1GZNA

Structure of pkb kinase domain
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
296
structure length
271
Chain Sequence
KVTMNDFDYLKLLGKGTFGKVILVREKATGRYYAMKILRKEVIVTESRVLQNTRHPFLTALKYAFQTHDRLCFVMEYANGGELFFHLSRERVFTEERARFYGAEIVSALEYLHSRDVVYRDIKLENLMLDKDGHIKITDFGLTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHERLFELILMEEIRFPRTLSPEAKSLLAGLLKKDPKQRLGGGPSDAKEVMEHRFFLSINWQDVVQKKLLPPFKPQVTSEVDTRYFDD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RAC-BETA SERINE/THREONINE PROTEIN KINASE
publication title Molecular Mechanism for the Regulation of Protein Kinase B/Akt by Hydrophobic Motif Phosphorylation
pubmed doi rcsb
source organism Homo sapiens
molecule tags Kinase
total genus 69
structure length 271
sequence length 296
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2002-05-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
A PF00433 Pkinase_C Protein kinase C terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 1gznA01
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 1gznA02
1ZYLA 4I6QA 2WO6A 3VBYA 3QU0A 1B6CB 2OJ9A 3NUNA 4J8NA 5CLPA 3ZS5A 4AT3A 3GFWA 4GW8A 5HE1A 4FKWA 3TI1A 4DBNA 3AOXA 4RLLA 3FHIA 3VS7A 4Z9LA 1VYZA 1XBCA 2IO6A 4KIQA 2GNJA 2EXEA 3BYSA 1KV1A 3FLZA 4F63A 4XG2A 5KMLA 4AT5A 2ITYA 1UA2A 4BDBA 3G51A 4PNIA 2OIQA 3UMWA 2PULA 2P55A 3Q53A 3G33A 2EU9A 2GNHA 3G90X 1UU3A 2F7EE 4IAFA 5AIKA 2YN8A 3ZLXA 4ITIA 4L3PA 1V1KA 4OT5A 2JAVA 1E9HA 4D0WA 3DBQA 4E6AA 3GCSA 2C5VA 2XIYA 3ROYA 3P9JA 4H39A 1YRPA 1J7UA 4DEAA 2QU6A 4BCPA 1W84A 5DRDA 4BBEA 4HNIA 3NRMA 5A14A 3VUMA 3RI1A 2PVNA 4G16A 2OJGA 4DFUA 3P5KA 2WIHA 5IMEA 4YSJA 3OEZA 4EL9A 3LFFA 2F2UA 3ENHA 5HVYA 4BCIA 2XEYA 1H0WA 5CVHA 5AM6A 5IH5A 3M42A 3NAXA 5M06A 4YSMA 2BPMA 4K18A 3KA0A 2YFXA 2Y9QA 3I4BA 3QQJA 5KMMA 5DPVA 1TQMA 4FZDB 4F09A 2HYYA 1M52A 3EMGA 1GY3A 2JLDA 4C4GA 3T9TA 5AWMA 4R7BA 2NRYA 3ZM9A 2A4LA 3AMYA 5AAEA 5A4EA 4AN3A 4BDEA 2ONLA 4ZTRA 3SA0A 3OFMA 3PVUA 2VWXA 3CR0A 4CLJA 1JWHA 2HWPA 3DAKA 3FUPA 3ZM4A 4RIWB 4Y46A 2PVFA 2GU8A 2XK6A 3ORMA 3FLWA 3Q4CA 1OL2A 4ACCA 4CFVA 3MB6A 3UO4A 3KXZA 3UQCA 2HAKA 3BPRA 3PSDA 4F7JA 1PHKA 2IZSA 3Q9XA 1F3MC 4XV1A 1R39A 2B54A 2AC5A 3PJ1A 4I21A 4KA3A 3VNTA 3QBNA 2C6IA 4YGAA 5FUTA 2PVMA 1ZZ2A 2AUHA 4ZLZA 2J0JA 3DJ7A 2VU3A 4L01A 3PG3A 4M0YA 4BIBA 3TUDA 2JKQA 5AR2A 1Y6AA 4EWHA 3KEXA 3ZZWA 4XV2A 5TOZA 3Q60A 3Q6UA 2BILB 3QQHA 4HCVA 1JKLA 2XBJA 5K9IA 4D2PA 4K6ZA 3CD3A 5F4NA 5LOHA 1S9IA 4BKJA 5DFPA 4D58A 4L3JA 2X7OA 3VUDA 3EL7A 3KXHA 4C3RA 3VJNA 2SRCA 3V6RA 4C2WA 4RX5A 5EI2A 4ENXA 3SV0A 3TV7A 5BYLA 2YIXA 3ZEPA 5EDRA 3DKFA 4HGTA 2ESMA 3QX2A 4KWPA 4EH5A 3UNKA 2JDOA 2BRBA 1WCCA 4ID7A 4N6YA 4H05A 3GC7A 4I0SA 5CU2A 4DH7A 4PP9A 4C3FA 3U6IA 1Q5KA 3UP2A 3W8QA 3ZTXA 4QQJA 4RX9A 3DLZA 3F7WA 3MIAA 3WBLA 1PJKA 4GFMA 1Q8ZA 3RPRA 1IG1A 3RMFA 4CFFA 2XZSA 1Y91A 2ZM3A 4CT1A 5ANJA 2WXVA 4O0YA 3CY2A 3HGKA 3M1SA 4O1PA 4BGQA 5M53A 4LL5A 3HLLA 2R3KA 4BTMA 4HNFA 4G9RA 2RIOA 4XP3A 3VBXA 2ONLC 3NYNA 3OP5A 5BVNA 3K3IA 1G3NA 4IWOA 4EK5A 2CCHA 2UW7A 4QYEA 3K2LA 5KBRA 2YCRA 1Z57A 3OZ6A 2BHHA 4GYGA 3E93A 3R9DA 2OZAA 3HV7A 2IVTA 5FDXA 1FQ1B 2AYPA 4ACGA 4QMVA 2KULA 3VS5A 2FSMX 3MFSA 2B0QA 1PKGA 3DS6A 4C37A 5BVEA 2QCSA 4TY1A 4GMYA 3CPBA 4A9SA 3H9FA 4KIOA 3UC4A 2WU7A 4FEWA 2FH9A 2H6DA 4YBKA 4E6CA 4ZY5A 4DFZE 2GHLA 1ZZLA 3QTWA 2JDSA 3IDCA 4ZZNA 3GNIB 4FZFB 5J7BA 2WTCA 3FLYA 4GJ2A 4E73A 4CMUA 3TZ9A 4R8QA 4GG7A 1SM2A 4IB1A 5CXHA 4O7NA 2GHMA 1S9JA 2OJFE 3KULA 4NKAA 5M56A 3CQUA 4LM5A 3NGAA 4RA4A 5H9BA 5HLNA 1J91A 1URWA 1WZYA 4UZDA 3KRJA 3EIDA 4QYFA 3ORIA 3ZOSA 3UOJA 4D2SA 2W17A 4FC0A 1WVYA 3VS6A 5AA9A 1OBDA 1ZY5A 2CCIA 1QPJA 3TCPA 3ALOA 1KE9A 3LCTA 3LFCA 3P0MA 1Q61A 4O6EA 4MBIA 4EYMA 3GC0A 1V0BA 2ZMCA 5ITAA 3N4UA 3DFAA 4O2ZA 3EQRA 4GK2A 4ANBA 5AV4A 4KBCA 4I93A 4JRVA 5L2WA 3L9PA 3DCVA 3SC1A 5JQ5A 1VZOA 2BIKB 2Z2WA 4YC3A 3I81A 2WU6A 5DEYA 2DUVA 2IN6A 4IAYA 3ZFYA 2ITZA 3C4FA 2ZV2A 3LE6A 4UXQA 3T8OA 3ULZA 3D7TA 2HXQA 3GCQA 2UW9A 3F66A 4TT7A 3DTCA 3F61A 2YACA 3M11A 4FA2A 3TJDA 1YDRE 2QO2A 3WOWA 1OUYA 2R3HA 4XOYA 2J0MB 3PPZA 4IDVA 2PZRA 3E63A 2PMIA 5HBJA 4Y83A 5HBEA 2HWOA 1I09A 2H34A 1OL7A 2V55A 3MTLA 4J95A 4P5ZA 4PTEA 4ERKA 1OL6A 3E62A 5E8TA 4DBXA 4XG9A 5B0XA 2GQGA 5AUWA 2QKRA 3RNIA 3DV3A 3F3TA 2ZV9A 3MVJA 4CKRA 4RFZA 4LFIA 3UC3A 3ZDUA 2WB8A 4JQ7A 2CNUA 2WTKB 1OM1A 1L8TA 4XRLA 2WMAA 2XRWA 2XYNA 2CHLA 5C4LA 4DC2A 4EC8A 3BHTA 2IWIA 3R1QA 4F6UA 2XNEA 3CP9A 2EUFB 4FIEA 3P79A 4EK8A 5CAUA 3D7ZA 3Q5IA 4ZAUA 3UP7A 3SG8A 3NDMA 2BZIB 3OOGA 4M0ZA 4E20A 5F9EA 4MQ2A 4HPUE 2VN9A 2VTLA 3EL8A 4FOCA 4N0SA 3LJ2A 5E90A 3PE2A 2OO8X 1U54A 3RJCA 4AT4A 3G9NA 4F9BA 4UN0C 4CLIA 5A4TA 3ZO1A 4DITA 2WGJA 4JDIA 3IOPA 3FMNA 5IEVA 5TR6A 3MB7A 3GXLA 3B8RA 5EG3A 3I7BA 4E5AX 3Q9ZA 5JQ8A 3D5VA 3JVRA 3GT8A 3MH1A 5LJJA 1IA9A 3QQLA 1J7LA 4YLJA 3QGYA 3FL5A 4FSTA 4X0MA 2YWVA 1OUKA 2JEDA 4BBFA 2EB2A 4UB7A 3LIJA 4XG3A 1NW1A 3IW8A 4EKLA 3LHJA 2PVYA 3CS9A 4RA5A 3IG7A 3LCSA 4FICA 3MIYA 3MPMA 3MY1A 2UZBA 3QQFA 4TW9A 2YIQA 3PP0A 3OXIA 3JUHA 3HP5A 4MHAA 4WUAA 3GU6A 3U4UA 3D2IA 4O82A 3BEAA 1ZMUA 3UZTA 5D41A 1JBPE 3NVMB 4O0TA 3BQRA 3OUKA 5FGKA 5IA0A 2RSVA 3NPCA 4FI1A 4XG8A 1W7HA 3G0FA 4IWPA 2B1PA 5EDPA 3GGFA 4RC3A 2WEVA 3IW5A 1LEZA 4IVCA 4CTBA 4IWDA 3C50A 3SD0A 2W1ZA 4FZ6A 3ATSA 4II5A 3VAPA 1RDQE 4NW5A 5LMAA 1YWVA 2IW8A 4YTFA 4YPDA 4I24A 2JKKA 4ZSEA 3BHYA 3MWUA 3AD5A 3QKKA 5E8WA 5CY3A 3M2WA 3SW7A 4MQ1A 2UW6A 4D0XA 1IRKA 4DTKA 2X8EA 1SVGA 3IDPA 3HMIA 5K5NA 3OCBA 1Z5MA 3E88A 4D4YA 1PW2A 3GVUA 4PL4A 4A9RA 2HW6A 4FKUA 4K0YA 1ZAOA 2VX3A 1A9UA 1NT2A 3P78A 4J1RA 5H8BA 3G6HA 4OT6A 4WO5A 3R8UA 5I9WA 3DK6A 4FSZA 3BYUA 3QWJA 5B7VA 3G15A 5LXMA 2X9FA 4YP8A 4JDKA 4JQEA 4A06A 4EK3A 3MY5A 2W1EA 1YHSA 3FMKA 3Q9YA 4QMUA 4TRLA 3WF9A 3WYXA 3OTUA 2B9JA 4FSNA 1PXLA 3EZRA 3VRYA 5KX8A 3MYGA 4QNYA 4V05A 4O7ZA 4H36A 5BVOA 2BTRA 3LAUA 3DGKA 4OTPA 4TNDA 5E8ZA 3BCEA 4FK3A 3UYTA 4M67A 2B4SB 2O3PA 3I1AA 3PXZA 2UVXA 4FTUA 5ANDA 5EDQA 4ZLYA 4UX9A 1FGIA 4DINA 4NK9A 4APCA 3LLAA 4KS7A 3FBVA 3O51A 5JEBA 3MDYA 4JAIA 2W1DA 4WSYA 4OBQA 5K0KA 4O7SA 5IQCA 2J0KA 2VTRA 4GUEA 4QD6A 4EKKA 3NNUA 3UDBA 3KFAA 4FTMA 4J98A 3G2FA 1ATPE 1KSWA 1GZNA 3LJ0A 3TT0A 3UYSA 1B38A 4JBPA 5E92A 3VS3A 4PL3A 5BQ0A 5I0BA 4JVGA 4KIPA 5KCVA 3NUUA 4WNOA 4QRCA 4YURA 2HZNA 1H27A 2VGOA 1YDTE 4S33A 5AUYA 3QC9A 2OSCA 2VTHA 4FZ7A 4IAZA 5DRBA 2J7TA 5AP6A 3RPSA 5BVFA 2PZIA 4Q5EA 4F9WA 5EW9A 4NJ3A 5A4QA 1SNXA 2CGUA 1H1QA 3D5XA 3OEFX 4IB3A 1H01A 1JSTA 2C6DA 3C13A 4NM7A 1GAGA 1U5RA 4DAWA 2W1FA 3PXRA 4RIWA 3R73A 3ZYAA 4RIYB 1FOTA 5GHVA 1ZLTA 1RW8A 2YDJA 1Y8GA 4LL0A 2PTKA 4H3BA 3LXLA 3QC4A 4UXLA 2WQEA 2CSNA 5DVRA 4E6DA 4ZJIA 3BU5A 5L8JA 3Q4TA 4O84A 3RAWA 2VZ6A 2XIKA 2XKCA 5GNKA 3IONA 3CJGA 5HNGA 3DU8A 3QQGA 4NKSA 4M3QA 2FSTX 4YNOA 2QOQA 4PDYA 5LMBA 4I5HA 4K11A 4YHFA 5KBQA 3DJ6A 3DK3A 4CYJA 1PXKA 3ZHPC 4F7LA 5E1EA 5DMZA 1PXPA 2UUEA 3MJ1A 2VD5A 1PKDA 2OIDA 2PSQA 3PXQA 3QCXA 2HZ0A 4N70A 4BIDA 5L2TA 3LKMA 3GU7A 3TXOA 4O7RA 3BI6A 2XK8A 3SXSA 2X6EA 3DKCA 3FZPA 4GIIA 5HE3A 1U46A 3RK9A 2WQBA 2JIVA 3KMMA 4GEOA 4CCBA 2PVLA 4S32A 1Y8YA 2DS1A 4ZTSA 3QCSA 3DZQA 3O8PA 3FMJA 3BHVA 4FNWA 4F6WA 4WNPA 4UWCA 1CTPE 4I0RA 3F3UA 3HV6A 4I5CA 4QMNA 1ZXEA 5CSHA 3FZRA 4FIFA 1H1WA 1K9AA 5AUXA 3QXPA 4HGLA 4EEVA 3BE2A 5ACKA 3CD8A 4L67A 2HW7A 3V8WA 3W2CA 4E5BA 4QPMA 4FIIA 2W4JA 4O1OA 1JOWB 5CF4A 1UU7A 2C5XA 2DWBA 2J9MA 5CX9A 3RHXA 3KL8A 3QRIA 4QMSA 2YHVA 3QHRA 5AV3A 2WHBA 4DFXE 2ERKA 4FTLA 4RWIA 1A48A 5KUPA 3CKXA 1ZMVA 4MF0A 3AD4A 1QMZA 4NWMA 3UMXA 3QGWA 1Q8WA 4N6ZA 3FZ1A 2B53A 2IW6A 4HYUA 4ANNA 4AXAA 4O2PA 3G6GA 2WTJA 4U3ZA 4CKJA 3BBWA 3LQ5A 5HI2A 4KSQA 4PMMA 4TYEA 5DBXA 3LXKA 4IX5A 2J0LA 3LXNA 3GBZA 3CTHA 1YHWA 2C5OA 1LP4A 3CQEA 3VRZA 4QMWA 5CU0A 3DXQA 2WOTA 2C6KA 3EOCA 4KAOA 3SOCA 4D5KA 4PWNA 3HV3A 4QQTA 4PP7A 4YUQA 3QZGA 1YOLA 3P23A 3ZSHA 3ERKA 2XCKA 3U9NA 2PE0A 4JBQA 1WFCA 3EQGA 4QP3A 2G2IA 3MV5A 1Q8UA 3QKMA 3W2SA 5DR6A 2C6TA 1OMWA 3Q32A 5EM5A 3EYHA 4BCJA 2CLQA 4ZMEA 4QMTA 3COHA 4J7BA 2ZV8A 3LCDA 3SHEA 2C1BA 2X4ZA 4GRBA 3QRKA 4J97A 2XK3A 1ZWSA 4HCTA 4B4LA 3E8EA 2GPHA 3V8SA 4A4OA 2IVSA 5HX8A 3KY2A 2C0IA 2VO0A 4L45A 1B39A 2XA4A 3FSKA 5I9UA 5IQIA 4CG8A 3C7QA 3KXGA 3I5NA 3A4OX 4OAVB 3FI3A 4S34A 2QOBA 5FXSA 2QODA 3R1SA 3TM0A 4IVDA 2WMVA 3FY2A 3TNIA 1JAMA 2IW9A 4RC4A 4BCMA 1CKIA 5EM6A 4ACMA 4MD8E 5ANKA 3HA8A 4C34A 4JDHA 2W96B 3VUGA 4IXPA 2ZB0A 3PLSA 3V6SA 4F4PA 2V0DA 5AP1A 3NUYA 3SXRA 2VTNA 5M4FA 4JLCA 2ITTA 2ETMA 2WMRA 4GVAA 4E4MA 3VBWA 4YTHA 3PVBA 4L68A 5J9YA 4KUJA 3QX4A 3Q04A 4M69B 4E26A 2VTQA 2OXDA 3MESA 3CY3A 3LM5A 4N57A 4IQ6A 3DAJA 4O0VA 4D9UA 5ANIA 4EZ7A 2R2PA 5IG1A 4I41A 1P2AA 5IISA 3EB0A 1CDKA 3AGMA 2ERZE 3TNWA 3VQHA 4ZTQA 1RE8A 5BUIA 5BYYA 3ODZX 4FSYA 3PXKA 4IBMA 5BVWA 1KV2A 4BCGA 4U7ZA 5CASA 4M68A 5IQGA 3RWQA 2RFNA 3VWAA 2UW5A 2XKDA 3POOA 2R7IA 3LOKA 3DNEA 3KK8A 3RK5A 5HORA 3LQ3A 5FLFA 5HO8A 1BUHA 2WFYA 3KRLA 2I40A 4S30A 4EOSA 1M2QA 3KCKA 1GZKA 5TF9A 5J9ZA 3JY0A 5GJFA 1X8BA 4FL2A 5T68A 3Q2JA 4RT7A 4BHZA 2R64A 4FE2A 2YDKA 4AX8A 2OH0E 1MP8A 3DXPA 1HCKA 4DH1A 5BPYA 4EBWA 4UZHA 3C4CA 1O6YA 3MGYA 3R63A 4H3PA 3FC2A 3PPKA 5EHLA 3R8ZA 2J5FA 5DG5A 5JZNA 3SQQA 4L7FA 3GQLA 1OKYA 2OJIA 2WQNA 3LFQA 4FTCA 4EH6A 4X21A 4G3EA 5HD7A 5EQPA 4I4FA 3KREA 1GZOA 3F5PA 5K3YA 1ZOEA 1PYXA 5DT3A 3VBVA 4U6RA 2EVAA 1ZYJA 5JH6A 1YOMA 2CNVA 4JRNA 3F2AA 2C5YA 2W1IA 3R7EA 3L8SA 5DA3A 2B52A 4WNKA 2WMSA 4GG5A 2YZAA 2O65A 4JIKA 5GIPE 5L8LA 3QA0A 3Q3BA 3S00A 4JT3A 3UZPA 1JPAA 4FOBA 5D7VA 2Z60A 4QP9A 4ANSA 2A1AB 2BVAA 4CV9A 3C5IA 4ZSLA 4Z7HA 4J71A 4F1OA 1PRYA 3UBDA 2BFXA 1URCA 3PA5A 2YLEA 2VUWA 1IA8A 4RVMA 4TWCA 1XWSA 2W1CA 3O96A 3ZLYA 1GIJA 4MBLA 3TKHA 4L6QA 2ITOA 4EUUA 3L9NA 1Q97A 1Y57A 4OLIA 4NIFA 2W5BA 3A2CA 2CNQA 3RVGA 2O0UA 2VWIA 3KGAA 3QCYA 3ORTA 3BYMA 2CDZA 4DT9A 4FT0A 2CN5A 4RIXA 4F7NA 4CSVA 5LMKA 4AZVA 4W8DA 5AP7A 2C6OA 2UZNA 4MNEA 1OL5A 3R7UA 4USEA 2PUUA 4XBRA 3ODYX 3HAVA 4FKVA 4J53A 4L44A 4LMUA 5HHWA 4GCJA 2QOLA 3HMOA 4OUCA 5L2QA 5B2KA 5LWNA 3PUPA 4MD7E 5GJDA 4FZAB 5FEQA 4G2FA 4BF2A 4C4FA 3ZO2A 3F9NA 2XJ2A 4ASZA 3PY1A 4BZNA 5CYIA 3PSBA 3DJ5A 3R00A 4WG4A 3EFLA 4YZMA 2R3QA 3U6HA 4O27B 3QD2B 5DE2A 3MBLA 4XLVA 2FUMA 2CGXA 1DAYA 4RX7A 5AP2A 3KB7A 4AACA 5IUHA 4DT8A 5A3XA 2WTKC 3R1NA 4MVFA 4B99A 3IW6A 4RLKA 2E9OA 3CKWA 4IADA 4YJPA 1FBNA 1R1WA 3WIGA 3QQUA 2C6MA 2V7OA 3DNDA 5A46A 1MUOA 3R8VA 4MXXA 4TWOA 4PPCA 4QMPA 1H26A 5BUJA 4Z16A 3FLNC 3L8VA 3WZKA 2GNLA 2OJJA 4V0GA 4RJ8A 4HCUA 1PXIA 4A9TA 4DG2E 4IB0A 3MY0A 4FEXA 4IJ9A 3U9CA 3Q96A 3DB6A 1BX6A 5J1WA 3EKNA 5KO1A 1YWNA 4C4EA 4JAJA 3D15A 3FI2A 3DXNA 4L53A 4CFWA 3NYXA 4NTTA 3RZFA 5I4NA 4QMXA 5IQHA 1V0OA 1Z9XA 1KOBA 1UU8A 1FGKA 2XB7A 5KE0A 4E1ZA 4E7WA 3AT2A 1J1BA 4FSUA 4W4XA 3AGLA 1OPLA 3FYKX 4FG8A 4NFNA 4LOOA 1KE5A 3VUTA 1VYWA 2QO9A 4EBVA 5CEOA 3CTJA 2JDTA 4GK3A 2XIRA 3FHRA 3L9LA 5AX9A 2PWLA 4UALA 2ZB1A 4EH4A 2YCFA 4D9TA 1OIRA 2X7GA 3JYAA 1WBVA 3VS0A 2RG5A 1IASA 2VX1A 4UMRA 5TT7A 4YJOA 4CQEA 4F9YA 4WOVA 2XKEA 3R04A 4RPVA 4OTDA 3LPBA 4D2WA 3EJ1A 5AP0A 4BRXA 4EH8A 5FD2A 2I0HA 3RWPA 3GQIA 2XJ1A 3NZ0A 5T3QA 4GT3A 3F5XA 3UGCA 3SW4A 5J1VA 1JNKA 4F6SA 5JGAA 4IAIA 5FTQA 3P7BA 4GVJA 1XH4A 4CNHA 2Z7SA 3BGQA 2VTIA 4K2RA 4YJTA 4QPAA 4TXCA 1H4LA 4IWQA 3DQXA 5E8VA 4LOQA 1PXOA 3RPYA 4OGRA 2C5NA 4PMPA 4CVAA 4IZ7A 3P7CA 3PYYA 1NY3A 3RP9A 1ZYDA 3DPKA 5JKGA 1STCE 4XX9A 1H0VA 2FGIA 4FVPA 4G3GA 2GNGA 2HENA 2O2UA 2WKMA 3G9LX 3QCQA 1ZARA 3W32A 3PA4A 4AOTA 4CYIA 5JRQA 4WG5A 2ITQA 4RIYA 4TWNA 4IAKA 4HZSA 4U0IA 5L6WL 2P4IA 3ORNA 3VBQA 3NWWA 3R83A 4QMYA 4BWXA 3BQCA 5HU3A 5AP4A 3V01A 4GU9A 3PWDA 4BI0A 5HX6A 1J7IA 5HIBA 4PF4A 3MA3A 4TYHA 3PE1A 4F7SA 5HEZA 1YXSA 1TQIA 2YLFA 5CS6A 4DCEA 4PMTA 1WBPA 2XM8A 4EOIA 5IA5A 2R9SA 3HMPA 3FKLA 3EQFA 3D0EA 2ITNA 2E2BA 4FV9A 2OGVA 5E9EA 4FT3A 3GENA 2BZHB 1SVHA 3EZVA 3PJ3A 2CGWA 5AR5A 4RJ4A 4FV3A 3NIZA 5C8MA 4IAAA 2QLQA 3WYYA 3ZRLA 4AUAA 3I6WA 4GKHA 5I9ZA 5HO6A 3IOKA 3FY0A 4YNEA 4EZ3A 3QRUA 3NSZA 5HLWA 3VW8A 3F7ZA 3MJ2A 4O22A 3C51A 1OIYA 5HVJA 3TZMA 5FXRA 1TQPA 4YJSA 3O0GA 1U5QA 4JDJA 5LARA 2GNIA 2V7AA 3EHAA 4I22A 4QMOA 3UZRA 3TZ7A 3I0QA 1M2PA 2C3LA 3R6XA 1F0QA 3TIZA 5I9XA 3DAEA 3ORPA 3D14A 1ND4A 4W4WA 4C59A 1PMVA 2JBPA 2G01A 3FSFA 3PPJA 3QAME 4AZWA 3QD3A 2VTPA 3K3JA 2G2FA 5DIAA 4BR3A 3FQHA 3D9VA 4TNBA 1UWHA 3MPAA 3PZEA 4K1BA 3R8MA 4L46A 3VF8A 4F9CA 2YWPA 3HEGA 4ZLOA 5A4LA 4DFBA 2XNBA 3HRFA 4K8AA 3AG9A 3R2BA 4XUFA 3NLBA 4WRSA 5HU9A 3KVWA 3VUKA 4NEUA 1LR4A 4DLJA 2OK1A 4KKHA 3R7GA 4IX4A 4JR7A 2XP2A 5BMSA 1H1SA 4MX9A 2VX0A 3KF4A 2UZOA 5CSXA 2GS2A 2GDOA 4H1MA 3H10A 4BZDA 5D11A 1NVQA 3TACA 4P90A 3R9OA 5CEKA 1XO2B 4EH9A 4XJ0A 3V5LA 3HDNA 4XP2A 3T3UA 2PE1A 4YHTA 4CCUA 2CKQA 4MXYA 4NM0A 4OTGA 4DTAA 2YIWA 5M4IA 1LPUA 3C4ZA 3NYVA 1TVOA 4A07A 5EI6A 4G5PA 4BCNA 2VWWA 4FYOA 1GIIA 3AD6A 3QTRA 4FKPA 4IM0A 4FTKA 2BROA 4CZYB 4XMOA 5DNRA 5HO7A 3WILA 5IUIA 2YA9A 3QUPA 4FT7A 4YTIA 5E8UA 3BBTB 2OBJA 5BMMA 3BRBA 4FV1A 4QTDA 4LRJA 1UNHA 4MCVA 5IEXA 5C4KA 5L6OA 3OBGA 4X3FA 5M4CA 3UE4A 5LWMA 1SNUA 2R7BA 4IM2A 2GTNA 3SKCA 3U87A 4U45A 4CFNA 3ULIA 4GH2A 3TTJA 4I92A 3VO3A 2IZUA 5CU6A 4BCQA 2C47A 4ZTLA 4TYGA 4QP6A 5CEIA 4HVGA 1OGUA 3R8LA 2REIA 4MBJA 5DHJA 3TNQB 2PMOX 2VNYA 4OAUC 3CBLA 4YLKA 2FO0A 3JR1A 4ONAA 3KN6A 4E5WA 3NW5A 4FKOA 4DHFA 5K4IA 4XOZA 2BDFA 4AOIA 4MF1A 4FG7A 4DFYA 2XEZA 5J87A 2OIBA 3DQWA 1M7NA 2E9UA 4G3FA 4ASEA 4C62A 3WZEA 4DH5A 4FKLA 4M69A 2BZJA 2BAJA 3V5PA 5EK7A 2E9VA 4QP1A 1JKKA 1JKTA 2QC6A 3LCOA 3ZCLA 4WG3A 4KBAA 1RQQA 5CU4A 5EKOA 5K5XA 4ZS4A 4QMLA 3RK7A 3COIA 2ACXA 4FKGA 5FTGA 2C3IB 2OU7A 1Q8YA 1PXNA 3NX8A 3OS3A 5J95A 4B6LA 1Q62A 4TZRA 3OY1A 3VQUA 2ITXA 3V3VA 4BTFA 5F95A 4D1SA 2YABA 4D28A 4EI4A 5BNJA 4ANMA 4RVKA 4U81A 4DGLC 2QR7A 2I0EA 4FL1A 5GZ9A 4NIFB 4CXAA 2XNGA 4ZJVA 3WE4A 1WBWA 2PU8A 4PX6A 4F0IA 1XJDA 1PXMA 1R0PA 4EJ7A 4YBJA 5D7AA 4RIXB 5H2UA 3MSSA 2C6LA 3HECA 4MNEB 5CZIA 4ANLA 1KE6A 2VTOA 1GNGA 3MW1A 2G1TA 4E4LA 3QZHA 4FT5A 4IEBA 3ACJA 2VO7A 2PE2A 2QG7A 3BHUA 2HCKA 3VHEA 3FMDA 4IFGA 3II5A 5IA1A 3LFNA 3OMVA 2OF2A 5AEPA 3AC2A 1UU9A 3FZOA 3F88A 3EQDA 3HV5A 2NPQA 1YXXA 4TKSA 3V5JA 1M2RA 4FSWA 1BI8A 5ANGA 2W4OA 5EH0A 3OWPA 3OG7A 3ZRMA 2UZDA 2A19B 5C27A 4EQCA 5M44A 1H24A 5JGBA 5FBOA 5M07A 3ZMMA 4JBOA 4GL9A 3H4JA 4KKGA 3NUSA 2ITPA 1OECA 2XUUA 4FBXA 2VV9A 4L8MA 2VWYA 4FTIA 4F08A 2GQSA 5F1ZA 3LMGA 5HVKA 2IPXA 3R1YA 2W9ZB 3GP0A 4IANA 2VTMA 4HOKA 4KINA 4C4JA 4F0FA 3H9RA 4UY9A 5JZJA 1JKSA 4V0GB 4EH3A 5KZIA 3KKVA 4A4LA 3TEIA 4EWQA 3GCPA 2X4FA 1Q4LA 2EB3A 2W7XA 1TKIA 4U41A 4Z7GA 5A6NA 2BKKA 4M12A 5HOAA 3TV6A 4BI2A 5D9HA 4E6QA 3AC3A 2FYSA 2YIRA 3OBJA 2VWZA 4IC8A 1UNGA 4YZ9A 5FDPA 4BDIA 1YXVA 2PUNA 4O81A 2J2IB 1M17A 4XBUA 5EYDA 5EQEA 3NVKI 4NT4A 1FMKA 3V04A 2WAJA 3GOPA 5J8IA 4XEYA 3QHWA 1OPKA 3PVGA 3Q5ZA 4ZMFA 4YZNA 4Z3VA 3FXWA 4FTOA 4YZDA 2X2LA 3K54A 4ZY6A 3V5QA 4C2VA 5C26A 4PDOA 3KMWA 1APME 3O7LD 1Q3WA 1UWJA 4D2VA 5HTIA 2X2KA 4QO9A 2J5EA 4IC7A 1XBAA 3NUAA 5HNIX 3CJFA 3CE3A 2FSLX 2HZIA 4U44A 3ZUUA 3PVWA 2X8IA 2XF0A 5L2IA 3E87A 4EK4A 3UOHA 4O6LA 4E93A 5IU2A 2WIPA 3BV2A 1ZYCA 4FV7A 2H9VA 1JSUA 4M97A 2HZ4A 3EKKA 4IM3A 3OCSA 3R22A 3UVPA 4JI9A 3RHKA 4BCHA 4QP7A 2C6EA 3TJCA 4LUDA 4IX6A 5LCKA 4L42A 5DN3A 5HNBA 5CSWA 2YDIA 1CSNA 3MTFA 2C4GA 2Y4IC 2PMLX 3EQBA 3COKA 3QQKA 4HPTE 4JR3A 4ZSJA 3QTXA 4NU1A 3TG1A 5ANEA 4IZAA 4DEBA 4F99A 5CZHA 2C1AA 1XKKA 3D5UA 3IW4A 5K0XA 4AE6A 2QHNA 1A06A 3IS5A 3IPHA 2WOUA 2GS6A 1LUFA 3KXNA 2XIXA 5CSVA 5CF8A 2YCSA 3C4WA 3TKUA 3BELA 3OROA 4AOJA 2C30A 4BCKA 5FEDA 1MRYA 2P0CA 4PMSA 5ETAA 3CPCA 4R6VA 5IQBA 3VUIA 5KMOA 1H1PA 4C4IA 1OKWA 3IGOA 4ORKA 4O21A 4XH6A 1PMEA 4FF8A 3PJ8A 3UTOA 4BCOA 2F7XE 3ORKA 4YC8A 3OW3A 3PXFA 2CMWA 5C9CA 2YJSA 4L00A 2BFYA 4EH7A 3R9NA 2BTSA 4TYHB 4HVDA 3AC8A 2R0UA 3HUBA 1YI3A 5C03A 4I0TA 4RWKA 1Q3DA 3OXZA 3Q9WA 2X0GA 4Y85A 4QQ5A 5G6VA 3LFAA 3SG9A 4J8MA 2BDJA 4BDCA 4G3DA 4IJPA 1AQ1A 2LAVA 5JMSA 4DG3E 2OFUA 4W8EA 2IZRA 3ANQA 3NCGA 3THBA 2XCHA 4JX7A 2XIZA 3R7YA 2BRNA 3BKBA 5CI7A 4FKQA 2XNPA 3DBFA 4EOKA 3FZSA 3F69A 1SZMA 1OITA 4O0XA 4CT2A 4DEGA 2BHEA 2PZYA 3OUNB 4UWBA 4ASDA 5AAGA 5HTBA 4C8BA 5L8KA 2ITUA 4FTJA 5DWRA 1W0XC 4U79A 5JRSA 3SOAA 1PYEA 4EOMA 2QURA 5ETCA 3Q6WA 4L3LA 4QYGA 3RINA 2BRGA 3E3PA 4LGHA 3QTSA 1MRUA 4WSQA 5CEQA 4DFNA 5HESA 3RKBA 2EXCX 4UMTA 3RAHA 3EQPA 3ORLA 2XM9A 2CJMA 4KS8A 3FE3A 3IK3A 3OVVA 2XMYA 4J99A 4FKTA 4D5HA 1W8CA 4AGWA 1W83A 3HRCA 3LQ8A 4AN2A 5IDPA 4S31A 3K5VA 3MFUA 4C36A 5HCZA 1AD5A 5LQFA 2W4KA 1R0EA 3KXMA 4O7YA 2PMNX 3JS2A 4EORA 3ITZA 5J5SA 2X8DA 4RJ3A 2A27A 4UBAA 2Z8CA 3F2RA 3MVMA 4HW7A 2NO3A 3QD4A 3FL4A 4HYHA 5BVKA 4LQMA 2UVYA 4G3CA 4XNEA 3RNYA 3F3VA 1XBBA 4C4HA 3ID6C 3EWHA 2RKUA 4FMQA 4U42A 3JY9A 3DA6A 5L4QA 2WTDA 1QPEA 4BYIA 5IQDA 2YITA 4ZOGA 4DH8A 4XP0A 3SRVA 2QKWB 4BICA 3KN5A 4C7TA 5KHWA 4EHGA 1BYGA 2W1HA 1T45A 3DDPA 5I5ZA 3R21A 3BV3A 3KRXA 3H0YA 3SDJA 3HL7A 4CFXA 2NRUA 3K5UA 5HG5A 3SX9A 2BKZA 1WBOA 5BUEA 3UQFA 3CGOA 2JC6A 2UW8A 2YAAA 3KK9A 4BN1A 2WMBA 3EFWA 3W33A 4WRGA 4FGBA 4RWLA 3EFJA 4ALVA 4DEDA 4NSTA 4DTBA 1IR3A 1UNLA 3TUCA 5D10A 3UIXA 3RCJA 4F0GA 3F3WA 3L9MA 4X3FB 5CQUA 4I6BA 4JNWA 2C0TA 4KNBA 5E8YA 4HJOA 3BX5A 3EQIA 4TYIA 2F49A 3KCFA 5FTOA 4PY1A 2QR8A 4QYHA 4RMZA 4YLLA 2O63A 1BMKA 3VUHA 1YVJA 2JFLA 3QXOA 2XRUA 4W9WA 1Q8TA 5LVOA 2BAQA 2PVRA 3BE9A 4HYSA 4PV0A 2W5AA 4G1WA 4UEUA 3CIKA 1CKPA 3W18A 2V62A 5AADA 3HUCA 3OF0A 5E7RA 4DN5A 1H28A 4GFOA 4N4SA 2PYWA 4YPSA 3TN8A 2RFEA 4TWPA 4L52A 1JLUE 3QL8A 1OIQA 4BHNA 4FEQA 1OKZA 5DLSA 2JFMA 3MI9A 3VC4A 3ZONA 3A7HA 4J96A 4G6LA 3GB2A 3ZUVA 4BYJA 4PRJA 1U4DA 2ETKA 5AUUA 3EFKA 4G34A 4LMNA 5I3OA 3MPTA 5CF5A 2VWBA 5JFXA 3ZXTA 4YTCA 4U40A 5AX3A 3QD0A 3L8XA 3QTIA 4CMTA 3WF6A 3H0ZA 3LMIA 3O7LB 5C8NA 4M14A 4DGNA 2X39A 4OTIA 1BL6A 2J50A 3PJCA 4EQMA 2NNWB 1J3HA 3ALNA 4BB4A 3VJOA 3MN3A 4PL5A 2ZM1A 2PY3A 2QO7A 2X7FA 4B9DA 2WQOA 2A2AA 5J7HA 3V51A 2DQ7X 3OCGA 3TNHA 1JVPP 5JT2A 1DI8A 5CQWA 3RPOA 3QZIA 2UZTA 3HMMA 4X2GA 4DF3A 3MVHA 1IAHA 5BVDA 5GZ8A 5EW3A 1FVVA 4PPAA 4O0SA 4CZTA 4YO6A 3ORXA 5HG7A 4C58A 4NH1A 2BR1A 1P14A 2IJMA 2BRMA 4CFMA 2C0OA 2OH4A 4DYMA 2QOKA 3IQ7A 5AR8A 3VS4A 4F1MA 3PXYA 5CAQA 3I7CA 1ERKA 3HZTA 3KU2A 2Y4IB 3A62A 3GU5A 3A4PA 1MRVA 3R2YA 5IEYA 3RZBA 2GQRA 4E4XA 4MK0A 4AW0A 4B8LA 4MTAA 2WMQA 5HG9A 5J79A 3R7VA 3H3CA 3D83A 4JG8A 2R0IA 3QYWA 4MWHA 3W10A 4NFMA 2RGPA 4QP4A 3WIKA 4AA4A 4JG7A 3TV4A 3QUDA 3BEGA 5DYJA 2UZUE 4IFCA 1UKHA 3W55A 3FKOA 3CLYA 3R7IA 3RAKA 2QOIA 4W4YA 4X3JA 3EQCA 3AXWA 3UG2A 3BU3A 3U51A 3PDTA 3PJ2A 4RGJA 3FKNA 3IDBA 3FPQA 3CQWA 3QLGA 5DGZA 5EM7A 2XNOA 2HY0A 2P33A 4XRJA 4FIGA 4IVAA 4PTCA 4P2KA 4AQCA 5FM3A 3ROCA 3GEQA 3TUBA 3MS9A 4JG6A 3FMLA 3IECA 4TN6A 4EJNA 2FVDA 4CQGA 4EHVA 3ZDIA 3BZ3A 4AZEA 4X6QC 4DEHA 2PVJA 4W9XA 4UMUA 4O83A 4C33A 5LVLA 2YM5A 5IQEA 4BDHA 5HIEA 5AV1A 4FV4A 4RIOA 5KMKA 3OWKA 4O7TA 2G9XA 3C0GA 2XNNA 2W06A 2HXLA 4PPBA 2WZJA 2FA2A 4S2ZA 2PPQA 3KQ7A 3EN9A 4IH8A 4RQVA 2F7ZE 2FB8A 3QKLA 5JFVA 5FBNC 4BDGA 2QI8A 4NYEA 3FLSA 5HBHA 4O7WA 2YM3A 4E3CA 4BGGA 4YZCA 3E64A 3GCUA 3PIYA 4LGDA 4R7HA 5EI8A 2J90A 4K77A 3G5DA 4NL0A 2VNWA 1GJOA 3W2PA 1BLXA 1W82A 5FG8A 4EOQA 3OWLA 1DS5A 1HOWA 4DG0E 3LM0A 2WMXA 4RX8A 3VBTA 2X2MA 4QTAA 1PXJA 4C35A 5IQFA 1UKIA 4Y72A 4P4CA 5EYMA 4AZTA 1WVXA 4GU6A 4LV5A 4YJQA 3QYZA 5CT7A 4O0WA 3VS1A 4AAAA 4AP7A 4QPSA 2HIWA 1ZYSA 3MA6A 4MH7A 4IMYA 5FXQA 2ZDUA 1EH4A 3UQGA 5J9LA 1JSVA 4NZWB 4G6OA 4FEUA 3I5ZA 2IVUA 4XS2A 5M4UA 5EM8A 5A54A 4GJ3A 1OPJA 3WI6A 4R7IA 3A60A 3PY0A 1CM8A 3O50A 4XCUA 4O91A 5C1QB 1KUTA 4O86A 1YI4A 4A4XA 5B2MA 2GMXA 4QP8A 3UVQA 3JPVA 5BX0A 4MD9E 5KZ0A 2WPAA 2XYUA 3R71A 4YHJA 4ZTHA 3LVPA 1H00A 4BKYA 5KMIA 3E5AA 3AQVA 3R0TA 3GI3A 4W4VA 1LEWA 3A7FA 1P4OA 4H58A 1ZOGA 4AGUA 4BFMA 3D94A 1MQBA 4D2TA 2VTJA 3TL8A 2HOGA 4I1ZA 5DT4A 5HG8A 3REPA 2YCQA 4QMZA 3FWQA 3HA6A 4GT4A 3TNPC 5CEMA 3Q52A 2YISA 2XNMA 3FZTA 4M15A 2UVZA 2WD1A 3E7OA 3IKAA 4WBOA 3BGPA 4AFEA 1R78A 2Y4PA 4RBLA 4ZS0A 4MXAA 2Y6OA 3OD6X 4CV8A 1Q24A 4GIHA 4ERWA 4UMPA 2OXYA 5IQAA 3F6XA 2WTIA 4WUNA 4D55A 3U6JA 4L9IA 2Z02A 3H30A 4U97A 5LMKC 3TDVA 1REKA 2Z7QA 4C0TA 4G5JA 4M84A 3QTUA 4FIHA 3R01A 1I44A 3CXWA 4RC2A 3SXFA 4UWYA 4HVHA 1XH5A 1YXUA 2Q0BA 3E3BX 3QF9A 3MFTA 3ZLSA 4EHEA 5JFSA 3NNXA 4UYAA 1NVSA 5M51A 2R5TA 3QLFA 5LVNA 4Q9ZA 3E92A 4KRCA 2QOCA 2OICA 3CTQA 5IUGA 5FEEA 4I94A 3ZC6A 3OT3A 2YM7A 2XVDA 4B0GA 3SVVA 3S4QA 1KE7A 1KE8A 3JVSA 3W2QA 1FVTA 2GSFA 2QNJA 3DBCA 2JIUA 2XKFA 3F82A 4DGOA 3B2WA 3FAAA 2PUPA 4BDAA 4MKCA 3ETAA 3ORZA 3DBDA 1P5EA 1AGWA 4ZP5A 5EQYA 2OXXA 3UODA 4D4RA 2YEXA 4AW2A 1G8AA 3D2KA 3WZJA 3UIBA 1FPUA 5DEWA 2QOOA 3RM6A 5JGDA 5EOBA 3FXXA 2JDRA 3O8UA 4M66A 5CAVA 4MAOA 3NAYA 1YI6A 4ACHA 4DEIA 5IH4A 1SMHA 3S0OA 2BUJA 2W05A 3ANRA 5D1JA 5C01A 2QOFA 5B2LA 2JGZA 4PDSA 4RJ6A 1FVRA 2HELA 3NS9A 5TKDA 3N4TA 3UPXA 3OC1A 4LRMA 4ANOA 5FM2A 3O8TA 4Z55A 2X81A 4QTCA 5M08A 5LVPA 2VO6A 4FV8A 2XH5A 3SRVB 2WMWA 3TZ8A 3EN6A 5TO8A 2RG6A 4DFLA 3LFBA 3LFDA 3UJGA 4KSPA 4PTGA 3DZOA 2GFCA 4DH3A 4PDPA 3C4EA 3DBEA 3VULA 1O6KA 5EW8A 2B7AA 5BYZA 4O96A 2CKOA 2R3PA 2XBAA 4TL0A 3HRBA 4RJ7A 4X2FA 5CAOA 3IW7A 4I3ZA 4ZXTA 3RPVA 4ZY4A 5IA2A 3EN7A 4A9UA 3HP2A 3UNJA 2IVVA 5HE2A 2ITVA 1XH9A 3PIZA 4GK4A 1VR2A 4KKEA 3LFSA 4HVSA 3ZLWA 2ZDTA 4RRVA 1OVEA 1G5SA 4NTSA 5AM7A 1DI9A 4XV3A 3DKOA 4M8TA 1GZ8A 3AC4A 2IG7A 1OIUA 4O7LA 4CGAA 5ETIA 2RF9A 1YWRA 3MH3A 5L6PA 4FNZA 4FV6A 2OKRA 1BL7A 2G15A 2QOHA 4O38A 4ASXA 4AW1A 4KIKA 3H9OA 2QLUA 4MNFA 3NYOA 2PHKA 3PP1A 4Y5HA 3BIZA 3QZFA 3KMUA 4YJNA 4P7EA 4CZUA 3E7VA 2JITA 2BIYA 4OTQA 4D1ZA 5C8KA 3COMA 3CCNA 4R5YA 3PZHA 4V01A 5EFQA 3PRFA 5DR2A 4E4NA 5AIRA 1DAWA 3QA8A 4RZWA 5F20A 5CVGA 2WEIA 4OW8A 5F94A 3TTIA 1ZMWA 1QCFA 5I3RA 5HZNA 4JOAA 3UVRA 3NR9A 3NUXA 4YC6A 4FYNA 5IH6A 4USFA 5AV0A 3E8NA 3KVXA 4NCTA 5CAPA 3D5WA 4QQCA 3WF7A 4AS0A 4QOXA 4BKZA 5AP3A 1CKJA 5JSMA 3NW6A 4R1VA 1NA7A 2EXMA 1V0PA 2JD5A 4NW6A 4OTWA 4CRLA 4F70A 3LXPA 3UNZA 2W5HA 3ZC5A 3B8QA 3FXZA 4FEVA 3QRTA 3KRRA 4I20A 4EUTA 3S1HA 5EKNA 4AA5A 3CC6A 3HAMA 3AC1A 1BI7A 3W2RA 1XQZA 1H08A 2R3MA 3AT3A 4U8ZA 4X7QA 3PG1A 4BCFA 1OZ1A 1YKRA 4GT5A 3GOKA 5DOSA 4AA0A 4WNMA 3ZZEA 3GCVA 1ZOHA 4YZBA 2YERA 5CU3A 2OLCA 3OW4A 4QYYA 3VHKA 2B9FA 3QRJA 4LRKA 3BWJA 3NEWA 3A7IA 1WBTA 5FP5A 3CEKA 5HIDA 3ZSGA 3S2PA 5AUTA 1ZRZA 4NM5A 4FV5A 3VW6A 3O2MA 3S95A 4XG6A 4JXFA 2PK9A 2UW0A 5JN2A 3AMBA 2GFSA 5HQ0A 1YHVA 4ZJJA 4MXOA 2QU5A 3AC5A 4FK6A 2JDVA 3U4WA 4B7TA 2YM8A 4I5MA 3BLHA 5AR4A 2PUIA 4BC6A 3O23A 3QFVA 4KABA 3UPZA 5AA8A 3VVHA 4DGMA 4X2KA 3HKOA 4BTJA 3FMMA 3W1FA 4JS8A 4O0RA 4FTAA 4UV0A 3UIUA 1OB3A 1XR1A 2ITWA 2PZPA 5KKRC 2G2HA 4CFUA 3N4VA 2BDWA 3WF8A 3FI8A 4FIJA 4GFGA 3A61A 3L1SA 3PWYA 4FVRA 4WD5A 1JQHA 5AAFA 3DT1A 4R1YA 1WVWA 2WNTA 5IZFA 2J51A 4L7SA 3BLQA 3T3VA 1F5QA 1XH8A 3HVCA 3CGFA 5DR9A 4HZRA 4C61A 3ET7A 2VGPA 2VWUA 5JK3A 4ARKA 5A6OA 4NCTC 3OWJA 1QL6A 3R02A 4AE9A 4PNKA 4MEDA 1KWPA 2VAGA 1G8SA 5M09A 5CTPA 2QHMA 3R9HA 4NM3A 4R77A 2X1NA 5ETFA 2PVHA 2QQ7A 4I5PA 2WMUA 4H1JA 4C02A 1XH7A 4BY9E 3NCZA 4OBPA 3Q4UA 4IW0A 3CSVA 4EYJA 4V04A 3LJ1A 5HLPA 3VF9A 2F9GA 4K33A 3OTVA 2C3KA 3OHTA 2BCJA 3HV4A 3V5WA 4EH2A 4U3YA 2I0YA 5AMNA 5IDNA 4FODA 3WZUA 4IB5A 4ALWA 4BIEA 1L3RE 4FSRA 3DFCB 4GS6A 4O0UA 2UZWE 2JBOA 4X3FC 3LMHA 3A7JA 4M13A 4NJDA 3OY3A 3UO6A 4BTKA 3PRIA 4XG7A 4QTEA 3Q2MA 5M55A 2YJRA 4HGEA 4Q5HA 3HNGA 4KD1A 3MH0A 4EOOA 3WF5A 3ZSIA 3FEGA 2OG8A 4BDFA 3PFQA 4EQUA 4CRSA 4U9AA 3QTZA 2P3GX 4FT9A 4RVTA 3W16A 4AGDA 3UIMA 2GHGA 3DLSA 4XG4A 4RFYA 4ZZMA 3W8LA 3NIEA 2XK4A 2PZ5A 4FNXA 2GNFA 1R3CA 3R30A 3WE8A 3F5GA 5AUZA 3Q4ZA 4Q2AA 3WZDA 5CSPA 1PF8A 3F2NA 3MVLA 4HGSA 2GS7A 3SGCA 2ZJWA 5AFVA 3DK7A 1MQ4A 2QD9A 3HX4A 5AJQA 2R3NA 3BU6A 4CKIA 4AFJA 4ENYA 4ZSGA 4ALUA 4AZSA 2R3FA 3QTQA 4GV1A 3A8WA 5CNOA 4FSQA 3SAYA 4AF3A 3P7AA 3ZFXA 3EQHA 4Y5QA 2B55A 2KTYA 2JIIA 2I7QA 1NXKA 3NMUF 3ZRKA 5KNJA 3P08A 3ZUTA 4I6FA 2YZLA 1H8FA 4FV2A 3FLQA 3PSCA 5CENA 2OZOA 1OI9A 3ZO4A 2FSOX 5FWKK 4AWIA 3C1XA 4F1TA 5K4JA 4QMQA 4RFMA 2P2HA 3DDQA 4G6NA 3OT8A 3NNVA 4ZTNA 3LCKA 3BHHA 3GC8A 3N51A 1GIHA 5FP6A 3MH2A 1PMNA 3QUEA 3UG1A 5GINE 3AT4A 1OL1A 2Z7RA 2Y6MA 4Q9SA 2ZOQA 5KMJA 4DLIA 4MXCA 1E1VA 2BMCA 3POZA 5GZAA 2PL0A 3GFEA 5E1SA 3ZXZA 4IVBA 3HDMA 3KC3A 3KRWA 4CD0A 4YJRA 3TIYA 2OW3A 4YJVA 1Q41A 2R3GA 2Z7LA 4BWPA 3EH9A 4ZIMA 1VEBA 4QP2A 5LVMA 4R3RA 2R3LA 2W1GA 4FTRA 2W99B 4B8MA 4XHKB 5HE0A 3VIDA 4C57A 1QPCA 3OXTA 3A99A 3C0IA 3I79A 4PQNA 4DGGA 5CALA 5HCXA 4F65A 4BL1A 2YIYA 4EOPA 4FKRA 5E8XA 3ENMA 4R5SA 4RG0A 5L2SA 2QONA 4EOJA 2X6DA 2QVSE 5L3AA 4ANQA 3PLAE 5CI6A 3BGZA 2X9EA 5E91A 2OFVA 4EONA 2F57A 1DM2A 5HGIA 4BDDA 4KB8A 5M57A 2IZTA 4YMJA 4TPTA 3A7GA 4OTRA 4BWKA 2UZEA 3PY3A 5CT0A 2ZM4A 3RM7A 4UMQA 1YW2A 4JQ8A 4ITHA 2QG5A 3P4KA 3EN5A 4XV9A 2XS0A 3C0HA 3BWFA 4I23A 3FC1X 4QT1A 4YO4A 5I9YA 2J4ZA 4USDA 4IZ5A 2E9PA 4DCAA 3FPMA 3E8CA 2I0VA 2YM4A 3GU8A 2ZMDA 4LYNA 4P5QA 3I0OA 4JJRA 2I6LA 5AR3A 1OBGA 3LW0A 2CKPA 4QMMA 3ZEWA 3FMEA 4LOPA 2PVKA 1YOJA 4IDTA 3RAIA 5IA3A 2RFDA 2R3RA 2RL5A 2EWAA 3R28A 2XK7A 3C5UA 1H25A 2OF4A 4LG4A 4GUBA 5HKMA 4C3PA 2JKMA 3FV8A 2OZAB 2O8YA 3L8PA 3C9WA 1K2PA 3FQSA 4JL9A 5CANA 4EZ5A 5CVFA 4PUZA 3LLTA 3GC9A 4FL3A 5EHOA 4LGGA 4R3CA 4CEGA 5AUVA 4FNYA 4IHPA 4KIKB 1W98A 4G31A 5KKRB 3O71A 1REJA 1K3AA 3MFRA 2XK9A 4EHZA 3KF7A 4WBBB 2BRHA 4WKQA 4BI1A 4H3QA 3ZU7A 2UW3A 5IF1A 1VJYA 4LV8A 4BDJA 4U5JA 2W0JA 4WHZA 5HICA 3G0EA 4FGRA 2WTWA 1SVEA 4EK6A 4J52A 4CMOA 4YR8A 3FQEA 2VRXA 4EOLA 5IMXA 2BZKB 2UW4A 4NUSA 1Y6BA 2C69A 3KULB 4X2NA 1QPDA 3ACKA 3DTWA 4QNAA 3RALA 3GUBA 4D2RA 4GKIA 2AC3A 4G17A 1WBNA 2ZYBA 3U8WA 1O6LA 2WELA 2F2CB 2GTMA 3DY7A 3QWKA 1WAKA 4K9YA 4AGCA 2UV2A 4IZYA 3BYVA 1XHAA 3OOMA 1UVRA 4MXZA 1U59A 3DKGA 2C3JA 4FSMA 4Y8DA 4OTFA 5FQDC 4JIAA 4RQKA 5IPJA 3R8PA 2ZV7A 2Q83A 1WBSA 3F5UA 4TYJA 4BDKA 3R9RA 4AU8A 3NW7A 3ZH8A 2F4JA 2LGCA 4FX3A 3ATTA 2JAMA 2R4BA 3I60A 5CWZA 2WTVA 5E8SA 4E8AA 3U55A 2CGVA 3D4QA 3WARA 4IACA 4R3PA 4WA9A 4ZK5A 4ZZOA 2JKOA 4OR5A 2BAKA 3PTGA 4JX3A 3D7TB 4BZOA 2O64A 2V5QA 1YQJA 2CKEA 3PIXA 4JBVA 4MYGA 4D4VA 5A4CA 4APPA 3ZBXA 1T46A 5IKWA 5ACBC 5AR7A 1PMUA 5CEPA 2Y0AA 4F64A 1O9UA 1YXTA 2CN8A 3LZBA 4WIHA 4Y95A 2B9IA 3HYHA 5CNNA 5EOLA 5HCYA 4BGHA 1M7QA 3RCDA 5DT0A 5KMNA 1Q99A 3A8XA 4RVLA 1IEPA 4D4SA 5KHXA 4BVUA 3FYJX 4TTHB 2Y7JA 4I4EA 4LUEA 4UYNA 5E4HA 5LCJA 2R3JA 3NNWA 3S3IA 2HY81 3VN9A 4ZSAA 1M14A 4X2JA 4OTHA 3UOKA 4ACDA 1H07A 5H8GA 4CTCA 3FDNA 1NVRA 2OWBA 3ZO3A 1KOAA 3SLSA 1WMKA 3T9IA 2VTSA 2V22A 4WT6A 4YJUA 3RTPA 3U54A 3BLRA 4L43A 4LI5A 3NUPA 4FKJA 4R78A 5JFWA 3IO7A 2H8HA 2WMTA 4FUYA 4U80A 5ANOA 4RSSA 3QALE 1HCLA 3F3ZA 3EYGA 1RJBA 3JXWA 3I6UA 1FINA 2CPKE 4I6HA 5EYKA 4HVIA 3HMNA 2ZVAA 5HTCA 3N9XA 5CF6A 3ELJA 5HD4A 2UZLA 4DEEA 3TDWA 4RZVA 5GJGA 2H96A 2RFSA 3BYOA 2WQMA 3B2TA 4FR4A 1GOLA 3PA3A 1ZY4A 5TE0A 1U54B 4FUXA 2CLXA 3P1AA 1UV5A 2VO3A 2UZVA 4BBMA 4KBKA 4FKSA 5A9UA 2DYLA 4ZEGA 4XLIA 4G9CA 5J5TA 2J6MA 3UOLA 5I9VA 1OKVA 5DH3A 4A9YA 2XJ0A 1XH6A 5D12A 4HYIA 1BKXA 2J0IA 2VWVA 2R3IA 2A0CX 4D1XA 4FVQA 2W9FB 5DI1A 3TWJA 1E1XA 4FKIA 5H8EA 4U43A 5T6KA 4DA5A 2P2IA 3AMAA 1P4FA 4QTBA 3EN4A 1YDSE 2I1MA 3FMHA 4GSBA 5EHYA 2VTAA 4YU2A 3ZFMA 2YAKA 3P86A 3V5TA 5GIOE 3VS2A 3DOGA 3TKIA 5CXZA 3ZBFA 2OI4X 4FG9A 3KXXA 4MWIA 4DE4A 5EYCA 4AN9A 2VTTA 3RBWA 3E8DA 5AP5A 3RGFA 4KRDA 1CMKE 3V8TA 4XYFA 1SYKA 1PY5A 4EC9A 2BALA 2GCDA 4C38A 4FTQA 4IE9A 5IA4A 3DB8A 3LFEA 5FRIA 2NP8A 3GU4A 1IAJA 4F9AA 4M7IA 2E9NA 4CG9A 4X6RA 3W2OA 4IX3A 5G1XA 2ETRA 4AG8A 5ICPA 3UO5A 2HK5A 2O5KA 2ZAZA 3R7OA 1FMOE 2C68A 4IIRA 1H1RA 5H3QA 4O7VA 3FI4A 2Q0NA 4OBOA 5AV2A 2R3OA 4ITJA 4FTNA 2Y8OA 2YM6A 3C4XA 4RWJA 3FJQE 4GYIA 4AW5A 4AZFA 4FTTA 2B9HA 1J1CA 4ZTMA 3OCTA 3O17A 4Y73A 4RJ5A 3IGGA 4A7CA 4FV0A
chains in the Genus database with same CATH superfamily
1ZYLA 4I6QA 2WO6A 3VBYA 3QU0A 1B6CB 2OJ9A 3NUNA 4J8NA 5CLPA 3ZS5A 4AT3A 3GFWA 4GW8A 5HE1A 4FKWA 3TI1A 4DBNA 3AOXA 4RLLA 3FHIA 3VS7A 4Z9LA 1VYZA 1XBCA 2IO6A 4KIQA 2GNJA 2EXEA 3BYSA 1KV1A 3FLZA 4F63A 4XG2A 5KMLA 4AT5A 2ITYA 1UA2A 4BDBA 3G51A 4PNIA 2OIQA 3UMWA 2PULA 2P55A 3Q53A 3G33A 2EU9A 2GNHA 3G90X 1UU3A 2F7EE 4IAFA 5AIKA 2YN8A 3ZLXA 4ITIA 4L3PA 1V1KA 4OT5A 2JAVA 1E9HA 4D0WA 3DBQA 4E6AA 3GCSA 2C5VA 2XIYA 3ROYA 3P9JA 4H39A 1YRPA 1J7UA 4DEAA 2QU6A 4BCPA 1W84A 5DRDA 4BBEA 4HNIA 3NRMA 5A14A 3VUMA 3RI1A 2PVNA 4G16A 2OJGA 4DFUA 3P5KA 2WIHA 4O4CA 4YSJA 3OEZA 4EL9A 5IMEA 3LFFA 2F2UA 3ENHA 5HVYA 4BCIA 3W0SA 2XEYA 1H0WA 5CVHA 5AM6A 5IH5A 3M42A 3NAXA 5M06A 4YSMA 2BPMA 4K18A 3KA0A 2YFXA 2Y9QA 3I4BA 3QQJA 5KMMA 5DPVA 1TQMA 4FZDB 4F09A 2HYYA 1M52A 3EMGA 1GY3A 2JLDA 4C4GA 3T9TA 5AWMA 4R7BA 2NRYA 3ZM9A 2A4LA 3AMYA 5AAEA 5A4EA 4AN3A 4BDEA 2ONLA 4ZTRA 3SA0A 3OFMA 3PVUA 2VWXA 4AXEA 3CR0A 4CLJA 1JWHA 2HWPA 3DAKA 3FUPA 3ZM4A 4RIWB 4Y46A 2PVFA 2GU8A 2XK6A 3ORMA 3FLWA 3Q4CA 1OL2A 4ACCA 4CFVA 3MB6A 3UO4A 3KXZA 3UQCA 2HAKA 3BPRA 3PSDA 4F7JA 4DDIA 1PHKA 2IZSA 3Q9XA 1F3MC 4XV1A 1R39A 2B54A 2AC5A 3PJ1A 4I21A 4KA3A 3VNTA 3QBNA 2C6IA 4YGAA 5FUTA 2PVMA 1ZZ2A 2AUHA 4ZLZA 2J0JA 3DJ7A 2VU3A 4L01A 3PG3A 4M0YA 4BIBA 3TUDA 2JKQA 5AR2A 1Y6AA 4EWHA 3KEXA 3ZZWA 4XV2A 5TOZA 3Q60A 3Q6UA 2BILB 3QQHA 4HCVA 1JKLA 2XBJA 5K9IA 4D2PA 4K6ZA 3CD3A 5F4NA 5LOHA 1S9IA 4BKJA 5DFPA 4D58A 4L3JA 2X7OA 3VUDA 3EL7A 3KXHA 4C3RA 3VJNA 2SRCA 3V6RA 4C2WA 4RX5A 5EI2A 4ENXA 3SV0A 2NYAA 2XAOA 3TV7A 5BYLA 2YIXA 3ZEPA 5EDRA 3DKFA 4HGTA 2ESMA 3QX2A 4KWPA 4EH5A 3UNKA 2JDOA 2BRBA 1WCCA 4ID7A 4N6YA 4H05A 3GC7A 4I0SA 5CU2A 4DH7A 3PUFC 4PP9A 4C3FA 3U6IA 1Q5KA 3UP2A 3W8QA 3ZTXA 4QQJA 4RX9A 3DLZA 3F7WA 3MIAA 3WBLA 1PJKA 4GFMA 1Q8ZA 3RPRA 1IG1A 3RMFA 4CFFA 2XZSA 1Y91A 2ZM3A 4CT1A 5ANJA 2WXVA 4O0YA 3CY2A 3HGKA 3M1SA 4O1PA 4BGQA 5M53A 4LL5A 3HLLA 2R3KA 4BTMA 4HNFA 4G9RA 2RIOA 4XP3A 3VBXA 2ONLC 3NYNA 3OP5A 5BVNA 3K3IA 1G3NA 4IWOA 4EK5A 2CCHA 2UW7A 4QYEA 3K2LA 5KBRA 2YCRA 1Z57A 3OZ6A 2BHHA 4GYGA 3E93A 3R9DA 2OZAA 3HV7A 2IVTA 5FDXA 1FQ1B 2AYPA 4ACGA 4QMVA 2KULA 3VS5A 2X0OA 2FSMX 3MFSA 2B0QA 1PKGA 3DS6A 4C37A 5BVEA 2QCSA 4TY1A 4GMYA 3CPBA 4A9SA 3H9FA 4KIOA 3UC4A 2WU7A 4FEWA 2FH9A 3O5AA 2H6DA 4YBKA 4E6CA 4ZY5A 4DFZE 2GHLA 1ZZLA 3QTWA 2JDSA 3IDCA 4ZZNA 3GNIB 4FZFB 5J7BA 2WTCA 3FLYA 4GJ2A 4E73A 4CMUA 3TZ9A 4R8QA 4GG7A 1SM2A 4IB1A 5CXHA 4O7NA 2GHMA 1S9JA 2OJFE 3KULA 4NKAA 5M56A 3CQUA 4LM5A 3NGAA 4RA4A 3W0OA 5H9BA 5HLNA 1J91A 1URWA 1WZYA 4UZDA 3KRJA 3EIDA 4QYFA 3ORIA 3ZOSA 3UOJA 4D2SA 2W17A 4FC0A 1WVYA 3VS6A 5AA9A 1OBDA 1ZY5A 2CCIA 1QPJA 3TCPA 3ALOA 3UDTA 1KE9A 3LCTA 3LFCA 3P0MA 1Q61A 4O6EA 4MBIA 4EYMA 3KIOC 3GC0A 1V0BA 2ZMCA 5ITAA 3N4UA 3DFAA 4O2ZA 3EQRA 4GK2A 4ANBA 5AV4A 4KBCA 4I93A 4JRVA 5L2WA 3L9PA 3DCVA 3SC1A 5JQ5A 1VZOA 2BIKB 2Z2WA 4YC3A 3I81A 2WU6A 5DEYA 2DUVA 2IN6A 4IAYA 3ZFYA 2ITZA 3C4FA 2ZV2A 3LE6A 4UXQA 3T8OA 3ULZA 3D7TA 2HXQA 3GCQA 2UW9A 3F66A 4TT7A 3DTCA 3F61A 2YACA 3M11A 4FA2A 3TJDA 1YDRE 2QO2A 3WOWA 1OUYA 2R3HA 4XOYA 2J0MB 3PPZA 4IDVA 2PZRA 3E63A 2PMIA 5HBJA 4Y83A 5HBEA 2HWOA 1I09A 2H34A 1OL7A 2V55A 3MTLA 4J95A 4P5ZA 4PTEA 4ERKA 1OL6A 3E62A 5E8TA 4DBXA 4XG9A 4O4DA 5B0XA 2GQGA 5AUWA 2QKRA 3RNIA 3DV3A 3F3TA 2ZV9A 3MVJA 4CKRA 4RFZA 4LFIA 3UC3A 3ZDUA 2WB8A 4JQ7A 2CNUA 2WTKB 1OM1A 1L8TA 4XRLA 2WMAA 2XRWA 2XYNA 2CHLA 5C4LA 4DC2A 4EC8A 3BHTA 2IWIA 3R1QA 4F6UA 2XNEA 3CP9A 2EUFB 4FIEA 3P79A 4EK8A 5CAUA 3D7ZA 3Q5IA 4ZAUA 3UP7A 3SG8A 3NDMA 2BZIB 3OOGA 4M0ZA 4E20A 5F9EA 4MQ2A 4HPUE 2VN9A 2VTLA 3EL8A 4FOCA 3PFYA 4N0SA 3LJ2A 5E90A 3PE2A 2OO8X 1U54A 3RJCA 4AT4A 3G9NA 4F9BA 4UN0C 4CLIA 5A4TA 3ZO1A 4DITA 2WGJA 4JDIA 3IOPA 3FMNA 5IEVA 5TR6A 3MB7A 3GXLA 3B8RA 5EG3A 3I7BA 4E5AX 4FJVA 3Q9ZA 5JQ8A 3D5VA 3JVRA 3GT8A 3MH1A 5LJJA 4AXDA 1IA9A 3QQLA 1J7LA 4YLJA 3QGYA 3FL5A 4FSTA 4X0MA 2YWVA 1OUKA 2JEDA 4BBFA 2EB2A 4UB7A 3LIJA 4XG3A 1NW1A 3IW8A 4EKLA 3LHJA 2PVYA 3CS9A 4RA5A 3IG7A 3LCSA 4FICA 3MIYA 3BL7A 3MPMA 3MY1A 2UZBA 3QQFA 4TW9A 2YIQA 3PP0A 3OXIA 3JUHA 3HP5A 4MHAA 4WUAA 3GU6A 3U4UA 3D2IA 4O82A 3BEAA 1ZMUA 3UZTA 5D41A 1JBPE 3NVMB 4O0TA 3BQRA 3OUKA 5FGKA 5IA0A 2RSVA 3NPCA 4FI1A 4XG8A 1W7HA 3G0FA 4IWPA 2B1PA 5EDPA 3GGFA 4RC3A 2WEVA 3IW5A 1LEZA 4IVCA 4CTBA 4IWDA 3C50A 3SD0A 2W1ZA 4FZ6A 3ATSA 4II5A 3VAPA 1RDQE 4NW5A 5LMAA 1YWVA 2IW8A 4YTFA 4YPDA 4I24A 2JKKA 4ZSEA 3BHYA 3MWUA 3AD5A 3QKKA 5E8WA 5CY3A 3M2WA 3SW7A 4MQ1A 2UW6A 4D0XA 1IRKA 4DTKA 2X8EA 1SVGA 3IDPA 3HMIA 5K5NA 3OCBA 1Z5MA 3E88A 4D4YA 1PW2A 3GVUA 4PL4A 4LDTA 4A9RA 2HW6A 4FKUA 4K0YA 1ZAOA 2VX3A 1A9UA 1NT2A 3P78A 4J1RA 5H8BA 3G6HA 4OT6A 4WO5A 3R8UA 5I9WA 3DK6A 4FSZA 3BYUA 3QWJA 5B7VA 3G15A 5LXMA 2X9FA 4YP8A 4JDKA 4JQEA 4A06A 4EK3A 3MY5A 2W1EA 1YHSA 3FMKA 3Q9YA 4QMUA 4TRLA 3WF9A 3WYXA 3OTUA 2B9JA 4FSNA 1PXLA 3EZRA 3VRYA 5KX8A 3MYGA 4QNYA 4V05A 4O7ZA 4H36A 5BVOA 2BTRA 3LAUA 3DGKA 4OTPA 4TNDA 5E8ZA 3BCEA 4FK3A 3UYTA 4M67A 2B4SB 2O3PA 3I1AA 3PXZA 2UVXA 4FTUA 5ANDA 5EDQA 4ZLYA 1VLRA 4UX9A 1FGIA 4DINA 4NK9A 4APCA 3LLAA 4KS7A 3FBVA 3O51A 5JEBA 3MDYA 4JAIA 2W1DA 4WSYA 4OBQA 5K0KA 4O7SA 5IQCA 2J0KA 2VTRA 4GUEA 4QD6A 4EKKA 3NNUA 3UDBA 3KFAA 4FTMA 4J98A 4DHJA 3G2FA 1ATPE 1KSWA 1GZNA 3LJ0A 3TT0A 3UYSA 1B38A 4BJJA 4JBPA 5E92A 3VS3A 4PL3A 5BQ0A 5I0BA 4JVGA 4KIPA 5KCVA 3NUUA 4WNOA 4QRCA 4YURA 2HZNA 1H27A 2VGOA 1YDTE 4S33A 5AUYA 3QC9A 2OSCA 2VTHA 4FZ7A 4IAZA 5DRBA 2J7TA 5AP6A 3RPSA 5BVFA 2PZIA 4Q5EA 4F9WA 5EW9A 4NJ3A 5A4QA 1SNXA 2CGUA 1H1QA 3D5XA 3OEFX 4IB3A 1H01A 1JSTA 2C6DA 3C13A 4NM7A 1GAGA 1U5RA 4DAWA 2W1FA 3PXRA 4RIWA 3R73A 3ZYAA 4RIYB 1FOTA 5GHVA 1ZLTA 1RW8A 2YDJA 1Y8GA 4LL0A 2PTKA 4H3BA 3LXLA 3QC4A 4UXLA 3BL9A 2WQEA 2CSNA 5DVRA 4E6DA 4ZJIA 3BU5A 5L8JA 3Q4TA 4O84A 3RAWA 2VZ6A 2XIKA 2XKCA 5GNKA 3IONA 3CJGA 5HNGA 3DU8A 3QQGA 4NKSA 4M3QA 2FSTX 4YNOA 2QOQA 4PDYA 5LMBA 4I5HA 4K11A 4YHFA 5KBQA 3DJ6A 3DK3A 4CYJA 2AQXA 1PXKA 3ZHPC 4F7LA 5E1EA 5DMZA 1PXPA 2UUEA 3MJ1A 3TYKA 2VD5A 1PKDA 2OIDA 2PSQA 3PXQA 3QCXA 2HZ0A 4N70A 4BIDA 5L2TA 3LKMA 3GU7A 3TXOA 4O7RA 3BI6A 2XK8A 3SXSA 2X6EA 3DKCA 3FZPA 4GIIA 5HE3A 1U46A 3RK9A 2WQBA 2JIVA 3KMMA 1XMLA 4GEOA 4CCBA 2PVLA 4S32A 1Y8YA 2DS1A 4ZTSA 3QCSA 3DZQA 3O8PA 3FMJA 3BHVA 4FNWA 4F6WA 4WNPA 4UWCA 1CTPE 4I0RA 3F3UA 3HV6A 4I5CA 4QMNA 1ZXEA 5CSHA 3FZRA 4FIFA 1H1WA 1K9AA 5AUXA 3QXPA 4HGLA 4EEVA 3BE2A 5ACKA 3CD8A 4L67A 2HW7A 3V8WA 3W2CA 4E5BA 4QPMA 4FIIA 2W4JA 4O1OA 3AKKA 1JOWB 5CF4A 1UU7A 2C5XA 2DWBA 2J9MA 5CX9A 3RHXA 3KL8A 3QRIA 4QMSA 2YHVA 3QHRA 5AV3A 2WHBA 4DFXE 2ERKA 4FTLA 4RWIA 1A48A 5KUPA 3CKXA 1ZMVA 4MF0A 3AD4A 1QMZA 4NWMA 3UMXA 3QGWA 1Q8WA 4N6ZA 3FZ1A 2B53A 2IW6A 4HYUA 4ANNA 4AXAA 4O2PA 3G6GA 2WTJA 4U3ZA 4CKJA 3BBWA 3LQ5A 5HI2A 4KSQA 4PMMA 4TYEA 5DBXA 3LXKA 4IX5A 3UDSA 2J0LA 3LXNA 3GBZA 3CTHA 1YHWA 2C5OA 1LP4A 3CQEA 3VRZA 4QMWA 5CU0A 3DXQA 2WOTA 2C6KA 3EOCA 4KAOA 3SOCA 4D5KA 4PWNA 3HV3A 4QQTA 4PP7A 4YUQA 3QZGA 1YOLA 3P23A 3ZSHA 3ERKA 2XCKA 3U9NA 2PE0A 4JBQA 1WFCA 1TZDA 3EQGA 4QP3A 2G2IA 3MV5A 1Q8UA 3QKMA 3W2SA 3TMOA 5DR6A 2C6TA 1OMWA 3Q32A 5EM5A 3EYHA 4BCJA 2CLQA 4ZMEA 4QMTA 3COHA 4J7BA 2ZV8A 3LCDA 3SHEA 2C1BA 2X4ZA 4GRBA 3QRKA 4J97A 2XK3A 1ZWSA 4HCTA 4B4LA 3E8EA 2GPHA 3V8SA 4A4OA 2IVSA 5HX8A 3KY2A 2C0IA 2VO0A 4L45A 1B39A 2XA4A 3FSKA 5I9UA 5IQIA 4CG8A 3C7QA 3KXGA 3I5NA 3A4OX 4OAVB 3FI3A 4S34A 2QOBA 5FXSA 2QODA 3R1SA 3TM0A 4IVDA 2WMVA 3FY2A 3TNIA 1JAMA 2IW9A 4RC4A 4BCMA 1CKIA 4AQKA 5EM6A 4ACMA 4MD8E 5ANKA 3HA8A 4C34A 4JDHA 2W96B 3VUGA 4IXPA 2ZB0A 3PLSA 3V6SA 4F4PA 2V0DA 5AP1A 3NUYA 3SXRA 2VTNA 5M4FA 4JLCA 2ITTA 2ETMA 2WMRA 4GVAA 4E4MA 3VBWA 4YTHA 3PVBA 4L68A 5J9YA 4KUJA 3QX4A 3Q04A 4M69B 4E26A 2VTQA 2OXDA 3MESA 3CY3A 3LM5A 4N57A 4IQ6A 3DAJA 4O0VA 4D9UA 5ANIA 4EZ7A 2R2PA 5IG1A 4I41A 1P2AA 5IISA 3EB0A 1CDKA 3AGMA 2ERZE 3TNWA 3VQHA 4ZTQA 1RE8A 5BUIA 5BYYA 3ODZX 4FSYA 3PXKA 4IBMA 5BVWA 3W0NA 1KV2A 4BCGA 4U7ZA 5CASA 4M68A 5IQGA 3RWQA 2RFNA 3VWAA 2UW5A 2XKDA 3POOA 2R7IA 3LOKA 3DNEA 3KK8A 3RK5A 5HORA 3LQ3A 5FLFA 5HO8A 1BUHA 2WFYA 3KRLA 2I40A 4S30A 4EOSA 1M2QA 3KCKA 1GZKA 5TF9A 5J9ZA 3JY0A 5GJFA 1X8BA 4FL2A 5T68A 3Q2JA 4RT7A 4BHZA 2R64A 4FE2A 2YDKA 4AX8A 2OH0E 1MP8A 3DXPA 1HCKA 4DH1A 5BPYA 4EBWA 4UZHA 3C4CA 1O6YA 3MGYA 3R63A 4H3PA 3FC2A 3PPKA 5EHLA 3R8ZA 2J5FA 5DG5A 5JZNA 3SQQA 4L7FA 3GQLA 1OKYA 2OJIA 2WQNA 3LFQA 4FTCA 4EH6A 4X21A 4G3EA 5HD7A 5EQPA 4I4FA 3KREA 1GZOA 3F5PA 5K3YA 1ZOEA 1PYXA 5DT3A 3VBVA 4U6RA 2EVAA 1ZYJA 5JH6A 3UDZA 1YOMA 2CNVA 4JRNA 3F2AA 2C5YA 2W1IA 3R7EA 3L8SA 5DA3A 2B52A 4WNKA 2WMSA 4GG5A 2YZAA 2O65A 4JIKA 5GIPE 5L8LA 3QA0A 3Q3BA 3S00A 4JT3A 3UZPA 1JPAA 4FOBA 5D7VA 2Z60A 4QP9A 4ANSA 2A1AB 2BVAA 4CV9A 3C5IA 4ZSLA 4Z7HA 4J71A 4F1OA 1PRYA 3UBDA 2BFXA 1URCA 3PA5A 2YLEA 2VUWA 1IA8A 4RVMA 4TWCA 1XWSA 4DDGA 2W1CA 3O96A 3ZLYA 1GIJA 4MBLA 3TKHA 4L6QA 2ITOA 4EUUA 3L9NA 1Q97A 1Y57A 4OLIA 4NIFA 2W5BA 3A2CA 2CNQA 3RVGA 2O0UA 2VWIA 3KGAA 3QCYA 3ORTA 3BYMA 2CDZA 3W0RA 4DT9A 4FT0A 2CN5A 4RIXA 4O4BB 2IF8A 4CSVA 4F7NA 5LMKA 4AZVA 4W8DA 5AP7A 2C6OA 2UZNA 4MNEA 1OL5A 3R7UA 4USEA 2PUUA 4XBRA 3ODYX 3HAVA 4FKVA 4J53A 4L44A 4LMUA 5HHWA 4GCJA 2QOLA 3HMOA 4OUCA 5L2QA 5B2KA 5LWNA 3PUPA 4MD7E 5GJDA 4FZAB 5FEQA 4G2FA 4BF2A 4C4FA 3ZO2A 3F9NA 2XJ2A 4ASZA 3PY1A 4BZNA 5CYIA 3PSBA 3DJ5A 3R00A 4WG4A 3EFLA 4YZMA 2R3QA 3U6HA 4O27B 3QD2B 5DE2A 3MBLA 4XLVA 2FUMA 2CGXA 1DAYA 4RX7A 5AP2A 3KB7A 4AACA 2X0PA 5IUHA 2XANA 4DT8A 5A3XA 2WTKC 3R1NA 4MVFA 4B99A 3IW6A 4BJJB 4RLKA 2E9OA 3CKWA 4IADA 4YJPA 1FBNA 1R1WA 3WIGA 4DHIB 3QQUA 2C6MA 2V7OA 2X0QA 3DNDA 5A46A 1MUOA 3R8VA 4MXXA 4TWOA 4PPCA 4QMPA 1H26A 5BUJA 4Z16A 3FLNC 3L8VA 3WZKA 2GNLA 2OJJA 1G8JA 4V0GA 4RJ8A 4HCUA 1PXIA 4A9TA 4DG2E 4IB0A 3MY0A 4FEXA 4IJ9A 3U9CA 3Q96A 3DB6A 1BX6A 5J1WA 3EKNA 5KO1A 1YWNA 4C4EA 4JAJA 3D15A 3FI2A 3DXNA 4L53A 4CFWA 3NYXA 4NTTA 3RZFA 5I4NA 4QMXA 5IQHA 1V0OA 1Z9XA 1KOBA 1UU8A 1FGKA 2XB7A 5KE0A 4E1ZA 4E7WA 3AT2A 1J1BA 4FSUA 4W4XA 3AGLA 1OPLA 3FYKX 4FG8A 4NFNA 4LOOA 1KE5A 2IEWA 3VUTA 1VYWA 2QO9A 4EBVA 5CEOA 3CTJA 2JDTA 4GK3A 2XIRA 3FHRA 3L9LA 5AX9A 2PWLA 4UALA 2ZB1A 4EH4A 2YCFA 4D9TA 1OIRA 2X7GA 3JYAA 1WBVA 3VS0A 2RG5A 1IASA 2VX1A 4UMRA 5TT7A 4YJOA 4CQEA 4F9YA 4WOVA 2XKEA 3R04A 4RPVA 4OTDA 3LPBA 4D2WA 3EJ1A 5AP0A 4BRXA 4EH8A 5FD2A 2I0HA 3RWPA 3GQIA 2XJ1A 3NZ0A 5T3QA 4GT3A 3F5XA 3UGCA 3SW4A 5J1VA 1JNKA 4F6SA 5JGAA 4IAIA 5FTQA 3P7BA 4GVJA 1XH4A 4CNHA 2Z7SA 3BGQA 2VTIA 4K2RA 4YJTA 4QPAA 4TXCA 1H4LA 4IWQA 3DQXA 5E8VA 4LOQA 1PXOA 3RPYA 4OGRA 2C5NA 4PMPA 4CVAA 4IZ7A 3P7CA 3PYYA 1NY3A 3RP9A 1ZYDA 3DPKA 5JKGA 1STCE 4XX9A 1H0VA 2FGIA 4FVPA 4G3GA 2GNGA 2HENA 2O2UA 2WKMA 3G9LX 3QCQA 1ZARA 3W32A 3PA4A 4AOTA 4CYIA 5JRQA 4WG5A 2ITQA 4RIYA 4TWNA 4IAKA 4HZSA 4U0IA 5L6WL 2P4IA 3ORNA 3VBQA 3NWWA 3R83A 4QMYA 4BWXA 3BQCA 5HU3A 1TFFA 5AP4A 3V01A 4GU9A 3PWDA 4BI0A 5HX6A 1J7IA 5HIBA 4PF4A 3MA3A 4TYHA 3PE1A 4F7SA 5HEZA 1YXSA 1TQIA 2YLFA 5CS6A 4DCEA 4PMTA 1WBPA 2XM8A 4EOIA 5IA5A 2R9SA 3HMPA 3FKLA 3EQFA 3D0EA 2ITNA 2E2BA 4FV9A 2OGVA 5E9EA 4FT3A 3GENA 2BZHB 1SVHA 3EZVA 3PJ3A 2CGWA 5AR5A 4RJ4A 4FV3A 3NIZA 5C8MA 4IAAA 2QLQA 3WYYA 3ZRLA 4AUAA 3I6WA 4GKHA 5I9ZA 5HO6A 3IOKA 3FY0A 4YNEA 4EZ3A 3QRUA 3NSZA 5HLWA 3VW8A 3F7ZA 3MJ2A 4O22A 3C51A 1OIYA 5HVJA 3TZMA 5FXRA 1TQPA 4YJSA 3O0GA 1U5QA 4JDJA 5LARA 2GNIA 2V7AA 3EHAA 4I22A 4QMOA 3UZRA 3TZ7A 3I0QA 1M2PA 2C3LA 3R6XA 1F0QA 3TIZA 5I9XA 3DAEA 3ORPA 3D14A 1ND4A 4W4WA 4C59A 1PMVA 2JBPA 2G01A 3FSFA 3PPJA 3QAME 4AZWA 3QD3A 2VTPA 3K3JA 2G2FA 5DIAA 4BR3A 3FQHA 3D9VA 4TNBA 1UWHA 3MPAA 3PZEA 4K1BA 3R8MA 4L46A 3VF8A 4F9CA 2YWPA 3HEGA 4ZLOA 5A4LA 4DFBA 2XNBA 3HRFA 4K8AA 3AG9A 3R2BA 4XUFA 3NLBA 4WRSA 5HU9A 3KVWA 3VUKA 4NEUA 1LR4A 4DLJA 2OK1A 4KKHA 4I6LA 3R7GA 4IX4A 4JR7A 2XP2A 5BMSA 1H1SA 4MX9A 2VX0A 3KF4A 2UZOA 5CSXA 2GS2A 2GDOA 4H1MA 3H10A 4BZDA 5D11A 1NVQA 3TACA 4P90A 3R9OA 5CEKA 1XO2B 4EH9A 4XJ0A 3V5LA 3HDNA 4XP2A 3T3UA 2PE1A 4YHTA 4CCUA 2CKQA 4MXYA 4NM0A 4OTGA 4DTAA 2YIWA 5M4IA 1LPUA 3C4ZA 3NYVA 1TVOA 4A07A 5EI6A 4G5PA 4BCNA 2VWWA 4FYOA 1GIIA 3AD6A 3QTRA 4FKPA 4IM0A 4FTKA 2BROA 4CZYB 4XMOA 5DNRA 5HO7A 3WILA 5IUIA 2YA9A 3QUPA 4FT7A 4YTIA 5E8UA 3BBTB 2OBJA 5BMMA 3BRBA 4FV1A 4QTDA 4LRJA 1UNHA 4MCVA 5IEXA 5C4KA 5L6OA 3OBGA 4X3FA 5M4CA 3UE4A 5LWMA 1SNUA 2R7BA 4IM2A 2GTNA 3SKCA 3U87A 4U45A 4CFNA 3ULIA 4GH2A 3TTJA 4I92A 3VO3A 2IZUA 5CU6A 4BCQA 2C47A 4ZTLA 4TYGA 4QP6A 5CEIA 4HVGA 1OGUA 3R8LA 2REIA 4MBJA 5DHJA 3TNQB 2PMOX 2VNYA 4OAUC 3CBLA 4YLKA 2FO0A 3JR1A 4ONAA 3KN6A 4E5WA 3NW5A 4FKOA 4DHFA 5K4IA 4XOZA 2BDFA 4AOIA 4MF1A 4FG7A 4DFYA 2XEZA 5J87A 2OIBA 3DQWA 1M7NA 2E9UA 4G3FA 4ASEA 4C62A 3W0PA 3WZEA 4DH5A 4FKLA 4M69A 2BZJA 2BAJA 3V5PA 5EK7A 2E9VA 4QP1A 1JKKA 1JKTA 2QC6A 3LCOA 3ZCLA 4WG3A 4KBAA 1RQQA 5CU4A 5EKOA 5K5XA 4ZS4A 4QMLA 3RK7A 3COIA 2ACXA 4FKGA 5FTGA 2C3IB 2OU7A 1Q8YA 1PXNA 3NX8A 3OS3A 5J95A 4B6LA 1Q62A 4TZRA 3OY1A 3VQUA 2ITXA 3V3VA 4BTFA 5F95A 4D1SA 2YABA 4D28A 4EI4A 5BNJA 4ANMA 4RVKA 4U81A 4DGLC 2QR7A 2I0EA 4FL1A 5GZ9A 4NIFB 4CXAA 2XNGA 4ZJVA 3WE4A 1WBWA 2PU8A 4PX6A 4F0IA 1XJDA 1PXMA 1R0PA 4EJ7A 4YBJA 5D7AA 4RIXB 1W2FA 5H2UA 3MSSA 2C6LA 3HECA 4MNEB 5CZIA 4ANLA 1KE6A 2VTOA 1GNGA 3MW1A 2G1TA 4E4LA 3AKLA 3QZHA 4FT5A 4IEBA 3ACJA 2VO7A 2PE2A 2QG7A 4AAYA 3BHUA 2HCKA 3VHEA 3FMDA 4IFGA 3II5A 5IA1A 3LFNA 3OMVA 2OF2A 5AEPA 3AC2A 1UU9A 3FZOA 3F88A 3EQDA 3HV5A 2NPQA 1YXXA 4TKSA 3V5JA 1M2RA 4FSWA 1BI8A 5ANGA 2W4OA 5EH0A 3OWPA 3OG7A 3ZRMA 2UZDA 2A19B 5C27A 4EQCA 5M44A 1H24A 5JGBA 5FBOA 5M07A 3ZMMA 4JBOA 4GL9A 3H4JA 4KKGA 3NUSA 2ITPA 1OECA 2XUUA 4FBXA 2VV9A 4L8MA 2VWYA 4FTIA 4F08A 2GQSA 5F1ZA 3LMGA 5HVKA 2IPXA 3R1YA 2W9ZB 3GP0A 4IANA 2VTMA 4HOKA 4KINA 4C4JA 4F0FA 3H9RA 4UY9A 5JZJA 1JKSA 4V0GB 4EH3A 5KZIA 3KKVA 4A4LA 3TEIA 4EWQA 3GCPA 2X4FA 1Q4LA 2EB3A 2W7XA 1TKIA 4U41A 4Z7GA 5A6NA 2BKKA 4M12A