1SVHA

Crystal structure of protein kinase a in complex with azepane derivative 8
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
337
structure length
335
Chain Sequence
SVKEFLAKAKEDFLKKWENPAQNTAHLDQFERIKTLGTGSFGRVMLVKHMETGNHYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMVMEYVPGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGFAKRVKGRTWLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFATTDWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEEEIRVINEKCGKEFSEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords cAMP-dependent protein kinase, alpha-catalytic subunit
publication title Structure-based optimization of novel azepane derivatives as PKB inhibitors
pubmed doi rcsb
source organism Bos taurus
molecule tags Transferase
total genus 106
structure length 335
sequence length 337
ec nomenclature ec 2.7.11.11: cAMP-dependent protein kinase.
pdb deposition date 2004-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 1svhA01
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 1svhA02
3BWJA 3U6JA 4EYJA 4CT2A 3FLSA 3MH3A 3OTVA 5D7VA 4D2SA 3ORNA 4IB1A 3LFSA 2C3JA 3LAUA 5EM6A 3KXZA 3QQFA 4NM5A 2VV9A 2HK5A 2RSVA 3Q96A 3EFLA 3FZPA 5IUIA 1HCKA 2WQOA 4BKJA 1IA9A 4XLVA 4L68A 3ZDIA 4QOXA 2ZB1A 5J79A 5IH6A 4LGHA 4C58A 3V01A 4Q5EA 4QQTA 3OC1A 4PP9A 5LVLA 4BBEA 3BE9A 3LQ5A 1OKZA 3QQHA 4F6SA 3ZSIA 3K3IA 3QCSA 4TT7A 1PXNA 4BCGA 3A60A 4EBVA 3HMPA 5B2MA 2ZOQA 4RFMA 2R4BA 3EQPA 3ITZA 3LM0A 1BUHA 3FQEA 4MWHA 4MK0A 2WD1A 4M13A 3ZDUA 3VJOA 2BROA 4JQ7A 4DGGA 4GJ3A 4H58A 2C30A 5KCVA 2XNMA 2WO6A 4AGDA 3CKWA 1WFCA 4MF1A 4KWPA 2FUMA 1BMKA 4BCOA 2Y9QA 2O8YA 4G6NA 2YM3A 4NFNA 2R7BA 5LQFA 3TDVA 5HLWA 4AX8A 3TNPC 4JBQA 3L9MA 3EFJA 3NDMA 5EQYA 4YPSA 4OTFA 2C6EA 5E8VA 4HCVA 2VTJA 5DT4A 4LL0A 5EH0A 2WOUA 2E9OA 4GYIA 2GQGA 3JY0A 3OWLA 3O8TA 2XNOA 4D2PA 2PU8A 4L45A 4KS8A 4NK9A 3TN8A 2J5FA 3RNIA 3LLTA 3RKBA 3TKHA 4ALUA 4AFEA 2Q83A 4ENYA 2YLEA 4U45A 3VS1A 3EQDA 2IZRA 4MD7E 4P5ZA 1GIHA 2UZBA 3UC4A 3ZTXA 2X6EA 2ZM4A 5GINE 4F9CA 4TYEA 1YDRE 3QD4A 4YSMA 3BKBA 3F5UA 3NNVA 2B7AA 3R7YA 4JVGA 3RWQA 1FBNA 2UUEA 1TVOA 4QTAA 5LWNA 5K5NA 4BCHA 1H1PA 1VEBA 3L8PA 3HMNA 4XH6A 1Q41A 3F9NA 3HV5A 2WAJA 3ORTA 3VBWA 4O0YA 3GGFA 2IWIA 2P33A 4YJRA 5AM7A 4OTGA 4Y5HA 5F4NA 3K5UA 4QPSA 4YZ9A 2ZM3A 4DFUA 1FMKA 2W4JA 5HLPA 1AGWA 4G16A 3VUDA 4FNYA 1KE5A 5HBEA 4FVRA 4QT1A 2XZSA 4D1SA 2C3LA 3DKGA 3GU5A 4J8MA 3D5UA 5E8WA 3VS3A 4II5A 1UVRA 1WVXA 3GC7A 4WG3A 4WT6A 3ZRLA 2XYNA 2GNIA 3CGFA 3KN5A 4IAFA 4O6EA 2WTKC 1IEPA 4P2KA 1HCLA 4PPAA 5L6PA 5IQBA 4HZRA 1XH7A 4L7SA 2XNBA 3MH1A 3MSSA 5HVKA 2PE1A 3HV6A 4PRJA 3MFUA 4R1VA 2JKOA 1STCE 3GU8A 1EH4A 5M4IA 3UZRA 1OZ1A 3QKMA 2IVSA 4NWMA 3PA5A 5J95A 4O7WA 4Q9SA 2CN8A 4H3QA 2CPKE 2VRXA 4NCTC 4NZWB 4DGMA 2OBJA 3E8DA 4IZ7A 2W17A 2FA2A 3DBFA 3OXIA 1TKIA 5BUIA 2W5AA 4LUEA 1K3AA 5KMMA 4BTFA 5HX8A 3VJNA 3DS6A 3DA6A 3GCUA 4H39A 1KE8A 3RK5A 3QQLA 1QPJA 4CMTA 3EYHA 2GS6A 1B6CB 3WI6A 5H8EA 3NW7A 3LXNA 3AGLA 3NUUA 5CWZA 1OL6A 5AP7A 3V8WA 2JFMA 5D9HA 2W1DA 2A0CX 4QO9A 3SC1A 2WKMA 5AUTA 4IZYA 4FTTA 3FC2A 4QMTA 2XB7A 1S9JA 3M2WA 2PVJA 4LFIA 4MD9E 4FV4A 4S34A 4FGBA 4ZLZA 3V8SA 4JQEA 4QYGA 2ITOA 2C5VA 4AT4A 1YXUA 4FIHA 4PPCA 3C0HA 4NW5A 1U4DA 5CTPA 4IANA 1LEWA 3F7ZA 5FP5A 3R9OA 4A07A 4GKIA 4FIEA 3AD5A 3D7ZA 4GFOA 1YDSE 2J2IB 1JSVA 5AR3A 4CYIA 2VTMA 5LMKC 3FMMA 3NUXA 3UJGA 3PXRA 2BCJA 5D41A 2VWVA 4HVIA 4Y83A 2YLFA 3LJ0A 4S30A 4JDIA 3GU6A 2J4ZA 4AN2A 2E9PA 4FZFB 4RC4A 3EHAA 4DGLC 2X2MA 4F08A 3QZIA 3TZ7A 2GQRA 2PL0A 2WIPA 3ENMA 3V5PA 5I5ZA 4LM5A 5CF4A 4X2KA 4NJ3A 1KE6A 4C3PA 4A9YA 3UOHA 3BBWA 2WU6A 2B55A 3IK3A 3QQGA 2NNWB 5AEPA 3NVKI 5M57A 1XH5A 1GZKA 2QU5A 1YW2A 2VGPA 2GFSA 2UZVA 5HU9A 5KKRC 5HEZA 3KVXA 2W1FA 4QMZA 4OT5A 4BDEA 4S2ZA 4C4EA 2PVYA 1M7QA 5CYIA 4DFNA 4DA5A 1OPJA 2QOBA 3D4QA 3VS4A 3QTUA 1OKWA 2IW6A 3SG9A 4XNEA 3HP5A 3UNJA 4GK3A 3AC1A 2ETKA 4FKOA 2W96B 4U43A 3HZTA 2UW7A 4JAIA 4LV8A 2HAKA 3R8LA 1I09A 2OF2A 4QMQA 1KUTA 4CZTA 4BN1A 3VW6A 2R3JA 2W06A 4JI9A 1KSWA 5L8KA 4MWIA 2QO2A 4FL3A 4V0GB 2IVTA 2XM9A 4I0RA 3VBXA 1U5QA 4BHZA 3R01A 4FYNA 4HOKA 2ZVAA 4X0MA 3ZO2A 3FBVA 4JDJA 5GZ9A 4PWNA 5AUWA 3AC2A 3QLFA 3R8PA 3BWFA 3CGOA 2KTYA 4D2WA 2RFNA 3KMMA 5HVJA 3PA4A 3PLAE 2OIQA 4X2FA 3UIUA 3OEFX 1WVWA 3LXLA 3U9CA 4NEUA 4QTBA 4BL1A 3HNGA 2W9ZB 5ACKA 2C5YA 2YEXA 4FTKA 4O27B 4UXQA 2OH4A 3CS9A 4ZSLA 5AR4A 4A9RA 3PY0A 4FKVA 4E20A 5I9VA 5T68A 3FMKA 2W5HA 1ZXEA 4EH8A 3MB7A 4BBFA 5GJGA 4E5BA 4O7ZA 3GFWA 3ZC5A 3UPZA 2O2UA 3UO5A 4M67A 3QALE 4JG6A 4QPAA 4EOPA 2ITVA 1GIIA 1GY3A 1YI3A 4DFBA 3DQWA 3FKLA 3EQRA 3KGAA 3OFMA 4YNEA 3BIZA 4JBVA 3FKOA 4FG8A 4N57A 3QD0A 3V6RA 4MBLA 4RJ3A 3IECA 3EJ1A 4B9DA 3CPBA 2YHVA 4YJVA 2OFVA 2GNGA 1YXVA 2P2HA 3DOGA 3QLGA 4FSMA 4UWYA 3WZJA 2R9SA 2X8DA 1KE9A 2WEVA 4I24A 4KKEA 2E9VA 3C5UA 3DTWA 4R8QA 3UG1A 3ZRKA 5AWMA 4I6BA 3W8LA 1JOWB 4XRJA 3ZBFA 4DEAA 1YWRA 3HX4A 3VIDA 4IVCA 1ND4A 4D4YA 3FY0A 5LVMA 4I3ZA 1SM2A 3CSVA 2UVZA 3DBQA 2J0LA 4KRCA 3FI3A 3KRLA 1OL2A 2BALA 3DCVA 3ORPA 3ULZA 1PW2A 3QC4A 3L9LA 5IF1A 4E4XA 4I1ZA 4RZWA 3A7FA 3AXWA 3DBCA 3R2YA 4DEHA 2XCHA 4IJ9A 5J8IA 4FT9A 5BVNA 3AC5A 2VX1A 4MXAA 5J5TA 5GHVA 3R7IA 4XCUA 5KMKA 4S33A 3UDBA 2QOQA 3DLZA 3CIKA 4JJRA 1NVRA 2XKCA 2QR7A 3DU8A 2R2PA 2R3NA 4TYGA 4GFMA 4ZIMA 2C1AA 3FHIA 4IC7A 4IX6A 4AE9A 4QMYA 3PG1A 2FSLX 4EQMA 2FB8A 5CVGA 5JFXA 3DT1A 3RWPA 4MH7A 4EK3A 3EFKA 4LMNA 4R3RA 3UOLA 2YWVA 1P2AA 5BQ0A 2ETMA 5C26A 2PZPA 1E1XA 1YHSA 3PWYA 5DA3A 3R04A 3ELJA 3I81A 4L6QA 2GFCA 4Y5QA 3T3UA 4MD8E 4IQ6A 4MKCA 3R1NA 5AP0A 2E9UA 4B8LA 4GKHA 4AOJA 4JBPA 4IVBA 5IQAA 5LMAA 4C02A 4ZTHA 3OY3A 4DCEA 5E8YA 4L52A 4EQUA 4EH7A 5AR2A 2SRCA 4V01A 5ITAA 4ZLOA 4TZRA 2BDJA 4G31A 4J1RA 4U41A 4HYIA 2J0IA 4XOYA 3MIAA 5CQUA 5ANJA 3EN4A 4FKLA 4XLIA 4CZYB 2ZB0A 3DDQA 4ZS4A 4FV9A 3KK9A 4RVLA 5HCZA 5FRIA 1YQJA 4RVMA 4YC3A 4EOIA 3AQVA 2XBJA 3I7BA 4LOOA 5BVEA 3ZO3A 5J1WA 4FA2A 4HJOA 3EN6A 3DJ5A 3ENHA 4YHTA 3AD6A 1U54B 4QYEA 3DNEA 4R1YA 5E9EA 2FO0A 2XEYA 3R2BA 5KX8A 2DWBA 3R7VA 1YKRA 5C8MA 5K0XA 5KMNA 2ETRA 4UYNA 2PE0A 3MVLA 3L1SA 4GK4A 3ZOSA 4BDDA 2F49A 1Q8TA 3GI3A 5EHOA 1IAJA 5E90A 1VYZA 4PTCA 3DTCA 2XYUA 4AUAA 3QTRA 2H96A 1WBOA 3WF5A 5DR9A 3FYJX 4PDPA 2X81A 3BRBA 2AUHA 4O38A 4IX4A 4CRSA 5JT2A 4W8DA 3VQHA 4ZMFA 5BX0A 1L3RE 4EH5A 3II5A 5HHWA 5L2WA 4DBNA 5IUHA 2O0UA 3LOKA 3QYWA 3CPCA 3CY2A 1MQ4A 2R64A 4KD1A 4L9IA 5CI6A 5B2KA 4MBJA 5HG8A 4BTKA 5H3QA 1GJOA 4TPTA 4J53A 5GZ8A 2CMWA 4GMYA 4EI4A 5FLFA 1NXKA 4U3ZA 4IE9A 2B1PA 3UNZA 3H0ZA 4E4LA 3U54A 2PYWA 2Z60A 3FKNA 2VTIA 3GQIA 3ORIA 3R1SA 4EQCA 4DCAA 1CTPE 1ZYJA 3IDBA 2RG5A 4F70A 4AG8A 3EQIA 2OJIA 3H9FA 3MTFA 3MVHA 3R22A 5FBNC 3U4UA 4YMJA 5DNRA 4O7LA 2ZV7A 4TYHA 4MBIA 4N6YA 4FKJA 5IEVA 1H1WA 2BRHA 2YN8A 2CGVA 3MY1A 3F3UA 5HGIA 5BPYA 4FNWA 4KBKA 4RJ5A 5HG7A 4QYYA 1URWA 3WYXA 4J8NA 5KMOA 1Q3DA 3MY5A 5AR5A 4IDTA 4X2GA 3ZUTA 3RAIA 4CKJA 1I44A 1AD5A 5AV4A 3GXLA 2G2HA 3NCZA 4F63A 1H4LA 3QCQA 4L00A 3ZH8A 3E8CA 1Z9XA 2XKDA 4NT4A 2VWXA 4BB4A 4FKSA 4FK3A 3D9VA 3QTQA 4IJPA 2W1HA 5HO6A 4XHKB 4ZTMA 3PXYA 2UW4A 2YISA 3GCSA 4BWKA 5L4QA 5EDRA 3FMDA 3ROYA 1UNLA 4I6HA 4JDKA 2Y4IB 1FINA 1YWVA 2GNJA 3ALOA 2H9VA 4HPTE 3SAYA 2G15A 1ZMVA 2VWZA 3E3PA 3ETAA 2R3PA 3QUEA 2C3KA 4GEOA 4UMTA 4UZDA 3TJCA 4D2TA 4E3CA 4EZ7A 5JRQA 3N4TA 2WPAA 2FSTX 3EQFA 4MAOA 3BEGA 4Q2AA 3R1YA 4OAUC 1Q8WA 4FUXA 4M69B 5KE0A 5TF9A 4PQNA 5E1SA 4UMUA 5LVNA 4DTKA 1LPUA 1JNKA 3V3VA 4HGEA 5HE1A 4TY1A 2JD5A 4QMWA 1GIJA 5KHWA 3Q2MA 3UPXA 4XX9A 3RGFA 5J7BA 4FTIA 4C4IA 5K9IA 1YI4A 2ONLC 2HWPA 5FP6A 2YFXA 4D2VA 3MW1A 2Z7LA 5JGBA 3N4UA 2VTQA 2YDIA 1FPUA 2WNTA 3Q4CA 3NX8A 3R9HA 3CY3A 4QP6A 1WBSA 4ASDA 2NRUA 1YRPA 2V22A 4XP3A 5F1ZA 3WBLA 5CASA 2R3KA 1A9UA 4HNFA 2OGVA 5JFWA 4G5JA 2A1AB 4YC6A 4J95A 1O6LA 1YOJA 5AAGA 3TDWA 4PY1A 3JVSA 4JIAA 4BICA 3Q4TA 4EBWA 3OD6X 2HW7A 3E64A 2J51A 5FUTA 1G5SA 3SOCA 5IH5A 5JMSA 3QUPA 3RI1A 4X3FA 3RJCA 5A46A 1M17A 3LXKA 2WMSA 2IVVA 2VO7A 2XM8A 2XNNA 5BVFA 3JR1A 4D28A 4RX9A 2XRWA 2CNQA 4GK2A 2G2IA 3ORMA 4YPDA 4GG5A 3D2IA 3R83A 4FTQA 5A4EA 3MA3A 4MHAA 3ZSGA 2WTDA 2IG7A 2FYSA 4JX7A 3LE6A 4DAWA 1LR4A 4NIFB 4K33A 4BKYA 1XJDA 3NGAA 3I79A 3FL5A 5M4FA 1JQHA 1ZOEA 3MVMA 5AV1A 2X6DA 4XG6A 2YABA 2QO7A 2IW8A 1VR2A 4BF2A 1ZAOA 3BYSA 3ZHPC 4FOBA 2W4KA 1UU8A 1DS5A 3FYKX 4FKRA 3CC6A 2C6TA 2HCKA 1H28A 4FIFA 4RQKA 1NW1A 3F2RA 2RIOA 3TUDA 2XIKA 4EOOA 4MXCA 5FDPA 2QR8A 3BYMA 4K11A 4C7TA 4EWQA 4R77A 3W16A 3QCXA 3EKNA 5HG9A 4FKWA 3VQUA 1YHWA 4CV9A 3EL8A 3KREA 5JFVA 2E2BA 3MH2A 5DR6A 1QL6A 3C0IA 3SW4A 4A4OA 5JH6A 3HEGA 3AT2A 3C50A 4D4RA 5AA8A 1MRUA 2JIUA 3KC3A 3A62A 3P78A 3PJ1A 4YLLA 5DGZA 3WIGA 4FBXA 4HGSA 4RT7A 4F9WA 2W4OA 4YJTA 2JAVA 4IX3A 3P5KA 2UW8A 2ZMCA 5E92A 4FIGA 3W55A 2EB3A 1H25A 3C13A 5HIDA 4O0WA 3TIYA 1PMUA 3G6GA 3RHKA 2YDJA 4DE4A 3H9RA 2PVLA 3KRWA 5M4UA 3JVRA 3LFDA 3QTWA 3QRIA 4FV2A 4PMTA 4CMOA 1PKDA 5CT7A 1YVJA 4MQ2A 4AQCA 3HAVA 3UBDA 4FOCA 4BR3A 2OW3A 3I4BA 5AUXA 3VNTA 5DEWA 5CSVA 3R9NA 1ATPE 1BKXA 1W98A 3ACJA 4KKGA 5H9BA 4O7SA 1SMHA 3FQHA 3LMGA 3P7CA 4CZUA 4AE6A 4TNDA 4BDGA 1IG1A 2BRGA 3KVWA 3MGYA 4RIWB 4F9YA 3VUGA 3P9JA 4RFYA 3BYVA 1YI6A 3W2OA 4BDBA 2RFEA 1WBPA 3G9NA 4D0XA 4Y8DA 3UNKA 4J98A 5LARA 3GC0A 1MUOA 3WF8A 2BFYA 3S95A 3LMHA 3CP9A 3Q6WA 4RWIA 3FZRA 4C38A 1SYKA 3PXKA 4LG4A 2R0UA 4ZTRA 4QQ5A 4I20A 4PMSA 4FTAA 4GFGA 2EVAA 4M0ZA 4E7WA 2V55A 4C61A 5JZNA 5HO8A 4RIXA 1Q3WA 2VWIA 4UMRA 1UKIA 2WTKB 4RC2A 5K4IA 2WMVA 2REIA 4PTGA 2I0VA 4O7RA 3S00A 4KIKB 4IHPA 4BIEA 3PE2A 3A7GA 3NR9A 5J87A 2Z7QA 2XP2A 3PXZA 3CKXA 2ZAZA 3EQGA 4NM3A 3UIMA 5HO7A 3ROCA 2FH9A 3AOXA 4A4XA 3EH9A 3FLYA 4QMXA 3UGCA 3E93A 4EOJA 1PXLA 5FEQA 4ZY5A 2OJGA 1G8AA 4ZJJA 1Q5KA 4RIYB 4XP2A 4JG7A 5CAVA 4DC2A 5IQFA 1JWHA 3UOKA 2ZV2A 2R7IA 3BHUA 3W2SA 4IADA 4G9RA 4CTCA 2FSOX 4IACA 5LWMA 4DG2E 5HKMA 3KB7A 4G3GA 5L2SA 4RWLA 3F66A 3MESA 3UMWA 4AZTA 2YWPA 2VWWA 4MXYA 5AJQA 3SRVB 1UU9A 4LMUA 5FTOA 4UB7A 2ITTA 1ZARA 3IDCA 3QTZA 3QTXA 4YSJA 4GVJA 3QGWA 1P4OA 1Q61A 3PJCA 1OPLA 4RIOA 3O96A 5AUZA 2O65A 2DS1A 4TYIA 4HVSA 2VX0A 4Z16A 5TOZA 1O9UA 4FEXA 2WU7A 3TCPA 4YJPA 4QMOA 3U6HA 2B9HA 2BRMA 3Q4ZA 3UTOA 3HLLA 2DQ7X 4BZNA 4A9UA 2Z02A 4U8ZA 3VHKA 4GUEA 4F1TA 4U6RA 3R8ZA 1REJA 5CXZA 2WMUA 3OXZA 4XBUA 2I1MA 1M14A 2PE2A 4UBAA 4BCQA 2PULA 1REKA 4K8AA 2PZ5A 4IH8A 1YXSA 4MEDA 3QCYA 1BYGA 4BGQA 4HPUE 5BYZA 3O17A 4M84A 4J99A 3GOKA 5HE3A 4JQ8A 4M7IA 4N70A 2QOFA 4W8EA 5HE2A 3FEGA 4PNKA 5HORA 5AP4A 1OVEA 3SKCA 4O83A 4XJ0A 2R3FA 5CAUA 1ZYDA 1PJKA 2QNJA 4KINA 2HXLA 2VUWA 4IWQA 4IZ5A 4YTIA 3LKMA 2HZIA 4MCVA 3NUYA 4QQJA 3TI1A 3L8SA 1DAWA 2R3QA 3EB0A 4Y73A 3W10A 4NU1A 2XCKA 3WZDA 4I92A 3QFVA 4AA4A 4ACHA 3LIJA 3HV7A 4GIIA 4GG7A 5FBOA 4AA5A 2ITQA 2JKQA 4FVPA 1R3CA 5M44A 4FX3A 5KKRB 1OIUA 3DFCB 1OKYA 2GCDA 4C3FA 4I93A 3OW4A 3DPKA 5GJDA 3ZFMA 5AIRA 5AV3A 4O7NA 3WZUA 3FQSA 2OXXA 4ZSJA 3O51A 2PUPA 3V8TA 3BELA 4E6CA 1Y6AA 4IAZA 4ZSAA 3A8XA 3HL7A 4O22A 4AT3A 4APCA 1ZYCA 4EONA 2BHHA 2Q0NA 2YIXA 2X7OA 1H24A 4RA4A 5HTIA 1UA2A 2XUUA 3A2CA 3CCNA 3VVHA 5L6OA 2I7QA 4M68A 4KS7A 2WMBA 2W5BA 3KMWA 2IJMA 4BCFA 4KKHA 3I0QA 3WF6A 4R7BA 1H1RA 3I60A 3WE4A 5KUPA 4AGUA 3NYXA 3DK6A 3DKCA 5IA1A 4JX3A 2OIBA 3F7WA 4DH7A 3Q2JA 4MYGA 3KULA 4QNYA 3RM6A 1YXTA 5EHLA 5FQDC 3OWJA 5EDQA 4QMLA 4UZHA 2W9FB 4EK8A 4CFNA 4JOAA 1Q4LA 1PXJA 4S32A 4XV3A 4BIBA 4I0SA 3VN9A 4Z55A 4R78A 3V04A 2PVKA 3MN3A 2I40A 3CLYA 2P0CA 4E6QA 4EWHA 3ODZX 2ZDTA 2CCIA 3MPAA 2YZLA 4C36A 3R6XA 4IXPA 3FI8A 2UZOA 2QHMA 4C4HA 2NRYA 4F7LA 4WNOA 3O2MA 1OECA 5L8LA 3VUIA 4MNEA 2QCSA 3COMA 4B8MA 4Z7HA 4JXFA 3QA0A 5JRSA 1UNHA 5FXSA 3FLQA 3VBTA 2QG7A 4CCUA 5IISA 4FEWA 5D11A 1J91A 4OTIA 3H30A 2HWOA 4A06A 4DEEA 4RFZA 4AN9A 2JITA 3E8EA 3PWDA 2IVUA 3MS9A 4J71A 1KV1A 3P23A 3DXQA 4EOQA 5HG5A 4EOMA 1J7IA 2Y6MA 5HBHA 3MFTA 4FEUA 1XBAA 4XG3A 1OUYA 4KA3A 3ZCLA 2C0IA 3SHEA 2JBOA 5IZFA 1UU3A 5KZ0A 4E5WA 4BCIA 3RHXA 1OIQA 4IC8A 3ODYX 2HELA 4BZDA 2XJ0A 5IEYA 2X4FA 2W7XA 3DJ6A 3O0GA 5J5SA 5C4LA 2BMCA 3R8VA 3CE3A 4FKUA 2WTVA 4L7FA 3LFFA 5E8TA 4FIIA 4O0UA 3VS0A 1XQZA 1T45A 3Q9XA 1J1CA 4ITJA 4FT3A 3TNWA 3D5XA 4GS6A 4OTWA 4XS2A 3OHTA 3E92A 3C4FA 3IG7A 3QZFA 3MDYA 3ORXA 5IKWA 3RINA 2O3PA 3AMAA 5FEEA 1JLUE 4G17A 4CLJA 3PFQA 3KRRA 5AP6A 4ITHA 3ZLXA 4C37A 3DB6A 4FC0A 3MTLA 4E1ZA 3HRCA 1IRKA 2JFLA 2G2FA 2BRBA 2OK1A 2CNVA 4OBPA 3BU5A 4FNXA 5DVRA 5ETIA 5F20A 2YJSA 2UVYA 3POOA 4B7TA 4OBQA 3VS7A 3D5WA 4IWDA 4WHZA 2IPXA 4PP7A 3BU3A 3QRUA 1RQQA 3PVBA 5I3RA 2XKEA 4WUNA 4YTHA 3F5PA 2UZTA 1XKKA 3DBEA 4ZMEA 3OF0A 4FV8A 3KF7A 2YCSA 2AC5A 4YZCA 4FSRA 1P5EA 2JC6A 3HV3A 1IA8A 3GCPA 3LW0A 3FMHA 2OJFE 5CVHA 4ANOA 5I9ZA 4O0SA 1SNUA 5M4CA 4M8TA 5BVKA 3AT4A 2OJJA 1PXKA 5CY3A 4DF3A 1YWNA 3DZQA 3RCDA 4RVKA 4D58A 3OCTA 4BDJA 3A7IA 2ZYBA 4BTJA 4C34A 5HICA 2OO8X 4XV2A 4E4NA 5KMIA 3OUNB 4CFXA 1VZOA 3D7TB 3KCKA 2WHBA 2G1TA 3CQEA 3N9XA 3IW4A 2QU6A 3F6XA 4FT7A 4J52A 1Q24A 3FE3A 4OLIA 5DEYA 3C4WA 3GCQA 3Q5IA 4WIHA 3THBA 3ANQA 3V5LA 3CTHA 2PVFA 3QWJA 3PE1A 2GU8A 2CSNA 5ANOA 3DY7A 2OG8A 2X2KA 4QD6A 3R9DA 5I9XA 4QYFA 3QZHA 4XV9A 4C33A 5HIEA 5DT3A 5IG1A 4GIHA 2Z2WA 2V0DA 3S0OA 5HVYA 2ITYA 2PMNX 2XNEA 2R3IA 3VS6A 1KV2A 4CV8A 2BVAA 1OM1A 3NAXA 4QQCA 2CN5A 4BCMA 3GOPA 4FEQA 5IQGA 4HVGA 2B9JA 3GUBA 3RTPA 3KEXA 3TACA 4AU8A 4H36A 3BGPA 1Y6BA 1G3NA 2OZAB 4CYJA 2WMXA 4HCUA 4K9YA 1H1SA 2B9FA 2PSQA 2CJMA 3PSBA 4AFJA 4ASZA 1DM2A 1M7NA 2ACXA 3UIBA 5G1XA 1FVRA 5AX3A 3QAME 5BVWA 2HY81 4W4WA 3WYYA 2ERKA 3ZO1A 2Z7RA 5DHJA 3TWJA 3S4QA 4F9AA 3LFEA 5DMZA 3QD3A 5IH4A 4YGAA 3D83A 5CNOA 5AR8A 3PLSA 4O6LA 4FK6A 3UVPA 4M12A 5EG3A 4AZWA 4NFMA 1OBDA 4PMMA 4IDVA 1P14A 2X7FA 4GU6A 5ICPA 5BVOA 3DXPA 4ZJVA 4OT6A 5CI7A 3NNUA 3PP1A 4EKLA 1R78A 4C0TA 4O7VA 2ZM1A 3FSKA 1OKVA 4HGLA 3TTJA 4X7QA 5K3YA 3KMUA 5IA2A 3M42A 4FZ7A 4USFA 4D1XA 3FXWA 5E8ZA 3KCFA 5JN2A 4X6QC 3SW7A 2H34A 3OXTA 4DEBA 2GNHA 1TQIA 4YZDA 1OL7A 2W1EA 4I5CA 3OT8A 4DH3A 4KBAA 4YZMA 4DFLA 4O84A 2C1BA 4O7YA 5FXRA 4DTBA 4R5SA 2WMQA 3DDPA 5CX9A 3O7LD 3OG7A 5D7AA 5H2UA 2Y7JA 4FTCA 4NKAA 3UYTA 2VNYA 1F5QA 2PWLA 5HD7A 3FLNC 1JVPP 4LOQA 2X8IA 5HTCA 4A9TA 3HP2A 4O21A 2UZDA 4YBKA 3PJ3A 3EL7A 3KFAA 3IO7A 4RX7A 4U0IA 2WTIA 4FV6A 4K2RA 1FGIA 4MQ1A 3DV3A 4BDCA 3ATTA 2LAVA 3FI2A 4YU2A 4PDYA 3AC3A 1NY3A 3GCVA 4HYUA 4IM2A 4YJOA 3I6UA 2IN6A 3JYAA 4WG4A 4E5AX 4FG7A 1PYEA 1ZLTA 4UMQA 2YM5A 4G3EA 3OBGA 3DQXA 3PRIA 1Y8GA 3ACKA 4EH4A 5AX9A 5CEIA 5FM2A 3V5TA 4G9CA 1BX6A 2XA4A 2IO6A 4DTAA 4DH5A 3DZOA 1PMEA 4BBMA 4EC9A 2GHLA 2CGUA 3B2TA 4UY9A 4XG9A 3ZEWA 4D5KA 4DG0E 3ALNA 3E8NA 1JAMA 4IM0A 4R3CA 4CQGA 2BTSA 5B0XA 4DH1A 4ZSGA 4RJ7A 3ATSA 3PXQA 2VO3A 5AA9A 3W2RA 1Z5MA 3Q04A 4LGGA 5CVFA 5M51A 2VN9A 2HIWA 4FTRA 4FZDB 5TKDA 2V7AA 4O86A 3AT3A 3S2PA 2C6DA 3MIYA 4JIKA 1QPEA 4FSTA 1WZYA 3OMVA 4GVAA 3UZPA 4WSQA 5KMJA 4PX6A 3H3CA 3LMIA 2XF0A 3A61A 3COHA 4CTBA 4O0TA 5GIPE 4TXCA 4PL5A 4BI0A 5FXQA 1JKSA 4QP2A 3TNQB 4IFCA 3I7CA 4RX5A 2KULA 3FY2A 3HV4A 3WE8A 4DG3E 3DK3A 3I5NA 2R3GA 3TXOA 3ZXZA 5DFPA 3KQ7A 3KU2A 3GP0A 3LCTA 3UVRA 2GTNA 2UW3A 4S31A 2YM7A 3WF7A 4WO5A 2CKOA 3RZBA 4C8BA 2WQNA 2VU3A 3QC9A 4PL4A 2GS2A 4P4CA 4WBBB 2JDSA 2XH5A 4IAYA 2VTAA 4PV0A 3D7TA 4DEIA 3KRXA 3OBJA 3NPCA 3LQ8A 4V0GA 3ORLA 5E8XA 1P4FA 4ZTSA 5B7VA 5GNKA 2VWYA 3MJ2A 2BZHB 3NIZA 4XOZA 1H00A 3AGMA 4AS0A 1GOLA 3JY9A 4Y85A 3IW8A 4AW2A 1Y8YA 4FVQA 3LFBA 3OCBA 3SDJA 2PTKA 2OJ9A 3QBNA 3TV7A 3UO4A 4ANSA 3UIXA 1Q8ZA 1QPDA 5D12A 1NT2A 3E7OA 4WBOA 3Q32A 3ORKA 3NWWA 5DG5A 2P4IA 4AA0A 5C8KA 2V7OA 3QRJA 4EH9A 3OOGA 3TNIA 4LYNA 5ETAA 4QMSA 4CVAA 2BDWA 4L44A 3U4WA 4BZOA 2QVSE 1K2PA 3H0YA 4PDOA 1AQ1A 3A99A 3BCEA 3H10A 4I21A 3LM5A 3CTQA 4ACMA 3PZHA 2PZRA 3W1FA 3ULIA 4N0SA 4ANBA 4ZY6A 2JDOA 3G90X 2GDOA 1CDKA 5BYLA 2GTMA 4AGCA 5HIBA 3QTIA 3KL8A 3IW5A 4C3RA 1H0VA 2FVDA 4CG8A 3Q9ZA 4RJ8A 4YHFA 3DKFA 4DHFA 5CEOA 4ZLYA 5M55A 1B38A 1IAHA 3E7VA 4HGTA 4MTAA 4L43A 5DE2A 5AP1A 5EDPA 3PXFA 3VUKA 4CG9A 2PMOX 2W1CA 3SD0A 4YP8A 5I4NA 4L8MA 2EWAA 5IMXA 5J9ZA 3H4JA 4H3PA 5K5XA 4OR5A 1OIYA 3OT3A 4UYAA 4EZ3A 3DNDA 5G6VA 2YITA 3WILA 3FZ1A 3QF9A 3MH0A 4O0VA 5AAEA 3MYGA 1JBPE 4JR3A 5JKGA 4WOVA 3SLSA 5A6NA 4R5YA 2WXVA 1KE7A 5C4KA 3Q5ZA 4PL3A 2VTSA 4EJ7A 4YZBA 3FWQA 5EKOA 4ALVA 3RM7A 5K4JA 3R0TA 4B4LA 1K9AA 3GENA 4JT3A 4G2FA 1M2QA 2R5TA 2V62A 4IX5A 4L3JA 3W2QA 4RA5A 4F1OA 2DYLA 1W83A 3KXNA 4JLCA 4IWOA 4P5QA 4O1PA 4FZ6A 4QP9A 4IMYA 2W99B 4K77A 4QP7A 2J90A 5KO1A 3VBYA 3KXXA 2YERA 3G51A 3EYGA 4CD0A 3R63A 4QP3A 4EH2A 4DEDA 2WTCA 2F57A 3LCOA 3QHRA 4K6ZA 3ZONA 3DGKA 3CBLA 4APPA 4KIPA 3V5WA 4I4FA 2WZJA 2BIKB 3T9TA 5JEBA 2CKPA 4A7CA 5JFSA 2VTRA 4G3DA 4OW8A 3AMYA 3V51A 1VYWA 4QMVA 3WF9A 2CGXA 2QC6A 4QMPA 4DBXA 3I1AA 5IA3A 4XG7A 4M14A 3RMFA 4TKSA 1V0PA 1H07A 4JDHA 3B2WA 1FVVA 4NL0A 4FTUA 1OITA 4RX8A 4CCBA 2RL5A 3SGCA 3K5VA 4X3FC 4BCJA 2YCQA 2YDKA 4FSZA 3PIZA 4UWCA 4FV7A 4ORKA 4TWNA 4FT0A 5C1QB 3R9RA 3BYUA 5C27A 5A4QA 3GC8A 1ERKA 2ITWA 4HYSA 3EN9A 3EOCA 4Y72A 2HOGA 2Q0BA 4GJ2A 2YM8A 4U3YA 3TIZA 5BNJA 1APME 1OMWA 3GBZA 4MF0A 3FXXA 3PTGA 3D14A 4FSUA 2WB8A 3R73A 4LRKA 1TQMA 4ASEA 2ZV8A 2ITUA 1PYXA 3G15A 4A9SA 4A4LA 4O82A 3BLRA 3O50A 4ZOGA 3MJ1A 4NH1A 3OEZA 4GV1A 4FGRA 1KWPA 3CJFA 4QTDA 3UQCA 2QO9A 3QL8A 4E6AA 5CT0A 4RJ4A 4X3JA 4NTTA 1PMNA 2F4JA 3DFAA 1SZMA 5E8SA 4RRVA 4HVHA 5KMLA 2PY3A 4D9TA 4FKTA 5CU2A 1WVYA 4BDHA 2P3GX 2CKQA 2QKWB 4TW9A 4B0GA 4PMPA 4C35A 3Q3BA 4KBCA 3EN7A 3SG8A 4HVDA 1U54A 5A3XA 5EQEA 4WRGA 1WBTA 2CCHA 3RPOA 2WTWA 4F65A 4N6ZA 2I6LA 4XBRA 3UQGA 1OB3A 4NYEA 5BUEA 3QA8A 4EJNA 3ZFXA 4BYJA 2QOOA 4XRLA 3SXFA 3LLAA 5IQIA 4IB0A 2GHMA 3BGQA 3C51A 2HYYA 5EYMA 2XJ2A 4E8AA 3FV8A 3PY1A 4Y46A 3KF4A 2UW6A 5K0KA 3VHEA 2ZDUA 2E9NA 2H8HA 4CFVA 3TTIA 1XH6A 3EIDA 4FV3A 1Y57A 2F9GA 2Z7SA 5DI1A 4RGJA 1WBWA 4D1ZA 4UX9A 1WBNA 3UQFA 4Y95A 5CQWA 3VULA 4BKZA 1XBBA 4FZAB 3DK7A 1NA7A 5DOSA 3CD3A 5EW9A 5HCYA 3VC4A 4LQMA 2HY0A 1VJYA 5HESA 3LFCA 2OIDA 4EH3A 4EL9A 4QMNA 5E1EA 4JS8A 4PTEA 2WMRA 1OGUA 4MXZA 2HXQA 3Q9WA 4UWBA 4AW1A 5CS6A 4NJDA 1BLXA 3N51A 3RALA 3ZS5A 4DEGA 3LCDA 4YR8A 3LHJA 3HGKA 3ZM9A 5JQ5A 5BUJA 3F5GA 4F0FA 3SQQA 4QTEA 2WELA 3EQCA 3P79A 1W82A 4DINA 3R8MA 2BZJA 1XHAA 2R3HA 4JAJA 1X8BA 3RBWA 5LJJA 4EHVA 3F3WA 5HLNA 2X1NA 5EM5A 3NW6A 3P1AA 4FL2A 5CSHA 1ZY5A 1M2PA 5HOAA 4LRJA 2XK3A 4TNBA 3NUNA 5IMEA 3U51A 1RE8A 2WMTA 3PVWA 3ZLYA 3CEKA 1R0EA 2XIRA 2QONA 3U87A 3UODA 4LV5A 5M06A 2C69A 1HOWA 3FUPA 2ITNA 3D2KA 2ITXA 3OCSA 4OGRA 5A4LA 1DI9A 1M2RA 2VTNA 1ZZ2A 3OY1A 4UEUA 3OTUA 2WOTA 4FYOA 4EORA 5JQ8A 4KIOA 3U6IA 2J6MA 4FI1A 2PZIA 5EYKA 5A4CA 2X0GA 2UZUE 4I0TA 2J7TA 4YJNA 5EYCA 2ZV9A 2XS0A 4USDA 4U44A 3F3VA 4TWPA 4TL0A 1LUFA 2PVRA 4YNOA 3MY0A 1YOMA 4L67A 4CFWA 3NEWA 5DWRA 4IIRA 4ASXA 3MVJA 4M69A 2VTOA 4U40A 3PG3A 2JKMA 2UW0A 1PXIA 4H1MA 4ANNA 1L8TA 5M09A 3BV3A 4L42A 4YHJA 3MPMA 2EB2A 2VTTA 2QQ7A 5FWKK 1J7LA 3HYHA 4ANLA 4UALA 4ANMA 4GT4A 5J9YA 5CSWA 4FV1A 2GNFA 3VS5A 4BCNA 1ZZLA 2RF9A 2EXCX 1UU7A 3VUMA 2WEIA 5C01A 4RBLA 4UV0A 5CLPA 5L6WL 4KUJA 3PP0A 3ZEPA 4BWXA 1FGKA 2I0YA 2OZOA 4AXAA 5EQPA 3BGZA 2QOIA 4QP8A 1RW8A 2ZMDA 3MBLA 2C0TA 2ESMA 2X4ZA 2GHGA 3IGGA 2EUFB 4O7TA 1ZYLA 4XEYA 4F1MA 3OS3A 2IW9A 5HQ0A 2X9FA 2UV2A 5CAQA 2NPQA 4HNIA 3PIYA 1T46A 1WMKA 2BAJA 4UN0C 5LCJA 4RC3A 3UYSA 3UOJA 5E4HA 1CKIA 3FI4A 3PPZA 3EMGA 3SV0A 3E63A 4HYHA 4TWCA 5CSXA 3WOWA 4O2ZA 1OL5A 2B53A 4U81A 1NVQA 2C0OA 1JSTA 3IW6A 2J0JA 3GC9A 4IEBA 2O63A 4OTHA 1WCCA 1RDQE 3C4EA 1Q8YA 3DAKA 4CEGA 4Z3VA 2A2AA 3HDNA 3T9IA 2XIZA 5JSMA 3LZBA 4DFZE 2XEZA 4JRVA 4NIFA 3TJDA 2XIYA 3CR0A 2P2IA 4FMQA 4XV1A 4XYFA 1M52A 2J9MA 4L46A 4O1OA 5AFVA 1H01A 3SXRA 2WFYA 4AW0A 4QYHA 1B39A 3G33A 1NVSA 4NM0A 2PMIA 2C6KA 4O0RA 3ET7A 4FKIA 4F9BA 4GSBA 4V04A 2UZWE 3IOPA 2PK9A 5A9UA 3PPKA 4XUFA 3P0MA 1PXPA 5HI2A 4C2WA 2XK8A 3C4ZA 2BIYA 5CAOA 2XIXA 3ZM4A 2BZKB 3QGYA 4OTPA 4D0WA 2F2CB 4E93A 1O6YA 4FSYA 2R3RA 3R8UA 4DITA 3R28A 4PPBA 2VTPA 3QUDA 4ID7A 5AP5A 2WIHA 4DT9A 4FTJA 2UW5A 2W1ZA 2AYPA 1QCFA 4FR4A 2Z8CA 4O91A 2WTJA 3PJ2A 5C9CA 3EFWA 1UWHA 2PMLX 3LFQA 5HD4A 2C6OA 3AC4A 3DBDA 4BDIA 2XNPA 3FPMA 3VO3A 3ZUVA 2WQBA 1E1VA 3MA6A 1SVEA 3O8PA 4IFGA 4L01A 3AC8A 2BZIB 4U9AA 3N4VA 3E62A 4LRMA 4QNAA 3RAWA 1BL7A 2R0IA 3WIKA 4GUBA 4I4EA 4DGOA 3HRFA 4M3QA 2Y6OA 3O8UA 4ZP5A 4PUZA 2BTRA 4G6OA 4YJUA 4C62A 3A7HA 3GQLA 5LCKA 3CXWA 3OWPA 3PVGA 4D4SA 4M66A 1OI9A 3LCKA 4CFMA 3QD2B 4E4MA 3RK9A 5AAFA 3PSDA 4GYGA 4RIWA 4JRNA 3VW8A 5ANIA 4W9XA 3UG2A 4ANQA 2UZEA 3G2FA 2BHEA 2YCRA 4FSQA 4NTSA 5CEPA 2OKRA 5ETFA 3OW3A 4FSWA 5CAPA 3S1HA 1BL6A 5HZNA 5DLSA 5A6OA 3CD8A 2BAQA 3TT0A 2QLQA 4K18A 3F3ZA 2BUJA 3TV6A 4QP4A 1BI8A 4WA9A 3K2LA 2BILB 2BRNA 3PJ8A 4L53A 3G9LX 3L9NA 4QRCA 1XR1A 3RPYA 3V6SA 3ZUUA 1PXOA 3RNYA 5TO8A 2QI8A 4MVFA 4W4YA 4KIKA 3DB8A 3GEQA 4ONAA 5FGKA 1Z57A 2OSCA 2XKFA 4FUYA 3ZXTA 4EOKA 4EUTA 4FKGA 4RLLA 4FKPA 4DYMA 5EM7A 3JUHA 3UMXA 3DJ7A 2O64A 3FMLA 4EHZA 2XMYA 2OH0E 4RIYA 2PUIA 3QXOA 2ITZA 5HU3A 1PRYA 4ZJIA 3QQJA 4BI1A 5D1JA 4F6UA 2YCFA 4YUQA 2OLCA 4NCTA 3PA3A 1XWSA 4I6QA 5ETCA 1Q99A 3TEIA 4BRXA 4U80A 4MNFA 4CKIA 3P7AA 4NSTA 4ZZOA 5IA5A 3A4OX 3B8RA 5HBJA 4YBJA 1XH8A 1FOTA 2XRUA 3D0EA 3UP7A 1OIRA 3SRVA 2QOLA 1OPKA 4FTLA 3OUKA 3L8XA 1J1BA 4G1WA 4CNHA 2C5OA 3QRTA 4N4SA 2QOHA 5FEDA 2VD5A 4ERWA 3ZZWA 5CF6A 4FL1A 1LEZA 4AWIA 5A4TA 4HCTA 3U9NA 3S3IA 1MQBA 4G6LA 3M1SA 3Q60A 2OWBA 4G34A 4IAIA 1H8FA 1G8SA 5AV0A 5FM3A 3R30A 4GW8A 3PRFA 4KABA 3FMJA 3JPVA 5FTQA 3LVPA 4XG8A 4KSPA 2OXDA 5FD2A 1FMOE 3P4KA 4W4VA 4ZK5A 3FSFA 3BZ3A 3OWKA 4GRBA 4EK4A 4C2VA 2GQSA 4C57A 3F5XA 5JGDA 2EXEA 5LMKA 3FXZA 5I9WA 5JZJA 2F7XE 4M0YA 4RZVA 3NYVA 5EYDA 3PVUA 3BU6A 2GPHA 3DXNA 3GU4A 5J9LA 5D10A 1PKGA 3HRBA 1ZOHA 2OFUA 2P55A 3NS9A 2DUVA 5EOBA 4OUCA 2HZ0A 2LGCA 1ZYSA 3DLSA 2WMAA 3QZGA 3T8OA 4TN6A 4EEVA 2C6LA 3BQRA 4U7ZA 5IA4A 4RJ6A 1W8CA 2QHNA 3MPTA 4IVDA 3IONA 4I22A 2X8EA 2BKZA 2QODA 3UP2A 4C59A 1QPCA 4IB3A 1F3MC 1YDTE 2A27A 4AACA 4ERKA 4GT5A 3CQUA 2I0EA 4F64A 3KA0A 4YO4A 4K0YA 4YTCA 4RVTA 5IA0A 3HMIA 3IW7A 3Q4UA 4F4PA 3ERKA 2PVNA 3GU7A 4WNKA 5AR7A 4E6DA 2B52A 3UVQA 1A48A 3NUAA 4BHNA 2HZ4A 3F2NA 4LOPA 4GT3A 2EU9A 3BI6A 3EWHA 2BAKA 2JEDA 2F2UA 2JLDA 3EZVA 3O7LB 3R7UA 3VF8A 3C1XA 1V0BA 2R3LA 2CDZA 2Y4PA 3NUSA 4W4XA 4ZTLA 2AC3A 4M15A 1DI8A 3R00A 4PDSA 4EYMA 4IVAA 2ERZE 4FSNA 1W84A 1PF8A 2XBAA 3LXPA 3R7EA 5KNJA 3NYNA 1FQ1B 5TT7A 1H1QA 4U79A 2JAMA 5T6KA 5DT0A 5EI8A 3E88A 4ZZMA 3QRKA 1XH9A 4ITIA 3VF9A 3NMUF 3PYYA 1S9IA 1URCA 3GB2A 3JXWA 4ACGA 3E5AA 4M97A 2YIRA 3KK8A 1UV5A 3HMMA 3R7OA 3R7GA 3KRJA 4G3FA 3HECA 4BFMA 4LUDA 3VRZA 3GFEA 2BFXA 5IQEA 3L8VA 4OTRA 3LJ1A 5CNNA 3RAKA 4DFYA 5DPVA 4QMMA 1ZOGA 2PZYA 1H08A 4FTNA 4I6FA 4TYHB 4AZFA 1JSUA 2QURA 4USEA 5CANA 2JGZA 3HVCA 1ZMUA 3GT8A 3RAHA 3COIA 1RJBA 3F69A 4O96A 4TWOA 4AP7A 1IASA 2EXMA 3EQBA 2UW9A 2VX3A 2G01A 4RLKA 5HNGA 1GAGA 4WNPA 3AMBA 3BX5A 2C5NA 1WAKA 3IOKA 3KKVA 2C5XA 3FMEA 4FF8A 5DN3A 5EI6A 3REPA 4LI5A 3QWKA 4RMZA 3BHYA 3QYZA 2W1GA 4IM3A 5EW8A 4OAVB 3FC1X 3QXPA 4R7HA 4B99A 3TZ9A 2J50A 5M53A 3F88A 4L3LA 4BGHA 2WQEA 3TZMA 3OCGA 3HKOA 4XG2A 4TRLA 1A06A 2OF4A 5AM6A 3I0OA 2BPMA 5M07A 4EK6A 3G0EA 1SVHA 2PUNA 4U42A 3OOMA 3RCJA 3TKIA 5DR2A 4ZXTA 3K54A 4GCJA 5DH3A 4BIDA 5HNIX 2WMWA 3M11A 2C47A 3IGOA 3I6WA 4O2PA 1JKKA 1Y91A 4V05A 3ZFYA 5I9YA 4I5PA 2F7EE 4J97A 5E7RA 3ZC6A 4E73A 2YM6A 4ZAUA 4F6WA 3PSCA 5CEKA 4IW0A 1XBCA 3OZ6A 4XP0A 3NNWA 5CSPA 3D5VA 2UVXA 2J5EA 3JS2A 4KNBA 2HZNA 4C4GA 2YJRA 5LMBA 3OVVA 1BI7A 3F82A 3QX4A 4X6RA 3PUPA 1GNGA 1QMZA 3I5ZA 1KOBA 3E87A 2PVMA 3HA6A 2VZ6A 5AV2A 4ARKA 2RG6A 4AT5A 3P08A 3NIEA 4DGNA 2XK9A 4H05A 3EQHA 2X7GA 4BCKA 5HTBA 2I0HA 4NW6A 3NAYA 5F94A 3BE2A 3RZFA 4BC6A 3IQ7A 4EHEA 1YHVA 2XK4A 3ZZEA 1V0OA 3MV5A 2A19B 5C03A 4ALWA 3WZEA 4RWKA 4X3FB 1CKJA 5DIAA 3RPRA 4ZSEA 2JBPA 4JL9A 2OICA 3G0FA 4KRDA 3FLWA 2JIVA 4Z7GA 4CT1A 3KXGA 3UE4A 2GS7A 3BLQA 3EN5A 3UZTA 4HZSA 5ANEA 4CMUA 2OU7A 3SVVA 4FIJA 1IR3A 2JDVA 4BWPA 2GNLA 2YIYA 3QKKA 3MB6A 4I23A 1OUKA 4OTDA 3GNIB 3LFAA 2PVHA 1CMKE 1U5RA 1GZ8A 1LP4A 5TR6A 4HW7A 3BV2A 5CU6A 3A8WA 1H27A 5TE0A 3HUBA 4ZY4A 1FVTA 3TNHA 2CKEA 4DLIA 5IUGA 5DBXA 4DLJA 3TL8A 5FG8A 4E26A 5H8BA 2VWUA 4ZTNA 2RFSA 3MFSA 3ZLWA 5GJFA 2C6IA 2RGPA 2GSFA 4OBOA 1W0XC 2XJ1A 1OL1A 4GL9A 3HA8A 2H6DA 5FDXA 2YACA 4TYJA 5ACBC 4D9UA 5HX6A 3H9OA 4AZSA 5AUVA 5EOLA 3FAAA 1ZRZA 5LOHA 2CLXA 5AADA 4AF3A 1V1KA 4CFUA 3NZ0A 5J7HA 2YIQA 3KXMA 4RQVA 3HMOA 3FHRA 1YXXA 2C6MA 4YJQA 1TQPA 2ZJWA 4ZEGA 3QKLA 3VUTA 5B2LA 4BVUA 4TTHB 3ZSHA 5A14A 4JR7A 4F7SA 3NYOA 5L2TA 4D2RA 3W18A 5IU2A 1GZNA 4RPVA 4BGGA 3CJGA 1Q62A 4RSSA 3U8WA 4PNIA 2OZAA 5EI2A 1E9HA 1H26A 2QD9A 4JNWA 4WKQA 3RVGA 2R3OA 2R3MA 4MX9A 3EKKA 5L3AA 2QG5A 4AW5A 4W9WA 5I3OA 4DH8A 1Q97A 2XNGA 4FEVA 5CEQA 2CGWA 3ZRMA 3FPQA 3BHTA 2B9IA 3O71A 3ZLSA 1U59A 4AZEA 4CRLA 3F3TA 2BKKA 2J0MB 1MRVA 2BR1A 1DAYA 4D4VA 5I0BA 1Q8UA 2Y8OA 4KAOA 4PF4A 5HCXA 3ID6C 5FTGA 5LVOA 1PMVA 4FG9A 3ZMMA 4QP1A 2C4GA 4EOLA 4FT5A 3BHHA 5AUYA 5T3QA 5H8GA 1J3HA 1JKLA 3QHWA 4O81A 5JGAA 3PY3A 5HE0A 3BYOA 2VO6A 4JBOA 4FV5A 3FMNA 4RIXB 2W05A 4ZZNA 3V5QA 4ENXA 4R3PA 4DFXE 4U97A 3P7BA 3BQCA 3MFRA 3F61A 5AUUA 2X39A 4X21A 2PUUA 3PZEA 3A7JA 1O6KA 4Q5HA 2VNWA 1XH4A 2QOKA 2VO0A 3Q6UA 4F99A 4F7JA 4R6VA 3IDPA 1U46A 4KIQA 3BEAA 5L2QA 3C7QA 4AZVA 4LGDA 5CXHA 4LL5A 4BI2A 4UMPA 5JK3A 2FGIA 4GH2A 3TZ8A 2V5QA 2JIIA 5CZHA 2F7ZE 5EM8A 5F9EA 2QKRA 3SXSA 2C68A 4NKSA 5J1VA 4QPMA 2UZNA 4NUSA 3ZU7A 2W0JA 3NUPA 3BLHA 1UKHA 3QQUA 4MXXA 3QQKA 3IPHA 5BVDA 5IDPA 3UO6A 1KOAA 5IQDA 1SNXA 5ANGA 2WGJA 5AP3A 3EZRA 5BMSA 3E3BX 5EKNA 4F0IA 4CKRA 1CSNA 3NVMB 2YA9A 3ZO4A 1PHKA 3NRMA 4H1JA 2RFDA 3W8QA 2JDTA 2QLUA 5DRDA 3VBVA 1R0PA 1GZOA 1YOLA 3ANRA 3C0GA 5C8NA 4G5PA 4G3CA 3MI9A 3R71A 4KSQA 2XVDA 5F95A 5CU4A 5CU3A 1ZWSA 4BCPA 3C5IA 3OROA 2ONLA 5CF8A 3HUCA 2HW6A 4AOIA 5AIKA 5I9UA 4P7EA 3OP5A 2O5KA 5AP2A 5EHYA 1WBVA 2W1IA 4EH6A 4FODA 3HDMA 4FKQA 1J7UA 2JKKA 2CNUA 4CXAA 3TM0A 2A4LA 3U55A 5M08A 3FDNA 4Q9ZA 3BBTB 1W7HA 3POZA 4EK5A 4C4JA 3NLBA 4AN3A 4CSVA 4F09A 2B54A 2FSMX 4QMUA 1UWJA 1F0QA 3F2AA 5ANDA 4C4FA 4BY9E 3W2CA 1OBGA 2VGOA 3WZKA 4IAKA 4GU9A 4EC8A 2ITPA 3TUCA 5DYJA 3P86A 3RP9A 3V5JA 4U5JA 4EOSA 3R21A 4FTMA 4J96A 3PPJA 2HENA 3HAMA 3BPRA 5IQHA 3MWUA 4CQEA 5KBQA 1R39A 4FICA 5KZIA 3LPBA 5E8UA 3Q53A 3ZYAA 4YLKA 3A4PA 3BHVA 4YTFA 1XO2B 2BDFA 5A54A 4X2JA 3G5DA 2VTLA 4FNZA 2NP8A 4JG8A 5E91A 2IZTA 4IAAA 4H3BA 4WNMA 4EHGA 3W33A 3G6HA 2NO3A 1MP8A 4FTOA 4XG4A 3SA0A 3R02A 3FL4A 2PPQA 3QX2A 4I41A 4BTMA 4AAAA 4WUAA 4OTQA 3KXHA 4QTCA 4YZNA 1ZMWA 3VWAA 3LQ3A 3Q9YA 3NW5A 4F0GA 5BYYA 3COKA 3WARA 4DT8A 5CZIA 4BDAA 2YZAA 2XK6A 4WRSA 2JDRA 3CTJA 4IB5A 4WSYA 3W2PA 3RK7A 2VWBA 4DN5A 4I5HA 2CLQA 4D5HA 4D55A 3DAEA 5CF5A 4FE2A 4XMOA 4NM7A 1CM8A 2G9XA 2UZLA 2J0KA 4L3PA 3C4CA 2C3IB 3GVUA 3PIXA 3NSZA 5EK7A 1UNGA 2XK7A 5CALA 3PDTA 4X2NA 3O23A 4F7NA 3QTSA 3LJ2A 3T3VA 4YJSA 4CGAA 4I5MA 2RKUA 4MXOA 3TKUA 4O0XA 5IPJA 3FZSA 3LCSA 3L9PA 4K1BA 3KULB 4YURA 3SOAA 4KB8A 4Z9LA 4IBMA 5LXMA 2VTHA 1R1WA 2Y0AA 1MRYA 4RG0A 4EUUA 5IDNA 4IZAA 3KN6A 5IEXA 5L8JA 4CLIA 3DAJA 5ANKA 4IWPA 5KHXA 5EW3A 3VS2A 4BYIA 3B8QA 3VBQA 3K3JA 4UXLA 1JPAA 3TG1A 4ACDA 5GIOE 3CQWA 5L2IA 3C9WA 5EFQA 4RWJA 2QOCA 2X2LA 2YAAA 4YLJA 2B4SB 2OXYA 3IKAA 3Q52A 3D15A 4I94A 4MNEB 2B0QA 2GMXA 4J7BA 1H0WA 2Y4IC 3QU0A 3VRYA 5CEMA 5CU0A 1PY5A 3C4XA 4AGWA 3W32A 3LFNA 4ZTQA 2YM4A 5KBRA 3FLZA 1JKTA 3ZBXA 2IZSA 5AMNA 2VAGA 5GZAA 3AG9A 5M56A 5LVPA 3D94A 2CHLA 3FJQE 1ZY4A 2PHKA 3VAPA 4CFFA 4YO6A 3TV4A 3DKOA 4B6LA 5IQCA 3NNXA 2X9EA 3SX9A 3VUHA 3R1QA 4ZS0A 3RPSA 3KY2A 4ACCA 4R7IA 3ORZA 3AD4A 5DRBA 3RPVA 1CKPA 4P90A 4WG5A 3IS5A 3FZOA 3NCGA 5HNBA 1SVGA 1PXMA 3FZTA 3UC3A 2YAKA 5BMMA 4EKKA 3TUBA 2WQMA 2YIWA 4AOTA 4BDFA 4YC8A 4EZ5A 5CENA 2OI4X 4BDKA 4FV0A 4WD5A 2IZUA
chains in the Genus database with same CATH superfamily
3BWJA 3U6JA 4EYJA 4CT2A 3FLSA 3MH3A 3OTVA 5D7VA 4D2SA 3ORNA 4IB1A 3LFSA 2C3JA 3LAUA 5EM6A 3KXZA 3QQFA 4NM5A 2VV9A 2HK5A 2RSVA 3Q96A 3EFLA 3FZPA 5IUIA 1HCKA 2WQOA 4BKJA 1IA9A 4XLVA 4L68A 3ZDIA 4QOXA 2ZB1A 5J79A 5IH6A 4LGHA 4C58A 3V01A 4Q5EA 4QQTA 3OC1A 4PP9A 5LVLA 4BBEA 3BE9A 3LQ5A 1OKZA 3QQHA 4F6SA 3ZSIA 3K3IA 3QCSA 4TT7A 1PXNA 4I6LA 4BCGA 3A60A 4EBVA 3HMPA 5B2MA 3W0NA 2ZOQA 4RFMA 2R4BA 3EQPA 3ITZA 3LM0A 1BUHA 3FQEA 4MWHA 4MK0A 2WD1A 4M13A 3ZDUA 3VJOA 2BROA 4JQ7A 4DGGA 4GJ3A 4H58A 2C30A 5KCVA 2XNMA 2WO6A 4AGDA 3CKWA 1WFCA 4MF1A 4KWPA 2FUMA 1BMKA 4BCOA 2Y9QA 2O8YA 4G6NA 2YM3A 4NFNA 2R7BA 5LQFA 3TDVA 5HLWA 4AX8A 3TNPC 4JBQA 3L9MA 3EFJA 3NDMA 5EQYA 4YPSA 4OTFA 2C6EA 5E8VA 4HCVA 2VTJA 5DT4A 4LL0A 5EH0A 2WOUA 2E9OA 4GYIA 2GQGA 3JY0A 3OWLA 3O8TA 2XNOA 4D2PA 2PU8A 4L45A 4KS8A 4NK9A 3TN8A 2J5FA 3RNIA 3LLTA 3RKBA 3TKHA 4ALUA 4AFEA 2Q83A 4ENYA 2YLEA 4U45A 3VS1A 3EQDA 2IZRA 4MD7E 4P5ZA 1GIHA 2UZBA 3UC4A 3ZTXA 2X6EA 2ZM4A 4DDIA 4F9CA 5GINE 4TYEA 1YDRE 3QD4A 4YSMA 3BKBA 3F5UA 3NNVA 2B7AA 3R7YA 4JVGA 1OGYA 3RWQA 1FBNA 2UUEA 1TVOA 4QTAA 5LWNA 5K5NA 4BCHA 1H1PA 1VEBA 3L8PA 3HMNA 4XH6A 1Q41A 3F9NA 3HV5A 2WAJA 3ORTA 3VBWA 4O0YA 3GGFA 2IWIA 2P33A 4YJRA 5AM7A 4OTGA 4Y5HA 5F4NA 3K5UA 4QPSA 4YZ9A 2ZM3A 4DFUA 1FMKA 2W4JA 5HLPA 1AGWA 4G16A 3VUDA 4FNYA 1KE5A 5HBEA 4FVRA 4QT1A 2XZSA 4D1SA 2C3LA 3DKGA 3GU5A 4J8MA 3D5UA 5E8WA 3VS3A 4II5A 1UVRA 1WVXA 3GC7A 4WG3A 4WT6A 3ZRLA 2XYNA 2GNIA 3CGFA 3KN5A 4IAFA 4O6EA 2WTKC 1IEPA 4P2KA 1HCLA 4PPAA 5L6PA 5IQBA 4HZRA 1XH7A 4L7SA 2XNBA 3MH1A 3MSSA 5HVKA 2PE1A 3HV6A 4PRJA 3MFUA 4R1VA 2JKOA 1STCE 3GU8A 1EH4A 5M4IA 3UZRA 1OZ1A 3QKMA 2IVSA 4NWMA 3PA5A 5J95A 4O7WA 4AXCA 4Q9SA 2CN8A 4H3QA 2CPKE 2VRXA 4NCTC 4NZWB 4DGMA 2OBJA 3E8DA 4IZ7A 2W17A 2FA2A 3DBFA 3OXIA 1TKIA 5BUIA 2W5AA 4LUEA 1K3AA 5KMMA 4BTFA 5HX8A 3VJNA 3DS6A 3DA6A 3GCUA 4H39A 1KE8A 3RK5A 3QQLA 1QPJA 4CMTA 3EYHA 2GS6A 1B6CB 3WI6A 5H8EA 3NW7A 3LXNA 3AGLA 3NUUA 5CWZA 1OL6A 5AP7A 3V8WA 2JFMA 5D9HA 2W1DA 2A0CX 4QO9A 3SC1A 2WKMA 5AUTA 4IZYA 4FTTA 3FC2A 4QMTA 2XB7A 1S9JA 3M2WA 2PVJA 4LFIA 4MD9E 4FV4A 4S34A 4FGBA 4ZLZA 3V8SA 4JQEA 4QYGA 2ITOA 2C5VA 4AT4A 1YXUA 4FIHA 4PPCA 3C0HA 4NW5A 1U4DA 5CTPA 4IANA 1LEWA 3F7ZA 5FP5A 3R9OA 4A07A 4GKIA 4FIEA 3AD5A 3D7ZA 4GFOA 1YDSE 2J2IB 1JSVA 5AR3A 4CYIA 2VTMA 5LMKC 3FMMA 3NUXA 3UJGA 4BJJB 3PXRA 2BCJA 5D41A 2VWVA 4HVIA 4Y83A 2YLFA 3LJ0A 4S30A 4JDIA 3GU6A 2J4ZA 4AN2A 2E9PA 4FZFB 4RC4A 3EHAA 4DGLC 2X2MA 4F08A 3QZIA 3TZ7A 2GQRA 2PL0A 2WIPA 3ENMA 3V5PA 5I5ZA 4LM5A 5CF4A 4X2KA 4NJ3A 1KE6A 4C3PA 4A9YA 3UOHA 3BBWA 2WU6A 2B55A 3IK3A 3QQGA 2NNWB 5AEPA 3NVKI 5M57A 1XH5A 1GZKA 2QU5A 4QDEA 1YW2A 2VGPA 2GFSA 2UZVA 5HU9A 5KKRC 5HEZA 3KVXA 2W1FA 4QMZA 4OT5A 4BDEA 4S2ZA 4C4EA 2PVYA 1M7QA 5CYIA 4DFNA 4DA5A 1OPJA 2QOBA 3D4QA 3VS4A 3QTUA 1OKWA 2IW6A 3SG9A 4XNEA 3HP5A 3UNJA 3TMOA 4GK3A 3AC1A 2ETKA 4FKOA 2W96B 4U43A 3HZTA 2UW7A 4JAIA 4LV8A 2HAKA 3R8LA 1I09A 2OF2A 4QMQA 1KUTA 4CZTA 4BN1A 3VW6A 2R3JA 2W06A 4JI9A 1KSWA 5L8KA 4AAYA 4MWIA 2QO2A 4FL3A 4V0GB 2IVTA 2XM9A 4I0RA 3VBXA 1U5QA 4BHZA 3W0OA 3R01A 4FYNA 4HOKA 2ZVAA 4X0MA 3ZO2A 3FBVA 4JDJA 5GZ9A 4PWNA 5AUWA 3AC2A 3QLFA 3R8PA 3BWFA 3CGOA 2KTYA 4D2WA 2RFNA 3KMMA 5HVJA 3PA4A 3PLAE 2OIQA 4X2FA 3UIUA 3OEFX 1WVWA 3LXLA 3U9CA 4NEUA 4QTBA 4BL1A 1W2DA 3HNGA 2W9ZB 5ACKA 2C5YA 2YEXA 4FTKA 4O27B 4UXQA 2OH4A 3CS9A 4ZSLA 5AR4A 4A9RA 3PY0A 4FKVA 4E20A 5I9VA 5T68A 3FMKA 2W5HA 1ZXEA 4EH8A 3MB7A 4BBFA 5GJGA 4E5BA 4O7ZA 3GFWA 3ZC5A 3UPZA 2O2UA 3UO5A 4M67A 3QALE 4JG6A 4QPAA 4EOPA 2ITVA 1GIIA 1GY3A 1YI3A 4DFBA 3DQWA 3FKLA 3EQRA 3KGAA 3OFMA 4YNEA 3BIZA 4JBVA 3FKOA 4FG8A 3AKLA 4N57A 3QD0A 3V6RA 4MBLA 4RJ3A 3IECA 3EJ1A 4B9DA 3CPBA 2YHVA 4YJVA 2OFVA 2GNGA 1YXVA 2P2HA 3DOGA 3QLGA 4FSMA 4UWYA 3WZJA 2R9SA 2X8DA 1KE9A 2WEVA 4I24A 4KKEA 2E9VA 3C5UA 3DTWA 4R8QA 3UG1A 3ZRKA 5AWMA 4I6BA 3W8LA 1JOWB 4XRJA 3ZBFA 4DEAA 1YWRA 3HX4A 3VIDA 4IVCA 1ND4A 4D4YA 3FY0A 5LVMA 4I3ZA 1SM2A 3CSVA 2UVZA 3DBQA 2J0LA 4KRCA 3FI3A 3KRLA 1OL2A 2BALA 3DCVA 3UDTA 3ORPA 3ULZA 1PW2A 3QC4A 3L9LA 5IF1A 4E4XA 4I1ZA 4RZWA 3A7FA 3AXWA 3DBCA 3R2YA 4DEHA 2XCHA 4IJ9A 5J8IA 4FT9A 5BVNA 3AC5A 2VX1A 4MXAA 5J5TA 5GHVA 3R7IA 4XCUA 5KMKA 4S33A 3UDBA 2QOQA 3DLZA 3O5AA 3CIKA 4JJRA 1NVRA 2XKCA 2QR7A 3DU8A 2R2PA 3ML1A 2R3NA 4TYGA 4GFMA 4ZIMA 2C1AA 3FHIA 4IC7A 4IX6A 4AE9A 4QMYA 3PG1A 2FSLX 4EQMA 2FB8A 5CVGA 5JFXA 4LV7A 3DT1A 3RWPA 4MH7A 4EK3A 3EFKA 4LMNA 4R3RA 3UOLA 2YWVA 1P2AA 1TZDA 2ETMA 5BQ0A 5C26A 3BLAA 2PZPA 1E1XA 1YHSA 3PWYA 5DA3A 3R04A 3ELJA 3I81A 4L6QA 2GFCA 4Y5QA 3T3UA 2XAOA 4MD8E 4IQ6A 4MKCA 3R1NA 5AP0A 2E9UA 4B8LA 4GKHA 4AOJA 4JBPA 4IVBA 5IQAA 5LMAA 4C02A 4ZTHA 3OY3A 4DCEA 5E8YA 4L52A 4EQUA 4EH7A 5AR2A 2SRCA 4V01A 3PUFC 5ITAA 4ZLOA 4TZRA 2BDJA 4G31A 4J1RA 4U41A 4HYIA 2J0IA 4XOYA 3MIAA 5CQUA 5ANJA 3EN4A 4FKLA 4XLIA 4CZYB 2ZB0A 3DDQA 4ZS4A 4FV9A 3KK9A 4RVLA 5HCZA 5FRIA 1YQJA 4RVMA 4YC3A 4EOIA 3AQVA 2XBJA 3I7BA 4LOOA 5BVEA 3ZO3A 5J1WA 4FA2A 4HJOA 3EN6A 3DJ5A 3ENHA 4YHTA 3AD6A 1U54B 4QYEA 3DNEA 4R1YA 5E9EA 3W0MA 2FO0A 2XEYA 3R2BA 5KX8A 2DWBA 3R7VA 1YKRA 5C8MA 5K0XA 5KMNA 2ETRA 4UYNA 2PE0A 3MVLA 3L1SA 4GK4A 3ZOSA 4BDDA 2F49A 1Q8TA 3GI3A 5EHOA 1IAJA 5E90A 1VYZA 4PTCA 3DTCA 2XYUA 3W0QA 4AUAA 3QTRA 2H96A 1WBOA 3WF5A 5DR9A 3FYJX 4PDPA 2X81A 3BRBA 2AUHA 4O38A 4IX4A 4CRSA 5JT2A 4W8DA 3VQHA 4ZMFA 5BX0A 1L3RE 4EH5A 3II5A 5HHWA 5L2WA 4DBNA 5IUHA 2O0UA 3LOKA 3QYWA 3CPCA 3CY2A 1MQ4A 2R64A 4KD1A 4L9IA 5CI6A 5B2KA 4MBJA 5HG8A 4BTKA 5H3QA 1GJOA 4TPTA 4J53A 5GZ8A 2CMWA 4GMYA 4EI4A 5FLFA 1NXKA 4U3ZA 4IE9A 3UDZA 2B1PA 3UNZA 3H0ZA 4E4LA 3U54A 2PYWA 2Z60A 3FKNA 2VTIA 3GQIA 3ORIA 3R1SA 4EQCA 4DCAA 1CTPE 1ZYJA 3IDBA 2RG5A 4F70A 4AG8A 3EQIA 2OJIA 3H9FA 3MTFA 3MVHA 3R22A 5FBNC 3U4UA 4YMJA 5DNRA 4O7LA 2ZV7A 4TYHA 4MBIA 4N6YA 4FKJA 5IEVA 1H1WA 2BRHA 2YN8A 2CGVA 3MY1A 3F3UA 5HGIA 5BPYA 4FNWA 4KBKA 4RJ5A 5HG7A 4QYYA 1URWA 3WYXA 4J8NA 5KMOA 1Q3DA 3MY5A 5AR5A 4IDTA 4X2GA 3ZUTA 3RAIA 4CKJA 1I44A 1AD5A 5AV4A 3GXLA 2G2HA 3NCZA 4F63A 1H4LA 3QCQA 4L00A 3ZH8A 3E8CA 1Z9XA 2XKDA 4NT4A 2VWXA 4BB4A 4FKSA 4FK3A 3D9VA 3QTQA 4IJPA 2W1HA 5HO6A 4XHKB 4ZTMA 3PXYA 2UW4A 2YISA 3GCSA 4BWKA 5L4QA 5EDRA 3FMDA 3ROYA 1UNLA 4I6HA 4JDKA 2Y4IB 1FINA 1YWVA 2GNJA 3ALOA 2H9VA 4HPTE 3SAYA 2G15A 1ZMVA 2VWZA 3E3PA 3ETAA 2R3PA 3QUEA 2C3KA 4GEOA 4UMTA 4UZDA 3TJCA 4D2TA 4E3CA 4EZ7A 5JRQA 3N4TA 2WPAA 2FSTX 3EQFA 4MAOA 3BEGA 4Q2AA 3R1YA 4OAUC 1Q8WA 4FUXA 4M69B 5KE0A 5TF9A 4PQNA 5E1SA 4UMUA 5LVNA 4DTKA 1LPUA 1JNKA 3V3VA 4HGEA 5HE1A 4TY1A 2JD5A 4QMWA 1GIJA 5KHWA 3Q2MA 3UPXA 4XX9A 3RGFA 5J7BA 4FTIA 4C4IA 5K9IA 1YI4A 2ONLC 2HWPA 5FP6A 2YFXA 4D2VA 3MW1A 2Z7LA 5JGBA 3N4UA 2VTQA 2YDIA 1FPUA 2WNTA 3Q4CA 3NX8A 3R9HA 3CY3A 4QP6A 1WBSA 4ASDA 2NRUA 1YRPA 2V22A 4XP3A 5F1ZA 3WBLA 5CASA 2R3KA 1A9UA 4HNFA 2OGVA 5JFWA 4G5JA 2A1AB 4YC6A 4J95A 1O6LA 1YOJA 5AAGA 3TDWA 4PY1A 3JVSA 4JIAA 4BICA 3Q4TA 4EBWA 3OD6X 2HW7A 3E64A 2J51A 5FUTA 1G5SA 3SOCA 5IH5A 5JMSA 3QUPA 3RI1A 4X3FA 3RJCA 5A46A 1M17A 3LXKA 2WMSA 2IVVA 2VO7A 2XM8A 2XNNA 5BVFA 3JR1A 4D28A 4RX9A 2XRWA 2CNQA 4GK2A 2G2IA 3ORMA 4YPDA 4GG5A 3D2IA 3R83A 4FTQA 5A4EA 3MA3A 4MHAA 3ZSGA 2WTDA 2IG7A 2FYSA 4JX7A 3LE6A 4DAWA 1LR4A 4NIFB 4K33A 4BKYA 1XJDA 3NGAA 3I79A 3FL5A 5M4FA 1JQHA 1ZOEA 3MVMA 5AV1A 2X6DA 4XG6A 2YABA 2QO7A 2IW8A 1VR2A 4BF2A 1ZAOA 3BYSA 3ZHPC 4FOBA 2W4KA 1UU8A 1DS5A 3FYKX 4FKRA 3CC6A 2C6TA 2HCKA 1H28A 4FIFA 4RQKA 1NW1A 3F2RA 2RIOA 3TUDA 2XIKA 4EOOA 4MXCA 5FDPA 2QR8A 3BYMA 4K11A 4C7TA 4EWQA 4R77A 3W16A 3QCXA 3EKNA 5HG9A 4FKWA 3VQUA 1YHWA 4CV9A 3EL8A 3KREA 5JFVA 2E2BA 3MH2A 5DR6A 1QL6A 3C0IA 3SW4A 4A4OA 5JH6A 3HEGA 3AT2A 3C50A 4D4RA 5AA8A 1MRUA 2JIUA 3KC3A 3A62A 3P78A 3PJ1A 4YLLA 5DGZA 3WIGA 4FBXA 4HGSA 4RT7A 4F9WA 2W4OA 4YJTA 2JAVA 4IX3A 3P5KA 2UW8A 2ZMCA 5E92A 4FIGA 3W55A 2EB3A 1H25A 3C13A 5HIDA 4O0WA 3TIYA 1PMUA 3G6GA 3RHKA 2YDJA 4DE4A 3H9RA 2PVLA 3KRWA 5M4UA 3JVRA 3LFDA 3QTWA 3QRIA 4FV2A 4PMTA 4CMOA 1PKDA 5CT7A 1YVJA 4MQ2A 4AQCA 3HAVA 3UBDA 4FOCA 4BR3A 2OW3A 3I4BA 5AUXA 3VNTA 5DEWA 5CSVA 3R9NA 1ATPE 1BKXA 3VONA 1W98A 3ACJA 4KKGA 5H9BA 4O7SA 1SMHA 3FQHA 3LMGA 4DHIB 3P7CA 4CZUA 4AE6A 4TNDA 4BDGA 1IG1A 2BRGA 3KVWA 3MGYA 4RIWB 4F9YA 3VUGA 3P9JA 4RFYA 3BYVA 1YI6A 3W2OA 4BDBA 2RFEA 1WBPA 3G9NA 4D0XA 4Y8DA 3UNKA 4J98A 5LARA 3GC0A 1MUOA 3WF8A 2BFYA 3S95A 3LMHA 3CP9A 3Q6WA 4RWIA 3FZRA 4C38A 1SYKA 3PXKA 4LG4A 2R0UA 4ZTRA 4QQ5A 4I20A 4PMSA 4FTAA 4GFGA 2EVAA 4M0ZA 4E7WA 2V55A 4C61A 5JZNA 5HO8A 4RIXA 1Q3WA 2VWIA 4UMRA 1UKIA 2WTKB 4RC2A 5K4IA 2WMVA 2REIA 4PTGA 2I0VA 4O7RA 3S00A 4KIKB 4IHPA 4BIEA 3PE2A 3A7GA 3NR9A 5J87A 2Z7QA 2XP2A 3PXZA 3CKXA 2ZAZA 3EQGA 4NM3A 3UIMA 5HO7A 3ROCA 2FH9A 3AOXA 4A4XA 3EH9A 3FLYA 4QMXA 3UGCA 3E93A 4EOJA 1PXLA 5FEQA 4ZY5A 2OJGA 1G8AA 4ZJJA 1Q5KA 4RIYB 4XP2A 4JG7A 5CAVA 4DC2A 5IQFA 1JWHA 3UOKA 2ZV2A 2R7IA 3BHUA 3W2SA 4IADA 4G9RA 4CTCA 2FSOX 4IACA 5LWMA 4DG2E 5HKMA 3KB7A 4G3GA 5L2SA 4RWLA 3F66A 3MESA 3UMWA 4AZTA 2YWPA 2VWWA 4MXYA 5AJQA 3SRVB 1UU9A 4LMUA 5FTOA 4UB7A 2ITTA 1ZARA 3IDCA 3QTZA 3QTXA 4YSJA 4GVJA 4AQKA 3QGWA 1P4OA 1Q61A 4O4BB 3PJCA 1OPLA 4RIOA 3O96A 5AUZA 2O65A 1W2CA 2DS1A 4TYIA 2VX0A 4HVSA 4Z16A 5TOZA 1O9UA 4FEXA 2WU7A 3TCPA 4YJPA 4QMOA 3U6HA 2B9HA 2BRMA 3Q4ZA 3UTOA 3HLLA 2DQ7X 4BZNA 4A9UA 2Z02A 4U8ZA 3VHKA 4GUEA 4F1TA 4U6RA 3R8ZA 1REJA 5CXZA 2WMUA 3OXZA 4XBUA 2I1MA 1M14A 2PE2A 4UBAA 4BCQA 2PULA 1REKA 4K8AA 2PZ5A 4IH8A 1YXSA 4MEDA 3QCYA 1BYGA 1W2FA 4HPUE 5BYZA 4BGQA 3O17A 4M84A 4J99A 3GOKA 5HE3A 4JQ8A 4M7IA 4N70A 2QOFA 4W8EA 5HE2A 3FEGA 4PNKA 5HORA 5AP4A 1OVEA 3SKCA 4O83A 4XJ0A 2R3FA 5CAUA 1ZYDA 1PJKA 2QNJA 4KINA 2HXLA 2VUWA 4IWQA 4IZ5A 4YTIA 3LKMA 2HZIA 4MCVA 3NUYA 4QQJA 3TI1A 3L8SA 1DAWA 2R3QA 3EB0A 4Y73A 3W10A 4NU1A 2XCKA 3WZDA 4I92A 3QFVA 4AA4A 4ACHA 3LIJA 3HV7A 4GIIA 4GG7A 5FBOA 4AA5A 2ITQA 2JKQA 4FVPA 1R3CA 5M44A 4FX3A 5KKRB 1OIUA 3DFCB 1OKYA 2GCDA 4C3FA 4I93A 3OW4A 3DPKA 5GJDA 3ZFMA 5AIRA 5AV3A 4O7NA 3WZUA 3FQSA 2OXXA 4ZSJA 3O51A 2PUPA 3V8TA 3BELA 4E6CA 1Y6AA 4IAZA 4ZSAA 3A8XA 3HL7A 4O22A 4AT3A 4APCA 1ZYCA 4EONA 2BHHA 2Q0NA 2YIXA 2X7OA 1H24A 4RA4A 5HTIA 1UA2A 2XUUA 3A2CA 3CCNA 3VVHA 5L6OA 2I7QA 4M68A 4KS7A 2WMBA 2W5BA 3KMWA 2IJMA 4BCFA 4KKHA 3I0QA 3WF6A 4R7BA 1H1RA 3I60A 3WE4A 5KUPA 4AGUA 3NYXA 3DK6A 3DKCA 5IA1A 4JX3A 2OIBA 3F7WA 4DH7A 3Q2JA 4MYGA 3KULA 4QNYA 3RM6A 1YXTA 5EHLA 5FQDC 3OWJA 5EDQA 4QMLA 4UZHA 2W9FB 4EK8A 4CFNA 4JOAA 1Q4LA 1PXJA 4S32A 4XV3A 4BIBA 4I0SA 3VN9A 4Z55A 4R78A 3V04A 2PVKA 3MN3A 2I40A 3CLYA 2P0CA 4E6QA 4EWHA 3ODZX 2ZDTA 2CCIA 3MPAA 2YZLA 4C36A 3R6XA 4IXPA 3FI8A 2UZOA 2QHMA 4C4HA 2NRYA 4F7LA 4WNOA 3O2MA 1OECA 5L8LA 3VUIA 4MNEA 2QCSA 3COMA 4B8MA 4Z7HA 4JXFA 3QA0A 5JRSA 1UNHA 5FXSA 3FLQA 3VBTA 4AXDA 2QG7A 4CCUA 5IISA 4FEWA 5D11A 1J91A 4OTIA 3H30A 2HWOA 4A06A 4DEEA 4RFZA 4AN9A 2JITA 3E8EA 3PWDA 2IVUA 3MS9A 4J71A 1KV1A 3P23A 3DXQA 4EOQA 5HG5A 4EOMA 1J7IA 2Y6MA 5HBHA 3MFTA 4FEUA 3AKJA 4AXFA 1XBAA 4XG3A 1OUYA 4KA3A 3ZCLA 2C0IA 3SHEA 2JBOA 5IZFA 1UU3A 5KZ0A 4E5WA 4BCIA 3RHXA 1OIQA 4IC8A 3ODYX 2HELA 4BZDA 2XJ0A 5IEYA 2X4FA 2W7XA 3DJ6A 3O0GA 5J5SA 3W0SA 5C4LA 2BMCA 3R8VA 3CE3A 4FKUA 2WTVA 4L7FA 3LFFA 5E8TA 4FIIA 4O0UA 3VS0A 1XQZA 1T45A 3Q9XA 1J1CA 4ITJA 4FT3A 3TNWA 3D5XA 4GS6A 4O4DA 4OTWA 3OHTA 3E92A 3C4FA 3IG7A 3QZFA 4XS2A 3W0PA 3MDYA 3ORXA 5IKWA 3RINA 2O3PA 3AMAA 5FEEA 1JLUE 4G17A 4CLJA 3PFQA 3KRRA 5AP6A 4ITHA 3ZLXA 4C37A 3DB6A 4FC0A 3MTLA 4E1ZA 3HRCA 1IRKA 2JFLA 2G2FA 2BRBA 2OK1A 2CNVA 4OBPA 3BU5A 4FNXA 5DVRA 5ETIA 5F20A 2YJSA 2UVYA 3POOA 4B7TA 4OBQA 3VS7A 3D5WA 4IWDA 4WHZA 2IPXA 4PP7A 1ST4A 3BU3A 3QRUA 1RQQA 3PVBA 5I3RA 2XKEA 4WUNA 4YTHA 3F5PA 2UZTA 1XKKA 3DBEA 4ZMEA 3OF0A 4FV8A 3KF7A 2YCSA 2AC5A 4YZCA 4FSRA 1P5EA 2JC6A 3HV3A 1IA8A 3GCPA 3LW0A 3FMHA 2OJFE 5CVHA 4ANOA 5I9ZA 4O0SA 1SNUA 5M4CA 4M8TA 5BVKA 3AT4A 2OJJA 1PXKA 5CY3A 4DF3A 1YWNA 3DZQA 3RCDA 4RVKA 4D58A 3OCTA 4BDJA 4DDGA 3A7IA 2ZYBA 4BTJA 4C34A 5HICA 2OO8X 4XV2A 4E4NA 5KMIA 3OUNB 4CFXA 1VZOA 3D7TB 3KCKA 2WHBA 2G1TA 3CQEA 3N9XA 3IW4A 2QU6A 3F6XA 4FT7A 4J52A 1Q24A 3FE3A 4OLIA 5DEYA 3C4WA 3GCQA 3Q5IA 4WIHA 3THBA 3ANQA 3V5LA 3CTHA 2PVFA 3QWJA 3PE1A 2GU8A 2CSNA 2X0OA 3DY7A 2OG8A 2X2KA 4QD6A 5ANOA 3R9DA 4QYFA 3QZHA 4XV9A 4C33A 5HIEA 5DT3A 5IG1A 4GIHA 2Z2WA 2V0DA 3S0OA 5HVYA 2ITYA 2PMNX 2XNEA 2R3IA 3VS6A 1KV2A 4CV8A 2BVAA 1OM1A 3NAXA 4QQCA 2CN5A 4BCMA 3GOPA 4FEQA 5IQGA 4HVGA 2B9JA 3GUBA 3RTPA 3KEXA 3TACA 4AU8A 4H36A 3BGPA 1Y6BA 1G3NA 2OZAB 4CYJA 2WMXA 4HCUA 4K9YA 1H1SA 2B9FA 4O4CA 2PSQA 2CJMA 3PSBA 3TYKA 4AFJA 4ASZA 1DM2A 1M7NA 2ACXA 3UIBA 5G1XA 1FVRA 5AX3A 3QAME 5BVWA 2HY81 4W4WA 3WYYA 2ERKA 3ZO1A 2Z7RA 5DHJA 3TWJA 3S4QA 4F9AA 3LFEA 5DMZA 2IF8A 3QD3A 5IH4A 4YGAA 3D83A 5CNOA 5AR8A 3PLSA 4O6LA 4FK6A 3UVPA 4M12A 5EG3A 4AZWA 4NFMA 1OBDA 4PMMA 4IDVA 1P14A 2X7FA 4GU6A 5ICPA 5BVOA 3DXPA 4ZJVA 4OT6A 5CI7A 3NNUA 3PP1A 4EKLA 1R78A 4C0TA 4O7VA 2ZM1A 3FSKA 1OKVA 4HGLA 3TTJA 4X7QA 5K3YA 3KMUA 5IA2A 3M42A 4FZ7A 4USFA 4D1XA 3FXWA 5E8ZA 3KCFA 5JN2A 4X6QC 3SW7A 2H34A 3OXTA 4DEBA 2GNHA 1TQIA 4YZDA 1OL7A 2W1EA 4I5CA 3OT8A 4DH3A 4KBAA 4YZMA 4DFLA 3NFGB 2C1BA 4O84A 4O7YA 5FXRA 4DTBA 4R5SA 2WMQA 3DDPA 5CX9A 3O7LD 3OG7A 5D7AA 5H2UA 2Y7JA 4FTCA 4NKAA 3UYTA 2VNYA 1F5QA 2PWLA 5HD7A 3FLNC 1JVPP 4LOQA 2X8IA 5HTCA 4A9TA 3HP2A 4O21A 2UZDA 4YBKA 3PJ3A 3EL7A 3KFAA 3IO7A 4RX7A 4U0IA 2WTIA 4FV6A 4K2RA 1FGIA 4MQ1A 3DV3A 4BDCA 3ATTA 2XALA 2LAVA 3FI2A 4YU2A 4PDYA 3AC3A 1NY3A 3GCVA 4HYUA 4IM2A 4YJOA 3I6UA 2IN6A 3JYAA 4WG4A 4E5AX 4FG7A 1PYEA 4O4EA 1ZLTA 4UMQA 2YM5A 4G3EA 3OBGA 3DQXA 3PRIA 1Y8GA 3ACKA 4EH4A 5AX9A 5CEIA 5FM2A 3V5TA 5BV3A 4G9CA 1BX6A 2XA4A 2IO6A 1TFFA 4DTAA 4DH5A 3DZOA 1PMEA 4BBMA 4EC9A 2GHLA 2CGUA 3B2TA 4UY9A 4XG9A 3ZEWA 4D5KA 4DG0E 4BJJA 3ALNA 3E8NA 1JAMA 4IM0A 4R3CA 4CQGA 2BTSA 5B0XA 4DH1A 4ZSGA 4RJ7A