4U80A

Mek 1 kinase bound to g799
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
319
structure length
286
Chain Sequence
b'MELKDDDFEKISELGAGNGGVVFKVSHKPSGLVMARKLIHLEIKPAIRNQIIRELQVLHECNSPYIVGFYGAFYSDGEISICMEHMDGGSLDQVLKKAGRIPEQILGKVSIAVIKGLTYLREKHKIMHRDVKPSNILVNSRGEIKLCDFGVSGQLIDSMAVGTRSYMSPERLQGTHYSVQSDIWSMGLSLVEMAVGRYPIPPPDAKELELMFPPMAIFELLDYIVNEPPPKLPSGVFSLEFQDFVNKCLIKNPAERADLKQLMVHAFIKRSDAEEVDFAGWLCSTI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dual specificity mitogen-activated protein kinase kinase 1
publication title Structure based design of novel 6,5 heterobicyclic mitogen-activated protein kinase kinase (MEK) inhibitors leading to the discovery of imidazo[1,5-a] pyrazine G-479.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 86
structure length 286
sequence length 319
ec nomenclature ec 2.7.12.2: Mitogen-activated protein kinase kinase.
pdb deposition date 2014-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4u80A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4u80A01
4FODA 1ZY4A 3SQQA 4D2SA 5M55A 4L42A 4EYMA 5C4LA 3KREA 3KC3A 1V0PA 4O1OA 4IM2A 3SOAA 5JKGA 4I5HA 2J2IB 3BHYA 4M3QA 2YM3A 4HGSA 2VD5A 3UZTA 1F5QA 3K3IA 5IH6A 3U8WA 2OJIA 3CKWA 4RSSA 3D83A 1LPUA 2F2UA 3EQCA 4FV3A 4C34A 4L43A 2PULA 3NIEA 3R00A 3RM7A 3A7JA 3N51A 3VVHA 2W4KA 2OIBA 3C51A 3RP9A 3FAAA 4KNBA 5AMNA 4U43A 2OF4A 3MJ1A 3WF9A 4DG3E 1E1VA 1YWRA 4TYHA 1PRYA 2WTKC 2ITNA 1UV5A 3KVXA 2FGIA 4XS2A 3TZ9A 4PTEA 4IJPA 4Q9SA 1YXUA 4BCKA 2XJ2A 4USEA 3LPBA 1R3CA 3NX8A 5K4JA 2JIUA 2WOTA 2CKEA 5A9UA 3OWPA 1PF8A 4LV5A 4MXYA 1OITA 3Q5ZA 4ZAUA 2XKFA 4L6QA 4BDIA 3FLNC 4DGMA 2IVVA 4E5WA 1IA9A 3GCQA 2CLXA 5AV0A 3UP2A 4EHGA 5FWKK 2J50A 3QL8A 4GK3A 3LJ2A 1SVEA 1PMEA 3F2AA 1M52A 2I0HA 3QGWA 3D4QA 3QKMA 3SXFA 2HW6A 3A60A 5EHYA 2UVZA 3LCSA 2W1DA 3QUPA 4JNWA 5EK7A 2WEIA 4JAJA 3C0IA 2IJMA 2YJSA 3F3UA 4PUZA 5I5ZA 1UU9A 4KSQA 2XMYA 5JN2A 3TUCA 3HA6A 4DE4A 1VJYA 1Y57A 2VX0A 3PXFA 4WO5A 3BHTA 4NCTC 4CV8A 4GIHA 3DKOA 2HK5A 5LVOA 3Q9XA 2WPAA 1CTPE 2YM6A 5CSPA 5J7BA 2WMWA 2CLQA 2PWLA 3R2YA 1YI6A 2HENA 4USFA 3DDQA 5IZFA 5D7AA 1FVTA 1GIHA 3OCGA 4MD9E 4E5BA 3T9IA 4JBOA 3KXZA 1P4FA 4GYGA 5J9YA 3WBLA 5J9LA 4G3EA 4K0YA 2VU3A 4O0UA 3Q2MA 3M42A 4FSQA 4KIKB 1ZOHA 2V55A 4C4GA 3K54A 3TT0A 4BBEA 3EB0A 4CCUA 4YHJA 4IHPA 4F7JA 2VWZA 4TPTA 2OH0E 2QHNA 3EYGA 4C36A 5L6OA 4G2FA 2RFSA 3FXXA 4N4SA 4FV1A 4PPCA 3EN4A 4WRGA 3VHKA 4F63A 1QL6A 2BALA 2OWBA 2VTPA 4AN9A 4TXCA 2XCKA 4B8LA 4BL1A 3ET7A 4PP7A 4MK0A 3WE4A 4B6LA 4F0GA 5FGKA 3WOWA 3FLWA 4IWOA 1U46A 3PVGA 4FTQA 4M8TA 4QTCA 3GB2A 4JBPA 4OT6A 3G15A 4FTIA 2WEVA 4RIYA 4X6QC 3U51A 1O9UA 3E93A 2XK6A 4DFYA 1Q3WA 1H25A 3G0EA 3KXMA 4W4VA 3HKOA 3AGMA 3VF8A 2ZB0A 5TT7A 1ZZLA 3A8WA 3GUBA 2CGXA 2HY81 2UZUE 5GHVA 5M09A 1JQHA 2WMQA 3SG9A 2EB2A 3NEWA 3U54A 5IQAA 1PYEA 3NYXA 4ASZA 3UZRA 5HNGA 4BDDA 1L3RE 1SYKA 4ZTQA 3LXNA 3HZTA 4BDKA 1TKIA 4D2RA 4MXAA 4W4WA 3LLTA 1DI9A 4RIXA 5H8EA 4XV3A 1UNLA 4FL3A 2C6DA 2W1IA 3EIDA 3MY0A 3SC1A 5GIPE 4AW1A 4E8AA 2C5NA 2X7OA 1PMUA 3BEAA 2A0CX 3HP5A 5HVYA 3AC1A 4Q5EA 4WG5A 2R3GA 3MB7A 5ETFA 3VUTA 3I81A 3FMMA 4TY1A 4F1OA 2E9OA 3V8WA 4A06A 1FMKA 3E92A 3OWLA 4C4FA 3G9LX 3UOKA 5JT2A 4HYHA 4CG9A 4QD6A 4YC3A 5I3OA 3ZSHA 2CJMA 4BIBA 1O6YA 5E92A 1YWVA 5HQ0A 4FKWA 4BZNA 5JSMA 3BELA 4J96A 2BKKA 2LGCA 4GS6A 2CKOA 3KY2A 2OZAB 5EHOA 4M67A 4PV0A 3VF9A 4EOOA 2PK9A 3QRKA 4Y46A 3UYSA 3ZCLA 2PMNX 3PLSA 2WTDA 3CY2A 4CCBA 5FXQA 5FDPA 3R22A 4FV6A 3F2NA 5J9ZA 3HMNA 4DF3A 3PE2A 4CTCA 3DT1A 3CTQA 5A4TA 3LCDA 1ZZ2A 4QNYA 3V5PA 4H36A 1UNGA 1PMNA 2UZLA 3LQ5A 4I3ZA 5D1JA 4TWPA 2UVXA 5JRQA 3CEKA 2FB8A 2YABA 3IO7A 2QC6A 4OLIA 3ALNA 4IW0A 5F1ZA 4QTEA 3VQHA 2VGPA 4U5JA 2BDWA 3LZBA 3VBWA 4PPAA 2YFXA 4U0IA 4Y5QA 3VUHA 4Z7HA 4A4LA 3FLSA 4U7ZA 3M2WA 4PP9A 5HG7A 3PVBA 2QNJA 4FKRA 1Y91A 2PVLA 3FI3A 3SG8A 4P5ZA 5M53A 2UW4A 4ZLOA 4I20A 4O82A 4OBOA 3ATSA 2PUIA 1VEBA 2VO3A 3NIZA 4LMNA 4ZTSA 4QMVA 1UKHA 2W4OA 3C9WA 4IWDA 4DEDA 1GZOA 2WMRA 5BVNA 2XNBA 1ZXEA 1PXLA 4RQVA 4GL9A 3LFQA 5ANJA 3UGCA 4CYIA 3QYWA 2QODA 1Q61A 3Q4CA 4IIRA 5J95A 4JG6A 2Q0BA 4K9YA 4UMQA 2FYSA 5E8XA 3UC3A 3KXHA 3AT3A 3GNIB 3O17A 4O81A 2ITXA 1CKPA 3MH3A 3SLSA 2JFLA 2XNNA 5CAVA 5FP6A 4P5QA 5J1WA 3ZH8A 4BC6A 2RFEA 3PTGA 2H6DA 2GMXA 5I4NA 2QOHA 4FSWA 2JDSA 3LFBA 3NZ0A 3KRRA 4APCA 5CWZA 4HVDA 5KMNA 3R8LA 4G6NA 1WBVA 4XX9A 5HE2A 4GFGA 4MWIA 5KZIA 1XBAA 3FMKA 1XH4A 4JXFA 3VJOA 3MB6A 3ZRMA 5JFWA 2IVSA 4PF4A 2J0JA 5IMXA 3PG1A 2YAKA 4IADA 5I9WA 1YI4A 4ACGA 4FSTA 4G1WA 3OHTA 1Q24A 4DFBA 3QXPA 4KINA 3MN3A 2C0TA 3MTFA 4F9YA 3SRVA 3LXPA 4QMSA 3VS2A 3EMGA 4I0RA 2QG7A 1YDTE 3ZEPA 3UIBA 2B53A 3H9OA 4NZWB 5EOBA 4CZYB 4UWCA 2PVHA 4TNBA 3W2PA 4C3FA 4ENYA 4XP2A 1S9IA 3HMMA 2JIVA 3OF0A 4K33A 4G6LA 4PQNA 3G90X 1CSNA 2QI8A 4LUDA 4DLJA 4GYIA 2BZIB 3CQWA 1JPAA 2WELA 2UZDA 5LMKC 5E8VA 4WG4A 1WBNA 2ZYBA 2OH4A 3ZZEA 3MA6A 5DI1A 3TNPC 4FTKA 1X8BA 2OIDA 4MX9A 2YERA 4X0MA 3A4OX 3W55A 1PXJA 3D14A 3OROA 5LXMA 1H1PA 5FTQA 1JSVA 3MWUA 4RWKA 3UC4A 4EK3A 3BYVA 5CVHA 4DEGA 4IBMA 4FNYA 4RMZA 3H0ZA 4NM0A 3TWJA 2V0DA 5EOLA 2PTKA 3LKMA 5K0XA 2X2LA 4KSPA 3IQ7A 4MNFA 4YBJA 5I9YA 3F61A 2A27A 3TL8A 4E4LA 5D11A 5J5SA 3IDBA 5EHLA 3B2WA 3FHIA 4IX3A 1W84A 2YJRA 4TRLA 5E8TA 4ZEGA 2RL5A 5AUVA 1M7NA 2RG5A 4HPUE 3UTOA 1Q8TA 4KRCA 4PMMA 3FSKA 3FBVA 4YZCA 3WZEA 4I21A 2QKWB 4C57A 3BX5A 3LAUA 2R2PA 4MVFA 4R5YA 2BAKA 3E8CA 3KFAA 3VUIA 3ZXZA 3CTJA 5HE3A 2VWIA 4Q2AA 4ZOGA 3OTUA 3UO5A 3OY1A 4RFYA 1K3AA 4CT2A 1LR4A 1LUFA 4RT7A 3FMDA 2YCSA 4IACA 2C6MA 4DTAA 1BUHA 3ORMA 1IA8A 3E7OA 4YLJA 4IE9A 3UE4A 1NXKA 5FM2A 4CNHA 3SGCA 3CTHA 3ENHA 3E8DA 1SNXA 4IX6A 4C0TA 2DWBA 2W5AA 4X21A 4DYMA 5K4IA 4QP7A 5IPJA 4C37A 5IQIA 3PPKA 3WYXA 4E4NA 4E3CA 3ZRLA 4AU8A 5T6KA 3JS2A 5CYIA 3SW7A 2YIQA 4I92A 4IZYA 3ZFYA 3TTJA 4B9DA 2GHMA 4EEVA 3ZO3A 4D2WA 4IZAA 5AR3A 3SAYA 4IAYA 3HMPA 4W9WA 5EDQA 3ZFXA 4EZ7A 3BIZA 2VTIA 3RJCA 4EC9A 2VTSA 2WQNA 4EH4A 4EQMA 4NYEA 5AAFA 4ZSEA 4EK6A 4L8MA 5EI8A 2QOFA 4C4JA 1CMKE 4PWNA 2R3NA 3FY0A 3O71A 4ERKA 4AUAA 3QTSA 4JBVA 5M4CA 4V05A 4DH1A 4EK8A 5IA5A 5DE2A 4FIJA 3OD6X 4G9CA 4D0XA 5L3AA 3QKLA 4GFMA 4NL0A 5BYLA 1FVVA 2CHLA 4K18A 4FGBA 2YIYA 1OKVA 1NVRA 2C5VA 4RC2A 2DQ7X 2P55A 4UV0A 2OJGA 3ZS5A 4AZVA 4PMTA 3E7VA 3RNIA 3ZONA 2GNFA 4EUUA 3OW3A 4CRSA 4YJSA 4OTDA 5J5TA 2PPQA 3ODZX 2BDJA 4YR8A 1DS5A 3A2CA 3F82A 1J1CA 3QXOA 3NR9A 4O38A 3COKA 5AR4A 1UWJA 4FSRA 4CMUA 5FP5A 2C5OA 2JEDA 2C6LA 2F49A 2PHKA 2VNYA 4LQMA 3EQIA 4ZSJA 2CMWA 2UZVA 2W5BA 3FJQE 5E4HA 4K6ZA 4CFWA 2YN8A 4BKZA 3HA8A 2YLEA 2XEZA 4JG7A 2GFSA 2C1BA 3OWJA 3PIYA 4P2KA 3EHAA 3ZEWA 2WIPA 1J91A 3EN9A 4FZ6A 4M15A 4TTHB 4ASDA 4OT5A 5CU3A 2OFVA 4XUFA 5H8GA 3RBWA 3LQ3A 2XZSA 2XJ0A 2RKUA 2F7ZE 4IB0A 3NCZA 5HIEA 3Q6WA 3NUYA 4GMYA 3F6XA 1VYZA 5L2SA 1OBDA 2FSLX 3QWJA 2HWPA 4JLCA 4FTOA 4QP6A 2ITOA 3PFQA 3ROYA 3LXLA 3HDNA 2VX1A 1OECA 2XKCA 5GNKA 3ORXA 1U5RA 5JEBA 1W7HA 3DZQA 4C3RA 1BX6A 3HL7A 3O0GA 2HW7A 4ITHA 5F20A 4E93A 4FL1A 4FK6A 3PIZA 2PMOX 4XBUA 1J7UA 2BDFA 2WU7A 3ZYAA 1OL6A 5D9HA 5B2KA 2UW0A 4NUSA 3KMUA 4FIIA 2Y9QA 3GQLA 3QAME 3VN9A 3BU3A 3NUUA 2QLQA 2R3LA 5LVNA 3LE6A 2UW7A 4XG8A 5AA8A 4QPAA 3ELJA 3EN7A 4TW9A 5FUTA 3LXKA 4QQJA 5IA2A 5M4FA 4M69A 3D5VA 4EH2A 3UNKA 4EI4A 5CENA 2X9EA 3MJ2A 1YXTA 3QCXA 1PXIA 4IAAA 3T8OA 4ACMA 2X7FA 3VJNA 5L2WA 4XNEA 3NYVA 4LOOA 2YA9A 2R3MA 3CLYA 4EBWA 3Q04A 4J53A 3K3JA 4EOKA 1DI8A 4X2JA 3FL4A 3GC7A 1ZYLA 4C3PA 3MPMA 3ACJA 5BMMA 4BCOA 3TNQB 4EH8A 1MRUA 3QLFA 3R01A 4L44A 2VN9A 4FKJA 3VUMA 2PZ5A 2ZDUA 4AA5A 4JX7A 1H00A 2WHBA 3GU8A 4AE9A 1UU7A 5AJQA 4D2VA 1OPLA 4X3FC 4EH9A 2YM4A 4S33A 5EW8A 3UMXA 4E73A 5DVRA 5KE0A 2WTVA 3UIMA 5ETAA 4XG3A 3QQJA 5ANOA 5HTCA 3DXQA 3R1QA 2ZVAA 3C4EA 3F88A 4HCVA 4JJRA 4UY9A 4DAWA 3V04A 4I5MA 4FVRA 5BVOA 1Q99A 3RK7A 2R4BA 3O8TA 1ATPE 3NUSA 4AGWA 3HUCA 4BF2A 3PJ8A 5CVGA 4DT9A 4I6QA 3P79A 3FMEA 3DAKA 2B9HA 2ZMCA 3HRFA 3DLSA 4CGAA 4BTJA 5DOSA 3I6WA 3AT4A 2FA2A 4FIEA 4R1YA 4RC3A 3Q9WA 3OC1A 5CEIA 3S00A 3UVRA 2ITZA 4RZVA 4JBQA 4ZY4A 4LGDA 3C4FA 3CY3A 4NIFA 1Y6AA 2OKRA 3E3BX 5I0BA 1OM1A 4BWPA 5M06A 5BVFA 1SMHA 2WU6A 2Z2WA 5E91A 5L6PA 4EC8A 3FDNA 1OKWA 4HVIA 3MH0A 2R5TA 4ZZNA 1H28A 4WIHA 5CT0A 2BRMA 3NCGA 3E5AA 4QMOA 4FSUA 5FBOA 4RC4A 2WTIA 3COMA 3HGKA 4MQ2A 4DC2A 1R39A 4LUEA 1WBTA 3RHKA 3WZDA 1UVRA 4ZS0A 5HTIA 4YP8A 3Q9YA 4CMOA 5M08A 4U8ZA 5TO8A 5HE1A 4D4VA 3G9NA 1JKKA 5CSHA 4Q9ZA 4V0GA 4JR7A 4OBPA 3R7EA 3Q5IA 3NRMA 1AGWA 1WVWA 2JKKA 2HWOA 3QD3A 4F64A 3BHVA 3NNUA 2W0JA 4FTMA 4YJUA 4D4RA 5IQGA 2B4SB 4DCEA 2CNVA 2OXXA 2Z60A 4H58A 4I5PA 2RSVA 4BDJA 5EM8A 1ZAOA 3R8ZA 3QX2A 4ZZOA 3EWHA 4QTAA 3CXWA 4OBQA 3DBQA 3TI1A 4DGLC 1WVYA 2W99B 3NYOA 4QP1A 3NNVA 2KULA 2JD5A 2G2HA 1J3HA 4D58A 3T3UA 3ODYX 3DZOA 4U81A 4ZIMA 4PTGA 3NNWA 4JT3A 3NAYA 4F7SA 4CKIA 3OBJA 2EWAA 4N0SA 2VTMA 3QTWA 4AZEA 3U6HA 3CGFA 5HO7A 3ZRKA 3HRBA 4DFZE 5L2IA 2BFYA 3KN6A 4RPVA 4NCTA 4BTKA 5HCXA 2WQBA 3A7GA 1JLUE 2Z7SA 4S31A 5CT7A 2R9SA 1KE7A 4MHAA 2GNHA 3BLRA 4IVAA 1W83A 2J0MB 3ITZA 3KULA 5HX6A 4USDA 5KUPA 4L52A 3Q3BA 2GCDA 1H1RA 5DEWA 4D1XA 2DS1A 2C6KA 3FWQA 5DT3A 3L9NA 2I6LA 4OTIA 3RM6A 1OB3A 2XIRA 3DJ6A 2ERZE 4RVMA 4S2ZA 3R8MA 4H1MA 5EKOA 1AD5A 3GP0A 1KSWA 3GT8A 3C5IA 4UYNA 3A7FA 1H08A 3AT2A 3SOCA 4AZFA 2JKQA 3E8NA 4QPSA 3KRXA 4P7EA 4MXZA 3DBFA 3NMUF 4OR5A 3ZO2A 4F99A 2F57A 1FMOE 4JIKA 4QO9A 5DT4A 4QMNA 5A4LA 4S32A 3GBZA 2C0IA 2YAAA 1YOMA 2XNMA 3NVMB 1KE8A 3R63A 4O22A 5AX9A 3PIXA 3TTIA 4WNPA 2XNGA 1Q8UA 1R1WA 2YDKA 3KQ7A 4IX5A 4YZBA 5AR7A 4UN0C 4JX3A 4X2FA 3VNTA 2GNJA 1JAMA 4YLLA 4AT4A 2C3IB 1UU3A 4V01A 1FQ1B 4CXAA 1U54B 2W05A 2XIYA 4KIPA 4L53A 4FIGA 3V6RA 4C33A 3AC8A 4GCJA 4O0XA 1BMKA 4D1SA 2HZIA 4TL0A 3UNZA 4XP3A 4EHVA 4JQ7A 4DFLA 4RG0A 4I5CA 5L4QA 2HOGA 3DNDA 2ITVA 4ENXA 3OWKA 3WF6A 5LOHA 5C8NA 4YZ9A 4JDIA 2J9MA 3SXSA 2J0IA 4FZDB 3TZ8A 5HI2A 4AFEA 4FUYA 2PVNA 2QONA 4FKPA 4HCTA 3BGPA 4ZTRA 2XVDA 3KEXA 3MESA 5B2MA 5B2LA 5IUHA 2ZMDA 2XRUA 4EOQA 5HBJA 2FUMA 1P14A 3COIA 2OICA 2HY0A 1XJDA 4IWQA 4C2VA 4OUCA 1OUYA 2WKMA 4Y73A 3UO4A 3UVQA 1V0BA 3ZO1A 4O7RA 5AV2A 3IDCA 4LL5A 2B9IA 4BCIA 3HDMA 2HZ0A 3W32A 2ZB1A 2X2MA 4LOPA 3OEZA 4WSQA 4DBXA 2NNWB 2JAVA 2YIRA 4BTFA 3PXRA 4QRCA 2NPQA 4D4SA 2IG7A 2I0YA 3LMGA 4W9XA 4E5AX 2JKMA 3MA3A 2C30A 2OXDA 2HYYA 2OFUA 4FG9A 3KXXA 2H8HA 2J0LA 4UX9A 3I4BA 4FSMA 4O0WA 3VS5A 2XYNA 2G2FA 4QNAA 4QYFA 3ZLYA 3L1SA 5BPYA 1Y8YA 3V01A 2A2AA 3OFMA 4ZP5A 4RJ8A 4GK4A 3W8QA 5CZIA 2C1AA 3VS0A 3E3PA 5CASA 3R8PA 5AUZA 3TACA 1GY3A 4ZZMA 3BE9A 3IW8A 3O8UA 4R7HA 5AR5A 2QCSA 4KA3A 4DH5A 4YNOA 5I3RA 1J7IA 4O7SA 4KS7A 2R7BA 1QPDA 3FPQA 5B7VA 4R78A 1CM8A 5JH6A 4I4EA 2JBOA 4A07A 4C7TA 4Z55A 3AD4A 5IQCA 1URCA 5HE0A 4E26A 4M13A 3ZFMA 2VGOA 4U3ZA 4FZFB 1Q8YA 4YJQA 3PPJA 4YSMA 2PVKA 4DA5A 4FK3A 4UMRA 1NT2A 3R7GA 4BFMA 5F4NA 5LMAA 2IZTA 3F7WA 4QMPA 1W82A 5EW9A 4BCNA 5IA3A 5CI7A 1A06A 3QQGA 5DRBA 5LVMA 2E9PA 2PE1A 3UNJA 3QTIA 3DK3A 4M97A 1IAHA 4AW2A 1PXOA 2R3PA 2ZV7A 3EQPA 3NAXA 4HJOA 4XCUA 4TWOA 4XLIA 3O96A 4K2RA 3MDYA 4ZTNA 1I44A 3I60A 3MH2A 4FYOA 4BGHA 3HAMA 1IRKA 2XA4A 1SNUA 3MFSA 4PNIA 4BCHA 2OIQA 3OUNB 4XH6A 4YSJA 2CSNA 4O7ZA 4H3BA 4F0FA 3IECA 4O6LA 4TYHB 1Z57A 4RJ5A 1YDRE 1IEPA 2YCQA 1OIRA 2X4ZA 3DK7A 4FKOA 4UZDA 3E63A 5D10A 1GNGA 4AXAA 4EOPA 2PU8A 1OKZA 1ZMUA 1T46A 2V7AA 3L8SA 3LFAA 4JOAA 1H24A 4MAOA 2YACA 1A9UA 2BZJA 4CSVA 2BIKB 3ZOSA 5E1SA 1U59A 4MXOA 4FKVA 4YC6A 4KKEA 4U9AA 5A6NA 3HMOA 3A99A 2VTNA 3PWDA 1IR3A 5HNBA 1YHWA 3F5GA 4YU2A 2BAJA 2CCIA 1V0OA 1DAWA 2JAMA 2BCJA 2EUFB 4MQ1A 4RRVA 3LM0A 5ACKA 4EOJA 5BMSA 1MRYA 2C6IA 2ZM4A 3FMLA 2WZJA 2C0OA 4C38A 3DB6A 3RPVA 2WMBA 4IB3A 4QYYA 4XMOA 5HCZA 5CX9A 2RG6A 5AP6A 3CBLA 1R0PA 2XNPA 5BQ0A 2UZWE 5J79A 2PUNA 2ZV8A 1XH8A 4M66A 1GZKA 3S0OA 5LVLA 2OW3A 4IVBA 2PVYA 4OTHA 4O0SA 4X3JA 4ZSGA 3W2QA 4OTQA 5FXRA 2IW9A 2EXCX 3R83A 5CF5A 3QQLA 4R8QA 3MSSA 3A7IA 4R7IA 5C03A 4E6CA 3PSCA 4BGGA 1PW2A 5ANGA 4FE2A 3MFRA 3TV4A 4N6YA 4CG8A 4AFJA 2FO0A 3N9XA 2VTAA 4FV5A 5LMKA 3OVVA 5DEYA 2VWBA 2GNGA 2BRNA 5AP4A 2BPMA 4PX6A 2BILB 5BVEA 1ZMWA 3LW0A 2BRGA 2PUUA 3AC5A 1G3NA 2B52A 3V5TA 4NH1A 4J97A 3UG2A 3WE8A 2IZRA 4CVAA 2Z02A 3QQFA 4GIIA 3GC8A 2GSFA 4Z7GA 5AUXA 3E62A 4I24A 3D2IA 4JIAA 3FKOA 5CI6A 3F3TA 4C4HA 3V51A 3U87A 4ACDA 3D5UA 4RJ7A 3C0GA 1XBCA 4IDVA 2R3JA 4HYUA 3ENMA 3BEGA 3FLYA 3QZHA 4WUNA 4LRKA 5AR2A 3EFJA 1HCKA 2V5QA 4RIYB 4L46A 3VUGA 3RINA 5HGIA 3F5UA 4YJPA 3GEQA 2V62A 3Q6UA 4D1ZA 3VULA 3ZM9A 2WMSA 3HYHA 1K9AA 3LFCA 1OVEA 3IW4A 4IVDA 3ZUTA 2OGVA 3FQSA 3IW5A 3MVMA 3KB7A 4AW5A 3KK8A 3MI9A 3AG9A 2WMXA 3K2LA 5JZNA 4DEBA 3G6GA 4E1ZA 4H05A 3OXTA 4TT7A 4GVJA 2QKRA 3KXGA 3O7LD 3Q52A 4Y72A 3BQRA 3PA3A 3DQWA 3MGYA 1UU8A 3MPTA 4JG8A 1YHVA 4RIXB 5TF9A 3DXNA 2YIXA 4CZUA 4DGOA 3D7TA 3U9NA 5CNOA 3SKCA 5CAOA 5BX0A 4QYHA 3IOPA 3T3VA 1OIYA 5FG8A 3C1XA 2G1TA 3H3CA 3R8VA 3VBVA 3RPSA 3VS3A 1VZOA 2E9UA 4C59A 4FOBA 4R7BA 2XH5A 3OCSA 3DGKA 1TQMA 5LWMA 3DXPA 1Q4LA 5AM6A 4JS8A 3DPKA 4QQCA 3D9VA 1YRPA 2R0IA 2B9FA 4OAUC 3MV5A 4J98A 3TJDA 5HO8A 3LOKA 2CKQA 4UZHA 2C69A 2AUHA 4DH7A 5FQDC 5E8WA 1S9JA 2J5EA 1HCLA 4EKKA 4DCAA 3IGGA 5IEXA 3D15A 3IKAA 3Q4ZA 4X2NA 3N4TA 4PY1A 4N57A 2QHMA 3E8EA 2W1ZA 3KF7A 3CD8A 4XP0A 2AC3A 3QQUA 4L7FA 4O96A 4QP8A 1NY3A 5E8SA 1UNHA 2WMTA 4IM3A 5KBRA 4IC7A 1KE6A 2C47A 4QMLA 3OT3A 2I0VA 4RVLA 3FSFA 2HELA 4YBKA 3DBCA 4IB5A 1E1XA 4W8EA 2E2BA 3QTUA 4YTIA 2W1CA 5AP5A 2IZSA 5IH4A 3ETAA 3HX4A 3UPZA 3EFLA 2GS6A 4FV0A 3ZC6A 2X1NA 5IG1A 4MWHA 2IO6A 3AXWA 4IMYA 4P4CA 5EQYA 2XB7A 2HAKA 3LMIA 2RGPA 3QTRA 3P08A 4IM0A 3BYSA 4RIWA 3I5NA 4OTFA 3V8TA 2WB8A 5I9ZA 4FNXA 3D94A 2F9GA 3PRFA 3P4KA 4ZS4A 1PXMA 1QMZA 3H10A 3MVLA 3QTZA 3R02A 5L8JA 3QZFA 4D4YA 2IVUA 3D0EA 4ZY6A 2PE2A 4ZTLA 3I79A 1IAJA 4NEUA 3DK6A 4NKAA 3S4QA 3UPXA 2G01A 3K5UA 3ZBXA 1Q41A 3V6SA 3C4ZA 3WZUA 4UMUA 4OAVB 3U55A 2RFDA 5KMMA 1JSTA 5M56A 3LCKA 2GDOA 4A7CA 3ZSGA 4U6RA 3BQCA 5A4EA 4BDHA 3TUBA 3QQKA 4B0GA 2QQ7A 3SW4A 5AP2A 5AIKA 1FINA 3PVWA 4GRBA 3JUHA 1YHSA 4JI9A 4I1ZA 4AX8A 3FXWA 2EVAA 5IQHA 3PUPA 4FG8A 4FKIA 4GT5A 4NSTA 4XRJA 3ULZA 1XO2B 2A19B 2BHEA 3FC1X 3WIGA 4EH6A 1PKGA 5E9EA 3RNYA 3CE3A 4IWPA 3LFDA 4FMQA 4U45A 4U44A 2BRBA 5D41A 4UBAA 3NW7A 4NM3A 2QOCA 3ALOA 4U80A 4AZSA 4PMPA 1FOTA 2GHLA 1QPCA 3H9RA 4FTJA 3RPYA 4EORA 2PYWA 4KWPA 2RF9A 4EOIA 2BKZA 3B2TA 3EQHA 4CQGA 4WSYA 1H01A 4JR3A 2G15A 1CKIA 3C50A 5AIRA 4PTCA 5E8ZA 1YQJA 3OS3A 1Q8WA 2W1GA 4CLIA 3DCVA 1ZYJA 2W1EA 3WF7A 5CALA 3FE3A 1XR1A 2HIWA 4ANSA 2WTWA 3PJCA 1H4LA 2R7IA 3JY9A 5HESA 3PDTA 3AGLA 4ANOA 4OTGA 3MVJA 3FQEA 2QO7A 3O23A 3F3WA 5GJGA 4AT3A 4E7WA 3KL8A 2BZHB 4PMSA 3PJ2A 2VWUA 3DS6A 3JR1A 5HG5A 3LCOA 4RA4A 3VRYA 2ITYA 3I7BA 4II5A 3CIKA 3RHXA 1OIQA 2C3KA 3M1SA 1MQ4A 3G5DA 4R3CA 4ITIA 2XUUA 4D9TA 4F08A 4AN3A 3GFEA 5IISA 2BZKB 2VWWA 2Y4IB 4LYNA 4H1JA 4W8DA 5AV1A 4TYJA 4G34A 3QU0A 2QOIA 3BV3A 4O2PA 1PY5A 3OOGA 3R21A 4FV4A 3KCKA 1OUKA 5AUWA 3D7ZA 3BKBA 4FL2A 2ZOQA 4X3FA 4ACHA 5ANEA 3QA8A 3N4VA 5GINE 4GH2A 2PY3A 5DNRA 1Q62A 5EQPA 1RW8A 4F7NA 2CNQA 2ONLC 4YHTA 3B8QA 1P5EA 2IVTA 3HV4A 3UYTA 4F09A 3JVSA 5C27A 5I9XA 4XG7A 3DJ7A 2O2UA 2J6MA 3E64A 5LWNA 2OU7A 4G6OA 4WKQA 4FSNA 5IEVA 5DGZA 3G0FA 2ITQA 3RKBA 4MNEA 1Z5MA 5FXSA 3O51A 4AOJA 4FTCA 5JFSA 3AOXA 5CEPA 4RX9A 5HO6A 3OXIA 4C58A 1W98A 4LOQA 3R7YA 3MFTA 5EI6A 3TZMA 4Z16A 3S1HA 4Y85A 4IAKA 2GQGA 4YZMA 2OF2A 3FZRA 4L9IA 4Y5HA 1F3MC 2YM5A 2OSCA 1JKLA 2W9ZB 3QALE 4DLIA 3IW6A 4G17A 2VO6A 3A61A 5HCYA 4O86A 3GFWA 5IDPA 4G16A 4LRMA 2OG8A 3RI1A 5I9VA 4O7VA 2QOBA 1R78A 2JKOA 2DYLA 5IUGA 2EU9A 3H30A 3UDBA 1PJKA 3IS5A 4KRDA 4HGLA 5E1EA 4AAAA 4RBLA 4BGQA 3QRIA 4QPMA 3SV0A 5BNJA 3BYMA 4IAZA 5HIDA 3R9RA 5K0KA 4QMMA 4BDBA 2CDZA 5KMIA 2PMLX 4L45A 3KVWA 3EQGA 3Q60A 3EQFA 3JVRA 3BCEA 5LJJA 2QOOA 3OMVA 4FTRA 1WCCA 4RZWA 2UUEA 3GI3A 3ULIA 4UMPA 3GOPA 4KUJA 1KUTA 1WVXA 4O83A 4GT3A 4F1TA 1SM2A 4L67A 5JGDA 5H2UA 3AC2A 2XIXA 4IH8A 1JKSA 1MP8A 4MF0A 3V5LA 3KMMA 5JQ5A 5FTOA 2Q0NA 4ASXA 4JL9A 3C7QA 2CPKE 4O7YA 5EH0A 5A4CA 1YWNA 5AEPA 3IPHA 1YXSA 2GNLA 1BLXA 2XRWA 1ZRZA 5KKRB 3EFWA 4G31A 3ORNA 3DY7A 4RVKA 3HP2A 5CSWA 3A4PA 3RK9A 2WD1A 4EZ5A 2F4JA 5CEKA 4XV1A 1F0QA 1CDKA 1KOBA 2NRYA 4L7SA 3ZU7A 4D28A 3ROCA 3OT8A 3P7BA 5CQUA 1CKJA 4R6VA 4MBLA 5D7VA 2YEXA 2FH9A 2ERKA 1KV2A 2O3PA 2R3QA 2BIYA 4FKTA 3RCDA 2YCFA 2WAJA 3I7CA 3VS6A 4D2PA 4RX5A 5BVDA 4MTAA 3OOMA 5DBXA 4O84A 3ZM4A 4CV9A 3OXZA 2YLFA 4Y95A 1ZARA 3ORKA 1H26A 4I94A 2ZAZA 2PE0A 2IWIA 1H0VA 2VTHA 1OL5A 3FV8A 3LJ1A 2H96A 3KA0A 2O63A 3RPOA 2VTJA 3FC2A 4B4LA 3PSBA 4RQKA 3TDVA 3LJ0A 2C4GA 2F2CB 4AGDA 3L8XA 4F9CA 1W8CA 1GOLA 4CKRA 4BI0A 1VYWA 3H4JA 4CFNA 5JMSA 4LMUA 4WA9A 4BVUA 5AWMA 4BCJA 3F66A 4ITJA 4PDSA 4ZK5A 3BHHA 5DA3A 5EW3A 3SDJA 4WHZA 4BDAA 1PYXA 1Y6BA 3VBYA 4AN2A 4RFMA 4QMQA 3CSVA 3NUPA 4JVGA 3R7UA 1OIUA 2XIKA 2J90A 4NK9A 2ACXA 1HOWA 2CGWA 3BWJA 4RWLA 4LRJA 4ANMA 4XEYA 4WBBB 4IAIA 4CEGA 1V1KA 2WOUA 3O2MA 5CSVA 2ETMA 3QD2B 4JQEA 2C3JA 5ICPA 3UZPA 4NJDA 2UZNA 3KXNA 3ZLWA 3ZO4A 3ORIA 3H9FA 3R1YA 2BMCA 1GZ8A 4IVCA 3SHEA 1OI9A 5TKDA 3Q4UA 3JY0A 3BU6A 1LEZA 5K3YA 4M84A 4KBCA 5A3XA 5J7HA 4R1VA 2QD9A 2YCRA 4DH8A 4FI1A 2XS0A 5CXHA 3R9HA 4F6WA 2GQSA 3N4UA 2XF0A 4E6QA 3R1NA 1OKYA 5CU0A 4ZTMA 3DNEA 1XQZA 5ITAA 4FIFA 4I6FA 4J99A 2V7OA 4OW8A 4BZDA 4H3PA 4M69B 4YGAA 5A54A 3VRZA 4J8MA 2J0KA 2W7XA 3FMJA 5HBEA 2YWPA 1H1SA 2P2HA 2OJFE 4RFZA 4DINA 1H1WA 4WRSA 3LFEA 2QU5A 5F95A 5JGBA 2GS7A 3AD5A 5BUIA 1GAGA 2Y8OA 2BR1A 3U4UA 2FVDA 3Q32A 1WBSA 3WARA 3NYNA 4KBKA 2YIWA 3MTLA 4IANA 4DFXE 5KHWA 4ONAA 4DT8A 2VTLA 3PA4A 2JC6A 3FLZA 1H1QA 2X39A 3W10A 3BYOA 3AC3A 3OBGA 2H9VA 3FMHA 5A6OA 3OP5A 2CCHA 4NJ3A 3PJ3A 3OEFX 4FGRA 4OTWA 3FZOA 5IA1A 2PZPA 2QOLA 3O7LB 5DMZA 3AMYA 4W4XA 2I7QA 4HZSA 2BTRA 5KMJA 3W2CA 2XCHA 5A4QA 5HX8A 4IEBA 3F2RA 3D5XA 1OPJA 1JKTA 5ANDA 3PPZA 4Y83A 4IFCA 4YJVA 5CY3A 2GNIA 4JAIA 3WF8A 4EHZA 4YTCA 2WFYA 5DRDA 3ZBFA 5DYJA 4G5PA 2B0QA 3ANQA 2VZ6A 3AD6A 3EFKA 1STCE 3NGAA 3PJ1A 3QFVA 4ZMFA 3NVKI 3O8PA 3S3IA 3CR0A 4G3DA 3LMHA 2YDJA 2P4IA 3PXYA 1H0WA 4ANQA 1NVSA 1TQPA 1JWHA 2VTQA 4AACA 3L8PA 2PUPA 1YW2A 3PXZA 3FL5A 3FKNA 3UO6A 5HLPA 4ASEA 5AUTA 3BRBA 4HOKA 3G51A 1WFCA 2R0UA 5HLNA 4CZTA 4AZWA 4CRLA 4NIFB 3EN5A 3QA0A 5GJDA 4ZLZA 5IA4A 4DBNA 5M51A 4ZY5A 3BBTB 4RWJA 3LFNA 4KIOA 5M4UA 3LQ8A 3ERKA 2OJJA 2JLDA 2VX3A 3MY1A 1QCFA 4EUTA 5AUYA 3CJFA 3PZHA 3TV6A 3H0YA 4M12A 4EZ3A 2JGZA 1JOWB 4TYEA 4BIEA 4X2GA 5FM3A 5AADA 4GKHA 3P1AA 4OGRA 4AP7A 2R3IA 4C4EA 3VS7A 3R0TA 1ZY5A 3SVVA 4BDCA 4LG4A 4RX7A 5AV4A 3FPMA 2EXMA 3RWPA 4E6DA 3KU2A 3PSDA 3ZMMA 4MH7A 4V0GB 3F5XA 3RAWA 2WTKB 4ID7A 2VO0A 2X4FA 2BFXA 4WNKA 4QMYA 4EK5A 3Q53A 2BROA 4JRNA 2XK9A 5E7RA 4RJ6A 3TIYA 2REIA 1YVJA 3BE2A 3WF5A 4B8MA 4A9YA 4NTSA 4HVGA 4TWNA 4E6AA 3PA5A 3SX9A 5KBQA 3NPCA 3TV7A 2HXQA 3BU5A 3C4XA 4FX3A 4KD1A 3QD0A 3QCQA 1GIIA 1R0EA 4GJ3A 5EFQA 5J8IA 2IZUA 1YKRA 3C4WA 3FZ1A 2XKDA 2KTYA 3QKKA 4NM7A 5M07A 1FVRA 3GCSA 3JYAA 4FV7A 3LHJA 4A9UA 5C4KA 5HICA 5BYZA 1OMWA 3IOKA 3OZ6A 4DFUA 3QHWA 1RQQA 3TIZA 2UZBA 4FSZA 4FV2A 5I9UA 4R77A 4DG2E 2X6DA 2RFNA 4ORKA 4FKGA 1G5SA 4G3CA 4QP3A 4IQ6A 3PP1A 4YZNA 2HXLA 4QP4A 4UWBA 3KULB 4FF8A 4GW8A 1JSUA 5DLSA 2JITA 2PVMA 3AMAA 4HGEA 1U4DA 5L2QA 2UV2A 3EOCA 3FYKX 4KIKA 3TKUA 3ZTXA 4Z3VA 2VWXA 3MY5A 4QP9A 3RZBA 4TN6A 4I6BA 3KF4A 3UQGA 5C1QB 4BR3A 3R6XA 3RVGA 1PXNA 3TM0A 2CGUA 4FKQA 4CFFA 5KHXA 1G8SA 2O0UA 2UZOA 5F9EA 4GU6A 5JQ8A 3OY3A 4BI2A 4DTKA 4PDYA 4QYGA 1KOAA 1PXPA 4H39A 3VIDA 3MIAA 2C6EA 4GG5A 3EZRA 4RGJA 2JDVA 4ZSAA 2PZIA 2QOKA 2CN5A 3U9CA 3OTVA 1WBPA 5T3QA 3QCSA 2XKEA 4GEOA 5T68A 4EOLA 4BBMA 3OUKA 4B7TA 4TKSA 4FZ7A 4YO6A 3VC4A 2QR8A 4YURA 3EYHA 1XH5A 3OCBA 3HUBA 3DFCB 4CT1A 4MBJA 4F7LA 3R04A 2WIHA 3VBXA 5CF4A 5AA9A 4DGGA 1PMVA 4R3RA 3F9NA 2VRXA 3DA6A 3QTXA 4YJRA 4EHEA 4BTMA 5KO1A 5DWRA 4EH3A 3QCYA 3U6IA 2QR7A 2FSOX 1J7LA 4M68A 1YXVA 4O91A 2B1PA 5TOZA 1ZYDA 1PKDA 2JFMA 3ZHPC 1FPUA 2FSTX 5CZHA 3PG3A 1MRVA 3FMNA 2ZV2A 3HECA 1REJA 4EOMA 1ZOEA 2OI4X 3WIKA 2QG5A 3R2BA 4O27B 3V5QA 4AZTA 2GS2A 4NFNA 3W1FA 3ZUVA 3I5ZA 2XYUA 5CEOA 4AOIA 2UZEA 3KK9A 3VAPA 4NW6A 3IGOA 3MPAA 5CANA 5EM7A 4DH3A 2NRUA 4CYJA 3FZPA 2X8DA 1TVOA 3UBDA 3ZZWA 3CPBA 4BYJA 5GZAA 2P2IA 4PRJA 4UYAA 5A46A 5HU3A 5GJFA 2VO7A 3UQCA 1UA2A 1WBWA 1BYGA 2F7XE 3R1SA 5CU6A 2VTOA 4U41A 3OW4A 4IXPA 1M7QA 2O65A 4D5HA 5LMBA 4KS8A 4AG8A 3UIXA 3UVPA 2OZAA 2PVRA 5JFVA 4F9AA 5EG3A 4KB8A 2X8IA 2X81A 1EH4A 2WQOA 3RWQA 3ACKA 2BRHA 3V3VA 5K5NA 4LGHA 3SD0A 1Q8ZA 4O2ZA 4UALA 4KKHA 5AX3A 1URWA 4C61A 3QTQA 4C8BA 3R28A 3DBEA 4WNMA 5CU4A 4BI1A 3E87A 2WTCA 4YPSA 4BICA 3HV7A 4DEEA 1RE8A 3P5KA 4MXCA 3FUPA 3MW1A 2ITWA 1ZMVA 3I0OA 5IUIA 3F3ZA 3RZFA 2Z7QA 3DKFA 3W2SA 4EWHA 2XJ1A 4EYJA 4ZTHA 3RCJA 3HEGA 3Q96A 5IEYA 2GU8A 3GGFA 4UMTA 5CQWA 4O0TA 5DPVA 5CS6A 3MIYA 4YTHA 4FTLA 4I0TA 2P0CA 1APME 4NW5A 1GIJA 3DFAA 4FV9A 4O6EA 3W8LA 2HZ4A 4A9TA 3EN6A 1ZWSA 4OTRA 1PHKA 3L9PA 3DLZA 2IN6A 2QVSE 4ANLA 3TG1A 1OBGA 4BDFA 5CEMA 4FTTA 4QTBA 1MUOA 4FA2A 4IFGA 4QMUA 5KNJA 4ZMEA 4YJOA 1OGUA 1J1BA 4GUEA 3F7ZA 2X2KA 4FYNA 4NM5A 4W4YA 5CLPA 3WILA 5LQFA 2WGJA 3F69A 4PNKA 4ZXTA 4G9RA 1IG1A 5AV3A 4F1MA 4C2WA 2G9XA 4FIHA 4NTTA 3FHRA 2X7GA 2HCKA 4FZAB 5EDRA 1FGKA 5FDXA 4APPA 4G5JA 4ANBA 2QO2A 2ETKA 3POOA 1WBOA 5FEQA 3CC6A 3DDPA 3TN8A 4GJ2A 5IQEA 1JVPP 4DTBA 1E9HA 4AA4A 4AOTA 5EKNA 3V5JA 4O21A 5CTPA 5GZ9A 5L8LA 5FLFA 4GFOA 5CAPA 2IPXA 4GT4A 3NUNA 5CAQA 2OZOA 4TZRA 3BGQA 4I23A 2VUWA 4WNOA 3R8UA 1GZNA 3RAKA 1QPJA 4FG7A 2J4ZA 3G33A 4QTDA 2BHHA 3A62A 4P90A 2VWYA 2B9JA 3PVUA 4YHFA 3KKVA 5JGAA 3QYZA 5GIOE 2WXVA 5HHWA 4Q5HA 3R9OA 4CFUA 3EKNA 4O7TA 5FEDA 2R3KA 3PY3A 3HLLA 3VHEA 4CKJA 5G6VA 3FKLA 3FEGA 4ZJJA 4I6HA 4ACCA 5IH5A 2X6EA 4N70A 4ALUA 4YJTA 5HG9A 4DGNA 3WZKA 4WG3A 5HVKA 3GCPA 4GV1A 5ANKA 5A14A 3LCTA 2WTJA 3GQIA 3HV6A 3VWAA 2PMIA 4FEQA 4S30A 4JDHA 4D2TA 3MYGA 4V04A 4F65A 2PSQA 5GZ8A 1WMKA 2XM9A 1LEWA 4HVHA 4FC0A 4I93A 2R3RA 3UP7A 3FXZA 2B55A 4KBAA 4NU1A 3EZVA 2CKPA 4MBIA 3QF9A 3FYJX 2UW3A 4HNFA 4FEXA 4BCQA 3LLAA 3GU4A 5G1XA 3IK3A 4RLLA 5DT0A 3F5PA 5AP7A 2ONLA 4XYFA 3GU6A 4UB7A 4D5KA 5AUUA 5ETCA 1Q97A 4HPTE 2XNEA 3LM5A 4E4MA 1UKIA 4FT3A 4GK2A 2JBPA 3POZA 3R73A 3A8XA 1XWSA 3RGFA 4QT1A 4HYSA 4DFNA 3BLQA 4F4PA 3U6JA 1BI8A 1OL1A 1KE5A 4DN5A 4L01A 4CLJA 1RJBA 3NW6A 4O0YA 2YZLA 5ANIA 4QMTA 3ZUUA 3P7CA 1UWHA 5FEEA 4TYGA 5DR2A 4M7IA 5HEZA 5C8KA 4FNZA 3UIUA 3ZLSA 3QBNA 3LVPA 4BN1A 4FUXA 4PL3A 3EQRA 4BCMA 1YXXA 3KMWA 4IC8A 2QURA 4LFIA 4LI5A 2WMUA 3CD3A 4RX8A 4C62A 3R30A 5BVWA 2IW6A 5KZ0A 4H3QA 3HV5A 4DG0E 2C68A 2EXEA 3GCVA 4G3GA 4LM5A 5L6WL 4TNDA 3ZXTA 5IF1A 4BCFA 3L9LA 3TEIA 4UWYA 2PL0A 4RIOA 2CNUA 4EH5A 2Z7RA 2BVAA 5LCJA 3CGOA 3D7TB 3LIJA 3KRLA 4HZRA 3RTPA 3WYYA 5IMEA 2GQRA 2XEYA 2HZNA 4I0SA 1GJOA 2W9FB 3GOKA 5IDNA 3BYUA 3V5WA 4XG6A 1I09A 4ERWA 2GPHA 1M2QA 2WO6A 3QD4A 3ZC5A 5HKMA 4FKLA 4WD5A 3ANRA 2J51A 1OPKA 3MFUA 3GVUA 4WOVA 3TNWA 4YO4A 2O64A 4FTAA 2YITA 3QUDA 3BPRA 2WQMA 3QC9A 3QC4A 4NT4A 5LARA 2FSMX 1NVQA 4J8NA 4BDGA 3TUDA 4FEVA 4XJ0A 4U42A 4YUQA 3VBTA 5DIAA 3P78A 4HCUA 2YISA 4TWCA 5EQEA 1LP4A 3D5WA 3TKHA 4CD0A 5BYYA 2XIZA 3LFSA 2E9VA 2P3GX 3UOLA 1ZLTA 4BCGA 3KCFA 4FKUA 1SVGA 4DEAA 5H3QA 1ERKA 4J52A 4E4XA 5B0XA 3S2PA 3PY0A 4CTBA 4QOXA 2XK7A 4FVPA 5HVJA 3IONA 2QO9A 4AWIA 3NLBA 5M4IA 3SRVB 5M57A 2C6TA 3QGYA 4HYIA 4IAFA 1BI7A 3QUEA 3VUKA 2R64A 4F70A 4EWQA 5CF6A 4HVSA 3FLQA 2LAVA 3PRIA 4RJ4A 3VBQA 4D0WA 1KV1A 2ITUA 4RIWB 5CEQA 2IW8A 3ZLXA 2XM8A 3LFFA 4LGGA 1OZ1A 5IQDA 2AYPA 2H34A 3WZJA 4L00A 2C5YA 3EQDA 5K5XA 2WMAA 4QP2A 1YOJA 2YM7A 4BDEA 5HZNA 2OBJA 4QQ5A 5E8YA 4EJNA 4YMJA 3C4CA 4AA0A 2JDRA 5L2TA 5KMLA 2BUJA 3ID6C 5DR9A 5AP1A 4BCPA 3BGZA 2UVYA 4DEHA 2VWVA 4C4IA 3TDWA 2WMVA 4KABA 5FRIA 2JIIA 5ETIA 5IQFA 4YTFA 1Y8GA 3CCNA 2W5HA 1Q5KA 3IW7A 4BHZA 5FTGA 1BL7A 3MH1A 4WUAA 3EQBA 5CU2A 3CQEA 2SRCA 3VW6A 3QRJA 2PZYA 3BLHA 2OK1A 5KMKA 4BIDA 5KMOA 4EKLA 4BB4A 3P86A 4FOCA 3HMIA 1TQIA 5JZJA 5AP0A 3CKXA 4JRVA 4AT5A 4L68A 2F7EE 2ZDTA 3BI6A 4FNWA 3O50A 1G8AA 2R3FA 3REPA 2PVFA 3VS4A 3QHRA 5BUEA 1Q3DA 2Y7JA 5HNIX 4MEDA 3DJ5A 5TR6A 3QZGA 4J1RA 3UMWA 1A48A 4BYIA 3GC0A 3PXQA 4FV8A 2OJ9A 2Z8CA 1T45A 4FT0A 4NWMA 3R7IA 3NUXA 2I0EA 3UOHA 2VAGA 2ETRA 3V8SA 5LVPA 3BBWA 3R9DA 4RA5A 1M2RA 2W1HA 4BRXA 4BWXA 1FBNA 2GFCA 5E8UA 1M14A 3TKIA 4YC8A 4XG2A 3EKKA 4XHKB 1ZYSA 2XBJA 4CFVA 2YZAA 5J87A 4BKYA 4ZLYA 2UZTA 4JDJA 2B7AA 4LL0A 3FZSA 4K1BA 4U97A 2Y0AA 2Y4IC 4M0YA 4PPBA 3TNIA 5KCVA 2Y6MA 4QYEA 1B39A 4C02A 4XOZA 3HV3A 3RAIA 3U4WA 5DHJA 3DB8A 1MQBA 1ND4A 4ZSLA 4BZOA 1L8TA 4MF1A 2OO8X 4QMWA 4D9UA 4GG7A 3THBA 5HBHA 4RVTA 5C8MA 3UQFA 3AMBA 3DOGA 4X3FB 2J7TA 3MBLA 5HU9A 3QLGA 4G3FA 4IDTA 4EOSA 3R71A 4DHFA 1PXKA 4MKCA 2XP2A 4EL9A 4U3YA 5AR8A 5DN3A 3UG1A 3EL7A 3NS9A 2XK4A 3Q9ZA 5LCKA 2X9FA 4XRLA 4D55A 4F9BA 3RAHA 2XBAA 3NSZA 4MD7E 2R3OA 3NUAA 3TCPA 4K8AA 4CFXA 4IX4A 2VV9A 4MNEB 1ZYCA 2AC5A 1U5QA 3FZTA 3EL8A 3AC4A 3QX4A 4GUBA 1XBBA 3I6UA 3PLAE 3ZDIA 4YLKA 5CNNA 4PDPA 4ZJIA 2VTTA 2XNOA 5IKWA 2XK3A 3VO3A 5C26A 1YI3A 5IA0A 4EK4A 4R5SA 3DAEA 3DKCA 3ORPA 4XLVA 4XV2A 5F94A 4A9SA 4EH7A 3P9JA 2GTMA 1SVHA 5DH3A 1AQ1A 3WI6A 3HAVA 4GKIA 3RK5A 4BWKA 3MVHA 4MXXA 1NA7A 4I4FA 1O6KA 5CSXA 5EM5A 4AQCA 2Q83A 3PE1A 4GSBA 4QMXA 3UOJA 5DFPA 4K11A 2ESMA 2PVJA 2NP8A 4XOYA 3ATTA 3R9NA 3A7HA 4A9RA 3JPVA 1M2PA 2BTSA 4JQ8A 4KAOA 4AW0A 4EONA 3R7OA 3KRWA 1KWPA 4BBFA 4GU9A 4CFMA 4EQCA 1RDQE 3ZSIA 2UW8A 2W17A 3BWFA 2QLUA 5HTBA 3RMFA 3FY2A 5K9IA 3SA0A 1Z9XA 2ZJWA 1SZMA 3UODA 5BUJA 3L9MA 2W06A 1IASA 4EQUA 3W2OA 2VNWA 1WZYA 4KKGA 3CPCA 2X0GA 3KN5A 4OTPA 3B8RA 4WBOA 3TXOA 3FI4A 5C01A 1W0XC 3QRUA 3MS9A 3COHA 4O1PA 3BHUA 4L3LA 2O8YA 4ARKA 1QPEA 4FR4A 5KKRC 1NW1A 5CAUA 3GU7A 5EI2A 4I22A 5HOAA 3T9TA 5JK3A 5H8BA 4U79A 3AQVA 5EDPA 4C35A 5BVKA 5FD2A 5E90A 3PYYA 1DAYA 3NWWA 1OL2A 4FTUA 4LV8A 5AP3A 4A4OA 4O7LA 3TZ7A 4IZ5A 5AM7A 2QOQA 3ZDUA 4F9WA 4PL5A 4XV9A 5HLWA 2NO3A 2C5XA 3GENA 4MD8E 2Y6OA 4QMZA 2GTNA 4FT9A 3NNXA 3VW8A 4ZJVA 3CJGA 1KE9A 5IQBA 3QQHA 3F3VA 4KIQA 4AS0A 1DM2A 4RWIA 5HD7A 5AAEA 4O7WA 2ZV9A 4XG9A 3S95A 4TYIA 3GU5A 1ZOGA 4I41A 3PXKA 3L8VA 2EB3A 4IJ9A 4XG4A 5EYCA 3DAJA 3VS1A 4HNIA 3KGAA 2OXYA 3HNGA 4M0ZA 3EJ1A 4F0IA 2GHGA 3W2RA 5JFXA 4ALVA 3OG7A 3QRTA 4IB1A 2J5FA 4UXLA 4HGTA 3M11A 3CQUA 1K2PA 4PL4A 5TE0A 4YNEA 3C13A 4FICA 2P33A 2Z7LA 3G2FA 3P0MA 5JRSA 2UW5A 4FEWA 5D12A 1FGIA 4X7QA 4ANNA 2CN8A 3CS9A 2JDTA 4O0RA 3GC9A 4S34A 2WQEA 1B38A 2E9NA 3GXLA 3QZIA 1O6LA 3G6HA 3DKGA 2UW9A 5L8KA 4L3PA 3PY1A 5M44A 3W33A 3VQUA 4F6UA 3CP9A 4RJ3A 5CF8A 4AGCA 3DBDA 2R3HA 3ORZA 4K77A 3R7VA 4DITA 1U54A 2I40A 4WT6A 4E20A 3DU8A 5CXZA 2Y4PA 2ITPA 3FI2A 3IG7A 1JNKA 3C0HA 2YM8A 4JDKA 4MCVA 3Q4TA 2CGVA 3PWYA 5CVFA 4EJ7A 1REKA 2X8EA 5ACBC 4BKJA 5HD4A 2A1AB 1OL7A 1YDSE 1BL6A 2PZRA 2DUVA 3HVCA 5DG5A 3GCUA 5HORA 4CMTA 5EM6A 2XK8A 4DEIA 2W96B 3EH9A 4UXQA 3D2KA 5HG8A 1M17A 2G2IA 4N6ZA 1XKKA 3P7AA 3RPRA 5IU2A 5AAGA 1JBPE 2RIOA 2WNTA 4FSYA 4FVQA 4CQEA 3JXWA 4BY9E 3DQXA 3NDMA 3II5A 3UJGA 1BKXA 2B54A 4XBRA 3TNHA 3NW5A 3ORTA 4MYGA 4YZDA 2O5KA 5H9BA 1P4OA 1XH7A 3BZ3A 4U40A 4FKSA 1H27A 4PDOA 3KRJA 3K5VA 3FI8A 2VTRA 3DTWA 3PZEA 4Y8DA 4B99A 2JDOA 4BHNA 2OLCA 4F6SA 4FT5A 1H07A 3HRCA 1YOLA 2YHVA 4J95A 4YPDA 2I1MA 3ORLA 3OCTA 3QWKA 1VR2A 4X2KA 4FT7A 5HIBA 4QQTA 3Q2JA 5EYDA 3W16A 2C3LA 3P23A 4NFMA 4AE6A 3FQHA 2A4LA 2QU6A 2BAQA 3PP0A 4A4XA 2ZM3A 5EYMA 4AF3A 2YDIA 1XHAA 3I0QA 1B6CB 4M14A 2W1FA 3E88A 4YJNA 5EYKA 2W4JA 5DR6A 4J7BA 3SXRA 4Z9LA 3VUDA 2YWVA 1XH6A 3I1AA 4FEUA 4GVAA 3RALA 1P2AA 3TJCA 4X6RA 4O7NA 2C6OA 4R3PA 5C9CA 5AFVA 1H8FA 3DTCA 4J71A 5KX8A 1WAKA 3C5UA 4FTNA 4EBVA 3BV2A 3DV3A 4IZ7A 4FBXA 4RLKA 2ITTA 4AGUA 4UEUA 2UW6A 5FBNC 4ALWA 3IDPA 2V22A 4L3JA 3W18A 5J1VA 4NKSA 1XH9A 4O0VA 2ZM1A 4HW7A
chains in the Genus database with same CATH superfamily
4FODA 1ZY4A 3SQQA 4D2SA 5M55A 4L42A 4EYMA 5C4LA 3KREA 3KC3A 1V0PA 4O1OA 4IM2A 3SOAA 5JKGA 4I5HA 2J2IB 3BHYA 4M3QA 2YM3A 4HGSA 2VD5A 3UZTA 1F5QA 3K3IA 5IH6A 3U8WA 2OJIA 3CKWA 4RSSA 3D83A 1LPUA 2F2UA 3EQCA 4FV3A 4C34A 4L43A 2PULA 3NIEA 3R00A 3RM7A 3A7JA 3N51A 3VVHA 2W4KA 2OIBA 3C51A 3RP9A 3FAAA 4KNBA 5AMNA 4U43A 2OF4A 3MJ1A 3WF9A 4DG3E 1E1VA 1YWRA 4TYHA 1PRYA 2WTKC 2ITNA 1UV5A 3KVXA 2FGIA 4XS2A 3TZ9A 4PTEA 4IJPA 4Q9SA 1YXUA 4BCKA 2XJ2A 4USEA 3LPBA 1R3CA 3NX8A 5K4JA 2JIUA 2WOTA 2CKEA 5A9UA 3OWPA 1PF8A 4LV5A 4MXYA 1OITA 3Q5ZA 4ZAUA 4AXFA 2XKFA 4L6QA 4BDIA 3FLNC 4DGMA 2IVVA 4E5WA 1IA9A 3O5AA 3GCQA 2CLXA 5AV0A 3UP2A 4EHGA 5FWKK 2J50A 3QL8A 4GK3A 3LJ2A 1SVEA 1PMEA 3F2AA 1M52A 2I0HA 3QGWA 3D4QA 3QKMA 3SXFA 2HW6A 3A60A 5EHYA 2UVZA 3LCSA 2W1DA 3QUPA 4JNWA 5EK7A 2WEIA 4JAJA 3C0IA 2IJMA 2YJSA 3F3UA 4PUZA 5I5ZA 1UU9A 4KSQA 2XMYA 5JN2A 3TUCA 3HA6A 4DE4A 1VJYA 1Y57A 2VX0A 3PXFA 4WO5A 3BHTA 4NCTC 4CV8A 4GIHA 3DKOA 2HK5A 5LVOA 3Q9XA 2WPAA 1CTPE 2YM6A 5CSPA 5J7BA 2WMWA 2CLQA 2PWLA 3R2YA 1YI6A 2HENA 4USFA 3DDQA 5IZFA 5D7AA 1FVTA 4O4CA 1GIHA 3OCGA 4MD9E 4E5BA 3T9IA 4JBOA 3KXZA 1P4FA 4GYGA 5J9YA 3WBLA 5J9LA 4G3EA 4K0YA 2VU3A 4O0UA 3Q2MA 3M42A 4FSQA 4KIKB 1ZOHA 2V55A 4C4GA 3K54A 3TT0A 4BBEA 3EB0A 4CCUA 4YHJA 4IHPA 4F7JA 2VWZA 4TPTA 2OH0E 2QHNA 3EYGA 4C36A 5L6OA 4G2FA 2RFSA 3FXXA 4N4SA 4FV1A 4PPCA 3EN4A 4WRGA 3VHKA 4F63A 1QL6A 2BALA 2OWBA 2VTPA 4AN9A 4TXCA 2XCKA 4B8LA 4BL1A 3ET7A 4PP7A 4MK0A 3WE4A 4B6LA 4F0GA 5FGKA 3WOWA 3FLWA 4IWOA 1U46A 3PVGA 4FTQA 4M8TA 4QTCA 3GB2A 4JBPA 4OT6A 3G15A 4FTIA 2WEVA 4RIYA 4X6QC 3U51A 1O9UA 3E93A 2XK6A 4DFYA 3BLAA 4DDGA 1Q3WA 1H25A 3G0EA 3KXMA 4W4VA 3HKOA 3AGMA 3VF8A 2ZB0A 5TT7A 1ZZLA 3A8WA 3GUBA 2CGXA 2HY81 2UZUE 5GHVA 5M09A 1JQHA 2WMQA 3SG9A 2EB2A 3NEWA 3U54A 2XAMA 5IQAA 1PYEA 3NYXA 4ASZA 3UZRA 5HNGA 4BDDA 1L3RE 1SYKA 4ZTQA 3LXNA 3HZTA 4BDKA 1TKIA 4D2RA 4MXAA 4W4WA 3LLTA 1DI9A 4RIXA 5H8EA 4XV3A 1UNLA 4FL3A 2C6DA 2W1IA 3EIDA 3MY0A 3SC1A 5GIPE 4AW1A 4E8AA 2C5NA 2X7OA 1PMUA 3BEAA 2A0CX 3HP5A 5HVYA 3AC1A 4Q5EA 4WG5A 2R3GA 3MB7A 5ETFA 3VUTA 3I81A 3FMMA 4TY1A 4F1OA 2E9OA 3V8WA 4A06A 1FMKA 3E92A 3OWLA 4C4FA 3G9LX 3UOKA 5JT2A 4HYHA 4CG9A 4QD6A 4YC3A 5I3OA 3ZSHA 2CJMA 4BIBA 3W0QA 1O6YA 5E92A 1YWVA 5HQ0A 4FKWA 4BZNA 5JSMA 3BELA 4J96A 2BKKA 2LGCA 4GS6A 2CKOA 3KY2A 2OZAB 5EHOA 4M67A 4PV0A 3VF9A 4EOOA 2PK9A 3QRKA 4Y46A 3UYSA 3ZCLA 2PMNX 3PLSA 2WTDA 3CY2A 4CCBA 5FXQA 5FDPA 3R22A 4FV6A 3F2NA 5J9ZA 3HMNA 4DF3A 3PE2A 4CTCA 3DT1A 3CTQA 5A4TA 3LCDA 1ZZ2A 4QNYA 3V5PA 4H36A 4BJJA 1UNGA 1PMNA 2UZLA 3LQ5A 4I3ZA 5D1JA 4TWPA 2UVXA 5JRQA 3CEKA 2FB8A 2YABA 3IO7A 2QC6A 4AXCA 4OLIA 3ALNA 4IW0A 5F1ZA 4QTEA 3VQHA 2VGPA 4U5JA 2BDWA 3LZBA 3VBWA 4PPAA 2YFXA 1W2CA 4U0IA 4Y5QA 3VUHA 4Z7HA 3NFFB 4A4LA 3FLSA 4U7ZA 3M2WA 4PP9A 5HG7A 3PVBA 2QNJA 4FKRA 1Y91A 2PVLA 3FI3A 3SG8A 4P5ZA 5M53A 2UW4A 4ZLOA 4I20A 4O82A 4OBOA 3ATSA 2PUIA 1VEBA 2VO3A 3NIZA 4LMNA 4ZTSA 4QMVA 1UKHA 2W4OA 3C9WA 4IWDA 4DEDA 1GZOA 2WMRA 5BVNA 2XNBA 1ZXEA 1PXLA 4RQVA 4GL9A 3LFQA 5ANJA 3UGCA 4CYIA 3QYWA 2QODA 1Q61A 3Q4CA 4IIRA 5J95A 4JG6A 2Q0BA 4K9YA 4UMQA 2FYSA 5E8XA 3UC3A 3KXHA 3AT3A 3GNIB 3O17A 4O81A 2ITXA 1CKPA 3MH3A 3SLSA 2JFLA 2XNNA 5CAVA 5FP6A 4P5QA 5J1WA 3ZH8A 4BC6A 2RFEA 3PTGA 2H6DA 2GMXA 5I4NA 2QOHA 4FSWA 2JDSA 3LFBA 3NZ0A 3KRRA 4APCA 5CWZA 4HVDA 5KMNA 3R8LA 4G6NA 1WBVA 4XX9A 5HE2A 4GFGA 4MWIA 5KZIA 1XBAA 3FMKA 1XH4A 4JXFA 3VJOA 3MB6A 3ZRMA 5JFWA 2IVSA 4PF4A 2J0JA 5IMXA 3PG1A 2YAKA 4IADA 5I9WA 1YI4A 4ACGA 4FSTA 4G1WA 3OHTA 1Q24A 4DFBA 3QXPA 4KINA 3MN3A 2C0TA 3MTFA 4F9YA 3SRVA 3LXPA 4QMSA 3VS2A 3EMGA 4I0RA 2QG7A 1YDTE 3ZEPA 3UIBA 2B53A 3H9OA 4NZWB 5EOBA 4CZYB 4UWCA 2PVHA 4TNBA 3W2PA 4C3FA 4ENYA 4XP2A 1S9IA 3HMMA 2JIVA 3OF0A 4K33A 4G6LA 4PQNA 3G90X 1CSNA 2QI8A 4LUDA 4DLJA 4GYIA 2BZIB 3CQWA 1JPAA 2WELA 2UZDA 5LMKC 5E8VA 4WG4A 1WBNA 2ZYBA 2OH4A 3ZZEA 3MA6A 5DI1A 3TNPC 4FTKA 1X8BA 2OIDA 4MX9A 2YERA 4X0MA 3A4OX 2IF8A 2ZFYA 3W55A 1PXJA 3D14A 3OROA 5LXMA 1H1PA 5FTQA 1JSVA 3MWUA 4RWKA 3UC4A 4EK3A 3BYVA 5CVHA 4DEGA 4IBMA 4FNYA 4RMZA 3H0ZA 4NM0A 3TWJA 2V0DA 5EOLA 2PTKA 3LKMA 5K0XA 2X2LA 4KSPA 3IQ7A 4MNFA 4YBJA 5I9YA 3F61A 2A27A 3TL8A 4E4LA 5D11A 5BV3A 5J5SA 3IDBA 5EHLA 1VLRA 3B2WA 3FHIA 4IX3A 1W84A 2YJRA 4TRLA 5E8TA 4ZEGA 2RL5A 5AUVA 1M7NA 2RG5A 4HPUE 3UTOA 1Q8TA 4KRCA 4PMMA 3FSKA 3FBVA 4YZCA 3WZEA 4I21A 2QKWB 4C57A 3BX5A 3LAUA 2R2PA 4MVFA 4R5YA 2BAKA 3E8CA 3KFAA 3VUIA 3ZXZA 3CTJA 5HE3A 2VWIA 4Q2AA 4ZOGA 3OTUA 3UO5A 3OY1A 4RFYA 1K3AA 4CT2A 1LR4A 1LUFA 4RT7A 3FMDA 2YCSA 4IACA 2C6MA 4DTAA 1BUHA 3ORMA 1IA8A 3E7OA 4YLJA 4IE9A 3UE4A 1NXKA 5FM2A 4CNHA 3SGCA 3CTHA 3ENHA 3E8DA 1SNXA 4IX6A 4C0TA 2DWBA 2W5AA 4X21A 4DYMA 5K4IA 4QP7A 5IPJA 4C37A 5IQIA 3PPKA 3WYXA 4E4NA 4E3CA 3ZRLA 4AU8A 5T6KA 3JS2A 5CYIA 3SW7A 2YIQA 4I92A 4IZYA 3ZFYA 3TTJA 4B9DA 2GHMA 4EEVA 3ZO3A 4D2WA 4IZAA 5AR3A 3SAYA 4IAYA 3HMPA 4W9WA 5EDQA 3ZFXA 4EZ7A 3BIZA 2VTIA 3RJCA 4EC9A 2VTSA 2WQNA 4EH4A 4EQMA 4NYEA 5AAFA 4ZSEA 4EK6A 4L8MA 5EI8A 2QOFA 4C4JA 1CMKE 4PWNA 2R3NA 3FY0A 3O71A 4ERKA 4AUAA 3QTSA 4JBVA 5M4CA 4V05A 4DH1A 4EK8A 5IA5A 5DE2A 4FIJA 3OD6X 4G9CA 4D0XA 5L3AA 3QKLA 4GFMA 4NL0A 5BYLA 1FVVA 2CHLA 4K18A 4FGBA 2YIYA 1OKVA 1NVRA 2C5VA 4RC2A 2DQ7X 2P55A 4UV0A 2OJGA 3ZS5A 4AZVA 4PMTA 3E7VA 3RNIA 3ZONA 2GNFA 4EUUA 3OW3A 4CRSA 4YJSA 4OTDA 5J5TA 2PPQA 3ODZX 2BDJA 4YR8A 1DS5A 3A2CA 3F82A 1J1CA 3QXOA 3NR9A 4O38A 3COKA 5AR4A 1UWJA 4FSRA 4CMUA 5FP5A 2C5OA 2JEDA 2C6LA 2F49A 2PHKA 2VNYA 4LQMA 3EQIA 4ZSJA 2CMWA 2UZVA 2W5BA 3FJQE 5E4HA 4K6ZA 4CFWA 2YN8A 4BKZA 3HA8A 2YLEA 2XEZA 4JG7A 2GFSA 2C1BA 3OWJA 3PIYA 4P2KA 3EHAA 3ZEWA 2WIPA 1J91A 3EN9A 4FZ6A 4M15A 4TTHB 4ASDA 4OT5A 5CU3A 2OFVA 4XUFA 5H8GA 3RBWA 3LQ3A 2XZSA 2XJ0A 2RKUA 2F7ZE 4IB0A 3NCZA 5HIEA 3Q6WA 3NUYA 4GMYA 3F6XA 1VYZA 5L2SA 1OBDA 2FSLX 3QWJA 2HWPA 4JLCA 4FTOA 4QP6A 2ITOA 3PFQA 3ROYA 3LXLA 3HDNA 2VX1A 1OECA 2XKCA 5GNKA 3ORXA 1U5RA 5JEBA 1W7HA 3DZQA 4C3RA 1BX6A 3HL7A 3O0GA 2HW7A 4ITHA 5F20A 4E93A 4FL1A 4FK6A 3PIZA 2PMOX 4XBUA 1J7UA 2BDFA 2WU7A 3ZYAA 1OL6A 5D9HA 5B2KA 2UW0A 4NUSA 3KMUA 4FIIA 2Y9QA 3GQLA 3QAME 4QDEA 3VN9A 3BU3A 3NUUA 2QLQA 2R3LA 5LVNA 3LE6A 2UW7A 4XG8A 5AA8A 4QPAA 3ELJA 3EN7A 4TW9A 5FUTA 3LXKA 4QQJA 5IA2A 5M4FA 4M69A 3D5VA 4EH2A 3UNKA 4EI4A 5CENA 2X9EA 3MJ2A 1YXTA 3QCXA 1PXIA 4IAAA 3T8OA 4ACMA 2X7FA 3TYKA 3VJNA 5L2WA 4XNEA 3NYVA 4LOOA 2YA9A 2R3MA 3CLYA 4EBWA 3W0RA 3Q04A 4J53A 3K3JA 4EOKA 1DI8A 4X2JA 3FL4A 3GC7A 1ZYLA 4C3PA 3MPMA 3ACJA 5BMMA 4BCOA 3TNQB 4EH8A 1MRUA 3QLFA 3R01A 4L44A 2VN9A 4FKJA 3VUMA 2PZ5A 2ZDUA 4AA5A 4JX7A 1H00A 2WHBA 3GU8A 4AE9A 1UU7A 5AJQA 4D2VA 1OPLA 4X3FC 4EH9A 2YM4A 4S33A 5EW8A 3UMXA 4E73A 5DVRA 5KE0A 2WTVA 2XANA 2XARA 3W0OA 3UIMA 5ETAA 4XG3A 3QQJA 5ANOA 5HTCA 3BL7A 3DXQA 3R1QA 2ZVAA 3C4EA 3F88A 4HCVA 4JJRA 4UY9A 4DAWA 3V04A 4I5MA 4FVRA 5BVOA 4QEBA 1Q99A 3RK7A 2R4BA 3O8TA 1ATPE 3NUSA 4AGWA 3HUCA 4BF2A 3PJ8A 5CVGA 4DT9A 4I6QA 3P79A 3FMEA 3DAKA 4F78A 2B9HA 2ZMCA 3HRFA 3DLSA 4CGAA 4BTJA 5DOSA 3I6WA 3AT4A 2FA2A 4FIEA 4R1YA 4RC3A 3Q9WA 3OC1A 5CEIA 3S00A 3UVRA 2ITZA 4RZVA 4JBQA 4ZY4A 4LGDA 3C4FA 3CY3A 4NIFA 1Y6AA 2OKRA 3E3BX 5I0BA 1OM1A 4BWPA 5M06A 5BVFA 1SMHA 2WU6A 2Z2WA 5E91A 5L6PA 4EC8A 3FDNA 1OKWA 4HVIA 3MH0A 2R5TA 4ZZNA 1H28A 4WIHA 5CT0A 2BRMA 3NCGA 3E5AA 4QMOA 4FSUA 5FBOA 4RC4A 2WTIA 3COMA 3HGKA 4MQ2A 4DC2A 1R39A 4LUEA 1WBTA 3RHKA 3WZDA 1UVRA 4ZS0A 5HTIA 4YP8A 3Q9YA 4CMOA 5M08A 4U8ZA 5TO8A 5HE1A 4D4VA 3G9NA 1JKKA 5CSHA 4Q9ZA 4V0GA 4JR7A 4OBPA 3R7EA 3Q5IA 3NRMA 1AGWA 1WVWA 2JKKA 2HWOA 3QD3A 4F64A 3BHVA 3NNUA 2W0JA 4FTMA 4YJUA 4D4RA 5IQGA 2B4SB 4DCEA 2CNVA 2OXXA 2Z60A 4H58A 4I5PA 2RSVA 4BDJA 5EM8A 1ZAOA 3R8ZA 3QX2A 4ZZOA 3EWHA 4QTAA 3CXWA 4OBQA 3DBQA 3TI1A 4DGLC 1WVYA 2W99B 3NYOA 4QP1A 3NNVA 2KULA 2JD5A 2G2HA 1J3HA 4D58A 3T3UA 3ODYX 1XMMA 3DZOA 4U81A 4ZIMA 4PTGA 3NNWA 4JT3A 3NAYA 4F7SA 4CKIA 3OBJA 2EWAA 4N0SA 2VTMA 3QTWA 4AZEA 3U6HA 3CGFA 5HO7A 3ZRKA 3HRBA 4DFZE 5L2IA 2BFYA 3KN6A 4RPVA 4NCTA 4BTKA 5HCXA 2WQBA 3A7GA 1JLUE 2Z7SA 4S31A 5CT7A 2R9SA 1KE7A 4MHAA 2GNHA 3BLRA 4IVAA 1W83A 2J0MB 3ITZA 3KULA 5HX6A 4USDA 5KUPA 4L52A 3Q3BA 2GCDA 1H1RA 5DEWA 4D1XA 2DS1A 2C6KA 3FWQA 5DT3A 3L9NA 2I6LA 4OTIA 3RM6A 1OB3A 2XIRA 3DJ6A 2ERZE 4RVMA 4S2ZA 3R8MA 4H1MA 5EKOA 3ML1A 1AD5A 3GP0A 1KSWA 3GT8A 3C5IA 4UYNA 3A7FA 1H08A 3AT2A 3SOCA 4AZFA 2JKQA 3E8NA 4QPSA 3KRXA 4P7EA 4MXZA 3DBFA 3NMUF 4OR5A 3ZO2A 4F99A 2F57A 1FMOE 4JIKA 4QO9A 5DT4A 4QMNA 5A4LA 4S32A 3GBZA 2C0IA 2YAAA 1YOMA 2XNMA 3NVMB 1KE8A 3R63A 4O22A 5AX9A 3PIXA 3TTIA 4WNPA 2XNGA 1Q8UA 1R1WA 2YDKA 3KQ7A 4IX5A 4YZBA 5AR7A 4UN0C 4JX3A 4X2FA 3VNTA 2GNJA 1JAMA 4YLLA 4AT4A 2C3IB 1UU3A 4V01A 1FQ1B 4CXAA 1U54B 2W05A 2XIYA 4KIPA 4L53A 4FIGA 3V6RA 1TZDA 4C33A 3AC8A 4GCJA 4O0XA 1BMKA 4D1SA 2HZIA 4TL0A 3UNZA 4XP3A 4EHVA 4JQ7A 4DFLA 4AXDA 4RG0A 4I5CA 5L4QA 2HOGA 3DNDA 2ITVA 4ENXA 3OWKA 3WF6A 5LOHA 5C8NA 4YZ9A 4JDIA 2J9MA 3SXSA 2J0IA 4FZDB 3TZ8A 5HI2A 4AFEA 4FUYA 2PVNA 2QONA 4FKPA 4HCTA 3BGPA 4ZTRA 2XVDA 3KEXA 3MESA 5B2MA 5B2LA 5IUHA 2ZMDA 2XRUA 4EOQA 5HBJA 2FUMA 1P14A 3COIA 2OICA 2HY0A 1XJDA 4IWQA 4C2VA 4OUCA 1OUYA 2WKMA 4Y73A 3UO4A 3UVQA 1V0BA 3ZO1A 4O7RA 5AV2A 3IDCA 4LL5A 2B9IA 4BCIA 3HDMA 2HZ0A 3W32A 2ZB1A 2X2MA 4LOPA 3OEZA 4WSQA 4DBXA 2NNWB 2JAVA 2YIRA 4BTFA 3PXRA 4QRCA 2NPQA 4D4SA 2IG7A 2I0YA 3LMGA 4W9XA 4E5AX 2JKMA 3MA3A 2C30A 2OXDA 2HYYA 2OFUA 4FG9A 3KXXA 2H8HA 2J0LA 4UX9A 3I4BA 4FSMA 2XALA 4O0WA 3VS5A 2XYNA 2G2FA 4QNAA 4QYFA 3ZLYA 3L1SA 5BPYA 1Y8YA 3V01A 2A2AA 3OFMA 4ZP5A 4RJ8A 4GK4A 3W8QA 5CZIA 2C1AA 3VS0A 3E3PA 5CASA 3R8PA 5AUZA 3TACA 1GY3A 4ZZMA 3BE9A 3IW8A 3O8UA 4R7HA 5AR5A 2QCSA 4KA3A 4DH5A 4YNOA 5I3RA 1J7IA 4O7SA 4KS7A 2R7BA 1QPDA 3FPQA 5B7VA 4R78A 1CM8A 5JH6A 4I4EA 2JBOA 4A07A 4C7TA 4Z55A 3AD4A 5IQCA 1URCA 5HE0A 4E26A 4M13A 3ZFMA 2VGOA 4U3ZA 4FZFB 1Q8YA 4YJQA 3PPJA 4YSMA 2PVKA 4DA5A 4FK3A 4UMRA 1NT2A 3R7GA 4BFMA 5F4NA 5LMAA 2IZTA 3F7WA 4QMPA 1W82A 5EW9A 4BCNA 5IA3A 5CI7A 1A06A 3QQGA 5DRBA 5LVMA 2E9PA 2PE1A 3W0SA 3UNJA 3QTIA 3DK3A 4M97A 1IAHA 4AW2A 1PXOA 2R3PA 2ZV7A 3EQPA 3NAXA 4HJOA 4XCUA 4TWOA 4XLIA 3O96A 4K2RA 3MDYA 4ZTNA 1I44A 3I60A 3MH2A 4FYOA 4BGHA 3HAMA 4O4DA 1IRKA 2XA4A 1SNUA 3MFSA 4PNIA 4BCHA 2OIQA 3OUNB 4XH6A 4YSJA 2CSNA 4O7ZA 4H3BA 4F0FA 3IECA 4O6LA 4TYHB 1Z57A 4RJ5A 1YDRE 1IEPA 2YCQA 1OIRA 2X4ZA 3DK7A 4FKOA 4UZDA 3E63A 5D10A 1GNGA 4AXAA 4EOPA 2PU8A 1OKZA 1ZMUA 1T46A 2V7AA 3L8SA 3LFAA 4JOAA 1H24A 4MAOA 2YACA 1A9UA 2BZJA 4CSVA 2BIKB 3ZOSA 5E1SA 1U59A 4MXOA 4FKVA 4YC6A 4KKEA 4U9AA 5A6NA 4O4FA 3HMOA 3A99A 2VTNA 3PWDA 1IR3A 5HNBA 1YHWA 3F5GA 4YU2A 2BAJA 2CCIA 1V0OA 1DAWA 2JAMA 2BCJA 2EUFB 4MQ1A 4RRVA 3LM0A 5ACKA 4EOJA 5BMSA 1MRYA 2C6IA 2ZM4A 3FMLA 2WZJA 2C0OA 4C38A 3DB6A 3RPVA 2WMBA 4IB3A 4QYYA 4XMOA 5HCZA 5CX9A 2RG6A 5AP6A 3CBLA 1R0PA 2XNPA 5BQ0A 2UZWE 5J79A 2PUNA 2ZV8A 1XH8A 4M66A 1GZKA 2IEWA 3S0OA 5LVLA 2OW3A 4IVBA 2PVYA 4OTHA 2AQXA 4O0SA 4X3JA 4ZSGA 3W2QA 4OTQA 5FXRA 2IW9A 2EXCX 3W0PA 3R83A 5CF5A 3QQLA 4R8QA 3MSSA 3A7IA 4R7IA 5C03A 4E6CA 3PSCA 4BGGA 1PW2A 5ANGA 4FE2A 3MFRA 3TV4A 4N6YA 4CG8A 4AFJA 2FO0A 3N9XA 2VTAA 4FV5A 5LMKA 3OVVA 5DEYA 2VWBA 2GNGA 2BRNA 5AP4A 2BPMA 4PX6A 2BILB 5BVEA 1ZMWA 3LW0A 2BRGA 2PUUA 3AC5A 1G3NA 2B52A 3V5TA 4NH1A 4J97A 3UG2A 3WE8A 2IZRA 4CVAA 2Z02A 3QQFA 4GIIA 3UDZA 3GC8A 2GSFA 4Z7GA 5AUXA 3E62A 4I24A 3D2IA 4JIAA 3FKOA 5CI6A 3F3TA 4C4HA 3V51A 3U87A 4ACDA 3D5UA 4RJ7A 3C0GA 1XBCA 4IDVA 2R3JA 4HYUA 3ENMA 3BEGA 3FLYA 3QZHA 4WUNA 4LRKA 5AR2A 3EFJA 1HCKA 2V5QA 4RIYB 4L46A 3VUGA 3RINA 5HGIA 3F5UA 4YJPA 3GEQA 2V62A 3Q6UA 4D1ZA 3VULA 3ZM9A 2WMSA 3HYHA 1K9AA 3LFCA 1OVEA 3IW4A 4IVDA 3ZUTA 2OGVA 3FQSA 3IW5A 3MVMA 3KB7A 4AW5A 3KK8A 3MI9A 3AG9A 2WMXA 3K2LA 5JZNA 4DEBA 3G6GA 4E1ZA 4H05A 3OXTA 4TT7A 4GVJA 2QKRA 3KXGA 3O7LD 3Q52A 4Y72A 3BQRA 3PA3A 3DQWA 3MGYA 1UU8A 3MPTA 4JG8A 1YHVA 4RIXB 5TF9A 3DXNA 2YIXA 4CZUA 4DGOA 3D7TA 3U9NA 5CNOA 3SKCA 5CAOA 5BX0A 4QYHA 3IOPA 3T3VA 1OIYA 5FG8A 3C1XA 2G1TA 3H3CA 3R8VA 3VBVA 3RPSA 3VS3A 1VZOA 2E9UA 4C59A 4FOBA 4R7BA 2XH5A 3OCSA 3DGKA 1TQMA 5KBRA 5LWMA 3DXPA 1Q4LA 5AM6A 4JS8A 3DPKA 4QQCA 3D9VA 1YRPA 2R0IA 2B9FA 4OAUC 3MV5A 4J98A 3TJDA 5HO8A 3LOKA 2CKQA 4UZHA 2C69A 2AUHA 4DH7A 5FQDC 5E8WA 1S9JA 2J5EA 1HCLA 4EKKA 4DCAA 3IGGA 5IEXA 3D15A 3IKAA 3Q4ZA 4X2NA 3N4TA 4PY1A 4N57A 2QHMA 3E8EA 2W1ZA 3KF7A 3CD8A 2X0PA 2AC3A 3QQUA 4L7FA 4O96A 4QP8A 1NY3A 4XP0A 1UNHA 2WMTA 4IM3A 5E8SA 4FRFA 1KE6A 4IC7A 2C47A 4QMLA 3OT3A 2I0VA 4RVLA 3AKLA 3FSFA 2HELA 4YBKA 3DBCA 4IB5A 1E1XA 4W8EA 2E2BA 3QTUA 4YTIA 4BJJB 2W1CA 5AP5A 2IZSA 5IH4A 3ETAA 3HX4A 3UPZA 3EFLA 2GS6A 4FV0A 3ZC6A 2X1NA 5IG1A 4MWHA 2IO6A 3AXWA 4IMYA 4P4CA 5EQYA 2XB7A 2HAKA 3LMIA 2RGPA 3QTRA 3P08A 4IM0A 3BYSA 4RIWA 3I5NA 4OTFA 3V8TA 2WB8A 5I9ZA 4FNXA 3D94A 2F9GA 3PRFA 3P4KA 4ZS4A 1PXMA 1QMZA 3H10A 3MVLA 3QTZA 3R02A 5L8JA 3QZFA 4D4YA 2IVUA 3D0EA 4ZY6A 2PE2A 4ZTLA 3I79A 1IAJA 4NEUA 3DK6A 4NKAA 3S4QA 3UPXA 2G01A 3K5UA 3ZBXA 1Q41A 3V6SA 3C4ZA 3WZUA 4UMUA 4OAVB 3U55A 2RFDA 5KMMA 1JSTA 5M56A 3LCKA 2GDOA 4A7CA 3ZSGA 4U6RA 3BQCA 5A4EA 4BDHA 3TUBA 3QQKA 4B0GA 2QQ7A 3SW4A 5AP2A 5AIKA 1FINA 3PVWA 4GRBA 3JUHA 1YHSA 4JI9A 4I1ZA 4AX8A 3FXWA 2X0OA 2EVAA 5IQHA 3PUPA 4FG8A 4FKIA 4GT5A 4NSTA 4XRJA 3ULZA 1XO2B 2A19B 2BHEA 3FC1X 3WIGA 4EH6A 1PKGA 5E9EA 3RNYA 3CE3A 4IWPA 3LFDA 4FMQA 4U45A 4U44A 2BRBA 5D41A 4UBAA 3NW7A 4NM3A 2QOCA 3ALOA 4U80A 4AZSA 4PMPA 1FOTA 2GHLA 1QPCA 3H9RA 4FTJA 3RPYA 4EORA 2PYWA 4KWPA 2RF9A 4EOIA 2BKZA 3B2TA 3EQHA 4CQGA 4WSYA 1H01A 4JR3A 2G15A 1CKIA 3C50A 5AIRA 4PTCA 5E8ZA 1YQJA 3OS3A 3VONA 1Q8WA 2W1GA 4CLIA 3DCVA 1ZYJA 2W1EA 3WF7A 5CALA 3FE3A 1XR1A 2HIWA 4ANSA 2WTWA 3PJCA 1H4LA 2R7IA 3JY9A 5HESA 3PDTA 3AGLA 4ANOA 4OTGA 3MVJA 3FQEA 2QO7A 3O23A 3F3WA 5GJGA 4AT3A 4E7WA 3KL8A 2BZHB 4PMSA 3PJ2A 2VWUA 3DS6A