4U80A

Mek 1 kinase bound to g799
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
319
structure length
286
Chain Sequence
MELKDDDFEKISELGAGNGGVVFKVSHKPSGLVMARKLIHLEIKPAIRNQIIRELQVLHECNSPYIVGFYGAFYSDGEISICMEHMDGGSLDQVLKKAGRIPEQILGKVSIAVIKGLTYLREKHKIMHRDVKPSNILVNSRGEIKLCDFGVSGQLIDSMAVGTRSYMSPERLQGTHYSVQSDIWSMGLSLVEMAVGRYPIPPPDAKELELMFPPMAIFELLDYIVNEPPPKLPSGVFSLEFQDFVNKCLIKNPAERADLKQLMVHAFIKRSDAEEVDFAGWLCSTI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/transferase inhibitor
molecule keywords Dual specificity mitogen-activated protein kinase kinase 1
publication title Structure based design of novel 6,5 heterobicyclic mitogen-activated protein kinase kinase (MEK) inhibitors leading to the discovery of imidazo[1,5-a] pyrazine G-479.
pubmed doi rcsb
source organism Homo sapiens
total genus 86
structure length 286
sequence length 319
ec nomenclature ec 2.7.12.2: Mitogen-activated protein kinase kinase.
pdb deposition date 2014-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4u80A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4u80A01
4ZP5A 2IZRA 3E8NA 3H9OA 1FMOE 2C69A 4FZAB 3BU5A 4G3FA 5I4NA 3W33A 4BDFA 3VAPA 2ZMDA 3O8UA 4IQ6A 3W2QA 4DFUA 3TZMA 1UNGA 4JDIA 3TNIA 1VR2A 4CXAA 4DTKA 3EFWA 1DI9A 4IX6A 4EZ5A 4S31A 4I41A 3QFVA 3QTWA 3O0GA 2B1PA 1Z57A 4AE6A 1ZYCA 3F69A 4GG7A 4H39A 5KMNA 4MNEB 5IMEA 1P2AA 3LFSA 5DHJA 4ZZNA 5K5XA 4L43A 4QMWA 2JFLA 3K5UA 2VTMA 3PYYA 5G1XA 2PVKA 3UIMA 4E5AX 5IDNA 2BALA 5CWZA 2JDRA 2B4SB 2BAQA 4BCJA 5B2LA 5GHVA 3IOPA 3M2WA 5HE2A 4KB8A 4JBQA 3A2CA 4Y83A 3QTXA 3GVUA 2P33A 1SNXA 3Q32A 4PL4A 1KE7A 2UZTA 3V5PA 1ZWSA 1M52A 3MFRA 3MJ2A 4ZTSA 2WEIA 2A2AA 3HDMA 4PPBA 2PMIA 2PVJA 4GFOA 4C8BA 5AEPA 1JVPP 2UW9A 3NYOA 3B8RA 5CU4A 4EH5A 4N0SA 4YZCA 2OJJA 2C6IA 1UU7A 3QWJA 4FV3A 3ZBXA 3Q96A 4EQUA 3DJ6A 1YXUA 5AUVA 4X21A 3SG8A 4JQ7A 4A4XA 5EYDA 4DYMA 2YCSA 5HTCA 3I7CA 1DS5A 4KAOA 4O27B 3NRMA 4NTTA 4X2NA 4M84A 5HE3A 3V04A 4FIEA 4C3FA 2VX0A 4QP9A 2XUUA 1GZOA 4FSMA 2ZM1A 4XJ0A 3A7HA 4QMYA 3DZOA 3KQ7A 4RVMA 4B6LA 2F7XE 1MRYA 2PE2A 4HPTE 3RMFA 4TW9A 3R7IA 3BYVA 5EQYA 4FNZA 1OB3A 3LVPA 3QHWA 4UZHA 1DM2A 5AWMA 3WZJA 3COKA 3MY0A 1J7LA 3VW6A 3WARA 2BR1A 5IQIA 3VWAA 3VBWA 3ZDIA 4HPUE 4BI0A 3PPZA 1XH6A 3ZM4A 1EH4A 2IVUA 3DTWA 5EM7A 3MV5A 2CSNA 3NGAA 3W1FA 4R7BA 3NUPA 1Y6BA 4FK3A 2J51A 3RJCA 3V6RA 2XIYA 1P5EA 3FBVA 4PP7A 4H36A 5A46A 4YTFA 4OTPA 4RGJA 2FSTX 4IAIA 3LM5A 3R8MA 2GCDA 3RK9A 3WF9A 4ACGA 3BGQA 3ZO4A 4O6EA 2VTQA 3PVGA 3O71A 1U5QA 2YCFA 4V0GA 1PMUA 2YM4A 1Q41A 1OGUA 2WIPA 2XNNA 3HRCA 3TWJA 3VUTA 3NWWA 5CF4A 5HVJA 5I9XA 3TEIA 2HK5A 3PWYA 4R8QA 4ZJJA 4ZLYA 4XNEA 3V01A 4FGRA 3QQKA 1OBDA 3P86A 1YOMA 3R1SA 4JIKA 4D1SA 3EN6A 3GC9A 3UDBA 5EYCA 5DT0A 2BRHA 5LVLA 3TIYA 1H01A 2BMCA 3GOPA 1YWRA 4BDCA 2OI4X 2UW0A 2YZAA 4O91A 2HXQA 3LQ3A 4JT3A 2GPHA 5AAGA 2Y8OA 4DEBA 4GKIA 5CEOA 3LFFA 3NCGA 3GCPA 4FTAA 5L2TA 4C3PA 4YURA 3BKBA 3HDNA 4DEHA 4EH4A 3I5ZA 3Q52A 3MB6A 4FTJA 4GEOA 3RI1A 1XR1A 5KUPA 5BMSA 5IQFA 1GY3A 2VTOA 3A61A 3CTQA 4QMMA 3UZPA 2GHMA 4IWQA 4EUTA 4TYGA 5ANOA 3C4FA 4AOIA 2FB8A 4FV8A 4Q5HA 2RSVA 4AZFA 4R78A 4IJ9A 3R8UA 5AFVA 3COHA 3KVWA 5AUUA 5CSHA 5FM2A 1H26A 4A06A 4C4FA 5CTPA 4D2RA 2A1AB 3CTHA 3DQWA 2VWIA 4EBVA 4EBWA 4EK6A 2RIOA 5DR6A 2VNYA 3CS9A 4MXCA 2QG7A 5HKMA 2WTWA 3IGGA 4UN0C 3QTZA 3P08A 2YIWA 4AN9A 2XM9A 5F20A 4ZEGA 4ZY4A 4CV8A 2R3IA 4FIGA 5ETAA 4LMUA 2FSLX 2QD9A 2W0JA 4YR8A 4RG0A 1ZYJA 2UW5A 3HKOA 4JG8A 4YJQA 3ZLWA 3UQFA 3G9LX 5T3QA 4E8AA 3C4ZA 4DE4A 4JX3A 5I9VA 1JQHA 4W8EA 4C4HA 4CFUA 3TDWA 4JI9A 5CT7A 4DFZE 3EFKA 4F6SA 3OHTA 4NFMA 2H96A 2UZDA 4A07A 3OOMA 2BVAA 4A9UA 4G3GA 2Y4IB 3D2KA 1UU9A 3H3CA 4O1OA 5EG3A 3RPSA 2GS7A 2Y9QA 3F3ZA 3R8ZA 1IRKA 3BHVA 3OD6X 4I22A 2PPQA 5IA3A 4XLVA 1PKGA 1WZYA 3BBWA 3FSKA 3KCFA 2PE1A 5DRDA 3QRJA 3MWUA 3SGCA 3DXNA 4FKOA 5HBHA 4BZNA 4RJ6A 5EDPA 5GZAA 2YZLA 3ZC6A 2VUWA 5B2KA 1YWNA 2NO3A 2ACXA 4W4YA 3D5UA 3DFCB 2GHLA 3OT3A 3Q9YA 4J96A 4H05A 5J5TA 3T3VA 3DAEA 1P4FA 5LARA 4JXFA 3EL7A 3TACA 1G8AA 1O6LA 1W82A 4FIIA 4G5PA 3FI8A 3UOLA 3GEQA 2WOUA 4FSUA 4QP7A 4AZTA 5J9ZA 5LCJA 1XH5A 2IVTA 2WELA 5C03A 3MIAA 2QHNA 1KSWA 3ZRMA 4DCEA 3HECA 2Z7QA 1APME 3AC5A 3EIDA 3RPRA 3CD3A 3FJQE 2GQSA 3SAYA 5KE0A 2R3RA 2Y0AA 1BI8A 3CJFA 3AMBA 3EYHA 4ZTLA 4DINA 4QP2A 5TR6A 4EOMA 1PXIA 2JBPA 4GIHA 4TWCA 3SX9A 2PUNA 5CT0A 4CMTA 5C4LA 2VTIA 2IWIA 2HW6A 4EZ3A 4L9IA 4F7NA 3OTVA 2P0CA 2CGVA 2A4LA 2VTJA 5EM6A 4Z55A 4FKQA 4AFJA 5IH4A 2ZAZA 3BLRA 3I6UA 2PL0A 2HY81 2XK7A 4WNKA 4ANBA 3LCSA 3HRFA 4F9AA 4USEA 4UV0A 3UNJA 1PMVA 2QVSE 3AG9A 1CM8A 3L8VA 2CN8A 3OC1A 4YPDA 2OJFE 5BVNA 3ZHPC 5AV1A 2C6KA 4G2FA 3KB7A 3TZ7A 5IA1A 3WZKA 2XRUA 3MA6A 4FKJA 2W1CA 5C26A 1OITA 3QYWA 1U4DA 5IDPA 5ACBC 3VJNA 4ARKA 3ORKA 3A60A 2BIKB 5DR2A 5HG5A 3OF0A 4EKLA 3D14A 3F6XA 5ANJA 4E73A 1FOTA 1SMHA 1OPKA 2VN9A 2WD1A 3IGOA 4IAFA 4UXLA 5CS6A 3U9CA 2PMOX 2XIXA 1GIJA 5E4HA 4E5BA 5HG8A 1X8BA 4C36A 3R7GA 1ZARA 3G33A 4L45A 3SA0A 4HGTA 1GOLA 2W1IA 2YHVA 4YO6A 5E91A 2UZBA 3TL8A 1B39A 3FZRA 5ANGA 3PRIA 3R30A 3CBLA 4AX8A 4EH9A 1SVGA 4LFIA 4BDIA 5JMSA 3KVXA 4Y5HA 4BHZA 5CU0A 2GMXA 5DGZA 4IW0A 3OWKA 4EWQA 4C4EA 2PK9A 3PXKA 3EYGA 4HNIA 4I20A 4EK3A 4F7JA 4UWCA 1IG1A 3AMYA 5DNRA 4WBOA 1MP8A 1ZLTA 3DBDA 4O96A 3FEGA 5J9LA 4CZUA 4TYHA 5FXSA 4P7EA 3QC9A 2QR7A 4MVFA 5IG1A 3Q6UA 3LLTA 3MPMA 3V5JA 2UZNA 5DPVA 1ZZ2A 4JRNA 4BIDA 3SVVA 1WFCA 3ATTA 3CIKA 1AQ1A 4RIXA 3O2MA 1Q8ZA 4FT7A 4XV2A 5DA3A 4AACA 4YC6A 4NIFA 4BWXA 3AT2A 3LZBA 2R3MA 3DBFA 3QHRA 2XBJA 3R1NA 1WBNA 3IDCA 3LFDA 3SOCA 2IVSA 3EL8A 3U6JA 3HA6A 2UUEA 4NJDA 2G1TA 1ATPE 3N51A 2F2CB 3OZ6A 4UYAA 3V8SA 2WXVA 4C4GA 1KV2A 5I5ZA 3QTQA 4X3FC 2RKUA 2XNPA 3K3IA 3OEZA 3BGZA 4MTAA 4TT7A 3KREA 4G6OA 3PXFA 4RA5A 5KO1A 4EOIA 1WBWA 5KKRB 2O0UA 5JH6A 5M4FA 4IVBA 3EQPA 3MH2A 1OIRA 5CAUA 2V62A 4FV6A 3DQXA 5EHOA 4OTFA 3L8SA 1UV5A 4FT9A 4E1ZA 2UVXA 1PJKA 3D7TA 3MVHA 3RCJA 2B9FA 5JQ5A 4U0IA 3U8WA 3VUIA 1Z5MA 1JNKA 2Y6MA 3JYAA 2W99B 1J91A 3IKAA 4FTOA 4D2PA 4F9YA 1J7UA 4O0UA 2GNJA 2JDOA 3HVCA 2OXYA 4E4MA 1ZAOA 3W8QA 3GBZA 4NM0A 2O63A 4A9TA 5JQ8A 2ITTA 3GFWA 3KK9A 4YJNA 4FI1A 4D4YA 2GNGA 3RZBA 2GNFA 4C33A 2QOBA 4C59A 3LW0A 3WI6A 3OWLA 2P55A 4H3BA 3OCBA 4AG8A 4I0RA 4J1RA 4L7SA 5FBNC 1FBNA 4FT3A 5E8ZA 3BE9A 5AUZA 4EOSA 3BELA 3MH1A 3ZUTA 3GC7A 4D58A 4QMUA 3CKWA 4M66A 2EWAA 3CD8A 3I0QA 4OTRA 2ZB0A 3PP1A 1W98A 3TV7A 2WEVA 4UMPA 2WKMA 3U6HA 2AUHA 3QQLA 4D0XA 4UX9A 1PXMA 1MQBA 5HNGA 3QQGA 1LUFA 2RG5A 2UZEA 5HBJA 3A7FA 3QZGA 5AUYA 2F2UA 3DBEA 3Q4UA 1PMNA 4LM5A 5HD4A 3EN9A 4F0GA 5B2MA 5AP3A 3MESA 2HWPA 3QAME 4BYJA 5BMMA 4ZLOA 3KRWA 4AW0A 2CJMA 1BL7A 4U80A 4XCUA 5DVRA 2HY0A 4YO4A 4EL9A 3DNDA 3O51A 5DFPA 4C02A 4JQEA 2BTSA 3D83A 4LRJA 4XV1A 5DEYA 2Q0BA 2OBJA 4QMSA 5FEQA 3VUDA 1JSTA 2R5TA 5EI6A 5FG8A 4BKYA 4BRXA 1B38A 3FI3A 3LFNA 4GG5A 2QOFA 4G6LA 2X9FA 3JUHA 4GT4A 4OUCA 2WIHA 4GJ2A 3UGCA 4DGOA 3FUPA 2XK6A 3KKVA 4R6VA 5J87A 3HAVA 2IO6A 3EN7A 5FD2A 3TZ9A 1Q8WA 2ZOQA 2NRUA 2ZB1A 4YJSA 4F6UA 5BYZA 3SXRA 4BZOA 4G5JA 4YPSA 2X7OA 3NSZA 4XP3A 5E8SA 3ZRLA 4B7TA 4PTEA 4AZVA 1XJDA 4FGBA 5LWNA 3N4VA 5KHWA 3S95A 2E9VA 4ZJVA 4R7HA 2WO6A 4FTNA 2XIKA 5KMJA 1OIYA 2WU7A 2ZMCA 3BEAA 2UW3A 4PV0A 3BHHA 2UW8A 2X4FA 3CY3A 4PQNA 5DWRA 3S2PA 5DG5A 3QRKA 3NUSA 5L2IA 2YM5A 1CSNA 2JAMA 3KXNA 3WE8A 4O84A 2I0VA 3RAKA 3QD0A 4XBRA 4B4LA 4D5KA 2PULA 2QI8A 4GRBA 1DAYA 3GU7A 3O8PA 3PTGA 4FSWA 3ANQA 4HCTA 2J5EA 3OWJA 4IZAA 5CQUA 3TNQB 4JJRA 4XOYA 3ODZX 3QUDA 4P5QA 4QP6A 1YXVA 4FL2A 4IE9A 3CXWA 3ULIA 2ZV2A 4BKJA 5BUIA 4ASZA 3VHKA 4KRDA 4XG7A 4EOJA 3GI3A 4KIKB 1UA2A 4JBOA 2EXMA 2XIZA 2OJIA 5EQEA 2HOGA 4R1YA 3NZ0A 4YLLA 1SM2A 4ZY6A 4U6RA 4CT1A 4DH8A 2OXDA 3BX5A 4NCTC 4DEIA 2OZAA 3LLAA 1H0VA 3GB2A 4QT1A 4IHPA 4EQMA 4XRJA 3P0MA 2WTKC 5CNOA 5HLNA 4C62A 5CZHA 4ITHA 5BNJA 3O8TA 1QPDA 2OW3A 2UZOA 4X3FA 5AP5A 5CSPA 3VS4A 4YP8A 3O23A 2DYLA 1F5QA 2QO2A 5LMBA 4XH6A 4GUEA 3R7UA 4K8AA 4HYHA 4IB0A 3PA4A 3G9NA 4FKTA 2WMSA 3EWHA 3QCSA 4KA3A 1Q61A 1PKDA 1WBVA 3WYYA 3ZCLA 4E7WA 3F2NA 2QNJA 4MEDA 1H1QA 3UNZA 4CTCA 2O64A 4NSTA 4FG8A 4QMPA 2WMVA 3LCKA 4U97A 4IC7A 1TQIA 2B52A 2Y6OA 4H1MA 4OGRA 3EZRA 4FTLA 2H9VA 3AGLA 4WRSA 1H1SA 3FXXA 2W1GA 5AV2A 2BPMA 1R0PA 5HCZA 1FGKA 4HVDA 4FG9A 5CENA 4F7LA 5C01A 3VS0A 1FQ1B 2E2BA 4U5JA 3P1AA 5J5SA 3R02A 3E92A 2YITA 4YZDA 5DT4A 4TL0A 4RX5A 5AX3A 3R71A 5LVNA 3O7LB 4FKLA 4IB1A 3Q3BA 3ETAA 5EH0A 5HU9A 4I6FA 1B6CB 3NVMB 4JQ8A 4GVAA 4PTGA 2C1BA 2OJ9A 3FPMA 3WZDA 4C34A 2YIXA 4O1PA 2P2IA 2OG8A 2ERKA 4JIAA 5A4QA 3D0EA 4O7YA 2RL5A 4XG9A 2HENA 2PUIA 2X2LA 4QP1A 3ZEPA 2QU5A 4HGSA 1PYXA 3IG7A 3NDMA 3MFUA 3SLSA 3VS5A 3ZO1A 2B9JA 3BBTB 3VUGA 4ONAA 1Y91A 4Y46A 1JSVA 3A8WA 3PJ8A 5DT3A 4AN3A 3F3TA 4QPSA 4CV9A 4TTHB 3U54A 3FKLA 3P5KA 1MRUA 5LVOA 3OROA 4N6YA 3IW7A 4UMTA 4FTQA 2QC6A 5AP1A 3UOKA 3P7BA 2C6TA 4CFWA 4B8MA 4U8ZA 2FYSA 2IZSA 5AUWA 3EQFA 1OI9A 2IW9A 3VF8A 2WFYA 5CU2A 3BLQA 4RQKA 2YA9A 4BTJA 4QYFA 4B99A 5JZJA 1JOWB 5AIKA 4FOBA 2ZV8A 4H58A 4TNBA 3SRVA 3ZLYA 5M56A 2VTSA 2QR8A 3BHTA 4MD8E 1ZOGA 2BTRA 2E9NA 3AC1A 2W96B 3HRBA 4V01A 2OZAB 3GGFA 1XBCA 2C6DA 4TYIA 4N6ZA 4AGUA 5H2UA 3ORMA 4H3PA 4KSQA 3WOWA 4QQJA 1BLXA 3E8CA 4AWIA 4L44A 4LOQA 4O86A 3O50A 3WF7A 2BILB 3UIXA 4D2SA 4IIRA 5HX8A 4USDA 5BVOA 3QA8A 3CP9A 4PPCA 3RHXA 4YLKA 2QODA 4PDOA 4HVGA 3DAJA 4OLIA 1BI7A 4S32A 5CY3A 3RWPA 3M42A 3FL5A 1YVJA 3DS6A 2FH9A 2PZPA 3PDTA 4AA4A 5CF8A 3MA3A 4PL3A 4L3PA 1LEZA 4DITA 4ZXTA 5A54A 2PVRA 4O82A 3NMUF 4RFYA 1U54A 5AP2A 1CKPA 3OCSA 4DG3E 4I6QA 4NH1A 5EDRA 4UMUA 5JFXA 4M0ZA 4I24A 2FSMX 2X6DA 1A9UA 3QF9A 4J52A 4AQCA 2JITA 2YIYA 3TNHA 5BPYA 3AC2A 4MF1A 4YJPA 4KIOA 4HJOA 1E9HA 5H8GA 3FLSA 5AV0A 1VEBA 3KULA 1IAHA 4J53A 2X1NA 3WF5A 1KV1A 3P7AA 2QU6A 3QQJA 4BGQA 4FUYA 4TWNA 2PZYA 4DAWA 2YEXA 3GU8A 4RFMA 4X6RA 1YXXA 4U79A 3ZS5A 4GT3A 4ZY5A 4GYGA 3KN6A 1OMWA 2WOTA 4EI4A 4O0RA 1PY5A 3TUCA 4ERKA 2QLQA 3QUEA 3ZC5A 1G3NA 4WA9A 3R7VA 4IVDA 5E8VA 4EORA 4RWJA 2JIUA 5CXHA 2GNHA 2UW6A 3LIJA 2P2HA 3MI9A 4OBPA 5AX9A 4L3LA 4II5A 3DNEA 3PJCA 3UJGA 2JKOA 4CNHA 4F1TA 5L4QA 5DYJA 3BV3A 5J1WA 4EH7A 4E6CA 3DK7A 4NFNA 2BUJA 1UWHA 2X9EA 4IMYA 3QLFA 4E3CA 1OIUA 1RDQE 3Q4TA 4BZDA 4E6AA 5IZFA 5E9EA 2ESMA 2BKZA 2I6LA 2DWBA 5CAVA 5CX9A 3ZDUA 3E87A 2WTJA 3L8XA 1STCE 3LFEA 4IWOA 4RPVA 4YBKA 3UIUA 2F7EE 5CF6A 1BUHA 2OO8X 4J71A 5ANIA 3KCKA 3HV6A 4FTCA 2R3JA 4MYGA 4X2FA 1W8CA 4WHZA 2ERZE 4FKVA 4CLIA 1J7IA 2REIA 2ZV9A 4AN2A 5HO6A 5IH5A 5D12A 1Y8YA 3SRVB 4G9CA 5LMAA 4FSRA 5M4IA 3DXQA 4Y95A 5HNBA 2PYWA 3L9MA 5D41A 1UKHA 3R9NA 4YUQA 4CFMA 3ID6C 4LI5A 5FEDA 3AQVA 2QOCA 3IDPA 4X7QA 2GQRA 4MBLA 5EKNA 5IQHA 1V0PA 2I40A 4FTIA 3F5XA 1H1RA 2G15A 3U9NA 3LMIA 2VV9A 3FZSA 3NYXA 5AUXA 4TYEA 3TKHA 3FKOA 3BWJA 5DN3A 3BGPA 3RK7A 3M1SA 3C0IA 5JT2A 4EHVA 1J3HA 4KNBA 2SRCA 3L9LA 1A48A 5KNJA 2VO0A 2PMLX 2B55A 3KXZA 2JAVA 4O2ZA 3MN3A 3PG1A 2CGWA 3A99A 3VJOA 3ZO2A 5CYIA 3SQQA 1MRVA 1ZOHA 1GIHA 3H10A 2PMNX 2HXLA 4LG4A 2I0EA 3G15A 4M8TA 2YM3A 3KRXA 4ACDA 4D2TA 1TQMA 3R1QA 4MNFA 3VS7A 2PVNA 5JZNA 2R3LA 4FZFB 2JGZA 4DT8A 5IQGA 2VRXA 4WG4A 5ITAA 4YC8A 4BDAA 4GU6A 5H9BA 5AR3A 2QO9A 3F5GA 3E3BX 3ZBFA 1YOLA 4BTKA 3QALE 4QTDA 3ACJA 3FYKX 4LUEA 4CCBA 2KTYA 3B2WA 3MY5A 2H8HA 5E1SA 5KMOA 5A3XA 5DRBA 4NM3A 3PG3A 3F3WA 5C1QB 4CRSA 3MVJA 2X7FA 5CXZA 2OGVA 4BCHA 3PVBA 1H07A 3GT8A 3KF7A 2LAVA 3ZYAA 4CMUA 1T45A 5LOHA 3NIEA 2WMRA 3K3JA 5IUHA 4ZJIA 2HZNA 2V22A 2HWOA 3C50A 4OT6A 3GU5A 4E4NA 5HLWA 2CNUA 5A4CA 1QL6A 2WMUA 4BN1A 3VO3A 2GNIA 4FEQA 1JLUE 5AM6A 1G8SA 4F9BA 2QO7A 3FSFA 3QLGA 1Q97A 1YHWA 4I5MA 4NM7A 1GZKA 4FUXA 3V5TA 5FRIA 3EQRA 5C27A 5J7BA 1XH7A 2JIIA 2OKRA 5CSVA 2C30A 1XQZA 3RCDA 2Z2WA 4G9RA 3UPXA 4QP3A 4QYEA 3LCTA 3Q5IA 2VWXA 4L52A 5AR5A 3TNWA 2IN6A 5JSMA 5CF5A 2GDOA 5HE1A 4ZTHA 4QMZA 2PHKA 3IQ7A 4FKUA 3TIZA 4CFFA 3LAUA 5CVHA 4EHEA 3FLYA 3RM7A 5HTBA 5I9YA 2J4ZA 2XKDA 3NUNA 3SHEA 1YHSA 5BVWA 4IM2A 5HG9A 5DEWA 1REKA 5FGKA 2QCSA 2V0DA 3KEXA 3VUHA 3VULA 3FI4A 3IW4A 4YNEA 4ZTMA 4O38A 5BVEA 2LGCA 3PJ1A 4AU8A 3ORLA 5IF1A 5BYLA 4WG3A 2XNMA 1OL2A 4IAKA 4HVIA 2VX3A 3QYZA 4IXPA 3RTPA 2BIYA 3R8PA 3S1HA 2XKEA 2PZIA 2WGJA 4G31A 4PMSA 3MB7A 4BCNA 4BICA 1PXJA 4D0WA 3UPZA 4CG8A 4MHAA 3VBYA 4DEDA 3GENA 4ANNA 1OUYA 2PE0A 4YTCA 1YDTE 2XNEA 3QBNA 3PY0A 5FTQA 2EB2A 2OH4A 4NWMA 3ZZEA 3FMMA 4AW2A 4Z16A 3ROCA 2RGPA 3BI6A 3DKFA 1V0BA 5AP4A 2OXXA 4J8NA 1KE5A 4K11A 4MWHA 2XEYA 2XRWA 1L8TA 2JFMA 4GK4A 4Z9LA 4I3ZA 4FTUA 3E3PA 2W1HA 2CKEA 3E8EA 3CR0A 3Q53A 4KSPA 3C13A 3GQLA 4IX5A 4LV5A 5TKDA 2WTCA 3M11A 2CLQA 4CTBA 2F7ZE 3IO7A 4OR5A 3A4OX 3DBQA 3DK3A 1O6KA 2YJSA 3R2BA 4I6BA 2ONLC 3HZTA 2P3GX 4LV8A 4QQ5A 5AUTA 3FXWA 2Y7JA 4AT4A 4RC4A 3ZFXA 1OL7A 5BQ0A 5IQDA 3PFQA 3EH9A 3HV5A 3N4TA 4XOZA 4CT2A 2QG5A 4B9DA 4GK2A 4MQ1A 1H25A 2C6EA 1H1PA 2OU7A 1R78A 1JKLA 3OW4A 4GMYA 2I0YA 5J7HA 5KX8A 3A7JA 4Y72A 3W55A 3DXPA 3DZQA 3F3UA 3D4QA 5HEZA 3WZUA 4BTMA 1ZOEA 4Y85A 4C2VA 4ANOA 4V0GB 3TG1A 4AP7A 3SDJA 3E62A 2XVDA 5H8EA 4CD0A 3WBLA 3TDVA 2RG6A 4JX7A 5EFQA 5JK3A 2PUUA 3DOGA 3B2TA 1O6YA 4I93A 4UB7A 2F9GA 2XA4A 1XBAA 4M97A 3TXOA 2PVYA 2YFXA 5AM7A 4GV1A 4WUNA 2BRMA 2BFYA 4RLKA 4YHJA 4IM3A 2R2PA 4U44A 3FY2A 3RNYA 4NW6A 4YSMA 3KXXA 4JBPA 3W2PA 4D5HA 2BROA 3MPAA 4PP9A 3ZONA 4USFA 4GIIA 2WQNA 3O96A 2BRBA 2BZJA 5FXQA 3I5NA 4U81A 3R7EA 3DU8A 5T6KA 4QPAA 4K6ZA 4WT6A 4DCAA 3OUNB 2AC5A 3WZEA 2H34A 1KOAA 1RJBA 4Q9SA 4LRKA 4RSSA 5I9ZA 4H1JA 4CYJA 3ZXZA 2AYPA 1H0WA 3F2RA 5IEYA 3QWKA 2R3GA 4O0YA 2VWVA 3U55A 2EU9A 3MS9A 4EK4A 4DH3A 3QGWA 4FEVA 4FSQA 4KS7A 3ROYA 1SNUA 2W06A 3H9RA 4Y8DA 4IACA 3R73A 5CLPA 3UVRA 4DGLC 1ZMWA 4ALVA 4UYNA 4M12A 3NVKI 3OXTA 2JC6A 3Q5ZA 1OPJA 5CVFA 4RIWA 3NYNA 4MBJA 3PA3A 3ZTXA 2YM8A 4Z7HA 2ITUA 4JOAA 4C4IA 2VTNA 2B0QA 1JWHA 1OIQA 1XH4A 2JLDA 3I0OA 3PJ3A 4MXYA 4FEUA 4AW1A 2R3PA 5LJJA 5L2WA 2X4ZA 1IAJA 2O3PA 2Q0NA 2XEZA 5TF9A 4OAUC 2JKQA 3QQHA 4ASEA 2B9IA 3OVVA 5CZIA 5CNNA 2OWBA 4E6DA 2OFVA 5M51A 4PDYA 4FODA 4OT5A 4AT5A 3PWDA 4R7IA 5IQCA 3DY7A 4IDVA 4BCQA 4F9WA 4WD5A 4DF3A 3OG7A 5IA5A 4BCIA 4F65A 3LFBA 3T8OA 4K33A 2EXCX 4WRGA 2VGOA 4YGAA 5IUGA 3QD4A 4CGAA 2FUMA 3LFQA 5M57A 5E92A 3VBXA 4N57A 2CMWA 4BDEA 1PXOA 2ZJWA 3NPCA 1FPUA 4I92A 3VW8A 4D4RA 3TCPA 3UNKA 3FLZA 2X39A 4DEEA 4LL0A 4RIYA 5KMLA 1IEPA 4LOPA 5CALA 2X2MA 4YHFA 4L42A 4JDKA 4IFGA 4IWPA 4N4SA 4ANMA 5A6OA 2G2IA 3OY3A 5HLPA 2W9ZB 4L53A 4AGCA 2IG7A 5KMIA 4ASDA 1Q8YA 4G16A 2BAKA 5M4CA 1P4OA 3Q4CA 4TPTA 4ZSAA 1RE8A 2FA2A 4KBKA 4XV9A 2VTTA 3GU4A 3PXQA 3MPTA 4BYIA 4CZTA 3VC4A 3Q9XA 4C2WA 2AC3A 4EOPA 3R8VA 4R3RA 1QMZA 5AP6A 4FEWA 3ZSIA 2R7BA 5EW8A 4PNKA 4ZAUA 2IZTA 3V5LA 2VWWA 1A06A 5DIAA 4XLIA 3PXRA 4J7BA 4S30A 4FIHA 5A9UA 3P23A 5E8WA 1SVEA 1ZYSA 3PY3A 5HICA 2XF0A 5KHXA 4XUFA 1VYZA 4TWPA 2IZUA 3UG1A 4WO5A 3TUDA 4M7IA 5F4NA 4RVKA 5HD7A 2XBAA 1YQJA 2YISA 3RZFA 3E93A 3AD4A 5M44A 1WBTA 3ZSHA 3FZOA 3OXIA 3F61A 5D10A 5HCYA 4EH8A 3FY0A 4PMMA 2JDTA 3DFAA 5HI2A 5IA2A 2XCKA 3EN4A 3NW7A 4FVPA 4IVAA 4MF0A 5KZIA 2YM6A 5L8JA 3UG2A 4DG0E 4JR3A 3V5QA 3LKMA 2QOIA 4BGGA 3Q2JA 4ZS4A 2W7XA 3LHJA 4RIWB 2ITZA 5GJDA 4HNFA 3NUUA 5CEPA 4WIHA 2Z7RA 4QQCA 4FYNA 3PE1A 2ETMA 3BHYA 4F63A 3BPRA 4AA5A 3GUBA 5FEEA 3VS1A 3P78A 4K2RA 1YW2A 4LGGA 3JVSA 2BHEA 1Q24A 4MK0A 5KBRA 2J90A 5FQDC 4DGGA 3NCZA 5CAQA 3I60A 4YJTA 4X3JA 3DLZA 3HNGA 3D94A 3E64A 3POZA 1RQQA 4IWDA 5M08A 4BI2A 4U43A 4KABA 4PY1A 3W2OA 3OCGA 5AMNA 3FMJA 3ZLSA 3A4PA 3NX8A 4L68A 4MH7A 4UZDA 3R0TA 4I5HA 2VWZA 3LOKA 4R5YA 5M55A 5M4UA 3BCEA 4RC2A 4X0MA 2VO7A 3VBVA 5EHYA 1VYWA 2VNWA 4RFZA 2DUVA 5LVMA 2R3OA 3KRRA 3KY2A 4BCKA 3FLQA 2FO0A 4U45A 3QKKA 4WOVA 3UOJA 3FZ1A 4M0YA 3LJ1A 1W84A 3E63A 4OTWA 4RIYB 2ITOA 2X2KA 3NEWA 3EQHA 1WVYA 4TYHB 1Q4LA 1PHKA 5TT7A 2VD5A 1OL5A 2QOLA 4JAJA 5AJQA 2O5KA 4FOCA 5JN2A 4RJ8A 3FQSA 3D15A 3I81A 3ITZA 2GTMA 2VTHA 4RIXB 1KE8A 1OZ1A 2R0UA 3D7ZA 3EFJA 1WMKA 1PYEA 2C6OA 1IR3A 4NIFB 4RX8A 5FWKK 4D4VA 3VN9A 3WF6A 2YLEA 3AOXA 3MH3A 4BWPA 5HTIA 3COIA 3NNVA 1YRPA 3HX4A 4OBQA 4O7ZA 3W16A 2CHLA 2ITQA 4RVLA 2XNOA 2HZ0A 5EYMA 4P2KA 2DS1A 5TOZA 2Z02A 5I9UA 4E6QA 2XM8A 4MWIA 4Q9ZA 2ITVA 3QXOA 3FZTA 3H0YA 4O6LA 3QX4A 4OTDA 1H27A 4WSQA 4O0TA 4RC3A 4ZOGA 5AR2A 2WPAA 4DGNA 2YDIA 5EI2A 4ZSGA 2UZLA 2X8DA 3EQCA 2WQMA 3CPCA 1HOWA 2EUFB 4GKHA 3QZHA 1MQ4A 1P14A 3C0HA 1QPEA 4JNWA 3RPYA 4DA5A 1TVOA 3II5A 3OEFX 3D7TB 4BVUA 3BU6A 5KZ0A 4CKJA 3LQ8A 4WKQA 4LOOA 4P5ZA 4I5CA 2VX1A 1ZMVA 2F57A 3NNUA 5IUIA 5L6PA 4M13A 4ITIA 3EFLA 5CEIA 4L01A 1FVTA 4D4SA 1LEWA 4U40A 3OWPA 4ITJA 1RW8A 3EZVA 4PMTA 4M67A 3F82A 4HCVA 4AXAA 4CCUA 4EKKA 4NYEA 3QXPA 1U46A 1I44A 4QMTA 3V3VA 4OTGA 3FDNA 4JL9A 3FWQA 3T9IA 4V05A 4RJ4A 5L3AA 4FT5A 4D55A 4OW8A 5CAOA 4ACMA 4UXQA 5CVGA 2QKRA 3AD5A 2WB8A 3GU6A 3I1AA 2F49A 3R04A 3MIYA 2BDJA 1OL6A 4O7TA 3UZRA 4F4PA 4QMVA 1PMEA 3GCVA 3PXZA 4IFCA 4O2PA 3R7OA 4BDJA 4NKAA 5IEVA 1I09A 4GFMA 3ATSA 1XWSA 2HZ4A 3NAYA 4AF3A 2WAJA 3PRFA 1WVWA 2BRNA 4JS8A 4RWIA 4U3ZA 3KC3A 4W4VA 4DEGA 2HW7A 3ET7A 3A7IA 3CTJA 4KUJA 3VF9A 4BIEA 3ZUVA 4O0XA 4CFXA 2C0OA 3HMOA 2WNTA 4XP0A 2J2IB 2YAKA 1NVQA 5BUJA 4PF4A 3HMNA 4AAAA 3QX2A 3BEGA 4QTEA 1OVEA 4WNMA 4F1OA 1CKIA 3AD6A 4D28A 2QHMA 2NPQA 4DLJA 4BDBA 2R3KA 5CU3A 2IJMA 3QCYA 4AOJA 3PE2A 4QMQA 4YZNA 5GNKA 3PSCA 4YTIA 1LPUA 5JFSA 1NVRA 3MTLA 4LGHA 1YWVA 2JEDA 1OKZA 4NL0A 4KKHA 1YI3A 5GIPE 3EQDA 2VTPA 2VWYA 5ETCA 3T9TA 4FZ6A 5HESA 3OBJA 4AGWA 4RWKA 4ZIMA 4C61A 2C4GA 4QQTA 3QTIA 5JRSA 4DC2A 2B7AA 5L2QA 5A4TA 4O7WA 3KXHA 1IA8A 4W8DA 5AAEA 5DOSA 4XG3A 4FF8A 4UBAA 4R3PA 2O65A 4JAIA 2PVHA 2ETKA 3HMPA 5D11A 1REJA 4ZTQA 2ITPA 2W1EA 2W5BA 3UYSA 5LXMA 1ND4A 3MFSA 4DHFA 2PU8A 2CLXA 4FKSA 5CI7A 5AA9A 3UP7A 4FX3A 4FKWA 4G34A 2YIRA 3AC4A 4J8MA 3KL8A 5K3YA 3GCUA 2R64A 2XNGA 4O0WA 4EJ7A 3R21A 2XK3A 3CC6A 3NLBA 4IZ5A 2PVMA 4XP2A 5EM8A 4C37A 1PF8A 4D1XA 3C1XA 3DKOA 4A9SA 3G90X 2X7GA 5C4KA 3C4EA 4FIJA 4L6QA 3JY9A 3DAKA 4HVSA 1UU3A 1LP4A 1UNLA 4E5WA 2XKCA 4NU1A 3HUBA 3F9NA 3R1YA 2GHGA 4MNEA 3HV7A 5IPJA 3V5WA 4FV0A 3ALOA 3GCSA 4MXXA 4C7TA 4EC8A 1Q8UA 4QTAA 5JGDA 3PP0A 3DTCA 3H0ZA 2CKOA 4FK6A 2Y4IC 1Z9XA 2ZM4A 1DI8A 5A14A 4NEUA 3QQUA 4BDDA 3HP5A 2B54A 1CMKE 3LQ5A 3LXKA 1R3CA 5GZ9A 5HOAA 3IS5A 3UP2A 2XJ0A 2Z8CA 3W32A 4S33A 3KK8A 3EJ1A 3CGOA 3HUCA 4X3FB 3AGMA 3OUKA 4HYUA 5EM5A 5ETFA 5JRQA 3L9NA 2JDSA 2XS0A 3KMUA 1VZOA 4KS8A 2EB3A 4FV2A 2ZM3A 5DE2A 4WNPA 2C1AA 2OH0E 2GNLA 4O21A 2OZOA 2GU8A 2RFDA 3SW7A 5M09A 4QMNA 1AD5A 4FTMA 4GCJA 5DH3A 4XRLA 5EK7A 1WCCA 4DH1A 3GC8A 4F64A 5FXRA 2YJRA 4F9CA 3LFAA 5D7VA 5M07A 3S0OA 3EB0A 2XYUA 2Y4PA 4EOLA 4PWNA 4EH6A 3B8QA 3K54A 1S9JA 4GL9A 4CLJA 5HZNA 1DAWA 1F3MC 4V04A 3FLNC 4I1ZA 3RGFA 5F95A 4NTSA 4LGDA 3Q04A 2FGIA 4PL5A 4XHKB 2P4IA 3WYXA 3MJ1A 2CNVA 4EHGA 5EDQA 4DGMA 4QP4A 4U9AA 4M69A 2H6DA 4CRLA 2C3LA 3IOKA 3SD0A 5JEBA 4P90A 3KU2A 4UEUA 2XP2A 4RMZA 3QU0A 1W7HA 4NCTA 4ZS0A 2C68A 4BGHA 3VUKA 4CKRA 2YN8A 4QNAA 4E26A 3MDYA 3OTUA 1ZXEA 2NNWB 4O7VA 4NT4A 4D9TA 2XK9A 1AGWA 3U51A 4NKSA 4AZWA 4FVRA 2Z7SA 2W5AA 2UVZA 3W2RA 2O2UA 4DBXA 3BHUA 5AADA 5BVDA 3LXNA 1T46A 1E1XA 2W1DA 5K0KA 2XK8A 1JKKA 5FTGA 3HV3A 3R6XA 3SC1A 3RAHA 5IH6A 4XYFA 5CSXA 3ZMMA 1IASA 4E20A 1XHAA 2V7AA 4F6WA 1FINA 2QOQA 1M2QA 3EQIA 3HL7A 4K1BA 3F7ZA 3HMIA 3LJ0A 4KIPA 4O0VA 5J79A 1ZMUA 4JDJA 4RJ7A 2CCHA 3GOKA 4QP8A 4HCUA 3AC3A 4G17A 3LJ2A 5IEXA 3UC4A 5HVKA 4RZVA 2VU3A 4XG4A 3D5VA 4DFBA 4I94A 1V1KA 3R83A 3OXZA 2WQEA 4R77A 4QPMA 3PSDA 4X2GA 5E1EA 4BBFA 3ACKA 3DKCA 2CDZA 3TNPC 2JBOA 5ANDA 3MVLA 3E7VA 3HGKA 4EH2A 1R0EA 3RK5A 3HAMA 2ZYBA 5AR4A 2X6EA 2R9SA 3HLLA 3NR9A 3W2CA 5F9EA 2PUPA 3KRLA 2WQBA 1L3RE 4DFYA 2BHHA 3ANRA 1ZRZA 5A4EA 3CSVA 4TN6A 4HOKA 3BYMA 3PY1A 3MH0A 4KRCA 1YHVA 3QKMA 4IZYA 1CTPE 4F08A 5H3QA 4K0YA 4UMRA 3UYTA 3AC8A 3ULZA 1BX6A 2G01A 5JFVA 2YCQA 3BU3A 5I3OA 4L3JA 3F3VA 4FIFA 4MAOA 5CAPA 1J1CA 3AXWA 4FV1A 4XBUA 3FQHA 5ANKA 3BQRA 5HO8A 5F1ZA 4DT9A 4GYIA 1U54B 4WUAA 5D9HA 4YU2A 4PDPA 5IQAA 4YJUA 1KE9A 2J5FA 2VTLA 3FKNA 4HYIA 2PZ5A 3CQWA 5T68A 2XNBA 2Z60A 4FNWA 2W1FA 4IVCA 1FVVA 4IC8A 5GJFA 4C38A 3EMGA 2W9FB 2C5XA 3KULB 3LPBA 3KXGA 3IW6A 4M69B 4ZSJA 2W4JA 3JY0A 4J97A 5GJGA 3QRUA 4O7NA 3GC0A 3ORNA 3G5DA 3T3UA 4BHNA 5LWMA 3LM0A 4BBMA 4M68A 4IH8A 2NP8A 1Q62A 3OT8A 5AR8A 4BIBA 5BVFA 4BB4A 1J1BA 2C6MA 5HIDA 5FLFA 1YI6A 2WTKB 2CKQA 1XH9A 3CY2A 5JGBA 4W4WA 5AV4A 3OBGA 3CPBA 2JDVA 4NW5A 5KKRC 2QOHA 2GS6A 4PTCA 3UC3A 2PSQA 2UVYA 3NIZA 2R7IA 2WTDA 3IW5A 4X6QC 3W2SA 4BCPA 1JPAA 3KA0A 1HCLA 1WBOA 1ZZLA 3DT1A 2E9PA 4IAAA 3RALA 3L8PA 3SV0A 4C57A 4L7FA 5C8KA 5JFWA 1Y6AA 3PSBA 4IAZA 1GIIA 1NA7A 5HBEA 3DLSA 3OY1A 5EOLA 3RHKA 3FMLA 1YXSA 4TZRA 3WIKA 4AW5A 5BUEA 4B0GA 5IU2A 1M7QA 3OMVA 3NW6A 3W8LA 4DFNA 2XMYA 4TYJA 4FE2A 4ZSLA 4ASXA 1Q99A 4CYIA 4FV9A 4A4LA 1R1WA 3DCVA 2YACA 4K77A 3VHEA 2PVFA 5HHWA 3LFCA 2QQ7A 4KKGA 4FG7A 3LE6A 3C0GA 4DEAA 2C5NA 2OIBA 1S9IA 4BTFA 2I7QA 1OBGA 3FHIA 1H1WA 2J7TA 3FC2A 4I5PA 2VTRA 4NK9A 4FV5A 3PIYA 4YLJA 3VQUA 4PX6A 1PXKA 4I4EA 3EOCA 2W4KA 3HYHA 2BAJA 4IEBA 2V7OA 2PTKA 2W5HA 3C5UA 3OW3A 3VNTA 4BWKA 2FSOX 3VRYA 3FC1X 3WIGA 3TJCA 4GW8A 4EWHA 4PMPA 3TTJA 3LXLA 4PDSA 4XG6A 4NJ3A 4G3CA 4A4OA 3LMHA 5E90A 4Q5EA 4YZBA 3W10A 5ICPA 4FTTA 3E88A 1G5SA 3VQHA 3Q9WA 4QRCA 4E4XA 2PVLA 1BL6A 2BCJA 3G2FA 2F4JA 3FQEA 3VS2A 4XX9A 1BKXA 3UVQA 1ERKA 2YDJA 3OCTA 4GSBA 4BFMA 4EQCA 5L6OA 3IW8A 3ORZA 5KBQA 2OF2A 3ORTA 4LYNA 3FLWA 3A8XA 5DBXA 4DBNA 5GZ8A 1CKJA 4PPAA 3QD3A 4CG9A 3LMGA 4MQ2A 3GXLA 5CEKA 3TZ8A 2HZIA 5HCXA 3I4BA 2UZWE 3V51A 4BI1A 1Q5KA 1SYKA 3UO4A 1OPLA 5LVPA 2C5VA 3QTUA 5HVYA 2BZIB 3TTIA 5B7VA 3CLYA 2WQOA 3DDPA 3BRBA 4J98A 4EK8A 5GIOE 4FSNA 3FMKA 3TKUA 4Z7GA 2PY3A 4OTHA 5AAFA 4B8LA 3MFTA 3ZLXA 1UWJA 3DDQA 5K4IA 4KBAA 3N4UA 2BDFA 1Q3WA 3D5XA 3ENHA 3NNWA 4GU9A 1FVRA 1FGIA 3MSSA 5D1JA 4ZTRA 5IA0A 1OUKA 2VO6A 4W9WA 5EOBA 4YJOA 3K5VA 4EYMA 4D1ZA 4RQVA 4O83A 5CU6A 4JVGA 1MUOA 4R3CA 2JKMA 3AT4A 1XO2B 5FUTA 5KMKA 3S3IA 3SOAA 3P9JA 5CSWA 4CQGA 4HGEA 3UQGA 4CQEA 4DN5A 4BY9E 5BX0A 3UMXA 3JVRA 2B53A 3LCDA 4NUSA 1BYGA 2YABA 3FYJX 4L8MA 2R0IA 3OS3A 3VRZA 3HA8A 4CEGA 5DMZA 2KULA 5AR7A 3JPVA 3FMHA 4XS2A 5DI1A 4ZMEA 5JGAA 1U5RA 3BQCA 4MCVA 3QCQA 5EI8A 4QNYA 2XYNA 4BCGA 2GS2A 4EUUA 3L1SA 2J0MB 3EKNA 1JKSA 5F94A 5AA8A 3H9FA 5HU3A 4BCOA 4APPA 2VTAA 3JR1A 2OIQA 3EHAA 3RNIA 2YDKA 4MXOA 1FMKA 3NW5A 2C5YA 4EONA 3SXSA 4BCFA 2WMBA 3R00A 2ITYA 2W4OA 3R01A 3H30A 2VO3A 4FKGA 3QZIA 5HIBA 4KIQA 4ZMFA 4F0IA 3NNXA 4U3YA 4YJRA 4ZZOA 2R4BA 1UVRA 4BR3A 4EEVA 4FTRA 2GTNA 4P4CA 4CKIA 5E8UA 1PW2A 4OAVB 3FV8A 4FNXA 3MW1A 3KRJA 3F7WA 5EKOA 5J95A 3C9WA 5L6WL 1QPCA 3R22A 2JD5A 4U7ZA 3ZM9A 3MY1A 4GVJA 3R9DA 3GNIB 4U42A 4AZSA 2A27A 2G2FA 2BZHB 3RVGA 1ZYDA 4FSZA 3PZEA 5IKWA 4FNYA 3UIBA 3RP9A 3VBQA 2QKWB 3NAXA 2XK4A 2ETRA 3EQGA 4KWPA 3Q60A 5BYYA 3ZFYA 4CSVA 1M2PA 3PJ2A 2RFEA 2W05A 3CKXA 4QOXA 4QYHA 4ZSEA 4FYOA 3UVPA 3FHRA 3I79A 4HZRA 1E1VA 2QOOA 4TWOA 1JAMA 4AOTA 1NXKA 3HEGA 4MX9A 3EQBA 3FAAA 4LUDA 4DTAA 5D7AA 4F09A 4CFVA 3QTRA 4EK5A 3MGYA 2IW6A 4JG7A 2G2HA 4DFLA 2WTIA 3KMWA 2R3NA 2V5QA 1BMKA 2HELA 2J0IA 3TM0A 5G6VA 1GJOA 2YIQA 3PPKA 3BYOA 2BRGA 3ERKA 1R39A 4M14A 3Q9ZA 4CVAA 3G0FA 4YTHA 2XKFA 2RFSA 3H4JA 3V6SA 4QTCA 1PRYA 5KCVA 1PXNA 2BDWA 5HG7A 4UWYA 2CNQA 2A19B 3QGYA 2XIRA 2VAGA 4FL1A 3Q2MA 4Q2AA 1KOBA 5J8IA 2CCIA 3CQUA 4X2JA 2WMXA 2OF4A 3VVHA 4UWBA 5ETIA 4AFEA 2ONLA 3F5UA 4RZWA 2ITXA 1OKWA 2X8EA 1OKVA 2OLCA 2UW7A 4ANQA 4NZWB 2ZDUA 4GS6A 3KMMA 4KBCA 5I9WA 3RBWA 4FTKA 4M15A 2FVDA 3AT3A 3E7OA 1GZNA 4IB5A 5EW9A 1ZY4A 2ZDTA 4FZDB 4I0SA 4RX7A 3KXMA 5E8TA 3D2IA 4HZSA 5L8KA 4AE9A 4W9XA 5L2SA 5IQEA 3FI2A 4UALA 1O9UA 4RIOA 5FM3A 3DB8A 5E7RA 5KMMA 3L9PA 3PZHA 5CI6A 4QTBA 3WILA 2WMAA 4K9YA 4O0SA 3R9HA 1YDRE 4MXAA 3R8LA 3C51A 3FE3A 5AP7A 1H24A 3FZPA 4QMOA 4Z3VA 1XBBA 2GQGA 3BE2A 2JKKA 4QMXA 3RPOA 1NVSA 4C4JA 4O22A 3U4WA 4JBVA 2EXEA 3CJGA 2XJ1A 3JS2A 4ACCA 2WU6A 2R3HA 3BLHA 1JBPE 3QCXA 2XJ2A 1VJYA 4DH5A 4FMQA 1TQPA 4RVTA 4RT7A 1UNHA 1YKRA 3CGFA 4A9RA 4FVQA 1URWA 3E8DA 2PWLA 1K9AA 3F5PA 2B9HA 3IONA 4I23A 4YHTA 4ZZMA 5FP6A 3SW4A 4GT5A 4H3QA 4DFXE 3BYUA 3FMNA 3PPJA 3DA6A 3DK6A 4FA2A 4FT0A 4EYJA 2OICA 3JXWA 4TKSA 4LMNA 3ZZWA 4C58A 4C35A 2YAAA 3I7BA 3VS6A 4BDGA 3QZFA 4KIKA 5CEMA 3R9OA 5A6NA 5M53A 4I6HA 4D9UA 4EOQA 4R5SA 5HIEA 2BZKB 3ZH8A 2CGUA 5CEQA 3OFMA 5J1VA 4PRJA 3SKCA 3POOA 5K9IA 2VZ6A 3CEKA 3DGKA 4FKIA 4DH7A 1V0OA 2X81A 3GCQA 4BBEA 4APCA 5A4LA 3ZXTA 5K5NA 1H08A 4IAYA 3EN5A 2C0TA 2UW4A 2YWPA 2OJGA 3ENMA 3MTFA 4RBLA 2BKKA 1M2RA 2IW8A 4ANLA 2XZSA 3BIZA 5ACKA 3ELJA 3DPKA 4LRMA 4XG8A 2ITNA 2R3FA 3DV3A 4QYGA 4A7CA 2VWBA 1Q3DA 2X8IA 1SVHA 2X0GA 4ENXA 5JKGA 5H8BA 3ZU7A 2OSCA 1Q8TA 5EYKA 3V8TA 4K18A 3P4KA 3C7QA 3EKKA 3UE4A 3VBTA 3P79A 1GNGA 3WE4A 1JKTA 3BWFA 3QKLA 1XKKA 5J9YA 4AT3A 4TNDA 3R2YA 1QCFA 1WAKA 2V55A 3VUMA 5C8MA 1M7NA 4TRLA 5AP0A 3O7LD 4L46A 1OL1A 3BZ3A 4O7LA 1YI4A 3TI1A 4MXZA 2XH5A 3WF8A 4IDTA 2J0KA 4IANA 5FDXA 4QD6A 1GAGA 2WTVA 3CE3A 3F2AA 3N9XA 4IZ7A 2J6MA 2XB7A 4JG6A 3NYVA 3FPQA 4AS0A 4DTBA 3KN5A 3BYSA 3CQEA 4NM5A 3CCNA 5FBOA 2O8YA 5FP5A 4UMQA 2BFXA 3UZTA 4XV3A 4YBJA 2A0CX 5ANEA 3UBDA 1UU8A 2C3IB 4ZTNA 3UTOA 3W18A 4FKPA 3SG9A 3PLAE 4ENYA 5LQFA 2WMTA 4JDHA 1SZMA 2C0IA 3QTSA 1LR4A 3GP0A 5HX6A 1W0XC 5HORA 2QLUA 4RJ5A 3TV4A 4FZ7A 4OTQA 3R7YA 4CZYB 5HNIX 3ZFMA 3ORIA 4XMOA 4G1WA 4D2VA 3TUBA 1HCKA 1XH8A 5LMKC 3PVUA 4S34A 4KKEA 1PXLA 3TT0A 1H00A 1WBPA 5BVKA 4FSYA 4GFGA 4LQMA 1YOJA 4RRVA 4RLLA 1K2PA 2WMWA 3IECA 5LCKA 2J9MA 4L00A 3ALNA 4PUZA 4O81A 4OBOA 4WSYA 4FV4A 3SXFA 4YSJA 2ZV7A 1OM1A 3KF4A 1K3AA 4PNIA 3C4CA 2WHBA 4YMJA 5EQPA 3HMMA 3PLSA 4BKZA 2JIVA 3R63A 4ZLZA 5IQBA 1YDSE 4FL3A 1TKIA 5FTOA 3S00A 1H28A 3TN8A 4TY1A 4EOOA 3UO5A 3DJ5A 2C3KA 4TXCA 3NS9A 5HQ0A 4O7SA 4Y5QA 5C9CA 3REPA 5TO8A 3P7CA 1GZ8A 4OTIA 3AMAA 2XCHA 4FSTA 4F7SA 3ZOSA 4JR7A 4BF2A 3ODYX 4IBMA 4ALWA 4AUAA 4QO9A 3TJDA 4E93A 4AA0A 4EH3A 2IVVA 4YZ9A 4EHZA 3RINA 1URCA 4ALUA 4MBIA 3FMDA 3GFEA 1H8FA 5IMXA 3ZEWA 3MVMA 5DLSA 3DKGA 4ID7A 1CDKA 1UKIA 2E9UA 3QRIA 4RJ3A 2HAKA 3I6WA 4F1MA 4L67A 1W83A 2J0JA 3OP5A 2GSFA 3DB6A 1WVXA 4WG5A 4X2KA 4M3QA 3RAWA 3ZUUA 2Q83A 5K0XA 4IB3A 3G0EA 4HW7A 3U4UA 3TV6A 1H4LA 2YCRA 2CGXA 3MYGA 3PA5A 4G3EA 2HYYA 5CASA 1M14A 3IDBA 4MD9E 5HO7A 2ITWA 3PXYA 3R28A 1KUTA 4AGDA 4MD7E 4GJ3A 4FBXA 3RWQA 2YM7A 1IA9A 4YNOA 4G6NA 2QONA 2ZVAA 4IADA 4J99A 4ACHA 3D5WA 5EHLA 4BDHA 5B0XA 3V8WA 3QD2B 3KGAA 4AZEA 2J50A 4YZMA 2YWVA 5M06A 1F0QA 2RFNA 1NW1A 3NUAA 4D2WA 3PUPA 2R3QA 3ZRKA 3R9RA 3HP2A 3IPHA 1ZYLA 4N70A 4RWLA 4CFNA 2I0HA 5I0BA 3PIXA 5DR9A 4MKCA 2OK1A 2CPKE 3K2LA 4C3RA 3D9VA 2C47A 2UZUE 4O7RA 3QRTA 4FR4A 3QQFA 4ANSA 3F88A 4EZ7A 4RA4A 5EW3A 1PXPA 3ZO3A 4R1VA 3THBA 4I4FA 5AIRA 3RM6A 3UQCA 1OKYA 1QPJA 3U6IA 3NUYA 2QURA 2CKPA 4UY9A 1Y57A 2CN5A 1NT2A 2VGPA 4GK3A 5HGIA 2IPXA 2J0LA 2QOKA 4XEYA 4WNOA 4FICA 3KFAA 2HCKA 2C3JA 3C4WA 3UODA 3VIDA 4FEXA 4BC6A 3DJ7A 1OECA 4Y73A 3MBLA 4S2ZA 2E9OA 4HGLA 3COMA 2EVAA 4GH2A 2OIDA 1KWPA 4KINA 3PIZA 3LXPA 4WBBB 1ZY5A 3G51A 3TKIA 2NRYA 3FMEA 2UV2A 4EC9A 5L8LA 3QC4A 2RF9A 5E8YA 2G9XA 3DBCA 4BDKA 4BCMA 4I21A 4YJVA 5E8XA 3A62A 3FXZA 4W4XA 2VWUA 4IX4A 4HYSA 4RX9A 1KE6A 4XG2A 2Z7LA 3ORXA 3RAIA 4IJPA 3VS3A 4ZK5A 3PVWA 3FL4A 5CQWA 4JRVA 2W17A 4U41A 4EJNA 1NY3A 3HV4A 3RKBA 3QL8A 4DG2E 5IISA 3ZSGA 2I1MA 4HVHA 4JLCA 3F66A 4IM0A 3E5AA 3QUPA 5HE0A 3A7GA 4FKRA 2YERA 3LCOA 2W1ZA 3RPVA 4KD1A 5AV3A 4F70A 4G3DA 3G6HA 5I3RA 4QMLA 4E4LA 5FDPA 3Q6WA 1JSUA 3UOHA 3OOGA 1Y8GA 2DQ7X 3UMWA 5C8NA 1M17A 2HIWA 3GQIA 4LL5A 2GFCA 4CMOA 5LMKA 4QYYA 3UO6A 3NUXA 2GFSA 2C5OA 3S4QA 1YXTA 4EOKA 2UZVA 4BL1A 4GUBA 4F0FA 5IA4A 2C6LA 3C5IA 4ORKA 2OFUA 4J95A 4I0TA 4DLIA 2YLFA 5GINE 3O17A 1WBSA 2PZRA 3Q4ZA 4C0TA 4A9YA 4FV7A 5CANA 4F99A 3ORPA 2WMQA 4IX3A 5TE0A 4FC0A 3C4XA 4YC3A 3U87A 4ERWA 3IK3A 5K4JA 3QA0A 1U59A 2WZJA 3G6GA 3BV2A
chains in the Genus database with same CATH superfamily
4ZP5A 2IZRA 3E8NA 3H9OA 1FMOE 2C69A 4FZAB 3BU5A 4G3FA 5I4NA 3W33A 4BDFA 3VAPA 2ZMDA 3O8UA 4IQ6A 3W2QA 4DFUA 3TZMA 1UNGA 4JDIA 3TNIA 1VR2A 4CXAA 4DTKA 3EFWA 1DI9A 4IX6A 4EZ5A 4S31A 4I41A 3QFVA 3QTWA 3O0GA 2B1PA 1Z57A 4AE6A 1ZYCA 3F69A 4GG7A 4H39A 5KMNA 4MNEB 5IMEA 1P2AA 3LFSA 5DHJA 4ZZNA 5K5XA 4L43A 4QMWA 2JFLA 3K5UA 2VTMA 3PYYA 5G1XA 2PVKA 3UIMA 4E5AX 5IDNA 2BALA 5CWZA 2JDRA 2B4SB 2BAQA 4BCJA 5B2LA 5GHVA 3IOPA 3M2WA 5HE2A 4KB8A 4JBQA 3A2CA 4Y83A 3QTXA 3GVUA 2P33A 1SNXA 3Q32A 4PL4A 1KE7A 2UZTA 3V5PA 1ZWSA 1M52A 3MFRA 3MJ2A 1OGYA 4ZTSA 2WEIA 2A2AA 3HDMA 4PPBA 2PMIA 2PVJA 4GFOA 4C8BA 5AEPA 1JVPP 2UW9A 3NYOA 3B8RA 5CU4A 4EH5A 4N0SA 4YZCA 2OJJA 2C6IA 1UU7A 3QWJA 4FV3A 3ZBXA 3Q96A 4EQUA 3DJ6A 1YXUA 5AUVA 4X21A 3SG8A 4JQ7A 4A4XA 5EYDA 4DYMA 2YCSA 5HTCA 3I7CA 1DS5A 4KAOA 4O27B 3NRMA 4NTTA 4X2NA 4M84A 5HE3A 3V04A 4FIEA 4C3FA 2VX0A 4QP9A 2XUUA 1GZOA 4FSMA 2ZM1A 4XJ0A 3A7HA 4QMYA 3DZOA 3KQ7A 4RVMA 4B6LA 2F7XE 1MRYA 2PE2A 4HPTE 3RMFA 4TW9A 3R7IA 3BYVA 5EQYA 4FNZA 1OB3A 3LVPA 3QHWA 4UZHA 1DM2A 5AWMA 3WZJA 3COKA 3MY0A 1J7LA 3VW6A 3WARA 2BR1A 5IQIA 3VWAA 3VBWA 3ZDIA 4HPUE 4BI0A 3PPZA 1XH6A 3ZM4A 1EH4A 2IVUA 3DTWA 5EM7A 3MV5A 2CSNA 3NGAA 3W1FA 4R7BA 4LV7A 3NUPA 1Y6BA 4FK3A 2J51A 3RJCA 3V6RA 2XIYA 1P5EA 3FBVA 4PP7A 4H36A 5A46A 4YTFA 4OTPA 4RGJA 2FSTX 4IAIA 3LM5A 3R8MA 2GCDA 3RK9A 3WF9A 4ACGA 3W0SA 3BGQA 3ZO4A 4O6EA 2VTQA 3PVGA 3O71A 1U5QA 2YCFA 4V0GA 1PMUA 2YM4A 1Q41A 1OGUA 2WIPA 2XNNA 3HRCA 3TWJA 3VUTA 3NWWA 5CF4A 5HVJA 5I9XA 3TEIA 2HK5A 3PWYA 4R8QA 4ZJJA 4ZLYA 4XNEA 3V01A 4FGRA 3QQKA 1OBDA 3P86A 1YOMA 3R1SA 4JIKA 4D1SA 3EN6A 3GC9A 3UDBA 5EYCA 5DT0A 2BRHA 5LVLA 3TIYA 1H01A 2BMCA 3GOPA 1YWRA 4BDCA 2OI4X 2UW0A 2YZAA 4O91A 2HXQA 3LQ3A 4JT3A 2GPHA 5AAGA 2Y8OA 4DEBA 4GKIA 5CEOA 3LFFA 3NCGA 3GCPA 4FTAA 5L2TA 4C3PA 4YURA 3BKBA 3HDNA 4DEHA 4EH4A 3I5ZA 3Q52A 3MB6A 4FTJA 4GEOA 3RI1A 1XR1A 5KUPA 5BMSA 5IQFA 1GY3A 2VTOA 3A61A 3CTQA 3ML1A 4QMMA 3UZPA 2GHMA 4IWQA 4EUTA 4TYGA 5ANOA 3C4FA 4AOIA 2FB8A 4FV8A 4Q5HA 2RSVA 4AZFA 4R78A 4IJ9A 3R8UA 5AFVA 3COHA 3KVWA 5AUUA 5CSHA 5FM2A 1H26A 4A06A 4C4FA 5CTPA 4D2RA 2A1AB 3CTHA 3DQWA 2VWIA 4EBVA 4EBWA 4EK6A 1XMLA 2RIOA 5DR6A 2VNYA 3CS9A 4MXCA 2QG7A 5HKMA 2WTWA 3IGGA 4UN0C 3QTZA 3P08A 2YIWA 4AN9A 2XM9A 5F20A 4ZEGA 4ZY4A 4CV8A 2R3IA 4FIGA 5ETAA 4LMUA 2FSLX 2QD9A 2W0JA 4YR8A 4RG0A 1ZYJA 2UW5A 3HKOA 4JG8A 4YJQA 3ZLWA 3UQFA 3G9LX 5T3QA 4E8AA 3C4ZA 4DE4A 4JX3A 5I9VA 1JQHA 4W8EA 4C4HA 4CFUA 3TDWA 4JI9A 5CT7A 4DFZE 3EFKA 4F6SA 3OHTA 4NFMA 2H96A 2UZDA 4A07A 3OOMA 2BVAA 4A9UA 2X0OA 4G3GA 2Y4IB 3D2KA 1UU9A 3H3CA 4O1OA 5EG3A 3RPSA 3NFGB 2GS7A 2Y9QA 3F3ZA 3R8ZA 1IRKA 3BHVA 3OD6X 4I22A 2PPQA 5IA3A 4XLVA 1PKGA 1WZYA 3BBWA 3FSKA 3KCFA 2PE1A 5DRDA 3QRJA 3MWUA 3SGCA 3DXNA 4FKOA 5HBHA 4BZNA 4RJ6A 5EDPA 5GZAA 2YZLA 3ZC6A 2VUWA 5B2KA 1YWNA 2NO3A 2ACXA 4W4YA 3D5UA 3DFCB 2GHLA 3OT3A 3Q9YA 4J96A 4H05A 5J5TA 3T3VA 3DAEA 1P4FA 5LARA 4JXFA 3EL7A 3TACA 1G8AA 1O6LA 1W82A 4FIIA 4G5PA 3FI8A 3UOLA 3GEQA 2WOUA 4FSUA 4QP7A 4AZTA 5J9ZA 5LCJA 3BL9A 1XH5A 2IVTA 2WELA 5C03A 3MIAA 2ZFYA 3W0PA 2QHNA 1KSWA 3ZRMA 4DCEA 3HECA 2Z7QA 1APME 3AC5A 3EIDA 3RPRA 3CD3A 3FJQE 2GQSA 3SAYA 5KE0A 2R3RA 2Y0AA 1BI8A 3CJFA 3AMBA 3EYHA 4ZTLA 4DINA 4QP2A 5TR6A 4EOMA 1PXIA 2JBPA 4GIHA 4TWCA 3SX9A 2PUNA 5CT0A 4CMTA 5C4LA 2VTIA 2IWIA 2HW6A 4EZ3A 4L9IA 4F7NA 3OTVA 2P0CA 2CGVA 2A4LA 2VTJA 5EM6A 4Z55A 4FKQA 4AFJA 5IH4A 2ZAZA 3BLRA 3I6UA 2PL0A 2HY81 2XK7A 4WNKA 4ANBA 3LCSA 3HRFA 4F9AA 4USEA 4UV0A 3UNJA 1PMVA 2QVSE 3AG9A 1CM8A 3L8VA 2CN8A 3OC1A 4YPDA 2OJFE 5BVNA 3ZHPC 5AV1A 2C6KA 4G2FA 3KB7A 3TZ7A 5IA1A 3WZKA 2XRUA 3MA6A 4FKJA 2W1CA 4O4BB 5C26A 1OITA 3QYWA 1U4DA 5IDPA 5ACBC 3VJNA 4ARKA 3ORKA 3A60A 2BIKB 5DR2A 5HG5A 3OF0A 4EKLA 3D14A 3F6XA 5ANJA 4E73A 1FOTA 1SMHA 1OPKA 2VN9A 2WD1A 3IGOA 4IAFA 4UXLA 5CS6A 3U9CA 2PMOX 2XIXA 1GIJA 5E4HA 4E5BA 5HG8A 1X8BA 4C36A 3R7GA 1ZARA 3G33A 4L45A 3SA0A 4HGTA 1GOLA 2W1IA 2YHVA 4YO6A 5E91A 2UZBA 3TL8A 1B39A 3FZRA 5ANGA 3PRIA 3R30A 3CBLA 4AX8A 4EH9A 1SVGA 4LFIA 4BDIA 5JMSA 3KVXA 4Y5HA 4BHZA 5CU0A 2GMXA 5DGZA 4IW0A 3OWKA 4EWQA 4C4EA 2PK9A 3PXKA 3EYGA 4HNIA 4I20A 4EK3A 4F7JA 4UWCA 1IG1A 3AMYA 5DNRA 4WBOA 1MP8A 1ZLTA 3DBDA 4O96A 3FEGA 5J9LA 4CZUA 4TYHA 5FXSA 4P7EA 3QC9A 2QR7A 4MVFA 5IG1A 3Q6UA 3LLTA 3MPMA 3V5JA 2UZNA 5DPVA 1ZZ2A 4JRNA 4BIDA 3SVVA 1WFCA 3ATTA 3CIKA 1AQ1A 4RIXA 3O2MA 1Q8ZA 4FT7A 4XV2A 5DA3A 4AACA 4YC6A 4NIFA 4BWXA 3AT2A 4AQKA 3LZBA 2R3MA 3DBFA 3QHRA 2XBJA 3R1NA 1WBNA 3IDCA 3LFDA 3SOCA 2IVSA 3EL8A 3U6JA 3HA6A 2UUEA 4NJDA 2G1TA 1ATPE 3N51A 2F2CB 3OZ6A 4UYAA 3V8SA 2WXVA 4C4GA 1KV2A 5I5ZA 3QTQA 4X3FC 2RKUA 2XNPA 3K3IA 3OEZA 3BGZA 4MTAA 4TT7A 3KREA 4DHIB 4G6OA 3PXFA 4RA5A 5KO1A 4EOIA 1WBWA 5KKRB 2O0UA 5JH6A 5M4FA 4IVBA 3EQPA 3MH2A 1OIRA 5CAUA 2V62A 4FV6A 3DQXA 5EHOA 4OTFA 3L8SA 1UV5A 4FT9A 4E1ZA 2UVXA 1PJKA 3D7TA 3MVHA 3RCJA 2B9FA 5JQ5A 4U0IA 3U8WA 3VUIA 1Z5MA 1JNKA 2Y6MA 3JYAA 2W99B 1J91A 3IKAA 4FTOA 4D2PA 4F9YA 1J7UA 4O0UA 2GNJA 2JDOA 3HVCA 2OXYA 4E4MA 1ZAOA 3W8QA 3GBZA 4NM0A 2O63A 4A9TA 5JQ8A 2ITTA 3GFWA 3KK9A 4YJNA 4FI1A 4D4YA 2GNGA 3RZBA 2GNFA 4C33A 2QOBA 4C59A 3LW0A 3WI6A 3OWLA 2P55A 4H3BA 3OCBA 4AG8A 4I0RA 4J1RA 4L7SA 5FBNC 1FBNA 4FT3A 5E8ZA 3BE9A 5AUZA 4EOSA 3BELA 3MH1A 3ZUTA 3GC7A 4D58A 4QMUA 3CKWA 4M66A 2EWAA 3CD8A 3I0QA 4OTRA 2ZB0A 3PP1A 1W98A 3TV7A 2WEVA 4UMPA 2WKMA 3U6HA 2AUHA 3QQLA 4D0XA 4UX9A 1PXMA 1MQBA 5HNGA 3QQGA 1LUFA 2RG5A 2UZEA 5HBJA 3A7FA 3QZGA 5AUYA 2F2UA 3AKJA 3DBEA 3Q4UA 1PMNA 4LM5A 5HD4A 3EN9A 4F0GA 5B2MA 5AP3A 3MESA 2HWPA 3QAME 4BYJA 5BMMA 4ZLOA 3KRWA 4AW0A 2CJMA 4AAYA 1BL7A 4U80A 4XCUA 5DVRA 2HY0A 4YO4A 4EL9A 3DNDA 3O51A 5DFPA 4C02A 4JQEA 2BTSA 3D83A 4LRJA 4XV1A 5DEYA 2Q0BA 2OBJA 3UDSA 4QMSA 5FEQA 3VUDA 1JSTA 2R5TA 5EI6A 5FG8A 4BKYA 4BRXA 1B38A 3FI3A 3LFNA 4GG5A 2QOFA 4G6LA 2X9FA 3JUHA 4GT4A 4OUCA 2WIHA 4GJ2A 3UGCA 4DGOA 3FUPA 2XK6A 3KKVA 4R6VA 5J87A 3HAVA 2IO6A 3EN7A 5FD2A 3TZ9A 1Q8WA 2ZOQA 2NRUA 2ZB1A 4YJSA 4F6UA 5BYZA 3SXRA 4BZOA 4G5JA 4YPSA 2X7OA 3NSZA 4XP3A 5E8SA 3ZRLA 4B7TA 4PTEA 4AZVA 1XJDA 4FGBA 5LWNA 3N4VA 4I6LA 5KHWA 3S95A 3TMOA 2E9VA 4ZJVA 4R7HA 2WO6A 4FTNA 2XIKA 5KMJA 1OIYA 2WU7A 2ZMCA 3BEAA 2UW3A 4PV0A 3BHHA 2UW8A 2X4FA 3CY3A 4PQNA 5DWRA 3S2PA 5DG5A 3QRKA 3NUSA 5L2IA 2YM5A 1CSNA 2JAMA 3KXNA 3WE8A 4O84A 2I0VA 3RAKA 3QD0A 4O4FA 4XBRA 4B4LA 4D5KA 2PULA 2QI8A 4GRBA 1DAYA 3GU7A 3O8PA 3PTGA 4FSWA 3ANQA 4HCTA 2J5EA 3OWJA 4IZAA 5CQUA 3TNQB 4JJRA 4XOYA 3ODZX 3QUDA 4P5QA 3KIOC 4QP6A 1YXVA 4FL2A 4IE9A 3CXWA 3ULIA 2ZV2A 4BKJA 5BUIA 4ASZA 3VHKA 4KRDA 4XG7A 4EOJA 3GI3A 4KIKB 1UA2A 4JBOA 2EXMA 2XIZA 2OJIA 5EQEA 2HOGA 4R1YA 3NZ0A 4YLLA 1SM2A 4ZY6A 4U6RA 4CT1A 4DH8A 2OXDA 3BX5A 4NCTC 4DEIA 2OZAA 3LLAA 1H0VA 3GB2A 4QT1A 4IHPA 4EQMA 4XRJA 3P0MA 2WTKC 5CNOA 5HLNA 4C62A 5CZHA 4ITHA 5BNJA 3O8TA 1QPDA 2OW3A 2UZOA 4X3FA 5AP5A 5CSPA 3VS4A 4YP8A 3O23A 2DYLA 1F5QA 2QO2A 5LMBA 4XH6A 4GUEA 3R7UA 4K8AA 4HYHA 4IB0A 3PA4A 3G9NA 4FKTA 2WMSA 3EWHA 3QCSA 4KA3A 1Q61A 1PKDA 1WBVA 3WYYA 3ZCLA 4E7WA 3F2NA 2QNJA 4MEDA 1H1QA 3UNZA 4CTCA 2XAMA 2O64A 4NSTA 4FG8A 4QMPA 2WMVA 3LCKA 4U97A 4IC7A 1TQIA 2B52A 2Y6OA 4H1MA 4OGRA 3EZRA 4FTLA 2H9VA 3AGLA 4WRSA 1H1SA 3FXXA 2W1GA 5AV2A 2BPMA 1R0PA 5HCZA 1FGKA 4HVDA 4FG9A 5CENA 4F7LA 5C01A 3VS0A 1FQ1B 2E2BA 4U5JA 3P1AA 5J5SA 3R02A 3E92A 2YITA 4YZDA 5DT4A 4TL0A 4RX5A 5AX3A 3R71A 5LVNA 3O7LB 4FKLA 4IB1A 3Q3BA 3ETAA 5EH0A 5HU9A 4I6FA 1B6CB 3NVMB 4JQ8A 4GVAA 4PTGA 2C1BA 2OJ9A 3FPMA 3WZDA 4C34A 2YIXA 4O1PA 2P2IA 2OG8A 3BLAA 2ERKA 4JIAA 5A4QA 3D0EA 4O7YA 2RL5A 4XG9A 2HENA 2PUIA 2X2LA 4QP1A 3ZEPA 2QU5A 4HGSA 1PYXA 3IG7A 3NDMA 3MFUA 3SLSA 3VS5A 3ZO1A 2B9JA 3BBTB 3VUGA 4ONAA 1Y91A 4Y46A 1JSVA 3A8WA 3PJ8A 5DT3A 4AN3A 3F3TA 4QPSA 4CV9A 4TTHB 3U54A 3FKLA 3P5KA 1MRUA 5LVOA 3OROA 4N6YA 3IW7A 4UMTA 4FTQA 2QC6A 5AP1A 3UOKA 3P7BA 2C6TA 4CFWA 4B8MA 4U8ZA 2FYSA 2IZSA 5AUWA 3EQFA 1OI9A 2IW9A 3VF8A 2WFYA 5CU2A 3BLQA 4RQKA 2YA9A 4BTJA 4QYFA 4B99A 5JZJA 1W2FA 1JOWB 5AIKA 4FOBA 2ZV8A 4H58A 4TNBA 3SRVA 3ZLYA 5M56A 2VTSA 2QR8A 3BHTA 4MD8E 1ZOGA 2BTRA 2E9NA 3AC1A 2W96B 3HRBA 4V01A 2OZAB 3GGFA 1XBCA 2C6DA 4TYIA 4N6ZA 4AGUA 5H2UA 3W0RA 3ORMA 4H3PA 4KSQA 3WOWA 4QQJA 1BLXA 3E8CA 4AWIA 4L44A 4LOQA 4O86A 3O50A 3WF7A 2BILB 3UIXA 4D2SA 4IIRA 5HX8A 4USDA 5BVOA 3QA8A 3CP9A 4PPCA 3RHXA 4YLKA 2QODA 4PDOA 4HVGA 3DAJA 4OLIA 1BI7A 4S32A 5CY3A 3RWPA 3M42A 3FL5A 1YVJA 3DS6A 2FH9A 2PZPA 3PDTA 4AA4A 5CF8A 3MA3A 4PL3A 4L3PA 1LEZA 4DITA 4ZXTA 5A54A 2PVRA 4O82A 4DHZA 3NMUF 4RFYA 1U54A 5AP2A 1CKPA 3OCSA 4DG3E 4I6QA 4NH1A 5EDRA 4UMUA 5JFXA 4M0ZA 4I24A 2FSMX 2X6DA 1A9UA 3QF9A 4J52A 4AQCA 2JITA 2YIYA 3TNHA 5BPYA 3AC2A 4MF1A 4YJPA 4KIOA 4HJOA 1E9HA 5H8GA 3FLSA 5AV0A 2NYAA 1VEBA 3KULA 1IAHA 4J53A 2X1NA 3WF5A 1KV1A 3P7AA 2QU6A 3QQJA 4BGQA 4FUYA 4TWNA 2PZYA 4DAWA 2YEXA 3GU8A 4RFMA 4X6RA 1YXXA 4U79A 3ZS5A 4GT3A 4ZY5A 4GYGA 3KN6A 1OMWA 2WOTA 4EI4A 4O0RA 1PY5A 3TUCA 4ERKA 2QLQA 3QUEA 3ZC5A 1G3NA 4WA9A 3R7VA 4IVDA 5E8VA 4EORA 4RWJA 2JIUA 5CXHA 2GNHA 2UW6A 3LIJA 2P2HA 3MI9A 4OBPA 5AX9A 4L3LA 4II5A 3DNEA 3PJCA 3UJGA 2JKOA 4CNHA 4F1TA 5L4QA 5DYJA 3BV3A 5J1WA 4EH7A 4E6CA 3DK7A 4NFNA 2BUJA 1UWHA 2X9EA 4IMYA 3QLFA 4E3CA 1OIUA 1RDQE 3Q4TA 4BZDA 4E6AA 5IZFA 5E9EA 2ESMA 2BKZA 2I6LA 2DWBA 5CAVA 5CX9A 3ZDUA 3E87A 2WTJA 3L8XA 1STCE 3LFEA 4IWOA 4RPVA 4YBKA 3UIUA 2F7EE 5CF6A 1BUHA 2OO8X 4J71A 5ANIA 3KCKA 3HV6A 4FTCA 2R3JA 4MYGA 4X2FA 1W8CA 4WHZA 2ERZE 4FKVA 1XMMA 4CLIA 1J7IA 2REIA 2ZV9A 4AN2A 5HO6A 5IH5A 5D12A 1Y8YA 3SRVB 4G9CA 5LMAA 4FSRA 5M4IA 3DXQA 4Y95A 5HNBA 2PYWA 3L9MA 5D41A 1UKHA 3R9NA 4YUQA 4CFMA 3ID6C 4LI5A 5FEDA 3AQVA 2QOCA 3IDPA 4X7QA 2GQRA 4MBLA 5EKNA 5IQHA 1V0PA 2I40A 4FTIA 3F5XA 1H1RA 2G15A 3U9NA 3LMIA 2VV9A 3FZSA 3NYXA 5AUXA 4TYEA 3TKHA 3FKOA 3BWJA 5DN3A 3BGPA 3RK7A 3M1SA 3C0IA 5JT2A 4EHVA 1J3HA 4KNBA 2SRCA 3L9LA 1A48A 5KNJA 2VO0A 2PMLX 2B55A 3KXZA 2JAVA 4O2ZA 3MN3A 3PG1A 2CGWA 3A99A 3VJOA 3ZO2A 5CYIA 3SQQA 1MRVA 1ZOHA 1GIHA 3H10A 2PMNX 1G8JA 2HXLA 4LG4A 2I0EA 3G15A 4M8TA 2YM3A 3KRXA 4ACDA 4D2TA 1TQMA 3R1QA 4MNFA 3VS7A 2PVNA 5JZNA 2R3LA 4FZFB 2JGZA 4DT8A 5IQGA 2VRXA 4WG4A 5ITAA 4YC8A 4BDAA 4GU6A 5H9BA 5AR3A 2QO9A 3F5GA 3E3BX 3ZBFA 1YOLA 4BTKA 3QALE 4QTDA 3ACJA 3FYKX 4LUEA 4CCBA 2KTYA 3B2WA 3MY5A 2H8HA 5E1SA 5KMOA 5A3XA 5DRBA 4NM3A 3PG3A 3F3WA 5C1QB 4CRSA 1ST4A 3MVJA 2X7FA 5CXZA 2OGVA 4BCHA 3PVBA 1H07A 3GT8A 3KF7A 2LAVA 3ZYAA 4CMUA 1T45A 5LOHA 3NIEA 2WMRA 3K3JA 5IUHA 4ZJIA 2HZNA 2V22A 2HWOA 3C50A 4OT6A 3GU5A 4E4NA 5HLWA 2CNUA 5A4CA 1QL6A 2WMUA 4BN1A 3VO3A 2GNIA 4FEQA 1JLUE 5AM6A 1G8SA 4F9BA 2QO7A 3FSFA 3QLGA 1Q97A 1YHWA 4I5MA 4NM7A 1GZKA 4FUXA 3V5TA 5FRIA 1VLRA 3EQRA 5C27A 5J7BA 1XH7A 2JIIA 2OKRA 5CSVA 2C30A 1XQZA 3RCDA 2Z2WA 4G9RA 3UPXA 4QP3A 4QYEA 3LCTA 3Q5IA 2VWXA 4L52A 5AR5A 3TNWA 2IN6A 5JSMA 5CF5A 2GDOA 5HE1A 4ZTHA 4QMZA 2PHKA 3IQ7A 4FKUA 3TIZA 4CFFA 3LAUA 5CVHA 4EHEA 3FLYA 3RM7A 2A98A 5HTBA 5I9YA 2J4ZA 2XKDA 3NUNA 3SHEA 1YHSA 5BVWA 4IM2A 5HG9A 5DEWA 1REKA 5FGKA 2QCSA 2V0DA 3KEXA 3VUHA 3VULA 3FI4A 3IW4A 4YNEA 4ZTMA 4O38A 5BVEA 2LGCA 3PJ1A 4AU8A 3ORLA 5IF1A 5BYLA 4WG3A 2XNMA 1OL2A 4IAKA 4HVIA 2VX3A 3QYZA 4IXPA 3RTPA 2BIYA 3R8PA 3S1HA 2XKEA 2PZIA 2WGJA 4G31A 4PMSA 3MB7A 4BCNA 4BICA 1PXJA 4D0WA 3UPZA 4CG8A 4MHAA 3VBYA 4DEDA 3GENA 4ANNA 1OUYA 2PE0A 4YTCA 1YDTE 2XNEA 3QBNA 3PY0A 5FTQA 2EB2A 2OH4A 4NWMA 3ZZEA 3FMMA 4AW2A 4Z16A 3ROCA 2RGPA 3BI6A 3DKFA 1V0BA 5AP4A 2OXXA 4J8NA 1KE5A 4K11A 4MWHA 2XEYA 2XRWA 1L8TA 2JFMA 4GK4A 4Z9LA 4I3ZA 4FTUA 3E3PA 2W1HA 2CKEA 3E8EA 3CR0A 3Q53A 4KSPA 3C13A 3GQLA 4IX5A 4LV5A 5TKDA 2WTCA 3M11A 2CLQA 4CTBA 2F7ZE 3IO7A 4OR5A 3A4OX 3DBQA 3DK3A 1O6KA 2YJSA 3R2BA 4I6BA 2ONLC 3HZTA 2P3GX 4LV8A 4QQ5A 5AUTA 3FXWA 2Y7JA 4AT4A 4RC4A 3ZFXA 1OL7A 5BQ0A 5IQDA 3PFQA 3EH9A 3HV5A 3N4TA 4XOZA 4CT2A 2QG5A 4B9DA 4GK2A 4MQ1A 1H25A 2C6EA 1H1PA 2OU7A 1R78A 1JKLA 3OW4A 4GMYA 2I0YA 5J7HA 5KX8A 3A7JA 4Y72A 3W55A 3DXPA 3DZQA 3F3UA 3D4QA 5HEZA 3WZUA 4BTMA 1ZOEA 4Y85A 4C2VA 4ANOA 4V0GB 3TG1A 4AP7A 3SDJA 1TFFA 3E62A 2XVDA 5H8EA 4CD0A 3WBLA 2AQXA 3TDVA 2RG6A 4JX7A 5EFQA 5JK3A 2PUUA 3DOGA 3B2TA 1O6YA 4I93A 4UB7A 2F9GA 2XA4A 1XBAA 4M97A 3TXOA 2PVYA 2YFXA 5AM7A 4GV1A 4WUNA 2BRMA 2BFYA 4RLKA 4YHJA 4IM3A 2R2PA 4U44A 3FY2A 3RNYA 4NW6A 4YSMA 3KXXA 4JBPA 3W2PA 4D5HA 2BROA 3MPAA 4PP9A 3ZONA 4USFA 4GIIA 2WQNA 3O96A 2BRBA 2BZJA 5FXQA 3I5NA 4U81A 3R7EA 3DU8A 5T6KA 4QPAA 4K6ZA 4WT6A 4DCAA 3OUNB 2AC5A 3WZEA 2H34A 1KOAA 1RJBA 4Q9SA 4LRKA 4RSSA 5I9ZA 4H1JA 4CYJA 3ZXZA 2AYPA 1H0WA 3F2RA 5IEYA 3QWKA 2R3GA 4O0YA 2VWVA 3U55A 2EU9A 3MS9A 4EK4A 4DH3A 3QGWA 4FEVA 4FSQA 4KS7A 3ROYA 1SNUA 2W06A 3H9RA 4Y8DA 4IACA 3R73A 5CLPA 3UVRA 4DGLC 1ZMWA 4ALVA 4UYNA 4M12A 3NVKI 3OXTA 2JC6A 3Q5ZA 1OPJA 5CVFA 1G8KA 4RIWA 3NYNA 4MBJA 3PA3A 3ZTXA 2YM8A 4Z7HA 2ITUA 4JOAA 4C4IA 2VTNA 2B0QA 1JWHA 1OIQA 1XH4A 2JLDA 3I0OA 3PJ3A 4MXYA 4FEUA 4AW1A 2R3PA 5LJJA 5L2WA 2X4ZA 1IAJA 2O3PA 2Q0NA 2XEZA 5TF9A 3UDZA 4OAUC 2JKQA 3QQHA 4ASEA 2B9IA 3OVVA 5CZIA 5CNNA 2OWBA 4E6DA 2OFVA 5M51A 4PDYA 4FODA 4OT5A 4AT5A 3PWDA 4R7IA 5IQCA 3DY7A 4IDVA 4BCQA 4F9WA 4WD5A 4DF3A 3OG7A 5IA5A 4BCIA 4F65A 1TZDA 3LFBA 3T8OA 4K33A 2EXCX 4WRGA 2VGOA 4YGAA 5IUGA 3QD4A 4CGAA 2FUMA 3LFQA 5M57A 5E92A 3VBXA 4N57A 2CMWA 4BDEA 1PXOA 2ZJWA 3NPCA 1FPUA 4I92A 3VW8A 4D4RA 3TCPA 3UNKA 3FLZA 2X39A 4DEEA 4LL0A 4RIYA 5KMLA 1IEPA 4LOPA 5CALA 2X2MA 4YHFA 4L42A 4JDKA 4IFGA 4IWPA 4N4SA 4ANMA 5A6OA 2G2IA 3OY3A 5HLPA 2W9ZB 4L53A 4AGCA 2IG7A 5KMIA 4ASDA 1Q8YA 4G16A 2BAKA 5M4CA 1P4OA 3Q4CA 4TPTA 4ZSAA 1RE8A 2FA2A 4KBKA 4XV9A 2VTTA 3GU4A 3PXQA 3MPTA 4BYIA 4CZTA 3VC4A 3Q9XA 4C2WA 2AC3A 4EOPA 3R8VA 4R3RA 1QMZA 5AP6A 4FEWA 3ZSIA 2R7BA 5EW8A 4PNKA 4ZAUA 2IZTA 3V5LA 2VWWA 1A06A 5DIAA 4XLIA 3PXRA 4J7BA 4S30A 4FIHA 5A9UA 3P23A 5E8WA 1SVEA 1ZYSA 3PY3A 5HICA 2XF0A