1SVHA

Crystal structure of protein kinase a in complex with azepane derivative 8
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
337
structure length
335
Chain Sequence
SVKEFLAKAKEDFLKKWENPAQNTAHLDQFERIKTLGTGSFGRVMLVKHMETGNHYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMVMEYVPGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGFAKRVKGRTWLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFATTDWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEEEIRVINEKCGKEFSEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords cAMP-dependent protein kinase, alpha-catalytic subunit
publication title Structure-based optimization of novel azepane derivatives as PKB inhibitors
pubmed doi rcsb
source organism Bos taurus
total genus 106
structure length 335
sequence length 337
ec nomenclature ec 2.7.11.11: cAMP-dependent protein kinase.
pdb deposition date 2004-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 1svhA01
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 1svhA02
3BLHA 4GIIA 3BQRA 3KN5A 3T3VA 4BCOA 4TYHA 5GJDA 1H4LA 3EQDA 3FMKA 3NYOA 4AXAA 2B52A 4F7LA 4DEBA 3ZS5A 2WTKC 3S00A 3PG3A 5H3QA 3NW6A 4FT0A 3ZMMA 2AC5A 5HLPA 4DGLC 3BWJA 1ATPE 3EJ1A 3MJ1A 4F08A 3Q9WA 4F99A 4OAVB 3EZRA 3VO3A 4YJRA 4FMQA 3GBZA 4GG7A 3RBWA 4I92A 2XA4A 1SVEA 4U43A 3UZPA 4BBFA 3HX4A 1WCCA 4OAUC 4D4SA 3D83A 4X3FC 4MYGA 4CFXA 4HZRA 2HENA 4PUZA 3A61A 1UNHA 4C0TA 3QRUA 2XNEA 3GXLA 2CJMA 1OECA 5EW9A 5C4LA 2XRUA 4XRLA 2X9FA 3H0ZA 3PIZA 4IADA 4YLJA 5HKMA 4JS8A 1J1BA 4GMYA 5CNOA 4IEBA 5A4CA 4EBWA 1XH7A 1YOLA 3HV3A 4G9CA 5F20A 4A9RA 3NNXA 2CN5A 3SOAA 2X8DA 2C3KA 3WZJA 3W2PA 3MTLA 4Q5EA 3FEGA 2R3NA 2ZDTA 5CX9A 4CKIA 1G8AA 4YP8A 2JDSA 2R0UA 4GU6A 2W1IA 3QD3A 4DEDA 4ZOGA 4MF1A 4HGTA 4BHZA 3G33A 5FD2A 4O86A 3V51A 4EOLA 4PX6A 2OXDA 4K2RA 5JGBA 5HO8A 5JSMA 4QP2A 4BTJA 4AN3A 4FOCA 2J5FA 4NK9A 3BRBA 4E4NA 2I0EA 3TJDA 3UVQA 2WZJA 1UU7A 2UW6A 3TKHA 1VYWA 5JMSA 5M09A 4L52A 3PLSA 4ZTRA 5A54A 2FB8A 3ITZA 2NRYA 2VWIA 3HAVA 3AQVA 2BDJA 4NKSA 2OBJA 5BVKA 4GIHA 3DU8A 1J7IA 5AV3A 2HW7A 3R30A 4I1ZA 5B7VA 4KBKA 2W4KA 3W18A 3BU5A 4UMRA 4AF3A 2CKPA 4BB4A 4BVUA 1M17A 3SV0A 2QHMA 5L8LA 5K4JA 4JL9A 5GHVA 2X7GA 2IZRA 3EKNA 3RM6A 4TN6A 4CV8A 3QD0A 4A4OA 4QP4A 3R9RA 5FP6A 1NW1A 1IAJA 4DTAA 2VO3A 2FSTX 4WUNA 2X4ZA 2QOQA 5KMMA 4F1TA 2F7ZE 4WNOA 3FY2A 2QOLA 3V01A 3QUPA 4EUTA 3LXNA 3UO4A 3ORPA 5HIEA 4EQMA 1UNLA 3IQ7A 3LCOA 4C37A 3SXRA 4P4CA 1CDKA 1OL7A 4IHPA 4X2FA 4E6CA 3A4OX 3C5IA 2ZYBA 1RE8A 3C0HA 4QP8A 5DGZA 2QOOA 5EG3A 3C5UA 3G2FA 1Z57A 2QKWB 3QHRA 3L1SA 2Z7QA 2XK8A 4GEOA 4JG6A 4WRGA 4F9BA 2BPMA 4X2GA 3K5UA 5EYMA 3GVUA 2G2FA 4EL9A 4M84A 5EYDA 1H07A 3R0TA 4RIWB 2QOKA 2ERZE 4U44A 3W16A 3RCJA 3TL8A 3LQ5A 5IUIA 3CQUA 2IW6A 4X7QA 1E1VA 4HYSA 3UOJA 4FT7A 2YM5A 4JRVA 5JK3A 2IG7A 3EKKA 4AS0A 5BQ0A 1T46A 3KB7A 3AG9A 5HE2A 4M67A 5CS6A 3PVBA 1OZ1A 3OBJA 3CS9A 4EZ5A 4ITJA 1PRYA 4IAKA 5GNKA 3B8RA 3ET7A 1JSTA 2QR7A 3ZOSA 2YM8A 1YHWA 3PXQA 5J5SA 4IB0A 2F4JA 4NTTA 3TI1A 2YIYA 2H96A 1A9UA 2WMAA 3AD5A 3RP9A 3MY0A 4H36A 3BU3A 4U79A 1SYKA 5HG7A 1MRVA 3QU0A 4BCMA 2R3JA 4CKRA 4MQ2A 3WBLA 1RW8A 5M44A 4BTKA 4FSMA 2XNOA 3CGOA 4E8AA 5ETAA 3NUNA 4YNEA 2VWZA 4LFIA 4XV9A 3DB8A 4QNYA 3QTUA 3U6HA 1RQQA 4E4MA 1ZOHA 3A62A 5DR9A 4BDCA 3TUBA 2YJRA 3KRWA 1UU8A 4FSZA 4GK4A 4NM7A 4ZIMA 3OP5A 3VBXA 3M42A 2VAGA 3P23A 3H0YA 3GNIB 1QPDA 4DH1A 4IC8A 4GT3A 3ZCLA 3QCXA 3PA4A 3MFRA 5CNNA 3CSVA 3BQCA 2QC6A 3F5PA 4I21A 4H05A 3FC2A 3GP0A 5B2MA 3NAXA 4FSUA 3GQLA 4O22A 4RSSA 3UPZA 3OY3A 4J7BA 4O21A 5DT4A 2UZTA 3DBDA 3KN6A 5F4NA 4F63A 5I9XA 5M4CA 3MA6A 5CSVA 4HCUA 3W8QA 2XKCA 1TQIA 5I9UA 4L00A 4NT4A 1BL7A 3COMA 2HXLA 4RIWA 4XG3A 4GJ3A 3C13A 3HA8A 4YJVA 4ACDA 1CKIA 3LM0A 3MIYA 3ERKA 1OKWA 3QXPA 4EC9A 5T68A 4C4HA 3V5LA 2UZWE 2BMCA 4LOOA 1OKZA 4HYUA 4EOMA 4D58A 2UVZA 3DJ5A 3EFWA 3IOKA 3DCVA 4JI9A 3RI1A 4DCAA 5IA1A 1XH4A 2X2KA 3COIA 3EWHA 3HP2A 5DEWA 4Z3VA 3OWJA 3R8VA 3DZQA 1UNGA 3GCPA 5HCYA 4FK3A 2RFEA 3E63A 2FSOX 3EQIA 3SXFA 1J7LA 3LVPA 4ANOA 4QQ5A 3LFDA 3OEZA 1OITA 3BYUA 3PXFA 4QMXA 3ULIA 3KRJA 3T9TA 3LOKA 1GAGA 2X9EA 3KXNA 4MAOA 2VUWA 2X8EA 5LOHA 1A06A 3BHUA 3TACA 4BWXA 1LUFA 3ZO2A 4ASEA 4CQGA 4JR7A 2XK3A 4FZAB 2VO0A 3T8OA 2XYNA 5HESA 3ZLXA 3CBLA 4AN2A 3QTWA 3UODA 3DKFA 4H3QA 3FZOA 4UV0A 3ZDIA 4EQCA 4HVIA 5L2SA 4APCA 4R7HA 4DFLA 4NM5A 4D1XA 5HQ0A 3PRFA 4I20A 2HW6A 5KMIA 3SG8A 4CT2A 3E93A 4KS7A 1XH5A 4ZSLA 3ZTXA 5CXHA 5I9ZA 3MS9A 1G5SA 5LVLA 4QYGA 4KBCA 4PMMA 4FEQA 5HTBA 1OIRA 3ZDUA 2Z2WA 5EOLA 3THBA 2O0UA 3R7IA 3V6RA 4Z9LA 4FODA 4RJ6A 2BKKA 4PMTA 4B99A 2CLQA 5AAFA 4IFCA 5HE0A 3ZXTA 4JXFA 3PZEA 5EM5A 3EQPA 2YACA 1ZXEA 5E8ZA 2PMLX 4QMLA 2W0JA 5HG8A 3TNIA 4EK5A 5A4TA 2YJSA 2UZNA 4D5KA 5AR5A 4BR3A 3SHEA 5CF6A 1FBNA 4ZMFA 2WOTA 3O17A 3ZUTA 5CANA 4M0YA 4CG9A 2GPHA 1ZY4A 3QAME 5DRBA 4JG8A 4M69B 4TXCA 4DGGA 2WGJA 3GU4A 3Q53A 4LL5A 2BFXA 2ZM1A 5IZFA 5EW3A 3RAHA 2Z60A 3FHIA 3QTQA 2WQNA 2Y9QA 2ITQA 5CTPA 3V5WA 3WZDA 5DRDA 3VUTA 4FT5A 3R6XA 4DG2E 4WG3A 4O1OA 2X0GA 1OUYA 5EQYA 3PPKA 4FTTA 4RX5A 3KQ7A 3TNWA 3DY7A 3T3UA 2EB3A 3U54A 5HD4A 3BX5A 3KULB 2VTQA 5TF9A 5BVNA 5CU2A 1JVPP 2BTSA 2GU8A 3O50A 3BWFA 4UN0C 5KHWA 4O7VA 5JQ5A 2QOCA 4IX5A 4I0SA 4I6HA 4HYHA 1IG1A 4UZHA 4XOZA 4PNKA 4ZZOA 4D2RA 5L8JA 4HOKA 3ZC5A 5FG8A 1IEPA 3JVSA 4EK8A 3NMUF 3REPA 3QHWA 3DXNA 5FM3A 4WOVA 4QYEA 5J1VA 4I4EA 2OSCA 3UMWA 2XNNA 4LV5A 3SRVB 4N0SA 5DOSA 1Q5KA 3GC9A 1BX6A 4NKAA 2EWAA 2PULA 2IZSA 2BAKA 1J91A 1OPJA 1Q41A 4JT3A 5AUXA 5HOAA 4YTIA 4TWNA 4AP7A 4RWLA 2YCRA 5KBQA 3QXOA 4IX6A 4USFA 4QMYA 2JKKA 5IEVA 2F2UA 5CVFA 3PXZA 5FDXA 5KBRA 2CGWA 2QO2A 5HIDA 5I4NA 3TKUA 2OO8X 5LVOA 4FIFA 2RL5A 3HDNA 3UVRA 4ACHA 5HVKA 5KMOA 2C5OA 4FBXA 5BYZA 5HE3A 5HNGA 4AG8A 2Z02A 2C6OA 4HZSA 4F1OA 1OUKA 3HUBA 5CEQA 3UNJA 3FMJA 4JAJA 4XV1A 4YC6A 3I4BA 1PMVA 3PJ3A 3TZ9A 4BDFA 4IAZA 4MX9A 2WTWA 5AP3A 3FLNC 2R5TA 1WBOA 4FG7A 4USEA 4R78A 3VWAA 1WBVA 4Y72A 1JKLA 5E4HA 1H1RA 3H30A 3OCGA 2YCQA 4AW5A 4FKTA 4KIKA 5FEEA 4BDDA 5IQEA 3GCVA 3OUNB 5GIPE 3QRJA 2OU7A 2XIYA 3NW5A 4L3JA 3VS7A 3E87A 2C6TA 1Y8GA 2QNJA 3QGYA 4GVJA 2ETRA 2X6EA 2W1ZA 3D9VA 4Q9SA 1WMKA 3C4WA 4CCBA 3TNQB 1YKRA 2J4ZA 4DEGA 4FV1A 5CAOA 5L3AA 1Q8TA 3LFFA 3KULA 3DK7A 5CWZA 4BWPA 4QMUA 3EQHA 2PSQA 3A8WA 4IWOA 4DFUA 3MB7A 4PRJA 3QQJA 5DHJA 2O3PA 3MDYA 2PZYA 3F88A 3H3CA 4O1PA 4FEWA 4YC8A 1G3NA 3MN3A 4E73A 4R7BA 4FYNA 1OBDA 3FQEA 4J8NA 3KA0A 4BTFA 2ZV9A 2I6LA 2W1EA 1OL2A 4GG5A 4AZEA 2OH4A 2AYPA 4EH6A 5M4UA 4CLIA 5HG9A 3WZUA 2A19B 2GNHA 3DAJA 5AUTA 1KE5A 4HNIA 3SRVA 2CHLA 3VUIA 2R4BA 3QX2A 5KHXA 3R7GA 2VO6A 5IDPA 1H0WA 2GQRA 4MTAA 4ZSGA 2SRCA 1FQ1B 4DITA 2HWOA 3EQFA 4Z55A 1ZMVA 4YZ9A 3W2SA 3IOPA 3OY1A 4H3PA 3C51A 3UE4A 4DFYA 4DGNA 3QTSA 3DOGA 3PUPA 4FTAA 3DPKA 3PG1A 2JDRA 4L44A 4UALA 3DA6A 5EM8A 5J95A 4BCFA 2YDKA 1YI6A 2GS7A 3FSKA 3ROYA 4BCIA 4KIOA 4M68A 4O7WA 4BIDA 3KKVA 4S2ZA 3EQBA 4LYNA 5LJJA 4UYNA 5KE0A 5D10A 2GHLA 3VUDA 4RZWA 4HCVA 3HAMA 3NIZA 3MJ2A 3ANRA 4FOBA 3R7VA 1VZOA 2HXQA 2JDTA 2OXXA 2QKRA 4A9SA 3SGCA 4NCTA 5LCKA 5D11A 4G3EA 3ODYX 5IMXA 4A9TA 1FINA 5CU4A 5DLSA 3EQRA 5J9YA 3QD2B 5ANDA 3AT2A 4KKHA 3RZBA 4OTIA 5CAVA 4W4YA 5HE1A 2Z7RA 4C4EA 5AV0A 2UW0A 4MD7E 4L3LA 4Z7HA 1ZOEA 2BR1A 3OCBA 4ZJVA 4YC3A 1JAMA 1BYGA 1PW2A 1R78A 2BIKB 3I7CA 3O96A 4AW1A 5L8KA 5M57A 3C0GA 3UG2A 3OS3A 1LEWA 1H08A 5K3YA 4CTCA 3IO7A 3R7UA 4C36A 4CFFA 1PMEA 4P2KA 2XK7A 2WTDA 3LCKA 4ZTLA 4DTKA 4EK3A 1STCE 4CXAA 5LVNA 3D7TB 5DBXA 3E88A 4KRDA 3U9NA 3CTHA 4CQEA 2ITWA 2CCIA 4XMOA 5IEYA 3QGWA 3IW7A 2NO3A 3W2RA 5BNJA 2WMTA 1R3CA 4YR8A 4FG9A 2WIHA 3RZFA 3A7JA 3BIZA 1R0PA 1WBPA 5ACBC 2C30A 4D4YA 3OT8A 1PXMA 3AC3A 4FIIA 3QQUA 3RPYA 4RJ4A 3ZH8A 5LMKC 4FTOA 4MXXA 2Y7JA 1H1PA 2UW9A 4IAIA 2A4LA 4OBPA 4R3CA 4IE9A 2WTKB 5CU3A 4BGQA 4O7RA 4FV2A 3IPHA 3IS5A 5AP5A 3ENMA 4JNWA 1SNUA 2DS1A 2F9GA 2X7OA 3VRYA 4ASZA 4EC8A 2H9VA 1JOWB 3KCKA 4C3FA 3RPVA 5DR2A 3PXRA 4NFNA 3CEKA 2C3IB 4JLCA 3D2KA 4BCPA 3WYXA 4QP1A 2BZIB 2JBPA 1GZOA 1EH4A 4E6QA 3CY3A 3VBVA 3LHJA 4X3FB 4AACA 4FUYA 3Q6WA 1PXOA 3TN8A 3UYTA 2UVYA 3PJCA 2R2PA 4D0XA 4YSMA 4JDKA 3KCFA 3NW7A 4F9YA 4BIBA 1K3AA 4FV4A 2OIQA 4ERWA 4HGEA 3VQUA 1U59A 3C7QA 3TV7A 2C3LA 3RK5A 3RAWA 2R3LA 3DQXA 3VJOA 3BLQA 4B9DA 4J97A 3BEAA 5FEDA 3MFSA 5LVPA 3SG9A 1ZMUA 3TTJA 4RVKA 1PXPA 5CEMA 4PTGA 1ERKA 3PIYA 2VX1A 3ZZEA 4BC6A 1NVRA 4FG8A 3BHHA 3BPRA 4W4WA 2PZPA 1AGWA 3I0QA 3C50A 3MH2A 4CZTA 2IW9A 1Q62A 4PDSA 1W84A 4EWHA 4FSYA 4L45A 2X39A 3M2WA 4RRVA 2VTLA 5H2UA 4ACGA 5KCVA 2PWLA 3LM5A 2IVSA 4N6YA 2ZVAA 3O51A 4AA0A 4HJOA 4IC7A 3IGGA 3TV4A 4D0WA 3EN7A 4FTLA 3QQFA 2I0VA 4J1RA 3ZFXA 4EOPA 4JBVA 3I5NA 4MXZA 4W4XA 3E8DA 4CT1A 4MBIA 1CKJA 1YWNA 4F70A 4RQVA 5I3OA 5IH5A 4HVSA 1CTPE 4FUXA 2XIKA 4V04A 5EI6A 5HX6A 4NM0A 3PXYA 2PUNA 2UW8A 1PJKA 2WMSA 5JQ8A 1CM8A 4GUBA 5M08A 2ONLA 2VTPA 3H9RA 4D2TA 3K54A 3Q52A 4MBLA 4BYIA 2WXVA 3DKGA 5EQPA 3PVWA 3A7FA 3RWQA 3FLSA 4W9XA 4XG2A 1BL6A 5AIKA 2A27A 1OM1A 4EONA 3CKWA 2OIBA 4HVGA 2C5NA 3IDCA 3MPAA 5GJFA 4FVPA 2XK6A 4ANLA 2QOFA 3GU5A 4I4FA 1U54A 3GQIA 4CFMA 4FA2A 1YWVA 4QP3A 5FXSA 4CZUA 3SX9A 1W83A 3TDVA 5AUUA 4GRBA 3ZSHA 4AOJA 1BLXA 1WBSA 3QCQA 3VS4A 3P79A 5IA3A 1W98A 1KSWA 4F6SA 2PY3A 4YU2A 5CSXA 1QPCA 4DEHA 4BDHA 4DGMA 3NAYA 5TT7A 2OGVA 3R01A 3VF9A 4EZ3A 4P5ZA 3RINA 3CCNA 3B2WA 3UVPA 4QQCA 4KWPA 2R3GA 2HOGA 4PPAA 4ANNA 4E5BA 3NWWA 3FE3A 5E8VA 4K11A 4FSTA 3BLRA 4UWCA 2C3JA 3E8CA 4RX8A 3ZRMA 4D4RA 4FIEA 1J1CA 4UMPA 3F82A 4J96A 2R3KA 4FKGA 2OWBA 3UIUA 3GU8A 4OGRA 1M2RA 3FLZA 3MPTA 4GVAA 4WUAA 3DDQA 2R3QA 3U6IA 3NUXA 3R04A 2FA2A 2YLEA 4QTEA 2PVMA 4KS8A 3UOLA 1I09A 2C47A 5HVJA 3AXWA 3V04A 3FXZA 3R22A 3AC4A 4ZTHA 5J9ZA 3MESA 2E9NA 4HGLA 3UJGA 3S0OA 3N9XA 4F7NA 3DQWA 3LXKA 4ITIA 1H00A 3NLBA 4XG9A 4G1WA 1F3MC 3CD8A 4MNFA 3QKMA 2XJ2A 5D41A 3LPBA 3WE4A 5JZJA 3QZHA 4X6QC 4DT9A 4O7LA 4DYMA 5DA3A 2RFNA 2VX0A 3K5VA 4RJ5A 3DFCB 1WBTA 4GKIA 4G3FA 3S95A 1OIUA 2FYSA 4DLIA 2WMBA 5BVOA 1TQPA 2G15A 3POZA 1JSUA 5EI2A 5AP1A 3GCSA 3ELJA 3NCZA 2E9VA 1KWPA 2ZMDA 2JKQA 4EYMA 2EUFB 4BDJA 4YO4A 5IUGA 4ID7A 4GK2A 2B1PA 3F2RA 3BYOA 4M7IA 4EOSA 4MXAA 2XM8A 3QF9A 3QQHA 3HECA 4CNHA 4X21A 4WNMA 4LGGA 5EDRA 1NY3A 4DFXE 3JY0A 4LMNA 4FKPA 5HNBA 3RHKA 3UC3A 1Y57A 3P1AA 3DV3A 3QLFA 3R2BA 4FKJA 4OBQA 3UP7A 4AW0A 4B0GA 1K9AA 4FVRA 4BFMA 4EH2A 3ZC6A 4ONAA 2YFXA 3E64A 5DPVA 4K1BA 2W1CA 4XNEA 5CF8A 5L6PA 4D1ZA 1V0BA 3GI3A 3ORXA 5HCXA 5HU9A 4NW6A 4RX7A 5I3RA 3LMHA 4N70A 3LW0A 5I9YA 4RFYA 5DNRA 1Z9XA 2JITA 3A2CA 4GFOA 2C5VA 2QURA 2E9PA 2J5EA 2C0IA 3ORMA 4ANBA 1NVSA 5IQGA 2W05A 4FNYA 3Q4TA 3R00A 4OR5A 3TWJA 3UPXA 3ATTA 5IQFA 4JOAA 3PY0A 5B0XA 3PY1A 5IG1A 2F49A 2HZ4A 4FNWA 4DCEA 5EKNA 4AAAA 4ZSJA 2G01A 2DWBA 4BKZA 4D1SA 2QOIA 5K4IA 3R9OA 3QYZA 2P3GX 3NYVA 3BYSA 2C6LA 4I5HA 4QMOA 3RPOA 4CVAA 5M07A 4IIRA 4I94A 5CYIA 4UXQA 3DKOA 3IGOA 1H24A 1KE9A 3ZSGA 2PVJA 4AZVA 3NEWA 2GHMA 4EUUA 1GIHA 5M4IA 2XNBA 4BICA 3NS9A 3VJNA 2YM3A 3KF7A 3HZTA 5IA4A 2PE1A 1HOWA 3FYJX 3FXWA 4YHTA 3N4VA 5CEKA 3PWDA 5E9EA 4B4LA 4H1MA 4I3ZA 2PVFA 4IZYA 4X0MA 1Q4LA 3NSZA 4YJPA 3L8XA 4G9RA 2VO7A 5C1QB 2PK9A 4L6QA 2XM9A 2OJFE 2X2MA 4W8EA 2FGIA 1YOJA 2OF2A 3IDPA 5FGKA 3K3JA 1LEZA 4MWIA 3UGCA 5HO7A 2CGUA 4JIKA 4IFGA 5HBEA 5ANEA 1OPKA 3P9JA 1OMWA 5BUEA 3R71A 2CKQA 1S9JA 3NVMB 3A99A 1YDSE 5CXZA 5JZNA 3MH3A 4RWKA 1TQMA 3U51A 3R73A 3UOKA 1Q8UA 4FTQA 3JPVA 4IWDA 4F7SA 3FLYA 4BCGA 1FMOE 2PMIA 4EH9A 3HGKA 4EZ7A 5KO1A 2WQBA 3LJ2A 4AT5A 3OMVA 2UZOA 3QZGA 5I9VA 5AUWA 1UVRA 4V05A 3UQCA 5H8BA 4JBPA 3WI6A 4D2PA 1L8TA 4C8BA 2RIOA 3SDJA 4KKGA 1YI4A 2OLCA 4RC3A 2VTTA 3GEQA 3MFUA 3PY3A 4ZK5A 2O8YA 4C2VA 1ZWSA 4XJ0A 4FGRA 3I1AA 3I6WA 3QWJA 4FKUA 1DAYA 2XBAA 3TIZA 5AA8A 2WQMA 4DEEA 3F5XA 4EOIA 4GJ2A 5EI8A 4UMUA 5FTOA 5EYCA 4JQEA 5CALA 3CPCA 4PP9A 4DHFA 3KREA 3BCEA 4GFGA 4EHGA 3TEIA 3ACJA 3OOMA 4I6BA 5LXMA 3GB2A 3A7HA 3TZ8A 5ETFA 5EOBA 5FTGA 5HVYA 3LMGA 5A6OA 4G3CA 3OUKA 4RJ8A 2R3RA 3EIDA 3G6HA 4L7FA 4F0IA 3VS0A 3GENA 1LR4A 4M14A 4PNIA 2YM6A 2YWVA 3V8SA 1ZAOA 5JT2A 5AR4A 2VTIA 3F7WA 5K0KA 5DYJA 3KXHA 2JD5A 2QG5A 2VTSA 3HMIA 3OCSA 5FLFA 4R3RA 3UBDA 3LFAA 4O84A 1K2PA 3MVMA 5HCZA 2PE0A 4FZDB 5CEIA 4AUAA 2F7XE 4XP0A 3WYYA 4QMQA 3R28A 2HELA 2Y8OA 4ZY5A 2PU8A 4ZSAA 4F6UA 1OI9A 2VTJA 1VR2A 1QPEA 1MUOA 2VTHA 2GNLA 3OFMA 3FL4A 3DAKA 4LGHA 5ANJA 1H28A 3VQHA 2W5HA 1TVOA 2XJ1A 3G6GA 4LI5A 3SC1A 4ZEGA 4AZSA 4EYJA 3TUDA 3O71A 3NUAA 1ZYCA 3QTRA 2YIQA 3BYMA 3R63A 4YJSA 3UP2A 5EKOA 5HNIX 3D2IA 3LJ1A 2EXCX 3HMMA 3Q96A 1FVVA 4OT6A 5CZIA 4DAWA 1R0EA 1XH9A 4XYFA 2X1NA 3O7LD 3WIKA 4BN1A 2BUJA 4R1VA 1FMKA 5E1EA 1XHAA 5J5TA 3MGYA 4FL1A 4F6WA 4X2KA 2ZB1A 5DIAA 3VULA 2YHVA 5A46A 2Y4IC 3AMAA 5IISA 2EVAA 2JKOA 3F66A 3MH1A 4GT5A 2JAVA 1OPLA 3F3VA 2WKMA 4FGBA 4RQKA 4BCQA 3QQLA 4QQJA 1SVGA 5K9IA 1Q8ZA 3G0EA 4JIAA 1VYZA 4PDOA 4W9WA 4Y46A 4ORKA 2BIYA 5BMSA 3GC0A 1OVEA 3R9NA 4CGAA 2B9JA 4DGOA 2JDOA 2YAKA 5HTCA 4YPSA 5A4EA 3EHAA 3RAKA 4AZTA 4FNZA 4AGWA 4BI2A 4TYEA 3KK8A 3G0FA 1FPUA 4R5YA 3NNVA 4EI4A 4WG5A 4WT6A 1QPJA 3Q60A 3VS6A 4D9UA 5IQAA 3DTCA 4DT8A 2OICA 2CDZA 3V5QA 4BKJA 2V62A 4CZYB 4BCKA 3FI4A 3Q32A 3P08A 3P7AA 4J95A 4U3YA 2GDOA 4O0XA 3R8PA 4E26A 4XG7A 5GZ9A 5EHOA 2H34A 1NT2A 3RK9A 2P2IA 4NH1A 1BKXA 1YVJA 5IQIA 4WNPA 3LFCA 1VEBA 4IM0A 5DFPA 4ZAUA 1JLUE 3QTIA 4IACA 4IDTA 4RX9A 3O23A 2UW5A 4ASXA 3GCQA 4MEDA 1URCA 2QODA 2ZMCA 3CJGA 5T6KA 2R3FA 4JDIA 2J2IB 1ZLTA 3OOGA 1SNXA 3RJCA 2QQ7A 4BDEA 5KMNA 2QI8A 5L2WA 2GNJA 3OVVA 4BDIA 4OT5A 2UZVA 3WARA 4D5HA 2XH5A 3JR1A 3HP5A 2B55A 4G31A 3VN9A 5EW8A 2QVSE 4I0TA 1OIQA 4JDJA 3ZXZA 2F57A 3FYKX 4RA5A 4DG0E 4FTIA 2RG5A 3P7BA 4JBOA 3I6UA 1J7UA 3B8QA 3LFQA 3QUEA 1I44A 2RKUA 3TXOA 4E20A 3GU7A 4O38A 2YITA 2EU9A 4MKCA 4O6LA 4MBJA 3RM7A 4EJ7A 3WF7A 4L67A 2VZ6A 4TL0A 2Y6MA 4G17A 2IN6A 2VTAA 1CMKE 4E6AA 3ETAA 2BAJA 2XP2A 4L01A 4P7EA 2KULA 3DBFA 4UB7A 4ZTNA 2WTJA 4UYAA 2C5XA 3QZFA 5LCJA 1GIIA 3FI2A 4FYOA 4ACCA 4YJNA 3V8WA 3EQGA 3O0GA 4Y85A 3UQGA 5A9UA 1SMHA 2WTVA 4L46A 5FUTA 4NUSA 5EH0A 3FMNA 3SA0A 5HD7A 2KTYA 1RDQE 1BI7A 3MH0A 1H1SA 1WAKA 4E7WA 4ZZMA 2ZM3A 3G90X 2GS2A 4O2PA 3KMUA 2RFDA 4DG3E 2OFVA 4E3CA 3CC6A 1ZY5A 4FV7A 4XCUA 5CI7A 2GFCA 5I9WA 2ETMA 3UTOA 4HPTE 4CFNA 4EHVA 1Z5MA 3MB6A 4CYIA 3F2AA 4IMYA 1OIYA 2W5BA 4JX3A 3UNKA 2IZUA 3F3WA 3EN5A 3KC3A 4NU1A 2PVHA 2CKEA 4FV0A 3VS5A 4FSQA 4BL1A 2YEXA 3UYSA 4FI1A 5GIOE 2W7XA 4AX8A 3VS3A 5LWMA 2FSMX 5AUZA 5FDPA 3R9DA 2JEDA 5IH4A 4OTRA 3ZM9A 4TPTA 4EWQA 2X7FA 3OW4A 4I22A 3R8ZA 3HDMA 3PYYA 2PVRA 3MBLA 4YHJA 5HEZA 4CSVA 3ZO4A 3HMPA 3W55A 5HICA 2WMQA 2XKEA 4O0VA 2W99B 3NUUA 3HMNA 3B2TA 5EYKA 5JEBA 3PE1A 4MVFA 4QMPA 4S30A 2WELA 3ID6C 2JIVA 4IBMA 4IVCA 4RLKA 2OK1A 4M69A 2O5KA 5ANOA 5J87A 3DNDA 2BRBA 4LRMA 4YBJA 3LXLA 4OTHA 4QOXA 2W1FA 4F65A 4RIYB 3CQWA 2CPKE 4QT1A 1RJBA 2W1GA 4CTBA 3OTVA 4EHZA 2GFSA 4QO9A 5C8MA 4FE2A 3HNGA 4XBRA 2VTMA 3EMGA 2NPQA 4HYIA 2WHBA 4PTEA 4RJ7A 4E6DA 2J0JA 3T9IA 4APPA 1PXIA 4F0FA 4CYJA 3O8UA 4EKLA 4E4LA 1H1QA 4ERKA 3GUBA 2E9OA 4L42A 1JPAA 4JG7A 2C68A 5IEXA 3R1SA 4CMUA 4YTCA 4GYIA 4IZ5A 4YZCA 4DC2A 2VTOA 2I0HA 4M3QA 3FZSA 4IZ7A 1R39A 3V6SA 1P2AA 1WFCA 4UEUA 4QMVA 3GCUA 3VF8A 3VW8A 1YXSA 5E8XA 3FI8A 1Y91A 3PA5A 1XBBA 3MWUA 4IQ6A 4A07A 5AAEA 5LVMA 2XCHA 3IW5A 3A4PA 4UWBA 4DF3A 3PP0A 4I5MA 4J71A 3NPCA 4EOJA 3ZHPC 3F3UA 4UZDA 1BI8A 1KOBA 4BDBA 3DXPA 4DBXA 2ITVA 3L9NA 1GZ8A 2P4IA 5CEPA 4LOPA 4RPVA 4AGUA 3F2NA 2YIWA 5FQDC 5IQBA 5G6VA 3BE2A 1GY3A 4J52A 3IKAA 2PVKA 3DS6A 3U8WA 4QPSA 2V7AA 2VU3A 1FVTA 4LUEA 4DA5A 3ZONA 2GNGA 4LQMA 4XG4A 5DI1A 3BV2A 4QMWA 2XNMA 3KF4A 1T45A 4XRJA 4W4VA 4U42A 2PYWA 3DJ6A 3L8PA 3TNHA 4ZS0A 3LMIA 2QU5A 1CKPA 3ZLSA 3CD3A 3E3BX 4KIQA 3QRTA 2YZAA 1PHKA 3ORKA 3U4UA 3II5A 4M97A 3HUCA 4GKHA 1Q61A 2BVAA 1U46A 3F61A 2I1MA 2OG8A 4OTDA 2VX3A 4DTBA 3VHEA 3POOA 3D15A 4WO5A 4KD1A 3OF0A 2A2AA 2IWIA 2XNGA 4K8AA 4YURA 1JKKA 2VTNA 5FXQA 4U41A 4O0RA 4ALWA 1IA9A 3TM0A 4FT3A 3AMBA 5CU6A 4BBEA 1QMZA 4O0WA 3GFEA 2XEZA 3BYVA 4AOIA 1JSVA 4ZZNA 4FNXA 1YXTA 4K18A 3ZU7A 4ZY4A 2XNPA 4C58A 2C6EA 3S2PA 4CRSA 2XIXA 3W33A 2CGVA 3QA0A 3GOPA 3UIBA 3DK6A 3DLZA 3Q5ZA 2HYYA 5BUIA 2BZHB 1B6CB 2NRUA 3FZPA 2XZSA 5CVHA 3D14A 1XH6A 3TCPA 2CKOA 4YPDA 3ZO3A 1DM2A 4QMSA 3QYWA 5LWNA 4O0TA 4ZJIA 1F0QA 4RIXB 5HHWA 4AQCA 5IF1A 3TDWA 3O7LB 3DGKA 3VAPA 4C4IA 2BHEA 3I5ZA 3UG1A 2YDIA 4ZLZA 3MA3A 4ZP5A 4V0GB 3KVWA 2V5QA 5IQCA 5C01A 3Q6UA 4RVTA 4TT7A 5JFSA 3F5UA 4C59A 4O7NA 1XH8A 2OJGA 3EN9A 3KRLA 4E4XA 3A60A 2QOBA 2B4SB 4NJDA 4JQ8A 3TNPC 3QC4A 4XG6A 4BYJA 2QLQA 2YCSA 3P0MA 2DQ7X 2VGPA 4TYGA 4WKQA 2O2UA 2HIWA 3OEFX 3QLGA 5DT0A 3CIKA 3VRZA 3CKXA 5CLPA 4C4FA 5CF4A 5LMBA 4IXPA 4UBAA 2JBOA 4RA4A 4ZS4A 4I5PA 2WU6A 2QLUA 3NRMA 1TKIA 5AR7A 2W4OA 4WSYA 4WNKA 1Q8WA 3F69A 3MI9A 2IW8A 3ZLYA 4CLJA 1WBNA 3W1FA 3CTJA 1ZYLA 3CQEA 5I0BA 3OHTA 3QCYA 5FM2A 2WPAA 3KMMA 4N6ZA 1E9HA 1NA7A 3HMOA 5JH6A 3L9LA 5K0XA 4U3ZA 4C57A 4PL3A 2Z8CA 3PPJA 2XB7A 5AP4A 3WF5A 4BDKA 2YIRA 4U8ZA 3GC7A 4D2SA 4PY1A 4FICA 2WMUA 2PL0A 3SOCA 3P7CA 4FV9A 4AA5A 4PWNA 2FUMA 4FKIA 3MVLA 1GZKA 4FZFB 4L9IA 4YLKA 5AP0A 5TOZA 4M8TA 4KA3A 1NXKA 1B38A 2ETKA 2UW3A 5DH3A 3UIXA 5I5ZA 5IMEA 4NCTC 5JFXA 3TZ7A 4F4PA 2GQGA 4JBQA 1UV5A 3FV8A 3VUGA 4CRLA 4E5AX 3EB0A 3D7TA 1APME 2UZLA 4IWQA 2AUHA 4LL0A 2PUUA 5EDPA 4CG8A 2V7OA 3ZFMA 1M2PA 1AD5A 1W82A 4U81A 1PYXA 2WAJA 3BHYA 2ZAZA 4GFMA 3V3VA 1U5RA 1VJYA 2PZ5A 4FEXA 4BKYA 2XBJA 4RLLA 4YJTA 5J7BA 2ZJWA 5F95A 3UQFA 4QP9A 2JFLA 2B9FA 3PVGA 4GH2A 4I41A 3QTZA 5CSWA 2XIRA 1MQ4A 2O65A 3TT0A 2XYUA 4UWYA 3EL8A 4UMQA 1W7HA 4MCVA 4WIHA 1H1WA 4G3DA 1O6KA 2UW4A 3DAEA 4BZNA 3WILA 4C7TA 4NIFB 5ANIA 3PZHA 4XLIA 3HV6A 3BBWA 2HCKA 5ACKA 4RFZA 3BE9A 2P55A 2VRXA 2GMXA 5F94A 4E1ZA 5BPYA 3FI3A 3TUCA 3O8PA 3PDTA 4U40A 1YI3A 3L9PA 4GSBA 3CTQA 5AIRA 4FTNA 2ZOQA 4NSTA 2WMWA 4BCNA 3E8EA 3D4QA 4X3FA 4TYHB 3V5TA 5BYLA 3LAUA 1JKSA 2BHHA 3G51A 5HX8A 2R3MA 1FGKA 3I0OA 4K0YA 5IQDA 5LMAA 2YA9A 4CMTA 5IA0A 2HZIA 3I79A 2ESMA 4TWOA 3WF9A 4OLIA 5AP7A 4JR3A 4OTPA 4GV1A 1SM2A 4QMNA 4KINA 3JUHA 4MNEB 4WSQA 2XKDA 3VS2A 2JAMA 2VV9A 4FTRA 4KIPA 3NUYA 4DH8A 2XS0A 3FMMA 2ZB0A 3MFTA 2X8IA 1UU3A 3R1QA 2YLFA 4G5PA 2WQEA 2CNVA 4DFBA 3RWPA 3FBVA 1URWA 2IVVA 4I6FA 2G1TA 1XR1A 2C6KA 1MRUA 3FC1X 3ACKA 5ETCA 5L2IA 4TNDA 3RVGA 4BGHA 2BTRA 3ZBFA 3OCTA 4RMZA 4AA4A 5D1JA 4FKRA 3VW6A 3SAYA 3DNEA 4FL2A 3GT8A 3OWLA 3AGMA 1ND4A 1WVWA 3QC9A 5L2TA 5CENA 3PJ2A 4IX4A 4O96A 4AT4A 3BHTA 5KZ0A 4EH8A 2HK5A 4F09A 5D7AA 5JFVA 3TJCA 4JJRA 4DBNA 4QPAA 2C6MA 5CY3A 2PVYA 2PHKA 5AP6A 3KL8A 4O27B 5AV4A 3FMDA 2PUIA 1Y6BA 4YLLA 4QMTA 3FQHA 1JQHA 4OW8A 4IWPA 2C0TA 3IG7A 4RBLA 4ALVA 4Q9ZA 5KKRC 4G3GA 1PMUA 3QBNA 1REKA 4H1JA 2VWBA 1IASA 1QCFA 4WBBB 2Y6OA 3KXGA 3O2MA 3ZM4A 3OC1A 3KU2A 2ZM4A 4RVMA 1MQBA 5AAGA 2B0QA 4DH3A 5AM7A 3MY1A 5IU2A 4J98A 3BKBA 5FP5A 1P4OA 2BDFA 2ZV2A 3ZSIA 3WZKA 5KX8A 3HA6A 3DBCA 2XF0A 5EQEA 1IA8A 4MXYA 3NX8A 4O0UA 5DG5A 5JRSA 1A48A 2ONLC 1UKHA 4F64A 3AOXA 4RIOA 4TZRA 4XBUA 4S33A 3JS2A 4MHAA 3MIAA 3IDBA 3UIMA 4JQ7A 4O7SA 2Q83A 4RG0A 4Y5QA 5CSPA 4FKSA 4MNEA 4CD0A 5IH6A 4D2VA 3BI6A 3TG1A 5HORA 5ANKA 3OD6X 5AM6A 3G5DA 3Q5IA 3LLTA 2J0MB 3AC1A 4FR4A 4FV5A 4A06A 4K77A 4IAAA 2ZV7A 3N51A 4XHKB 4NZWB 4HCTA 2E2BA 2PVLA 3KRRA 2HAKA 1OL5A 3NR9A 1YW2A 4YZMA 2HWPA 4H3BA 5BMMA 2EB2A 3GU6A 3PLAE 3MPMA 4KAOA 1KV2A 2UVXA 2Y4PA 4NM3A 5DT3A 5BUJA 4F9CA 4RWIA 3PXKA 3Q4CA 2WEIA 3IW8A 4GUEA 1S9IA 2DUVA 2Y4IB 3QZIA 4MD8E 4PPCA 4DFNA 3U55A 4DE4A 1CSNA 5J1WA 4IAYA 4U5JA 4DEAA 3Q4UA 3DB6A 4EHEA 2BRNA 4ZY6A 1NVQA 3EYGA 2BAQA 4FT9A 4PL4A 4QP6A 1O6YA 3F9NA 3R8LA 4CV9A 5L2QA 2OH0E 5ICPA 2QD9A 4U45A 3R83A 3VNTA 2GQSA 4I93A 5IDNA 2RGPA 3LFSA 4TYJA 3RNYA 2PVNA 5BYYA 5M06A 2AC3A 3HV4A 3DBEA 4B8LA 5FXRA 3ORZA 4YO6A 4XOYA 5C9CA 1ZYDA 2CNQA 2OJJA 4F1MA 1GZNA 3NUPA 3RALA 2WTIA 5AX3A 3V8TA 1U5QA 2YERA 3GGFA 4H39A 1LPUA 3UNZA 4D28A 2I7QA 2VN9A 4CMOA 1PYEA 5CVGA 3SKCA 3FDNA 4NFMA 2OZOA 5GZ8A 4GL9A 2R3OA 1UA2A 3V5PA 5AFVA 1ZARA 2G9XA 2ACXA 5DE2A 2PE2A 4J8MA 4BY9E 5BVEA 3ENHA 3KXZA 4YJOA 4II5A 4AFJA 4CEGA 1YQJA 2ITOA 3OZ6A 1O6LA 2UZDA 3Q4ZA 5KUPA 5KMKA 3FAAA 3Q2MA 2P33A 1HCLA 3DTWA 4AE6A 3UO5A 1ZMWA 3FSFA 4R77A 3VBWA 4C38A 4X2JA 4DH7A 5TE0A 3AT3A 3O8TA 3E8NA 4AT3A 3LZBA 4L3PA 4TW9A 5L6OA 3LJ0A 4LOQA 3G15A 3F5GA 2YDJA 4KSPA 2PMOX 4EK4A 4FZ6A 4LGDA 2RSVA 4ANSA 4F0GA 4X6RA 5KMJA 2Z7SA 5BX0A 4YMJA 5KMLA 3TV6A 1H0VA 4YGAA 5CAQA 3ZBXA 3WF6A 3SLSA 4FKQA 1PXJA 3WF8A 3NYNA 5M55A 1ZRZA 2V22A 4FTMA 2UZBA 4BRXA 1Q3WA 5CZHA 4UY9A 3S3IA 5JN2A 4ASDA 3W32A 3JXWA 3MVJA 4AOTA 4S32A 5HGIA 3ZYAA 4OUCA 4C34A 4MH7A 5DR6A 2PMNX 1MP8A 2ITYA 4XH6A 2W9FB 4HVDA 1L3RE 4QTBA 4JRNA 4ANQA 4B8MA 4XX9A 2B53A 4H58A 3E3PA 3HRCA 3NCGA 3QD4A 4RWJA 1UKIA 5AR2A 3RK7A 3MVHA 4YNOA 5AEPA 3UOHA 4FTJA 4TWPA 3DFAA 2JKMA 3HRFA 4U80A 3FPMA 2B54A 3HV5A 3EH9A 4FIJA 4I6QA 4BGGA 4O81A 4C2WA 4LRKA 4LM5A 2J50A 3D5UA 4EK6A 3LCSA 4U7ZA 2B9HA 3OG7A 4KKEA 3RMFA 5L4QA 3ORNA 4EH7A 4X3JA 2OFUA 3QQGA 2WFYA 3TTIA 5FBNC 2HY0A 4G6LA 5IA5A 3FLWA 4O7TA 5FWKK 4UMTA 4BF2A 3MY5A 2C1BA 3UZRA 1H25A 3LE6A 5EM7A 2ITUA 4PQNA 1AQ1A 3L8SA 5AMNA 3H9OA 3Q9YA 2O63A 2W1HA 1KE7A 4EQUA 3FL5A 2VWYA 5HO6A 3A7IA 3PIXA 5LARA 4NYEA 5AUVA 4DINA 4R3PA 5CEOA 4IB5A 1Q3DA 2REIA 4K33A 5CQUA 2WMRA 2ITXA 5HTIA 2Q0BA 4QYFA 4GS6A 4EOKA 1IR3A 2PTKA 1OB3A 5JGDA 3QA8A 2XUUA 2X6DA 2XMYA 5AUYA 5TKDA 5HLNA 1B39A 2RG6A 3H9FA 3QKLA 5AV1A 4C4JA 1DS5A 1KE6A 1UWJA 2E9UA 3E5AA 3IK3A 3VS1A 3SVVA 5CSHA 4TY1A 5LQFA 1BUHA 2C1AA 1FGIA 4CFWA 1HCKA 4ENYA 3Q04A 4XG8A 3KXMA 4AWIA 2CNUA 1XJDA 1XO2B 1PKGA 4AZWA 3PJ1A 1YOMA 3EQCA 3W2CA 3LCDA 2R7BA 2HY81 3LCTA 4MD9E 3Q3BA 4BZOA 4FTCA 4PDPA 5IUHA 3QFVA 4QRCA 5BVFA 3QL8A 3OWPA 3NYXA 4N4SA 4QYYA 4TWCA 4ZTSA 2WMVA 2C0OA 4L53A 4U97A 3DBQA 3GC8A 3WIGA 2Z7LA 2WMXA 3ATSA 1OL1A 4IVAA 4RZVA 3TKIA 3GFWA 3KK9A 3DT1A 5EHLA 4XS2A 5HG5A 4Y5HA 3C4XA 3I81A 3BBTB 5DWRA 3EL7A 3PTGA 4CFVA 1ZYSA 2QO9A 4QTAA 2RF9A 3NNUA 4G6NA 2UUEA 3AC2A 4ZSEA 5TR6A 3KY2A 3BGQA 3ZRKA 3ZEWA 3BELA 1LP4A 1J3HA 3C4CA 4QYHA 4JX7A 5E1SA 2CMWA 4M12A 5HLWA 5KZIA 2QR8A 4RGJA 4HNFA 1JWHA 4EH4A 5A4QA 5E91A 2X2LA 4O0YA 3UC4A 2ITZA 3AC5A 1DAWA 4O2ZA 4ZJJA 3TIYA 3NDMA 1SVHA 3BGZA 4TNBA 1IAHA 2CSNA 3ZLWA 3G9LX 1FVRA 3AC8A 4KABA 1YXVA 3OXIA 2QHNA 5CI6A 4KUJA 3QALE 4IX3A 1YDRE 4AU8A 4Y8DA 3S4QA 4EOQA 4PMPA 2GNFA 4EH5A 3EFJA 4YSJA 3DZOA 4MXCA 3HLLA 1V1KA 2JIUA 4G5JA 3QTXA 5AX9A 2BDWA 2EXMA 4FX3A 5F1ZA 3PSDA 5CF5A 2G2IA 2QO7A 2W5AA 3I60A 5AJQA 4F9AA 5AADA 2WEVA 2PZIA 1U4DA 3AD4A 3LQ8A 4EKKA 5CASA 4WA9A 4PP7A 2PUPA 3AT4A 3PSCA 5FEQA 3FPQA 3PVUA 5AV2A 2QG7A 2IVUA 4C35A 2WTCA 3ZZWA 5DVRA 2OIDA 2OXYA 3FKOA 4RT7A 3ROCA 4BZDA 3NIEA 2J6MA 4R7IA 1YHVA 3P86A 4U0IA 3SD0A 1H8FA 4G16A 4EEVA 3ORIA 1P14A 5KNJA 4PF4A 4XUFA 3VBYA 3FZ1A 3PWYA 2H6DA 3C9WA 2YABA 4V01A 5E8SA 4ITHA 4QNAA 4WD5A 2IVTA 3KXXA 4KSQA 4KIKB 3FZTA 1PKDA 3FKNA 3HKOA 3VVHA 1OKVA 4BDAA 4C3RA 2YAAA 4G34A 1KOAA 2NP8A 4YTHA 3RKBA 2BRGA 3U6JA 1R1WA 3Q2JA 5E8YA 1GIJA 4O91A 4IM2A 4QMZA 3KGAA 1PXKA 3FY0A 3KMWA 4XLVA 1ZZLA 5E90A 1XBAA 3MSSA 3UDBA 3R2YA 2VWUA 1PXNA 5CT0A 5TO8A 3R8UA 2GTMA 3FZRA 4I24A 3C4FA 4FC0A 3F3ZA 4YZNA 4YBKA 5T3QA 4TRLA 5M4FA 4D2WA 4O7ZA 3LFBA 4LV8A 2B7AA 4R6VA 2W1DA 3D5XA 4FTKA 2UV2A 2ITPA 3LIJA 4NWMA 4EBVA 3PE2A 2W06A 4QD6A 3KVXA 4YTFA 5HI2A 3OT3A 1XKKA 4O0SA 3OTUA 1WZYA 5M51A 3QRIA 2JFMA 4IW0A 3DDPA 3CXWA 4QP7A 3VHKA 5E92A 1M52A 2R64A 2VGOA 3LLAA 2P0CA 4HPUE 1Q99A 4K9YA 4OTWA 1UWHA 4ANMA 3UZTA 4IZAA 3W2QA 3UO6A 4GK3A 4NW5A 1DI9A 4E5WA 1JNKA 4C61A 4ALUA 5E8TA 2OI4X 1H27A 2OZAB 4M0ZA 1M14A 4L68A 5ITAA 3R1YA 3GOKA 3K3IA 2R0IA 4FKWA 2JC6A 5H8EA 3WOWA 4Q5HA 4BCJA 1Q8YA 4RVLA 4EORA 3PPZA 2J9MA 2GCDA 3PFQA 5C27A 5GZAA 5AR3A 2VNYA 4IB1A 1KE8A 2VWVA 2RFSA 5GINE 2XJ0A 2BROA 1UU9A 3MV5A 1M7NA 3EOCA 2C6IA 4U6RA 5C8NA 5GJGA 2GNIA 3MW1A 3VUKA 1BMKA 4FF8A 4PL5A 3HV7A 4D4VA 3C1XA 5C8KA 2J7TA 3ZO1A 3H10A 2GS6A 4FKOA 4Z7GA 3DXQA 3HRBA 3JY9A 4D9TA 3LKMA 4GW8A 3Q9XA 4WRSA 4WHZA 2OW3A 3FQSA 3QX4A 4M15A 1GNGA 2XVDA 1XBCA 2J0LA 3KRXA 1OL6A 2XCKA 4Y95A 3OW3A 3VIDA 3D5WA 4G6OA 4FZ7A 1H26A 2F2CB 4HGSA 1ZZ2A 2UZEA 5A4LA 3F6XA 5CU0A 5J79A 3KEXA 1Y8YA 2R3PA 1GJOA 4M13A 5E8UA 4B6LA 3ZUVA 3A7GA 2J0KA 2VNWA 4XP2A 3LXPA 4F7JA 4JAIA 3L9MA 4RC2A 5D9HA 5C4KA 3NGAA 5HU3A 3NNWA 4I0RA 5C26A 4LUDA 4FV6A 4O83A 4YZBA 3BZ3A 5FBOA 2ITNA 4RJ3A 3FMHA 4WBOA 4DEIA 5LMKA 1Q24A 4JVGA 2GHGA 1W8CA 2W96B 3AMYA 4YJQA 5DMZA 3RNIA 2VWWA 1DI8A 2BZKB 4FV3A 1JKTA 2C4GA 3TZMA 3RAIA 3ORTA 4YJUA 2A0CX 2BZJA 3VUHA 4FIGA 5A6NA 2JDVA 2X81A 4UX9A 3D7ZA 4IANA 1IRKA 2J0IA 2JLDA 4EJNA 2CCHA 4A9YA 3ZFYA 1E1XA 2OJ9A 4ZLOA 1KUTA 3MYGA 1YXXA 4AGCA 4U9AA 4L8MA 5AA9A 2XRWA 5D7VA 4FVQA 3DLSA 2XEYA 3M11A 2OZAA 3QRKA 2W4JA 3FHRA 4P5QA 4RIYA 3S1HA 2DYLA 1JBPE 2G2HA 2JGZA 3BGPA 4FIHA 4KRCA 3W8LA 4MQ1A 4S31A 4CFUA 4DFZE 3AD6A 4AZFA 5JGAA 4A4LA 2J90A 2J51A 4ZMEA 1YHSA 3BU6A 3FMEA 3NZ0A 3CP9A 3BV3A 4NTSA 5AP2A 4BI1A 4C4GA 4E93A 5J9LA 3CE3A 4K6ZA 5JKGA 1PMNA 3C4ZA 3LFNA 5B2LA 1W0XC 4BIEA 4HVHA 1YDTE 3F7ZA 2BRHA 3MTFA 5B2KA 5EM6A 1KV1A 2ITTA 3IECA 3COKA 3FKLA 2WNTA 2OF4A 2BRMA 2WO6A 3VUMA 3ORLA 2HZNA 3Q9ZA 4GT4A 4IVDA 4FKVA 3IW6A 1M7QA 2R7IA 2C69A 2YIXA 4EOOA 1V0OA 2VD5A 3NUSA 4AW2A 5J8IA 3WE8A 3RHXA 2O64A 3VBQA 3EN6A 4C02A 4MWHA 3P5KA 3JYAA 3QUDA 5D12A 5JFWA 2YWPA 3RPRA 5JRQA 5A3XA 4PPBA 4RC4A 3SW4A 1Q97A 4NJ3A 4C62A 3D5VA 1V0PA 4XEYA 3VBTA 3ZRLA 3P78A 1X8BA 2ERKA 4QTDA 1G8SA 4MF0A 5KKRB 1MRYA 2HZ0A 2X4FA 4MXOA 4IJ9A 4J53A 5BVWA 2EXEA 3E92A 3FUPA 1H01A 1WBWA 1YXUA 3OWKA 3SXSA 2P2HA 3EYHA 5AR8A 4BCHA 4PDYA 5DEYA 2GSFA 4YZDA 3H4JA 4NEUA 4DLJA 1FOTA 4Q2AA 1P5EA 3ANQA 1PF8A 1WVXA 5IPJA 4PTCA 5H9BA 2YZLA 5IQHA 3OXZA 2FO0A 2QCSA 5CT7A 3OBGA 1F5QA 2BCJA 3HVCA 4M66A 3VC4A 4DH5A 5M53A 5M56A 3DKCA 3E62A 2BALA 1P4FA 1YRPA 2A1AB 3C0IA 4QMMA 4N57A 3HL7A 5ETIA 1REJA 3FJQE 4W8DA 3ALOA 4G2FA 4D55A 2H8HA 5K5NA 3LQ3A 4IDVA 3R7EA 1YWRA 3D94A 4FEVA 4QPMA 2ZV8A 3N4UA 4OTQA 3P4KA 4ACMA 3SW7A 3FWQA 4FSRA 3KFAA 4CKJA 1U54B 3PP1A 4LMUA 5A14A 4KNBA 3N4TA 3SQQA 2UZUE 5BVDA 5IKWA 2FSLX 2V0DA 3DJ7A 3RGFA 5C03A 1PXLA 1M2QA 3A8XA 3COHA 4RIXA 4F9WA 4IAFA 2JIIA 3E7VA 4FK6A 4ENXA 3R8MA 2FH9A 2Q0NA 4TKSA 2GTNA 2WB8A 1OGUA 4FSNA 3ZUUA 5CAPA 4YUQA 4BWKA 4UXLA 2R3IA 4V0GA 4USDA 4O82A 2XK9A 4GCJA 2R3HA 3OXTA 5CQWA 5FRIA 3WZEA 1XWSA 2BILB 4XV3A 5EDQA 5HZNA 1ZOGA 3AGLA 3QKKA 4ZTQA 3R7OA 4S34A 3CPBA 2IJMA 4R1YA 2YN8A 3ULZA 3NVKI 4ZLYA 3D0EA 3F3TA 2C6DA 2BKZA 4FEUA 5E8WA 4KB8A 3HYHA 3R21A 4ZXTA 5J7HA 5EHYA 5AWMA 4FKLA 3PJ8A 5F9EA 3U87A 3V5JA 1XQZA 3W2OA 4KBAA 3OROA 4NL0A 3R02A 2R9SA 3EFKA 4TTHB 2OKRA 4Z16A 4J99A 2IZTA 1OKYA 4RFMA 3ALNA 4P90A 5K5XA 1PY5A 4Y73A 3BHVA 2PPQA 4EH3A 2W17A 4OTGA 2BFYA 4PMSA 3W10A 2I40A 4FL3A 1ZYJA 5CAUA 2V55A 3ZEPA 3EN4A 1O9UA 3HEGA 1QL6A 3JVRA 4CCUA 4PV0A 2F7EE 3PSBA 2QU6A 4Y83A 4LG4A 4IM3A 2VWXA 4I23A 4BHNA 2YCFA 3CLYA 4YHFA 3RPSA 3M1SA 4AGDA 5G1XA 2FVDA 4MK0A 5H8GA 4AE9A 3LFEA 4IJPA 3CGFA 2ZDUA 3E7OA 5HIBA 4GU9A 3RCDA 2CGXA 4BBMA 4QQTA 4AFEA 5HBJA 2CN8A 3EFLA 5FTQA 3FLQA 4AN9A 2XK4A 2QONA 2CLXA 3QQKA 3UMXA 2VTRA 4LRJA 4R8QA 4L43A 4A4XA 4O7YA 4XP3A 5L6WL 1SZMA 2PZRA 3R7YA 2YISA 4OTFA 3DK3A 4B7TA 4A7CA 3PRIA 4FSWA 3R9HA 2NNWB 3L8VA 5ANGA 3CJFA 4BTMA 2WOUA 4OBOA 2YM7A 5HBHA 2XIZA 3IONA 4JDHA 5IA2A 4BI0A 3QWKA 3IW4A 2YM4A 5EFQA 3K2LA 4FTUA 1Y6AA 2C5YA 4IH8A 3RTPA 3CY2A 1WVYA 2LGCA 2IPXA 4R5SA 5DN3A 4IB3A 1GOLA 2WD1A 2WQOA 4C3PA 4XV2A 4A9UA 2B9IA 3I7BA 2UW7A 3C4EA 2WIPA 3U9CA 3PA3A 4X2NA 4ARKA 4DN5A 4HW7A 4L7SA 3U4WA 4QTCA 2WU7A 4NIFA 4ZTMA 1OBGA 3FMLA 4BDGA 4FV8A 3ODZX 2LAVA 3R1NA 4IVBA 4WG4A 5EK7A 3G9NA 2I0YA 4I5CA 3BEGA 3QCSA 3CR0A 2IO6A 2QOHA 4TYIA 2Y0AA 5E7RA 2OJIA 3EZVA 3FXXA 4O6EA 2XKFA 4GYGA 4C33A 2W9ZB
chains in the Genus database with same CATH superfamily
3BLHA 4GIIA 3BQRA 3KN5A 3T3VA 4BCOA 4TYHA 5GJDA 1H4LA 3EQDA 3FMKA 3NYOA 4AXAA 2B52A 4F7LA 4DEBA 3ZS5A 2WTKC 3S00A 3PG3A 5H3QA 3NW6A 4FT0A 3ZMMA 2AC5A 5HLPA 4DGLC 3BWJA 1ATPE 3EJ1A 3MJ1A 4F08A 3Q9WA 4F99A 4OAVB 3EZRA 3VO3A 4YJRA 4FMQA 3GBZA 4GG7A 3RBWA 4I92A 2XA4A 1SVEA 4U43A 3UZPA 4BBFA 3HX4A 1WCCA 4OAUC 4D4SA 3D83A 4X3FC 4MYGA 4CFXA 4HZRA 2HENA 4PUZA 3A61A 1UNHA 4O4BB 4C0TA 3QRUA 2XNEA 3GXLA 2CJMA 3W0SA 1OECA 5EW9A 4F78A 5C4LA 2XRUA 4XRLA 2X9FA 3H0ZA 3PIZA 4IADA 4YLJA 5HKMA 4JS8A 1J1BA 4GMYA 5CNOA 4IEBA 5A4CA 4EBWA 1XH7A 1YOLA 3HV3A 4G9CA 5F20A 4A9RA 3NNXA 2CN5A 3SOAA 2X8DA 2C3KA 3WZJA 3W2PA 3MTLA 4Q5EA 3FEGA 2R3NA 2ZDTA 5CX9A 4CKIA 1G8AA 2XARA 4YP8A 2JDSA 2R0UA 4GU6A 2W1IA 3QD3A 4DEDA 4ZOGA 4MF1A 4HGTA 4BHZA 3G33A 5FD2A 4O86A 1OGYA 3V51A 4EOLA 4PX6A 2OXDA 4K2RA 5JGBA 5HO8A 5JSMA 4QP2A 4BTJA 4AN3A 4FOCA 2J5FA 4NK9A 3BRBA 4E4NA 2I0EA 3TJDA 3UVQA 2WZJA 1UU7A 2UW6A 3TKHA 1VYWA 5JMSA 5M09A 4L52A 3PLSA 4ZTRA 4O4CA 2FB8A 3ITZA 5A54A 2NRYA 2VWIA 3HAVA 3AQVA 2BDJA 4NKSA 2OBJA 5BVKA 4GIHA 3DU8A 1J7IA 5AV3A 2HW7A 3R30A 4I1ZA 5B7VA 4KBKA 2W4KA 3W18A 3BU5A 4UMRA 4AF3A 2CKPA 4BB4A 4BVUA 1M17A 3SV0A 2QHMA 5L8LA 5K4JA 4JL9A 5GHVA 2X7GA 2IZRA 3EKNA 3RM6A 3NFGB 4TN6A 4CV8A 3QD0A 4A4OA 4QP4A 3R9RA 5FP6A 1NW1A 1IAJA 4DTAA 2VO3A 2FSTX 4WUNA 2X4ZA 2QOQA 5KMMA 4F1TA 2F7ZE 4WNOA 3FY2A 2QOLA 3V01A 3QUPA 4EUTA 3LXNA 3UO4A 3ORPA 5HIEA 4EQMA 1UNLA 3IQ7A 3LCOA 4C37A 3SXRA 4P4CA 1CDKA 1OL7A 4IHPA 4X2FA 4E6CA 3A4OX 3C5IA 2ZYBA 1RE8A 3C0HA 4QP8A 5DGZA 2QOOA 5EG3A 3C5UA 3G2FA 1Z57A 2QKWB 3QHRA 3L1SA 2Z7QA 2XK8A 4GEOA 4JG6A 4WRGA 4F9BA 2BPMA 4X2GA 3K5UA 5EYMA 3GVUA 2G2FA 4EL9A 4M84A 5EYDA 1H07A 3R0TA 4RIWB 2QOKA 2ERZE 4U44A 3W16A 3RCJA 3TL8A 3LQ5A 5IUIA 3CQUA 2IW6A 4X7QA 1E1VA 4HYSA 3UOJA 4FT7A 2YM5A 4JRVA 5JK3A 2XAOA 2IG7A 3EKKA 4AS0A 5BQ0A 1T46A 3KB7A 3AG9A 5HE2A 4M67A 5CS6A 3PVBA 1OZ1A 3OBJA 3CS9A 4EZ5A 4ITJA 2XALA 1PRYA 4IAKA 5GNKA 3B8RA 3ET7A 1JSTA 2QR7A 3ZOSA 2YM8A 1YHWA 3PXQA 5J5SA 4IB0A 2F4JA 4NTTA 3TI1A 2YIYA 2H96A 1A9UA 2WMAA 3AD5A 3RP9A 3MY0A 4H36A 3BU3A 4U79A 1SYKA 5HG7A 1MRVA 3QU0A 4BCMA 2R3JA 4CKRA 4MQ2A 3WBLA 1RW8A 5M44A 4AXCA 4BTKA 4FSMA 2XNOA 3CGOA 4E8AA 5ETAA 3NUNA 4YNEA 2VWZA 4LFIA 4XV9A 3DB8A 4QNYA 3QTUA 3U6HA 1RQQA 4E4MA 1ZOHA 3A62A 5DR9A 4BDCA 3TUBA 2YJRA 3KRWA 1UU8A 4FSZA 4GK4A 4NM7A 4ZIMA 3OP5A 3VBXA 3M42A 2VAGA 3P23A 3H0YA 3GNIB 1QPDA 4DH1A 4IC8A 4GT3A 3ZCLA 3QCXA 3PA4A 3MFRA 5CNNA 3CSVA 3BQCA 2QC6A 3F5PA 4I21A 4H05A 3FC2A 3GP0A 5B2MA 3NAXA 4FSUA 3GQLA 4O22A 4RSSA 3UPZA 3OY3A 4J7BA 4O21A 5DT4A 2UZTA 3DBDA 3KN6A 5F4NA 4F63A 5I9XA 5M4CA 3MA6A 5CSVA 4HCUA 3W8QA 2XKCA 1TQIA 5I9UA 4L00A 4NT4A 1BL7A 3COMA 2HXLA 4RIWA 4XG3A 4GJ3A 3C13A 3HA8A 4YJVA 4ACDA 1CKIA 3LM0A 3MIYA 3ERKA 1OKWA 3QXPA 4EC9A 5T68A 4C4HA 3V5LA 2UZWE 2BMCA 4LOOA 1OKZA 4HYUA 4EOMA 4D58A 2UVZA 3DJ5A 3EFWA 3IOKA 3DCVA 4JI9A 3RI1A 4DCAA 5IA1A 1XH4A 2X2KA 3COIA 3EWHA 3HP2A 5DEWA 4Z3VA 3OWJA 3R8VA 3DZQA 1UNGA 3GCPA 5HCYA 4FK3A 2RFEA 3E63A 2FSOX 3EQIA 3SXFA 1J7LA 3LVPA 4ANOA 4QQ5A 3LFDA 3OEZA 1OITA 3BYUA 3PXFA 4QMXA 3ULIA 3KRJA 3T9TA 3LOKA 1GAGA 2X9EA 3KXNA 2X0OA 4MAOA 2VUWA 2X8EA 5LOHA 1A06A 3BHUA 3TACA 4BWXA 1LUFA 3ZO2A 4ASEA 4CQGA 4JR7A 2XK3A 4FZAB 2VO0A 3T8OA 2XYNA 5HESA 3ZLXA 3CBLA 4AN2A 3QTWA 3UODA 3DKFA 4H3QA 3FZOA 4UV0A 3ZDIA 4EQCA 4HVIA 5L2SA 4APCA 4R7HA 4DFLA 4NM5A 4D1XA 5HQ0A 3PRFA 4I20A 2HW6A 5KMIA 3SG8A 4CT2A 3E93A 4KS7A 1XH5A 4ZSLA 3ZTXA 5CXHA 5I9ZA 3MS9A 1G5SA 5LVLA 4QYGA 4KBCA 4PMMA 4FEQA 5HTBA 4JMQA 1OIRA 3ZDUA 2Z2WA 5EOLA 3THBA 2O0UA 3R7IA 3V6RA 4Z9LA 4FODA 4RJ6A 2BKKA 4PMTA 4B99A 2CLQA 5AAFA 4IFCA 5HE0A 3ZXTA 4JXFA 3PZEA 5EM5A 3EQPA 2YACA 1ZXEA 5E8ZA 2PMLX 4QMLA 2W0JA 5HG8A 3TNIA 4EK5A 5A4TA 2YJSA 2UZNA 4D5KA 5AR5A 4BR3A 3SHEA 5CF6A 1FBNA 4ZMFA 2WOTA 3O17A 3ZUTA 5CANA 4M0YA 4CG9A 2GPHA 1ZY4A 3QAME 5DRBA 4JG8A 4M69B 4TXCA 4DGGA 2WGJA 3GU4A 3Q53A 4LL5A 2BFXA 2ZM1A 5IZFA 5EW3A 3RAHA 2Z60A 3FHIA 3QTQA 2WQNA 2Y9QA 2ITQA 5CTPA 3V5WA 3WZDA 5DRDA 3VUTA 4FT5A 3R6XA 4DG2E 4WG3A 4O1OA 2X0GA 1OUYA 5EQYA 3PPKA 4FTTA 4RX5A 3KQ7A 3TNWA 3DY7A 3T3UA 2EB3A 3U54A 5HD4A 3BX5A 3KULB 2VTQA 5TF9A 5BVNA 5CU2A 1JVPP 2BTSA 2GU8A 3O50A 3BWFA 4UN0C 5KHWA 4O7VA 5JQ5A 2QOCA 4IX5A 4I0SA 4I6HA 4HYHA 1IG1A 4FRFA 4UZHA 4XOZA 4PNKA 4ZZOA 4D2RA 5L8JA 4HOKA 3ZC5A 5FG8A 1IEPA 3JVSA 4EK8A 3NMUF 3REPA 3QHWA 3DXNA 5FM3A 4WOVA 4QYEA 5J1VA 4I4EA 2OSCA 3UMWA 2XNNA 4LV5A 3SRVB 4N0SA 5DOSA 1Q5KA 3GC9A 1BX6A 4NKAA 2EWAA 2PULA 2IZSA 2BAKA 1J91A 1OPJA 1Q41A 4JT3A 5AUXA 5HOAA 4YTIA 4TWNA 4AP7A 4RWLA 2YCRA 5KBQA 3QXOA 4IX6A 4USFA 4QMYA 2JKKA 5IEVA 2F2UA 5CVFA 4AXEA 3PXZA 5FDXA 5KBRA 2CGWA 2QO2A 5HIDA 5I4NA 3TKUA 2OO8X 5LVOA 4FIFA 2RL5A 3HDNA 3UVRA 4ACHA 5HVKA 5KMOA 2C5OA 4FBXA 5BYZA 5HE3A 5HNGA 4AG8A 2Z02A 2C6OA 4HZSA 4F1OA 1OUKA 3HUBA 5CEQA 3UNJA 3FMJA 4JAJA 4XV1A 4YC6A 3I4BA 1PMVA 3PJ3A 3TZ9A 4BDFA 4IAZA 4MX9A 2WTWA 5AP3A 4BJJB 3FLNC 2R5TA 1WBOA 4FG7A 4USEA 4R78A 3VWAA 1WBVA 4Y72A 1JKLA 5E4HA 1H1RA 3H30A 3OCGA 2YCQA 4AW5A 4FKTA 4KIKA 5FEEA 4BDDA 5IQEA 3GCVA 3OUNB 5GIPE 3QRJA 4QDEA 2OU7A 2XIYA 3NW5A 4L3JA 3VS7A 3E87A 3PUFC 2C6TA 1Y8GA 2QNJA 3QGYA 4GVJA 5BV3A 2ETRA 2X6EA 2W1ZA 3D9VA 4Q9SA 1WMKA 3C4WA 4CCBA 3TNQB 1YKRA 2J4ZA 4DEGA 4FV1A 5CAOA 5L3AA 1Q8TA 3LFFA 3KULA 3DK7A 5CWZA 4BWPA 4QMUA 3EQHA 2PSQA 3A8WA 4IWOA 4DFUA 3MB7A 4LV7A 4PRJA 3QQJA 5DHJA 2O3PA 3MDYA 2PZYA 3F88A 3H3CA 4O1PA 4FEWA 4YC8A 1G3NA 3MN3A 4E73A 4R7BA 4FYNA 1OBDA 3FQEA 4J8NA 3KA0A 4BTFA 2ZV9A 2I6LA 2W1EA 1OL2A 4GG5A 4AZEA 2OH4A 2AYPA 4EH6A 5M4UA 4CLIA 5HG9A 3WZUA 2A19B 2GNHA 3DAJA 5AUTA 1KE5A 4HNIA 3SRVA 2CHLA 3VUIA 2R4BA 3QX2A 5KHXA 3R7GA 2VO6A 5IDPA 1H0WA 2GQRA 4MTAA 4ZSGA 2SRCA 1FQ1B 4DITA 2HWOA 3EQFA 4Z55A 1ZMVA 4YZ9A 3W2SA 3IOPA 3OY1A 4H3PA 3C51A 3UE4A 4DFYA 4DGNA 3QTSA 3DOGA 3PUPA 4FTAA 3DPKA 3PG1A 2JDRA 4L44A 4UALA 3DA6A 5EM8A 5J95A 4DHZA 4BCFA 2YDKA 1YI6A 2GS7A 3FSKA 3ROYA 4BCIA 4KIOA 4M68A 4O7WA 4BIDA 3KKVA 4S2ZA 3EQBA 4LYNA 5LJJA 4UYNA 5KE0A 5D10A 2GHLA 3VUDA 4RZWA 4HCVA 3HAMA 3NIZA 3MJ2A 3ANRA 4FOBA 3R7VA 4BJJA 1VZOA 2HXQA 2JDTA 2OXXA 2QKRA 4A9SA 2ZFYA 4NCTA 3SGCA 5LCKA 5D11A 4G3EA 3ODYX 5IMXA 4A9TA 1FINA 5CU4A 5DLSA 3EQRA 5J9YA 3QD2B 5ANDA 3AT2A 4KKHA 3RZBA 4OTIA 5CAVA 4W4YA 5HE1A 2Z7RA 4C4EA 5AV0A 2UW0A 4MD7E 4L3LA 4Z7HA 1ZOEA 2BR1A 3OCBA 4ZJVA 3W0NA 4YC3A 1JAMA 1BYGA 1PW2A 1R78A 2BIKB 3I7CA 3O96A 4AW1A 5L8KA 5M57A 3C0GA 3UG2A 3OS3A 1LEWA 1H08A 5K3YA 4CTCA 1W2FA 3IO7A 3R7UA 4C36A 1PMEA 4CFFA 4P2KA 2XK7A 2WTDA 3LCKA 4ZTLA 4DTKA 4EK3A 1STCE 4CXAA 5LVNA 3D7TB 5DBXA 3E88A 4KRDA 3U9NA 3CTHA 4CQEA 2ITWA 2CCIA 4XMOA 5IEYA 3QGWA 3IW7A 2NO3A 3W2RA 5BNJA 2WMTA 1R3CA 4YR8A 4FG9A 2WIHA 3RZFA 3A7JA 3BIZA 1R0PA 1WBPA 5ACBC 2C30A 4D4YA 3OT8A 1PXMA 3AC3A 4FIIA 3QQUA 3RPYA 4RJ4A 3ZH8A 5LMKC 4FTOA 4MXXA 2Y7JA 1H1PA 2UW9A 4IAIA 2A4LA 4OBPA 4R3CA 4IE9A 2WTKB 5CU3A 4BGQA 4O7RA 4FV2A 3IPHA 3IS5A 5AP5A 3ENMA 4JNWA 1SNUA 2DS1A 2F9GA 2X7OA 3VRYA 4ASZA 4EC8A 2H9VA 1JOWB 3KCKA 4C3FA 3RPVA 5DR2A 3PXRA 4NFNA 3CEKA 2C3IB 4JLCA 3D2KA 4BCPA 3WYXA 4QP1A 2BZIB 2JBPA 1GZOA 1EH4A 4E6QA 3CY3A 3VBVA 3LHJA 4X3FB 4AACA 4FUYA 3Q6WA 1PXOA 3TN8A 3UYTA 2UVYA 3PJCA 2R2PA 4D0XA 4YSMA 4JDKA 3KCFA 3NW7A 4F9YA 4BIBA 1K3AA 4FV4A 2OIQA 4ERWA 4HGEA 3VQUA 1U59A 3C7QA 3TV7A 2C3LA 3RK5A 3RAWA 2R3LA 3DQXA 3VJOA 3BLQA 4B9DA 4J97A 3BEAA 5FEDA 3MFSA 5LVPA 3SG9A 1ZMUA 3TTJA 4RVKA 1PXPA 5CEMA 4PTGA 1ERKA 3PIYA 2VX1A 3ZZEA 4BC6A 1NVRA 4FG8A 3BHHA 3BPRA 4W4WA 2PZPA 1AGWA 3I0QA 3C50A 3MH2A 4CZTA 2IW9A 1Q62A 4PDSA 1W84A 4EWHA 4FSYA 4L45A 2X39A 3M2WA 4RRVA 2VTLA 5H2UA 4ACGA 5KCVA 2PWLA 3LM5A 2IVSA 4N6YA 2ZVAA 3O51A 4AA0A 4HJOA 4IC7A 3IGGA 3TV4A 4D0WA 3EN7A 4FTLA 3QQFA 2I0VA 4J1RA 3ZFXA 4EOPA 4JBVA 3I5NA 4MXZA 4W4XA 3E8DA 4CT1A 4MBIA 2AEGA 1CKJA 1YWNA 4F70A 4RQVA 5I3OA 5IH5A 4HVSA 1CTPE 4FUXA 2XIKA 4V04A 5EI6A 5HX6A 4NM0A 3PXYA 2PUNA 2UW8A 1PJKA 2WMSA 5JQ8A 1CM8A 4GUBA 4MUQA 5M08A 2ONLA 2VTPA 3H9RA 4D2TA 3K54A 3BL7A 3Q52A 3VONA 4MBLA 4BYIA 2WXVA 3DKGA 5EQPA 3PVWA 3A7FA 3RWQA 3FLSA 4W9XA 4XG2A 1BL6A 5AIKA 2A27A 1OM1A 4EONA 3CKWA 2OIBA 4HVGA 2C5NA 3IDCA 3MPAA 5GJFA 4FVPA 2XK6A 4ANLA 2QOFA 3GU5A 4I4FA 1U54A 3GQIA 4CFMA 4FA2A 1YWVA 4QP3A 5FXSA 4CZUA 3SX9A 1W83A 3TDVA 5AUUA 4GRBA 3ZSHA 4AOJA 1BLXA 1WBSA 3QCQA 3VS4A 3P79A 5IA3A 1W98A 1KSWA 4F6SA 2PY3A 4YU2A 5CSXA 1QPCA 4DEHA 4BDHA 4DGMA 3NAYA 5TT7A 2OGVA 3R01A 3VF9A 4EZ3A 4P5ZA 3RINA 3CCNA 3B2WA 3UVPA 4QQCA 4KWPA 2R3GA 2HOGA 4PPAA 4ANNA 4E5BA 3NWWA 3FE3A 5E8VA 4K11A 4FSTA 3BLRA 4UWCA 2C3JA 3E8CA 4RX8A 3ZRMA 4D4RA 4FIEA 1J1CA 4UMPA 3F82A 4J96A 2R3KA 4FKGA 2OWBA 3UIUA 3GU8A 4OGRA 1M2RA 3FLZA 3MPTA 4GVAA 4WUAA 3DDQA 2R3QA 3U6IA 3NUXA 3R04A 2FA2A 2YLEA 4QTEA 2AQXA 2PVMA 4KS8A 3UOLA 1I09A 2C47A 5HVJA 3AXWA 3V04A 3FXZA 3R22A 3AC4A 4ZTHA 5J9ZA 3MESA 2E9NA 4HGLA 3UJGA 3S0OA 3N9XA 4F7NA 3DQWA 3LXKA 4ITIA 1H00A 3NLBA 4XG9A 4G1WA 1F3MC 3CD8A 4MNFA 3QKMA 2XJ2A 5D41A 3LPBA 3WE4A 5JZJA 3QZHA 4X6QC 4DT9A 4O7LA 4DYMA 5DA3A 2RFNA 2VX0A 3K5VA 4RJ5A 3DFCB 1WBTA 4GKIA 4G3FA 3S95A 1OIUA 2FYSA 4DLIA 2WMBA 5BVOA 1TQPA 2G15A 3POZA 1JSUA 5EI2A 5AP1A 3GCSA 3ELJA 3NCZA 2E9VA 1KWPA 2ZMDA 2JKQA 4EYMA 2EUFB 4BDJA 4YO4A 5IUGA 4ID7A 4GK2A 2B1PA 3F2RA 3BYOA 4M7IA 4EOSA 4MXAA 2XM8A 3QF9A 3QQHA 3HECA 4CNHA 4X21A 4WNMA 4LGGA 5EDRA 1NY3A 4DFXE 3JY0A 4LMNA 4FKPA 5HNBA 3RHKA 3UC3A 1Y57A 3P1AA 3DV3A 3QLFA 3R2BA 4FKJA 4OBQA 3UP7A 4AW0A 4B0GA 1K9AA 4FVRA 4BFMA 4EH2A 3ZC6A 4ONAA 2YFXA 3E64A 5DPVA 4K1BA 2W1CA 4XNEA 5CF8A 5L6PA 4D1ZA 1V0BA 3GI3A 1W2DA 3ORXA 5HCXA 4NW6A 5HU9A 4RX7A 5I3RA 3LMHA 4N70A 3LW0A 5I9YA 4RFYA 5DNRA 1Z9XA 2JITA 3A2CA 4GFOA 2C5VA 2QURA 2E9PA 2J5EA 2C0IA 3ORMA 4ANBA 1NVSA 5IQGA 2W05A 4FNYA 3Q4TA 3R00A 4OR5A 3TWJA 3UPXA 1ST0A 3ATTA 5IQFA 4JOAA 3PY0A 5B0XA 3PY1A 5IG1A 2F49A 2HZ4A 4FNWA 4DCEA 5EKNA 4AAAA 4ZSJA 2G01A 2DWBA 4BKZA 4D1SA 2QOIA 5K4IA 3R9OA 3QYZA 2P3GX 3NYVA 3BYSA 2C6LA 4I5HA 4QMOA 3RPOA 4CVAA 5M07A 4IIRA 4I94A 5CYIA 4UXQA 3DKOA 3IGOA 1H24A 4LDTA 1KE9A 2X0QA 2PVJA 3ZSGA 4AZVA 3NEWA 4AQKA 2GHMA 4EUUA 1GIHA 5M4IA 2XNBA 4BICA 3NS9A 3VJNA 2YM3A 3KF7A 3HZTA 5IA4A 2PE1A 1HOWA 3FYJX 3FXWA 4YHTA 3N4VA 5CEKA 3PWDA 4DDIA 5E9EA 3O5AA 4B4LA 4H1MA 4I3ZA 2PVFA 4IZYA 4X0MA 1Q4LA 3NSZA 4YJPA 3L8XA 4G9RA 2VO7A 3W0MA 5C1QB 2PK9A 4L6QA 2XM9A 2OJFE 2X2MA 4W8EA 2FGIA 1YOJA 2OF2A 3IDPA 5FGKA 3K3JA 1LEZA 4MWIA 3UGCA 5HO7A 2CGUA 4JIKA 4IFGA 5HBEA 5ANEA 1OPKA 3P9JA 1OMWA 5BUEA 3R71A 2CKQA 1S9JA 3NVMB 3A99A 1YDSE 5CXZA 5JZNA 3MH3A 4RWKA 1TQMA 3U51A 3R73A 3UOKA 1Q8UA 4FTQA 3JPVA 4IWDA 4F7SA 3FLYA 4BCGA 1FMOE 2PMIA 4EH9A 3HGKA 4EZ7A 5KO1A 2WQBA 3LJ2A 4AT5A 3OMVA 2UZOA 3QZGA 5I9VA 5AUWA 1UVRA 4V05A 3UQCA 5H8BA 4JBPA 3WI6A 4D2PA 1L8TA 4C8BA 2RIOA 3SDJA 4KKGA 1YI4A 2OLCA 4RC3A 2VTTA 3GEQA 3MFUA 3PY3A 4ZK5A 2O8YA 4C2VA 1ZWSA 4XJ0A 4FGRA 3I1AA 3I6WA 3QWJA 4FKUA 1DAYA 2XBAA 3TIZA 5AA8A 2WQMA 4DEEA 3F5XA 4EOIA 4GJ2A 5EI8A 4UMUA 5FTOA 5EYCA 4JQEA 5CALA 3CPCA 4PP9A 4DHFA 3KREA 3BCEA 4GFGA 4EHGA 3TEIA 3ACJA 3OOMA 4I6BA 5LXMA 3GB2A 3A7HA 3TZ8A 5ETFA 5EOBA 5FTGA 5HVYA 3LMGA 5A6OA 4G3CA 3OUKA 4RJ8A 2R3RA 3EIDA 3G6HA 4L7FA 4F0IA 3VS0A 3GENA 1LR4A 4M14A 4PNIA 2YM6A 2YWVA 3V8SA 1ZAOA 5JT2A 5AR4A 2VTIA 3F7WA 5K0KA 5DYJA 3KXHA 2JD5A 2QG5A 2VTSA 3HMIA 3OCSA 5FLFA 3W0OA 4R3RA 3UBDA 3LFAA 4O84A 1K2PA 3MVMA 5HCZA 2PE0A 4FZDB 5CEIA 4AUAA 2F7XE 4XP0A 3WYYA 4QMQA 3R28A 2HELA 2Y8OA 4ZY5A 2PU8A 4ZSAA 4F6UA 1OI9A 2VTJA 1VR2A 1QPEA 4QEBA 1MUOA 2VTHA 2GNLA 3OFMA 3FL4A 3DAKA 4LGHA 5ANJA 1H28A 3VQHA 2W5HA 1TVOA 2XJ1A 3G6GA 4LI5A 3SC1A 4ZEGA 4AZSA 4EYJA 3TUDA 3O71A 3NUAA 1ZYCA 3QTRA 2YIQA 3BYMA 3R63A 4YJSA 3UP2A 5EKOA 5HNIX 3D2IA 3LJ1A 2EXCX 3HMMA 3Q96A 1FVVA 4OT6A 5CZIA 4DAWA 1R0EA 1XH9A 4XYFA 2X1NA 3O7LD 3WIKA 4BN1A 2BUJA 4R1VA 1FMKA 5E1EA 1XHAA 5J5TA 3MGYA 4FL1A 4F6WA 4X2KA 2ZB1A 5DIAA 3VULA 2YHVA 5A46A 2Y4IC 3AMAA 5IISA 2EVAA 2JKOA 3F66A 3MH1A 4GT5A 2JAVA 1OPLA 3F3VA 2WKMA 4FGBA 4RQKA 4BCQA 3QQLA 4QQJA 1SVGA 5K9IA 1Q8ZA 3G0EA 4JIAA 1VYZA 4PDOA 4W9WA 4Y46A 4ORKA 2BIYA 5BMSA 3GC0A 1OVEA 3R9NA 4CGAA 2B9JA 4DGOA 2JDOA 2YAKA 5HTCA 4YPSA 5A4EA 3EHAA 3RAKA 4AZTA 4FNZA 4AGWA 4BI2A 4TYEA 3KK8A 3G0FA 1FPUA 4R5YA 3NNVA 4EI4A 4WG5A 4WT6A 1QPJA 3Q60A 3W0QA 3VS6A 4D9UA 5IQAA 3DTCA 4DT8A 2OICA 2CDZA 3P5JC 3V5QA 4BKJA 2V62A 4CZYB 4BCKA 3FI4A 3Q32A 3P08A 3P7AA 4J95A 4U3YA 2GDOA 4O0XA 3R8PA 4E26A 4XG7A 5GZ9A 5EHOA 2H34A 1NT2A 3RK9A 2P2IA 4NH1A 1BKXA 1YVJA 5IQIA 4WNPA 3LFCA 1VEBA 3AKJA 4IM0A 5DFPA 4ZAUA 1JLUE 3QTIA 4IACA 4IDTA 4RX9A 3O23A 2UW5A 4ASXA 3GCQA 4MEDA 1URCA 2QODA 2ZMCA 3CJGA 5T6KA 2R3FA 4JDIA 2J2IB 1ZLTA 3OOGA 1SNXA 3RJCA 2QQ7A 4BDEA 5KMNA 2QI8A 5L2WA 2GNJA 3OVVA 4BDIA 4OT5A 2UZVA 3WARA 4D5HA 2XH5A 3JR1A 3HP5A 2B55A 4G31A 3VN9A 5EW8A 2QVSE 4I0TA 1OIQA 4JDJA 3ZXZA 2F57A 3FYKX 4RA5A 4DG0E 4FTIA 2RG5A 3P7BA 4JBOA 3I6UA 1J7UA 3B8QA 3LFQA 3QUEA 1I44A 2RKUA 3TXOA 4E20A 3GU7A 4O38A 2YITA 2EU9A 4MKCA 4O6LA 4MBJA 3RM7A 4EJ7A 3WF7A 4L67A 2VZ6A 4TL0A 2Y6MA 4G17A 2IN6A 2VTAA 1CMKE 4E6AA 3ETAA 2BAJA 2XP2A 4L01A 4P7EA 2KULA 3DBFA 4UB7A 4ZTNA 2WTJA 4UYAA 2C5XA 3QZFA 5LCJA 1GIIA 3FI2A 4FYOA 4ACCA 4YJNA 3V8WA 3EQGA 3O0GA 4Y85A 3UQGA 5A9UA 1SMHA 2WTVA 4L46A 5FUTA 4NUSA 5EH0A 3FMNA 3SA0A 5HD7A 2KTYA 1RDQE 1BI7A 3MH0A 1H1SA 1WAKA 4E7WA 4ZZMA 2ZM3A 3G90X 2GS2A 4O2PA 3KMUA 2RFDA 4DG3E 2OFVA 4E3CA 3CC6A 1ZY5A 4FV7A 4XCUA 5CI7A 2GFCA 5I9WA 2ETMA 3UTOA 4HPTE 4CFNA 4EHVA 1Z5MA 3MB6A 4CYIA 3F2AA 4IMYA 1OIYA 2W5BA 4JX3A 3UNKA 2IZUA 3F3WA 3EN5A 3KC3A 4NU1A 2PVHA 2CKEA 4FV0A 3VS5A 4FSQA 4BL1A 2YEXA 3KIOC 3UYSA 4FI1A 5GIOE 2W7XA 1W2CA 4AX8A 3VS3A 5LWMA 2FSMX 5AUZA 5FDPA 3R9DA 2JEDA 5IH4A 4OTRA 3ZM9A 4TPTA 4EWQA 2X7FA 3OW4A 4I22A 3R8ZA 3HDMA 3PYYA 2PVRA 3MBLA 4YHJA 5HEZA 4CSVA 3ZO4A 3HMPA 3W55A 5HICA 2WMQA 2XKEA 4O0VA 2W99B 3NUUA 3HMNA 3B2TA