2ZM3A 2WMTA 4ZY5A 3FZRA 4Z7GA 2VTPA 3IS5A 3JPVA 3KK9A 3ZOSA 1M7QA 3QZIA 4I22A 5HIBA 3SXSA 2IZRA 5H3QA 3PG3A 2XH5A 3QWJA 5IUGA 3NPCA 4CKJA 2QOHA 4KSQA 1O6YA 5CANA 4EORA 2UW6A 3NVMB 4RJ5A 4M7IA 2BVAA 3EQFA 4F1MA 1REKA 4NIFA 1V0BA 3QHRA 4Y46A 2QOFA 3DT1A 2GCDA 5T3QA 4RLKA 5HIDA 3GENA 3UZPA 4BWKA 4F1OA 3LOKA 4KRDA 2PVNA 4O1PA 4E26A 3ERKA 4F9YA 2R7IA 3OT8A 4TXCA 4HGSA 1Z9XA 4E5WA 2WGJA 4JIAA 4IWQA 2JKOA 2WMRA 4MAOA 3RWQA 3I5NA 2OLCA 3JY0A 5CU4A 2V7OA 1WCCA 3L8SA 3COMA 2UW0A 3NUNA 4BTJA 2XNPA 1U4DA 4EHEA 2F2UA 3QBNA 4R3CA 4DG3E 2ZM4A 4LG4A 3B2WA 2XIKA 4CCUA 5IQEA 4ALUA 1M2QA 4HVIA 2PZPA 4KKHA 3EKNA 5L3AA 4F7LA 3EYHA 2C1AA 3CIKA 2WTIA 3F3TA 5K9IA 1RW8A 1PYEA 5E8VA 3H4JA 3U6HA 4AT4A 2XYNA 5A3XA 3LFFA 5HGIA 2BILB 3JXWA 5DNRA 1V0OA 5C01A 4APPA 5I5ZA 2O63A 2WTWA 3EMGA 2OU7A 2R3IA 3VUTA 4DEBA 2J9MA 1Y8GA 5J9YA 5L2TA 2HOGA 4CZTA 3NZ0A 3A61A 3DCVA 3HLLA 3POZA 2B9HA 2XNMA 4ZLYA 4F9WA 3C5UA 5DPVA 3QD4A 3PPKA 3DFAA 3ZBFA 2ZMCA 4PL5A 3HVCA 3VBTA 2HELA 2Y4IB 2G1TA 4ITIA 4KINA 1HCKA 2J6MA 1U5RA 2V5QA 3K2LA 3GOKA 5HBEA 1RE8A 2O0UA 1H24A 5GJFA 2QU5A 4DTAA 4GH2A 4BFMA 2ITNA 2I0HA 3EH9A 4FSMA 4L00A 3KMWA 4BIEA 4IFGA 3BE9A 4TYGA 3AD5A 4DLJA 4FEVA 3MFTA 1VEBA 2VTSA 3ATSA 4EOJA 4EC9A 3ZFYA 4RC4A 5E1EA 5C26A 4DE4A 4TYIA 1Q8ZA 3WF9A 1PMUA 4RX5A 2OK1A 5AR3A 4ZS4A 1UVRA 3HV6A 4NKAA 2UZDA 2XS0A 4FGBA 3ORTA 4YURA 5KKRC 4BGHA 4I94A 2R2PA 1Q8UA 4XG9A 3HUCA 3VS5A 3R7VA 4MH7A 5DR2A 5M56A 3A2CA 4QP2A 3LXNA 4UZHA 2RFSA 2A1AB 3DAEA 3PTGA 4JBOA 1H1WA 1NVRA 2C5NA 2KULA 2XRWA 1ZYDA 3Q4CA 3WF6A 4C34A 3RAKA 5KO1A 1YHVA 4CLJA 4ACDA 4JDIA 5A54A 4XP2A 4AZFA 4D2VA 2UZBA 4O7RA 3VUMA 2X8IA 4AW5A 4FV1A 3NYNA 4NW6A 2WTDA 3CJGA 5J87A 1KE9A 4B9DA 2PTKA 4A7CA 4CQEA 3LKMA 2W1FA 3GOPA 5IQBA 3W2PA 4JLCA 3E87A 5J5TA 2JDSA 3F5PA 4EUTA 4I5MA 4C3FA 3RK7A 1GIIA 4BDGA 4FV8A 1OPLA 1IR3A 2PVMA 1TQPA 1GIJA 2QC6A 1NA7A 5KHXA 4I5PA 2W4KA 2XNOA 1XKKA 3NGAA 3MYGA 4L7SA 5CSVA 4OBQA 1CTPE 3R21A 1OZ1A 4GUEA 4MXCA 3FAAA 3GCPA 4X3JA 3WF5A 2I0VA 2YEXA 2WOTA 3UNKA 3PJ3A 3QD2B 3W16A 4LV8A 4DCAA 3JYAA 1R39A 5T68A 3SGCA 2W4JA 3V8SA 1XH5A 4KKEA 2QKWB 3DDPA 4WG3A 5IA5A 4CYJA 2BKKA 2BRGA 2Y6OA 3FJQE 2QR7A 3LXKA 4B8LA 4QPMA 1JLUE 3GC7A 4IX3A 4XOZA 2F49A 3NUPA 4D9TA 4ZMFA 5LVOA 1KOBA 3MVJA 4OTHA 4BCHA 4DTBA 5LQFA 3DQXA 3BCEA 4GMYA 4GVAA 3BYVA 2I6LA 2X4FA 3GU8A 1GJOA 2OIBA 3M11A 4CTCA 3DTCA 3OOGA 2IZTA 3HX4A 2VO7A 4D28A 3PVWA 4ERWA 4BVUA 2VU3A 3GC8A 5LVLA 3F88A 4PMTA 2RIOA 2VGOA 3QC4A 5HKMA 1ZYJA 4OAVB 4OT6A 2WAJA 2WHBA 1B39A 4R7IA 3COKA 3KQ7A 4AFJA 4O7VA 3FI2A 2F7ZE 3R2BA 1QPEA 2PE2A 3DKGA 3DQWA 3ODYX 4ALWA 3TCPA 3C4XA 4ZIMA 4WRSA 2PZIA 1UNLA 3V8TA 4BKJA 4NTTA 3BWFA 4X3FC 5EYDA 1BI7A 4FG9A 2J50A 3I60A 3VW6A 2VNYA 3GCUA 4A4OA 3IDBA 4L45A 3UP2A 3R7EA 4FV0A 2Z2WA 4BWPA 2VO3A 4MD9E 2FA2A 4JNWA 3TNHA 3R9OA 4CFMA 2BIYA 3Q32A 3G6GA 3IW6A 3UYTA 4XV1A 2OZOA 3FZOA 5DRBA 4RVMA 3RPVA 4CRLA 3ACKA 4FEQA 4U5JA 3GU5A 4WG4A 5FM2A 4GFGA 3RK9A 4DFXE 1ZY4A 4BCKA 2UVZA 3ROCA 4YLKA 1WVWA 4I1ZA 3VS6A 1WZYA 2ZDTA 3OUKA 4S32A 3WI6A 1PKGA 3MB7A 3DS6A 4FL1A 4FSZA 2PK9A 2X7GA 4I21A 4TYHA 3WE4A 5L8LA 3C0GA 3BKBA 4JDKA 3VBVA 2CKEA 1A48A 4B6LA 4PTCA 2B9IA 3SXFA 5IDNA 4U97A 3FZSA 5FTOA 2FGIA 5HX8A 1K9AA 1OVEA 4GK2A 2HENA 1CSNA 3CXWA 4EYJA 3UIUA 3IOKA 2PE0A 4AW1A 4M67A 1P4OA 4FTAA 4IVAA 4BTMA 4J1RA 4FTIA 4PV0A 5HU9A 4RZVA 5K0XA 4QMXA 5DGZA 5CQWA 3R7GA 4O7ZA 3OC1A 3HDMA 2EXEA 3TNPC 4MCVA 3TZ7A 4GFOA 3UOHA 5A4TA 3ZFXA 4UMRA 1S9JA 4RX7A 5JRQA 4PNKA 2VWVA 3BBTB 1STCE 1M2RA 4FZAB 4UYAA 3CY3A 3QZHA 3ZSHA 2GU8A 2OW3A 4TT7A 3HMMA 4YLJA 5CEKA 2QODA 1F5QA 1M7NA 4NUSA 5CXZA 4GIHA 2B1PA 4BRXA 2EWAA 3MIYA 2ITQA 4D4SA 3K5VA 5DVRA 2CNUA 2E9PA 5AIKA 5JSMA 4ZMEA 1AQ1A 3I4BA 3A7IA 1Q4LA 4KS8A 4CD0A 4EWQA 3R30A 4XG8A 2P0CA 1ZXEA 4IIRA 4OGRA 5FUTA 2VTOA 4O7SA 4OTWA 4EBWA 4JG7A 4JOAA 3V01A 2YIYA 2CSNA 4OW8A 2GS2A 3MH1A 1G3NA 1OIQA 4BI0A 2ZV8A 2B53A 2PMOX 2VTMA 3MGYA 4Q5HA 3UC3A 3EJ1A 4XG7A 1BX6A 2XIRA 3UDBA 2R3FA 4O7LA 3K5UA 4G9RA 3MI9A 5HE3A 3FKLA 4X0MA 4WD5A 3UBDA 4CT2A 4PL3A 4FIGA 2QI8A
chains in the Genus database with same CATH superfamily
2XKCA 3Q52A 4IMYA 4V0GA 3NCGA 4C3PA 2C5YA 5ETCA 5BMMA 5E8UA 4RWKA 2VUWA 4QQJA 3E3BX 5DR9A 3FBVA 5FM3A 4UWCA 4YJRA 4BCPA 4O4DA 4DG2E 5LWNA 3CCNA 3HGKA 2ZJWA 4M66A 4JRNA 5TT7A 1ZLTA 1QL6A 2W1ZA 3BU5A 3AC1A 3DBEA 4W4WA 4AGDA 4EZ3A 3HMNA 1E1XA 4EZ5A 3D7ZA 2YDKA 3AGMA 4B7TA 3FKNA 5HVJA 2ZV7A 5AFVA 2WQBA 5AEPA 4M8TA 3R2YA 4FSQA 3WZJA 5B0XA 2JAVA 2PUUA 2W9ZB 2XM9A 3R8VA 3LCTA 2FSMX 3PVGA 2CKQA 2FYSA 2BPMA 3UG1A 1FQ1B 4M97A 5EM7A 5FTQA 3KULA 3OWKA 3MFUA 4L67A 3F2AA 1W0XC 2WMAA 4Y5QA 4XBRA 3UOKA 2XARA 3SG9A 4QTAA 3R7YA 3ZRKA 3T8OA 4O0VA 3TJCA 3CS9A 3TZMA 4YJUA 3VQHA 1KE8A 4N6YA 5A6OA 1JQHA 3UO6A 5HTIA 4ZK5A 1SNXA 2B52A 3O2MA 4C8BA 3U4WA 5IMEA 4CRSA 5GZ8A 5HLNA 2VTAA 1WBVA 3UMXA 3DLZA 1OGUA 2JAMA 2CGWA 4P5QA 4QMNA 4ZJJA 3O8TA 4V04A 3KMUA 4ZTLA 4UWBA 4NK9A 3DGKA 3VBQA 4EH5A 4H3QA 3E64A 3FYKX 5AMNA 2PYWA 4A9YA 3EQBA 3HNGA 4O38A 3ZRMA 3DOGA 4XP0A 2WEIA 3KKVA 4IZ5A 5AV2A 5L8JA 4DT8A 4UYNA 3QUDA 5A4CA 3R71A 4LOOA 1PXNA 3EFLA 3LXLA 1SZMA 2UZUE 2OJ9A 4B4LA 3HMIA 3I0OA 4I0RA 4RPVA 4EK4A 2C0TA 3OW4A 5AV0A 2C3JA 3C7QA 2ITYA 3PYYA 1XH4A 4U7ZA 3WYXA 5FDPA 3NIEA 4BIDA 3FZTA 4RSSA 4CXAA 4RGJA 3R9RA 2XMYA 2GHLA 1IA9A 3I1AA 3FMDA 3O71A 4O0RA 2ESMA 3NW7A 4DGNA 3F3UA 5K5XA 4PTGA 1UU8A 4JBVA 5LOHA 4DHFA 2ONLC 4IBMA 3PFYA 3K3IA 4QP8A 4CFXA 3TTIA 2XA4A 3DK3A 4FIIA 4UV0A 2X7OA 5M09A 3FYJX 1OKYA 3WILA 2BFYA 3A60A 3D5UA 3QGWA 3W2QA 3BEGA 5JGAA 4FMQA 1UU3A 4H1MA 3QCSA 5JFWA 2Z8CA 4CFFA 2PVHA 4O7TA 3BEAA 2WMSA 4NJDA 3ZYAA 5CI6A 4WNOA 5CEQA 3W8LA 2YM4A 5KBRA 3ALNA 1MUOA 3A8XA 4MD7E 1WBWA 3PY0A 5KMLA 5JFVA 3KU2A 4XX9A 3QAME 4P2KA 3S3IA 5HD4A 4B99A 4RIXA 4HNFA 1W84A 4BI2A 5GJGA 5FXRA 2J5FA 2IN6A 2BHEA 2VRXA 2XZSA 2XJ1A 4LGHA 1PHKA 5FG8A 5FXQA 1OL5A 2YM5A 3EN5A 3PPJA 3VHEA 3HECA 5C4LA 4O82A 4ORKA 4IX4A 4M69A 5AM7A 2ZB0A 3EN6A 3BQRA 1RQQA 3KXZA 4N70A 5E90A 2W1HA 4R7HA 2C6KA 2W96B 5AAFA 1OPJA 1JBPE 1Q8WA 3IG7A 4CSVA 1R3CA 2C1BA 3NUSA 4WIHA 2A98A 3ORXA 4L68A 4DFZE 5J1VA 3F82A 4IE9A 4D55A 1TZDA 1NVSA 3RP9A 4BCJA 4D4RA 3FI4A 1U59A 4G3FA 2XNBA 5DI1A 2Q0NA 2QG7A 2X9EA 5DEYA 1OUKA 3EL8A 2WMXA 3E88A 1ZOGA 2BFXA 3H0YA 2OIQA 5BVNA 2PU8A 4YO4A 4BJJB 2HZIA 2ZB1A 4QP1A 5AUWA 5B7VA 3UODA 3U54A 1LEWA 2QOIA 3BRBA 5HO8A 3ZLSA 2XALA 3PSDA 4QYEA 4ZTHA 3UDZA 3VUKA 4NL0A 1JSTA 1AGWA 4MTAA 4ZSJA 5HD7A 3NNXA 5DOSA 3MN3A 5IQIA 1W98A 3WIKA 3EB0A 4EKLA 3LFCA 3OXTA 5HLWA 3FHRA 3O8PA 3UOLA 4X3FB 2C3KA 4O0SA 2Y8OA 5LVMA 2OZAB 4NTSA 1IA8A 4E93A 5HORA 3D0EA 4HGTA 4FGRA 1OGYA 3UVPA 2XYUA 1ND4A 4A4XA 5JEBA 3BIZA 3OROA 2PZRA 3LM0A 4J96A 2J0MB 3R1QA 5BNJA 3KB7A 1FBNA 2W7XA 3LCOA 4G6NA 4I6HA 5KZIA 4DC2A 3GC9A 3PDTA 4RA4A 2ZM1A 3PG1A 2C30A 3FLYA 4U6RA 5BVFA 4QEBA 4KWPA 3ZHPC 4JBPA 5AADA 4A4LA 2CGUA 5AV1A 4ANBA 2FSTX 4O21A 1UU9A 3AKKA 1V0PA 3VUDA 4CFWA 2CCIA 5KBQA 4L7FA 3ETAA 4TYEA 3WYYA 1LUFA 4XRLA 5C27A 4EK3A 4UWYA 2R64A 5BVKA 1M52A 3EQHA 5KMJA 1T45A 2OKRA 4MNFA 3NW5A 3P9JA 1XQZA 5JZNA 4FR4A 3G2FA 3DKOA 1SVGA 4WUAA 4UMTA 3GNIB 4UX9A 4KIOA 1HCLA 4X3FA 4D2PA 3F5GA 3QQHA 4AWIA 4BB4A 3B2TA 3MSSA 5GZAA 2YIRA 5D12A 4EH6A 1M17A 1P2AA 3D9VA 4L6QA 2Z02A 3HA8A 4L3JA 4U41A 4BCMA 2FUMA 3P7BA 5CY3A 5HZNA 3O7LB 3AMAA 2FVDA 1H07A 3EFJA 4YSMA 4F7NA 2IVVA 1R1WA 3ULZA 4FKVA 4WA9A 3RMFA 4GJ3A 2YCFA 4FSWA 4U42A 3BLAA 2I7QA 2PMLX 4ANOA 3VIDA 3QGYA 4IAIA 4EHGA 1IG1A 4Y73A 3R8LA 3DJ5A 1PXPA 2HIWA 5HLPA 1XMLA 5EH0A 1FMOE 2PZYA 3R73A 5AX9A 3JVSA 1B6CB 2BRHA 2XKFA 3PUPA 4C35A 3LW0A 3KREA 3DKFA 3PRFA 4YP8A 2J90A 4E8AA 1OL6A 3QCYA 4G6OA 4IDVA 4JR3A 5ANIA 4ITJA 5DHJA 4A07A 3MPTA 2IVSA 2XCKA 5BYYA 1ZYLA 3U9NA 3UPXA 2XJ2A 5KNJA 4S30A 2HXLA 1PXKA 1URWA 1CKIA 4HPTE 5BYLA 1OPKA 2ITOA 2HYYA 3DU8A 2JLDA 2JIIA 3EWHA 4YJTA 2JIUA 4MYGA 4FV9A 3W32A 2QO9A 3EYGA 4FSUA 5BQ0A 2FSLX 5IPJA 1Y8YA 5JFXA 1JNKA 4C0TA 3R8UA 5J9ZA 4MQ2A 5AR8A 5DE2A 3GU7A 2CNVA 2WTKC 4D1ZA 3GCQA 1OKZA 1Q41A 1XBBA 4RIYA 5EK7A 4KIKA 2OXDA 1BLXA 3ZDIA 3PA3A 2W5HA 2EUFB 3LCSA 5HCXA 4ANSA 4F6WA 4LRKA 2XIYA 2EVAA 3GEQA 3E5AA 4IDTA 3ZFMA 4C57A 3VS1A 4EK6A 3ZM9A 5J5SA 4NYEA 1YVJA 2YHVA 4RJ6A 4C7TA 4DH7A 5AWMA 2PZ5A 5BVWA 4ZAUA 4HCUA 2WTJA 4RFMA 1QPCA 5HEZA 2NRYA 5TE0A 3ZO2A 3U51A 4NJ3A 4E20A 4W4VA 4WG5A 1W2CA 4I93A 2VO0A 3GCVA 2GNGA 1WAKA 3MJ2A 4FKLA 4XBUA 4UXLA 3ALOA 4FTTA 2PSQA 1OIRA 3KN5A 3PJ1A 1KV2A 4NIFB 5AP2A 2A19B 4GUBA 2A0CX 5AR2A 4KS7A 4KIPA 5CSHA 4BZNA 4PPBA 2PVYA 5I4NA 2YIWA 4AZSA 3NUUA 2X6EA 3LFSA 4QQCA 4UALA 4I0TA 4WUNA 4LM5A 4QDEA 4FX3A 2FSOX 4FV6A 5CI7A 3V5JA 2CN8A 5EKNA 3TDWA 4FYOA 3SC1A 3IW4A 3RAHA 3UVQA 5IQCA 3CTHA 2H8HA 3QX4A 2C3IB 2YM7A 5L2WA 3ORLA 4AAYA 3EN9A 5DT0A 4CLIA 3NRMA 4LMUA 4DEEA 3R28A 1BYGA 1ERKA 2VTRA 4PY1A 5A4LA 4NT4A 4CKIA 4IX5A 1J91A 4EQCA 2ETKA 3NMUF 4R77A 4F78A 3UGCA 5CNNA 4XG4A 3V5PA 3LJ2A 4J99A 2X0GA 4EEVA 5JT2A 5EI6A 4FK3A 5HNGA 1KE7A 3F5XA 4EOPA 2XNEA 2AC3A 3G51A 2HY0A 4FSYA 4BHZA 1OIYA 4MXYA 1R0PA 4WNMA 5I9YA 4G6LA 2C6EA 1NXKA 4IACA 3TN8A 4GV1A 5JK3A 1ZOHA 2WO6A 4HYIA 3UDSA 2C69A 2OXYA 4FT0A 3PY1A 4EOQA 4BBMA 3I81A 4G5JA 2XNGA 2VTQA 2XRUA 1LP4A 3MTLA 4YZCA 4J7BA 4MF0A 5DG5A 4EOOA 2UW3A 3Q96A 4HGLA 3ZCLA 1CMKE 2RF9A 3PRIA 4DH8A 3UVRA 4D1SA 4F4PA 3NUAA 1Y6AA 2ZAZA 4M68A 3TTJA 4BDKA 3BLHA 3QCXA 4FT5A 5L2IA 3CQUA 2EB3A 3V51A 3TM0A 3UJGA 1WBTA 2QNJA 4BCGA 3FE3A 3BI6A 3N4UA 4AG8A 4PMSA 5HTCA 3FZ1A 3H9OA 5JRSA 3DA6A 1H0VA 3O7LD 3SDJA 4YUQA 2NNWB 5J95A 1YKRA 5HCYA 3UYSA 5C9CA 3SLSA 2IVUA 5E8XA 4GKHA 4DYMA 4GSBA 3WZDA 2WQOA 2QOCA 4Y95A 2YZLA 3CR0A 4NZWB 4I6FA 2PMNX 5AV3A 2NYAA 3TKHA 4D0XA 3NAYA 5CSPA 1JSVA 3I6WA 1Q24A 2X81A 4P4CA 4OBPA 4RIOA 4E6AA 4IEBA 2R3HA 4EQMA 4QMQA 5JFSA 2RFDA 4ASDA 3I6UA 4TKSA 2GNFA 5D10A 4ARKA 4AXCA 4L53A 1URCA 2GNIA 2QLUA 4BTKA 3N4TA 1F0QA 2QLQA 4MK0A 4G16A 4X6RA 3EQDA 4QMYA 4U0IA 1E1VA 5M4CA 1J7IA 3FKOA 5L2SA 4TWPA 5EW8A 3BGPA 4QMTA 4EJNA 2GFSA 2Z7LA 2ONLA 4C59A 4H39A 3SRVB 5A46A 4QRCA 4JXFA 3WIGA 2RFNA 2F7EE 4O0YA 4WSYA 3EZVA 3FY2A 3H0ZA 2RSVA 4P5ZA 4BF2A 3IPHA 4QO9A 4D58A 4QP3A 3OF0A 4ZSLA 4W8EA 1IASA 3HRBA 2BMCA 2XK4A 3IONA 4Y72A 3R6XA 3FC2A 2A27A 3QRIA 4L43A 4BTFA 5T6KA 4D0WA 3NW6A 3HV4A 3Q9ZA 1FVVA 4PUZA 4F64A 3ANQA 4ZY4A 3HV7A 1DAWA 1F3MC 2NPQA 3RM7A 3S4QA 4CFUA 4NFMA 4DBNA 3HAVA 4IM2A 1OECA 2XK8A 4LRMA 3BU6A 3HRFA 3RCJA 2ITTA 4ZLOA 4PX6A 5BYZA 1VJYA 2YISA 4F6UA 4APCA 2R3OA 3C1XA 2YN8A 2XK3A 3BV2A 4RVKA 4XS2A 5HBHA 4AOJA 5HI2A 1XH6A 3RALA 2YM8A 4WNKA 4O7NA 3KL8A 4RIWA 3SRVA 3RPSA 4AOTA 3VO3A 2WB8A 3FMNA 3MPMA 2X2MA 4HVHA 2F2CB 3ZEWA 3AC8A 3BX5A 5CEOA 5IA4A 3CE3A 3W55A 2WU7A 4X6QC 1OKWA 3DB6A 3GGFA 1ZMVA 4JVGA 2XVDA 2XKDA 3FUPA 3QD0A 4LMNA 5HG8A 1H08A 4MXXA 2P55A 2JDRA 3ULIA 4TTHB 5LWMA 2JD5A 3KRRA 4FKWA 4AW0A 4CQGA 3JVRA 5EYMA 3AQVA 4RMZA 3P79A 3ZRLA 2X4ZA 5ICPA 4JMQA 3WZEA 3KXMA 4QMZA 1AD5A 1O6LA 4WBOA 4F63A 1G8AA 3F2NA 4U9AA 4FTCA 3E7OA 3IGGA 3FPQA 4ACMA 3FMJA 4I20A 1U5QA 4YZMA 2GMXA 5LMBA 4FEXA 3BL9A 1P14A 4HYUA 4MKCA 3QFVA 5FEQA 3ZO3A 3VQUA 1MP8A 4FVRA 3MPAA 3W18A 4D1XA 4YMJA 1H1SA 3AMYA 4D2TA 5D7AA 2VAGA 5DYJA 3AG9A 1YOLA 4QP7A 3BHVA 3PXZA 4FTQA 4DGGA 4FVPA 4IVDA 1IAHA 1Y6BA 4GT4A 2ITWA 3BHHA 2IW6A 4RVTA 3DJ7A 2Y9QA 4G17A 2OFUA 3SA0A 4GT3A 4D5HA 2GNLA 1J7UA 2BAJA 4U43A 1QPJA 4TYHB 3KVXA 3PZEA 5M4FA 2W17A 3UO4A 4GYIA 4C38A 1OI9A 3W8QA 2CPKE 2BAKA 2VD5A 2VNWA 5CF6A 5GIOE 5J9LA 4ZOGA 3UIXA 4OT5A 2W1EA 2B0QA 4QNAA 4QTCA 2GTMA 3BYUA 3NR9A 4QYYA 1YXSA 4FICA 4AA4A 3QF9A 4FKOA 4MBIA 4QOXA 3TWJA 5CF5A 3Q9WA 3L8PA 1UKHA 3QU0A 4JQ7A 5IA0A 1XHAA 3ZMMA 5K4JA 4BWXA 5F4NA 3LMIA 4FTNA 3RPOA 5FWKK 4LGDA 5CU3A 5A6NA 1GZOA 1GNGA 3ZC6A 3S1HA 2X7FA 5EG3A 4QTDA 2VWYA 3QX2A 4TWOA 4FG8A 1W7HA 3PVBA 3GUBA 4N0SA 2C6LA 2ZV2A 4WO5A 5IH4A 3MFRA 4X7QA 3F7WA 3ID6C 1H01A 5FXSA 3FLSA 3GI3A 5AUYA 3C4WA 4A9TA 4TL0A 2GTNA 3O8UA 2F4JA 2BHHA 4YTFA 3KN6A 3PIYA 3O51A 2HCKA 4X2FA 4FSNA 3ZLXA 3WF7A 4O81A 4MQ1A 4QMPA 4AACA 4YGAA 5I3RA 2X39A 3CPCA 4O0UA 3L1SA 2R3JA 4H58A 5DT3A 3RAWA 4PDYA 2WZJA 3EQCA 4ASXA 4BDAA 3R9NA 4AU8A 1MQBA 4X2NA 5JZJA 4BZDA 3OBGA 4M0ZA 2IEWA 3LLTA 1W83A 2J51A 4QPAA 3ZUUA 4OTFA 3DBCA 4AP7A 4R7BA 3QWKA 3G15A 4HVGA 4F0GA 5HHWA 3FWQA 5IQGA 3TKUA 1FOTA 5J7BA 4N57A 4ZSEA 3RHXA 1VYWA 4XP3A 4JG8A 2ITXA 5BUEA 3FMLA 4V01A 2QOLA 2YAAA 3QRUA 4IB3A 3ACJA 2Q0BA 4IJPA 1OUYA 4RVLA 3HRCA 5EM5A 1ZARA 4O1OA 3NNWA 2I1MA 1UNGA 2OICA 3PJCA 5E8SA 3RVGA 3SHEA 3S00A 2CLQA 2VZ6A 5HBJA 4E73A 4V0GB 4KBCA 4ANMA 4FV7A 3V3VA 2CMWA 2LGCA 5M4IA 2R3RA 2OG8A 2ACXA 5CF4A 2DQ7X 2VX1A 4FG7A 5E1SA 4EL9A 3KF4A 3R8PA 2QKRA 4RA5A 1WVYA 5FQDC 4F7SA 4YC8A 5I9UA 1YI4A 3BYSA 5KMMA 3MIAA 2IZSA 1OIUA 5BUIA 5IQAA 3OCTA 4Z3VA 1JPAA 3QTZA 4BR3A 4OBOA 4BDDA 4LYNA 2DUVA 3IQ7A 2QOKA 3A7GA 4FNXA 4L9IA 4R8QA 5DWRA 3VUGA 2XBAA 5J7HA 5CALA 1SVHA 4W4YA 5FRIA 3Q6WA 3D14A 4IAFA 4OTDA 2O64A 4YHJA 3QRTA 3GP0A 1RJBA 3AC3A 3C4FA 1DI8A 5JH6A 5AP5A 4QMWA 1YDTE 5GHVA 5CVHA 3QQLA 5C03A 4C3RA 5IDPA 3PIZA 2R3LA 3E63A 4E6CA 3Q2MA 3HZTA 2H34A 1Y57A 4DEHA 3KULB 1YXTA 4NWMA 3VNTA 4QDVA 4MWIA 1YW2A 5CAPA 4BDJA 2B55A 5C4KA 3QTWA 1I09A 3C4CA 4BHNA 4U44A 3SW7A 2OO8X 3AGLA 4TPTA 4XV9A 5D11A 4CT1A 3W0MA 4CG9A 5IUIA 1CDKA 3G9NA 3C13A 3H10A 3OP5A 4E6DA 1Q97A 2C6IA 2GSFA 5D1JA 2CKPA 4C58A 3TIYA 3AC2A 3U87A 2F57A 3OVVA 2VV9A 4S2ZA 3MWUA 3VBYA 3C4ZA 3AKLA 1IRKA 4EHZA 3NEWA 4M13A 4AW2A 4WHZA 1ST0A 4LL5A 2C5VA 2OSCA 4GK3A 4D2RA 3I7BA 4XHKB 5HCZA 2C5XA 2JGZA 4PQNA 1H1RA 3Q60A 5GIPE 1WFCA 3OWJA 4BCIA 3MVLA 4MF1A 4J98A 3BELA 3D83A 4AZWA 2GQGA 3ZH8A 1R78A 2R3KA 1YWNA 2IZUA 4XV3A 4JDHA 4C62A 2EXMA 2HW7A 3D7TA 3LJ1A 3RPYA 3BL7A 4EH4A 3FXXA 4G3EA 4I92A 3BGZA 3KF7A 3EN7A 3L8XA 3QTSA 1UNHA 4FKIA 3BZ3A 4FV4A 3KCKA 4WKQA 5CSWA 5EOLA 4AA0A 3RK5A 4IC7A 3TI1A 4FTJA 3BQCA 3RPRA 2P4IA 3IECA 3V5LA 1DAYA 3LQ5A 4EBVA 3JUHA 3QCQA 2RL5A 2XM8A 4FNWA 5HVYA 3QZFA 2E9UA 3DV3A 1KOAA 3EQIA 3OOMA 4KKGA 4O0XA 3QQJA 2ITVA 4C33A 3DPKA 4DGOA 2JBOA 2BIKB 3P5KA 4YZ9A 3LMHA 3DXQA 4JR7A 2X9FA 4CEGA 2W9FB 2UZEA 3BWJA 3F3WA 4AN2A 4CVAA 3G5DA 2W99B 4IB5A 4M12A 4C2VA 3CJFA 3RHKA 1OKVA 3OG7A 5GINE 4K33A 5KKRB 2VTIA 1QCFA 4UMQA 4D5KA 5TO8A 5JQ5A 5HICA 3CGFA 3EL7A 1PMNA 4AGUA 5M06A 4E5AX 1XJDA 4J53A 4OTPA 3RGFA 4RIXB 4E6QA 4E3CA 5IF1A 3TV7A 4AZTA 3FQSA 2GHGA 4KRCA 4U3YA 3LIJA 4K18A 5E7RA 5B2KA 5F9EA 4Z55A 4X2JA 4FL2A 3KRLA 4OR5A 3R9HA 3OTVA 3PWDA 3L9LA 4M69B 5AX3A 2R3GA 4AGWA 3M42A 2PVJA 4G3DA 2BTRA 4O4BB 4IAZA 4S33A 3G0EA 3SX9A 1W2DA 4FVQA 4MHAA 4PRJA 4X21A 5HE2A 2ETRA 3HL7A 4TNBA 4EOSA 4FYNA 5ACKA 3QXPA 3CSVA 1KE5A 4QP6A 4NM3A 1OB3A 5KZ0A 4JAJA 3OUNB 3BV3A 1G8SA 1MQ4A 2CDZA 3PXQA 2PWLA 3IDCA 4EH2A 4EOKA 4XLIA 3LFEA 4GIIA 1PF8A 2IWIA 2E2BA 4ZLZA 3QUPA 3PXYA 4KIQA 4AXEA 4BGGA 3R22A 4F9AA 5B2MA 3P7CA 2YLFA 1PXOA 3BGQA 5J1WA 4WNPA 5FEEA 2WMBA 2GFCA 1Q61A 3E92A 3CD8A 3ZSGA 3I7CA 3KGAA 4MEDA 1H8FA 1ST4A 3NX8A 3PA4A 2PUPA 3RZFA 1U54A 2CCHA 4O0TA 4MVFA 4QQ5A 4GU9A 1I44A 3HP5A 2V7AA 4L01A 3EFKA 5HESA 3FEGA 1W82A 3WARA 4E7WA 2R7BA 4GEOA 2OJGA 5AUXA 4YJQA 2R9SA 4IADA 4CMTA 2VTHA 3VJOA 3LCKA 2VWZA 4K2RA 4GW8A 5EM6A 3T9IA 5G6VA 2PUNA 2OH4A 3I79A 3QL8A 4FC0A 3EN4A 4BL1A 4LOPA 3BHTA 2AUHA 2C4GA 3H9RA 4IW0A 3V8WA 4CZUA 5D7VA 4DEAA 4FF8A 4CMUA 4FEUA 1MRVA 4BBFA 3QQGA 1ZYSA 2Y4IC 4FV5A 5ACBC 3RKBA 3PXRA 5EKOA 3TUDA 3LMGA 4DAWA 5DMZA 4H05A 2O8YA 4IFCA 3VUHA 3OTUA 1IAJA 2WEVA 3BHYA 3EIDA 1CKPA 3QQKA 1SNUA 1YI6A 1YOJA 4YO6A 4QYFA 4ZEGA 1UV5A 3VWAA 3DK6A 3GFEA 4UEUA 4F0IA 2JDTA 2W0JA 3S2PA 5C8NA 4K6ZA 4DDIA 2WFYA 4MNEA 3W2SA 4EH9A 4S34A 5CNOA 1XH7A 3Q4UA 3A7HA 4FIEA 3AT2A 3CQWA 3WZUA 3BU3A 4G5PA 2XKEA 4YC6A 4TYJA 3LFQA 2CGVA 5HG5A 3UC4A 2AC5A 4LUDA 5CF8A 3EQRA 3HDNA 3ZZWA 4NU1A 4O86A 4YC3A 4ANQA 1UA2A 3VS0A 4ZSAA 4HNIA 2JIVA 2JC6A 4KSPA 3LHJA 4BDBA 1PJKA 3GQIA 4WOVA 3MDYA 5CEIA 1Q8TA 3B8RA 4B0GA 2F9GA 4BC6A 5LCJA 3Q4ZA 2C6OA 4M0YA 5ETFA 2HZ0A 1YXUA 3U55A 4BN1A 5TOZA 4IXPA 4RC2A 2BCJA 1YHWA 3AC5A 4L44A 2GDOA 4OAUC 3N4VA 4Q5EA 4LQMA 4U81A 4DFNA 2FO0A 4YJSA 4YJPA 3VS3A 3W0RA 1NVQA 3PIXA 4O2PA 4RWJA 5EQYA 4ACHA 3MY5A 3D2IA 3MFSA 3QYZA 5CEPA 4FSRA 3A99A 4F9BA 5IZFA 3NFFB 4I41A 2RFEA 3QKKA 2QOBA 3NNUA 4USFA 1WMKA 2WMWA 4ZZMA 4YTIA 2R3QA 4W8DA 3ZEPA 5DBXA 3V6SA 3ANRA 3O17A 2ITZA 2VWIA 2WIPA 1OL1A 1Q62A 3BHUA 3D5VA 3M1SA 4FOBA 4DEGA 5IH6A 3AD4A 4FTOA 4RIYB 5CENA 5KUPA 3PVUA 4KIKB 2JITA 3ZU7A 4AF3A 3TL8A 5HE1A 3AKJA 3NDMA 4I3ZA 1Q99A 3ITZA 2XIZA 3FI8A 4AXDA 1WBSA 4H1JA 4IVCA 5C8KA 1OL7A 3MS9A 5AAEA 3E8CA 1YQJA 3BLQA 3IW5A 3ORZA 5LVNA 4FJVA 2R0UA 5HO7A 1GZNA 2A2AA 3DLSA 4QQTA 1HOWA 4O22A 4IZ7A 3W0QA 1GIHA 3OEFX 3COHA 3MTFA 4F1TA 2IJMA 2QQ7A 3FY0A 3HAMA 5F95A 3BYOA 1NW1A 3DFCB 4FTKA 4FV2A 3W1FA 3BPRA 3DDQA 4ZTRA 2E9OA 5M07A 4FIFA 3FXWA 4IM0A 4FZFB 3TEIA 5AP4A 1SM2A 4OTGA 5BVDA 4WT6A 2C6TA 3F3ZA 4NFNA 4OTRA 4QMOA 3NSZA 3FL5A 3TDVA 2PY3A 2GQSA 1LR4A 3AD6A 3TV4A 4MXZA 5K4IA 3QA8A 5EHOA 2J5EA 4PDPA 2Y0AA 3PSCA 3UO5A 3KIOC 2FB8A 2IPXA 3COIA 4LFIA 3R04A 3VC4A 2VO6A 3BLRA 2OGVA 3E62A 1LPUA 3QKLA 3R1SA 2AEGA 2R0IA 2Y4PA 4CNHA 4D4YA 3V5QA 4HZRA 4EYMA 5FTGA 2X0QA 5CU2A 4AGCA 5KX8A 4EH8A 2CNQA 5I9VA 2WQNA 3OXIA 4FTMA 4GG7A 4XYFA 4EI4A 5AR7A 3OWPA 5CYIA 2QHNA 4K9YA 2WOUA 4LI5A 4QMUA 4PWNA 3FXZA 4OTIA 1H4LA 2BRNA 3FSKA 3O96A 3GBZA 3RBWA 3QTQA 3L9NA 3POOA 2R5TA 2NO3A 4DINA 4ERKA 3GCSA 4J71A 3QRJA 5A4EA 4ZSGA 5EDPA 4IX6A 5CU0A 4F65A 2GPHA 4GYGA 4OUCA 4RX8A 2NP8A 1Q3DA 5FP6A 3ELJA 3Q53A 4TZRA 3IOPA 4D2WA 5IA2A 3C4EA 5HNIX 2G2HA 4J95A 4W4XA 2XF0A 5DLSA 2YDJA 4FV3A 1L3RE 1GZKA 1BL7A 3AOXA 3Q04A 4JJRA 4CMOA 1DI9A 1P4FA 1WBPA 4EC8A 4R78A 5AR5A 3RWPA 2HWOA 3QZGA 1YHSA 4O4FA 1SYKA 3CLYA 5EM8A 5AP3A 1A06A 4DTKA 4QTEA 3W2CA 3KA0A 2G9XA 3A7JA 3CKWA 3VS7A 4RC3A 4YLLA 4JQEA 3S95A 3QA0A 2XBJA 3VVHA 3R63A 2VX3A 3ZS5A 5KMKA 1JSUA 4B8MA 5EYKA 5FGKA 4FZDB 4OTQA 2QO2A 1ZMWA 4DGLC 3HV5A 4FUYA 3E8EA 3LLAA 5F20A 5BVEA 4DCEA 4UY9A 4QTBA 1WBOA 4R1VA 4GS6A 5EHYA 1RDQE 4RT7A 3DZOA 3W10A 4UZDA 2JEDA 5JKGA 2HXQA 3U9CA 3QLFA 4FKQA 2X2LA 4GJ2A 2AYPA 5AUZA 5HTBA 4RJ8A 4E4LA 5AM6A 4FSTA 4KBKA