3MH2A

Mutagenesis of p38 map kinase establishes key roles of phe169 in function and structural dynamics and reveals a novel dfg-out state
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
348
structure length
330
Chain Sequence
RPTFYRQELNKTIWEVPERYQNLSPVGGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDYGTRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Mitogen-activated protein kinase 14
publication title Mutagenesis of p38alpha MAP kinase establishes key roles of Phe169 in function and structural dynamics and reveals a novel DFG-OUT state.
pubmed doi rcsb
source organism Homo sapiens
total genus 103
structure length 330
sequence length 348
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2010-04-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3mh2A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3mh2A01
1CDKA 4F1TA 5J5SA 2JDVA 4JS8A 3PVGA 5JZNA 2I0VA 4Y83A 5L3AA 4AT5A 3DFCB 3EL7A 4QP9A 5AUYA 4A4OA 2GQRA 3JXWA 5ANGA 4U41A 1UU8A 3R6XA 5AUUA 2FO0A 1R0EA 3VVHA 1KSWA 2CN8A 4EZ5A 2PE0A 3DBCA 1Q5KA 1OECA 4YTIA 3S3IA 3HMIA 4OW8A 5FTQA 2HYYA 5CU2A 5FEDA 4BCQA 2C6DA 3AC3A 2PVLA 4FTMA 4L7SA 4ZOGA 5IH4A 2OXYA 4LI5A 4JLCA 4J99A 4A9SA 1Y6BA 4JT3A 4ZAUA 3BQCA 3UO4A 5K4IA 3N9XA 4WO5A 1H28A 4O1PA 3O7LB 4C37A 4UN0C 4M15A 3CKWA 2WXVA 4FOBA 3NNUA 4MH7A 2XKDA 4YJUA 4AW0A 4EZ3A 5IUHA 3DK6A 5DWRA 5AX3A 1H4LA 5H8BA 4F7JA 2FYSA 4K8AA 2X0GA 1SYKA 5HO6A 1PXNA 2ITQA 2VX0A 1PKDA 1YKRA 3PXQA 4IAAA 4IFCA 2OZOA 4IACA 1WBPA 5G1XA 2UZUE 4KSPA 3HLLA 3QTSA 1TQPA 2WMSA 3UPZA 2HW6A 1Q8UA 3ET7A 1SVEA 3O8PA 4HZRA 3C4CA 2X2MA 4EK4A 5IPJA 3P7BA 1E9HA 4BN1A 4E26A 3M42A 4EORA 4J95A 4YHTA 1Q4LA 4W8EA 4F70A 2VGPA 3DKGA 4I5CA 4U7ZA 3ZC6A 1OVEA 2XNBA 4FEUA 3F2NA 2W1FA 2P55A 4YJPA 2Y4IC 4RGJA 4YJVA 3F61A 4IEBA 3A4OX 4PL4A 2GNFA 4MF1A 4NW6A 4O7WA 5AFVA 3PIYA 3HVCA 4O0VA 2RIOA 4RVMA 4CLJA 3THBA 2VWXA 4WD5A 3OF0A 4GVAA 1MRVA 3H3CA 5B0XA 4FKLA 5J95A 4GKHA 4AOTA 4AN3A 4JAJA 3MIAA 5LVNA 3JYAA 4I23A 4L43A 4PMMA 5B2KA 3TV4A 3QQGA 4B8MA 3D15A 1XH8A 3HGKA 4CMOA 1M2PA 3S2PA 4E73A 4FZFB 3VS5A 3UZTA 3ZSHA 4G5PA 2OO8X 4H1MA 5GHVA 3QL8A 5EHOA 4BDBA 4X7QA 2YCFA 2R7IA 5L2QA 2OICA 2WMAA 3OCTA 4W9WA 3AXWA 3MVMA 3NUNA 3QTWA 1RE8A 4OTIA 4YNEA 1TQIA 2PVHA 4KBAA 5D11A 4G2FA 3ZDUA 5EKOA 3ZXZA 2H6DA 3OHTA 3TZ8A 4CGAA 2VWBA 2XIZA 3OWLA 4F63A 4BCHA 2F7ZE 4P90A 3PPKA 3BHHA 3EJ1A 4KIKB 1ZLTA 2IW6A 2PULA 4QMYA 2WIHA 4PPAA 2VO0A 2BIKB 4I1ZA 4AT3A 4DCEA 4NJ3A 3EQBA 4JBVA 3A7IA 4FV5A 1HOWA 4YBKA 4IW0A 3ZO1A 5D1JA 2E9OA 3NW7A 5FXQA 3E3BX 5EM6A 4JQ8A 4OTHA 1NVRA 1Q8WA 3IW6A 5AP6A 3EZVA 4O6EA 4TT7A 4FSUA 3POOA 4AN9A 3EZRA 3KRRA 5JQ8A 3U87A 5JT2A 2HZ4A 2HWOA 2ONLC 2LAVA 2YLEA 1JQHA 3RM6A 3DKOA 4PRJA 2UV2A 3QTIA 1O6YA 1Q3DA 3JVSA 2OJ9A 3PPZA 5DEWA 4HYIA 3ZDIA 1H26A 4AW1A 2FUMA 1H00A 2C0OA 3BE2A 5KMNA 1YDRE 4UMRA 5IDNA 4KUJA 4NK9A 3PUPA 4AUAA 4BDEA 2XM8A 5JKGA 3T9TA 4WKQA 5GZ8A 4DLIA 4Z7HA 5EQPA 3KB7A 4NCTA 5G6VA 4KRCA 3HRCA 5HIEA 4YZNA 4ZMFA 4CYJA 4ZJJA 4QNYA 2ZV9A 5CNNA 2X4ZA 4JI9A 3SLSA 3PSDA 5JZJA 4MCVA 4DEHA 4RC2A 4EI4A 2OH0E 3LXKA 2AC5A 4FV7A 4BDAA 1CTPE 1VYZA 3H9FA 4GH2A 4AOJA 4PX6A 4QYGA 4EL9A 5HCZA 4B9DA 4Q5EA 1T46A 3D7ZA 4LGGA 2DUVA 1Y8YA 3ORXA 4UYNA 4RFMA 4CFXA 4KABA 5CAUA 2OIBA 4NSTA 1PYEA 3SRVA 2UZBA 4D2TA 3UOJA 3R9RA 3G9LX 4UBAA 5EH0A 4D2PA 5JK3A 1QPDA 1ZWSA 2IWIA 4EBWA 5GJDA 4HGLA 5TR6A 3SD0A 3BELA 3N4TA 2OU7A 1WBSA 4MTAA 4Y5HA 3E8EA 5DI1A 4BB4A 2J0LA 3D2KA 4LL5A 3ATTA 4R3CA 3CGFA 5AR5A 3W8QA 3ZU7A 2F9GA 3SXFA 3QZIA 5HORA 4PDYA 3AMYA 3Q6WA 2RKUA 2VRXA 1M14A 5M53A 2UZTA 3OZ6A 4KRDA 4RX9A 4CZYB 4GT3A 4G31A 3FV8A 1OIQA 3HX4A 4CQEA 4ZTSA 3PXYA 3QTQA 2G2IA 1YI3A 1KE7A 4X3FC 4PNKA 3DDPA 2ETKA 3UIUA 4L52A 2PZYA 3Q4ZA 4MQ2A 1YXTA 4AZSA 3HAVA 4AT4A 3OOMA 4O7SA 3ENMA 5ITAA 2BUJA 3AQVA 3NYXA 3O96A 1NVSA 5FRIA 4GK2A 4FIHA 4YBJA 3MWUA 5A4CA 3GVUA 3TT0A 1V0BA 2YM3A 5CF6A 4WBBB 3BGQA 5TE0A 4XP2A 4OBOA 4WNMA 2UW0A 1FMKA 3EQDA 3FZPA 3QC4A 5LARA 2VTSA 3MJ1A 3MFTA 2CCIA 2OBJA 3KVWA 1YXVA 5CSVA 2REIA 4D5HA 3L1SA 4XP0A 4FC0A 2JLDA 3RPOA 2R3KA 2BRBA 2XM9A 4RVLA 3V8WA 4ANSA 3I5ZA 4XLVA 3WIKA 5JGAA 5J1VA 3LM0A 4G1WA 2Q0BA 4NTSA 5CS6A 5BX0A 5JRQA 5CYIA 3GFWA 4FTIA 3PJ1A 4FNZA 3LJ2A 1M52A 1WFCA 3E7VA 3FI2A 4ZSAA 3CQEA 1PXMA 3G90X 4WG5A 1PHKA 3WF7A 3O2MA 4L68A 3ORKA 2F7EE 3LVPA 2B54A 4RQVA 4MNEB 5B7VA 4TYHA 3GU8A 3WYXA 4A9YA 3PXFA 4A7CA 4CCUA 4DTBA 3VBVA 2VGOA 2ERKA 5HCYA 1UU7A 2W1HA 2QI8A 2G2FA 4GCJA 2Y4PA 3TXOA 5LOHA 4R7IA 5ANOA 4CKJA 2IN6A 4TZRA 4S30A 4FZDB 3ZRLA 4BYJA 3JUHA 4E6CA 4NEUA 4FTLA 4CTBA 4CVAA 4G6LA 2B53A 2JKMA 4PV0A 3DK3A 4I4FA 3FZ1A 5E8UA 3E62A 2Z7SA 1TKIA 3F82A 2OSCA 5CU3A 4A4LA 5CTPA 4U80A 3EQHA 4EJNA 3E7OA 4DGMA 1WBWA 5E7RA 3FZSA 4MBLA 1ZYCA 2CMWA 4EOLA 1G8AA 1B38A 5C1QB 5I4NA 4QMPA 2QHNA 4FIIA 2XKCA 4E6AA 3MESA 2F7XE 3BYVA 3TL8A 4EOJA 3CSVA 3COHA 1CKPA 4A06A 4L46A 4OLIA 3KRXA 3MFUA 3QRTA 5KUPA 3F3VA 4I6QA 4UMQA 4XHKB 3QD4A 5LCJA 2EWAA 2R3IA 3Q4CA 4EK6A 2IZSA 4M69A 2A27A 4DEEA 5BQ0A 3DQWA 4BCJA 5CANA 4JBOA 4DLJA 2G9XA 4PPCA 5F95A 4GT5A 4G9RA 2AC3A 3FQHA 1OBDA 5AA8A 4JIAA 3LXLA 3EKNA 2BROA 3ORZA 1ZOGA 4BZOA 4I22A 5K4JA 2P4IA 1V1KA 4PL5A 5K5XA 2WD1A 3OXIA 5AIRA 5A3XA 3U55A 2W05A 3PE1A 3Q5IA 3UG1A 4EEVA 4J71A 1FGKA 2F57A 4KBCA 5AUWA 4F6UA 1IAJA 4XG2A 3ACJA 1MUOA 4I93A 4A9UA 4GYIA 3OWPA 3DA6A 3EL8A 4APCA 4QP6A 3GENA 3DY7A 4G9CA 1Q62A 3R7EA 3V5LA 1JWHA 3LMGA 3QQHA 4S2ZA 2HXQA 3VN9A 5H3QA 5FXSA 3VWAA 3WI6A 3TKHA 5CF8A 3LCTA 4AN2A 5DN3A 4FTJA 3F5PA 4IJ9A 5EQYA 4OTQA 3PJ3A 3A62A 4GIHA 2DQ7X 4HVDA 4AE6A 4BWKA 2YJRA 3D5XA 3BHVA 1VZOA 3TIYA 4PY1A 5D9HA 3WZDA 2C5YA 4IM2A 2QOIA 3MFSA 5A4LA 2VX1A 3VO3A 4U43A 4DG2E 3ZCLA 5IA4A 2O63A 4KA3A 4PTGA 4CG8A 4O7RA 3MGYA 3MY0A 1J1BA 4QP3A 4E20A 3TZ9A 4NUSA 5CF5A 5ANDA 3KY2A 2O5KA 2ESMA 4C3PA 4EH2A 2W99B 1FVTA 3TM0A 1F0QA 4OGRA 3JY9A 3KQ7A 3FE3A 3QX4A 4FIJA 4FKIA 5CQWA 5CT7A 3IECA 4BCNA 3OEZA 1OITA 2IVVA 4GFMA 4XG3A 3MSSA 1JBPE 3CXWA 3FUPA 1M7QA 3PA5A 4NCTC 1KE8A 4L00A 3KCKA 4D4SA 2H8HA 3O17A 2J50A 1OKVA 3I0OA 2ZMCA 4FT3A 2NP8A 4IX3A 5ETIA 1VEBA 4QMLA 3CJFA 4B8LA 3A7GA 4YLJA 1OPJA 4D9TA 5AWMA 3GFEA 3IW7A 1GZKA 4DGNA 2JITA 1UNGA 3EQFA 2C3KA 5DMZA 3PZHA 3A8XA 3OG7A 4TRLA 3P4KA 2QNJA 5E8XA 4AFJA 3NAXA 2HZIA 2CGXA 4UALA 4G3EA 4IX6A 1GNGA 5L4QA 5FP5A 3NVKI 1Q97A 1T45A 3VUDA 3TTIA 4LV8A 4C34A 5GZAA 4FTNA 4CT2A 3AT3A 5HNIX 5C8MA 2B9JA 3JVRA 4U79A 4AP7A 3BQRA 3CC6A 3UO6A 1OL5A 4X2NA 5FDPA 3JR1A 5ANKA 3F5XA 4L3LA 4EYMA 5I9WA 5AJQA 5AR7A 5IQAA 4BI2A 4S33A 5IDPA 1APME 4JQEA 3T3VA 4HYSA 4C58A 4QTDA 4HCTA 3PA4A 2GQGA 4HW7A 3D2IA 1OMWA 3G5DA 4OBPA 5FBNC 3PDTA 3TNHA 2OKRA 3A4PA 2QLQA 4O0UA 4PMSA 4IDTA 5E9EA 1UWJA 2XZSA 5J79A 2VX3A 2C5NA 3QBNA 3AGMA 3II5A 4N4SA 5DIAA 3EHAA 3UMWA 3QQLA 4BZDA 3MTLA 5D10A 4V01A 5HVKA 4GT4A 1M17A 2C6IA 3KFAA 1OL6A 3KC3A 3LFAA 5E92A 5HESA 4EHZA 3ZBFA 4MAOA 3IKAA 3AT4A 4BY9E 3QZFA 3SHEA 3E8NA 4ITHA 4JBPA 3KXMA 5F4NA 5CVFA 2WPAA 4RC3A 4NYEA 1JPAA 1L3RE 1DAWA 5AA9A 2XNNA 2XRWA 4NKAA 4FKVA 4U6RA 3MYGA 4FTKA 1YI6A 4QMTA 4YO6A 3TNQB 4FX3A 4OTGA 3VUHA 3C50A 3TNIA 5AM7A 3B2TA 3I5NA 5E1EA 3A60A 3SXSA 2X7GA 4UX9A 3ANQA 3DAEA 1PXKA 4H58A 3VHKA 2CKEA 2FH9A 3I79A 1JVPP 4C02A 5HI2A 2OFUA 3DK7A 2WU7A 3KMMA 2BRHA 4NIFB 1AGWA 3QAME 2WEIA 2BILB 1G3NA 4E5BA 5IZFA 3DJ6A 4BCOA 1IG1A 3NNXA 4FTQA 3Q4TA 5L2WA 5EQEA 4XG6A 3V01A 2QONA 2EB2A 3ZRMA 3P7CA 2WGJA 4D2SA 3QCYA 3KL8A 3FBVA 2H9VA 3KXNA 4X0MA 3QRJA 3LAUA 3VBQA 3TZ7A 4B0GA 3F88A 3T8OA 4C0TA 1JSUA 1GZ8A 3ORMA 4O27B 4EH3A 2B4SB 2A1AB 2YM7A 4JR7A 4ANQA 5AUVA 5IQFA 5HKMA 3KXGA 4DEBA 4OBQA 2X2KA 4BKZA 3QUDA 1ZYLA 4APPA 2IZRA 3ZUUA 3IK3A 2BFYA 4EWQA 4DT8A 3NYVA 4ZIMA 5IUGA 3SV0A 4D0WA 5AUZA 3HECA 4FKWA 3CR0A 3UVPA 3FDNA 4LQMA 3L9PA 4XBUA 2PVRA 2ETMA 4PMTA 3E92A 3H30A 3FKNA 2X4FA 4MXXA 4U9AA 4F09A 4MWIA 3GCPA 4D1XA 2OWBA 3DZQA 4FG9A 2PWLA 2WTKC 1OPLA 2WOTA 3FLZA 3E93A 4IB5A 3Q52A 4C7TA 5A9UA 1YWVA 4FTOA 3QWJA 3OMVA 3VQHA 4IQ6A 4DH7A 4DH8A 2V55A 4IB3A 2OLCA 2QOKA 2RF9A 4ZTRA 3RI1A 4ZSLA 2JD5A 5BYZA 2UVXA 3FEGA 1VJYA 1H27A 3DKCA 2V62A 1PMEA 4JDJA 4QMMA 4RX7A 5J8IA 3U9NA 3C4FA 1Y57A 3COKA 3O23A 3VUMA 4O7TA 4AA4A 3R8ZA 1XBAA 5L6WL 3BGPA 5I9UA 4EJ7A 1UWHA 2QODA 3O7LD 3QGWA 1H07A 3EIDA 4I94A 5HIBA 5IA5A 1KOAA 3W8LA 5EDQA 3BKBA 1ZYJA 3ETAA 2WMTA 4IZAA 4Y46A 4USEA 1FINA 3D14A 3MW1A 2YIWA 2WQNA 3ZXTA 3FQEA 1OGUA 3CD3A 4I0RA 1OKWA 4AX8A 5IG1A 2OZAB 1UU3A 2WMWA 1SVHA 5I5ZA 3RZFA 2VN9A 5DRBA 5AP5A 2I0EA 2XH5A 5AP3A 3UC3A 2ITUA 4WNKA 4I6FA 4M67A 1QMZA 4CZTA 4O86A 5M4IA 4HGTA 2R0IA 2JBPA 2XKEA 4JNWA 2OIDA 1F5QA 3CD8A 4G17A 4K18A 4TYJA 2IW8A 3QKLA 5H2UA 4CFWA 3EN7A 4AA0A 4BIBA 4GJ2A 2QOHA 1RW8A 1H01A 3HKOA 4AF3A 3R7IA 5J5TA 4DA5A 4OAVB 4F9BA 4B7TA 4CFUA 1BKXA 3KU2A 3PSBA 4BR3A 3I7BA 4RWLA 1PRYA 3RALA 3FXWA 2PZPA 1R3CA 3Q9WA 4LMUA 5E8VA 3HMPA 2VAGA 4C4JA 3GU5A 3RPSA 3G51A 4O2PA 1SNUA 2PE2A 2WQOA 2X6EA 2ZB0A 3OTUA 5EI2A 1U54A 3Q9XA 4FODA 4IADA 1A48A 1URWA 4LFIA 1YI4A 3PP1A 5DR9A 4O7NA 4AACA 5BVFA 3FXZA 2XYUA 3GC7A 3WF8A 4EH9A 2ZV8A 5HG8A 4I5HA 4BCMA 1LP4A 3QA0A 4B4LA 4DFLA 3F5GA 4FG7A 5C26A 4QMVA 2WTJA 3PXRA 5IF1A 3A2CA 5ETFA 1YOMA 4ZJVA 3NDMA 2YCSA 4J1RA 3TN8A 1BYGA 2NRUA 2UZLA 2Z60A 4MBJA 1LPUA 5BVWA 3GCSA 2X9EA 4OR5A 3HA8A 3QXPA 4O0YA 2VTOA 2ZB1A 4ITJA 1ERKA 1ZZLA 3R71A 4OTDA 4JBQA 2YDKA 3EYGA 1XH4A 2PZIA 3ZRKA 4FV8A 5HE3A 4BICA 4QYHA 5FG8A 2ITZA 4KINA 4DFNA 5LVMA 2BKKA 5CSHA 3OWKA 1KWPA 2BTSA 3V5QA 4UV0A 3NPCA 4WT6A 2YIRA 1UNHA 2BMCA 3U9CA 3KMUA 2G01A 4AZEA 4OTWA 5DVRA 2XIRA 3O71A 1K9AA 1UKIA 3NIZA 5DRDA 4WNPA 4EH6A 4ID7A 2YM8A 3WZUA 4DGOA 1WVYA 5HGIA 3WZEA 2OJGA 4S34A 1XQZA 5HZNA 1G5SA 3DLZA 1PW2A 4YJRA 3CJGA 1K3AA 4XYFA 1XO2B 2J5EA 3DXQA 5HEZA 3W2OA 5H8EA 1FOTA 4FKTA 4HPTE 2UZEA 3E8DA 1HCKA 4ACHA 2WU6A 1FBNA 3GI3A 4USDA 3QTUA 3U6IA 2VTLA 3SW7A 4AGUA 2R3GA 3M2WA 3I0QA 4D0XA 2BIYA 5IEVA 4KAOA 3TKUA 1ZY4A 3R8VA 2PZRA 2WTCA 2QVSE 2B0QA 4NKSA 3FL4A 2BAQA 1BL7A 2J2IB 3PVUA 4FZ7A 1JKTA 4JR3A 3O51A 4Z55A 3BLHA 2VTTA 5JEBA 2UZOA 3UNKA 4GK4A 2Y6MA 1H25A 2BPMA 2C6EA 4E7WA 4HVHA 4YZ9A 3QC9A 4QQ5A 3DAKA 3H0ZA 3TCPA 5EK7A 3R9NA 4CCBA 3DPKA 4LV5A 3PJ8A 4HJOA 5T6KA 5K5NA 2CKOA 4ZTQA 4QYEA 4JDHA 1V0PA 2J51A 5HG9A 4BI0A 3LW0A 4QMNA 2HZNA 1YHVA 2BZHB 2XK7A 5ETCA 4I3ZA 3VUIA 3GNIB 2JFLA 4YZDA 3CGOA 2VTRA 2YFXA 3VF9A 2JAMA 4O21A 4YJTA 1J7IA 2BRNA 1ZMVA 1JAMA 1G8SA 3DKFA 3PJ2A 3DXNA 1HCLA 2V7AA 4R7HA 2CGWA 3H0YA 4EOPA 3KEXA 3MI9A 4J7BA 4RIYA 3S1HA 2F4JA 3L8XA 3W2RA 2W1GA 3ZHPC 4C33A 4GU9A 3WZJA 4A9RA 4XH6A 3BEAA 2BZJA 3LQ8A 3PJCA 2QOBA 1W84A 3QD3A 3HNGA 3AD6A 5LVLA 2BFXA 3IPHA 3ZM9A 3F5UA 2UW7A 4QYFA 1KUTA 3FI8A 3UGCA 3FLWA 4O91A 4ZZMA 3FQSA 5ANIA 3BHUA 1JKSA 3BHYA 4EH5A 4F65A 4BTKA 3VW8A 5EKNA 3R28A 4FV6A 3UZPA 4PNIA 3KN5A 3FYKX 5HLPA 1I09A 3U6HA 3EFWA 4F9CA 3QX2A 4J96A 5TT7A 4O0WA 4BZNA 3VS0A 2R4BA 2VWZA 2V22A 1H1SA 2CHLA 3ZUTA 1Q8ZA 4I6BA 4F7NA 2XS0A 4DEDA 5H8GA 3O8TA 3TV6A 3V8SA 3OBGA 4DFYA 4TTHB 4XP3A 3IDPA 3EN4A 4R7BA 1GIJA 4RFYA 3TIZA 3AMBA 3F69A 3MS9A 2VWVA 4PDOA 4XG9A 3RAKA 4M13A 3SG8A 4DTAA 2JBOA 3P0MA 2UW9A 4IXPA 3HYHA 3DOGA 3IOPA 4PDSA 2RSVA 1QPEA 4X6QC 3RVGA 3TZMA 4V0GA 4EUTA 3EQCA 4RMZA 3VNTA 5IQEA 1ZARA 4H3BA 4RRVA 2XP2A 3CQUA 1PXOA 3HV7A 3SRVB 4O84A 1WBOA 2C6MA 3UIBA 4ALVA 1YOJA 1ZRZA 2XNEA 2OIQA 1EH4A 4RPVA 2B7AA 2PYWA 4QP8A 4EHEA 4NM3A 3BX5A 4YC6A 3EFKA 3R2YA 5EOBA 3COMA 3U4WA 4FV1A 3RTPA 2WMRA 3BWFA 4FK6A 3D0EA 5IQIA 4IH8A 2QU6A 3HV4A 2P33A 4XX9A 4IWOA 4IDVA 3ZO3A 4J53A 4UWYA 3NUPA 2W4JA 2PVFA 4QQCA 5KZ0A 3D5VA 3GCUA 3LFEA 4EWHA 3TDWA 3OXZA 3EKKA 5HE0A 2WMVA 3NYNA 2VWWA 4AU8A 4YHJA 4IB0A 2ETRA 3PPJA 3D4QA 3D9VA 3EQRA 1GIHA 3LJ0A 5FXRA 3QUPA 3ZFMA 5BMMA 4DE4A 4DG3E 4IIRA 5ACKA 3KK9A 4JXFA 3D5UA 4LRMA 4ZLYA 2J4ZA 2QG7A 2OK1A 3UQGA 2YEXA 3ROCA 4BCIA 5BVOA 4YUQA 1MRYA 4O7YA 2VWYA 4WBOA 3MA3A 2J9MA 3B2WA 3V5JA 4ZZNA 4PWNA 2XIKA 4K33A 5J7BA 2EXEA 3U4UA 3GQIA 4YC8A 3NAYA 5C01A 3RM7A 4ANOA 3P86A 1AD5A 2FSTX 2GU8A 5J1WA 3LCSA 5AR8A 4P7EA 4G3DA 4BBFA 1IEPA 4FV3A 4HGEA 3KGAA 5IEXA 1OM1A 4JL9A 1GAGA 3QD2B 4IBMA 4XS2A 4ALWA 4JG8A 4XG8A 4F7LA 3L9NA 2RFDA 3UP2A 1YVJA 1Q41A 4U42A 3Q53A 4UEUA 5AR3A 4Z3VA 4U3YA 2C4GA 1JKKA 4CMUA 3EN5A 1H1PA 4ZJIA 4FUYA 3OCGA 5FEEA 1YW2A 4LM5A 2Q83A 2VTQA 1REKA 4LRJA 4ZS4A 3FY0A 3LFBA 4ITIA 2WHBA 4L67A 1O6LA 3UIXA 3ODYX 4BCKA 5JGDA 3TV7A 5CF4A 3ZOSA 5E8ZA 2GDOA 2CNQA 4MD7E 1KOBA 5CEQA 3CCNA 2QOQA 3AD4A 2E9UA 1RDQE 3NW6A 2WB8A 4N57A 3I6WA 4CRSA 5LMKA 3W1FA 1JSVA 2OFVA 2HY81 3PP0A 3U8WA 5KNJA 1LEWA 4QMOA 3S00A 4LGHA 2ZJWA 2VUWA 4O6LA 4RT7A 4X21A 1NY3A 4XG7A 5CT0A 4H39A 2VTNA 2GNLA 5DNRA 3RPRA 3V6RA 4DG0E 4GG5A 3DGKA 3F7WA 2BZKB 4PDPA 4O7LA 4FSZA 4KIKA 3SG9A 3BI6A 5KMIA 3AC5A 1FMOE 4FTTA 2IJMA 4O7ZA 4OTPA 5DR6A 2X8EA 4I0SA 5EI6A 5CQUA 5CSWA 2EVAA 4FNWA 4G6NA 5AV0A 1YDSE 4BTJA 5CEMA 3UMXA 4LUDA 4L3JA 4OTRA 3DB6A 4ZEGA 5DA3A 3C4ZA 2X2LA 2G2HA 5AP7A 4EH8A 2G1TA 3BLRA 3QKKA 4MX9A 2XCHA 4FKJA 3JY0A 1WCCA 2WTKB 3CPBA 4FL1A 4EC9A 2YAKA 2HXLA 1JLUE 3D94A 4WG4A 3BRBA 2OF2A 2C1BA 1YHSA 3VUGA 5M08A 3BYSA 4H1JA 5AMNA 5IA1A 5LVOA 3NUUA 4MD9E 3V51A 2WTIA 4BWXA 5E8SA 3CLYA 3SW4A 4TWCA 5HICA 4FBXA 4C4IA 1XHAA 2E2BA 3OBJA 3IGGA 4RVTA 4BKYA 4JAIA 4DH3A 4F9AA 3RMFA 4JDIA 4BCGA 2IZTA 2A2AA 5L8JA 4XG4A 2E9PA 2ERZE 3OROA 4PP9A 4MK0A 5LJJA 4DFBA 2BZIB 4TKSA 2YIXA 1YOLA 4FIGA 3PRIA 5CXHA 4RG0A 3C0HA 1SVGA 2Y6OA 2UW6A 1U4DA 1TVOA 4N70A 2I6LA 2W06A 2ZV2A 3OD6X 2GHLA 4BDJA 3KMWA 5FEQA 2W9ZB 2PPQA 3U51A 1H1QA 4AS0A 3LCDA 4FTCA 3LKMA 2PUIA 2R3OA 3Q4UA 2GSFA 1BX6A 1R39A 2CLXA 2J5FA 4I21A 1SM2A 2WQEA 4HZSA 4GVJA 4IB1A 3VS1A 3HA6A 3KXXA 3OC1A 4UZHA 4AXAA 4B6LA 4XV1A 4ANMA 4ERKA 1P5EA 4CNHA 2YIQA 4WOVA 4RA5A 3RK7A 2W0JA 4GUBA 4XRLA 4C4FA 3LIJA 1A9UA 2WTDA 4NZWB 4RZVA 4O83A 4QTAA 3V5PA 4B99A 3MJ2A 5IA3A 3F2AA 4EKKA 2QD9A 3K3JA 3MVHA 2HELA 2Z8CA 4RC4A 3PZEA 4YLKA 4YPSA 3D83A 3TUCA 2WELA 2YERA 4IVCA 3NIEA 3R00A 5EYMA 4FNXA 5CI7A 3TJCA 3GU4A 4FSWA 4BCFA 5KHWA 4AG8A 4LRKA 1ATPE 4EK8A 3EQPA 3BCEA 2XK3A 1PMVA 4FTAA 1Y91A 4IANA 1OKZA 2RFEA 3RJCA 4FG8A 4U8ZA 4QMSA 4ASZA 4DHFA 3IW5A 3UZRA 2GCDA 5A4TA 3FLQA 5EHYA 3R2BA 4MXYA 4AAAA 3BU5A 4IC7A 5AEPA 5LMAA 4E8AA 4H05A 4F99A 4PQNA 1QCFA 1WBTA 2UVZA 2YACA 1O9UA 1TQMA 4FT5A 5IISA 1CSNA 2C5VA 3QHWA 4PF4A 4D1SA 3HDMA 5CY3A 2WMQA 3UVQA 3PTGA 1OL2A 2DWBA 4YTCA 2UVYA 2XJ1A 4KD1A 4E3CA 3EQGA 5I9XA 3OTVA 1KE6A 1JKLA 1ZYSA 2C6OA 3MH2A 3P5KA 4BF2A 3IONA 4FVPA 5AAGA 3LMHA 1YDTE 3F3ZA 4ACGA 3BPRA 3LFCA 1BL6A 3K3IA 5DG5A 1ZZ2A 4HYHA 5KMMA 3R9DA 3EYHA 4CSVA 4UXQA 5K3YA 1U59A 2BRMA 2G15A 3PYYA 4ASDA 3HMOA 3NR9A 3LJ1A 2IVUA 4NW5A 5I3OA 3SKCA 4DGGA 4DEGA 3GC0A 1H08A 1FVRA 4FSRA 3W2PA 5F94A 4U81A 4FL3A 1CMKE 2XIYA 3SC1A 2QKWB 4EOQA 4FGRA 3JPVA 4HCVA 4M97A 4EOKA 3VF8A 4F7SA 4C2VA 4GJ3A 2W5BA 5DOSA 2VTMA 4C3RA 5KBQA 3DTCA 5JN2A 1XH9A 2WMBA 4MQ1A 5LCKA 3ZSGA 5BUIA 4MWHA 3UO5A 2ITPA 4YNOA 4CD0A 4P4CA 4PTEA 5HO8A 3QGYA 2FSMX 5D7AA 4CV8A 5KMKA 2RFSA 5I3RA 2YM4A 4DAWA 5B2MA 2J0MB 4Y73A 3LFSA 4XBRA 3C13A 4NH1A 3PY0A 2JIUA 2V5QA 3LFDA 4FIFA 3MH3A 5C4KA 3H9OA 3R1YA 3F3UA 3QA8A 4ZLOA 4C36A 2OJFE 4ENXA 2QR7A 2PMIA 3H4JA 4TXCA 1M7NA 4FGBA 4NU1A 5BYLA 3MH1A 3HP2A 4QRCA 5HX6A 3WE4A 5IA0A 3WBLA 2ITXA 4GFGA 1OB3A 3KULB 5DH3A 3KRWA 2UZNA 1S9JA 4CG9A 1YWRA 2Y4IB 4I41A 3ZMMA 4C3FA 3R8UA 3F7ZA 2X9FA 3RZBA 2ZMDA 3AGLA 1PXLA 4FKGA 2J90A 4DC2A 3P08A 3F9NA 5L2TA 2CLQA 1H0WA 3BU3A 4W4VA 5LMKC 4NWMA 2QO9A 3ID6C 3SVVA 1YWNA 3ORIA 2QG5A 4R5SA 2W96B 2CSNA 2VTPA 3ZFYA 2XK6A 2HENA 3CTJA 2B55A 3G9NA 3WARA 4EC8A 2FGIA 2WZJA 5HG5A 5LXMA 3ULZA 4D4RA 5A54A 5CAPA 3GU6A 5M51A 3PSCA 3G33A 3AC4A 3T9IA 3R7OA 4IMYA 2O8YA 2XNMA 4AW2A 4IAIA 5DFPA 5JH6A 4GFOA 2GNHA 3EN6A 4R1YA 3FAAA 3R30A 5L8LA 2BDWA 4M0YA 1E1XA 4C2WA 1OKYA 3S4QA 4WUNA 4X6RA 1YXXA 5FM3A 5HQ0A 4ORKA 2PVYA 2J7TA 3E88A 4Y72A 5M55A 5HLNA 4MHAA 4L9IA 3VBYA 3GC9A 3D7TA 4RFZA 4XV3A 3N51A 3GBZA 4C62A 2GTNA 3I81A 1H8FA 3ZSIA 3K5VA 2I40A 2YLFA 5EDPA 1XH5A 3VBXA 4U0IA 4ZY4A 4W8DA 3EOCA 5CLPA 4EUUA 3CEKA 4MNFA 2XNOA 2GNGA 3MPTA 4FKQA 3MH0A 4K0YA 4I5PA 4P5ZA 4RIXB 4RSSA 4D28A 3QD0A 3R02A 5KO1A 2A19B 2WFYA 3I6UA 3N4VA 4XOYA 3FSKA 4O2ZA 4FEQA 3C7QA 1MQBA 2R3MA 2ZYBA 4QT1A 4L53A 3VBTA 3CE3A 3C9WA 3ZLYA 3C5IA 2F49A 2BHHA 2P2HA 2HIWA 3UODA 3KCFA 3COIA 1JOWB 4X2FA 4D55A 5E91A 3HL7A 2UZWE 3MY1A 4OTFA 2PZ5A 5HD7A 1NXKA 2PTKA 2YZAA 5IQHA 3O0GA 3QLGA 5F20A 4KS8A 3LPBA 2PVNA 2W5HA 3E63A 4II5A 1H1RA 4KKHA 5D12A 3DV3A 5HNGA 4E6QA 3V8TA 1CKJA 1OZ1A 5IUIA 4AFEA 4M66A 2IW9A 3VQUA 1J7LA 5HLWA 3QXOA 2W1IA 4TWOA 4JX3A 4YMJA 2VD5A 2ZV7A 4UB7A 5AX9A 2JIIA 3RCDA 5L6OA 2YWPA 4BDFA 2Y0AA 4I20A 5KKRC 4FA2A 2GNIA 5GIOE 2GPHA 3A61A 4RZWA 4V05A 4BDHA 2GFCA 5HU3A 3A7HA 3POZA 4BBMA 3RAWA 3NWWA 4K6ZA 3TNWA 3BE9A 1UVRA 4TWNA 3RCJA 3VS7A 2CNVA 3F66A 4RIWB 4BC6A 4YJNA 4AGDA 5CEOA 2QOLA 4AGCA 3OCBA 4QTBA 4Y85A 4BL1A 3AC1A 4N6ZA 2PUUA 2BDJA 4NM5A 1PKGA 4MXZA 3L9MA 1OI9A 5CEPA 4MF0A 2YISA 1QL6A 2HCKA 3C4XA 4X2JA 4E5AX 5J9YA 2JDRA 4ZTLA 1OPKA 4IVAA 3OFMA 4I92A 5DT4A 3KA0A 4XV9A 4KWPA 5HCXA 4YTHA 3QQJA 4HPUE 3BBWA 4NFMA 5C03A 4D4YA 5KE0A 2ITTA 4R6VA 1KE9A 4UYAA 2WMUA 2F2CB 3HMNA 4JRNA 5EW3A 4AGWA 2EXMA 3E64A 5H9BA 2P0CA 4GK3A 4WIHA 4A9TA 2X6DA 4X3FB 3HRFA 4R8QA 1DI9A 3HP5A 4YURA 3Q9YA 4LGDA 3VS6A 1GOLA 4ALUA 4P2KA 2KULA 4TPTA 5BMSA 3HDNA 4I4EA 2BDFA 5ANEA 3GQLA 2XBJA 4LOQA 5LWMA 3LQ3A 2OI4X 2WNTA 1M2RA 3ZEPA 4E1ZA 2OXDA 2OGVA 4EHVA 4CTCA 3ZUVA 2CCHA 4L44A 3ZZWA 2PY3A 3IW8A 2R7BA 4U5JA 2O65A 4DGLC 1OIYA 2YABA 3HMMA 5JFWA 5IEYA 1QPJA 3B8RA 5AUXA 5AP2A 2GS2A 4PL3A 4IVDA 5BYYA 4IZ5A 2ZOQA 2OF4A 3LZBA 5E8WA 2ZDUA 3P23A 1PMUA 3LCOA 2R64A 4E6DA 5FTOA 4FSQA 5M09A 4CKRA 2QURA 4FSYA 4H3QA 4LMNA 1OIUA 2YA9A 1IASA 1OL1A 3HEGA 5ACBC 2IG7A 3DBQA 3NYOA 1VR2A 3OP5A 3R83A 4ZSEA 2ZM3A 5CALA 4EYJA 3DT1A 3GUBA 5DEYA 2GHGA 2SRCA 1NVQA 2C6KA 3IO7A 2YM6A 2XJ2A 1MQ4A 3UDBA 5IQDA 1ZYDA 4BFMA 3FC2A 1W7HA 1IA9A 3TNPC 2HY0A 5ICPA 3WF9A 5BVDA 5FTGA 4ZP5A 3VUKA 3PE2A 3W2SA 4MKCA 2YITA 1XH6A 3QHRA 3FJQE 3VS4A 4MD8E 4F64A 3RWPA 5DYJA 4AZTA 4JOAA 1XKKA 2VTHA 3ODZX 4FYOA 4FK3A 2HW7A 2R9SA 4U40A 2XK9A 4L45A 2PMOX 2Q0NA 4UWBA 5AP1A 3BYMA 3PY1A 3UC4A 3ZZEA 4EOOA 1FGIA 4ZTHA 5M4FA 2YCRA 3FPMA 4RJ8A 5CASA 2RL5A 4EOSA 4KB8A 1PF8A 5CEKA 4R3RA 2B52A 4NM0A 4CYIA 2BVAA 3L8PA 3SXRA 4HCUA 4BHZA 4O1OA 2HZ0A 2GMXA 2CNUA 3RK9A 2O0UA 3PXKA 5TF9A 1Q99A 5D41A 2B1PA 2XEZA 4CRLA 1U5QA 4EBVA 2R2PA 4EZ7A 3LMIA 4UMUA 1Q3WA 3DBEA 3FMNA 4R1VA 4HOKA 1PJKA 3P7AA 3TACA 4RQKA 4MXAA 3UIMA 3ALNA 1A06A 2I0YA 2JC6A 2YDIA 1O6KA 4FV4A 2QHMA 4AE9A 3D5WA 5FUTA 4LUEA 3KRJA 4UWCA 1P4FA 3QALE 5CNOA 1W0XC 2LGCA 2VV9A 3QCQA 2R3RA 3WYYA 5EI8A 3ZYAA 3BZ3A 3FLSA 5FBOA 5GNKA 4L8MA 4M3QA 2VTIA 4AWIA 4C4EA 4DF3A 4O0TA 1K2PA 2FVDA 3UJGA 4W4XA 5DT3A 3AT2A 2ITNA 2BKZA 3H10A 3GP0A 3OUKA 3W2CA 3ZLSA 3HUCA 3P1AA 4C8BA 3NMUF 2NPQA 3LM5A 2XNGA 1XBBA 4EONA 1GIIA 3NLBA 1Z9XA 1XWSA 1U46A 2EUFB 4BHNA 2JIVA 5F9EA 4GEOA 5A4EA 4C61A 2CKPA 4GKIA 4TYGA 2BCJA 5EFQA 5J9ZA 4DINA 3HRBA 5KMLA 3A8WA 3UQCA 3O50A 5D7VA 4E4LA 3FMJA 3EB0A 3HV6A 3ZBXA 4BWPA 3NRMA 4M68A 4EQCA 4FE2A 4KIOA 3QF9A 3NEWA 3F2RA 1DS5A 4CT1A 5I9ZA 3DNDA 2W7XA 4TN6A 2QOOA 5KHXA 3CS9A 4ENYA 3RBWA 5CAOA 2I7QA 4PMPA 1R78A 2PVJA 3MA6A 3QRUA 3FHRA 3I60A 4RBLA 1KE5A 4KBKA 5C4LA 2IPXA 3MPAA 4X3JA 5DR2A 4IC8A 3QLFA 3R1NA 2PMLX 5HTBA 4JRVA 4NT4A 1F3MC 4F0FA 3IDCA 4NM7A 1QPCA 3RPYA 3R7UA 3VAPA 4CFMA 5IMXA 3QWKA 4HYUA 5CU6A 2WAJA 3QRIA 3GCVA 4HNFA 2XKFA 5F1ZA 3UNJA 3C1XA 4G3GA 3IQ7A 1NA7A 5AADA 5GIPE 2WEVA 3MPMA 2V0DA 2XNPA 3Q32A 3HUBA 4TL0A 4F0GA 1OBGA 4FT0A 4O96A 5JQ5A 3MVLA 3QZGA 4XLIA 1YRPA 2XBAA 2QR8A 3FMHA 5EM8A 5CZHA 3TI1A 4QMQA 3G15A 5ANJA 1PXPA 3SQQA 5GINE 4R5YA 1GJOA 4DITA 4F6SA 4UZDA 2GS7A 3ALOA 1FQ1B 4HNIA 2ITOA 3BEGA 2VTJA 4QOXA 4BIEA 4F0IA 3ZM4A 4D2VA 5J7HA 2DYLA 3FMKA 5CZIA 3W32A 4BIDA 4IAKA 4M14A 4LOOA 4YJQA 4IZYA 4IM3A 4RWJA 4CFVA 5CU0A 4GYGA 3WF5A 5HTIA 2UUEA 2VU3A 1H1WA 4HVSA 5AP4A 3BHTA 3W55A 3C5UA 4IZ7A 4DFUA 1R0PA 3GCQA 2B9FA 4IJPA 2OXXA 3SOCA 2P2IA 2PUPA 2GTMA 1FPUA 3DNEA 3HZTA 1W83A 2E9VA 4WA9A 4TYIA 4WUAA 3DJ5A 4M8TA 3R04A 4K77A 5T3QA 4IVBA 3C0IA 4MEDA 4ANLA 5EM5A 3DTWA 4UXLA 1V0OA 5BNJA 5FQDC 5CU4A 5E8TA 3RNYA 1IA8A 3Q2MA 3I1AA 4USFA 3VHEA 3PWDA 4KIQA 5HO7A 4BDKA 3E8CA 4ZZOA 3SGCA 3E5AA 2RFNA 1UV5A 4QTCA 3NSZA 3AC8A 2RG6A 3UG2A 5GJFA 2JEDA 1M2QA 2AYPA 3R21A 2ITWA 4FZAB 2X7FA 4YJOA 2QO2A 2X7OA 3NUXA 3WILA 2Y7JA 4DEIA 2VNYA 2W4KA 3NVMB 1Z57A 3CQWA 3R8LA 3UOKA 4DTKA 5FM2A 4QQJA 2EU9A 3RAIA 2C6LA 2JKKA 3R22A 4RWKA 4G3FA 3ZLXA 4BDCA 4IHPA 1P14A 2C0TA 2R3JA 4AZFA 2ZDTA 3SX9A 3NGAA 3VW6A 1YQJA 3GXLA 1NW1A 4F1MA 3NUAA 2B9IA 4QMWA 4FTRA 5EOLA 5FGKA 3BWJA 3S95A 2QLUA 3A7JA 4KS7A 4L6QA 2OW3A 3NNVA 5DGZA 2A0CX 4OUCA 4TY1A 3K5UA 1XJDA 4BTMA 4AW5A 4YZCA 3UP7A 2PVKA 4FT7A 4ZY6A 3UOLA 3W10A 1PXJA 4Y8DA 3VRZA 5TKDA 3UNZA 1KV1A 4TYHB 2OJJA 3IGOA 2YM5A 3U54A 2BRGA 3MBLA 5IQGA 3OCSA 3FKLA 3IG7A 3KKVA 4XCUA 5CSXA 5EYKA 2QCSA 4EH7A 4IWQA 3R0TA 3KVXA 1FVVA 1UU9A 4F08A 5DPVA 3QZHA 3R01A 5HHWA 4QMZA 4L7FA 4ASXA 4RLKA 4IWDA 4TNDA 1LR4A 3DFAA 3PVWA 5M4UA 4EH4A 5I0BA 2WIPA 2X39A 3Q6UA 4GRBA 4EHGA 5E4HA 4KNBA 4CZUA 1XH7A 1ND4A 1BUHA 4JIKA 4LG4A 2NRYA 3OY3A 3R8MA 5KKRB 3FYJX 3QKMA 4ANBA 3FY2A 3E3PA 3ELJA 2WO6A 3CY3A 3RHXA 4D5KA 2KTYA 4KKEA 4XEYA 3R9HA 4ACDA 4BVUA 2WKMA 3C0GA 3GC8A 2XRUA 3BGZA 3I4BA 4PUZA 4RLLA 4YSMA 2GQSA 5K9IA 3G6GA 1WMKA 3TKIA 1IAHA 4AOIA 2XMYA 3K2LA 3OW4A 4BKJA 4G6OA 3WIGA 4GV1A 4M69B 3V3VA 4JX7A 1IR3A 4RJ5A 4ZK5A 3PY3A 3Q3BA 4PP7A 5IQCA 3FWQA 3PLAE 2XVDA 5DE2A 4QPAA 3CTHA 3MDYA 3IOKA 2J0JA 2QOFA 2R3LA 2X8IA 4GL9A 4JDKA 4G5JA 3UYTA 3PXZA 4RJ6A 4ZTNA 2E9NA 3FL5A 3FMDA 1OUKA 2F2UA 2YN8A 3OOGA 4FICA 4N0SA 4TNBA 5DT0A 3EFJA 3PRFA 4BCPA 3RPVA 1WBNA 4OT6A 5BVEA 3RK5A 2H96A 5HBHA 1OIRA 4CKIA 3ROYA 4N6YA 4EOMA 4R78A 3DLSA 1XBCA 3DCVA 1X8BA 4QP1A 2PHKA 5CWZA 3VBWA 4IE9A 3MN3A 3ZO4A 3UYSA 3Q9ZA 4D2RA 3G2FA 4FEXA 4EKLA 1RQQA 2J6MA 3TUBA 2CJMA 5CX9A 3VULA 3DBFA 4DH1A 2W17A 4IWPA 2PUNA 3P9JA 4P5QA 1Q8YA 2C30A 3DU8A 4YZMA 4C4GA 4WSYA 1CM8A 4F6WA 1YHWA 2R3NA 3OEFX 2C68A 4AA5A 4Q2AA 4U3ZA 5C8KA 3FMMA 3QRKA 3NCGA 3W33A 4AZVA 4Z9LA 5AV1A 2JGZA 4CMTA 1REJA 3KRLA 1RJBA 2C6TA 2YCQA 3HV5A 1MP8A 1B39A 5HIDA 3TG1A 3Q5ZA 5BVKA 3UBDA 3UQFA 2UW3A 3LE6A 5IKWA 1YXUA 4WSQA 4W4YA 2GS6A 3OVVA 3LOKA 3ERKA 1SNXA 3QTZA 3QU0A 3MIYA 4K1BA 4QYYA 5HVJA 4RX5A 2CKQA 4FEVA 5AR4A 4Q9SA 2I1MA 3LFFA 2XYNA 1P2AA 5AIKA 4H3PA 4LOPA 4YSJA 3LQ5A 5A4QA 1P4OA 2IVTA 3AC2A 4JJRA 5TO8A 1BI7A 2XEYA 1ZAOA 5A6NA 2J0IA 4GG7A 4IAFA 2R3HA 5HOAA 3WOWA 4CFFA 3AMAA 4K2RA 3ORPA 4PPBA 4RJ7A 4QQTA 4JQ7A 4CV9A 4ZY5A 3EWHA 3QQFA 4FZ6A 4L42A 5HTCA 3TTJA 4L01A 2W5AA 1URCA 2UZVA 1SMHA 4R3PA 1Q8TA 4BTFA 4Y95A 3V04A 1R1WA 3CPCA 4E4XA 4J98A 4OT5A 4WRSA 4FV2A 4OAUC 2WOUA 4IAZA 3ZC5A 4YR8A 2JDTA 2JDOA 3R63A 2JFMA 4ZXTA 2QU5A 5K0KA 3TDVA 5KMOA 3MB7A 4QNAA 3IDBA 3W18A 1WZYA 1ZMWA 5B2LA 4KKGA 3EFLA 4O0XA 3V5TA 1OL7A 5KX8A 3ZONA 1PY5A 2IZUA 3MVJA 2WTWA 3BLQA 5LWNA 2CN5A 1S9IA 2BHEA 2VNWA 4KIPA 5A46A 1GY3A 3NCZA 4NL0A 3C4WA 2H34A 4C4HA 2CGUA 4FV9A 4ONAA 5C27A 1J1CA 1PMNA 3C51A 5M57A 1Y8GA 3PIXA 2EXCX 3FC1X 3S0OA 2QOCA 3Q2JA 5IQBA 4RA4A 4E93A 3WE8A 3AD5A 4BDIA 3MFRA 5HVYA 4F4PA 4MNEA 1ZMUA 1L8TA 2W1EA 2HK5A 4JG6A 3Q04A 5L6PA 2C47A 3BV2A 5E90A 3N4UA 3Q96A 4RIOA 2C3JA 5JFVA 2C5XA 2YHVA 4YPDA 4YP8A 4F9WA 5C8NA 1Q24A 4IAYA 3V5WA 5J9LA 4CLIA 3DDQA 2R3QA 4E4NA 1ZOEA 3PLSA 2VZ6A 3QTRA 4QP7A 5E8YA 4BYIA 4X2KA 2EB3A 4UMTA 4Z7GA 2PE1A 2Y9QA 3BYOA 2V7OA 2ZAZA 3D7TB 4ZTMA 2VO6A 2FSOX 2ZVAA 2YIYA 3CTQA 5M07A 5DLSA 4QMXA 4FL2A 4IX4A 5IMEA 3FMEA 3FZOA 3F6XA 3RGFA 3UTOA 4GUEA 3SA0A 4EK5A 5AV2A 5JFXA 3VUTA 4FIEA 3QFVA 5A6OA 3ZLWA 4MVFA 2VO7A 2R5TA 3R7YA 1H0VA 2PK9A 2A4LA 3PWYA 1UNLA 2ZM1A 3NNWA 2DS1A 2IO6A 2Z7RA 3PFQA 4A07A 3NUSA 5FD2A 3R7GA 4BGGA 4YJSA 3ORNA 2JDSA 3I7CA 5AV3A 3RINA 3UPXA 4LYNA 3ZTXA 2ITYA 3VJOA 3AOXA 2PU8A 1YXSA 2YZLA 3ANRA 3B8QA 5CEIA 3G0EA 1WBVA 3ZO2A 4XUFA 5HD4A 4FUXA 3R1QA 3NUYA 2W1DA 4QTEA 5CSPA 4YGAA 4TWPA 3PA3A 1ZOHA 4O0SA 4U45A 3QUEA 2RGPA 1VYWA 3FPQA 3CBLA 4FVRA 1BI8A 2WMXA 2X8DA 4IFGA 2X81A 3ATSA 4J97A 2BR1A 3LLTA 5KCVA 3F3WA 2GFSA 5TOZA 3PVBA 4UMPA 1PXIA 3G6HA 5FWKK 2WQMA 2NO3A 4AZWA 3LLAA 3VJNA 4FSMA 3TEIA 3EQIA 3KXHA 3QCXA 4NJDA 4QPSA 4FKPA 2CPKE 4FMQA 3GEQA 4L3PA 4ASEA 4BGQA 3GGFA 1WVWA 1Z5MA 3LXPA 3VRYA 3W2QA 5A14A 5HX8A 4QP2A 4I0TA 3EN9A 2PSQA 4J8NA 3ZS5A 1XR1A 3IW4A 4C59A 4FYNA 4BI1A 5EYCA 3GOKA 2VO3A 4RJ4A 4XMOA 2YAAA 4CXAA 4O81A 4ACCA 1ZY5A 4WG3A 4BBEA 1E1VA 3G0FA 4FR4A 4MXCA 2O64A 5EW9A 5JGBA 5LMBA 1OUYA 3P79A 3ORTA 2Z02A 2VWIA 3BBTB 3GT8A 2WQBA 4FKRA 4RVKA 3NZ0A 4M0ZA 3H9RA 5CVHA 4YU2A 4X2GA 4RX8A 5CXZA 2PMNX 4FKSA 3QTXA 4IM0A 5HBJA 3K54A 2CDZA 2UW5A 3OT8A 3CY2A 4I6HA 1Q61A 2UW8A 3DBDA 4ZS0A 5GJGA 3ZH8A 4HVGA 4H36A 3F3TA 5CI6A 5M56A 1J91A 4WNOA 4O82A 1WAKA 3FZRA 4QP4A 4WHZA 5I9VA 3L9LA 3OS3A 4MBIA 5DHJA 5FP6A 5T68A 3OWJA 5BVNA 1I44A 5C9CA 1MRUA 4FT9A 4G3CA 1WVXA 2YJSA 5JRSA 4DEAA 2QO7A 3LHJA 5KMJA 1DM2A 4GS6A 2BAJA 5EDRA 2UW4A 3ZFXA 3DAJA 4YTFA 3SOAA 4XOZA 4YO4A 4J8MA 4DCAA 5HU9A 4HGSA 3R73A 3WF6A 3FLYA 4I5MA 4LL0A 3RNIA 2Y8OA 4XV2A 3LFNA 4ANNA 3BIZA 3GU7A 2QC6A 4D9UA 1IRKA 5JMSA 4M84A 2BALA 2XK8A 2QQ7A 3ZEWA 4C35A 2HOGA 5BUJA 4QPMA 3KULA 4XNEA 4YZBA 3A99A 5HNBA 4XRJA 2W1CA 4KSQA 3TJDA 2CGVA 3RAHA 2UZDA 2FA2A 3O8UA 2XK4A 3A7FA 4NTTA 3U6JA 4V04A 3ENHA 3W16A 3E87A 5LVPA 2ACXA 1U54B 4EOIA 4EQUA 3UE4A 2PL0A 3L8VA 2W4OA 4BDDA 5GZ9A 3M1SA 3CP9A 4A4XA 2J0KA 5AP0A 3EMGA 1J7UA 4TYEA 5EG3A 2AUHA 2W1ZA 2VTAA 5AAEA 4GU6A 1ZXEA 4NFNA 4D2WA 2OJIA 3DJ7A 4EQMA 4E4MA 3KK8A 3OUNB 3MY5A 2C0IA 1GZNA 2R0UA 3PIZA 5IA2A 1DI8A 2Z7LA 5KZIA 1U5RA 3CKXA 1KV2A 1SZMA 5EM7A 4FI1A 5M44A 3LXNA 3DXPA 4ACMA 3IS5A 3HV3A 4CEGA 5I9YA 2B9HA 4Q9ZA 4Z16A 2O2UA 4MXOA 3QCSA 2BAKA 3FZTA 3DS6A 3R9OA 4GW8A 3NS9A 4M12A 2BTRA 4YHFA 2X1NA 4DYMA 2WTVA 3REPA 3VS2A 5M06A 2ITVA 3CIKA 3QYWA 4FVQA 2GNJA 2Z2WA 4C57A 5JSMA 1BLXA 3KN6A 2W9FB 2XUUA 2XJ0A 3DQXA 3WZKA 5K0XA 3NX8A 3VS3A 5BPYA 2ZM4A 2XA4A 2PVMA 4JVGA 5IU2A 1Y6AA 4RJ3A 3SAYA 3FSFA 5BUEA 1UA2A 2C3IB 4YC3A 5L2IA 5EYDA 1BMKA 2OH4A 3FMLA 3OY1A 3QYZA 1JSTA 3R8PA 5CAVA 1LUFA 4RIXA 1STCE 5IH5A 4Q5HA 4NIFA 2C69A 3RWQA 3ITZA 3FXXA 4ZSGA 4DT9A 2ONLA 4DFXE 2OG8A 2RG5A 4GIIA 2XCKA 2HWPA 2O3PA 4FSTA 3FI3A 4RWIA 3UOHA 4D1ZA 4S32A 4ARKA 1AQ1A 2IVSA 5DBXA 3OW3A 5EHLA 3R1SA 3QQKA 4M7IA 4JG7A 2VWUA 3BV3A 3ACKA 3NW5A 4FF8A 4GSBA 5E1SA 3FHIA 3EH9A 4DH5A 4O0RA 3KF7A 4ERWA 1LEZA 1W82A 3TUDA 4WRGA 3KF4A 4HVIA 5CVGA 4FOCA 3PG1A 4F9YA 4ZLZA 3M11A 5CENA 2C5OA 5HBEA 4DBXA 4G16A 1UKHA 2Z7QA 4Y5QA 5EW8A 3R7VA 3MV5A 3VIDA 4S31A 2JKOA 3TWJA 3VC4A 3BU6A 4I24A 4G34A 4DBNA 3OT3A 5AR2A 3HAMA 2XB7A 4PTCA 4DN5A 1NT2A 3KXZA 1W8CA 4FSNA 4AQCA 4U97A 3P78A 4C38A 2QKRA 3LCKA 3MB6A 5CAQA 5AUTA 2JKQA 3Q60A 2XF0A 5HE2A 3SDJA 4D58A 4RIWA 3JS2A 4U44A 5HG7A 5L2SA 2YDJA 4EK3A 1JNKA 4CFNA 2FB8A 4YLLA 4ZMEA 3RKBA 4QMUA 4RIYB 5AV4A 4BRXA 4FEWA 4K9YA 2JAVA 4FTUA 4FNYA 4FV0A 5M4CA 3T3UA 3FKOA 4QD6A 1H24A 4DFZE 3PG3A 3RHKA 2C3LA 3GOPA 1PYXA 4FKUA 2R3PA 3RP9A 4E5WA 2YWVA 1B6CB 1W98A 2I0HA 5KBRA 1J3HA 4UY9A 4XJ0A 5FLFA 5HE1A 5J87A 1DAYA 4BGHA 2R3FA 2NNWB 4W4WA 2GHMA 5IH6A 5ETAA 3BYUA 4IX5A 3C4EA 3DZOA 3LFQA 4GMYA 4BDGA 4MYGA 5AM6A 3KREA 4O22A 3AG9A 5LQFA 3DB8A 2XIXA 2HAKA 3QQUA 4TW9A 4W9XA 4QO9A 5AAFA 2C1AA 4X3FA 1CKIA 4R77A 2OZAA 4J52A 4CQGA 3FLNC 3OXTA 4FKOA 4K11A 3UVRA 3V6SA 1GZOA 5JFSA 3GB2A 2P3GX 3L8SA 5FDXA 4O38A 4ZSJA 5L8KA 3FI4A 3ORLA 4F1OA 3MTFA 4V0GB 4O7VA 3ULIA 2FSLX 4D4VA
chains in the Genus database with same CATH superfamily
1CDKA 4F1TA 5J5SA 2JDVA 4JS8A 3PVGA 5JZNA 2I0VA 4Y83A 5L3AA 4AT5A 3DFCB 3EL7A 4QP9A 5AUYA 4A4OA 2GQRA 3JXWA 5ANGA 4U41A 1UU8A 3R6XA 5AUUA 2FO0A 1R0EA 3VVHA 1KSWA 2CN8A 4EZ5A 2PE0A 3DBCA 1Q5KA 1OECA 4YTIA 3S3IA 3HMIA 4OW8A 5FTQA 2HYYA 5CU2A 5FEDA 4BCQA 2C6DA 3AC3A 2PVLA 4FTMA 4L7SA 4ZOGA 5IH4A 2OXYA 4LI5A 4JLCA 4J99A 4A9SA 1Y6BA 4JT3A 4ZAUA 3BQCA 3UO4A 5K4IA 3N9XA 4WO5A 1H28A 4O1PA 3O7LB 4C37A 4UN0C 4M15A 4AXEA 3CKWA 2WXVA 4FOBA 3NNUA 4MH7A 2XKDA 4YJUA 4AW0A 4EZ3A 5IUHA 3DK6A 5DWRA 5AX3A 1H4LA 5H8BA 4F7JA 2FYSA 4K8AA 2X0GA 1SYKA 5HO6A 1PXNA 2ITQA 2VX0A 1PKDA 1YKRA 3PXQA 4IAAA 4IFCA 2OZOA 4IACA 1WBPA 5G1XA 2UZUE 4KSPA 3HLLA 3QTSA 1TQPA 2WMSA 3UPZA 2HW6A 1Q8UA 3ET7A 1SVEA 3O8PA 4HZRA 3C4CA 2X2MA 4EK4A 5IPJA 3P7BA 1E9HA 4BN1A 4E26A 3M42A 4EORA 4J95A 4YHTA 1Q4LA 4W8EA 4F70A 2VGPA 3DKGA 4I5CA 4U7ZA 3ZC6A 1OVEA 2XNBA 4FEUA 3F2NA 2W1FA 2P55A 4YJPA 2Y4IC 4RGJA 4YJVA 3F61A 4IEBA 3A4OX 4PL4A 2GNFA 4MF1A 4NW6A 4O7WA 5AFVA 3PIYA 3HVCA 4O0VA 2RIOA 4RVMA 4CLJA 3THBA 2VWXA 4WD5A 3OF0A 4GVAA 1MRVA 3H3CA 5B0XA 4FKLA 5J95A 4GKHA 4AOTA 4AN3A 4JAJA 3MIAA 5LVNA 3JYAA 4I23A 4L43A 4PMMA 2XARA 5B2KA 3TV4A 3QQGA 4B8MA 3D15A 1XH8A 3HGKA 4CMOA 1M2PA 3S2PA 4E73A 4FZFB 3VS5A 3UZTA 3ZSHA 4G5PA 2OO8X 4H1MA 5GHVA 3QL8A 5EHOA 4BDBA 4X7QA 2YCFA 2R7IA 5L2QA 2OICA 2WMAA 3OCTA 4W9WA 3AXWA 3MVMA 3NUNA 3QTWA 1RE8A 4OTIA 4YNEA 1TQIA 2PVHA 4KBAA 5D11A 4G2FA 3ZDUA 5EKOA 3ZXZA 2H6DA 3OHTA 3TZ8A 4CGAA 2VWBA 2XIZA 3OWLA 4F63A 4BCHA 2F7ZE 4P90A 3PPKA 3BHHA 3EJ1A 4KIKB 1ZLTA 2IW6A 2PULA 4QMYA 2WIHA 4PPAA 2VO0A 2BIKB 4I1ZA 4AT3A 4DCEA 4NJ3A 3EQBA 4JBVA 3A7IA 4FV5A 1HOWA 4YBKA 4IW0A 3ZO1A 5D1JA 2E9OA 3NW7A 5FXQA 3E3BX 5EM6A 4JQ8A 4OTHA 1NVRA 1Q8WA 3IW6A 5AP6A 2AQXA 3EZVA 4O6EA 4TT7A 4FSUA 3POOA 4AN9A 3EZRA 3KRRA 5JQ8A 3U87A 5JT2A 2HZ4A 2HWOA 2ONLC 2LAVA 2YLEA 1JQHA 3RM6A 3DKOA 4PRJA 2UV2A 3QTIA 1O6YA 1Q3DA 3JVSA 2OJ9A 3PPZA 5DEWA 4HYIA 3ZDIA 1H26A 4AW1A 2FUMA 1H00A 2C0OA 3BE2A 5KMNA 1YDRE 4UMRA 5IDNA 4KUJA 4NK9A 3BL9A 3PUPA 4AUAA 4BDEA 2XM8A 5JKGA 3T9TA 4WKQA 3W0QA 5GZ8A 4DLIA 4Z7HA 5EQPA 3KB7A 4NCTA 5G6VA 4KRCA 3HRCA 5HIEA 4YZNA 4ZMFA 4CYJA 4ZJJA 4QNYA 2ZV9A 5CNNA 2X4ZA 4O4DA 4JI9A 3SLSA 3PSDA 5JZJA 4MCVA 4DEHA 4RC2A 4EI4A 2OH0E 3LXKA 3UDTA 2AC5A 4FV7A 4BDAA 1CTPE 1VYZA 3H9FA 4GH2A 4AOJA 4PX6A 4QYGA 4EL9A 4QDVA 5HCZA 4B9DA 4Q5EA 1T46A 3D7ZA 4LGGA 2DUVA 1Y8YA 3ORXA 4UYNA 4RFMA 4CFXA 4KABA 5CAUA 2OIBA 4NSTA 1PYEA 3SRVA 2UZBA 4D2TA 3UOJA 3R9RA 3G9LX 4UBAA 5EH0A 4D2PA 5JK3A 1QPDA 1ZWSA 2IWIA 4EBWA 5GJDA 4HGLA 5TR6A 3SD0A 3BELA 3N4TA 2OU7A 1WBSA 4MTAA 4Y5HA 3E8EA 5DI1A 4BB4A 2J0LA 3D2KA 4LL5A 3ATTA 4R3CA 3CGFA 5AR5A 3W8QA 3ZU7A 2F9GA 3SXFA 3QZIA 5HORA 4PDYA 3AMYA 3Q6WA 2RKUA 2VRXA 1M14A 5M53A 2UZTA 3OZ6A 4KRDA 4RX9A 4CZYB 4GT3A 4G31A 3FV8A 1OIQA 3HX4A 4CQEA 4ZTSA 3PXYA 3QTQA 4AQKA 2G2IA 1YI3A 1KE7A 4X3FC 4PNKA 3DDPA 2ETKA 3VONA 3UIUA 4L52A 1XMMA 2PZYA 3Q4ZA 4MQ2A 1YXTA 4AZSA 3HAVA 4AT4A 3OOMA 4O7SA 3ENMA 5ITAA 2BUJA 3AQVA 3NYXA 3O96A 1NVSA 5FRIA 4GK2A 4FIHA 4YBJA 3MWUA 5A4CA 3GVUA 3TT0A 1V0BA 2YM3A 5CF6A 4WBBB 3BGQA 5TE0A 4XP2A 4OBOA 4WNMA 2UW0A 1FMKA 3EQDA 3FZPA 3QC4A 5LARA 2VTSA 3MJ1A 3MFTA 2CCIA 2OBJA 3KVWA 1YXVA 5CSVA 2REIA 4D5HA 3L1SA 4XP0A 4FC0A 3AKKA 4LV7A 2JLDA 3RPOA 2R3KA 2BRBA 2XM9A 4RVLA 3V8WA 4ANSA 3I5ZA 4XLVA 3WIKA 5JGAA 5J1VA 3LM0A 3NFFB 4G1WA 2Q0BA 4NTSA 5CS6A 5BX0A 5JRQA 5CYIA 3GFWA 4FTIA 3PJ1A 4FNZA 3LJ2A 1M52A 1WFCA 3E7VA 3FI2A 4ZSAA 3CQEA 1PXMA 3G90X 2XANA 4WG5A 1PHKA 3WF7A 3O2MA 4L68A 3ORKA 2F7EE 3LVPA 2B54A 4RQVA 4MNEB 5B7VA 4TYHA 3GU8A 3WYXA 4A9YA 3PXFA 4A7CA 4CCUA 4DTBA 3VBVA 2VGOA 2ERKA 5HCYA 1UU7A 2W1HA 2QI8A 2G2FA 4GCJA 2Y4PA 3TXOA 5LOHA 4R7IA 5ANOA 4CKJA 2IN6A 4TZRA 4S30A 4FZDB 3ZRLA 4BYJA 3JUHA 4E6CA 4NEUA 4FTLA 4CTBA 4CVAA 4G6LA 2B53A 2JKMA 4PV0A 3DK3A 4I4FA 3FZ1A 5E8UA 3E62A 2Z7SA 1TKIA 3F82A 2OSCA 5CU3A 4A4LA 5CTPA 4U80A 3EQHA 4EJNA 3E7OA 4DGMA 1WBWA 5E7RA 3FZSA 4MBLA 1ZYCA 2CMWA 4EOLA 1G8AA 1B38A 5C1QB 5I4NA 4QMPA 2QHNA 4FIIA 2XKCA 4E6AA 3MESA 2F7XE 3BYVA 3TL8A 4EOJA 3CSVA 3COHA 1CKPA 4A06A 4L46A 4AXDA 4OLIA 3KRXA 3MFUA 3QRTA 5KUPA 3F3VA 4I6QA 4UMQA 4XHKB 3QD4A 5LCJA 2EWAA 2R3IA 3Q4CA 4EK6A 2IZSA 4M69A 2A27A 4DEEA 5BQ0A 3DQWA 4BCJA 5CANA 4AXCA 4JBOA 4DLJA 2G9XA 4PPCA 5F95A 4GT5A 4G9RA 2AC3A 3FQHA 1OBDA 5AA8A 4JIAA 3LXLA 3EKNA 2BROA 3ORZA 1ZOGA 4BZOA 4I22A 5K4JA 2P4IA 1V1KA 4PL5A 5K5XA 3NFGB 2WD1A 3OXIA 5AIRA 5A3XA 3U55A 2W05A 3PE1A 3Q5IA 3UG1A 4EEVA 4J71A 1FGKA 2F57A 4KBCA 5AUWA 4F6UA 1IAJA 4XG2A 3ACJA 1MUOA 4I93A 4A9UA 4GYIA 3OWPA 3DA6A 3EL8A 4APCA 4QP6A 3GENA 3DY7A 4G9CA 1Q62A 3R7EA 3V5LA 1JWHA 3LMGA 3QQHA 4S2ZA 2HXQA 3VN9A 5H3QA 5FXSA 3VWAA 3WI6A 3TKHA 5CF8A 3LCTA 3W0NA 4AN2A 5DN3A 4FTJA 3F5PA 4IJ9A 5EQYA 4OTQA 3PJ3A 3A62A 4GIHA 2DQ7X 4HVDA 4AE6A 4BWKA 2YJRA 3D5XA 3BHVA 1VZOA 3TIYA 4PY1A 5D9HA 3WZDA 2C5YA 4IM2A 2QOIA 3MFSA 5A4LA 2VX1A 3VO3A 4U43A 4DG2E 3ZCLA 5IA4A 2O63A 4KA3A 4PTGA 3AKJA 4CG8A 4O7RA 3MGYA 3MY0A 1J1BA 4QP3A 4E20A 3TZ9A 4NUSA 5CF5A 5ANDA 3KY2A 2O5KA 2ESMA 4C3PA 4EH2A 2W99B 1TFFA 1FVTA 3TM0A 1F0QA 4OGRA 3JY9A 3KQ7A 3FE3A 3QX4A 4FIJA 4FKIA 5CQWA 5CT7A 3IECA 4BCNA 3OEZA 1OITA 4MUQA 2IVVA 4GFMA 1W2FA 3MSSA 4XG3A 1JBPE 3CXWA 3FUPA 1M7QA 3PA5A 4NCTC 1KE8A 4L00A 3KCKA 4D4SA 2H8HA 3O17A 2J50A 1OKVA 3I0OA 2ZMCA 4FT3A 2NP8A 4IX3A 5ETIA 1VEBA 4QMLA 3CJFA 4B8LA 3A7GA 4YLJA 1OPJA 4D9TA 5AWMA 3GFEA 3IW7A 1GZKA 4DGNA 2JITA 1UNGA 3EQFA 2C3KA 5DMZA 3PZHA 3A8XA 3OG7A 4TRLA 3P4KA 2QNJA 5E8XA 4AFJA 3NAXA 2HZIA 2CGXA 4UALA 4G3EA 4IX6A 1GNGA 5L4QA 5FP5A 3NVKI 1Q97A 1T45A 3VUDA 3TTIA 4LV8A 4C34A 5GZAA 4FTNA 4CT2A 3AT3A 5HNIX 5C8MA 2B9JA 3JVRA 4U79A 4AP7A 3BQRA 3CC6A 3UO6A 1OL5A 4X2NA 5FDPA 3JR1A 5ANKA 3F5XA 4L3LA 4EYMA 5I9WA 5AJQA 5AR7A 5IQAA 4BI2A 4S33A 5IDPA 1APME 4JQEA 3T3VA 4HYSA 4C58A 4QTDA 4HCTA 3PA4A 2GQGA 4HW7A 3D2IA 1OMWA 3G5DA 4OBPA 5FBNC 3PDTA 3TNHA 2OKRA 3A4PA 2QLQA 4O0UA 4PMSA 4IDTA 5E9EA 1UWJA 2XZSA 5J79A 2VX3A 2C5NA 3QBNA 3AGMA 3II5A 4N4SA 5DIAA 3EHAA 3UMWA 3QQLA 4BZDA 3MTLA 5D10A 4V01A 5HVKA 4GT4A 1M17A 2C6IA 3KFAA 1OL6A 3KC3A 3LFAA 5E92A 5HESA 4EHZA 3ZBFA 4MAOA 3IKAA 3AT4A 4BY9E 3QZFA 3SHEA 3E8NA 4ITHA 4JBPA 3KXMA 5F4NA 5CVFA 2WPAA 4RC3A 4NYEA 1JPAA 1L3RE 1DAWA 5AA9A 2XNNA 2XRWA 4NKAA 4FKVA 4U6RA 3MYGA 4FTKA 1YI6A 4QMTA 4YO6A 3TNQB 4FX3A 4OTGA 3VUHA 3C50A 3TNIA 5AM7A 3B2TA 3I5NA 5E1EA 3A60A 3SXSA 2X7GA 3PFYA 4UX9A 3ANQA 3DAEA 1PXKA 4H58A 3VHKA 2CKEA 2FH9A 3I79A 1JVPP 4C02A 5HI2A 2OFUA 3DK7A 2WU7A 3KMMA 2BRHA 4NIFB 4FJVA 1AGWA 3QAME 2WEIA 2BILB 1G3NA 4E5BA 5IZFA 3DJ6A 4BCOA 1IG1A 3NNXA 4FTQA 3Q4TA 5L2WA 5EQEA 4XG6A 3V01A 2QONA 2EB2A 3ZRMA 3P7CA 2WGJA 4D2SA 3QCYA 3KL8A 3FBVA 2H9VA 3KXNA 4X0MA 3QRJA 3LAUA 3VBQA 3TZ7A 4B0GA 3F88A 3T8OA 3PUFC 4C0TA 1JSUA 1GZ8A 3ORMA 4O27B 4EH3A 2B4SB 2A1AB 2YM7A 4JR7A 4ANQA 5AUVA 5IQFA 5HKMA 3KXGA 4DEBA 4OBQA 2X2KA 4BKZA 3QUDA 1ZYLA 4APPA 2IZRA 3ZUUA 3IK3A 2BFYA 4EWQA 4DT8A 3NYVA 4ZIMA 5IUGA 3SV0A 4D0WA 5AUZA 3HECA 4FKWA 3CR0A 3UVPA 3FDNA 4LQMA 3L9PA 4XBUA 2PVRA 2ETMA 4PMTA 3E92A 3H30A 3FKNA 2X4FA 4MXXA 4U9AA 4F09A 4MWIA 3GCPA 4D1XA 2OWBA 3DZQA 4FG9A 2PWLA 2WTKC 1OPLA 2WOTA 3FLZA 3E93A 4IB5A 3Q52A 4C7TA 5A9UA 1YWVA 4FTOA 3QWJA 3OMVA 3VQHA 4IQ6A 4DH7A 4DH8A 2V55A 4IB3A 2OLCA 2QOKA 2RF9A 4ZTRA 3RI1A 4ZSLA 2JD5A 5BYZA 2UVXA 3FEGA 1VJYA 1H27A 3DKCA 2V62A 1PMEA 4JDJA 4QMMA 4RX7A 5J8IA 3U9NA 3C4FA 1Y57A 3COKA 3O23A 3VUMA 4O7TA 4AA4A 3R8ZA 1XBAA 5L6WL 3BGPA 5I9UA 4EJ7A 1UWHA 2QODA 3O7LD 3QGWA 1H07A 3EIDA 4I94A 5HIBA 5IA5A 1KOAA 3W8LA 5EDQA 3BKBA 1ZYJA 3ETAA 2WMTA 4IZAA 4Y46A 4USEA 1FINA 3D14A 3MW1A 2YIWA 2WQNA 3ZXTA 3FQEA 1OGUA 3CD3A 4I0RA 1OKWA 4AX8A 5IG1A 2OZAB 1UU3A 2WMWA 1SVHA 5I5ZA 3RZFA 2VN9A 5DRBA 5AP5A 2I0EA 2XH5A 5AP3A 3UC3A 2ITUA 4WNKA 4I6FA 4M67A 1QMZA 4CZTA 4O86A 5M4IA 4HGTA 2R0IA 2JBPA 2XKEA 4JNWA 2OIDA 1F5QA 3CD8A 4G17A 4K18A 4TYJA 2IW8A 3QKLA 5H2UA 4CFWA 2XAOA 3EN7A 4AA0A 4BIBA 4GJ2A 2QOHA 1RW8A 1H01A 3HKOA 4AF3A 3R7IA 5J5TA 4DA5A 4OAVB 4F9BA 4B7TA 4CFUA 1BKXA 3KU2A 3PSBA 4BR3A 3I7BA 4RWLA 1PRYA 3RALA 3FXWA 2PZPA 1R3CA 3Q9WA 4LMUA 5E8VA 3HMPA 2VAGA 4C4JA 3UDZA 3GU5A 3RPSA 3G51A 4O2PA 1SNUA 2PE2A 2WQOA 2X6EA 2ZB0A 3OTUA 5EI2A 1U54A 3Q9XA 4FODA 4IADA 1A48A 1URWA 4LFIA 1YI4A 3PP1A 5DR9A 4O7NA 4O4EA 4AACA 5BVFA 3FXZA 2XYUA 3GC7A 3WF8A 4EH9A 3BL7A 2ZV8A 5HG8A 4I5HA 4BCMA 1LP4A 3QA0A 4B4LA 4DFLA 3F5GA 4FG7A 5C26A 4QMVA 2WTJA 3PXRA 5IF1A 3A2CA 5ETFA 1YOMA 4ZJVA 3NDMA 2YCSA 4J1RA 3TN8A 1BYGA 2NRUA 2UZLA 2Z60A 4MBJA 1LPUA 5BVWA 3GCSA 2X9EA 4OR5A 3HA8A 3QXPA 4O0YA 2VTOA 2ZB1A 4ITJA 1ERKA 1ZZLA 3R71A 4OTDA 4JBQA 2YDKA 3EYGA 1XH4A 2PZIA 3ZRKA 4FV8A 5HE3A 4BICA 4QYHA 5FG8A 2ITZA 4KINA 4DFNA 5LVMA 2BKKA 5CSHA 3OWKA 1KWPA 2BTSA 3V5QA 4UV0A 3NPCA 4WT6A 2YIRA 1UNHA 2BMCA 3U9CA 3KMUA 2G01A 4AZEA 4OTWA 5DVRA 2XIRA 3O71A 1K9AA 1UKIA 3NIZA 5DRDA 4WNPA 4EH6A 4ID7A 2YM8A 4LDTA 3WZUA 4DGOA 1WVYA 5HGIA 3WZEA 2OJGA 4S34A 1XQZA 5HZNA 1G5SA 3DLZA 1PW2A 4YJRA 3CJGA 1K3AA 4XYFA 1XO2B 2J5EA 3DXQA 5HEZA 3W2OA 5H8EA 1FOTA 1VLRA 4FKTA 4HPTE 2UZEA 3E8DA 1HCKA 4ACHA 2WU6A 1FBNA 3GI3A 4USDA 3QTUA 3U6IA 2VTLA 3SW7A 4AGUA 2R3GA 3M2WA 3I0QA 4D0XA 2BIYA 4O4CA 5IEVA 4KAOA 3TKUA 1ZY4A 3R8VA 2PZRA 2WTCA 5BV3A 2QVSE 2B0QA 4NKSA 3FL4A 2BAQA 3AKLA 1BL7A 2J2IB 3PVUA 4FZ7A 4FRFA 1JKTA 4JR3A 3O51A 4Z55A 3BLHA 2VTTA 5JEBA 2UZOA 3UNKA 4GK4A 2Y6MA 1H25A 2BPMA 2C6EA 4E7WA 4HVHA 4YZ9A 3QC9A 4QQ5A 3DAKA 3H0ZA 3TCPA 5EK7A 3R9NA 4CCBA 3DPKA 4LV5A 3PJ8A 4HJOA 5T6KA 5K5NA 2CKOA 4ZTQA 4QYEA 4JDHA 1V0PA 2J51A 5HG9A 4BI0A 3LW0A 4QMNA 2HZNA 1YHVA 2BZHB 2XK7A 5ETCA 4I3ZA 3VUIA 3GNIB 2JFLA 4YZDA 3CGOA 2VTRA 2YFXA 3VF9A 2JAMA 4O21A 4YJTA 1J7IA 2BRNA 1ZMVA 1JAMA 1G8SA 3DKFA 3PJ2A 3DXNA 1HCLA 2V7AA 4R7HA 2CGWA 3H0YA 4EOPA 3KEXA 3MI9A 2IF8A 4J7BA 4RIYA 3S1HA 2F4JA 3L8XA 3W2RA 2W1GA 3ZHPC 4C33A 4GU9A 3WZJA 4A9RA 4XH6A 3BEAA 2BZJA 3LQ8A 3PJCA 2QOBA 1W84A 3QD3A 3HNGA 3AD6A 5LVLA 2BFXA 3IPHA 4O4FA 3ZM9A 3F5UA 2UW7A 4QYFA 1KUTA 3FI8A 3UGCA 3FLWA 4O91A 4ZZMA 3FQSA 5ANIA 3BHUA 1JKSA 3BHYA 4EH5A 4F65A 4BTKA 3VW8A 5EKNA 3R28A 4FV6A 3UZPA 4PNIA 3KN5A 3FYKX 5HLPA 1I09A 3U6HA 3EFWA 4F9CA 3QX2A 4J96A 5TT7A 4O0WA 4BZNA 3VS0A 2R4BA 2VWZA 2V22A 1H1SA 2CHLA 3ZUTA 1Q8ZA 4I6BA 4F7NA 2XS0A 4DEDA 5H8GA 3O8TA 3TV6A 3V8SA 3OBGA 4DFYA 4TTHB 4XP3A 3IDPA 3EN4A 4JMQA 4R7BA 1GIJA 4RFYA 1W2CA 3AMBA 3TIZA 3F69A 3MS9A 2VWVA 4PDOA 4XG9A 3RAKA 4M13A 3SG8A 4DTAA 2JBOA 3P0MA 2UW9A 4IXPA 3HYHA 3DOGA 3IOPA 4PDSA 2RSVA 1QPEA 4X6QC 3RVGA 3TZMA 4V0GA 4EUTA 3EQCA 4RMZA 3VNTA 5IQEA 1ZARA 4H3BA 4RRVA 2XP2A 3CQUA 1PXOA 3HV7A 3SRVB 4O84A 1WBOA 2C6MA 3UIBA 4ALVA 1YOJA 1ZRZA 2XNEA 2OIQA 1EH4A 4RPVA 2B7AA 2PYWA 4QP8A 4EHEA 4NM3A 3BX5A 4YC6A 3EFKA 3R2YA 5EOBA 3COMA 3U4WA 4FV1A 3RTPA 2WMRA 3BWFA 4FK6A 3D0EA 5IQIA 4IH8A 2QU6A 3HV4A 2P33A 4XX9A 4IWOA 4IDVA 3ZO3A 4J53A 4UWYA 3NUPA 2W4JA 2PVFA 4QQCA 5KZ0A 3D5VA 3GCUA 3LFEA 4EWHA 3TDWA 3OXZA 3EKKA 5HE0A 2WMVA 3NYNA 2VWWA 4AU8A 4YHJA 4IB0A 2ETRA 3PPJA 3D4QA 3D9VA 3EQRA 1GIHA 3LJ0A 5FXRA 3QUPA 3ZFMA 5BMMA 4DE4A 4DG3E 4IIRA 5ACKA 3KK9A 4JXFA 3D5UA 4LRMA 4ZLYA 2J4ZA 2QG7A 2OK1A 3UQGA 2YEXA 3ROCA 4BCIA 5BVOA 4YUQA 1MRYA 4O7YA 2VWYA 4WBOA 3MA3A 2J9MA 3B2WA 3V5JA 4ZZNA 4PWNA 2XIKA 4K33A 5J7BA 2EXEA 3U4UA 3GQIA 4YC8A 3NAYA 5C01A 3RM7A 4ANOA 3P86A 1AD5A 2FSTX 2GU8A 5J1WA 3LCSA 5AR8A 4P7EA 4G3DA 4BBFA 1IEPA 4FV3A 4HGEA 3KGAA 5IEXA 1OM1A 4JL9A 1GAGA 3QD2B 4IBMA 4XS2A 4ALWA 4BJJA 4JG8A 4XG8A 4F7LA 3L9NA 2RFDA 3UP2A 1YVJA 1Q41A 4U42A 3Q53A 4UEUA 5AR3A 4Z3VA 4U3YA 2C4GA 1JKKA 4CMUA 3EN5A 1H1PA 4ZJIA 3TMOA 4FUYA 3OCGA 5FEEA 1YW2A 4LM5A 2Q83A 2VTQA 1REKA 4LRJA 4ZS4A 3FY0A 3LFBA 4ITIA 2WHBA 4L67A 1O6LA 3UIXA 3ODYX 4BCKA 5JGDA 3TV7A 5CF4A 3ZOSA 5E8ZA 2GDOA 2CNQA 4MD7E 3W0MA 1KOBA 5CEQA 3CCNA 2QOQA 3AD4A 2E9UA 1RDQE 3NW6A 2WB8A 4N57A 3I6WA 4CRSA 5LMKA 3W1FA 1JSVA 2OFVA 2HY81 3PP0A 3U8WA 5KNJA 1LEWA 4QMOA 3S00A 4LGHA 2ZJWA 2VUWA 4O6LA 4RT7A 4X21A 1NY3A 4XG7A 5CT0A 4H39A 2VTNA 2GNLA 5DNRA 3RPRA 3V6RA 4DG0E 4GG5A 3DGKA 3F7WA 2BZKB 4PDPA 4O7LA 4FSZA 4KIKA 3SG9A 3BI6A 5KMIA 3AC5A 1FMOE 4FTTA 2IJMA 4O7ZA 4OTPA 5DR6A 2X8EA 4I0SA 5EI6A 5CQUA 5CSWA 2EVAA 4FNWA 4G6NA 5AV0A 1YDSE 4BTJA 5CEMA 3UMXA 4LUDA 4L3JA 4OTRA 3DB6A 4ZEGA 5DA3A 3C4ZA 2X2LA 2G2HA 5AP7A 4EH8A 2G1TA 3BLRA 3QKKA 4MX9A 2XCHA 4FKJA 3JY0A 1WCCA 2WTKB 3CPBA 4FL1A 4EC9A 2YAKA 2HXLA 1JLUE 3D94A 4WG4A 3BRBA 2OF2A 2C1BA 1YHSA 3VUGA 5M08A 3BYSA 4H1JA 5AMNA 5IA1A 5LVOA 3NUUA 4MD9E 3V51A 2WTIA 4BWXA 5E8SA 3CLYA 3SW4A 4TWCA 5HICA 4FBXA 4C4IA 1XHAA 2E2BA 3OBJA 1G8KA 3IGGA 4RVTA 4BKYA 4JAIA 4DH3A 4F9AA 3RMFA 4JDIA 4BCGA 2IZTA 2A2AA 5L8JA 4XG4A 2E9PA 2ERZE 3OROA 4PP9A 4MK0A 5LJJA 4DFBA 2BZIB 4TKSA 2YIXA 1YOLA 2X0QA 4FIGA 3PRIA 5CXHA 4RG0A 3C0HA 1SVGA 2Y6OA 2UW6A 4O4BB 3UDSA 2ZFYA 1U4DA 1TVOA 4N70A 2I6LA 2W06A 2ZV2A 3OD6X 2GHLA 4BDJA 3KMWA 5FEQA 2W9ZB 4AXFA 2PPQA 3U51A 1H1QA 4AS0A 3LCDA 4FTCA 3LKMA 2PUIA 2R3OA 3Q4UA 2GSFA 1BX6A 1R39A 2CLXA 2J5FA 4I21A 1SM2A 2WQEA 4HZSA 4GVJA 4IB1A 3VS1A 3HA6A 3KXXA 3OC1A 2A98A 4UZHA 4AXAA 4B6LA 4XV1A 4ANMA 4ERKA 1P5EA 4CNHA 2YIQA 4WOVA 4RA5A 3RK7A 2W0JA 4GUBA 4XRLA 4C4FA 3LIJA 1A9UA 2WTDA 4NZWB 4RZVA 4O83A 4QTAA 3V5PA 4B99A 3MJ2A 5IA3A 3F2AA 4EKKA 2QD9A 3K3JA 3MVHA 2HELA 2Z8CA 4RC4A 3PZEA 4YLKA 4YPSA 3D83A 3TUCA 2WELA 2YERA 4IVCA 3NIEA 3R00A 5EYMA 4FNXA 5CI7A 3TJCA 3GU4A 4FSWA 4BCFA 5KHWA 4AG8A 4LRKA 1ATPE 4EK8A 3EQPA 3BCEA 2XK3A 1PMVA 4FTAA 1Y91A 4IANA 1OKZA 2RFEA 3RJCA 4FG8A 4U8ZA 4QMSA 4ASZA 4DHFA 3IW5A 3UZRA 2GCDA 5A4TA 3FLQA 5EHYA 3R2BA 4QEBA 4MXYA 4AAAA 3BU5A 4IC7A 5AEPA 5LMAA 4E8AA 4H05A 4F99A 4PQNA 1QCFA 1WBTA 2UVZA 2YACA 1O9UA 1TQMA 4FT5A 5IISA 1CSNA 2C5VA 3QHWA 4PF4A 4D1SA 3HDMA 5CY3A 2WMQA 3UVQA 3PTGA 1OL2A 2DWBA 4YTCA 2UVYA 2XJ1A 4KD1A 4E3CA 3EQGA 5I9XA 3OTVA 1KE6A 1JKLA 1ZYSA 2C6OA