1GZNA

Structure of pkb kinase domain
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
296
structure length
271
Chain Sequence
KVTMNDFDYLKLLGKGTFGKVILVREKATGRYYAMKILRKEVIVTESRVLQNTRHPFLTALKYAFQTHDRLCFVMEYANGGELFFHLSRERVFTEERARFYGAEIVSALEYLHSRDVVYRDIKLENLMLDKDGHIKITDFGLTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHERLFELILMEEIRFPRTLSPEAKSLLAGLLKKDPKQRLGGGPSDAKEVMEHRFFLSINWQDVVQKKLLPPFKPQVTSEVDTRYFDD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Kinase
molecule keywords RAC-BETA SERINE/THREONINE PROTEIN KINASE
publication title Molecular Mechanism for the Regulation of Protein Kinase B/Akt by Hydrophobic Motif Phosphorylation
pubmed doi rcsb
source organism Homo sapiens
total genus 69
structure length 271
sequence length 296
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2002-05-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
A PF00433 Pkinase_C Protein kinase C terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 1gznA01
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 1gznA02
3Q4TA 4EC9A 2W17A 3UZTA 3AT3A 4YLKA 4K2RA 4ZJJA 3SXFA 3W8QA 2YLEA 3DPKA 5JSMA 1H08A 2YM4A 2YABA 3BE2A 3E93A 3FZTA 5HNGA 4D2VA 4DG3E 5IH5A 4YJPA 4FR4A 2Z7SA 3MBLA 3VS2A 2PVLA 3C13A 5EYKA 4Y72A 4DYMA 5B2KA 4ONAA 1UKIA 2OJGA 4HVIA 5ICPA 4QMSA 1OL6A 3UP7A 4KIKB 4UXLA 5AP1A 4GU9A 3MB6A 2EXEA 3DCVA 4DT8A 3UBDA 2VX1A 3QA0A 3V8TA 4ANQA 5BYYA 4LFIA 2GNFA 1WAKA 3HA6A 4U3ZA 4B0GA 4MAOA 5M55A 5DR6A 1SVHA 3F66A 4EUUA 4PQNA 3OW4A 4AGDA 4GIIA 3SA0A 3ORMA 3TKUA 5J9YA 4MXOA 5M57A 4V01A 4LG4A 4YR8A 4JG8A 4MBLA 1Z9XA 4FV7A 2BHEA 1Q3DA 5HIDA 4EJ7A 3FDNA 5DBXA 5D7AA 2C30A 3FZ1A 3QU0A 5J87A 1VZOA 4IE9A 4QMVA 3ZRKA 4D5KA 4ZY4A 5LQFA 1UNLA 1PMNA 2XCHA 5AR4A 4HJOA 2F57A 3UP2A 4F7SA 2ONLC 3FE3A 3IECA 3PG1A 1RJBA 5M51A 4H3BA 1ZZLA 3Q9WA 3MVJA 2CCIA 4ITHA 2LGCA 1YI6A 4HVGA 2WAJA 3AC5A 3CC6A 5IA2A 4M69A 2R3NA 2VU3A 2RFEA 3C5IA 1AQ1A 4AW5A 4Y85A 4XOZA 3Q53A 5F1ZA 4YLJA 3TV7A 1U5QA 1MRYA 4DEHA 3QTIA 3DY7A 4ZLOA 2QONA 5JFSA 2CMWA 3FV8A 2J0LA 3DGKA 2JIIA 5KE0A 2WMQA 4JL9A 1JWHA 4AF3A 3CY2A 4HVHA 5GZ8A 5HX6A 2HAKA 4FA2A 2BIYA 4GT3A 3DLSA 4J98A 2PU8A 2J51A 5GJFA 4USEA 4BGHA 3QC9A 2GFSA 4O0TA 5FTOA 2RKUA 5CU6A 3FL4A 2O64A 2P33A 2PK9A 1W8CA 4NCTA 3NEWA 4HPTE 4RVTA 2PVRA 4XLVA 3UNJA 3QQGA 4RT7A 4CZTA 5AAGA 1XO2B 3N4UA 4LI5A 2R64A 2UZLA 3VF8A 3IW8A 2QD9A 4MTAA 4KKEA 4WOVA 5CVGA 4XS2A 4FNXA 3S4QA 5IUIA 5LVNA 3DBFA 3R8ZA 3ORXA 3QGYA 5ANDA 2XRUA 3PXRA 4EI4A 2WEIA 1R1WA 4IAKA 3B2WA 4BB4A 3EIDA 3U8WA 2OIQA 1ZZ2A 3PE2A 3SW7A 4MF0A 5A54A 5T6KA 4TWCA 4CYJA 3ZUUA 4I1ZA 4MBIA 4EK3A 3D5UA 4F63A 3DBEA 3NYXA 4WNPA 1NVSA 4EYJA 5AP3A 1PHKA 4BYIA 5IQFA 3DZQA 1U54B 3LXKA 4FBXA 4BWPA 4JT3A 1PMUA 5DEYA 3U9CA 3QRTA 5EK7A 4EORA 4AW2A 5JGBA 5C4LA 2JDTA 2X4FA 2XVDA 3E62A 3QTUA 2Y6OA 3O0GA 1J7UA 5CEPA 1AD5A 3KF4A 1ZOGA 4IM2A 4R7IA 4XBUA 4RVKA 4M66A 3E7VA 4FV0A 2WTIA 4RQKA 4C4HA 5ANIA 4YSMA 2V5QA 3GB2A 4D4RA 3BU5A 4EYMA 1JKSA 4PMSA 4EH9A 3QTQA 2QKWB 4RJ8A 5CZHA 4RA5A 2XCKA 2YM7A 3LLTA 5IQBA 3GC9A 3RPYA 4QMZA 1KOBA 3RNYA 3HP5A 2VWYA 1UU9A 2YAAA 1J7LA 2JKKA 2XYUA 1YKRA 4ZS4A 5FP6A 3UC3A 4AZWA 4C3FA 3OXZA 5M4UA 4FZAB 1U59A 1VEBA 3QAME 4Q5HA 4QP9A 5DRDA 2WELA 1NVRA 3D2IA 1ZLTA 5BVEA 3WARA 5E4HA 3FAAA 4U80A 4NL0A 2XZSA 3ALNA 1W98A 4S32A 3R7EA 2R3KA 1Q8YA 1A9UA 1Y8GA 2FGIA 2OSCA 2RFDA 3MI9A 3UVPA 2UVZA 3A2CA 3OWPA 3PSCA 2PUNA 4FSNA 2OIDA 1GY3A 5CSPA 4YNEA 2BAJA 5GZ9A 3GEQA 2WMXA 5I9YA 4O7LA 5TF9A 4ZZMA 3EKKA 1DAYA 3Q32A 2BRGA 4XV3A 3BU6A 4F9AA 5L8LA 2G01A 2I6LA 2IVVA 3MGYA 1KWPA 4O7TA 5LCKA 4O7SA 3RPVA 3PXFA 4GU6A 3GENA 1OL1A 4CFFA 2JD5A 5H2UA 5C1QB 4FK3A 4IM0A 2YWVA 2W5AA 4DG2E 4BCGA 5GIPE 2Z2WA 2FSTX 2VTMA 2NNWB 3ZLSA 3LMIA 3DFAA 3NVKI 3CD3A 3UOLA 5HO7A 3H9FA 3ULZA 4DLIA 1RW8A 4L00A 3HA8A 1JVPP 2RG6A 4IB5A 4A9TA 5AAEA 5J5SA 4W4WA 1IG1A 2E9PA 4IJPA 4IZ5A 2F7EE 3BX5A 4YUQA 3ZHPC 4DITA 2WMBA 2QKRA 3HV7A 3Q9XA 2XNMA 3EQCA 3QGWA 4C02A 4F4PA 2W1FA 4BCMA 5AP6A 2R0IA 3DK6A 3DAEA 4G2FA 3ENMA 4BY9E 3AC2A 1YOLA 3POZA 4YJVA 4MF1A 4RRVA 5T68A 2CCHA 1ZXEA 4H1JA 4IEBA 3A4PA 4XRLA 4H1MA 4QMUA 4GRBA 3QBNA 4AG8A 4D55A 3S1HA 5HG8A 2J5FA 4NWMA 5FEDA 5KMIA 1GOLA 2W1GA 3C0GA 4DF3A 4G9RA 4JOAA 2XKEA 5LWNA 4ALUA 2Y4IB 3R71A 3VS1A 4ZMFA 2FSMX 2RFSA 1ZYCA 3LLAA 3FUPA 2QU6A 3NW5A 4EZ3A 2CGWA 3KXZA 5L4QA 2C6TA 4FKUA 2UW8A 5C8KA 3L8PA 3PY3A 3QYZA 4M3QA 3Q5ZA 3R30A 2F2UA 4MXCA 4AFEA 3N4VA 3GOKA 3PLAE 4U5JA 1FMOE 1LPUA 3AD6A 5ANKA 3EZVA 5JKGA 5AIKA 4UMRA 3QQJA 3DTWA 3PRIA 4JBOA 5AA9A 3S0OA 2JKQA 3V5QA 3HDNA 2W1CA 4IB0A 4P5ZA 1O6KA 4IVBA 3UO6A 2KULA 1QPJA 4GG5A 2XJ2A 1DAWA 2VRXA 5HKMA 1XH7A 2HK5A 5DRBA 4DBNA 3NMUF 2W5HA 3E8DA 4LOQA 4TWOA 3DBQA 4XNEA 3FPQA 2C6IA 1OBDA 4FL3A 4FGRA 3OS3A 4F6SA 1O6LA 4NCTC 3WF5A 1YXXA 4QMWA 2YIWA 1XBCA 4YZNA 2F9GA 4DA5A 4FKIA 3RJCA 2HYYA 2YHVA 2CLXA 3OT8A 4QP2A 3UIUA 2A19B 5JZNA 4CMUA 4D9TA 4IZYA 5I9VA 4XX9A 4RG0A 5K4IA 3I5NA 4FZ7A 2GTMA 3BYVA 4GK4A 4NTTA 4PP9A 4R5SA 3NUUA 2XMYA 5EM8A 5M09A 1GNGA 2O2UA 5L8JA 3LXLA 2ZYBA 3A7HA 2YLFA 3KULA 1T45A 4O27B 3H30A 2Z7QA 3MA6A 4ACHA 5B2LA 4W9WA 4J95A 3AD5A 5D1JA 4XG6A 3KEXA 4EOKA 4P7EA 3UQFA 4FTCA 4WIHA 3A7JA 1U54A 2B9JA 3CY3A 4ZK5A 4FEXA 2C68A 2IZSA 5C4KA 4IWDA 3OCTA 3RCJA 2PMNX 2WB8A 1CKIA 2ZB1A 3BWJA 3KMMA 4KRCA 4TW9A 1MQ4A 4EWHA 3OOMA 3OHTA 4RWKA 4Z55A 2R3HA 3NNVA 5E8WA 3QD4A 3NUAA 4CCBA 4L3LA 2BRNA 2C5YA 2NRYA 4ALVA 5EH0A 5BPYA 1TVOA 2VTJA 2I7QA 4X6RA 1KSWA 3GU6A 3EB0A 1G8AA 2OGVA 3LCKA 2UW3A 1LEZA 4FMQA 4F09A 5KMJA 1QL6A 2WQBA 4USFA 1QPEA 4E4XA 3ULIA 2BFYA 3ET7A 4IZAA 2G9XA 2WTWA 4EOLA 4RVLA 4G17A 5KMKA 3LFSA 1URCA 4MD8E 5AR2A 4EK5A 2B54A 4ITIA 3GXLA 3OBJA 4BICA 3VUTA 2C5OA 4H58A 2I0EA 3RWQA 3UQCA 5AR5A 3AOXA 2C6LA 5CNNA 3I81A 4TKSA 1Q4LA 2JEDA 4WUAA 4BDAA 1Q99A 4FKGA 1JKLA 4RX7A 5DWRA 2C3IB 3F2NA 4J52A 4IC7A 2GHMA 2IWIA 5D41A 3QHWA 3TN8A 1KOAA 2X9EA 4D4YA 3EN6A 3ZFMA 2ITZA 4GUEA 4UY9A 3C50A 2HOGA 3EHAA 3WE8A 2W1HA 4ZLZA 3QTSA 1BX6A 3NUPA 2OXYA 5I9UA 4YHFA 4FUYA 4UV0A 3GU8A 2QO2A 3DJ7A 3O96A 4YPDA 5HBHA 3WZJA 4A9YA 1S9JA 3PSDA 2XNNA 3G33A 4MD9E 2Y6MA 4PDPA 2WZJA 2R7IA 5CAUA 4H05A 1R3CA 4ACMA 5I3RA 4MNFA 2OI4X 3PXQA 1J1BA 2Q0BA 2UZTA 4HZSA 3B8QA 4OUCA 4N57A 4DGMA 1UNHA 2QCSA 4FV9A 1ZYJA 5JQ5A 3VW6A 4TWNA 2WMTA 2F2CB 1YOMA 2J0MB 3HMOA 3THBA 2OFUA 2OXXA 2VTHA 3DK7A 5HTBA 5BYLA 2GNIA 1GIJA 4GYGA 3DDPA 5BMMA 5KCVA 3DKGA 4G3EA 3OD6X 4IVDA 3VW8A 4G9CA 1REJA 3JPVA 4FEVA 3FZRA 4YNOA 4Z3VA 1XH9A 4MVFA 4C33A 4AGUA 3MYGA 4FZDB 1VR2A 4FKVA 2Q0NA 2I1MA 4AT5A 3EZRA 3ZBXA 4V04A 1FMKA 3D15A 3ZBFA 4C0TA 2CKQA 3CQWA 3GC8A 4WBBB 4C35A 2W99B 2WFYA 3R8LA 4KS7A 2VTIA 1M2QA 5AP5A 5E8YA 5CLPA 2PUIA 4RQVA 3GU7A 4CG9A 4YTFA 3MFSA 5FTGA 4UXQA 5E92A 3UPZA 3SOAA 3OUNB 5GJGA 5IA5A 3EN4A 4ZZOA 4IBMA 1QMZA 4U81A 4JX3A 4WSYA 4U7ZA 4FIGA 3GQIA 2R3OA 3BYUA 4CFVA 5HLPA 4UYAA 3K5VA 4TY1A 3F82A 3POOA 2GNLA 3P7CA 5H9BA 4CFNA 3U87A 4YZCA 3RP9A 3WF9A 2B4SB 4F65A 5CEKA 4Q5EA 4O0RA 4PTEA 3G6HA 5JT2A 3BGPA 4QTBA 4R6VA 5EHOA 4GG7A 3QYWA 4BDFA 1KV2A 4R3RA 5C03A 2OW3A 3D9VA 3DS6A 2R3LA 3OW3A 4NKSA 4K18A 4AN9A 1NY3A 3H0ZA 4F99A 2PVMA 3E7OA 4CFWA 3D4QA 2WMVA 3KVXA 1Y8YA 3FJQE 2W06A 3CLYA 3Q3BA 5AUWA 4C2VA 4K1BA 2ZVAA 4IB1A 4O0UA 1W7HA 3QD3A 2C1AA 3QCSA 5CYIA 4J8MA 2X2KA 1YQJA 3CJFA 3Q2MA 3QQHA 5FXSA 4UWBA 3R7YA 3RKBA 4B9DA 3KN6A 1HCLA 3LXPA 3WYYA 2GFCA 3F6XA 3UMXA 3KXGA 5CNOA 4BKZA 3PIZA 4FT5A 1MP8A 2W1IA 3VUDA 5HX8A 3O17A 4TNBA 4GMYA 2IZUA 4CMTA 3RAIA 2PZYA 2WXVA 4KA3A 2R0UA 1JPAA 2OF4A 3JY0A 5C9CA 4UWYA 4RC4A 1WBTA 5M08A 3R04A 3QTXA 3ZUTA 4LRKA 3OOGA 2C47A 2G2HA 5IEYA 1WVYA 2QOHA 1OIQA 3I79A 3OCSA 5A4LA 4ZJVA 3KK9A 2CNUA 1JQHA 1GZKA 3DU8A 4YZ9A 5AR7A 3RNIA 4DEEA 3NYVA 2A4LA 2WOUA 2BZJA 3GI3A 3Q5IA 4FV2A 4MKCA 4RJ7A 4UMTA 3BYSA 3COKA 4HVDA 3QRUA 3PXKA 3R8UA 4IWPA 2WTCA 4N70A 3VS4A 4DN5A 3PVUA 5CI6A 2GNGA 3R2YA 3F5UA 4W4VA 3V5PA 2G2IA 4O81A 3C5UA 3E3BX 4DFNA 2WHBA 4L01A 3HMNA 5DI1A 2BAKA 3TI1A 2YCSA 3A8WA 3QQLA 4RWLA 4NU1A 3V8SA 3TZ7A 4CFUA 3ETAA 5EHLA 4I0SA 4OT6A 4YJRA 4IH8A 2VNYA 5CSXA 5IQCA 3HL7A 3LE6A 2CGVA 3QUDA 4PL5A 2V0DA 3RBWA 5L6OA 5B2MA 4QYHA 4IX5A 4JJRA 4L8MA 2IN6A 2NO3A 3IDPA 2XNBA 5LWMA 5LMBA 3I0QA 4I6QA 3QA8A 3M2WA 4TYGA 3WOWA 3SG9A 3R1QA 3TTJA 5HNIX 2CNQA 4PPBA 4CLJA 3W10A 4NFMA 4BI0A 3ITZA 3U4UA 3I6UA 3F9NA 4FKRA 2XKFA 5EOLA 5C26A 4KKHA 3OBGA 5HOAA 4L44A 3ZO2A 4CTCA 4OTPA 2RFNA 4QT1A 3FZPA 4JBPA 4ASEA 4ACGA 4BRXA 3ORLA 1Z5MA 3OWJA 3QX2A 3CGFA 4QP1A 4S34A 3VHKA 3ORPA 5JZJA 4QP4A 4GH2A 2UZUE 1J1CA 1PXKA 3LHJA 1O9UA 4E3CA 1QPDA 2F49A 3O2MA 3IO7A 3LJ0A 4FTMA 5DG5A 3FKLA 2C3JA 4WNMA 2XBAA 4BWKA 1JSTA 4Q2AA 5A4EA 4ANSA 2C6EA 1G3NA 3ZC5A 3BLHA 4ANOA 5CF8A 4DE4A 2OU7A 5AP7A 5EW8A 4L42A 3BQCA 5J95A 4BHNA 4DGLC 4NT4A 4D4SA 3DBCA 2ZJWA 3AC8A 1OVEA 3QWKA 4NZWB 2XYNA 2QOIA 3R9NA 3OCBA 5F94A 4IJ9A 3TIZA 3WZEA 4X3FC 4JR7A 2B9FA 5HI2A 4X2JA 1GZ8A 4O21A 5FG8A 4DFXE 4XV9A 4FTUA 5I0BA 1M14A 3OWLA 3UIBA 4QPAA 4NIFB 1KV1A 4QMLA 3ZXTA 3G51A 3WE4A 5FLFA 4R7BA 1MRVA 3P7BA 4N0SA 4PTGA 4OR5A 4R1YA 4BGGA 4U44A 3ZRMA 3E87A 3HECA 4LUDA 2O63A 2PE2A 5LJJA 3QFVA 4HVSA 4CRSA 5EDRA 5DGZA 5HG5A 3NYNA 1WBOA 2BFXA 3R21A 4A9RA 4QMQA 4NFNA 5C27A 5EW9A 3MPTA 5IISA 4Z9LA 4J7BA 5HU9A 5JMSA 2R3FA 1OL7A 4JQ8A 3QCYA 2R3MA 4PNKA 4XH6A 2ITYA 3EN9A 2J0KA 5AFVA 2VWXA 5AP2A 4WG5A 5FM2A 4CLIA 5CF4A 4KKGA 2C3KA 1IEPA 4APCA 4DH7A 3KRLA 1Q62A 5AJQA 3LFQA 5KKRB 1TQPA 4CD0A 4MXAA 4QMXA 1OPKA 5A4TA 1PJKA 2W9FB 1WVWA 5K3YA 2JIUA 3QRKA 3DLZA 1NXKA 4FG9A 4FTTA 4ANBA 3PTGA 4BFMA 4CQEA 3A4OX 1YI3A 4AS0A 3LXNA 3QF9A 1SNXA 3O8UA 3MY5A 3LFEA 2P2HA 4JNWA 3RM6A 3WZDA 1GZOA 1KUTA 4FSMA 4DFZE 3AC3A 3PVGA 5FBOA 5AV0A 5J79A 2YZAA 1LUFA 2BILB 3ANQA 3R22A 3ALOA 1RE8A 4PNIA 4AZSA 1GJOA 2YCFA 3NS9A 4IWOA 2CN5A 2PZIA 3LQ5A 4HOKA 2YDJA 2OH4A 4A4LA 5K0XA 3PJ8A 3QCXA 4CFXA 1DS5A 4E73A 2V7AA 3LIJA 3EFLA 3QRIA 4EK6A 5DMZA 5L2WA 4FZFB 5BUJA 4PDYA 5HBJA 2BRMA 3AC4A 3TV6A 3UIMA 1H24A 4BN1A 5L3AA 3MDYA 1BI7A 5DR9A 4WUNA 3FLWA 3C9WA 5GHVA 2CLQA 2WTVA 3DXPA 3QC4A 2XK9A 1HOWA 2OJFE 3O8PA 2H9VA 2ERZE 4YP8A 2IW8A 3CBLA 4K33A 5LCJA 4L43A 4EK4A 5JK3A 2XB7A 2VTNA 3EJ1A 3CCNA 2I0VA 3R73A 3KRXA 1RDQE 2EU9A 3IW7A 4U40A 4YHJA 3R7GA 4CMOA 4EH2A 4O1PA 3LQ3A 3V5JA 3F7WA 5FWKK 3FMDA 4TZRA 5BMSA 2IZTA 3I60A 4QMMA 5DT4A 4BCJA 4A9SA 4W4XA 5CAOA 1BMKA 1ZWSA 5BYZA 4KUJA 2YJSA 3LM5A 3VUIA 4NEUA 3DAJA 3E92A 2ZV2A 2WGJA 3AC1A 4L45A 1OKZA 3NUSA 4DH1A 4GK3A 3D5XA 3NCGA 4FL2A 2XH5A 5CENA 4DFYA 4ITJA 4O38A 4Y73A 5E8ZA 4RWJA 2W1EA 3QKMA 2J4ZA 3UGCA 3OY1A 4AZEA 4C34A 3PIYA 5CU0A 2VTTA 3F5PA 4E6AA 4APPA 3WIKA 2UW0A 4GFGA 5EYDA 2XEYA 4MXZA 5IDPA 3JVSA 3W32A 3OVVA 4V0GB 2YM6A 4GK2A 4GCJA 3DDQA 1SZMA 2QLUA 2W1ZA 2ZB0A 4FX3A 1JLUE 4RC2A 4R78A 5HESA 3HV5A 4BI2A 3PPKA 1L8TA 1A06A 4EONA 2HXLA 1B6CB 3DJ5A 3BELA 2YIRA 1B38A 1GIHA 3UVRA 5IEXA 5HEZA 4J1RA 3LW0A 1Q97A 4N6YA 2OXDA 1LP4A 3I6WA 1JBPE 3QWJA 5D12A 4U43A 4BZOA 4DEGA 5AV4A 4DLJA 5CXZA 4GIHA 3CEKA 2W5BA 5EOBA 2X8IA 3NUNA 5CVHA 4F70A 3CTHA 2X6DA 3LKMA 3S00A 4I92A 5IG1A 5AADA 1FBNA 4C57A 3K5UA 4X7QA 4QYEA 4OTFA 3SAYA 4J96A 4O1OA 5FXQA 5L2QA 2WQOA 4CT2A 3VS5A 1M17A 3DXNA 4AZVA 1WVXA 2PVHA 4G3CA 2PUPA 3QQFA 5M06A 3R8PA 4RFMA 3I7BA 4UALA 4GEOA 3MIAA 4Y46A 3ENHA 4C3PA 3F2RA 3JUHA 3UOJA 4G1WA 4EBWA 3UMWA 4RX8A 2C3LA 2P2IA 1QPCA 3C4EA 3FXXA 2IJMA 5EM7A 2BTRA 4TN6A 1XH8A 3NDMA 1XWSA 4WRGA 4YZDA 5C8MA 4OBOA 3V6SA 5DEWA 2X9FA 1S9IA 5IKWA 2C4GA 1FGKA 4USDA 1KE5A 3IONA 3RHXA 4RJ5A 5FEQA 1ATPE 1Q61A 4FG8A 1YOJA 4RIWA 2HWOA 2PMLX 2UW6A 4DTBA 3ZSGA 5A46A 4I0RA 4RC3A 3A8XA 3EL7A 5EM5A 5J7BA 2W9ZB 3AGLA 4CXAA 4O7WA 4FKSA 4HYIA 2GS2A 3ZLXA 4CSVA 3TACA 2QURA 2GDOA 2FSLX 4M13A 1FGIA 2R7BA 2WPAA 4M68A 4BZNA 3ATSA 1H07A 4LRJA 5M07A 2GHGA 3PP1A 3F5GA 3O7LB 2GCDA 2YZLA 4ZY6A 3MN3A 2QNJA 3ZM9A 5BVFA 2WTKB 2JKOA 4MQ2A 5I9XA 5GZAA 1U5RA 2UZDA 4P2KA 4NIFA 4IFCA 4YTCA 1H8FA 3EOCA 1ZOEA 4FTQA 3TJCA 1KE9A 4FKOA 4MK0A 4F7LA 3TKIA 4E6CA 3E63A 2VTLA 3C4CA 5G6VA 4QD6A 3PA5A 3G0EA 5K5NA 4ZOGA 4BTJA 3ZCLA 4KINA 3ELJA 4LL5A 3C4ZA 5ACKA 4XP0A 5DFPA 2Y9QA 4F6WA 4EUTA 4EK8A 3R28A 4U97A 3PPJA 1PXMA 3ERKA 4D28A 5L6WL 3BV3A 4AFJA 1YVJA 3R00A 5DH3A 3UDBA 3VUGA 3KXNA 4FV3A 3KQ7A 4C58A 5DE2A 3DK3A 3QX4A 3R7UA 4ZJIA 4ENYA 4ERKA 4ARKA 4V05A 3KF7A 2PVYA 4O0VA 3O23A 1H4LA 4O7NA 3CTQA 4K0YA 3EQBA 2REIA 2BRHA 2G1TA 5FXRA 3OP5A 1OL2A 4UYNA 3G0FA 3ZYAA 3EFWA 3O51A 3RWPA 2ITNA 3OMVA 4BCPA 4PX6A 1BL7A 2QHMA 4L53A 5FP5A 4PL3A 3BCEA 4TNDA 4GYIA 3RHKA 5L2IA 2ZV9A 5J1VA 4FTAA 4M0YA 5M56A 3VJNA 2X81A 1KE6A 1W0XC 1WZYA 2H8HA 3OF0A 3P9JA 4UEUA 3ZXZA 2UZNA 4RZVA 4YURA 3V6RA 3HEGA 1K2PA 4D58A 4JDHA 1OKYA 3JVRA 4ZP5A 1WBPA 1H1QA 3F69A 4F9BA 4RJ4A 5DYJA 5F20A 2F7XE 5B7VA 3EWHA 4LGGA 1R0PA 2Z60A 3TZMA 3UE4A 4KIKA 4DFUA 3VBVA 3E5AA 5M4FA 4FOBA 5ETIA 5A9UA 5CU3A 3E3PA 2JIVA 3FC1X 3F2AA 3C4WA 4X3FB 2W96B 3CE3A 4I41A 2QOFA 5DN3A 4XOYA 3T9IA 2DQ7X 5DIAA 5I4NA 2P55A 4NM7A 1GZNA 4MNEB 2GHLA 3IW4A 2C6DA 4ZAUA 3Q9ZA 3KXMA 4JIAA 4ACCA 2BVAA 1H26A 2Y0AA 3L9PA 4K8AA 1WBNA 3KREA 2J9MA 4G31A 4HGTA 4XG8A 3V04A 3ZFXA 5A4QA 3DB6A 2GQRA 4QP8A 4I5MA 2KTYA 3EL8A 1PRYA 4CKRA 4ZTRA 5CT7A 1XR1A 3PJ2A 3BHTA 3ZFYA 4XYFA 4WA9A 4CZUA 5AUZA 2I0HA 4IAIA 2YACA 4C37A 4EH5A 3VIDA 5KNJA 4EHGA 4GUBA 2EVAA 2JFMA 2A2AA 3EFKA 5CSHA 4ZZNA 4FF8A 4MX9A 5AUTA 2VWUA 4BCKA 2DWBA 3HMMA 4QQ5A 4EH8A 4C4IA 3AMAA 4HYHA 1OECA 4V0GA 3REPA 3RTPA 4KIPA 5IDNA 2OF2A 3UNZA 4TYIA 3PXYA 2PMIA 3K3IA 1U46A 4PV0A 4RFYA 3SKCA 2XM8A 4JQEA 3AD4A 4WD5A 3W1FA 3LCDA 5E9EA 2XIZA 2CNVA 3NCZA 2VTAA 3VUHA 4YJQA 4BDIA 3MFRA 4I3ZA 5F95A 4J71A 4BZDA 3DTCA 3FLSA 3KCFA 4M84A 5TO8A 2E9UA 4QRCA 3VBYA 2JAMA 3BHYA 2PZRA 3CQUA 3K3JA 4CZYB 3FI4A 3LFDA 4QP3A 3W2CA 2CKPA 1FINA 4BCHA 4EQUA 3UJGA 4E26A 2C6KA 3F61A 3W2OA 3L9LA 3NUYA 3A60A 5BX0A 4FE2A 2BZHB 5CI7A 3KN5A 3LOKA 4M8TA 3IPHA 2XK7A 2FVDA 5EYCA 5HQ0A 5KMLA 5BVOA 2GQSA 2XA4A 4RIOA 4BBEA 4C61A 3G2FA 2BZIB 2RF9A 3I1AA 4F0IA 1GAGA 4KSQA 3W55A 3GU5A 5J9LA 2HZIA 2B53A 1H01A 5E90A 4XBRA 2X6EA 2VGOA 1FVVA 5D9HA 2QG5A 4PDSA 2NRUA 3ORKA 4QMPA 2YERA 4J53A 3UO4A 4JXFA 3LCTA 3MJ1A 3Q96A 3UODA 3PG3A 5IMXA 4K9YA 3FWQA 2ESMA 4R3CA 4ERWA 3FY0A 3OFMA 2QOBA 1M7QA 3KRRA 4XJ0A 3EMGA 3R0TA 3ZC6A 3R6XA 4WSQA 2ZDTA 2PSQA 4EWQA 4MXYA 4HNIA 4BBFA 3FMHA 5CAVA 3R2BA 3GVUA 3CP9A 1DI9A 4G6OA 3DXQA 2QLQA 4ZTSA 3ZO3A 2EUFB 3IOKA 5ETAA 4IAFA 4E4MA 4LGHA 3I7CA 1BYGA 1HCKA 1OPLA 3DQWA 1W84A 4CV9A 1DI8A 1FVRA 4AOJA 2YM8A 1G5SA 1LR4A 4IHPA 4D1SA 3MH1A 4AN2A 4YBKA 4ZEGA 2ETMA 1V0PA 3P1AA 4FOCA 3FI2A 3UNKA 1SM2A 5KMMA 1PXOA 5GNKA 3W2QA 1OKWA 3KFAA 4O7VA 2W0JA 3HRFA 5KMNA 3HRCA 1WBSA 1V0BA 4H3PA 4QPSA 5KBQA 1FVTA 4L7SA 3FYKX 5CS6A 5IUHA 3HV3A 1DM2A 3OWKA 3RVGA 3PVBA 1JKKA 1ZOHA 2HY0A 3L8SA 4I6FA 3BGQA 2UZEA 3PPZA 4JIKA 4FEWA 1OB3A 4ANLA 3GC0A 3LJ2A 4AAAA 5IQDA 3ZS5A 4XUFA 3MWUA 2Z7RA 3A99A 3SVVA 4R1VA 4PRJA 3U54A 4AACA 5JRQA 3KB7A 3FMKA 3Q4UA 5DOSA 2R3PA 5HTCA 4GJ3A 4XG3A 2PULA 1LEWA 2VWBA 3O8TA 2BUJA 2OICA 2OIBA 2YN8A 4IADA 5IA0A 2PPQA 4D0WA 3GCSA 3ID6C 4B4LA 3H10A 4KRDA 2P4IA 5FM3A 1X8BA 2NPQA 3ZTXA 5FRIA 3NWWA 1M2RA 3L8VA 2QOOA 5F9EA 5FUTA 3G15A 5HBEA 2YIYA 2ITPA 3ODYX 3MY1A 4RIYB 2QI8A 5LMKA 2Q83A 4GVAA 3TG1A 4BTKA 2XK6A 4IACA 3RPSA 3T9TA 3LFBA 1WBVA 3FYJX 3WBLA 4IM3A 4DEDA 2HW7A 5CTPA 3KKVA 4FTJA 2LAVA 3VBQA 3FLQA 4DHFA 2BKZA 4F7JA 2A1AB 2OFVA 4HCUA 3CS9A 4EQCA 3DB8A 2VWZA 3OG7A 3NIEA 1Q41A 3ORIA 4FSWA 5CEQA 1PXNA 4FTRA 4LMUA 3RAKA 4RBLA 3EQGA 4AT3A 2ITVA 1SVEA 2WO6A 4OTHA 1M7NA 3LMHA 2CKEA 1H1SA 4IZ7A 3IW5A 2JAVA 2OJ9A 3M42A 1XH5A 2VV9A 3A62A 3F3TA 2GNHA 2ZM1A 4O7YA 3FBVA 5EI2A 4FSQA 4IX4A 4IVAA 5EI8A 2PVJA 1H1RA 5IU2A 1V1KA 5A3XA 4I93A 4AA0A 2C0TA 4OT5A 1YXUA 3SHEA 3SQQA 2JBOA 4IW0A 4U79A 2OH0E 4FV5A 1B39A 1QCFA 4CVAA 2W05A 5JFXA 4PL4A 4TRLA 4R8QA 3PWYA 4PF4A 1PF8A 3CXWA 2X7OA 3DA6A 5E1EA 1YHWA 3W16A 2JKMA 3AG9A 2W4JA 3CJGA 3FKNA 4YZBA 4FTLA 3TUBA 1XBBA 3OROA 4IANA 2EXCX 3SRVB 3ZO4A 3F3VA 4ZS0A 3FSKA 2VTPA 3BBTB 4O2PA 4RJ3A 4U42A 5ANEA 4RZWA 2YM3A 3IOPA 4D1XA 4ASDA 2X1NA 2OZAB 3JR1A 1PW2A 3MVMA 4PPAA 3MPAA 4KBKA 1PKDA 2HELA 3W2RA 4EC8A 3R9DA 2WQNA 3IK3A 2ZMDA 4XG4A 2PTKA 4IQ6A 4Y95A 3TKHA 5FD2A 5IMEA 4E1ZA 1H1WA 3C0IA 5HG9A 1Y91A 2CPKE 4A07A 3U6HA 3LAUA 1YDSE 3UZPA 4QMNA 3DKCA 4YTIA 4YJNA 4I5PA 3ZUVA 4JAJA 4KIQA 2C1BA 5BUIA 4RPVA 4ZMEA 3G5DA 3C1XA 4PMTA 3OUKA 5HD4A 3EYGA 5HGIA 2R3JA 5HE1A 2GU8A 1YW2A 4EH6A 4YU2A 4YSJA 4MHAA 1MQBA 3MSSA 1P2AA 4FEUA 4ASXA 4X6QC 2QC6A 4N4SA 4IFGA 4BDHA 3MH0A 2VUWA 3R1SA 5A6NA 5IA3A 2XKDA 4IDTA 1CSNA 3QL8A 2E2BA 5GJDA 4E93A 4OAUC 3E88A 3C4XA 3KVWA 4RVMA 5ANJA 4Z7HA 4DTAA 2UV2A 3BE9A 1OUYA 3HP2A 2XRWA 5E8SA 3BLQA 4AZFA 1IRKA 3JYAA 3BU3A 4OBQA 1M52A 5TR6A 4BTFA 4YMJA 3FL5A 5HO8A 2X8DA 4FKLA 4QYGA 4E7WA 4BYJA 3BZ3A 5ETFA 3RI1A 5EKOA 4A06A 1XH6A 2XF0A 1ZYSA 2P0CA 3WILA 5CANA 2G15A 3DKFA 4MCVA 3NW6A 2UUEA 3FLZA 5KZIA 5CU2A 3KK8A 2ONLA 1M2PA 4LQMA 3N4TA 3EKNA 3SLSA 4AOTA 3QZHA 3V8WA 4O83A 2R5TA 3OEFX 3OTUA 4GFOA 3VN9A 5CEMA 4I22A 4FSYA 4BIEA 5A14A 1OITA 3NZ0A 2Z02A 3C51A 4RGJA 3OCGA 4FIIA 2QQ7A 3RAWA 5HU3A 1UU3A 4JQ7A 4UZDA 4JX7A 2JLDA 2HZ0A 2CDZA 4HCTA 4B99A 5HO6A 3Q4CA 3TNHA 4LV8A 3V5WA 3EQDA 5HG7A 3RM7A 3ACJA 4FGBA 4IMYA 1OIYA 4EHEA 3AXWA 1OGUA 4EOMA 3BRBA 2WEVA 4IDVA 3D0EA 1BKXA 3ZH8A 3QLGA 2VX3A 4QMYA 4XLIA 4O7ZA 3IQ7A 3RALA 3WZKA 3HKOA 1J3HA 3R7VA 3SOCA 3TXOA 4TYEA 2J90A 4D4VA 2BROA 4C8BA 4XV2A 3HV6A 3KC3A 4BDKA 5L8KA 1ND4A 3MIYA 3PFQA 1UU7A 5AP0A 2V7OA 3DZOA 2OZOA 3WF7A 4FKJA 4RJ6A 5L2TA 4PP7A 2BTSA 4U41A 4WO5A 4LV5A 5AR8A 5JRSA 4FG7A 4DBXA 3FLYA 5HCZA 3ZSIA 4NJDA 4AUAA 2WQEA 4AP7A 5KO1A 1UWJA 3D7ZA 3OZ6A 3CPCA 3E64A 4ZTNA 4YJTA 2WU6A 3HX4A 5IA1A 2YDKA 3L9MA 3ODZX 3PRFA 4TXCA 5IQAA 4D2TA 1Q8TA 4H3QA 3FHRA 4DCEA 2FO0A 4RIYA 1PXIA 2E9OA 1F5QA 3QUPA 1ZMVA 3BYOA 2GSFA 3PXZA 4PWNA 4F1OA 4XRJA 2XK8A 5EM6A 5CALA 4C38A 2C5XA 3MA3A 2ZV8A 4LMNA 4FL1A 2EWAA 3NNUA 4W8DA 1WCCA 3TV4A 2C6OA 5LVPA 4R77A 3Q4ZA 5J7HA 3O71A 4QTAA 1XH4A 3RMFA 5LOHA 5FDPA 2JDVA 4OTRA 2JITA 2Y7JA 4IIRA 3FEGA 1I09A 2FA2A 4ANNA 5CASA 4C7TA 4UMUA 4A4XA 3GQLA 3LFNA 5FBNC 3VRYA 1SMHA 4ZTMA 5C8NA 4FVRA 1AGWA 3IGOA 3VUKA 2R3IA 4E6DA 3KRJA 3NX8A 4MXXA 3MPMA 5EFQA 2AUHA 5AX3A 5JGDA 2DYLA 1H28A 5JEBA 2J50A 3BHUA 4ALWA 2ITOA 4FTNA 5HLWA 4I4FA 3SV0A 2C6MA 2YJRA 4FIJA 4GS6A 3EQIA 4GT5A 4KB8A 3ROYA 4BIBA 1OM1A 4U45A 3EH9A 3GFWA 3HVCA 4QP6A 5EDPA 2R9SA 5BVKA 3PUPA 1H0VA 5AEPA 4D9UA 2XJ0A 4JDIA 4QPMA 4S31A 3OXIA 3KY2A 4L9IA 3R1NA 5IUGA 5E8VA 4CQGA 3V51A 4RX9A 4L67A 4DEIA 2Y4IC 4F7NA 3QLFA 2NP8A 5AA8A 3FQSA 3RAHA 4NTSA 2CGXA 4KAOA 3Q52A 4NW5A 3WIGA 2PMOX 3LFFA 4PDOA 4BIDA 4EKLA 5AM6A 3D5VA 4PY1A 3K54A 3CTJA 2QODA 3NRMA 4OTDA 3GT8A 4BDDA 3AT2A 1XBAA 4R3PA 3KCKA 2YA9A 3NSZA 3FMLA 3PSBA 4ZY5A 2Z8CA 3P23A 4U9AA 5HICA 3T3UA 1IAHA 3HV4A 4I6HA 2XNGA 3MTFA 1JNKA 2OBJA 3TT0A 1SNUA 5EG3A 5CSVA 3RK7A 4YO6A 3QZFA 5H3QA 2B9IA 2PVKA 3LQ8A 3CKXA 2A0CX 4FK6A 4J8NA 2CJMA 5HORA 4FKQA 4F9YA 2YEXA 4O0WA 1YXVA 4FT9A 4BVUA 4QQTA 4DGNA 4BI1A 3VNTA 4R5YA 2VO6A 3OEZA 4EHZA 5G1XA 4NUSA 1P4OA 4ID7A 4K77A 4EL9A 4OAVB 4A7CA 3MFUA 2BRBA 3FMNA 4GT4A 4EOIA 1NA7A 1T46A 3EQHA 4IWQA 3TZ9A 3MS9A 4E20A 2B7AA 2PY3A 1OKVA 1PYXA 3ZU7A 3FZOA 4FICA 2QR7A 2YFXA 4IX3A 3IG7A 3COIA 2BDFA 2EXMA 1Y57A 1YWNA 3BWFA 3OXTA 3VJOA 4OTGA 1SYKA 1OBGA 1UWHA 4E5AX 3R7IA 1F0QA 1BLXA 1E1VA 3GFEA 3H9OA 4EQMA 2VWVA 4F1MA 2O5KA 1K9AA 3GCUA 2WD1A 4JBQA 4OBPA 3ZEPA 4MEDA 3VAPA 5DA3A 4DGOA 5HNBA 5AWMA 1UVRA 4WT6A 1URWA 4FSRA 4FT3A 4L46A 5DHJA 3R02A 4AE6A 4BCFA 4RWIA 4J99A 5EI6A 4DEAA 5FDXA 2PZPA 3C0HA 3QXOA 4OGRA 5AM7A 5TKDA 4P5QA 4FNYA 3M11A 2X7GA 4AW1A 3KRWA 4FIEA 2PVNA 1ERKA 4PMPA 2X8EA 3UVQA 5H8EA 3FMMA 3EQRA 3EYHA 2IO6A 4X2FA 3P5KA 4X0MA 4PMMA 1EH4A 3MVHA 4WKQA 5EDQA 4ZSGA 1YXTA 4DTKA 4I94A 4IX6A 4Q9SA 5KUPA 3CPBA 4K6ZA 4LYNA 2ETRA 3RPOA 4YHTA 2UZOA 2XIXA 3VULA 4W4YA 4GFMA 2J0IA 2IVTA 2X2MA 4FVQA 4LUEA 3ZLYA 3A7IA 2QO9A 4IAAA 3BV2A 4QMTA 4EH3A 5CQWA 2ITQA 3JXWA 4NM0A 1Q5KA 1XQZA 3BLRA 4FTIA 4X2NA 4EJNA 4ASZA 2WMAA 3BGZA 3PY0A 3PA4A 1ZRZA 2A27A 2PL0A 4S2ZA 3VS7A 2QOCA 2PUUA 3FC2A 4M67A 1P5EA 4OLIA 2RSVA 4I5CA 5CF5A 2YWPA 4LRMA 3QZIA 4TPTA 1BUHA 1NVQA 4UBAA 2GQGA 2HENA 2QHNA 3U4WA 2BDWA 1OIRA 3GGFA 1UA2A 2BHHA 4Q9ZA 3PJ1A 3D14A 2ETKA 4BC6A 3OC1A 4Y83A 1PXLA 1VYZA 1WFCA 2IVSA 2VN9A 1UKHA 3CQEA 3RINA 2BAQA 4GSBA 4FV1A 4PTCA 5EHYA 3KULB 3ZDIA 4EHVA 3Q6UA 1JOWB 4G6LA 2FB8A 1J91A 5D7VA 1PKGA 5JN2A 1ZMUA 3I5ZA 5AAFA 3KXHA 2UVXA 4AGCA 2ZOQA 4YZMA 4HYSA 5DVRA 4CNHA 5FTQA 2R4BA 2WIPA 4BKYA 2W1DA 5CQUA 3HUBA 5AUVA 1BI8A 4XHKB 3B2TA 1WMKA 3S95A 4O96A 5DPVA 4D2SA 5JGAA 2DS1A 3ACKA 1YDTE 2WTJA 3V3VA 2O3PA 5ETCA 3T3VA 3Q6WA 4G5PA 4TL0A 3GCVA 2E9VA 3IDCA 1WBWA 3R01A 3R63A 1Y6AA 4ZXTA 4Z7GA 3R1YA 5AMNA 3FPMA 3VHEA 4I24A 1V0OA 2W4KA 3D7TB 3ORNA 4EOQA 2XNEA 3R9RA 4O84A 2B9HA 3VBXA 3O50A 2OLCA 3GUBA 3WZUA 3VO3A 4LGDA 4RX5A 4RIXB 4I4EA 4UN0C 3NVMB 4D0XA 2XUUA 3VS0A 4II5A 3HDMA 1I44A 2V22A 4KD1A 4S33A 5EW3A 4F1TA 5JQ8A 4L52A 2PE1A 4CTBA 4CGAA 2BKKA 4ZSAA 3SX9A 3B8RA 5FEEA 3DBDA 4FKPA 4WG4A 4YC3A 4HGSA 2VO3A 4JAIA 1O6YA 2V55A 4YO4A 4C4JA 5J9ZA 5L2SA 2YIXA 3II5A 4G5JA 4QYFA 1ZYLA 3NNWA 5DR2A 5BUEA 4Y5QA 1E9HA 3NYOA 3GBZA 3TNPC 4DFLA 3ZSHA 2YCQA 4X21A 5E8UA 3LFCA 3DJ6A 4KWPA 5I3OA 3BI6A 1ZARA 3UPXA 1NT2A 2H34A 4TYHB 3DNEA 1SVGA 3GC7A 4U3YA 5CWZA 5J1WA 4CEGA 3CKWA 2CKOA 2UW4A 4KABA 5AV1A 3RPRA 3UTOA 4IAZA 4G3GA 3CGOA 3DOGA 5HE0A 4ZTHA 4QQJA 4FEQA 3HNGA 3LCOA 1GIIA 4MYGA 5IQIA 4DEBA 2UW5A 3FXZA 2VZ6A 5HE3A 3HLLA 3PJ3A 3KA0A 2WNTA 5HVYA 5J5TA 1ZAOA 2H6DA 4BGQA 1XHAA 1ZY5A 5CY3A 1UNGA 3G9NA 3KL8A 3R8VA 1YWVA 3A7FA 4BDCA 4FNWA 2RGPA 3N9XA 3QZGA 5DT3A 1VJYA 4J97A 4FC0A 1K3AA 4I20A 1PXJA 3CD8A 4QO9A 1RQQA 2XK3A 1H00A 2WQMA 2XS0A 3PVWA 4UB7A 4XG9A 3UIXA 4CFMA 1OUKA 4FVPA 1Z57A 1ZY4A 2XP2A 3SXRA 5EQEA 1P14A 3TNWA 4AT4A 4W9XA 3ZO1A 4ZSLA 2X4ZA 4NM3A 1PYEA 3HAMA 1W82A 3FQHA 4O0SA 4JG7A 4I23A 5AV2A 4DAWA 4UX9A 4BHZA 5AR3A 3HGKA 1R78A 3BKBA 3Q60A 5AUUA 3EQFA 5FGKA 3A7GA 4GVJA 3U6JA 2HIWA 2YAKA 1IASA 2RL5A 3D5WA 3N51A 3VVHA 3SD0A 4MD7E 3VRZA 4BR3A 3R9HA 4DH5A 4L68A 3C7QA 3FMJA 3F3WA 5CAPA 3F3UA 3O7LD 3UQGA 5KBRA 2C0IA 4AA5A 1OI9A 4L7FA 4YC6A 4DCAA 4EH4A 1UU8A 3M1SA 4BCNA 3LMGA 4FT0A 4PPCA 4AN3A 2C69A 3ROCA 4OTQA 2ZAZA 2UW9A 5A4CA 2WMRA 5LVOA 4ZSJA 4PUZA 4BWXA 4M14A 4DG0E 5M4CA 4GKIA 1L3RE 2HZNA 3D83A 4FNZA 2ZM4A 2HWPA 4M0ZA 4KNBA 2BR1A 4HGEA 4JR3A 5KMOA 3DAKA 3A61A 3E8EA 4FSZA 3TZ8A 3ZMMA 3UZRA 2R3RA 2XEZA 5CEIA 5IQGA 4EBVA 1STCE 1YXSA 3PIXA 4ZSEA 4L3PA 4EKKA 3MH3A 4L3JA 3IS5A 4WNOA 3QTWA 3QUEA 4A4OA 3NR9A 3QXPA 4P90A 5GIOE 2OJIA 3G90X 5IQHA 2YDIA 4HNFA 2W4OA 1CDKA 3MJ2A 3NIZA 4YJOA 4F6UA 3LJ1A 5IQEA 2VNWA 5K0KA 2CN8A 1APME 4XEYA 4E5BA 2VTOA 5KX8A 3AQVA 4IC8A 1F3MC 3PA3A 4QTCA 5M44A 4E4LA 3NAXA 4QTDA 4NYEA 5LVLA 3U51A 2BDJA 2PVFA 4AOIA 3KMWA 3PY1A 1PMVA 1Q24A 2I0YA 4YJSA 3UC4A 4F08A 5GINE 5ANGA 4LL0A 4O6EA 4BTMA 5CF6A 5IH6A 4FIFA 4C4EA 3OTVA 2BPMA 4NSTA 5J8IA 3U6IA 4HPUE 3BPRA 5M53A 5JH6A 3IW6A 2C0OA 4E8AA 2GMXA 2QOLA 4NW6A 3FZSA 4R7HA 4WHZA 5IPJA 5HCXA 3UO5A 4FV4A 3MFTA 4C59A 3BEAA 4F9CA 1Q8UA 3RK5A 1OMWA 3FMEA 4U8ZA 3E8CA 3TUCA 1FOTA 2VO0A 2ZM3A 4MBJA 3DQXA 4OTWA 4U0IA 5AUXA 2SRCA 3NW7A 3ZEWA 5K4JA 4D2RA 1H27A 3MVLA 4DINA 4JDKA 2ITXA 4AE9A 4AQCA 4X2KA 1Y6BA 4HGLA 5K5XA 2X39A 3G6GA 5EYMA 2C5NA 3ZZEA 1G8SA 1PXPA 2VAGA 3ZDUA 3IDBA 4AA4A 3OT3A 5BVNA 4DFBA 4JRNA 4BCIA 4I6BA 2VWWA 2YITA 4O22A 4RSSA 3ZZWA 3IGGA 3D7TA 4EEVA 2WKMA 3UOKA 4BKJA 2FUMA 4BDJA 3P7AA 4C4GA 4D5HA 4ANMA 1IA9A 2EB2A 5KKRC 3F88A 1R39A 2OJJA 1OL5A 3VWAA 4RIXA 3W33A 5KHWA 2DUVA 4C62A 4QOXA 5ACBC 3P08A 5CX9A 3VQUA 4YBJA 4CT1A 1CMKE 3TL8A 1Q8WA 4M97A 2QR8A 2BMCA 4X2GA 3DNDA 4Y5HA 2UW7A 4Z16A 2X2LA 2VTQA 2OK1A 2E9NA 5KZ0A 5CZIA 4K11A 4G3DA 4OTIA 3TCPA 5ANOA 4EOSA 5IH4A 4M7IA 3EN7A 4BBMA 4G16A 3PP0A 4FKWA 3VQHA 3LCSA 3QQUA 2XBJA 2G2FA 2W7XA 5DLSA 4FODA 3WI6A 3AGMA 4AW0A 3BIZA 4TYHA 3PJCA 3P78A 2IPXA 3SGCA 2VX0A 1J7IA 2HY81 3GNIB 3V01A 3PZHA 3QHRA 5HD7A 5BQ0A 3FQEA 4NM5A 4X3FA 5AIRA 3VBTA 2F7ZE 1REKA 3GU4A 1CKPA 4JBVA 4AWIA 2ACXA 3LVPA 1XJDA 1TKIA 2XIYA 3OY3A 4MNEA 4MWHA 4O6LA 3ZONA 2YCRA 3R9OA 1JSVA 2WIHA 2X7FA 4F0GA 4L6QA 3TNQB 3F7ZA 1YDRE 1BL6A 3MV5A 3NGAA 2VTRA 3U9NA 4EZ7A 4AX8A 4TWPA 5I5ZA 3Q2JA 3Q9YA 5E8XA 5CAQA 3LZBA 3FKOA 1IA8A 4FKTA 2AC3A 4FIHA 4C2WA 4IAYA 4DH3A 3FY2A 5I9WA 1W83A 2QOQA 3H0YA 5AUYA 4C36A 4CRLA 4JVGA 4ZTQA 3PYYA 3EN5A 2CSNA 2I40A 4QNAA 4DGGA 2R3GA 3ZM4A 3R83A 1CTPE 2QVSE 3P86A 3T8OA 1CM8A 1Q3WA 4E5WA 3BHHA 3TNIA 5CSWA 4RLKA 5EKNA 2XIKA 4BDGA 5AX9A 2IVUA 3ATTA 3W2PA 3H3CA 5JFVA 2XKCA 4FYNA 1CKJA 3Q04A 4HW7A 2JDOA 2JC6A 2UZVA 2YISA 3KU2A 4JRVA 4JLCA 3BHVA 3TM0A 4CV8A 2YM5A 4QMOA 5LMAA 1JKTA 2WU7A 3SDJA 3GP0A 5TT7A 2V62A 5B0XA 4BF2A 2ZV7A 2RG5A 4IXPA 5BNJA 4U6RA 5F4NA 2BZKB 4DH8A 5E8TA 5E7RA 3NPCA 2VGPA 2XIRA 3V5LA 3QALE 4W8EA 2EB3A 4CYIA 5CT0A 1YI4A 1MRUA 4TT7A 3C4FA 4NKAA 3F3ZA 2J6MA 3HZTA 5FQDC 4YPSA 4O2ZA 2IW6A 3SXSA 3H4JA 2JBPA 4H36A 4HZRA 4FSTA 3DV3A 4AZTA 5CEOA 3NNXA 2FSOX 2C5VA 2HZ4A 1JAMA 1VYWA 3GCQA 3I4BA 3LPBA 3MH2A 3QQKA 4S30A 4XMOA 4BCQA 3KGAA 3FLNC 3COMA 3UG1A 3CR0A 4E6QA 2FH9A 3L1SA 3L8XA 5T3QA 2WMWA 3TIYA 3VUMA 5HIEA 1OZ1A 2BALA 3BYMA 1KE7A 4LOOA 4N6ZA 4QP7A 1YHSA 4BDBA 3P0MA 3QTRA 2GS7A 4FT7A 3VF9A 4TTHB 3MW1A 2QG7A 1H0WA 4YLLA 3TEIA 2IZRA 3PDTA 2J0JA 1KE8A 2GPHA 2Y8OA 4UWCA 5HIBA 3LM0A 3GOPA 2CGUA 3FXWA 4GKHA 3ORTA 3D94A 3E8NA 4FYOA 3QD2B 4HYUA 4FI1A 4O91A 3AT4A 3VS3A 4B6LA 1IAJA 2AYPA 3AMBA 3RZFA 3ZRLA 4RMZA 2VD5A 3NUXA 4XG2A 2J7TA 3BBWA 4B7TA 3IKAA 2GNJA 5KHXA 2QOKA 4FZ6A 1YWRA 1UV5A 3FSFA 3W2SA 5ITAA 5E1SA 5M4IA 2F4JA 3S3IA 4G3FA 2VTSA 4RLLA 2WTDA 2JFLA 3K2LA 1P4FA 2WMSA 5AP4A 4F0FA 5HTIA 4UMPA 3P79A 4KBAA 4ACDA 3F5XA 4DC2A 2X0GA 2R2PA 5A6OA 2ITUA 4MH7A 4H39A 3FI3A 1ZYDA 3MY0A 3W18A 4UZHA 1MUOA 4C3RA 4KBCA 3QKLA 3MB7A 3TUDA 3QKKA 2WTKC 4WRSA 4D2WA 2UZWE 2CHLA 4BDEA 1NW1A 2PZ5A 2JDSA 4QNYA 4ZTLA 3RCDA 4EZ5A 3CSVA 4AGWA 3TDWA 3WYXA 4M69B 2UZBA 4LOPA 2WOTA 4WG3A 2VO7A 3UYTA 4B8MA 4BL1A 5BVDA 2FYSA 2AC5A 2PHKA 3CIKA 1A48A 3TDVA 1FQ1B 4I5HA 4D2PA 5LVMA 2GTNA 3JY9A 3H9RA 3QD0A 5E91A 4QTEA 4JDJA 1U4DA 5TE0A 4EOOA 3COHA 5LXMA 3HMIA 2P3GX 3HRBA 2XM9A 1JSUA 3QCQA 4P4CA 2HXQA 4YTHA 5HHWA 2B1PA 3TWJA 4IB3A 5DT0A 5HLNA 4I0TA 4JS8A 4XP3A 4ORKA 2JDRA 3RGFA 1OIUA 4G34A 4O86A 5H8BA 4WNKA 2J5EA 1XKKA 1YHVA 3UOHA 5DNRA 3PZEA 4XG7A 5HCYA 2ZDUA 2IG7A 3W8LA 3ZLWA 4B8LA 1FPUA 4KS8A 2OWBA 5HVKA 4GL9A 4OW8A 4ZIMA 3KMUA 3MESA 3TJDA 2XJ1A 4M12A 4EH7A 3ZOSA 4GW8A 5EQPA 5CVFA 2B0QA 1TQIA 2BIKB 4XV1A 2ITTA 2H96A 4YC8A 4JG6A 2PYWA 3S2PA 3BQRA 5K9IA 3PWDA 3GCPA 5BVWA 4QQCA 3SW4A 4CKJA 1OPJA 2ERKA 4HCVA 5TOZA 3TTIA 4Y8DA 4C4FA 4F64A 4KSPA 4RIWB 3HUCA 4O7RA 3NAYA 3VS6A 2ITWA 3I0OA 2Z7LA 4XP2A 5AV3A 2J2IB 2O65A 5C01A 4G6NA 4MQ1A 4ZLYA 1H25A 2O0UA 5EQYA 3AMYA 2XK4A 5HZNA 4KIOA 3DKOA 2RIOA 3FHIA 5LMKC 1ZMWA 4O82A 4CG8A 2OKRA 3JS2A 3DT1A 2WMUA 4XCUA 4ENXA 3MTLA 3P4KA 5I9ZA 3DFCB 2B55A 3UG2A 4FV6A 1R0EA 4NJ3A 4NH1A 3U55A 2BCJA 2HW6A 2UVYA 4QYYA 3V5TA 4CKIA 2B52A 5H8GA 2PWLA 3HYHA 4FTOA 3EFJA 3LFAA 5LARA 2O8YA 4A9UA 4BCOA 3UYSA 2QU5A 2ZMCA 4FSUA 4X3JA 4YGAA 4O0YA 3ORZA 4YJUA 3G9LX 5HVJA 2XNPA 5IA4A 2PE0A 2R3QA 4AXAA 3SG8A 1Q8ZA 3VC4A 2OO8X 4AU8A 1PMEA 3EQPA 3WF8A 5IZFA 4I21A 2JGZA 1E1XA 4E4NA 3PE1A 5IEVA 3ANRA 4FTKA 4EOJA 5IF1A 2VWIA 1H1PA 4D1ZA 3SC1A 3QTZA 3HAVA 3R8MA 3RZBA 5D11A 1IR3A 4EOPA 2QO7A 5L6PA 3KXXA 2YIQA 4CCUA 5CU4A 1TQMA 5CXHA 1YRPA 4TYJA 3RK9A 2IW9A 2GS6A 3L9NA 3PLSA 4UMQA 5HE2A 3R7OA 3SRVA 4NK9A 4O0XA 2XNOA 3WF6A 4JI9A 4FUXA 4GJ2A 4WBOA 4M15A 3HMPA 4LM5A 4FV8A 4RA4A 4DT9A 5JFWA 3FI8A 2OZAA 4RFZA 2OG8A 4GV1A 4MWIA 3BEGA 4F9WA 3NLBA 2HCKA 2Y4PA 3QRJA 5D10A 3D2KA 1PY5A 4IVCA 3VBWA
chains in the Genus database with same CATH superfamily
3Q4TA 4EC9A 2W17A 3UZTA 3AT3A 4YLKA 4K2RA 4ZJJA 3SXFA 3W8QA 2YLEA 3DPKA 5JSMA 1H08A 2YM4A 2YABA 3BE2A 3E93A 3FZTA 5HNGA 4D2VA 4DG3E 5IH5A 4YJPA 4FR4A 2Z7SA 3MBLA 3VS2A 2PVLA 3C13A 5EYKA 4Y72A 4DYMA 5B2KA 4ONAA 1UKIA 2OJGA 4HVIA 5ICPA 3NFFB 4QMSA 1OL6A 2IF8A 3UP7A 4KIKB 4UXLA 5AP1A 4GU9A 3MB6A 2EXEA 3DCVA 4DT8A 3UBDA 2VX1A 3QA0A 3V8TA 4ANQA 5BYYA 4LFIA 2GNFA 1WAKA 3HA6A 4U3ZA 4B0GA 4MAOA 5M55A 5DR6A 1SVHA 3F66A 4EUUA 4PQNA 3OW4A 4AGDA 4GIIA 3SA0A 3ORMA 3TKUA 5J9YA 4MXOA 5M57A 4V01A 4LG4A 4YR8A 4QDEA 4JG8A 4MBLA 1Z9XA 4FV7A 2BHEA 1Q3DA 5HIDA 4EJ7A 3FDNA 5DBXA 5D7AA 2C30A 3FZ1A 3QU0A 5J87A 1VZOA 4IE9A 4QMVA 3ZRKA 4D5KA 4ZY4A 5LQFA 1UNLA 1PMNA 2XCHA 5AR4A 4HJOA 2F57A 3UP2A 1ST0A 4F7SA 2ONLC 3FE3A 3IECA 3PG1A 1RJBA 5M51A 4H3BA 1ZZLA 3Q9WA 3MVJA 2CCIA 4ITHA 2LGCA 1YI6A 4HVGA 2WAJA 3AC5A 3CC6A 5IA2A 4M69A 2R3NA 2VU3A 2RFEA 3C5IA 1AQ1A 4AW5A 4Y85A 4XOZA 3Q53A 5F1ZA 4YLJA 4DHJA 3TV7A 1U5QA 1MRYA 4DEHA 3QTIA 3DY7A 4ZLOA 2QONA 5JFSA 2CMWA 3FV8A 2J0LA 3DGKA 2JIIA 5KE0A 2WMQA 4JL9A 1JWHA 4AF3A 3CY2A 4HVHA 5GZ8A 5HX6A 2HAKA 4FA2A 2BIYA 4GT3A 3DLSA 4J98A 2PU8A 2J51A 5GJFA 4USEA 4BGHA 3QC9A 2GFSA 4O0TA 5FTOA 2RKUA 5CU6A 3FL4A 2O64A 2P33A 2PK9A 1W8CA 4NCTA 3NEWA 4HPTE 4RVTA 2PVRA 4XLVA 3UNJA 3QQGA 4RT7A 4CZTA 5AAGA 1XO2B 3N4UA 4LI5A 2R64A 2UZLA 3VF8A 3IW8A 2QD9A 4MTAA 1XMMA 4KKEA 4WOVA 5CVGA 4XS2A 4FNXA 3S4QA 5IUIA 4BJJA 5LVNA 3DBFA 3R8ZA 3ORXA 3QGYA 5ANDA 2XRUA 3PXRA 4EI4A 2WEIA 1R1WA 4IAKA 3B2WA 4BB4A 3EIDA 3U8WA 2OIQA 1ZZ2A 3PE2A 3SW7A 4MF0A 5A54A 5T6KA 4TWCA 4CYJA 3ZUUA 4I1ZA 4MBIA 4EK3A 3D5UA 4F63A 3DBEA 3NYXA 4O4BB 1NVSA 4WNPA 4EYJA 5AP3A 1PHKA 4BYIA 5IQFA 3DZQA 1U54B 3LXKA 4FBXA 4BWPA 4JT3A 1PMUA 5DEYA 3U9CA 3QRTA 5EK7A 4EORA 4AW2A 5JGBA 5C4LA 2JDTA 2X4FA 2XVDA 3E62A 3QTUA 2Y6OA 3O0GA 1J7UA 5CEPA 1AD5A 3KF4A 1ZOGA 4IM2A 4R7IA 4XBUA 4RVKA 4M66A 3E7VA 4FV0A 2WTIA 4RQKA 4C4HA 5ANIA 4YSMA 2V5QA 3GB2A 4D4RA 3BU5A 4EYMA 1JKSA 4PMSA 4EH9A 3QTQA 2QKWB 4RJ8A 5CZHA 4RA5A 2XCKA 2YM7A 3LLTA 5IQBA 3GC9A 3RPYA 4QMZA 1KOBA 3RNYA 3HP5A 2VWYA 1UU9A 2YAAA 1J7LA 2JKKA 2XYUA 1YKRA 4ZS4A 5FP6A 3UC3A 4AZWA 4C3FA 3ML1A 3OXZA 3W0SA 5M4UA 4FZAB 1U59A 1VEBA 3QAME 4Q5HA 4QP9A 5DRDA 2WELA 1NVRA 3D2IA 1ZLTA 5BVEA 3WARA 5E4HA 3FAAA 3PFYA 4U80A 4NL0A 2XZSA 3ALNA 1W98A 4S32A 3R7EA 2R3KA 1Q8YA 1A9UA 1Y8GA 2FGIA 2OSCA 2RFDA 3MI9A 3UVPA 2UVZA 3A2CA 3OWPA 3PSCA 2PUNA 4FSNA 2OIDA 1GY3A 5CSPA 4YNEA 2BAJA 5GZ9A 3GEQA 2WMXA 5I9YA 4O7LA 5TF9A 4ZZMA 3EKKA 1DAYA 3Q32A 2BRGA 4XV3A 3BU6A 4F9AA 5L8LA 2G01A 2I6LA 2IVVA 3MGYA 1TFFA 1KWPA 4O7TA 5LCKA 4O7SA 3RPVA 3PXFA 4GU6A 3GENA 1OL1A 4CFFA 2JD5A 5H2UA 5C1QB 4FK3A 4IM0A 2YWVA 2W5AA 4DG2E 4BCGA 5GIPE 2Z2WA 2FSTX 2VTMA 2NNWB 3ZLSA 3LMIA 3DFAA 3NVKI 3CD3A 3UOLA 5HO7A 3H9FA 1TZDA 3ULZA 4DLIA 1RW8A 4L00A 3HA8A 1JVPP 2RG6A 4IB5A 4A9TA 5AAEA 5J5SA 4W4WA 1IG1A 2E9PA 4IJPA 4IZ5A 2F7EE 3BX5A 4YUQA 3ZHPC 4DITA 2WMBA 2QKRA 3HV7A 3Q9XA 2XNMA 3EQCA 3QGWA 4C02A 4F4PA 2W1FA 4BCMA 5AP6A 2R0IA 3DK6A 3DAEA 4G2FA 3ENMA 4BY9E 3AC2A 1YOLA 3POZA 4YJVA 4MF1A 4RRVA 5T68A 2CCHA 1ZXEA 4H1JA 4IEBA 3A4PA 4XRLA 4H1MA 4QMUA 4GRBA 3QBNA 4AG8A 4D55A 3S1HA 5HG8A 2J5FA 4NWMA 5FEDA 5KMIA 1GOLA 2W1GA 3C0GA 4DF3A 4G9RA 4JOAA 2XKEA 5LWNA 4ALUA 2Y4IB 3R71A 3VS1A 4ZMFA 2FSMX 2RFSA 1ZYCA 4AXCA 3LLAA 3FUPA 2QU6A 3NW5A 4EZ3A 2CGWA 3KXZA 5L4QA 2C6TA 4FKUA 2UW8A 5C8KA 3L8PA 3PY3A 3QYZA 1OGYA 4M3QA 3Q5ZA 3R30A 2F2UA 4MXCA 4AFEA 3N4VA 3GOKA 3PLAE 4U5JA 1FMOE 1LPUA 3AD6A 5ANKA 4O4DA 3EZVA 5JKGA 5AIKA 4UMRA 3QQJA 3DTWA 3PRIA 4JBOA 5AA9A 3S0OA 2JKQA 3V5QA 3HDNA 2W1CA 4IB0A 4P5ZA 1O6KA 4IVBA 3UO6A 2KULA 1QPJA 4GG5A 2XJ2A 1DAWA 2VRXA 5HKMA 1XH7A 2HK5A 5DRBA 4DBNA 3NMUF 2W5HA 3E8DA 4LOQA 4TWOA 3DBQA 4XNEA 3FPQA 2C6IA 1OBDA 4FL3A 4FGRA 3OS3A 4F6SA 3W0PA 1O6LA 4NCTC 3WF5A 1YXXA 4QMWA 2YIWA 1XBCA 4YZNA 2F9GA 4DA5A 4FKIA 3RJCA 2HYYA 2YHVA 2CLXA 3OT8A 4QP2A 3UIUA 2A19B 5JZNA 4CMUA 4D9TA 4IZYA 5I9VA 4XX9A 4RG0A 5K4IA 3I5NA 4FZ7A 2GTMA 3BYVA 4GK4A 4NTTA 4PP9A 4R5SA 3NUUA 2XMYA 5EM8A 5M09A 1GNGA 2O2UA 5L8JA 3LXLA 2ZYBA 3A7HA 2YLFA 3KULA 1T45A 4O27B 3H30A 2Z7QA 3MA6A 4ACHA 5B2LA 4W9WA 4J95A 3AD5A 5D1JA 4XG6A 3KEXA 4EOKA 4P7EA 3UQFA 4FTCA 4WIHA 3A7JA 1U54A 2B9JA 3CY3A 4ZK5A 4FEXA 2C68A 2IZSA 5C4KA 4IWDA 3OCTA 3RCJA 2PMNX 2WB8A 1CKIA 2ZB1A 3BWJA 3KMMA 4KRCA 4TW9A 1MQ4A 4EWHA 3OOMA 3OHTA 4RWKA 4Z55A 2R3HA 3NNVA 5E8WA 3QD4A 3NUAA 4CCBA 4L3LA 2BRNA 2C5YA 2NRYA 4ALVA 5EH0A 5BPYA 1TVOA 2VTJA 2I7QA 4X6RA 1KSWA 3GU6A 3EB0A 2ZFYA 1G8AA 2OGVA 3LCKA 2UW3A 1LEZA 4FMQA 4F09A 5KMJA 1QL6A 2WQBA 4USFA 1QPEA 4E4XA 3ULIA 2BFYA 3ET7A 4IZAA 2G9XA 2WTWA 4EOLA 4RVLA 4G17A 5KMKA 3LFSA 1URCA 4MD8E 5AR2A 4EK5A 2B54A 4ITIA 3GXLA 3OBJA 4BICA 3VUTA 2C5OA 4H58A 2I0EA 3RWQA 3UQCA 5AR5A 3AOXA 2C6LA 5CNNA 3I81A 4TKSA 1Q4LA 2JEDA 4WUAA 4BDAA 1Q99A 4FKGA 1JKLA 4RX7A 5DWRA 2C3IB 3F2NA 4J52A 4IC7A 2GHMA 2IWIA 5D41A 3QHWA 3TN8A 1KOAA 2X9EA 4D4YA 3EN6A 3ZFMA 2ITZA 4GUEA 4UY9A 3C50A 2HOGA 3EHAA 3WE8A 2W1HA 4ZLZA 3QTSA 1BX6A 3NUPA 2OXYA 5I9UA 4YHFA 4FUYA 4UV0A 3GU8A 2QO2A 3DJ7A 3O96A 4YPDA 5HBHA 3WZJA 4A9YA 1S9JA 3PSDA 2XNNA 3G33A 4MD9E 2Y6MA 4PDPA 2WZJA 2R7IA 5CAUA 4H05A 1R3CA 4ACMA 5I3RA 4LDTA 4MNFA 2OI4X 3PXQA 1J1BA 2Q0BA 2UZTA 4HZSA 3B8QA 4OUCA 4N57A 4DGMA 1UNHA 2QCSA 4FV9A 1ZYJA 5JQ5A 3VW6A 4TWNA 2WMTA 2F2CB 1YOMA 2J0MB 3HMOA 3THBA 2OFUA 2OXXA 2VTHA 3DK7A 5HTBA 5BYLA 2GNIA 1GIJA 4GYGA 3DDPA 5BMMA 5KCVA 3DKGA 4G3EA 3OD6X 4IVDA 3VW8A 4G9CA 1REJA 3JPVA 4FEVA 3FZRA 4YNOA 4Z3VA 1XH9A 4MVFA 4C33A 4AGUA 3MYGA 4FZDB 1VR2A 4FKVA 2Q0NA 2I1MA 4AT5A 3EZRA 3ZBXA 4V04A 1FMKA 3D15A 3ZBFA 4C0TA 2CKQA 3CQWA 3GC8A 4WBBB 4C35A 2W99B 2WFYA 3R8LA 4KS7A 2VTIA 1M2QA 5AP5A 5E8YA 5CLPA 2PUIA 4RQVA 3GU7A 4CG9A 4YTFA 3MFSA 5FTGA 4UXQA 5E92A 3UPZA 3SOAA 3OUNB 5GJGA 5IA5A 3EN4A 4ZZOA 4IBMA 1QMZA 4U81A 4JX3A 4WSYA 4U7ZA 4FIGA 3GQIA 2R3OA 3BYUA 4CFVA 5HLPA 4UYAA 3K5VA 4TY1A 3F82A 3POOA 2GNLA 3P7CA 5H9BA 4CFNA 3U87A 4YZCA 4MUQA 3RP9A 3WF9A 2B4SB 4F65A 5CEKA 4Q5EA 4O0RA 4PTEA 3G6HA 5JT2A 3BGPA 4QTBA 4R6VA 5EHOA 4GG7A 3QYWA 4BDFA 1KV2A 4R3RA 5C03A 2OW3A 3D9VA 3DS6A 2R3LA 3OW3A 4NKSA 4K18A 4AN9A 1NY3A 3H0ZA 4F99A 2PVMA 3E7OA 4CFWA 3D4QA 2WMVA 3KVXA 1Y8YA 3FJQE 2W06A 3CLYA 3Q3BA 5AUWA 4C2VA 4K1BA 2ZVAA 4IB1A 4O0UA 2XAMA 1W7HA 3QD3A 2C1AA 3QCSA 5CYIA 4J8MA 2X2KA 1YQJA 3CJFA 3Q2MA 3QQHA 5FXSA 4UWBA 3R7YA 3RKBA 4B9DA 3KN6A 1HCLA 3LXPA 3WYYA 2GFCA 3F6XA 3UMXA 3KXGA 5CNOA 4BKZA 3PIZA 4FT5A 1MP8A 2W1IA 3VUDA 5HX8A 3O17A 4TNBA 4GMYA 2IZUA 4CMTA 3RAIA 2PZYA 2WXVA 4KA3A 2R0UA 1JPAA 2OF4A 3JY0A 5C9CA 4UWYA 4RC4A 1WBTA 5M08A 3R04A 3QTXA 3ZUTA 4LRKA 3OOGA 2C47A 2G2HA 5IEYA 3W0OA 1WVYA 2QOHA 1OIQA 3I79A 3OCSA 5A4LA 4ZJVA 3KK9A 2CNUA 1JQHA 1GZKA 3DU8A 4YZ9A 5AR7A 3RNIA 4DEEA 3NYVA 2A4LA 2WOUA 2BZJA 3GI3A 3Q5IA 4FV2A 4MKCA 4RJ7A 4UMTA 3BYSA 3COKA 4HVDA 3QRUA 3PXKA 3R8UA 4IWPA 2WTCA 4N70A 3VS4A 4DN5A 3PVUA 5CI6A 2GNGA 3R2YA 3F5UA 4W4VA 3V5PA 2G2IA 4O81A 3C5UA 3E3BX 4DFNA 2WHBA 4L01A 3HMNA 5DI1A 2BAKA 3TI1A 2YCSA 3A8WA 3QQLA 4RWLA 4NU1A 3V8SA 3TZ7A 4CFUA 3ETAA 5EHLA 4I0SA 4OT6A 4YJRA 4IH8A 2VNYA 5CSXA 5IQCA 3HL7A 3LE6A 2CGVA 3QUDA 4PL5A 2V0DA 3RBWA 5L6OA 5B2MA 4QYHA 4IX5A 4JJRA 4L8MA 2IN6A 2NO3A 3IDPA 2XNBA 5LWMA 5LMBA 3I0QA 4I6QA 3QA8A 3M2WA 4TYGA 3WOWA 3SG9A 3R1QA 3TTJA 5HNIX 2CNQA 4PPBA 4CLJA 3W10A 4NFMA 4BI0A 3ITZA 3U4UA 3I6UA 3F9NA 4FKRA 2XKFA 5EOLA 5C26A 4KKHA 3OBGA 5HOAA 4L44A 3ZO2A 4CTCA 4OTPA 2RFNA 4QT1A 3FZPA 4JBPA 4ASEA 4ACGA 4BRXA 3ORLA 1Z5MA 3OWJA 3QX2A 3CGFA 4QP1A 4S34A 3VHKA 3ORPA 5JZJA 4QP4A 4GH2A 2UZUE 1J1CA 1PXKA 3LHJA 1O9UA 4E3CA 1QPDA 2F49A 3O2MA 3IO7A 3LJ0A 4FTMA 5DG5A 3FKLA 2C3JA 4WNMA 2XBAA 4BWKA 1JSTA 4Q2AA 5A4EA 4ANSA 2C6EA 1G3NA 3ZC5A 3BLHA 4ANOA 5CF8A 4DE4A 2OU7A 5AP7A 5EW8A 4L42A 3BQCA 5J95A 4BHNA 4DGLC 4NT4A 4D4SA 3DBCA 2ZJWA 3AC8A 1OVEA 3QWKA 4NZWB 2XYNA 2QOIA 3PUFC 3R9NA 3OCBA 5F94A 4IJ9A 3TIZA 3WZEA 4X3FC 4JR7A 2B9FA 5HI2A 4X2JA 1GZ8A 4O21A 5FG8A 4DFXE 4XV9A 4FTUA 5I0BA 1M14A 3OWLA 3UIBA 4QPAA 4NIFB 1KV1A 4QMLA 3ZXTA 4F78A 3G51A 3WE4A 5FLFA 4R7BA 1MRVA 3P7BA 4N0SA 4PTGA 4OR5A 4R1YA 4BGGA 4U44A 3ZRMA 3E87A 3HECA 4LUDA 2O63A 2PE2A 5LJJA 3QFVA 4HVSA 4CRSA 5EDRA 5DGZA 5HG5A 3NYNA 1WBOA 2BFXA 3R21A 4A9RA 4QMQA 4AXEA 4NFNA 5C27A 4I6LA 5EW9A 3MPTA 5IISA 4Z9LA 4J7BA 5HU9A 5JMSA 4DDGA 2R3FA 1OL7A 4JQ8A 3QCYA 2R3MA 4PNKA 4XH6A 2ITYA 3EN9A 2J0KA 5AFVA 2VWXA 5AP2A 4WG5A 5FM2A 4CLIA 5CF4A 4KKGA 2C3KA 1IEPA 4APCA 4DH7A 3KRLA 1Q62A 5AJQA 3LFQA 5KKRB 1TQPA 4CD0A 4MXAA 4QMXA 1OPKA 5A4TA 1PJKA 2W9FB 1WVWA 5K3YA 2JIUA 3QRKA 3DLZA 1NXKA 4FG9A 4FTTA 4ANBA 3PTGA 4BFMA 4CQEA 3A4OX 1YI3A 4AS0A 3LXNA 3QF9A 1SNXA 3O8UA 3MY5A 3LFEA 2P2HA 4JNWA 3RM6A 3WZDA 1GZOA 1KUTA 4FSMA 4DFZE 3AC3A 3PVGA 5FBOA 5AV0A 5J79A 2YZAA 1LUFA 2BILB 3ANQA 3R22A 3ALOA 1RE8A 4PNIA 4AZSA 1GJOA 2YCFA 3NS9A 4IWOA 2CN5A 2PZIA 3LQ5A 4HOKA 2YDJA 2OH4A 4A4LA 5K0XA 3PJ8A 3QCXA 4CFXA 1DS5A 4E73A 2V7AA 3LIJA 3EFLA 3QRIA 4EK6A 5DMZA 5L2WA 4FZFB 5BUJA 4PDYA 5HBJA 2BRMA 3AC4A 3TV6A 3UIMA 1H24A 4BN1A 5L3AA 3MDYA 1BI7A 5DR9A 4WUNA 3FLWA 3C9WA 5GHVA 2CLQA 2WTVA 3DXPA 3QC4A 2XK9A 1HOWA 2OJFE 3O8PA 2H9VA 2ERZE 4YP8A 2IW8A 3CBLA 4K33A 5LCJA 4L43A 4EK4A 5JK3A 2XB7A 2VTNA 3EJ1A 3CCNA 2I0VA 3R73A 3KRXA 1RDQE 2EU9A 3IW7A 4U40A 4YHJA 3R7GA 4CMOA 4EH2A 4O1PA 3LQ3A 3V5JA 3F7WA 5FWKK 3FMDA 4TZRA 5BMSA 2IZTA 3I60A 4QMMA 5DT4A 4BCJA 4A9SA 4W4XA 5CAOA 1BMKA 1ZWSA 5BYZA 4KUJA 2YJSA 3LM5A 3VUIA 4NEUA 3DAJA 3E92A 2ZV2A 2WGJA 3AC1A 4L45A 1OKZA 3NUSA 4DH1A 4GK3A 3D5XA 3NCGA 4FL2A 2XH5A 5CENA 4DFYA 4ITJA 4O38A 4Y73A 5E8ZA 4RWJA 2W1EA 3QKMA 2J4ZA 3UGCA 3OY1A 4AZEA 4C34A 3PIYA 5CU0A 2VTTA 3F5PA 4E6AA 4APPA 3WIKA 1ST4A 2UW0A 4GFGA 5EYDA 2XEYA 4MXZA 5IDPA 3JVSA 3W32A 3OVVA 4V0GB 2YM6A 4GK2A 4GCJA 3DDQA 1SZMA 2QLUA 2W1ZA 2ZB0A 4FX3A 1JLUE 4RC2A 4R78A 5HESA 3HV5A 4BI2A 3PPKA 1L8TA 1A06A 4EONA 2HXLA 1B6CB 3DJ5A 3BELA 2YIRA 1B38A 1GIHA 3UVRA 5IEXA 5HEZA 4J1RA 3LW0A 1Q97A 4N6YA 3W0RA 2OXDA 1LP4A 3I6WA 1JBPE 3QWJA 5D12A 4U43A 4BZOA 4DEGA 5AV4A 4DLJA 5CXZA 4GIHA 3CEKA 2W5BA 5EOBA 2X8IA 3NUNA 5CVHA 4F70A 3CTHA 2X6DA 3LKMA 3S00A 4I92A 5IG1A 5AADA 1FBNA 4C57A 3K5UA 4X7QA 4QYEA 4OTFA 3SAYA 4J96A 4O1OA 5FXQA 5L2QA 2WQOA 4CT2A 3VS5A 1M17A 3DXNA 4AZVA 1WVXA 2PVHA 4G3CA 2PUPA 3QQFA 5M06A 3R8PA 4RFMA 3I7BA 4UALA 4GEOA 3MIAA 4Y46A 3ENHA 4C3PA 3F2RA 3JUHA 3UOJA 4G1WA 4EBWA 3UMWA 4RX8A 2C3LA 2P2IA 1QPCA 3C4EA 3FXXA 2IJMA 5EM7A 2BTRA 4TN6A 1XH8A 3NDMA 1XWSA 4WRGA 4YZDA 5C8MA 4OBOA 3V6SA 5DEWA 2X9FA 1S9IA 5IKWA 2C4GA 1FGKA 4USDA 1KE5A 3IONA 3RHXA 4RJ5A 5FEQA 1ATPE 1Q61A 4FG8A 1YOJA 4RIWA 2HWOA 2PMLX 2UW6A 4DTBA 3ZSGA 5A46A 4I0RA 4RC3A 3A8XA 3EL7A 5EM5A 5J7BA 2W9ZB 3AGLA 4CXAA 4O7WA 4FKSA 4HYIA 2GS2A 3ZLXA 4CSVA 3TACA 2QURA 2GDOA 2FSLX 4M13A 1FGIA 2R7BA 2WPAA 4M68A 4BZNA 3ATSA 1H07A 4LRJA 5M07A 2GHGA 3PP1A 3F5GA 3O7LB 2GCDA 2YZLA 4ZY6A 3MN3A 2QNJA 3ZM9A 5BVFA 2WTKB 2JKOA 4MQ2A 5I9XA 5GZAA 1U5RA 2UZDA 4P2KA 4NIFA 4IFCA 4YTCA 1H8FA 3EOCA 1ZOEA 4FTQA 3TJCA 1KE9A 4FKOA 4MK0A 4F7LA 3TKIA 4E6CA 3E63A 2VTLA 3C4CA 5G6VA 4QD6A 3PA5A 3G0EA 5K5NA 4ZOGA 4BTJA 3ZCLA 4KINA 3ELJA 4LL5A 3C4ZA 5ACKA 4XP0A 5DFPA 2Y9QA 4F6WA 4EUTA 4EK8A 3R28A 4U97A 3PPJA 1PXMA 3ERKA 4D28A 5L6WL 3BLAA 3BV3A 4AFJA 1YVJA 3R00A 5DH3A 3UDBA 3VUGA 3KXNA 4FV3A 3KQ7A 4C58A 5DE2A 3DK3A 3QX4A 3R7UA 4ZJIA 4ENYA 4ERKA 4ARKA 4V05A 3KF7A 2PVYA 4O0VA 3O23A 1H4LA 4O7NA 3CTQA 4K0YA 3EQBA 2REIA 2BRHA 2G1TA 5FXRA 3OP5A 1OL2A 4UYNA 3G0FA 3ZYAA 3EFWA 3O51A 3RWPA 2ITNA 3OMVA 4BCPA 4PX6A 1BL7A 2QHMA 4L53A 5FP5A 4PL3A 3BCEA 4TNDA 4GYIA 3RHKA 5L2IA 2ZV9A 5J1VA 4FTAA 4M0YA 5M56A 3VJNA 2X81A 1KE6A 1W0XC 1WZYA 2H8HA 3OF0A 3P9JA 4UEUA 3ZXZA 2UZNA 4RZVA 4YURA 3V6RA 3HEGA 1K2PA 4D58A 4JDHA 1OKYA 3JVRA 4ZP5A 1WBPA 1H1QA 3F69A 4F9BA 4RJ4A 5DYJA 5F20A 2F7XE 5B7VA 3EWHA 4LGGA 1R0PA 2Z60A 3TZMA 3UE4A 4KIKA 4DFUA 3VBVA 3E5AA 5M4FA 4FOBA 5ETIA 5A9UA 5CU3A 3E3PA 2JIVA 3FC1X 3F2AA 3C4WA 4X3FB 2W96B 3CE3A 4I41A 2QOFA 5DN3A 4XOYA 3T9IA 2DQ7X 5DIAA 5I4NA 2P55A 4NM7A 1GZNA 4MNEB 2GHLA 3IW4A 2C6DA 4ZAUA 2XARA 3Q9ZA 3KXMA 4JIAA 4ACCA 2BVAA 1H26A 2Y0AA 3L9PA 4K8AA 1WBNA 3KREA 2J9MA 4G31A 4HGTA 4XG8A 3V04A 3ZFXA 5A4QA 3DB6A 2GQRA 4QP8A 4I5MA 2KTYA 3W0NA 3EL8A 1PRYA 4CKRA 4ZTRA 5CT7A 1XR1A 3PJ2A 3BHTA 3ZFYA 4XYFA 4WA9A 4CZUA 5AUZA 2I0HA 4IAIA 2YACA 4C37A 4EH5A 3VIDA 5KNJA 3NFGB 4EHGA 4GUBA 2EVAA 2JFMA 2A2AA 3EFKA 5CSHA 4ZZNA 4FF8A 4MX9A 5AUTA 2VWUA 4BCKA 2DWBA 3HMMA 4QQ5A 4EH8A 4C4IA 3AMAA 4HYHA 1OECA 3TYKA 4V0GA 3REPA 3RTPA 4KIPA 5IDNA 2OF2A 3UNZA 4TYIA 3PXYA 2PMIA 3K3IA 1U46A 4PV0A 4RFYA 3SKCA 2XM8A 4JQEA 3AD4A 4WD5A 3W1FA 3LCDA 5E9EA 2XIZA 2CNVA 3NCZA 2VTAA 3VUHA 4YJQA 4BDIA 3MFRA 4I3ZA 5F95A 4J71A 4BZDA 3DTCA 3FLSA 3KCFA 4M84A 5TO8A 2E9UA 4QRCA 3VBYA 2JAMA 3BHYA 2PZRA 3CQUA 3K3JA 4CZYB 3FI4A 3LFDA 4QP3A 3W2CA 2CKPA 3UDZA 1FINA 4BCHA 4EQUA 3UJGA 4E26A 2C6KA 3F61A 3W2OA 3L9LA 3NUYA 3A60A 5BX0A 4FE2A 2BZHB 3KIOC 5CI7A 3KN5A 3LOKA 4M8TA 3IPHA 2XK7A 2FVDA 5EYCA 5HQ0A 5KMLA 5BVOA 2GQSA 2XA4A 4RIOA 4BBEA 4C61A 3G2FA 2BZIB 2RF9A 3I1AA 4F0IA 1GAGA 4KSQA 3W55A 3GU5A 5J9LA 2HZIA 2B53A 1H01A 5E90A 4XBRA 2X6EA 2VGOA 1FVVA 5D9HA 2QG5A 4PDSA 2NRUA 3ORKA 4QMPA 2YERA 4J53A 3UO4A 4JXFA 3LCTA 3MJ1A 3Q96A 3UODA 3PG3A 5IMXA 4K9YA 3FWQA 2ESMA 4R3CA 4ERWA 3FY0A 3OFMA 2QOBA 1M7QA 3KRRA 4XJ0A 3EMGA 3R0TA 3ZC6A 3R6XA 4WSQA 2ZDTA 2PSQA 4EWQA 4MXYA 4HNIA 4BBFA 3FMHA 5CAVA 3R2BA 3GVUA 3CP9A 1DI9A 4G6OA 3DXQA 2QLQA 4ZTSA 3ZO3A 2EUFB 3IOKA 5ETAA 4IAFA 4E4MA 4LGHA 3I7CA 1BYGA 1HCKA 1OPLA 3DQWA 1W84A 4CV9A 1DI8A 1FVRA 4AOJA 2YM8A 1G5SA 1LR4A 4IHPA 4D1SA 3MH1A 4AN2A 4YBKA 4ZEGA 2ETMA 1V0PA 3P1AA 4FOCA 3FI2A 3UNKA 1SM2A 5KMMA 1PXOA 5GNKA 3W2QA 1OKWA 3KFAA 4O7VA 2W0JA 3HRFA 5KMNA 3HRCA 1WBSA 1V0BA 4H3PA 4QPSA 5KBQA 1FVTA 4L7SA 3FYKX 5CS6A 5IUHA 3HV3<