5I9ZA

Crystal structure of ephrin a2 (epha2) receptor protein kinase with danusertib (pha739358)
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
293
structure length
273
Chain Sequence
b'FTTEIHPSCVTRQKVIGAGGEVYKGMLKTKEVPVAIKTLKAGYTEKQRVDFLGEAGIMGQFSHHNIIRLEGVISKYKPMMIITEYMENGALDKFLREKDGEFSVLQLVGMLRGIAAGMKYLANMNYVHRDLAARNILVNSNLVCKVSDFGLSRVLIPIRWTAPEAISYRKFTSASDVWSFGIVMWEVMTYGERPYWELSNHEVMKAINDGFRLPTPMDCPSAIYQLMMQCWQQERARRPKFADIVSILDKLIRAPDSLKTLADFDPRVSIRLP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Ephrin type-A receptor 2
publication title Chemical Proteomics and Structural Biology Define EPHA2 Inhibition by Clinical Kinase Drugs.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 82
structure length 273
sequence length 293
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2016-02-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 5i9zA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 5i9zA01
1ZYDA 4EBVA 3NNXA 2C69A 4J95A 4YR8A 3A4OX 2RG6A 3FMMA 4AWIA 4XV3A 3GCUA 3C4EA 4UMRA 1ZOEA 4M0YA 2GQSA 2I1MA 3FZ1A 4UALA 3PA3A 1O9UA 2WIHA 2DYLA 3QTZA 3KMUA 1YRPA 4EC9A 3ZO1A 2AC5A 3H9OA 2R3MA 2AUHA 4GK2A 5CNNA 4MK0A 5CX9A 3FPQA 4NH1A 5FRIA 2X9FA 4GSBA 4AX8A 4BHNA 4DA5A 5J1WA 1IR3A 4GKIA 3ZYAA 2XJ2A 2FUMA 3L8SA 3PVUA 4FSMA 4UWCA 2V7OA 1IA8A 4GL9A 1CKPA 3REPA 3ZEPA 5CQUA 2XUUA 5IA2A 1H0WA 4DHFA 3FL4A 5HLPA 4N6YA 3ZUUA 4U45A 5DMZA 2HW7A 3ZONA 1ZMVA 4EEVA 4YUQA 2IZTA 3QAME 2BZIB 3ZO4A 2YZAA 1ZAOA 3AQVA 4YHJA 3CIKA 4TRLA 3KRWA 4U3YA 1WBSA 3UO6A 4FOCA 2W4OA 3QTWA 4IJ9A 4LUDA 4C4EA 5JEBA 5HD7A 3V5QA 4U3ZA 1GJOA 2VTLA 4RWKA 5M09A 4E4LA 1RE8A 3LCOA 2OK1A 3RPVA 4EWQA 3RAKA 4EH7A 3VN9A 4KUJA 3PA5A 3OCSA 1Y6BA 1JKSA 2W96B 3D2IA 1H1QA 3EH9A 3N4VA 2BRBA 3Q4UA 4EKKA 4BRXA 4CEGA 3BI6A 3PP0A 1OL2A 4FVPA 4O1OA 4E5AX 1QPJA 3UTOA 2X4ZA 3PJ1A 4FV4A 4L44A 4OUCA 1E1XA 4ZZMA 2QHNA 2BRHA 4X2FA 4ZS0A 4XOYA 5IQIA 1BYGA 2JBPA 2J9MA 1KE7A 5AIKA 3PSCA 2R3IA 4D55A 2W06A 4IVAA 5KX8A 3QHWA 5CSHA 4IM2A 4TWOA 4X7QA 3ANRA 1JAMA 4AFJA 3VF8A 4FKIA 4KA3A 4O6EA 2WMUA 4A7CA 3MY1A 2GFSA 4DTKA 5KHWA 1CMKE 3NW7A 5HNIX 4CCUA 4FZ7A 1PKGA 5IQGA 3NNWA 1BKXA 5I3OA 3Q2MA 3PPKA 3ROYA 4I41A 4CFMA 3OCBA 4LYNA 4A4LA 1ZXEA 3K5VA 2PPQA 3MY5A 1GIJA 4RGJA 3FJQE 3F5UA 4PDSA 4DGNA 4YJSA 4YJTA 1ZYSA 4LGGA 2PE1A 3EFKA 3MB7A 4KBAA 3DGKA 4TYHA 1WVXA 5M44A 3RAHA 3DK3A 3F7ZA 2XK8A 4TWNA 4ZP5A 5EQYA 3QCXA 5CALA 3QRUA 1DI9A 1OL7A 4XP0A 4AT3A 2Y7JA 4EOOA 4BCNA 3QZHA 1PYEA 2J5EA 2OH0E 4NKSA 3SDJA 2VTAA 2QC6A 3UG2A 4XNEA 2GHGA 1HCKA 3UIMA 2O8YA 3WZEA 2GS6A 4BYJA 2CN8A 1YKRA 2VTMA 4CT2A 5HESA 2B9FA 4FSRA 4EOPA 3KA0A 1NT2A 2YM6A 4JX3A 4W4YA 5TOZA 1M7NA 3RKBA 1R39A 1LPUA 4EHVA 4Q2AA 4WRGA 3GU7A 2BIKB 1E9HA 4ZSEA 3I1AA 2UZWE 3LJ0A 4KAOA 2G1TA 3HV7A 2Y4PA 3HV4A 4IAZA 5HCZA 5A6OA 5CAUA 1KUTA 5C4KA 4GUBA 1BI7A 4CVAA 2JAVA 5E8UA 4FTJA 4KINA 5IDPA 1J7IA 3PZHA 3ZM9A 4NL0A 4AGUA 4H1MA 5HE1A 3ROCA 2JIIA 3GU8A 3TJDA 2Q83A 4C36A 4B4LA 4JBQA 1VZOA 3IO7A 1P2AA 3QFVA 4CFUA 3F82A 2YJSA 3V3VA 3RK7A 4ANQA 3L8XA 4F9BA 3WBLA 3V8WA 3OT8A 1H1RA 1ZWSA 4FIEA 3FMKA 4AP7A 1YDTE 2I0EA 2OU7A 3AC8A 3K2LA 3NEWA 4LG4A 3V5WA 2VO3A 4PL3A 3D15A 4FKGA 4MX9A 2XKDA 5CS6A 3UBDA 5IQHA 3HUBA 3F3ZA 5H8BA 4IWOA 4WG4A 3VS7A 4FMQA 3LQ3A 4IM0A 4E4XA 5CXZA 5A3XA 3N4UA 4RPVA 4TPTA 2B55A 4CFNA 5M4CA 4B99A 1PY5A 3MB6A 3R8LA 3WZDA 4AOJA 2R3FA 3TI1A 4EQMA 5DR9A 5HBEA 2EVAA 3OD6X 4HYHA 2CLXA 3IQ7A 2VTPA 2WMAA 3VBTA 4EORA 4HGSA 3K54A 5AUTA 3ZLXA 4FZDB 4TW9A 5CSWA 1W8CA 5HTCA 3N51A 1W98A 3HEGA 3VAPA 4U40A 2YA9A 5CEPA 3P08A 3BV2A 5AP1A 4F64A 3QQUA 4XX9A 1Q41A 5JGDA 3ZXZA 2XRWA 2VWYA 2YDKA 4TYHB 4PP9A 4Y73A 2WHBA 3NYNA 2QG5A 4KRDA 2R4BA 3BEGA 2O0UA 4QPMA 2O63A 4EOSA 5IISA 3LFBA 1URWA 5FWKK 3PYYA 2GNFA 2VWUA 4JVGA 3RPOA 4LOPA 4FF8A 4YO4A 4C3RA 3FLZA 3L8PA 5BUEA 4G5PA 4E3CA 4EZ7A 4BI2A 3GENA 4GV1A 5T6KA 4EWHA 4PTGA 4QNYA 2XYNA 4DAWA 4RJ8A 3UE4A 3JVSA 3MV5A 3H9FA 3MYGA 3U4UA 1OMWA 2QLQA 5LQFA 3U54A 5TE0A 4CRLA 4BCKA 5H8EA 3HP2A 4PL4A 3TUCA 2C1AA 4QYGA 4PF4A 3ZTXA 2OJ9A 3DFCB 2RFEA 4RC4A 5HCYA 3LKMA 1H26A 2O5KA 2UZLA 3D14A 3TNIA 2OKRA 3NCZA 3FI3A 4P5ZA 4ZS4A 2V0DA 4CG9A 3PY1A 2WTDA 3B8RA 3EQBA 4UV0A 3KU2A 2XIZA 2VO0A 4Y95A 4FYOA 3R9HA 4X2KA 1WAKA 2XKFA 3CJGA 2OIQA 5AR2A 5AV1A 5FBNC 1YXXA 3W2RA 4J98A 4BI1A 5L6WL 4FSNA 4QMNA 1Q8TA 2ACXA 3PWDA 2BPMA 4PTCA 3ZZEA 5KZ0A 5EOLA 1Z9XA 3TNQB 3ORZA 4BIBA 4F0FA 1YHSA 3DDQA 2BFXA 4DH7A 4DFUA 1Y8YA 4WD5A 3DAJA 1M2QA 5AM7A 3ALOA 3LFDA 3C51A 3DS6A 3PP1A 4G6LA 4O96A 1XO2B 4Y85A 5HLWA 4WT6A 4EL9A 5ITAA 3Q52A 4AQCA 1HOWA 2XIKA 3PXZA 2V7AA 5IDNA 2VUWA 3W2SA 5E91A 1OKWA 3QYZA 3GNIB 3UZTA 5K5XA 1P4OA 4I22A 4Y8DA 4UY9A 1NVRA 4ASDA 4FL2A 4RVTA 4X3FA 2WKMA 4Y5HA 4E6DA 4I24A 5IPJA 2PVNA 1XKKA 4C35A 2XCHA 3Q3BA 1FMKA 2E9VA 3RM7A 2NRUA 4GK4A 4U42A 3ZBFA 5JK3A 3EOCA 3A7FA 3GI3A 4FIHA 3KF7A 3MESA 1XBBA 4ANSA 3WYXA 5HLNA 2BKKA 2WXVA 1DM2A 3DJ7A 2UW9A 3IDCA 4V04A 3P5KA 4GU6A 3TL8A 3O0GA 4EOJA 2XJ1A 4MXXA 3V5PA 4MD8E 3SRVA 5CAPA 3FMHA 4EQUA 2YLFA 3W18A 2BILB 5BVKA 5F4NA 3CE3A 3ETAA 3VS3A 5HBHA 4C2VA 4IQ6A 3DNDA 2VWIA 2ITVA 3HA8A 5F9EA 4G9CA 2ITPA 3AMAA 3QHRA 3NYOA 2W5AA 2JIVA 4JR7A 5DT3A 2C68A 3MFTA 4JDJA 3E8EA 4Q9SA 2VTNA 4QP9A 1P4FA 4ANNA 4D4RA 3TZ8A 3ZSHA 3FEGA 4KNBA 2XVDA 3BLQA 4JX7A 4RWJA 3W8QA 3CGOA 2UZBA 4DEEA 4YNOA 5ANGA 4L52A 4XJ0A 3MA3A 5A4CA 3QX4A 4FIFA 2W9ZB 1S9IA 4U41A 1VEBA 4GFOA 3O7LB 3QWJA 4FT9A 2HY81 2R7IA 4M68A 3WIGA 3FE3A 1REJA 5ANEA 4JDIA 3DLZA 4FEQA 3SXRA 4LUEA 3RI1A 4C58A 4IMYA 3E87A 3Q5IA 3G15A 3MH0A 2BR1A 4AOTA 4HYIA 5ETAA 1STCE 2W4JA 5LVOA 1YWRA 2QOLA 2RF9A 3O8PA 4O7ZA 4I5MA 2C6DA 3R7OA 3QQGA 4FSWA 3OY1A 4HGEA 3DXQA 3KQ7A 4HGLA 4ITJA 3OW3A 2YM5A 4PMTA 1FGIA 3CD8A 5A54A 2Q0NA 1WZYA 4BGGA 4NJDA 5IU2A 5JZNA 2CKEA 1J3HA 1Q8WA 4F6UA 2UZVA 2WU6A 1I09A 4G16A 4X3FC 1DAYA 3OC1A 4RWLA 3UC3A 4A9SA 1FOTA 3LM0A 3JY0A 1Q8YA 4YHTA 4OAUC 1F3MC 5IQEA 1GZKA 2J0MB 3B2TA 4G6NA 4JIAA 3ACKA 5EOBA 4ANLA 3S2PA 4DG0E 4X3FB 5HHWA 1NW1A 4BCOA 4MF0A 1F0QA 4FKQA 3S3IA 4C7TA 3VHEA 2W1EA 1XJDA 3Q4ZA 2WMSA 3RK5A 5IH6A 3KMMA 4FG9A 2B9HA 2HK5A 4WIHA 2WB8A 5AWMA 2AYPA 2NNWB 3D94A 2W17A 3KGAA 3NR9A 2PE2A 3FC2A 3BLRA 5CZHA 3UQFA 1H28A 3PXQA 4RFMA 3THBA 3U6IA 4BTFA 2C6EA 5GNKA 3ACJA 3CBLA 1U59A 3BQRA 2ONLC 3A62A 4PPAA 4FBXA 3RZBA 4AOIA 3AGMA 5AUUA 5J79A 4A9RA 4XRLA 3O8UA 3SRVB 5HZNA 2CKQA 2ZJWA 3LIJA 3E63A 4BCMA 3L9NA 1U46A 4E73A 3ZDUA 3BYOA 2HZ0A 2JGZA 3QCQA 4O0XA 4EZ5A 5J9ZA 3QC9A 5M57A 4CYJA 2CNQA 2HOGA 2VTIA 4ANBA 3FKNA 4Z3VA 4CXAA 4MXYA 4E1ZA 2XZSA 4M84A 5DG5A 4ACGA 2IZSA 3PY0A 5LCKA 2F7ZE 4FZFB 5D41A 3HZTA 4M0ZA 4NW6A 5I5ZA 3TUDA 2W5HA 2YIWA 3A7GA 4D58A 4XP3A 4C4JA 2X1NA 1ZARA 3PRIA 3A8WA 4IXPA 4EYJA 4YMJA 3F3UA 5CF4A 4BIEA 3DA6A 5HD4A 4QNAA 1JBPE 3W2PA 2JC6A 3PPZA 5DPVA 2QQ7A 5HIBA 2FGIA 4GKHA 5AR5A 3I7BA 5KMNA 4O6LA 1E1VA 2C3JA 2C5YA 3ATTA 4CFWA 4O7VA 4C0TA 4NWMA 4O0SA 5AV4A 4FZAB 3KXHA 3NYVA 3TWJA 3UP7A 3TEIA 3ZDIA 5IUGA 5IA0A 2RGPA 3VW6A 4FA2A 1MP8A 3PJ3A 2VTHA 3UIXA 4NTSA 5I9WA 2XJ0A 4RZVA 3LCKA 5DOSA 2Y6OA 1WCCA 1NA7A 4NM3A 1JNKA 2VWXA 2J4ZA 5J87A 1PYXA 2ERZE 5HVJA 5M07A 4H58A 2XK6A 2SRCA 3R7GA 4FSYA 4KBCA 4MD7E 4QMUA 4M12A 3VS5A 3QRTA 5AP6A 4RA5A 4O7WA 3TV6A 2W1IA 2YIRA 3LCDA 3R2YA 5BVNA 3IW4A 3F66A 4WUAA 5EFQA 3V6RA 3LCSA 3HUCA 2HELA 4DFXE 3DV3A 1YDRE 5KO1A 5M4IA 2W1CA 5HTIA 3ZUVA 1PRYA 1JSVA 3GC9A 3IKAA 5LVMA 3QQKA 3LJ1A 2X6DA 4FG7A 3EL7A 3VUMA 2QVSE 4FKRA 1B6CB 4WNPA 3BE9A 3I0QA 2XCKA 4PUZA 3ZLYA 2DQ7X 2WTJA 3EQGA 5HO8A 1R0EA 1UU9A 4RLKA 3F2RA 5LMKC 3LMHA 4CT1A 2FVDA 5KBRA 2ETMA 3LZBA 3G33A 4HZSA 4S33A 5DE2A 4FIJA 1PXJA 3QRKA 4TWPA 2YITA 4FIGA 5TO8A 4D2VA 4R1VA 3V8TA 3LFFA 4QP2A 3FZRA 1ZYCA 4RX8A 4FT5A 4FKLA 4XUFA 3DPKA 3DXNA 3G90X 1ZMUA 1OIQA 5JKGA 1GZNA 4PP7A 4QYYA 2IW8A 3II5A 3NWWA 4GEOA 2PUNA 1O6YA 4QPSA 4IX6A 3OUNB 4OBQA 4O38A 3KY2A 5BYZA 4D1XA 3PJ2A 4TYIA 3FMLA 2PVHA 2FSOX 4MBLA 3NRMA 3BWFA 2J0KA 3IW6A 4CTBA 3CR0A 3RHXA 3K3IA 3ZLWA 2UW3A 5K3YA 4U81A 3ZZWA 3D5UA 2GU8A 3KULA 3BGQA 4YP8A 2BALA 3KL8A 2WMBA 4KKHA 2WGJA 4A07A 2HAKA 1Y8GA 5BYLA 3CTHA 2WO6A 4FNXA 4K33A 4KWPA 3OROA 3KMWA 4L7SA 4IANA 5AFVA 1ZY5A 3F7WA 4J97A 4BI0A 5DIAA 3HLLA 5CU0A 1W0XC 2B0QA 3WILA 3C4XA 3WZJA 3OHTA 4FGBA 4Q5HA 2YM4A 3A8XA 5BVOA 1SNUA 4B9DA 3FKLA 5FLFA 5I0BA 4ORKA 3DJ6A 4A06A 3C4ZA 5M4UA 3VQUA 5GHVA 4B0GA 4CFFA 5IF1A 3WF7A 1Q97A 4RQKA 4HCVA 5T3QA 3DKGA 1WBPA 4FTIA 2IVUA 3TTJA 1XH9A 4DGGA 2XF0A 3W10A 4F65A 3LFNA 4L67A 3E93A 4D9TA 3DBEA 3FLQA 4I4FA 4IM3A 4P90A 5EHLA 4WO5A 4PDYA 4APPA 2OF4A 3L9LA 2R3JA 3LVPA 3PIXA 1H4LA 3IPHA 4FSTA 5IQAA 2VX0A 4L3PA 2YM7A 3Q60A 1H8FA 5GZAA 2QO7A 1FVRA 4GU9A 5CAQA 5K5NA 3L9PA 5IA4A 3F69A 3QTUA 4QPAA 1OL6A 5FUTA 4X0MA 4EHEA 2CHLA 4LRMA 4HNIA 3D83A 5EM8A 3NDMA 2G15A 4XP2A 3HRFA 4BC6A 3GCSA 2BAKA 5BX0A 4FV6A 4GW8A 3F2NA 3R0TA 4ALUA 5GIPE 2R3HA 4JNWA 3R1NA 5E7RA 3VUTA 1JSUA 3RCDA 1XH8A 4FKSA 4U5JA 2OIDA 1XWSA 2EXMA 5J8IA 3BCEA 3ENHA 3SQQA 2XS0A 4AFEA 3ORMA 3G5DA 3NAXA 3OW4A 4YLLA 3V01A 4ANOA 5HOAA 4FR4A 2XRUA 5JSMA 3UNKA 4FODA 4MH7A 5G6VA 3BYMA 3KVWA 4BKYA 1Q3DA 1YHVA 2WQOA 4RRVA 3UC4A 3IGGA 4EK5A 2C0OA 2F7EE 2CNVA 3F3VA 4NIFA 3M2WA 5BNJA 3GT8A 4IWDA 3GOPA 3U87A 1H01A 3IW5A 4KIQA 2UZEA 1XBCA 4HPTE 4RC3A 4LV8A 3ZMMA 2CSNA 1B38A 2XBAA 4MQ1A 3HV6A 4AG8A 5AA8A 4F0GA 4MXAA 1LUFA 5H2UA 4FV5A 2W1FA 2X81A 4FTOA 1ZZLA 5LWMA 3ZOSA 1JKLA 1FPUA 1G5SA 3KULB 2C5XA 5L2QA 4MXOA 2EXEA 3F3WA 3R00A 5AR4A 4DF3A 4FTCA 4G17A 4EOMA 3ORNA 3Q4CA 4D5KA 1YXSA 3OXIA 4BVUA 4FSQA 2XK4A 5JH6A 2VTOA 1UNHA 4I4EA 4FV9A 1KE6A 4FYNA 4PNKA 1M17A 3E5AA 3DB6A 1PMVA 4RMZA 4C4FA 4QO9A 3WE8A 4FEWA 3FXXA 2BMCA 4RT7A 3W2QA 4Y46A 3Q2JA 1A06A 3TTIA 5I9YA 1RDQE 2UUEA 1IAJA 4AS0A 3I4BA 3Q32A 5FTQA 2ERKA 4QYFA 4EH3A 4QYEA 4I20A 4RWIA 3EB0A 5IH4A 4CRSA 1ZRZA 1G3NA 1YOJA 4ZY5A 1WVYA 4PV0A 4IB0A 4EK4A 2OJIA 4FTMA 3RZFA 2XEZA 5KHXA 3DDPA 4ZTHA 2I40A 3ANQA 2OSCA 1M2RA 5DR2A 3ORLA 3VS2A 2Y8OA 1YXVA 5C01A 2PVJA 2W4KA 2QLUA 2C30A 3EKKA 3CEKA 1JKTA 3GCVA 3HL7A 3O71A 2HZ4A 5EW3A 4ACHA 5FQDC 2WMTA 1YQJA 5E8WA 5EKNA 2Y6MA 2Y9QA 3A60A 3KCFA 3P7AA 2ETRA 3BLHA 3PUPA 2QOIA 3VS6A 3KK8A 2ZV2A 2JEDA 4O27B 4A4XA 3HDMA 5D1JA 3ZRLA 1VJYA 4GT4A 5FTOA 4NZWB 3NW5A 4QP8A 5K9IA 3HX4A 4II5A 3I79A 3IK3A 1PMUA 5L8JA 4E4NA 3FV8A 3WF5A 3KF4A 1IRKA 2YWPA 4HZRA 4BZDA 3F88A 3FHIA 4IZ5A 2A1AB 4X2NA 5HO6A 4OLIA 3TZ7A 2C4GA 2A19B 3ODYX 3F5PA 5CVGA 4TNBA 2QOFA 5AJQA 3C1XA 4BTMA 4IAIA 1CSNA 3BQCA 5KKRC 4BR3A 3FMJA 4I21A 3TNHA 3BGZA 1R78A 1WBVA 3EJ1A 5EW9A 3RALA 4NIFB 3A61A 2IZUA 3LOKA 2UW0A 3SW7A 3SAYA 4RJ6A 4JG7A 2QOOA 2V5QA 1KSWA 4AZVA 4PDOA 3QKMA 5E1SA 4CMUA 5KKRB 5AADA 5KMMA 5JRQA 4BDAA 3ORKA 1UKIA 5HX8A 3CTJA 2IG7A 3GXLA 3ZH8A 4UXQA 5K0KA 1GZ8A 3DBFA 3IGOA 1MQBA 3OS3A 2WAJA 3DAKA 4S30A 3JR1A 3VBVA 2UZOA 2F57A 2ZYBA 3RGFA 4BN1A 2UZTA 5BMMA 3G2FA 3QUPA 4RQVA 5CENA 2JKKA 3PXYA 1OIUA 4UZDA 4BL1A 2ZV8A 3QD3A 4JLCA 4FV8A 5CSPA 2FSMX 5CEIA 3R73A 4ZLOA 4JQ8A 1VYWA 3KREA 4ZJVA 2XIYA 4IB5A 1ERKA 3CPCA 4LI5A 4EJ7A 3RP9A 3E3PA 5L2WA 4LL0A 5E4HA 1W84A 3BHTA 4NCTA 2Z2WA 3FQHA 4CSVA 4FKUA 3EQIA 2XNNA 3IOPA 4KS7A 1Y57A 3UYSA 4BCJA 1OKZA 3EN9A 3ZSIA 2Z8CA 4RJ5A 3MDYA 1YXUA 1F5QA 2XYUA 3LXLA 4MF1A 2WQBA 1UKHA 4JT3A 1A9UA 2YCQA 2R9SA 5D7AA 4RVLA 5HTBA 4LRJA 1DS5A 2E9PA 3EN7A 5ANKA 4BDGA 4I92A 3VIDA 3W55A 4L00A 3VBWA 2YLEA 4OTFA 4IDVA 3NIEA 4DH5A 4MEDA 4DTAA 2PTKA 2YCRA 3UO4A 2C3IB 2OW3A 3R7EA 3OG7A 3QTIA 3D7TA 2PZPA 4NM5A 4EOLA 4EK6A 5HU3A 2OFVA 4K11A 1YWVA 5A4TA 3DBDA 3FAAA 4FI1A 1JLUE 2ESMA 4WG3A 5DHJA 2C5OA 3NVMB 3FMNA 1KE9A 1R1WA 4OGRA 2X8EA 4MXCA 2R3PA 4QTAA 4CKIA 3AT4A 4CMOA 3QXPA 3MH1A 4QTEA 3ZO2A 3PY3A 3S4QA 4C57A 4L53A 3MFUA 2PE0A 4IAAA 4YO6A 2WOTA 4YZDA 5AA9A 2HXLA 4GFMA 2PULA 4JI9A 4RX5A 2JITA 4MWIA 3HNGA 4H1JA 4USFA 4DT9A 4LQMA 5IA3A 4PPCA 2CLQA 1OIRA 2EB2A 2R0UA 3SHEA 5CSVA 4Y72A 4RZWA 4F70A 1OB3A 1TQIA 5CEOA 1AD5A 2XA4A 3HP5A 3I5NA 5CVFA 2YDIA 2Z7QA 3QYWA 1H08A 4TT7A 5CY3A 3BKBA 4XG3A 5IQCA 2GSFA 5CLPA 3EL8A 4G34A 5BUIA 3R71A 3ZFYA 1FMOE 4FEVA 1K3AA 2PVMA 1GIHA 3FXZA 1XH4A 2XB7A 4NCTC 3AD5A 5M53A 3MVJA 5GZ9A 4J52A 3OWJA 5M56A 4LOOA 1TKIA 3GQIA 2J0JA 4HVGA 2PMNX 2OO8X 1PXLA 4RX9A 4D2RA 2CGXA 4DLJA 2WTIA 1WFCA 4N57A 5EYKA 2OH4A 2OXXA 3W32A 3UYTA 3O50A 4KIOA 1R3CA 4K0YA 3EN5A 3H4JA 4JG8A 1OI9A 4PL5A 2G9XA 2YM8A 4YU2A 4FV1A 4AGWA 4ZMFA 2WZJA 3DOGA 4R8QA 2YERA 3MPMA 3OF0A 4UMPA 3C0HA 3DU8A 1OZ1A 3GFWA 3P78A 3EZRA 3R02A 5TT7A 3AMYA 2GS2A 2CGVA 2WD1A 3U4WA 4C4HA 5HE0A 2GQRA 5LMAA 4L7FA 3COHA 3N9XA 4XS2A 5HEZA 2YN8A 4CGAA 5L8LA 4XBUA 3UG1A 2CPKE 4AF3A 3H0ZA 1RQQA 3D7TB 3O96A 4NU1A 3GP0A 4XG6A 3NYXA 1CKJA 4D4VA 1MRUA 2BRMA 4R78A 3KN5A 5C9CA 3GU5A 3BELA 4O0UA 3P23A 3PSDA 4YBKA 4KS8A 2CNUA 1KE8A 3GU4A 2PZYA 1L8TA 4NM0A 4JL9A 4EOQA 1T45A 2HY0A 1PXMA 5ETFA 2J51A 4W8DA 3QKKA 4U79A 3D2KA 4QQJA 5F20A 5EYCA 2XBJA 2KULA 2R3NA 3EZVA 2R2PA 1PXIA 3VF9A 4IAFA 4MVFA 5DGZA 3VWAA 3T9TA 4F9AA 2XNEA 3IDPA 3I81A 3BRBA 2BTSA 5J9YA 4JOAA 3LAUA 4FE2A 1JPAA 4ASXA 1WVWA 2X39A 3D5VA 2IO6A 3EQHA 3Q9YA 4D4YA 2ZB1A 3OVVA 4XOZA 5JGBA 2GNGA 2BVAA 3D7ZA 4FIIA 4RJ7A 2ITQA 3HV3A 3NGAA 4KKGA 5ETCA 2W99B 2CKOA 4GS6A 2PWLA 3DAEA 3H30A 5DVRA 5GIOE 4C61A 2IN6A 4ARKA 4W4VA 2ITOA 5DLSA 2DS1A 3M11A 1KV2A 3H3CA 4DYMA 4QQTA 5KMKA 4MNFA 5HO7A 3QTXA 4E5WA 4QMVA 4FKWA 1GAGA 1W7HA 4ALWA 1V0OA 3VW8A 4UWBA 3MBLA 3BBWA 3B8QA 3QUEA 4CZUA 4DG3E 3MTLA 4BBFA 3HAVA 2GCDA 4O84A 4FX3A 3V04A 4CTCA 3U51A 1XQZA 2QD9A 2J7TA 1YWNA 4EJNA 2VTSA 3U9NA 2PL0A 5FDXA 3JS2A 5FEDA 2RG5A 3QZIA 4GH2A 2OJGA 3R21A 3GC8A 3LPBA 2OFUA 4I93A 4MKCA 4AW1A 4FUXA 5AAGA 3JY9A 3ZRMA 3WF8A 5CXHA 3HAMA 4YZCA 1KOAA 1O6LA 2QR8A 3CQUA 2RKUA 2VU3A 3FC1X 3ALNA 5C03A 4CD0A 4HGTA 5DRDA 4F1OA 3EQDA 3GU6A 5AX9A 1OUYA 2ONLA 1MRVA 3OXTA 3UNZA 3EFWA 4R6VA 1ZOHA 2F2CB 5FG8A 2YZLA 5EI6A 3GVUA 2OZOA 5IUHA 5F95A 3JVRA 4YJOA 5GJDA 2YHVA 4FT3A 3Q53A 4V01A 2PUIA 3QLGA 3OTUA 2WQMA 4WNMA 3W33A 4YZMA 2REIA 3R1SA 3QA0A 2UW4A 4WKQA 4KKEA 4YC8A 3O17A 1GZOA 2F4JA 3OXZA 3HRBA 3RPSA 4IX5A 2ZOQA 3VC4A 4JIKA 4O91A 2BZHB 2Y4IC 2VZ6A 4ZJIA 2BIYA 2G2HA 2BAQA 3TZ9A 5CNOA 4C8BA 2O3PA 3PWYA 4D2TA 2NRYA 2JD5A 1ZMWA 3CLYA 3QWKA 3UVRA 3R1YA 2Y4IB 4O7TA 3NCGA 4GT5A 4EUUA 1M14A 3MJ2A 4ZZOA 3TV4A 3WI6A 4EOIA 5GJGA 3I5ZA 4OTRA 5HE3A 1UA2A 2F49A 4FVQA 5LVLA 2CN5A 3WZUA 2EWAA 3ORXA 4S34A 5FXRA 3E88A 1VR2A 2VO6A 1KE5A 3PZEA 2RSVA 5B2KA 3SOCA 4DH1A 3C7QA 2IVTA 5HKMA 2WELA 1L3RE 3MPAA 2V22A 5EK7A 5JQ5A 5A4LA 5HIDA 4LMNA 4G1WA 4FNYA 1FGKA 3FZOA 3H9RA 1OBDA 3MN3A 3DZQA 4QRCA 5JFXA 2R3GA 3NPCA 2UVXA 4FSUA 3RAWA 2PMIA 1IASA 3UOJA 1OITA 4WG5A 2X2MA 2IJMA 4X2GA 4J53A 3U9CA 1S9JA 4QP6A 4HVDA 4AXAA 3FBVA 2QOCA 4KSPA 1QCFA 2C47A 3C4WA 3RTPA 2Z7RA 4RIWA 2XK7A 4O86A 3E64A 5IQFA 2CMWA 4U6RA 3DB8A 4R7HA 3FY2A 4IWPA 5BVDA 2A27A 3DTWA 4ZEGA 2BUJA 4F7NA 2OICA 1U54A 3C5IA 4FOBA 1XR1A 3PIZA 2X2KA 3BEAA 3FI8A 3DBQA 2GDOA 5I9VA 3FMEA 5CU6A 3TDVA 3E62A 5LMKA 5DA3A 1NVSA 4HVIA 4J8NA 3UZRA 4GK3A 2OBJA 3QCSA 4P2KA 4U97A 2XEYA 4IC8A 4JXFA 1YOLA 2J2IB 3UQGA 3Q6WA 4G2FA 2ZMCA 4J7BA 4BZOA 4CNHA 2WTKC 3EIDA 3DY7A 3FWQA 3QUDA 5KCVA 3R8UA 4IEBA 5GJFA 3C5UA 1PXNA 3T8OA 5HCXA 4O2PA 3WF9A 3A7IA 2WNTA 4YNEA 4JBOA 4RJ4A 4IVBA 2HW6A 3R9OA 4E26A 3BU6A 1BL7A 1H24A 3KRJA 4JJRA 2X8DA 1OECA 4RFZA 5CT7A 5EDRA 5IEXA 2WTKB 4RVKA 1ND4A 4HNFA 3ORTA 5KMLA 3OFMA 4BCHA 5CTPA 5J5SA 1NVQA 3AC3A 3MY0A 3WIKA 4BDBA 3G6HA 1Q62A 4WRSA 1URCA 4A9TA 3UVQA 4FK6A 2YCSA 2V55A 4W4XA 4ZK5A 5AP7A 4K2RA 3JUHA 4MTAA 5H9BA 2C6IA 2E9NA 4IADA 4QP7A 3RM6A 2GFCA 2VNYA 2G2FA 2YAAA 3MH2A 4EK3A 2WQNA 2A4LA 2H6DA 2O64A 3QA8A 5AUWA 2NPQA 4RC2A 4RBLA 4H3BA 4W4WA 1SM2A 4NEUA 4WHZA 4OT5A 5F1ZA 3U8WA 4N4SA 1K2PA 5HBJA 4G3CA 3QLFA 5CU2A 3S95A 3QU0A 4QQ5A 5KMOA 4FTKA 4UXLA 2A0CX 2PHKA 3SXFA 3ID6C 2QNJA 4LGDA 3SX9A 4KIPA 4O0TA 3R7UA 3POZA 2H9VA 2H96A 4E8AA 2OG8A 3VHKA 4D9UA 4HVHA 3S00A 4FVRA 1U5RA 4IX4A 2R3LA 3ORPA 4XH6A 4U9AA 4L3JA 3LQ5A 4ZSAA 3BHVA 3QZFA 4IW0A 4XCUA 3D5XA 3OY3A 5G1XA 3RAIA 4A9UA 4FC0A 5ANDA 3MVMA 3R9NA 4XLVA 4FK3A 4YTCA 3BV3A 5IUIA 4N70A 3MH3A 4Z7HA 2I0VA 2EXCX 1SVHA 5EH0A 5AP5A 2OIBA 3AC2A 3O51A 3GFEA 4RIWB 2UVZA 1ZY4A 3QRJA 1V0BA 5D7VA 4BIDA 3LXKA 5C4LA 5IA5A 4Q9ZA 3QQJA 4F7SA 2WU7A 2CCHA 2VWWA 4FNWA 4J71A 3ZUTA 4ANMA 1YXTA 1U54B 3R7VA 1UU8A 3Q96A 3PG3A 2PVFA 3PLSA 1YHWA 2ZB0A 3GOKA 1G8AA 3CJFA 3ZM4A 4AT5A 3TCPA 3G0FA 3U6JA 3E8DA 3G51A 3ZBXA 5A6NA 3Q9XA 5IZFA 5CQWA 1V1KA 4ZY6A 1LEWA 2QCSA 1OVEA 3BYUA 4K77A 3PA4A 4HPUE 5C8NA 2QG7A 4X6RA 4O7YA 2YFXA 2VV9A 3I7CA 4YURA 1FVTA 2JDRA 2VAGA 4JBPA 2JKMA 5JFWA 1CTPE 3HMPA 5E9EA 4I5CA 4L3LA 2WMQA 4OTPA 3CD3A 2PK9A 1OPKA 3TIYA 2XP2A 4XG4A 1LR4A 2C5VA 2W1ZA 2FYSA 3UMXA 1RW8A 4K8AA 3R63A 4O2ZA 1KOBA 2X8IA 2ZAZA 4QTDA 4U7ZA 5AV0A 3UODA 2GHLA 4UWYA 5CF5A 4ZLYA 3MVLA 4NM7A 4DEBA 2CJMA 5M51A 1SZMA 3ZS5A 5AP4A 4FKTA 1V0PA 2B4SB 3PXRA 4H3PA 2BRNA 2RFNA 3LCTA 4AN3A 1FBNA 5EM5A 2ZM1A 2X6EA 5EKOA 3SV0A 3HVCA 3LFSA 2BHHA 4K9YA 2C3KA 3WF6A 2UW7A 1ZOGA 4IHPA 4R7IA 4IZ7A 3RJCA 2QODA 4CKRA 3OOGA 2YM3A 5FP5A 4R77A 3NAYA 2CDZA 4O0RA 4AW2A 2C1BA 4F63A 3CSVA 1UNLA 1TQMA 4M13A 1JSTA 3CTQA 3DK7A 3LMGA 2C6MA 4RFYA 4QMMA 2JDTA 5EW8A 3MA6A 3FDNA 4U0IA 5BUJA 5AR3A 3P0MA 1YI6A 4QMPA 3UO5A 4DFBA 3T9IA 3R04A 3T3VA 3W8LA 1H25A 4AA5A 4D5HA 5CAVA 4BFMA 2IVSA 5K0XA 4ENYA 3RWQA 2BHEA 4GRBA 4JQ7A 3NIZA 1NXKA 2ETKA 4BGQA 2O2UA 4D0XA 2PMOX 3KKVA 3FSKA 1J1BA 3RMFA 2UVYA 3TACA 1SYKA 2JLDA 3LJ2A 1QPCA 4ZXTA 4MBIA 4NFNA 2ITZA 3G9NA 4CFXA 3EYHA 5HGIA 3CS9A 4HJOA 4AAAA 2JFMA 2GNJA 3MGYA 4JDKA 3ERKA 4B8LA 4N6ZA 4XG2A 3DQWA 2F7XE 5JMSA 3LE6A 2YIXA 3BIZA 4UYNA 4EBWA 4I6FA 2PYWA 3KVXA 5CZIA 4BDDA 5FM2A 1XH5A 4O7LA 5DBXA 5CF8A 3CGFA 4D4SA 2B52A 4AACA 5HORA 4R5YA 2P33A 5LMBA 1QMZA 4DEIA 4YTIA 3OCGA 4UMQA 2YABA 2Z60A 4G31A 3VUDA 2OJJA 5A46A 4BTJA 4FTQA 3DKFA 4M97A 4F9WA 1R0PA 4S31A 3F6XA 4MXZA 4TNDA 4C4IA 4WSYA 3PVWA 4PPBA 3VS4A 4E5BA 2BDWA 3F3TA 2I0HA 5IQBA 4NT4A 5A4EA 3FLWA 2QKRA 4DGLC 4CCBA 4DE4A 2HCKA 3TG1A 3QKLA 3QD2B 4TTHB 3PRFA 3PIYA 3TV7A 3UP2A 2RFSA 3MI9A 4TL0A 4HVSA 4G9RA 4F7LA 2VD5A 5DEWA 4XMOA 4O1PA 5IQDA 3GC7A 4CMTA 3NUPA 2J5FA 2JIUA 4R5SA 4J1RA 3HMNA 1M52A 4R3CA 4AE6A 4Z7GA 4BYIA 2XNBA 4C4GA 2VNWA 2P0CA 3P9JA 4WBOA 1JQHA 2W1GA 3FUPA 4TXCA 4YZNA 3PSBA 2R7BA 5F94A 5ICPA 2YWVA 3FMDA 4H3QA 5HG7A 2VRXA 4LFIA 3KK9A 4YGAA 4B7TA 4XEYA 3TJCA 1Q99A 1DI8A 1W82A 4GVJA 4G6OA 3VJOA 4GIIA 1OPJA 1PKDA 3O23A 5EM7A 5KUPA 2UZNA 5C8MA 3VS0A 2E9UA 4L43A 3GC0A 4I5PA 4DN5A 3Q6UA 4YBJA 4E93A 1ZYJA 4ZTSA 1TQPA 2OF2A 3I6WA 3TKHA 4I23A 4QMOA 3HGKA 4FZ6A 5LVPA 2HWPA 5M4FA 2ZDTA 3EHAA 4BCPA 4FKJA 5J9LA 5JFSA 3F9NA 3UZPA 2ZV7A 4OTGA 4FEXA 3AC1A 1H1WA 3FL5A 5AV2A 4DFLA 3Q04A 5DT0A 1OKYA 3KRLA 4HYUA 4L9IA 4CV9A 2O65A 3LW0A 3R6XA 3RPRA 4O7NA 4ZOGA 5B7VA 4MAOA 4OTIA 3E7OA 3EYGA 5L3AA 4EH5A 2FA2A 4ID7A 3C0IA 3VNTA 3C4FA 3HDNA 4F4PA 3TKUA 2QI8A 3KB7A 5JGAA 3OBGA 4BDFA 4EYMA 1FINA 5AUXA 5DT4A 3RK9A 2JAMA 5CWZA 4RIXA 5LOHA 3H10A 5AM6A 2JBOA 2UW5A 2PZ5A 4GYIA 1H1SA 4P4CA 3O7LD 2BRGA 1CM8A 3AGLA 1GNGA 4FV2A 3R8MA 5EHYA 5BQ0A 4ZIMA 3C0GA 3R8ZA 4ERKA 3VUIA 3BZ3A 2OWBA 5DR6A 4W9WA 4YZBA 5BVWA 3AOXA 4YJRA 2YAKA 2W1DA 4K1BA 4X21A 2HIWA 4PRJA 3R8VA 2QOBA 3RHKA 4IE9A 4DITA 4IB3A 5HICA 3Q9WA 5CANA 4OBPA 5DRBA 2BDJA 5IEVA 2R64A 2PZIA 4ZTLA 4AW5A 5IMEA 1BI8A 4X2JA 5FD2A 5CYIA 4O21A 5TR6A 5FDPA 5HG5A 4PY1A 5AMNA 5ANJA 4EHGA 5BPYA 3PXKA 4G3GA 5E8YA 4EH9A 4F9CA 1PMNA 3LFAA 4KIKA 2BFYA 3LLTA 4E20A 3DJ5A 3K5UA 3ENMA 2VX3A 4JBVA 3ORIA 3P4KA 5LJJA 5J5TA 3R22A 2HYYA 1GOLA 4K18A 2VWZA 3DBCA 4PQNA 4I6QA 4M3QA 1UWHA 3FLYA 4GYGA 4XG7A 1OPLA 3ZXTA 5HU9A 2XNOA 3QTQA 3ULIA 3BHYA 3CQEA 3N4TA 4IZAA 3QZGA 4TN6A 2RFDA 4BCFA 2WQEA 4EH8A 3KRXA 4DEDA 3GBZA 4IH8A 5L6PA 4NKAA 1JKKA 4QMWA 3AD4A 2VWVA 4I94A 4I0RA 5EYDA 2OI4X 4FSZA 3SGCA 3R7YA 3PE1A 3C4CA 4FGRA 4U80A 5CI7A 1NY3A 2WOUA 4UBAA 4MCVA 2IW9A 1JVPP 2X7GA 3V6SA 4QMXA 4BWPA 3MS9A 4M14A 4GVAA 2E2BA 3GB2A 4QTBA 2BZJA 2AC3A 5J1VA 4L46A 4FTAA 4DINA 4X3JA 5DH3A 4H05A 4UMUA 3NUUA 2RL5A 2ZM4A 3DT1A 5KNJA 2CCIA 5M06A 4ZTNA 2EB3A 4C59A 5L4QA 5AV3A 2QKWB 2HWOA 2X7OA 3MWUA 3R28A 4IWQA 3QGYA 3PE2A 4I0TA 1OM1A 4L8MA 3EN6A 3PJCA 1OUKA 3Q5ZA 3OMVA 4RIXB 5CU3A 3GCQA 4V05A 4GJ2A 5HE2A 4AA4A 4AZEA 4CV8A 5BVFA 4DFYA 2W5BA 3IOKA 2DUVA 2ITTA 2PVYA 1J91A 5FEEA 3FKOA 4QMSA 4YJNA 4JDHA 4JAJA 4D28A 2B53A 2C0IA 2IVVA 3MVHA 2QO2A 1H0VA 2ZM3A 4EQCA 3KN6A 1P5EA 1SMHA 3EFLA 2P3GX 4FKPA 5DNRA 1EH4A 4ENXA 3SC1A 3LMIA 2UW8A 1K9AA 5HNBA 4F08A 4UEUA 4YC3A 3ZFMA 4YJPA 2VTRA 4BHZA 2W0JA 3BWJA 2B1PA 3EQCA 3FZTA 4MWHA 2XMYA 2J6MA 3SG9A 2LAVA 3D5WA 3MTFA 5KE0A 4ZLZA 3MIYA 3NMUF 4AN9A 3BE2A 5E8ZA 3DK6A 4YSJA 3P1AA 5E8VA 4FNZA 4XLIA 5L8KA 5I4NA 1UWJA 3A7JA 4KIKB 4IB1A 1Q3WA 5FGKA 3TN8A 4ITIA 3UPXA 2OJFE 1TVOA 5CF6A 4DG2E 5H3QA 2X7FA 3UGCA 2GHMA 4FL3A 5FXQA 2H34A 4KB8A 1IA9A 4ASEA 1B39A 3SXSA 2QOKA 2Z02A 3IW7A 3AXWA 5CSXA 4HYSA 1YW2A 3PVGA 4FV3A 4CQGA 4E7WA 4EZ3A 4XHKB 3RBWA 3RINA 4HW7A 4CKJA 3ZRKA 1IEPA 2XKCA 2XM9A 3WYYA 4DGMA 3D9VA 3DLSA 3ZC5A 4A4OA 3TUBA 3GUBA 4FT7A 4ACCA 2C5NA 3NX8A 3B2WA 2E9OA 4FTLA 3G9LX 4IIRA 4FKVA 3W16A 4G3DA 3UOHA 3CC6A 2CKPA 4LM5A 1H27A 3NW6A 5ACKA 4XV9A 4BWXA 1Z5MA 3MJ1A 4LL5A 3SG8A 5AUVA 4YSMA 4PTEA 4ZSLA 3COMA 4BY9E 4CFVA 4J8MA 4XV2A 3BHUA 4OW8A 4ZMEA 4OR5A 2BDFA 4I1ZA 5AUYA 5HG9A 4AW0A 3VS1A 4DFZE 1Q4LA 4F1MA 5K4JA 4GJ3A 3PVBA 3QTRA 4YJVA 5AAEA 2HXQA 2HZNA 2UZDA 3L9MA 2GTNA 1UV5A 3QTSA 5BVEA 5A9UA 4XRJA 1UU7A 3QD4A 4FTNA 5AAFA 4OAVB 2JKOA 3SKCA 3CY2A 2I0YA 4IZYA 4KBKA 2B54A 1IG1A 5HQ0A 4IAKA 3R9DA 5IA1A 2W1HA 3D4QA 4Y5QA 3HRCA 4FTTA 4EONA 3T3UA 3AC4A 4UN0C 5AIRA 2HENA 3AMBA 4M7IA 1Q24A 4B6LA 2YJRA 2B7AA 3KC3A 4YLJA 5EI8A 4OT6A 2R0IA 4BDIA 4EH4A 3RPYA 3ULZA 2XH5A 5CU4A 5AP2A 1M7QA 2R5TA 3R8PA 3P7CA 2VO7A 1CKIA 3CPBA 4CZYB 3DCVA 3EN4A 4Q5EA 4ZTQA 4YZ9A 2GS7A 2BCJA 1Y91A 3UPZA 4BKJA 3R30A 3SA0A 2R3RA 3EQFA 2WMRA 1BLXA 2YDJA 2VX1A 4JR3A 5ETIA 3UIBA 4M69A 1A48A 4PNIA 1LP4A 2VN9A 1SVGA 3QRIA 2WTCA 3ELJA 4FKOA 3V51A 3PPJA 4BCGA 5KMIA 2BROA 3S1HA 4AGCA 1XHAA 1Z57A 3QGWA 4TY1A 4YJQA 4ZTMA 1WMKA 3UDBA 3FYKX 4QMQA 4MBJA 2P2IA 4BCIA 5FBOA 4ACDA 3ITZA 2BZKB 3BPRA 3BHHA 4RIOA 3BGPA 5FXSA 5TKDA 4DFNA 4P7EA 4F1TA 2R3KA 5IMXA 4LV5A 4F0IA 4NSTA 3GEQA 2C6TA 4BZNA 3QBNA 3VBYA 3EWHA 4YTFA 3RNIA 5J7BA 4NW5A 3UMWA 5FM3A 3QCYA 3C50A 2B9JA 1MUOA 3LHJA 3NUAA 4OTWA 4JRNA 3TXOA 3POOA 2Q0BA 5L2SA 1RJBA 4M67A 1UVRA 3KEXA 3CQWA 2C6OA 2PY3A 3KRRA 4GIHA 2ZMDA 4USEA 3P7BA 4FTRA 3SOAA 4ZSGA 2A2AA 3SW4A 4BBMA 2ITWA 3O2MA 4J99A 4WNKA 4C37A 5L6OA 1W83A 2OZAA 1LEZA 3COIA 3EFJA 2BTRA 4XV1A 1PHKA 4BDCA 4UYAA 4MQ2A 2ITUA 2UZUE 5KBQA 3FSFA 4BF2A 4IVCA 4CYIA 1PW2A 4IC7A 5CI6A 4EK8A 3QALE 4G3FA 4AZWA 4Z16A 3QQLA 4NK9A 5CEMA 2P55A 5E8TA 4UB7A 3SD0A 3UIUA 3ZU7A 4WBBB 2FB8A 4NJ3A 5ANOA 4AZTA 1REKA 2WIPA 2UV2A 3JXWA 3S0OA 2YACA 4IFGA 4O22A 2J0LA 3I6UA 3NZ0A 1AGWA 2FH9A 4QP3A 3TKIA 5JQ8A 3UNJA 4DH3A 4YHFA 1GIIA 3ZFXA 5CT0A 3BU5A 5AEPA 3ZCLA 1ZYLA 4H36A 4W8EA 5C27A 3HYHA 1PF8A 2PUUA 3QF9A 3DFAA 4L42A 1VYZA 4JG6A 5JT2A 3KCKA 4QD6A 2GTMA 3GGFA 2QO9A 4DGOA 1ATPE 4TYGA 4L45A 1J7LA 3CKWA 1J7UA 3E8CA 3NSZA 4QP4A 5LCJA 5FTGA 5CAOA 2X2LA 5AUZA 3TNWA 2PVLA 3E92A 3M1SA 3FQSA 2XK3A 5EI2A 1T46A 3RWPA 2J50A 4KRCA 3VVHA 4QMLA 4NFMA 4OTHA 3HKOA 3WOWA 4Z9LA 1Q8UA 4M69B 2PU8A 2W9FB 2WEVA 3RCJA 2WPAA 2CGUA 2NO3A 4IACA 4OBOA 3SLSA 5C1QB 3NVKI 5E8SA 5B0XA 1XH7A 2RIOA 3FPMA 2DWBA 4LGHA 1QL6A 3LFCA 4U43A 5E8XA 4I0SA 4D0WA 3UVPA 4C02A 5M55A 1H07A 5DN3A 5HG8A 4B8MA 4EOKA 1MRYA 2CGWA 3IW8A 3KXZA 3WARA 4C3PA 4PX6A 5LXMA 1PXPA 4ERWA 1QPEA 4PDPA 3QQHA 3DKCA 4OTDA 5K4IA 1CDKA 3VUKA 4GG7A 4L6QA 2PSQA 3KFAA 4EC8A 4S32A 3CY3A 4D1SA 5A14A 3OZ6A 2X9EA 5L2IA 3PXFA 5E1EA 5CASA 4TZRA 1OIYA 3O8TA 3F2AA 2H8HA 3IS5A 1Y6AA 2PVKA 3VUHA 5C26A 1MQ4A 3WZKA 4AE9A 5C8KA 3TDWA 3C9WA 2OGVA 1JWHA 3HV5A 3LXNA 4ONAA 2QOQA 1Q5KA 2PMLX 3EMGA 5J7HA 1SVEA 3ODZX 3QXOA 3VQHA 4C3FA 2GPHA 3EQPA 5AR8A 2OZAB 4O0YA 4C38A 3OCTA 4TKSA 4XBRA 4CQEA 2Y0AA 4IJPA 2G2IA 5JZJA 3CKXA 2KTYA 3W2CA 4AGDA 2X4FA 2B9IA 2OXYA 4UMTA 2X0GA 4FEUA 3LM5A 4GT3A 4FTUA 4P5QA 4AZSA 4BDHA 3A7HA 3Q4TA 3AT2A 4BB4A 4EKLA 3K3JA 4QTCA 4NYEA 1BL6A 4DT8A 4J96A 3IG7A 1PJKA 4QMTA 2WEIA 3D0EA 1OL5A 3HMIA 3LQ8A 3MFSA 4RJ3A 2XNPA 5E92A 1SNXA 4AUAA 3G6GA 2Z7SA 3E8NA 3AD6A 1Q8ZA 5AR7A 2YIYA 3FI2A 3VULA 4ZJJA 4G3EA 3FYJX 4ZSJA 2YIQA 5EQEA 5H8GA 5B2MA 5DYJA 4W9XA 4TYEA 4APCA 2I6LA 1XBAA 3ZO3A 4UX9A 4M15A 4R3PA 4R3RA 5HVYA 5B2LA 4BWKA 5EM6A 4FUYA 5HIEA 4RLLA 3ATSA 2IZRA 3ZLSA 2EU9A 5HVKA 4WSQA 1HCLA 2YISA 2C0TA 2WTVA 3ET7A 5T68A 4I6HA 1WBWA 3FLNC 3W1FA 4BTKA 3A99A 4XG8A 3U55A 4QYHA 3BU3A 4WOVA 5IG1A 4QMZA 2GNHA 2HZIA 3ZHPC 3PTGA 3U6HA 2Z7LA 3RVGA 5KZIA 1FQ1B 3PFQA 4HCTA 2JFLA 3FY0A 3WE4A 1OL1A 4R1YA 3SVVA 4O83A 4EUTA 5I9ZA 1U5QA 3H0YA 4L01A 4RX7A 3TIZA 3L8VA 3UJGA 4ACMA 4QMYA 5HNGA 4QP1A 3QX2A 4Y83A 5JFVA 4AU8A 4IDTA 3GQLA 1WBOA 2QURA 4BCQA 4BKZA 4C62A 4CZTA 5M08A 5IKWA 3FQEA 4I3ZA 2PZRA 1G8SA 4RSSA 4GUEA 4MNEA 4YTHA 3NUXA 2IWIA 1H00A 3JPVA 2BAJA 3OWLA 3V5LA 4LMUA 4BGHA 4FV7A 4CLIA 1GY3A 3F5XA 1YVJA 3CP9A 4IBMA 2VGOA 4ALVA 1ZZ2A 4RG0A 3A4PA 3KXNA 4WA9A 3W2OA 4XYFA 2C6KA 2R3OA 2ZVAA 4O0WA 2VGPA 4KSQA 4FV0A 1YI4A 2XKEA 4V0GA 3F61A 3TZMA 2WMXA 5ACBC 2LGCA 1P14A 2XIXA 4D2SA 4F9YA 4O7RA 3M42A 2VTQA 2YEXA 3NNVA 5AP0A 3C13A 4YPDA 3ZSGA 3HECA 3FHRA 4H39A 2JDOA 3NUNA 3DNEA 4JAIA 4PMMA 4C2WA 4HOKA 4YLKA 4YJUA 3TNPC 3VRYA 3VBQA 1DAWA 4A9YA 5HX6A 4YC6A 3OWKA 3LLAA 4DBXA 3FZSA 3UOLA 3QD0A 5D12A 4AA0A 4IFCA 5ANIA 1ZLTA 1QPDA 4LRKA 4BDJA 3IONA 2OXDA 1APME 4OTQA 3UOKA 1PXKA 3E7VA 3L1SA 2G01A 4DBNA 3MSSA 3R7IA 3PLAE 2QONA 4G5JA 1Q61A 1X8BA 3HMOA 2FO0A 4M66A 4ASZA 3MIAA 4O82A 4FG8A 4GCJA 4DCAA 2ITYA 2J0IA 2QHMA 5EDPA 4JQEA 4MYGA 4LOQA 3CXWA 5JRSA 3KXXA 1OBGA 1JOWB 3FI4A 3QL8A 5LARA 4E6AA 4EH6A 1FVVA 4CLJA 2C3LA 4F6WA 3A2CA 3LXPA 2F2UA 2QU6A 1YOMA 4IVDA 3P86A 4TYJA 2EUFB 3OBJA 4QQCA 3LFQA 3P79A 4IAYA 2PVRA 4ZTRA 5CEQA 2ITNA 3FLSA 4NUSA 3DXPA 1WBTA 3V8SA 2QU5A 3KXGA 4NTTA 5EG3A 3FXWA 2J90A 2VTJA 4QOXA 3F5GA 3PJ8A 5FEQA 2WTWA 5JN2A 4ITHA 4O81A 4E4MA 3IECA 2I7QA 5EHOA 4AN2A 4DEAA 3LFEA 4CG8A 4FT0A 2GQGA 1XH6A 2XK9A 3Q9ZA 4FL1A 3R9RA 4TWCA 4R7BA 4DH8A 5BMSA 4BDKA 5I9XA 4RIYA 2NP8A 2QR7A 1OGUA 4XG9A 4E6QA 3OEZA 2FSTX 4JS8A 4D1ZA 4KABA 2ZDUA 3QC4A 4MNEB 1O6KA 4KD1A 3MFRA 3OTVA 2WMWA 3KXMA 4HCUA 4L68A 5I3RA 3UQCA 3OP5A 3ZC6A 4EH2A 4YPSA 3OEFX 4AZFA 4X6QC 1H1PA 5IEYA 5D9HA 4N0SA 3CCNA 2VTTA 4C33A 1WBNA 5I9UA 5DEYA 5TF9A 4BICA 5LWNA 3E3BX 5D10A 3BYSA 4FICA 5CVHA 2ITXA 3V5TA 5EQPA 5IH5A 4M8TA 3PG1A 4V0GB 4O7SA 3NLBA 3V5JA 2BKZA 2PUPA 3GCPA 5DFPA 3JYAA 3VRZA 4QT1A 2WMVA 2YCFA 3TT0A 4ZZNA 2IW6A 3VBXA 3AC5A 3DKOA 5AX3A 3R01A 5EDQA 2IPXA 4WNOA 1J1CA 4C34A 3BBTB 3NUYA 3NNUA 3I60A 3R1QA 1BX6A 3EQRA 2XNMA 3COKA 1BUHA 4UZHA 1PMEA 4GFGA 5E90A 5LVNA 4RA4A 3BX5A 3RNYA 5BYYA 5EYMA 1KWPA 2FSLX 3R2BA 4K6ZA 1BMKA 5L2TA 2P2HA 2F9GA 4PWNA 4F09A 4E6CA 1KV1A 2C6LA 4S2ZA 3BYVA 4DLIA 4I5HA 4Z55A 1M2PA 2GNIA 2R3QA 3DQXA 2GMXA 4U8ZA 2QOHA 1YDSE 4ZAUA 4GG5A 4BDEA 2UW6A 3AG9A 1AQ1A 2W7XA 3VUGA 3DZOA 3IDBA 2XM8A 2JKQA 4RVMA 1OKVA 2GNLA 3NS9A 3OUKA 4GMYA 4F7JA 2JDVA 4PMPA 3TM0A 1UNGA 2V62A 4BBEA 4DC2A 4DEHA 4EHZA 3PDTA 4MD9E 2W05A 2OLCA 3MPTA 3EKNA 3OWPA 2VWBA 3FZPA 3G0EA 3OOMA 4JRVA 3DTCA 3MW1A 2JDSA 4I6BA 1YI3A 5AP3A 4WUNA 3I0OA 5GZ8A 1I44A 5DWRA 4DTBA 4AT4A 4DCEA 3NUSA 5D11A 3VJNA 4F99A 2ZV9A 5CEKA 3ZEWA 5KMJA 2XNGA 1PXOA 5DI1A 4PMSA 3VO3A 5GINE 2WFYA 3AT3A 5HI2A 2P4IA 4D2WA 4ZY4A 4USDA 5A4QA 3R83A 3HMMA 1UU3A 4O0VA 4EI4A 4MHAA 4D2PA 4F6SA 3HA6A 4IX3A 4RIYB 4U44A 4DEGA 1IAHA 5J95A 3QQFA 5FP6A 1U4DA 2XIRA 3OT3A
chains in the Genus database with same CATH superfamily
1ZYDA 4EBVA 3NNXA 2C69A 4J95A 4YR8A 3A4OX 2RG6A 3FMMA 4AWIA 1W2FA 4XV3A 3GCUA 3C4EA 4UMRA 1ZOEA 4M0YA 2GQSA 2I1MA 3FZ1A 4UALA 3PA3A 1O9UA 2WIHA 2DYLA 3QTZA 3KMUA 1YRPA 4EC9A 3ZO1A 2AC5A 3H9OA 2R3MA 2AUHA 4GK2A 5CNNA 4MK0A 5CX9A 3FPQA 4NH1A 5FRIA 2X9FA 4GSBA 4AX8A 4BHNA 4DA5A 5J1WA 1IR3A 4GKIA 3ZYAA 2XJ2A 2FUMA 3L8SA 3PVUA 4FSMA 4UWCA 2V7OA 1IA8A 4GL9A 1CKPA 3REPA 3ZEPA 5CQUA 2XUUA 5IA2A 1H0WA 4DHFA 3FL4A 5HLPA 4N6YA 3ZUUA 4U45A 5DMZA 2HW7A 3ZONA 1ZMVA 4EEVA 4YUQA 2IZTA 3QAME 2BZIB 3ZO4A 2YZAA 1ZAOA 3AQVA 4YHJA 3CIKA 4TRLA 3KRWA 4U3YA 1WBSA 3UO6A 4FOCA 2W4OA 3QTWA 4IJ9A 4LUDA 4C4EA 5JEBA 5HD7A 3V5QA 4U3ZA 1GJOA 2VTLA 4RWKA 5M09A 4E4LA 1RE8A 3LCOA 2OK1A 3RPVA 4EWQA 3RAKA 4EH7A 3VN9A 4KUJA 3PA5A 3OCSA 1Y6BA 1JKSA 2W96B 3D2IA 1H1QA 3EH9A 3N4VA 2BRBA 3Q4UA 4EKKA 4BRXA 4CEGA 3BI6A 3PP0A 1VLRA 1OL2A 4FVPA 4O1OA 4E5AX 1QPJA 3UTOA 2X4ZA 3PJ1A 4FV4A 4L44A 4OUCA 1E1XA 4ZZMA 2QHNA 2BRHA 4X2FA 4ZS0A 4XOYA 5IQIA 1BYGA 2JBPA 2J9MA 1KE7A 5AIKA 3PSCA 2R3IA 4D55A 2W06A 4IVAA 5KX8A 3QHWA 5CSHA 4IM2A 4TWOA 4X7QA 3ANRA 1JAMA 4AFJA 3VF8A 4FKIA 4KA3A 4O6EA 2WMUA 4A7CA 3MY1A 2GFSA 4DTKA 5KHWA 1CMKE 3NW7A 5HNIX 4CCUA 4FZ7A 1PKGA 5IQGA 3NNWA 1BKXA 5I3OA 3Q2MA 3PPKA 3ROYA 4I41A 4CFMA 3OCBA 4LYNA 4A4LA 1ZXEA 3K5VA 2PPQA 3MY5A 1GIJA 4RGJA 3FJQE 3F5UA 4PDSA 4DGNA 4YJSA 4YJTA 1ZYSA 4LGGA 2PE1A 3PUFC 3EFKA 3MB7A 4KBAA 3DGKA 4TYHA 1WVXA 4AQKA 1W2CA 5M44A 3RAHA 3DK3A 3F7ZA 2XK8A 4O4EA 4TWNA 4ZP5A 5EQYA 3QCXA 5CALA 3QRUA 1DI9A 1OL7A 4XP0A 4AT3A 2Y7JA 4EOOA 4BCNA 3QZHA 1PYEA 2J5EA 2OH0E 4NKSA 3SDJA 2VTAA 2QC6A 3UG2A 4XNEA 2GHGA 1HCKA 3UIMA 2O8YA 3WZEA 2GS6A 4BYJA 2CN8A 1YKRA 2VTMA 4CT2A 5HESA 2B9FA 4FSRA 4EOPA 3KA0A 1NT2A 1XMLA 2YM6A 4JX3A 4W4YA 5TOZA 1M7NA 3RKBA 1R39A 1LPUA 4EHVA 4Q2AA 4WRGA 3GU7A 2BIKB 1E9HA 4ZSEA 3I1AA 2UZWE 3LJ0A 4KAOA 2G1TA 3HV7A 2Y4PA 3HV4A 4IAZA 5HCZA 5A6OA 5CAUA 1KUTA 5C4KA 4GUBA 1BI7A 4CVAA 2JAVA 5E8UA 4FTJA 4KINA 5IDPA 1J7IA 3PZHA 3ZM9A 4NL0A 4AGUA 4H1MA 5HE1A 3ROCA 2JIIA 3GU8A 3TJDA 2Q83A 4C36A 4B4LA 4JBQA 1VZOA 3IO7A 1P2AA 3QFVA 4CFUA 3F82A 2YJSA 3V3VA 3RK7A 4ANQA 3L8XA 4F9BA 3WBLA 3V8WA 3OT8A 1H1RA 1ZWSA 4FIEA 3FMKA 4AP7A 1YDTE 2I0EA 2OU7A 3AC8A 3K2LA 3NEWA 4LG4A 3V5WA 2VO3A 4PL3A 3D15A 4FKGA 4MX9A 2XKDA 5CS6A 3UBDA 5IQHA 3HUBA 3F3ZA 5H8BA 4IWOA 4WG4A 3VS7A 4FMQA 3LQ3A 4IM0A 4E4XA 5CXZA 5A3XA 3N4UA 4RPVA 4TPTA 2B55A 4CFNA 5M4CA 4B99A 1PY5A 3MB6A 3R8LA 3WZDA 4AOJA 2R3FA 3TI1A 4EQMA 5DR9A 5HBEA 2EVAA 3OD6X 4HYHA 2CLXA 3IQ7A 2VTPA 2WMAA 3VBTA 4EORA 4HGSA 3K54A 5AUTA 3ZLXA 4FZDB 4TW9A 5CSWA 1W8CA 5HTCA 3N51A 1W98A 3HEGA 3VAPA 4U40A 2YA9A 5CEPA 3P08A 3BV2A 5AP1A 4F64A 3QQUA 4XX9A 1Q41A 5JGDA 3ZXZA 2XRWA 2VWYA 2YDKA 4TYHB 4PP9A 4Y73A 2WHBA 3NYNA 2QG5A 4KRDA 2R4BA 3BEGA 2O0UA 4QPMA 2O63A 4EOSA 5IISA 3LFBA 1URWA 5FWKK 3PYYA 2GNFA 2VWUA 4JVGA 3RPOA 4LOPA 4FF8A 4YO4A 4C3RA 3FLZA 4F78A 3L8PA 5BUEA 4G5PA 4E3CA 4EZ7A 4BI2A 3GENA 4GV1A 5T6KA 4EWHA 4PTGA 4QNYA 2XYNA 4DAWA 4RJ8A 3UE4A 3JVSA 3MV5A 3H9FA 3MYGA 3U4UA 1OMWA 2QLQA 5LQFA 3U54A 5TE0A 4CRLA 4BCKA 5H8EA 3HP2A 4PL4A 3TUCA 2C1AA 4QYGA 4PF4A 3ZTXA 2OJ9A 3DFCB 2RFEA 4RC4A 5HCYA 3LKMA 1H26A 2O5KA 2UZLA 3D14A 3TNIA 2OKRA 3NCZA 3FI3A 4P5ZA 4ZS4A 2V0DA 4CG9A 3PY1A 2WTDA 3B8RA 3EQBA 4UV0A 3KU2A 2XIZA 2VO0A 4Y95A 4FYOA 3R9HA 4X2KA 3W0PA 1WAKA 2XKFA 3CJGA 2OIQA 5AR2A 5AV1A 5FBNC 1YXXA 3W2RA 4J98A 4BI1A 5L6WL 4FSNA 4QMNA 1Q8TA 2ACXA 3PWDA 2BPMA 4PTCA 3ZZEA 5KZ0A 5EOLA 4DHIB 1Z9XA 3TNQB 3ORZA 4BIBA 4F0FA 1YHSA 3DDQA 2BFXA 4DH7A 4DFUA 1Y8YA 4WD5A 3DAJA 1M2QA 5AM7A 3ALOA 3LFDA 3C51A 3DS6A 3PP1A 4G6LA 4O96A 1W2DA 1XO2B 4Y85A 5HLWA 4WT6A 4EL9A 5ITAA 3Q52A 4AQCA 1HOWA 2XIKA 3PXZA 2V7AA 4DHJA 5IDNA 2VUWA 3W2SA 5E91A 1OKWA 3QYZA 3GNIB 3UZTA 1OGYA 5K5XA 1P4OA 4I22A 4Y8DA 4UY9A 1NVRA 4ASDA 4FL2A 4RVTA 4X3FA 2WKMA 4Y5HA 4E6DA 4I24A 5IPJA 2PVNA 1XKKA 4C35A 2XCHA 3Q3BA 1FMKA 2E9VA 3RM7A 2NRUA 4GK4A 4U42A 3ZBFA 5JK3A 3EOCA 3A7FA 3GI3A 4FIHA 3KF7A 3MESA 1XBBA 4ANSA 3WYXA 5HLNA 2BKKA 2WXVA 1DM2A 3DJ7A 2UW9A 3IDCA 4V04A 3P5KA 4GU6A 3TL8A 3O0GA 4EOJA 2XJ1A 4MXXA 3V5PA 4MD8E 3SRVA 5CAPA 3FMHA 4EQUA 2YLFA 3W18A 2BILB 5BVKA 5F4NA 3CE3A 3ETAA 3VS3A 5HBHA 4C2VA 4IQ6A 3DNDA 2VWIA 2ITVA 3HA8A 5F9EA 4G9CA 2ITPA 3AMAA 3QHRA 3NYOA 2W5AA 2JIVA 4JR7A 5DT3A 2C68A 3MFTA 4JDJA 3E8EA 4Q9SA 2VTNA 4QP9A 1P4FA 4ANNA 4D4RA 3TZ8A 3ZSHA 3FEGA 4KNBA 2XVDA 3BLQA 4JX7A 4RWJA 3W8QA 3CGOA 2UZBA 4DEEA 4YNOA 5ANGA 4L52A 4XJ0A 3MA3A 5A4CA 3QX4A 4FIFA 2W9ZB 1S9IA 4U41A 1VEBA 4GFOA 3O7LB 3QWJA 4FT9A 2HY81 2R7IA 4M68A 3WIGA 3FE3A 1REJA 5ANEA 4JDIA 3DLZA 4FEQA 3SXRA 4LUEA 3RI1A 4C58A 4IMYA 3E87A 3Q5IA 3G15A 3MH0A 2BR1A 4AOTA 4HYIA 5ETAA 1STCE 2W4JA 5LVOA 1YWRA 2QOLA 2RF9A 3O8PA 4O7ZA 4I5MA 2C6DA 3R7OA 3QQGA 4FSWA 3OY1A 4HGEA 3DXQA 3KQ7A 4HGLA 4ITJA 3OW3A 2YM5A 4PMTA 1FGIA 3CD8A 5A54A 2Q0NA 1WZYA 4BGGA 3AKLA 4NJDA 5IU2A 5JZNA 2AQXA 1J3HA 1Q8WA 2CKEA 4F6UA 2UZVA 2WU6A 1I09A 4G16A 4X3FC 1DAYA 3OC1A 4RWLA 3UC3A 4A9SA 1FOTA 3LM0A 3JY0A 1Q8YA 4YHTA 4OAUC 1F3MC 5IQEA 1GZKA 2J0MB 3B2TA 4G6NA 4JIAA 3ACKA 5EOBA 4ANLA 3S2PA 4DG0E 4X3FB 5HHWA 1NW1A 4BCOA 4MF0A 1F0QA 4FKQA 3S3IA 4C7TA 3VHEA 2W1EA 1XJDA 3Q4ZA 2WMSA 3RK5A 5IH6A 3KMMA 4FG9A 2B9HA 2HK5A 4WIHA 2WB8A 5AWMA 2AYPA 2NNWB 3D94A 2W17A 3KGAA 3NR9A 2PE2A 3FC2A 3BLRA 5CZHA 3UQFA 1H28A 3PXQA 4RFMA 3THBA 3U6IA 4BTFA 2C6EA 5GNKA 3ACJA 3CBLA 1U59A 3BQRA 2ONLC 3A62A 4PPAA 4FBXA 3RZBA 4AOIA 3AGMA 5AUUA 5J79A 3O5AA 4A9RA 4XRLA 3O8UA 3SRVB 5HZNA 2CKQA 2ZJWA 3LIJA 3E63A 4BCMA 3L9NA 1U46A 4E73A 3ZDUA 3BYOA 2HZ0A 2JGZA 3QCQA 4O0XA 4EZ5A 5J9ZA 3QC9A 5M57A 4CYJA 2CNQA 2HOGA 2VTIA 4ANBA 3FKNA 4Z3VA 4CXAA 4MXYA 4E1ZA 2XZSA 4M84A 5DG5A 4ACGA 2IZSA 3PY0A 5LCKA 2F7ZE 4FZFB 5D41A 3HZTA 4M0ZA 4NW6A 5I5ZA 3TUDA 2W5HA 2YIWA 3A7GA 4D58A 4XP3A 4C4JA 2X1NA 1ZARA 3PRIA 3A8WA 4IXPA 4EYJA 4YMJA 3F3UA 5CF4A 4BIEA 3DA6A 5HD4A 4QNAA 1JBPE 4O4FA 3W2PA 2JC6A 3PPZA 5DPVA 2QQ7A 5HIBA 2FGIA 4GKHA 5AR5A 3I7BA 5KMNA 4O6LA 1E1VA 2C3JA 2C5YA 3ATTA 4CFWA 4O7VA 4C0TA 4NWMA 4O0SA 5AV4A 4FZAB 3KXHA 3NYVA 3TWJA 3UP7A 3TEIA 3ZDIA 5IUGA 5IA0A 2RGPA 3VW6A 4FA2A 1MP8A 3PJ3A 2VTHA 3UIXA 4NTSA 5I9WA 2XJ0A 4RZVA 3LCKA 5DOSA 2Y6OA 1WCCA 1NA7A 4NM3A 1JNKA 2VWXA 2J4ZA 5J87A 4FJVA 1PYXA 2ERZE 5HVJA 5M07A 4H58A 2XK6A 2SRCA 3R7GA 4FSYA 4KBCA 4MD7E 4QMUA 4M12A 3VS5A 3QRTA 5AP6A 4RA5A 4O7WA 3TV6A 2W1IA 2YIRA 3LCDA 3R2YA 5BVNA 3IW4A 3F66A 4WUAA 5EFQA 3V6RA 3LCSA 3HUCA 2HELA 4DFXE 3DV3A 1YDRE 5KO1A 5M4IA 2W1CA 5HTIA 3ZUVA 1PRYA 1JSVA 3GC9A 3IKAA 5LVMA 3QQKA 3LJ1A 2X6DA 4FG7A 3EL7A 3VUMA 4LV7A 2QVSE 4FKRA 1B6CB 4WNPA 3BE9A 3I0QA 2XCKA 4PUZA 3ZLYA 2DQ7X 2WTJA 3EQGA 5HO8A 1R0EA 1UU9A 4RLKA 3F2RA 5LMKC 3LMHA 4CT1A 2FVDA 5KBRA 2ETMA 3LZBA 3G33A 4HZSA 4S33A 5DE2A 4FIJA 1PXJA 3QRKA 4TWPA 2YITA 4FIGA 5TO8A 4D2VA 4R1VA 3V8TA 3LFFA 4QP2A 3FZRA 1ZYCA 4RX8A 4FT5A 4FKLA 4XUFA 3DPKA 3DXNA 3G90X 1ZMUA 1OIQA 5JKGA 1GZNA 4PP7A 4QYYA 2IW8A 3II5A 3NWWA 4GEOA 2PUNA 1O6YA 4QPSA 4IX6A 3OUNB 4OBQA 4O38A 3KY2A 5BYZA 4D1XA 3PJ2A 4TYIA 3FMLA 2PVHA 2FSOX 4MBLA 3NRMA 3BWFA 2J0KA 3IW6A 4CTBA 3CR0A 3RHXA 3K3IA 3ZLWA 2UW3A 5K3YA 4U81A 3ZZWA 3D5UA 2GU8A 3KULA 3BGQA 4YP8A 1G8JA 2BALA 3KL8A 2WMBA 4KKHA 2WGJA 4A07A 2HAKA 1Y8GA 5BYLA 3CTHA 2WO6A 4FNXA 4K33A 4KWPA 3OROA 3KMWA 4L7SA 4IANA 5AFVA 1ZY5A 3F7WA 4J97A 4BI0A 5DIAA 3HLLA 5CU0A 1W0XC 2B0QA 3WILA 3C4XA 3WZJA 3OHTA 4FGBA 4Q5HA 2YM4A 3A8XA 5BVOA 1SNUA 1ST0A 4B9DA 3FKLA 5FLFA 5I0BA 4ORKA 3DJ6A 4A06A 3C4ZA 5M4UA 3VQUA 5GHVA 4B0GA 4CFFA 5IF1A 3WF7A 1Q97A 4RQKA 4HCVA 5T3QA 3DKGA 1WBPA 4FTIA 2IVUA 3TTJA 1XH9A 4DGGA 2XF0A 3W10A 4F65A 3LFNA 4L67A 3E93A 4D9TA 3DBEA 3FLQA 4I4FA 4IM3A 4P90A 5EHLA 4WO5A 4PDYA 4APPA 2OF4A 3L9LA 2R3JA 3LVPA 3PIXA 1H4LA 3IPHA 4FSTA 5IQAA 2VX0A 4L3PA 2YM7A 3Q60A 1H8FA 5GZAA 2QO7A 1FVRA 4GU9A 5CAQA 5K5NA 3L9PA 5IA4A 3F69A 3QTUA 4QPAA 1OL6A 5FUTA 4X0MA 4EHEA 2CHLA 4LRMA 4HNIA 3D83A 5EM8A 3NDMA 3TYKA 2G15A 4XP2A 3W0OA 3HRFA 4BC6A 3GCSA 2BAKA 5BX0A 4FV6A 4GW8A 3F2NA 3R0TA 4ALUA 5GIPE 2R3HA 4JNWA 3R1NA 5E7RA 3VUTA 1JSUA 3RCDA 1XH8A 4FKSA 4U5JA 2OIDA 1XWSA 2EXMA 5J8IA 3BCEA 3ENHA 3SQQA 2XS0A 4AFEA 3ORMA 3G5DA 3NAXA 3OW4A 4YLLA 3V01A 4ANOA 5HOAA 4FR4A 2XRUA 5JSMA 3UNKA 4FODA 4MH7A 5G6VA 3BYMA 3KVWA 4BKYA 1Q3DA 1YHVA 2WQOA 4RRVA 3UC4A 3IGGA 4EK5A 2C0OA 2F7EE 2CNVA 3F3VA 4NIFA 3M2WA 5BNJA 3GT8A 4IWDA 4AXFA 3GOPA 3U87A 1H01A 3IW5A 4KIQA 2UZEA 1XBCA 4HPTE 4RC3A 4LV8A 3ZMMA 2CSNA 1B38A 2XBAA 4MQ1A 3HV6A 4AG8A 5AA8A 3TMOA 4F0GA 4MXAA 1LUFA 5H2UA 4FV5A 2W1FA 2X81A 4FTOA 1ZZLA 5LWMA 3ZOSA 1JKLA 1FPUA 1G5SA 3KULB 2C5XA 5L2QA 4MXOA 2EXEA 3F3WA 3R00A 5AR4A 4DF3A 4AXEA 4FTCA 4G17A 4EOMA 3ORNA 3Q4CA 4D5KA 1YXSA 3OXIA 4AXDA 4BVUA 4FSQA 2XK4A 5JH6A 2VTOA 1UNHA 4I4EA 4FV9A 1KE6A 4FYNA 4PNKA 1M17A 3E5AA 3DB6A 1PMVA 4RMZA 4C4FA 4QO9A 3WE8A 4FEWA 3FXXA 2BMCA 4RT7A 3W2QA 4Y46A 3Q2JA 1A06A 3TTIA 5I9YA 1RDQE 2UUEA 1IAJA 4AS0A 3I4BA 3Q32A 5FTQA 2ERKA 4QYFA 4EH3A 4QYEA 4I20A 4RWIA 3EB0A 5IH4A 4CRSA 1ZRZA 1G3NA 1YOJA 4ZY5A 1WVYA 4PV0A 4IB0A 4EK4A 2OJIA 4FTMA 3RZFA 2XEZA 5KHXA 3DDPA 4ZTHA 2I40A 3ANQA 2OSCA 1M2RA 5DR2A 3ORLA 3VS2A 2Y8OA 1YXVA 5C01A 2PVJA 2W4KA 2QLUA 2C30A 3EKKA 3CEKA 1JKTA 3GCVA 3HL7A 3O71A 2HZ4A 5EW3A 4ACHA 5FQDC 2WMTA 1YQJA 5E8WA 5EKNA 2Y6MA 2Y9QA 2ZFYA 4AAYA 3A60A 3KCFA 3P7AA 2ETRA 3BLHA 3PUPA 2QOIA 3VS6A 3KK8A 2ZV2A 2JEDA 4O27B 4A4XA 3HDMA 5D1JA 3ZRLA 1VJYA 4GT4A 5FTOA 4NZWB 3NW5A 4QP8A 5K9IA 3HX4A 4II5A 3I79A 3IK3A 1PMUA 5L8JA 4E4NA 3FV8A 3WF5A 3KF4A 1IRKA 2YWPA 4HZRA 4BZDA 3F88A 3FHIA 4IZ5A 2XAMA 2A1AB 4X2NA 5HO6A 4OLIA 3TZ7A 2C4GA 2A19B 3ODYX 3F5PA 5CVGA 4TNBA 2QOFA 5AJQA 3C1XA 4BTMA 4IAIA 1CSNA 3BQCA 5KKRC 4BR3A 3FMJA 4I21A 3TNHA 3BGZA 1R78A 1WBVA 3EJ1A 5EW9A 3RALA 4NIFB 3A61A 2IZUA 3LOKA 2UW0A 3SW7A 3SAYA 4RJ6A 4JG7A 2QOOA 2V5QA 1KSWA 4AZVA 3NFFB 4PDOA 3QKMA 5E1SA 4CMUA 5KKRB 5AADA 5KMMA 5JRQA 4BDAA 3ORKA 1UKIA 5HX8A 3CTJA 2IG7A 3GXLA 3ZH8A 4UXQA 5K0KA 1GZ8A 3DBFA 3IGOA 1MQBA 3OS3A 2WAJA 3DAKA 4S30A 3JR1A 3VBVA 2UZOA 2F57A 2ZYBA 3RGFA 4BN1A 2UZTA 5BMMA 3G2FA 3QUPA 4RQVA 5CENA 2JKKA 3PXYA 1OIUA 4UZDA 4BL1A 2ZV8A 3QD3A 4JLCA 4FV8A 5CSPA 2FSMX 5CEIA 3R73A 4ZLOA 4JQ8A 1VYWA 3KREA 4ZJVA 2XIYA 4IB5A 1ERKA 3CPCA 4LI5A 4EJ7A 3RP9A 3E3PA 5L2WA 4LL0A 5E4HA 1W84A 3BHTA 4NCTA 4QDEA 2Z2WA 3FQHA 4CSVA 4FKUA 3EQIA 2XNNA 3IOPA 4KS7A 1Y57A 3UYSA 4BCJA 1OKZA 3EN9A 3ZSIA 2Z8CA 4RJ5A 3MDYA 1YXUA 1F5QA 2XYUA 3LXLA 4MF1A 2WQBA 1UKHA 4JT3A 1A9UA 2YCQA 2R9SA 5D7AA 4RVLA 5HTBA 4LRJA 1DS5A 2E9PA 3EN7A 5ANKA 4BDGA 4I92A 3VIDA 3W55A 4L00A 3VBWA 2YLEA 4OTFA 4IDVA 3NIEA 4DH5A 4MEDA 4DTAA 2IF8A 2PTKA 2YCRA 3UO4A 2C3IB 2OW3A 3R7EA 3OG7A 3QTIA 2X0OA 3D7TA 2PZPA 4NM5A 4EOLA 4EK6A 5HU3A 2OFVA 4K11A 1YWVA 5A4TA 3DBDA 3FAAA 4FI1A 1JLUE 2IEWA 2ESMA 4WG3A 5DHJA 2C5OA 3NVMB 3FMNA 1KE9A 1R1WA 4OGRA 2X8EA 4MXCA 2R3PA 4QTAA 4CKIA 3AT4A 4CMOA 3QXPA 3MH1A 4QTEA 3ZO2A 3PY3A 3S4QA 4C57A 4L53A 3MFUA 2PE0A 4IAAA 4YO6A 2WOTA 4BJJA 4YZDA 5AA9A 2HXLA 4GFMA 1ST4A 2PULA 4JI9A 4RX5A 2JITA 4MWIA 3HNGA 4H1JA 4USFA 2XAOA 4DT9A 4LQMA 5IA3A 4PPCA 2CLQA 1OIRA 2EB2A 2R0UA 3SHEA 5CSVA 4Y72A 4RZWA 4F70A 3NFGB 1OB3A 1TQIA 5CEOA 1AD5A 2XA4A 3HP5A 3I5NA 5CVFA 2YDIA 2Z7QA 3QYWA 1H08A 4TT7A 5CY3A 4DHZA 3BKBA 4XG3A 5IQCA 2GSFA 5CLPA 3EL8A 4G34A 5BUIA 3R71A 3ZFYA 1FMOE 4FEVA 1K3AA 2PVMA 1GIHA 3FXZA 1XH4A 2XB7A 4NCTC 3AD5A 5M53A 3MVJA 5GZ9A 4J52A 3OWJA 5M56A 4LOOA 1TKIA 3GQIA 2J0JA 4HVGA 2PMNX 2OO8X 1PXLA 4RX9A 4D2RA 2CGXA 4DLJA 2WTIA 1WFCA 4N57A 5EYKA 2OH4A 2OXXA 3W32A 3UYTA 3O50A 4KIOA 1R3CA 4K0YA 3EN5A 3H4JA 4JG8A 1OI9A 4PL5A 2G9XA 2YM8A 4YU2A 4FV1A 4AGWA 4ZMFA 2WZJA 3DOGA 4R8QA 2YERA 3MPMA 3OF0A 4UMPA 3C0HA 3DU8A 1OZ1A 3GFWA 3P78A 3EZRA 3R02A 5TT7A 3AMYA 2GS2A 2CGVA 2WD1A 3U4WA 4C4HA 5HE0A 2GQRA 5LMAA 4L7FA 3COHA 3N9XA 4XS2A 5HEZA 2YN8A 4CGAA 5L8LA 4XBUA 3UG1A 2CPKE 4AF3A 3H0ZA 1RQQA 3D7TB 3O96A 4NU1A 3GP0A 4XG6A 3NYXA 1CKJA 4D4VA 1MRUA 2BRMA 4R78A 3KN5A 5C9CA 3GU5A 3BELA 4O0UA 3P23A 3PSDA 4YBKA 4KS8A 2CNUA 1KE8A 3GU4A 2PZYA 1L8TA 4NM0A 4JL9A 4EOQA 1T45A 2HY0A 1PXMA 5ETFA 2J51A 4W8DA 3QKKA 4U79A 3D2KA 4QQJA 5F20A 5EYCA 2XBJA 2KULA 2R3NA 3EZVA 2R2PA 4BJJB 1PXIA 3VF9A 4IAFA 4MVFA 5DGZA 3VWAA 3T9TA 4F9AA 2XNEA 3IDPA 3I81A 3BRBA 2BTSA 5J9YA 4JOAA 3LAUA 4FE2A 1JPAA 4ASXA 1WVWA 2X39A 3D5VA 2IO6A 3EQHA 3Q9YA 4D4YA 2ZB1A 3OVVA 4XOZA 5JGBA 2GNGA 2BVAA 3D7ZA 4FIIA 4RJ7A 2ITQA 3HV3A 3NGAA 4KKGA 5ETCA 2W99B 2CKOA 4GS6A 2PWLA 3DAEA 3H30A 5DVRA 5GIOE 4C61A 2IN6A 4ARKA 4W4VA 2ITOA 5DLSA 2DS1A 3M11A 1KV2A 3H3CA 4DYMA 4QQTA 5KMKA 4MNFA 5HO7A 3QTXA 4E5WA 4QMVA 4FKWA 1GAGA 1W7HA 4ALWA 1V0OA 2X0QA 3VW8A 4UWBA 3MBLA 3BBWA 3B8QA 3QUEA 4CZUA 4DG3E 3MTLA 4BBFA 3HAVA 2GCDA 4O84A 4FX3A 3V04A 4CTCA 3U51A 1XQZA 2QD9A 2J7TA 1YWNA 4EJNA 2VTSA 3U9NA 3VONA 2PL0A 5FDXA 3JS2A 5FEDA 2RG5A 3QZIA 4GH2A 4O4BB 2OJGA 3R21A 3GC8A 3LPBA 2OFUA 4I93A 4MKCA 4AW1A 4FUXA 5AAGA 3JY9A 3ZRMA 3WF8A 5CXHA 3HAMA 4YZCA 1KOAA 1O6LA 2QR8A 3CQUA 2RKUA 2VU3A 3FC1X 3ALNA 5C03A 4CD0A 4HGTA 5DRDA 4F1OA 3EQDA 3GU6A 5AX9A 1OUYA 2ONLA 1MRVA 3OXTA 3UNZA 3EFWA 4R6VA 1ZOHA 2F2CB 5FG8A 2YZLA 5EI6A 3GVUA 2OZOA 5IUHA 5F95A 3JVRA 4YJOA 5GJDA 2YHVA 4FT3A 3Q53A 4V01A 2PUIA 3QLGA 3OTUA 2WQMA 4WNMA 3W33A 4YZMA 2REIA 3R1SA 3QA0A 2UW4A 2A98A 4WKQA 4KKEA 4YC8A 3O17A 1GZOA 2F4JA 3OXZA 3HRBA 3RPSA 4IX5A 2ZOQA 3VC4A 4JIKA 4O91A 2BZHB 3W0RA 2Y4IC 2VZ6A 4ZJIA 2BIYA 2G2HA 2BAQA 3TZ9A 5CNOA 4C8BA 2O3PA 3PWYA 4D2TA 2NRYA 2JD5A 1ZMWA 3CLYA 3QWKA 3UVRA 3BLAA 3R1YA 2Y4IB 4O7TA 3NCGA 4GT5A 4EUUA 1M14A 3MJ2A 4ZZOA 3TV4A 3WI6A 4EOIA 5GJGA 3I5ZA 4OTRA 5HE3A 1UA2A 2F49A 4FVQA 5LVLA 2CN5A 3WZUA 2EWAA 3ORXA 4S34A 5FXRA 3E88A 1VR2A 2VO6A 1KE5A 3PZEA 2RSVA 5B2KA 3SOCA 4DH1A 3C7QA 2IVTA 5HKMA 2WELA 1L3RE 3MPAA 2V22A 5EK7A 5JQ5A 5A4LA 5HIDA 4LMNA 4G1WA 4FNYA 1FGKA 3FZOA 3W0NA 3H9RA 1OBDA 3MN3A 3DZQA 4QRCA 5JFXA 2R3GA 3NPCA 2UVXA 4FSUA 3RAWA 2PMIA 1IASA 3UOJA 1OITA 5BV3A