3MH2A

Mutagenesis of p38 map kinase establishes key roles of phe169 in function and structural dynamics and reveals a novel dfg-out state
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
348
structure length
330
Chain Sequence
RPTFYRQELNKTIWEVPERYQNLSPVGGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDYGTRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mutagenesis of p38alpha MAP kinase establishes key roles of Phe169 in function and structural dynamics and reveals a novel DFG-OUT state.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Mitogen-activated protein kinase 14
total genus 103
structure length 330
sequence length 348
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2010-04-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3mh2A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3mh2A01
3QD0A 5AA9A 3QA0A 4AACA 2GQGA 1PKGA 4GT3A 5AUXA 3PVBA 4MTAA 4KWPA 3G6HA 2OO8X 3NR9A 4ZTNA 5KMIA 5EHYA 2X2LA 4TT7A 3TNHA 4BDEA 4YLKA 4YJTA 3QCQA 4LL5A 3LOKA 2PU8A 2Y4IC 1PMNA 3DBEA 4ZTLA 3OY3A 2Q0BA 2Y8OA 3BU3A 3NYXA 3FLWA 4Y85A 2UW5A 5H8BA 5GZ8A 4O0YA 1ZZ2A 2C6IA 2R3FA 3ORNA 3ZUVA 3C4FA 4QQ5A 5CF4A 2C5XA 3OOMA 1FBNA 2Z02A 1MRUA 4DFLA 3BEAA 4NUSA 3F2NA 3BLQA 1KE6A 4KBCA 4U3ZA 4ERKA 3NNUA 5EDQA 1WFCA 2I7QA 3FDNA 4A07A 2R3MA 3CGOA 3DK7A 5FEQA 3OF0A 1TQIA 4XOZA 2W1EA 4QQCA 4Y72A 3TZMA 3QKLA 5D7AA 1PW2A 3ZEWA 3M11A 1GZNA 3QQLA 3MJ2A 4WG5A 4EK8A 4TPTA 3GENA 2YZLA 2RFDA 4LV5A 4BDBA 3UZPA 1W84A 4NFMA 3VIDA 3EQRA 3R00A 1NY3A 5DOSA 1AD5A 3KMWA 5HIDA 3DDPA 4DGNA 4YHTA 4JAJA 1XH5A 2RF9A 2AUHA 3FI4A 3KXGA 4MF0A 3FAAA 3KK9A 3GU8A 3A8WA 2OZAB 4OTGA 3TV4A 4O81A 3FZOA 4B6LA 2X4FA 4QMSA 1H1PA 3BYOA 3VBTA 2YM6A 4HGLA 5E7RA 4MKCA 4PY1A 3ZSIA 1JNKA 5L6WL 2JC6A 4C4EA 4AOTA 3ZSGA 3JYAA 5CU4A 4J98A 3UP7A 4TWPA 1XWSA 4RJ3A 4EOLA 3HAMA 4EH8A 4P4CA 4MBJA 4QTBA 4F0IA 3VUKA 4YNOA 3A8XA 4OBPA 2QG5A 2YFXA 3C0HA 4NTSA 5JFVA 3K5UA 2J0KA 3O2MA 2ITVA 3EWHA 3PPKA 4PL5A 4WNOA 5BVDA 5FGKA 1BL7A 4JR7A 1H27A 4EQUA 5DIAA 4FT3A 4JIAA 4ANLA 3L8XA 2J6MA 3LCSA 3R9NA 4X2NA 1OUYA 3BHYA 2C5NA 5AX9A 3ZLWA 5CU2A 3KKVA 2UZDA 1DS5A 4IZ5A 1Y6AA 4JLCA 3ZM4A 2AC5A 3PY3A 4MQ2A 4NM0A 5E90A 4WNMA 4LUDA 4XHKB 3TIYA 5A4LA 3TG1A 4CEGA 3NWWA 1KE9A 4G6LA 3KCFA 4W8EA 5DPVA 2F7EE 3FXZA 3H30A 3GI3A 1XH9A 2FSTX 4C4HA 3LZBA 2G9XA 4DH5A 5EI2A 5HKMA 4RWJA 3MYGA 4M67A 5HG7A 3MVHA 1U5RA 3R7UA 3CTQA 4GEOA 4LMNA 1UU8A 3W33A 1OZ1A 5DRDA 5E8YA 5A4QA 3QWKA 3MH3A 4CYIA 4JXFA 4JRVA 4E6DA 4X7QA 2W96B 5T68A 2Z7RA 3JUHA 2C1AA 3GT8A 5B2LA 4ANMA 2UVYA 1JQHA 2X6EA 3B8QA 4EOJA 3UO5A 3UOKA 2JDVA 2VTAA 4BDFA 4NM7A 3TUBA 5CWZA 1YHWA 3KY2A 4GL9A 4O2ZA 3PVGA 2W1DA 3RPYA 5LCKA 5M4UA 3A7GA 3UZTA 4UYNA 2Q83A 2F7XE 4QP8A 1VJYA 5LWMA 2PE0A 5FQDC 4FOBA 3BKBA 3F3UA 4EQMA 5M56A 3F7ZA 3ZEPA 5HZNA 4CMTA 2BKKA 4DT9A 2QO7A 2PZPA 1OIQA 3E7VA 3E92A 3HV6A 3FJQE 3IDCA 4RIWA 4U7ZA 4UWYA 3ATSA 2UZNA 4QNYA 2EUFB 2UW8A 3AT3A 4FL1A 1BL6A 4I21A 4HVDA 4BCKA 4F64A 3D4QA 3BU5A 1FVTA 3ENMA 5C03A 2QODA 2YLFA 5AP6A 3CKXA 4M84A 4YSMA 4GRBA 3H10A 1DAYA 3ORMA 3KRXA 4WD5A 4FKGA 3JS2A 2FUMA 3ORKA 4V05A 2WMTA 3DBQA 4O6LA 1JKKA 2CKQA 3RHKA 2VWIA 3BV3A 4AT4A 3HVCA 5AP5A 2XMYA 2ZDTA 4I3ZA 4PMTA 5IMXA 2QOKA 2ITXA 4P7EA 4O0SA 2BHHA 3DKGA 4BCJA 3MIAA 3WILA 4BIBA 2PVHA 3C7QA 4DFXE 3CJGA 1JVPP 4IB0A 3PA5A 3ZTXA 4YBJA 2B55A 3ERKA 1H24A 3SRVA 4MWHA 1LEWA 4DGMA 4V01A 2W0JA 3RZFA 5KE0A 2XK7A 4G31A 2C6KA 1TQPA 3WF5A 4BB4A 3LPBA 1Q8YA 4OLIA 3Q32A 3D7TA 4C4JA 4AW2A 4YU2A 3NGAA 5GZAA 4OAVB 3PDTA 5LVPA 4MX9A 1AGWA 4O0WA 5DR9A 4FNZA 1BI7A 1DI8A 3GNIB 3LVPA 3EZVA 3EOCA 4MBLA 2ZDUA 3QTUA 5JGDA 2QURA 4AZEA 1OUKA 4XYFA 3SKCA 3FUPA 2VTJA 2QHMA 3UMWA 1FQ1B 4D2TA 3UOJA 4IAKA 3SHEA 5CEOA 4RLLA 3LFBA 4QMWA 2OH0E 5JEBA 5CS6A 2EVAA 2BZKB 2G15A 3ITZA 1SNUA 2ZM3A 3L9MA 4BCPA 2UZTA 4H05A 4K33A 5HCZA 3V5PA 4FG7A 2HOGA 1JSTA 4YHFA 2Z7LA 4TYJA 2PWLA 4D0WA 3P78A 3RZBA 1H1SA 1VYZA 3P0MA 3SX9A 2Y6MA 2ZV2A 1YOLA 4LFIA 5FEDA 4AQCA 2FVDA 3V5WA 5HIBA 1OITA 4MH7A 1BYGA 4DG2E 4R7IA 2UVZA 2YM5A 2GTMA 4YURA 3ET7A 2IPXA 5IF1A 4IBMA 1B39A 5JKGA 4QMUA 2C0OA 4XOYA 3PWDA 4QMVA 5JZJA 1CDKA 1VYWA 3LFAA 3S95A 4FTQA 3PWYA 2QOLA 3CP9A 3K5VA 3LLAA 3QYZA 4BCHA 4CNHA 5IQCA 3CD3A 2BR1A 4S33A 2BROA 4FSMA 3REPA 4J52A 5GJGA 4PNKA 5CEIA 3TNPC 2WHBA 2ITNA 4ACHA 2YIYA 3ZMMA 1UKHA 1UNHA 5CSWA 4AX8A 5J79A 2XK9A 4N4SA 3KXMA 3EQFA 2ERKA 4KD1A 1UU9A 2QLUA 5KZIA 4ERWA 2YIWA 5E4HA 2QLQA 3QTWA 4ITHA 3HRCA 1MQ4A 4IDTA 2IO6A 4BCOA 4M14A 3EQDA 1OL7A 3PJ2A 1SVEA 2F2UA 5FM2A 4O0RA 3TDWA 2PE1A 3BQCA 4U9AA 4RGJA 4IWQA 4L8MA 5HCYA 3NAYA 5EHLA 3MPTA 5BVKA 4FKOA 3BRBA 4ALWA 4EH2A 5BVOA 5M4IA 3FLYA 5HORA 4GMYA 2IWIA 2VWBA 3HA6A 4GV1A 2X2MA 5A4CA 4WA9A 5EFQA 5CNOA 1ERKA 2PVKA 3P23A 4F1MA 4W4YA 4WSYA 2ZMDA 4C58A 3FL4A 4EK6A 1H07A 4FV9A 3GQLA 4DT8A 3NMUF 4FK6A 4WHZA 3FI2A 4KAOA 1R0PA 3CSVA 3BYVA 1ZLTA 4ZJJA 4E3CA 4DG0E 1BLXA 3OBGA 5HLPA 2QHNA 4ACDA 4Z3VA 3KRLA 4DHFA 2Y9QA 2EXCX 3GEQA 3P4KA 4IFCA 4KSQA 4MWIA 1VR2A 3EMGA 4A4LA 5BYLA 5E8ZA 4BCQA 2C30A 2RFNA 1VEBA 2HZ4A 2QVSE 4Y83A 4XCUA 4QMLA 4YZNA 4DAWA 4L42A 2ITWA 4CGAA 4FICA 2XEYA 1LP4A 3CXWA 4NH1A 2OJJA 2H96A 1P2AA 2XJ0A 1GNGA 1YWVA 2BKZA 4UZDA 2B9FA 2OIBA 3V5LA 4IADA 5HICA 3QUDA 3D7ZA 4B8MA 4LMUA 1Z9XA 4H3QA 5GJFA 5AUWA 4XLIA 2VTIA 3OC1A 2BAJA 3E8NA 2W1GA 1WBPA 3MESA 5C8NA 2VX3A 4RX5A 1GIHA 3W2SA 3UZRA 5CAPA 4NKSA 3MW1A 3FSKA 4YZCA 5TKDA 1WBTA 4JDIA 3KULB 3SAYA 2PZRA 2P4IA 4ZZNA 3V01A 5KMNA 3FEGA 3CBLA 3LFFA 3WZDA 4G6NA 4BI0A 4JDHA 2Z7SA 2IVUA 1S9IA 4DC2A 1O6LA 1PXJA 4JQEA 2WIHA 3ZRLA 4TYEA 3M1SA 3V3VA 1YW2A 4GVAA 2CKEA 4B4LA 2X39A 5D1JA 4Z7GA 3U8WA 4D28A 3ZRKA 5CEKA 3R01A 3OT3A 5JRQA 2VTNA 3NVMB 4WBBB 4TNDA 1FPUA 2HZ0A 3GCSA 4LRMA 3RTPA 1KOAA 5IMEA 3ZM9A 1YQJA 2PVRA 2F49A 4K6ZA 3TNIA 5KMMA 3GCUA 2VNYA 2OFUA 3ZRMA 2IVTA 4ENXA 3UODA 5IDPA 5BQ0A 4C8BA 3ULZA 3KVWA 4W9XA 2ZOQA 3PLSA 2CDZA 4MNEA 2C3LA 4KB8A 3WI6A 3DGKA 2I0VA 2C6EA 3IDPA 3NUSA 4DLJA 3H4JA 2OSCA 2OZOA 4WBOA 3BI6A 3O96A 3OXTA 2BUJA 2I6LA 5EKOA 4O7WA 3KFAA 3CCNA 2QR8A 4KSPA 2W4OA 5LARA 4MQ1A 2GHLA 3RVGA 5HQ0A 1H26A 4R6VA 3VUDA 5C4LA 2O3PA 4FIEA 3BCEA 4FNYA 2E9UA 3DB6A 5ACKA 3R63A 3E8EA 4C34A 1EH4A 1MQBA 3NNWA 4PTGA 2J0LA 3ZO3A 3MBLA 5F95A 3TNQB 4FL2A 5HD7A 2ETKA 1ZY5A 3O51A 3OS3A 4ZJIA 4FR4A 4FG8A 3BBWA 4I92A 4TWNA 3SGCA 3GCPA 5FD2A 2PYWA 2CN5A 5M4CA 1YI4A 4I24A 4C2VA 4FTLA 4MXXA 3OROA 4E73A 2GCDA 4BBEA 3VW8A 5DT0A 4I6QA 4BWKA 4PMSA 3S0OA 4S34A 4C35A 3RCDA 4ZLZA 2IZSA 4IZ7A 3T9IA 2EWAA 2J5FA 4R5SA 4O0TA 4KIQA 2BALA 4X0MA 5CENA 5J9ZA 3B2TA 5AIRA 4E20A 2P33A 5DNRA 5K3YA 4BF2A 2YJRA 4NFNA 3TKUA 4GVJA 2R7BA 4MVFA 3MS9A 3QRJA 3GFWA 3MPAA 3MDYA 4QMOA 2OGVA 3CQWA 5EH0A 4X2KA 2IZTA 3O23A 2XIRA 3GQIA 3SXFA 3DLZA 3ZS5A 2J51A 2JGZA 3W2CA 2JFLA 4M66A 4JL9A 3IW6A 3MN3A 3A7IA 3NCZA 2V7AA 5C8MA 5AEPA 4FEWA 3F7WA 3ZO2A 2GNJA 4E1ZA 5BUJA 5CEMA 3TI1A 3HECA 4U43A 5AP1A 5M4FA 2H6DA 1QCFA 2VUWA 1Y91A 3DK3A 4HPTE 3U87A 2B7AA 3HMOA 2PUIA 4R7HA 4CCUA 2C69A 3MTLA 4BDAA 2VO7A 3D2IA 5C8KA 4H36A 3FLNC 2W9FB 3T8OA 5CNNA 3HUBA 3P7AA 3VAPA 5F4NA 4C36A 3BQRA 3VW6A 4GS6A 3FLSA 4PF4A 4EBVA 3MB7A 3KXXA 3F2RA 5DEWA 4AUAA 2VO0A 2ZV7A 4RMZA 1BUHA 1OL2A 2F4JA 3WOWA 2R3LA 2W1CA 4AFEA 1UKIA 4O7LA 1MRYA 3FL5A 4NCTA 4NJ3A 2OW3A 2JKOA 4S31A 3EKKA 2ZVAA 5FDPA 4A4XA 4NL0A 4RBLA 1XR1A 3LCDA 4FKUA 5DT4A 3P79A 4ACMA 2VWUA 2VX1A 2W4JA 3POZA 1H0WA 3F88A 2CNQA 1WVYA 2ZMCA 3FSFA 3R9HA 3FMJA 4OTIA 4ZSGA 3MV5A 3UIMA 2Z60A 4GYIA 4CQGA 4Y5QA 4A9TA 1XH6A 3HV7A 3PVWA 3RP9A 3QCYA 4IZAA 3ZC5A 4CFFA 2IG7A 4D2WA 1OKZA 5HD4A 1BI8A 4AN9A 5IA3A 4HYUA 2J0MB 4XV1A 5I3OA 4IC8A 3I0OA 5BVFA 2OBJA 5J9LA 4C3FA 4R3RA 2VWVA 4AZVA 3BYMA 5ICPA 4M13A 5DYJA 4I6BA 3ZC6A 4E5BA 2R3GA 5BVWA 3BGQA 5LMKC 3HGKA 2C1BA 4YO4A 2PPQA 3T3UA 2XKCA 4X3FA 1YKRA 4F9YA 4F7NA 2WTKB 5M53A 5IA2A 4E5WA 3PSBA 3EN4A 1XHAA 5AFVA 4Y46A 4WIHA 3CC6A 3C0GA 3PE1A 4B0GA 4QP7A 4XJ0A 4MD9E 2IW6A 3W8QA 3FHRA 4YC6A 4OT6A 2X4ZA 2ZYBA 4CFVA 2XK6A 2YM7A 2EXEA 3CQEA 4OTWA 1ZOGA 1U54A 2C5OA 2JITA 5DR2A 5CSXA 4O0XA 1FVRA 1JKLA 4RFZA 4WNPA 3EL7A 4QYHA 3COKA 4GU9A 2ZV9A 3M2WA 4GT5A 4DINA 4DF3A 3ULIA 4CFWA 4F08A 2FSMX 4EORA 3RPVA 4I4EA 4HCTA 4CG9A 1G3NA 3AMYA 4HOKA 4FNWA 4RJ5A 2C47A 3VBVA 1BKXA 3RK9A 2BHEA 2BZIB 4RSSA 4MBIA 2BRNA 3VUTA 4LYNA 4L3LA 4NW5A 1FMKA 3ACJA 1UNLA 3IQ7A 1R3CA 5EM6A 5IH4A 4QD6A 3LFCA 1Y8YA 3UVQA 1LEZA 3BGPA 3QXOA 2VU3A 3UNJA 3TKIA 5IISA 2UW4A 2QONA 4FIIA 4BTJA 2R64A 1NVQA 4RVTA 4RWKA 4CKIA 4DYMA 5HE0A 5FUTA 4U0IA 5GHVA 3E8DA 3HMIA 4DCEA 4RT7A 4M8TA 5CXZA 3MFSA 3E3BX 3C13A 2OI4X 4I0SA 1PXPA 3VUGA 3NRMA 2PHKA 3NEWA 3QZFA 2BDFA 3QYWA 2YIXA 3FZ1A 4OTPA 4AGCA 2A0CX 3GGFA 2HXLA 4I41A 5EDPA 4EJNA 2EB3A 4BL1A 3PSCA 3FLZA 1Q3WA 5BMSA 3D2KA 4ZTHA 2WU6A 5ANJA 5IG1A 1IR3A 3KEXA 4DGLC 4BR3A 4ZEGA 2H9VA 2VX0A 3I6WA 3ORZA 2BFYA 5J7HA 4CLIA 5KMLA 2CMWA 4L53A 5DGZA 4NWMA 3UBDA 5AV0A 2X9FA 2XRUA 3FPQA 4MXYA 4DH3A 5A14A 2XK3A 4FVPA 3NUXA 3GVUA 4BVUA 3Q9ZA 4ZZOA 3CTHA 4YC3A 3UE4A 5G1XA 4YHJA 1PRYA 5JGBA 3OBJA 3ORTA 2JEDA 3P08A 4FL3A 2FB8A 5CALA 5IA1A 3N4UA 4L43A 5EI6A 4BI1A 3FMDA 5E8UA 4PX6A 3NW5A 1V0PA 3W18A 4DTAA 3BE9A 4HGSA 4ZK5A 4DEEA 4AGUA 3RHXA 2OLCA 2BZHB 1Q8UA 3C4CA 3O0GA 2FSLX 3HMMA 3R1SA 2G2FA 4J8NA 3WF7A 2AYPA 5AIKA 4EHZA 4F6UA 1J7UA 3MWUA 2JKQA 5DH3A 3R6XA 4FV3A 5DR6A 4IB3A 3ODZX 3DNDA 3EKNA 3O17A 4L9IA 3QRIA 2KULA 2RGPA 4ARKA 2X7GA 1YHSA 4ITJA 3N4VA 3R83A 4X6RA 4R77A 4C3RA 3RMFA 5AR4A 3RALA 3UQCA 3TZ8A 2XZSA 1PMUA 4IWPA 3F66A 4BDJA 3CY2A 2W7XA 5HG9A 4IX5A 4F63A 1CKPA 3IS5A 4ZOGA 1Z5MA 4CFNA 3GC8A 3HRFA 3E8CA 3GXLA 5D9HA 3PRIA 4JJRA 5CU3A 3NSZA 3UIUA 4JBOA 4I5CA 3EN6A 4YZDA 5IQBA 3QA8A 2P2IA 4U8ZA 2ZJWA 4QMPA 4H1MA 3LKMA 5HE3A 2YAKA 5CSVA 2GHMA 4X6QC 4IVCA 5AWMA 5LMAA 4EWQA 4L44A 3ZDUA 5G6VA 1Q3DA 4U40A 2VV9A 2PUPA 1W83A 3LFSA 4RZWA 4RA5A 2VTMA 1ZYJA 4UEUA 4BC6A 5F9EA 2YLEA 4RC3A 4R7BA 1OBGA 2W06A 4JX7A 3R8PA 3D7TB 4IWOA 3VS3A 5A9UA 3MI9A 2IZUA 2W9ZB 3BPRA 3COIA 4IAZA 2X9EA 2PVJA 2BRMA 4RC2A 3JXWA 3QQJA 3OWKA 4OR5A 3G0EA 4E5AX 4D9TA 2ERZE 2RIOA 3PLAE 3QX2A 4OTRA 5B2MA 3S1HA 3COHA 5CYIA 1Q4LA 4DG3E 3E62A 3SD0A 5M06A 4AWIA 5TOZA 5ANOA 4EH6A 4MYGA 3NAXA 3CPBA 2YM4A 4YP8A 5A4EA 4QMZA 2OH4A 3A99A 3LFDA 4IM3A 2QOOA 4F0FA 1FMOE 4L45A 1PXIA 4M7IA 1WBSA 3OTVA 4AE9A 4ZSEA 2WMSA 4EHGA 5H8GA 5CU0A 4HJOA 3AT4A 5HO8A 2FA2A 2ITZA 3A2CA 3VVHA 4QMXA 2C6OA 3TV6A 2OF4A 2J4ZA 5HESA 1OL1A 1XJDA 4JT3A 3GUBA 4QYGA 4RZVA 5HI2A 2UZBA 2PVFA 3HRBA 4QYYA 4CT2A 3FI8A 4RFYA 4W9WA 3RWPA 2Y7JA 1W82A 2R2PA 3DTCA 3NUYA 2GFSA 4G5JA 4W4WA 1H00A 5FBNC 5K0KA 1IA9A 2DQ7X 3MIYA 2C4GA 4GK3A 3TDVA 5AR8A 3SXSA 4ACGA 4YLJA 3KXNA 4BBMA 3H9RA 4FTCA 3U6JA 5IU2A 1YXUA 3L9LA 4R1YA 1UA2A 4UWBA 2R3OA 3UGCA 3IOPA 4F0GA 4FX3A 1OKYA 2G2HA 4DH7A 3OTUA 3ZUUA 1J7LA 4R3CA 4XG8A 4EKKA 3ZDIA 4EZ3A 4EUUA 1M17A 3I60A 3OWJA 4ACCA 4QO9A 4JS8A 4ZY4A 4ANBA 2WQNA 4UX9A 3AC2A 3COMA 3OOGA 4IVDA 5FP5A 3VS0A 1XH8A 3KMMA 3G51A 3KRJA 1YRPA 2GNLA 3G6GA 5IQIA 4OTQA 4Q2AA 2ZM4A 4CRSA 4Q9ZA 4O7TA 3UPXA 3D9VA 4BGHA 4UYAA 2E9NA 2RFEA 4C33A 2YCQA 3L8SA 2JKMA 2UV2A 1GIJA 3RK5A 2QU5A 3V8TA 4AGWA 4UXQA 5HVJA 3EH9A 3U51A 1F3MC 2QO2A 3BV2A 1TVOA 5HX6A 4PL4A 3LM0A 2J90A 3W8LA 4RIXB 3PIXA 4FGBA 2FH9A 4I5MA 4O7ZA 2QOHA 3FXXA 2W5HA 3JPVA 3QKKA 3EJ1A 4IAAA 3LMHA 5AAFA 4HZSA 2DWBA 3AGMA 3TN8A 4CV8A 3SOCA 5HHWA 2R3HA 3NS9A 4G1WA 1DAWA 4RX7A 4D4SA 5L8KA 1K9AA 3HAVA 4DBXA 3QQFA 2IZRA 4Q9SA 4W4VA 4AOJA 2ACXA 1Q41A 1Q8WA 2R3QA 4I22A 5EKNA 5LJJA 3DTWA 3ZONA 2BPMA 4QTCA 3A62A 2PMNX 3EQPA 5B0XA 2PL0A 3FQSA 3GU6A 5ANEA 5HCXA 5J1VA 3EQGA 3BEGA 3UTOA 2X7OA 3R04A 1YVJA 4FZAB 3KB7A 5DG5A 3UC4A 2X2KA 3ID6C 4ASEA 5HG8A 2WGJA 2Y4IB 2P55A 3FYKX 5BVNA 2IJMA 4YTHA 3QTRA 2B9IA 4QP4A 4AOIA 5HNIX 1GAGA 4O27B 4XNEA 3OG7A 4QPMA 4C37A 5FP6A 4WG4A 2VTRA 4BZDA 5B7VA 2E9VA 5JZNA 2WEIA 2Z8CA 2GSFA 4CZTA 2YN8A 3PG1A 4OUCA 4K0YA 1J7IA 3BLHA 3MPMA 2QKWB 2WEVA 4FV2A 1OPLA 1M7QA 5FDXA 4M3QA 2PULA 4BBFA 4M0YA 4CD0A 4LM5A 3RPRA 2HY0A 2UW9A 3VS1A 5KUPA 2YDIA 4EC9A 5KMJA 2OZAA 2JDTA 1YOMA 3RWQA 4EH5A 1ZWSA 3U4WA 3AC3A 4FSRA 4UMUA 4AG8A 2WXVA 2WMBA 4QMTA 3WE8A 3L8VA 4QQTA 4DFNA 4HVGA 5CF6A 3QZGA 2XJ1A 4BDIA 5CVGA 3ZBFA 4IVBA 4C2WA 2PTKA 3DFAA 3MH2A 4ZTMA 3HZTA 3PYYA 1J1CA 3W2RA 2CN8A 3BU6A 4QTAA 4GK4A 3ANQA 1ZXEA 1MRVA 2X8IA 3FLQA 2I40A 4I94A 3UQGA 3SA0A 2UZLA 2J0JA 1JSVA 2B54A 4I0RA 3IOKA 5HO7A 3DAKA 4AE6A 1O9UA 4BHZA 1UWHA 4L46A 3IW5A 4A9UA 4O82A 2GNFA 5EW9A 1LUFA 3ETAA 2HY81 3BHUA 5BVEA 1KE8A 3G9NA 2YAAA 3JVRA 5IA4A 2ETMA 4BDCA 3V51A 4FC0A 4HCUA 4YZBA 4PWNA 4XV3A 4H3PA 3CTJA 4XP0A 4J53A 4KIPA 3VRZA 4HYIA 5HEZA 4FZ6A 3II5A 2HZIA 3W10A 3UYSA 2OXXA 2OFVA 4AA4A 5A46A 4U5JA 2RKUA 2WNTA 4OBQA 3DU8A 5AADA 1WBOA 2XNOA 4UMTA 2YCSA 3F3WA 3HV3A 4U81A 2R0UA 1OIYA 4FODA 2HWOA 1U5QA 4FV5A 4XP3A 4YBKA 4ZY6A 4KUJA 4O7YA 4AU8A 4EH3A 2WIPA 4AFJA 2BTRA 3DQWA 3WIKA 4EYJA 3PIYA 4BDDA 3GOPA 3KXZA 2O8YA 3ZO1A 2OJGA 4JG6A 5ANDA 4YGAA 4G9CA 3RJCA 5IEVA 1LPUA 2YDKA 3ATTA 5D41A 4XRLA 4J8MA 4Y95A 1Q8TA 5KMOA 3NUAA 5GIPE 1Q8ZA 3TZ7A 4ZLYA 4FMQA 1RJBA 3FMMA 5IQEA 3C4WA 3RKBA 3Q4UA 4HYSA 3VUMA 3UO6A 1ZZLA 4GG7A 4D0XA 4JBVA 3ZOSA 3UOHA 3ZYAA 4DTBA 1Q24A 3NCGA 1OIUA 3QD2B 4S30A 4K11A 1HCLA 2PZYA 2QR7A 3FBVA 3P86A 4JBPA 4BDKA 5FBOA 4CSVA 4GKIA 1R39A 3EZRA 2XNEA 3BE2A 3L8PA 2F2CB 1JOWB 4FV6A 2PVNA 4IAIA 4FEVA 5FTQA 4FNXA 3GB2A 4FV7A 5CU6A 3P9JA 4BIDA 4FSWA 2HENA 3TEIA 1RDQE 2G01A 4DEDA 4CXAA 2CNVA 1YWNA 3L9NA 3ORIA 3ZCLA 3PZHA 4H3BA 4CZUA 2WPAA 2GTNA 5TF9A 5CASA 4XP2A 4IM0A 2YCFA 2JDOA 3P5KA 4ALUA 4AZFA 5GZ9A 2UVXA 2B9JA 1K2PA 2OK1A 3C4XA 2X6DA 2WMRA 5AP7A 3PJCA 4GYGA 3VBYA 3WE4A 3P7BA 2OXYA 2NRUA 2GS2A 3QQKA 4U3YA 2JAMA 3IG7A 4IANA 4PPBA 5L2QA 2VNWA 3BLRA 3R0TA 1ZYLA 5FRIA 4GJ2A 4LRJA 5AAEA 4YTIA 2F9GA 4L7SA 2WMWA 1JAMA 3VS4A 3ZZEA 4FSUA 1UVRA 1OMWA 1OPKA 2REIA 3Q4ZA 3AD4A 3Q04A 3SRVB 2XNNA 5KNJA 4X3FB 2WMXA 2UUEA 3EL8A 1SM2A 5HNGA 4UN0C 3EN9A 1TQMA 4D1ZA 5KO1A 2ITPA 3DAEA 3QTIA 3LCTA 5CZIA 2IN6A 3QQUA 4IHPA 2JLDA 3VBXA 5K4JA 3PA3A 3PXYA 3QRTA 4YJRA 2XF0A 4DTKA 5JMSA 3AC4A 2HZNA 3DOGA 4D58A 3ZU7A 4ZY5A 2C5VA 4PDOA 4FV0A 5EM8A 5T6KA 1A48A 3HL7A 5CTPA 2P2HA 4C3PA 3AT2A 4PV0A 4QQJA 4YUQA 3CQUA 1OB3A 2W4KA 4FV1A 1V0OA 4PDPA 4YO6A 2C6LA 2J2IB 5JT2A 3FMKA 4OTDA 4C57A 4EZ7A 3F69A 2HK5A 3O7LB 5HLNA 2WTDA 3BYUA 5DWRA 1Y57A 2W5AA 1R0EA 3F5UA 2A27A 4ZSLA 1QMZA 2O0UA 2B53A 3NPCA 2A19B 3KXHA 3OXIA 3BX5A 3FZRA 3QTQA 3DKCA 4FSNA 3W2OA 4P2KA 3KVXA 5HOAA 4FTNA 4B7TA 3QGYA 4IQ6A 1W8CA 4BCNA 2JFMA 1IRKA 3OCSA 1G8SA 3RAKA 2R3RA 4GH2A 4GFOA 3N4TA 1STCE 3AG9A 3LLTA 3NX8A 5I9UA 2XCHA 1APME 3C9WA 1U59A 2GDOA 2YDJA 3Q60A 3FZTA 3I4BA 2GNHA 3D0EA 3PP0A 3TTJA 3V5QA 2XCKA 5HNBA 4D4VA 3KN5A 2XKDA 3NYNA 3GFEA 2UW0A 4G9RA 4OTHA 3OFMA 1UU7A 5CANA 1O6KA 4O7VA 4F9BA 4J7BA 3DXQA 4GFGA 1XQZA 3Q6UA 5FLFA 4Z7HA 1Y8GA 2CKOA 3IW7A 3UVRA 5FXSA 5HVKA 4G6OA 5I4NA 3WARA 5IA0A 3HYHA 4D1SA 5AR2A 4JI9A 4PTCA 2WAJA 4S32A 4X3JA 4C0TA 2Y0AA 5FG8A 3V5JA 5FXRA 4KA3A 1WVXA 2BDWA 3V6RA 3ZHPC 3Q4CA 3G0FA 2B4SB 3I5ZA 3I81A 2QOFA 3IONA 4KIKB 3R21A 4KABA 4MD7E 4RX8A 5CQWA 5DN3A 5LMKA 1OPJA 2OIQA 3MGYA 4NK9A 4TZRA 4DFYA 4FIJA 5K0XA 5ANGA 1ZY4A 2OJFE 1P5EA 3QZHA 2XM8A 2YERA 3OMVA 4TYHA 4YJUA 3W1FA 3PA4A 1IG1A 5DE2A 2HIWA 4DE4A 4WSQA 3MA6A 2WMVA 4DH8A 4JX3A 3TUCA 4DFUA 4L52A 4Z55A 5F94A 3QHWA 2J7TA 2CLQA 4B99A 4EI4A 1PXLA 4YJVA 5AM7A 3TM0A 4NT4A 1WMKA 3PIZA 3V6SA 2P3GX 1Q62A 3VJOA 2J9MA 3MVMA 4HNFA 4MHAA 3R8MA 4BY9E 4HYHA 3UIXA 4LG4A 5D11A 4WRSA 3GU4A 3R2YA 4LOOA 4G2FA 5M44A 4JQ8A 4JQ7A 2XNMA 5KBRA 4RX9A 5DEYA 4I20A 4N70A 2QC6A 1HCKA 4U80A 5L4QA 3PTGA 4K8AA 2OKRA 2R4BA 2X7FA 4YC8A 4L3JA 4UALA 1XO2B 3R2BA 4L3PA 2BAQA 3R7GA 4TYGA 5IQHA 5HE1A 4KIOA 1ZOHA 3MY5A 4ANSA 5I0BA 4Z16A 1ZYCA 3K3JA 1U46A 3Q53A 4O1PA 2WTKC 3GC7A 5IZFA 4B9DA 4FTRA 2CKPA 3F3TA 3NUNA 4TNBA 2JKKA 5EDRA 1QPCA 4Y5HA 3NZ0A 3V8WA 5IQDA 4G3CA 5CX9A 4MXZA 3QZIA 2P0CA 4FKLA 1GZOA 4LRKA 3S3IA 4ZLOA 3DBCA 4FKSA 4FSZA 1YDRE 5C27A 5AUTA 4CCBA 4PMMA 3MA3A 4IDVA 4PTEA 4YJPA 1URCA 4WG3A 4EWHA 3KC3A 1FVVA 4U44A 3KREA 2EXMA 3LQ5A 3FMNA 4APCA 2BIYA 4L6QA 4Q5EA 4GKHA 1ZMVA 2QCSA 3MY0A 4C61A 3I0QA 3SG9A 1GZ8A 3Q96A 1ZYDA 2R9SA 3QF9A 4FIGA 4LOPA 4UV0A 5EHOA 2ITQA 5AX3A 4D55A 4RLKA 5LXMA 2OXDA 2BCJA 4QPSA 2JBOA 4N6YA 3PXKA 1TKIA 4F4PA 5I9ZA 1BMKA 3KRRA 5AV3A 4OAUC 3PY0A 3QHRA 3DZOA 4I4FA 3AOXA 4ASXA 4WRGA 3PXRA 4EOMA 3DXNA 3ORPA 4L67A 4CV9A 2BTSA 3CKWA 3CIKA 4F65A 4ZAUA 4EYMA 5J9YA 2BIKB 4R3PA 2WKMA 5LOHA 5J5TA 1H25A 1J91A 3WZJA 5E92A 5BX0A 5L2WA 4O7NA 4HCVA 4I93A 2W1ZA 3W16A 3K3IA 5CI6A 1KE7A 4KRCA 1KE5A 4NW6A 1JKSA 2V5QA 5F1ZA 1YXSA 3P7CA 4XEYA 2KTYA 4XUFA 2J50A 4FGRA 3VS5A 1NA7A 5CVHA 3A7JA 3SDJA 4XG4A 5ETCA 4DEBA 4ZTRA 4EHVA 5EM7A 3H3CA 1BX6A 2XBJA 2O63A 3RAIA 4PNIA 5KCVA 4IC7A 3ZXZA 4AN2A 2NP8A 3DAJA 5IPJA 3QU0A 3KU2A 4HNIA 4X2FA 4D5HA 2J0IA 4FKRA 3ACKA 2R0IA 1YI6A 4RJ7A 4BTFA 4IX6A 4DGGA 3DKFA 4FSYA 2HWPA 4ASZA 5AM6A 4KNBA 4AT3A 4GSBA 4J99A 4R78A 4NKAA 3VULA 3EFKA 3SQQA 1KUTA 4F9WA 3E5AA 4K9YA 2W1FA 3DA6A 4A9SA 1CMKE 3CGFA 4IXPA 5KHWA 5FEEA 3T9TA 1YHVA 3KF4A 4ITIA 1GIIA 4ZXTA 3DFCB 1H1WA 1M7NA 4FTUA 2R3IA 4O22A 4II5A 4G3FA 4BDGA 4DBNA 5LWNA 3UYTA 2PMIA 4EHEA 5K9IA 1PMEA 4UMRA 2PZ5A 1URWA 4BGGA 3HEGA 4FEXA 4M0ZA 4DEIA 4F9AA 1IAHA 4EOQA 3U54A 1A06A 5TR6A 3GC9A 5HTBA 2I0YA 2IW8A 3LW0A 4ZSAA 3VJNA 2SRCA 3QQHA 4AZTA 3EQIA 3ZBXA 1U4DA 2R3NA 4PL3A 4ZSJA 3R9OA 1KOBA 4CMOA 1ZMUA 2CHLA 4EK3A 5L3AA 4OGRA 4EC8A 2PUUA 3TUDA 2C0IA 3JVSA 4X21A 2EU9A 4HVSA 3FKNA 3AQVA 3CE3A 3E88A 4CFXA 3MJ1A 2R5TA 3VS7A 3EQHA 1ZAOA 3AXWA 3NNVA 3QUPA 3KF7A 3S00A 4XG9A 4EOOA 4EBWA 2UW7A 3LIJA 4M97A 3WF8A 3Q52A 4ASDA 3R7VA 5LMBA 5M57A 2A4LA 1ZRZA 3UO4A 5LQFA 3UDBA 5JFSA 4ZS4A 4AAAA 3IPHA 4XBUA 5EM5A 3KK8A 2H34A 5JSMA 4QP3A 3U6IA 3QWJA 5CY3A 2XIYA 5GNKA 2QOBA 4YJSA 1WZYA 4J96A 3H9OA 3DT1A 4FZFB 1JPAA 5FXQA 4M69B 4U42A 1WVWA 3QCXA 3PZEA 3FKLA 3IO7A 1JWHA 4APPA 1U54B 4EK4A 2BRGA 4HW7A 2E2BA 2E9PA 4CTCA 3D5WA 4BFMA 1RW8A 3EN5A 2W1IA 3ZUTA 4QYFA 4EONA 4M69A 3QGWA 1R1WA 1JBPE 2WOTA 1W98A 5J87A 1ZARA 5AJQA 4TTHB 5CLPA 4BKZA 2UZUE 1SVHA 5CQUA 5M09A 3LMGA 3LE6A 2RFSA 2WTCA 3NW6A 3QKMA 5A54A 5KHXA 4R5YA 4W8DA 2C68A 2LAVA 3R1NA 4C38A 5JQ8A 3G90X 2C6MA 3H9FA 3PG3A 1KWPA 4E4LA 1NT2A 3OT8A 3NIZA 2VWWA 4P5QA 4YR8A 5KZ0A 3OHTA 2JD5A 1M2RA 2HW6A 4ZIMA 4KS8A 4RG0A 3D5VA 3EYHA 1M14A 4UBAA 2ESMA 4WNKA 3EYGA 3RNIA 1G8AA 2R3JA 4Y8DA 1VZOA 5JH6A 2F7ZE 5TT7A 3DJ5A 4QOXA 3A4OX 3IECA 5DT3A 5IEXA 5IH6A 2X8DA 3NDMA 4RA4A 4C4FA 2VTQA 1PHKA 1K3AA 5CXHA 4ID7A 4YLLA 3R8LA 5L2TA 2XS0A 3ALNA 4G3DA 2OG8A 1QPJA 3RNYA 2HAKA 5AUUA 3VF8A 2QG7A 3TV7A 5HTIA 4P5ZA 2CGWA 3Q6WA 2WO6A 4Z9LA 4ZTSA 3PXQA 4FTJA 4LUEA 5K5XA 2WQBA 5IH5A 3Q9XA 4FZDB 5EW3A 3Q5IA 4EJ7A 4I5PA 4JIKA 4V0GB 1KSWA 3HP5A 3R71A 3AGLA 5HU9A 5DFPA 3EQCA 4FKWA 4IX3A 4UZHA 4WOVA 5IUIA 4U97A 4JRNA 4RFMA 3UP2A 3DJ6A 4K2RA 3O8TA 3QRKA 5CAOA 2XYNA 3RM6A 2OF2A 4Q5HA 4KS7A 3RPOA 4AF3A 3DS6A 2V55A 3DK6A 3FKOA 3PJ1A 3ROYA 5DLSA 4PMPA 2C3IB 4EH9A 3OEZA 3MVLA 5BYYA 4EQCA 3RPSA 3OCGA 4HVIA 3F82A 5HBEA 5HO6A 5D12A 5LVLA 2AC3A 2FGIA 3I6UA 4RPVA 4X2GA 4AW1A 4BGQA 3ZO4A 2YZAA 4A7CA 1YOJA 4F7SA 2UZWE 2ZV8A 2HXQA 3GOKA 3Q2JA 3RGFA 2GPHA 3QQGA 1SZMA 1GJOA 3DQXA 3F5PA 5H2UA 4JBQA 4NJDA 4CKRA 5K4IA 5A3XA 4AZSA 4EEVA 5KKRC 2YISA 2IVSA 2V62A 4O83A 4FE2A 1WAKA 2QO9A 3O8UA 3U4UA 2QD9A 3UIBA 4CVAA 3R9DA 4BCMA 5J7BA 1REJA 4E7WA 2VGOA 4C02A 3VC4A 5CI7A 2VO6A 1O6YA 4YSJA 5IQGA 2PSQA 4MXAA 3NUUA 3TWJA 5CAUA 2XB7A 3E87A 4K1BA 1NXKA 1XBAA 3A4PA 2NRYA 3SLSA 3VQHA 2VTHA 3HA8A 3OEFX 1H8FA 4GK2A 3I79A 1J1BA 3FMLA 1HOWA 3UMXA 2VRXA 3HX4A 4FV8A 2C3JA 2C6TA 4NYEA 2VAGA 2XH5A 5IUGA 3I5NA 4FK3A 2PUNA 2FO0A 4RIYA 4FKJA 3DCVA 4BTKA 5AV4A 5J8IA 3G5DA 5I9VA 2YACA 4NM5A 4MNEB 3ZFYA 1V1KA 2XK8A 3ZSHA 5B2KA 4NIFA 3TTIA 3R7EA 3S2PA 2XM9A 2Y4PA 4FIHA 1UNGA 4U45A 2YWPA 4FUXA 5DBXA 2XIZA 4PQNA 2WMAA 4AXAA 1ATPE 1A9UA 3MFUA 3OY1A 3R8VA 4BCGA 4E6CA 4NU1A 3MVJA 3ZZWA 2Q0NA 3DB8A 3FXWA 4BKJA 4E4MA 4ZMFA 5A4TA 5BPYA 1F5QA 3L9PA 5EK7A 3U9NA 3V04A 3PE2A 4AGDA 4D2RA 4RRVA 2WQEA 4L68A 2CSNA 4IFGA 5AR5A 3PFQA 4C7TA 5BUEA 3U55A 4AA0A 4IIRA 5CSHA 3F5GA 3CJFA 1AQ1A 5FM3A 3DXPA 5D10A 3SG8A 4DFZE 3D83A 3DY7A 4XLVA 3BHVA 2VZ6A 2ETRA 4JAIA 1R78A 4F99A 2C3KA 4FEUA 5KX8A 3MH1A 2DUVA 2A2AA 4MNFA 3VS6A 3AD6A 4L00A 1XBBA 1P4FA 5E8TA 2BMCA 3NYVA 2UZOA 2VTTA 4QP6A 4UB7A 3VUIA 3JR1A 2WQMA 4XMOA 4EZ5A 5AAGA 4BZNA 4WUAA 2XK4A 1REKA 4BWPA 5M51A 4FI1A 4IX4A 3C4EA 3B8RA 2PVMA 3FC1X 4M68A 4KIKA 4TN6A 3RCJA 5IQAA 4IZYA 3WF9A 4L01A 5CF8A 2YM8A 2JIUA 4V0GA 1FGIA 4LGGA 3RBWA 2W1HA 4QNAA 4ZS0A 3KMUA 3EB0A 2ITOA 2WMUA 3BHTA 5LVMA 3G15A 4GT4A 4IAYA 4BYJA 5HVYA 3SOAA 3LCOA 3ORXA 1E9HA 5IEYA 2V0DA 2XIXA 3LCKA 5HLWA 3P1AA 1GY3A 3G2FA 3FYJX 5DHJA 3UVPA 1PYEA 4USFA 1T46A 2V22A 4FYOA 1YXVA 4PUZA 4QMYA 3U6HA 3BGZA 4E6AA 3RI1A 1E1XA 4OW8A 3RM7A 1ZYSA 3K54A 4GIIA 4D2VA 4EOPA 3LQ8A 4FTKA 4OT5A 4DITA 3HMPA 4MD8E 2BRHA 5H8EA 3O8PA 4F7LA 2O65A 2X8EA 5HBJA 1RE8A 2JBPA 3KCKA 2NNWB 1KV2A 2LGCA 3CLYA 1PYXA 4DGOA 3Q3BA 5CZHA 3TJCA 1OL5A 4FTOA 3LJ1A 2XKEA 3LM5A 4RVLA 2WU7A 4FSTA 2PE2A 5EYDA 3W2QA 4RQVA 3UG1A 3EQBA 5A6NA 4YJOA 4BHNA 3TXOA 2JAVA 2OIDA 2GFCA 4TWOA 2W99B 3VBQA 4IEBA 4MF1A 5AA8A 3SC1A 4FYNA 4RQKA 4BI2A 3HP2A 1JSUA 3D14A 3RAWA 3Q4TA 4LGHA 4CTBA 4CLJA 3JY9A 5D7VA 5E1EA 5BUIA 4GIHA 2F57A 3OCBA 2VN9A 4ANOA 1XBCA 4JOAA 4XG2A 2YM3A 4R1VA 3AC5A 5I5ZA 2C0TA 3JY0A 5AR7A 4BRXA 3SVVA 3NVKI 3VUHA 4XV2A 2C5YA 4LQMA 2VWXA 4V04A 3Q9WA 4MK0A 2C6DA 3Q2MA 3E93A 3AD5A 1OGUA 4LI5A 3R7IA 3QTZA 4LOQA 1OL6A 2FSOX 2JIIA 3POOA 4YTCA 4IMYA 4J95A 4QPAA 4NM3A 5T3QA 4TW9A 3WYXA 4FEQA 2RG5A 3KULA 3HV4A 5J1WA 3R02A 4EKLA 5AP0A 2R3PA 1XH7A 4CRLA 5KBQA 1GOLA 4YJNA 3SXRA 5AR3A 2J5EA 3HMNA 3R8ZA 4TY1A 2BVAA 5H9BA 2PK9A 3MTFA 5IKWA 3WIGA 2YHVA 3VN9A 3LJ2A 3VBWA 4TL0A 4NEUA 1PXOA 2BFXA 2ITYA 4RWIA 4BN1A 4EL9A 3KN6A 3CEKA 5E8VA 1WCCA 4ZJVA 3AMBA 4UWCA 3W55A 4AP7A 2PY3A 4EK5A 2QI8A 3BZ3A 4FG9A 4GU6A 3VHKA 3QLGA 4EOIA 3R28A 4GW8A 5HIEA 5ETIA 3BWJA 4R8QA 5TO8A 4JNWA 5EQPA 3QLFA 3IKAA 3DNEA 4JG8A 4EOKA 4XV9A 3CY3A 4J71A 1ND4A 4RVKA 3G9LX 4UY9A 3I7CA 5FWKK 1OM1A 1MUOA 3F61A 4O38A 5ITAA 5AP3A 2WFYA 2HELA 3UG2A 5EQEA 2B9HA 2GU8A 1CTPE 3LXLA 3ODYX 4FT9A 1J3HA 4GG5A 5IA5A 5AUZA 4CT1A 5I3RA 2CGVA 3FMHA 4OTFA 4FZ7A 3AMAA 4UXLA 5JRSA 4A9RA 5JK3A 1IASA 1SNXA 2O2UA 1YDSE 2YEXA 1Q99A 4PP9A 2WD1A 5EW8A 5EOLA 1OBDA 2YIQA 4FUYA 4IWDA 4F70A 4U79A 5EOBA 2UZVA 1OKWA 4CZYB 3OUNB 3LAUA 4FKTA 1UV5A 3KRWA 4RJ6A 5L6OA 3OP5A 3FHIA 3F9NA 3KL8A 4DEGA 4DFBA 4NSTA 4E8AA 2JIVA 4QMMA 3D94A 5AUVA 4CYJA 2E9OA 4XS2A 4I1ZA 4I6HA 5EQYA 2CJMA 3ELJA 3FV8A 5E1SA 4H1JA 4O0UA 4EH4A 3FPMA 4TXCA 3UPZA 4D4RA 1W7HA 2RSVA 5C4KA 4TWCA 4C4IA 4QMNA 2GNIA 3FZPA 2WTJA 1OKVA 2UW6A 2XRWA 3QL8A 1PKDA 4BCIA 3NIEA 4ENYA 2UZEA 3LFEA 4BICA 4FT5A 4FF8A 4HPUE 4O7RA 2WB8A 5CT0A 2YITA 4G3EA 5FTOA 3C5UA 2WOUA 4IW0A 3Q5ZA 3LXPA 3UC3A 3PUPA 3C4ZA 3R1YA 2CGUA 3D15A 3O50A 4U41A 4BIEA 4D2PA 4I0TA 1OIRA 3DKOA 2VD5A 4KKEA 2HYYA 4G17A 5CVFA 3SW7A 4S2ZA 5I9YA 4O1OA 4D2SA 5JFWA 4O86A 3AC8A 4JR3A 1YI3A 4XG7A 4GCJA 4U6RA 4DLIA 3UJGA 2V7OA 1Q61A 3PP1A 5DI1A 1P14A 2BRBA 2GNGA 2WTWA 2VGPA 2WZJA 1LR4A 3HUCA 3TACA 2CCIA 4FVQA 4JDKA 4A06A 3ROCA 3DZQA 2WTIA 5HE2A 1T45A 4UMPA 3R73A 4TYIA 4CQEA 1H08A 2G1TA 2GS7A 4ONAA 1DM2A 4JG7A 3O7LD 2W5BA 2FYSA 4KBAA 4NZWB 4B8LA 5HU3A 4KINA 5I9XA 4YJQA 2JDSA 3OWLA 4FVRA 4MXOA 3LXKA 4Y73A 4A4OA 2QOIA 4I23A 1JLUE 4G34A 2VTLA 3HV5A 4QTDA 4HGTA 5M55A 5IDNA 1NVSA 3QC9A 5E8XA 5IUHA 4KBKA 1FINA 3F6XA 2DYLA 3UNKA 3EFLA 3I7BA 2B1PA 4WT6A 4QYEA 2XKFA 4LL0A 3WZKA 3ZLYA 4BDHA 5EYKA 3FQHA 3ZXTA 2VTSA 4AT5A 3VO3A 3QRUA 1M52A 2NPQA 2Y6OA 3LFNA 3R22A 3PPJA 4IVAA 4UMQA 1H1QA 2QOQA 4XG6A 5CEPA 5DA3A 3R8UA 2OJIA 3TKHA 4YZMA 4EUTA 3VNTA 2ZB0A 2XJ2A 3SV0A 4C59A 3TCPA 4CFMA 5J95A 2HW7A 3CPCA 3OD6X 4L7FA 3QCSA 3D5XA 4BKYA 4BYIA 1P4OA 3QXPA 1IAJA 3GU5A 1QPEA 4CG8A 3QD4A 1PY5A 3C0IA 3C51A 2X0GA 1JKTA 5JQ5A 5GINE 3PY1A 5EG3A 4YNEA 2HCKA 3GBZA 5M07A 3GU7A 3TIZA 4O91A 3D5UA 2XBAA 2BDJA 1L8TA 3QALE 1UWJA 3HDMA 4DH1A 2ITUA 1GZKA 3ORLA 4FKQA 3ZFMA 4J97A 4D4YA 2Z7QA 5EI8A 4E4NA 3FY0A 2B0QA 1H01A 4F1TA 4O7SA 4ZMEA 4M12A 2XIKA 4O84A 1B6CB 3QAME 5E91A 3CD8A 4DEAA 3FI3A 5BYZA 5CF5A 1V0BA 3SW4A 5BMMA 1CM8A 3OVVA 4OBOA 3A61A 3NW7A 5TE0A 2VWZA 3K2LA 4F1OA 3FE3A 4IH8A 4WUNA 2RL5A 1I44A 1YDTE 4AW0A 1H28A 1M2QA 3IW4A 4AW5A 4O2PA 3VWAA 3NLBA 4X2JA 2PMOX 3MFRA 1H4LA 1B38A 4FIFA 4IJPA 3ENHA 5CAVA 3LQ3A 4EOSA 3HLLA 2QOCA 2W17A 3DV3A 3BHHA 4CKJA 1PJKA 2EB2A 5LCJA 4E4XA 5CEQA 3QC4A 4BZOA 3IGGA 4BWXA 4XRJA 3WZUA 3VS2A 5GJDA 3V5TA 5L2IA 1F0QA 4IAFA 3IGOA 4PPCA 4TKSA 3TZ9A 3MB6A 4IM2A 5BNJA 4ZTQA 3EN7A 3R7YA 4F9CA 1OECA 2DS1A 2W05A 5CT7A 3LXNA 5AP4A 5CAQA 1CKIA 5E8WA 4C62A 2QU6A 3WYYA 1XH4A 2XUUA 3QBNA 4MAOA 5HGIA 1CSNA 3NNXA 3TL8A 3MFTA 3VRYA 5KMKA 3B2WA 4N0SA 4FA2A 4XH6A 4HZRA 4ANNA 1RQQA 4N6ZA 4YZ9A 4O96A 4GUEA 4G16A 5L6PA 4LV8A 5HBHA 2VTPA 1Z57A 3OXZA 1PXMA 4GJ3A 5ACBC 5I9WA 5IQFA 3FY2A 2CLXA 3GCVA 2OICA 3IW8A 4QP2A 3WZEA 4F7JA 1WBNA 2R7IA 2IVVA 2XP2A 5HX8A 1Y6BA 3R1QA 3GP0A 3R30A 4QP9A 5ETFA 3WF6A 5K5NA 3WBLA 1YWRA 3MY1A 2XEZA 5C26A 3KA0A 2X1NA 4JDJA 4FBXA 3H0ZA 1XKKA 4WKQA 3W32A 3H0YA 4DA5A 4E26A 4RIWB 4NTTA 3I1AA 4QP1A 3HDNA 3QTSA 3LFQA 2I1MA 4QTEA 2GQSA 3KGAA 3ANRA 4M15A 2Z2WA 3OW4A 1S9JA 1YXXA 3F5XA 3EIDA 3HNGA 5AV1A 3E7OA 1WBWA 5AV2A 2YA9A 3LJ0A 3W2PA 5FTGA 1G5SA 1QPDA 1MP8A 2PMLX 4XG3A 2CNUA 3E63A 3PXFA 3IK3A 1IA8A 3EHAA 4FKIA 4MXCA 4RVMA 4RWLA 2CPKE 3ZFXA 4RJ4A 4FOCA 2ONLA 2WQOA 4ALVA 5LVNA 2PZIA 2QNJA 1PMVA 2VWYA 3PJ8A 2GS6A 4QRCA 2R3KA 4DN5A 5ANIA 3FC2A 4XBRA 4FSQA 1Q97A 5EYCA 3LHJA 4G3GA 3F2AA 4YPSA 1H0VA 4FTMA 2QKRA 4RIYB 3EFJA 4YTFA 3GCQA 2OU7A 2XNBA 4HGEA 3E3PA 2GMXA 3RINA 5DMZA 3PXZA 3QX4A 3BYSA 3RK7A 1ZMWA 3NUPA 1NVRA 4PPAA 3ZLSA 3QFVA 2JDRA 3DLSA 4DEHA 3TJDA 1SYKA 3FWQA 5DRBA 3LMIA 2ZB1A 3CR0A 2GHGA 3OWPA 4I6FA 1PXNA 3DDQA 3S4QA 4XX9A 4CMUA 4K77A 2RG6A 3T3VA 1PXKA 1DI9A 5L8LA 5JGAA 1E1VA 1W0XC 4PP7A 4PDYA 3C50A 3DJ7A 1KV1A 1UU3A 4KRDA 1Q5KA 1WBVA 2OWBA 3BIZA 4ZZMA 1FGKA 4GUBA 3E64A 4QMQA 2XNPA 4O6EA 3A7FA 4FV4A 3PVUA 4H39A 4F6WA 3OW3A 3PRFA 4NCTC 3F3VA 3MSSA 2XA4A 3C1XA 4YPDA 2WTVA 4J1RA 2GQRA 3OZ6A 4USDA 3Q9YA 3A60A 3ZLXA 3FZSA 3QTXA 4RIOA 4P90A 5GIOE 2O64A 3N51A 3THBA 1IEPA 3HKOA 1YXTA 3OUKA 4IE9A 2CGXA 4PDSA 2A1AB 4ANQA 2ITTA 4X3FC 3BWFA 4DCAA 4IACA 4HVHA 3FMEA 1PF8A 2BILB 4BCFA 3PJ3A 2NO3A 3C5IA 2YJSA 4I5HA 3VHEA 4E93A 4PRJA 5CSPA 5DVRA 3TT0A 3M42A 4FTAA 1OVEA 5L8JA 3A7HA 3MH0A 4FTIA 5AMNA 3AC1A 4JVGA 4FTTA 4KKHA 4C4GA 4EH7A 1SVGA 4KKGA 4RIXA 5A6OA 4ZP5A 4D5KA 2PVYA 4FT7A 1ZOEA 2I0EA 4MCVA 1FOTA 4MEDA 3RAHA 3UQFA 3QUEA 2WMQA 3BBTB 3GC0A 2ONLC 2ZAZA 1X8BA 2G2IA 4FKPA 1H1RA 3ALOA 5H3QA 2YABA 2UW3A 3UOLA 4USEA 3OCTA 5AP2A 4D1XA 4N57A 3PSDA 5C9CA 4TRLA 3FQEA 3L1SA 2OJ9A 4IB1A 4AA5A 4AZWA 4WO5A 5M08A 3IDBA 1M2PA 2WELA 4W4XA 3EFWA 4K18A 5ANKA 2IW9A 2I0HA 5L2SA 1L3RE 3N9XA 2XVDA 2O5KA 4IJ9A 2B52A 3DBFA 5C1QB 4IB5A 4ORKA 4D9UA 5JFXA 1I09A 4RC4A 4GFMA 2H8HA 4RJ8A 4A9YA 2X81A 5JN2A 4G5PA 1OI9A 3F3ZA 2VTOA 4E6QA 4LGDA 3VF9A 2YWVA 5C01A 3QD3A 2BZJA 2XNGA 4YMJA 3NYOA 2BAKA 3DBDA 4NIFB 4BTMA 4H58A 5J5SA 4O21A 5HG5A 2PVLA 3KQ7A 5F20A 2CCHA 1QL6A 2VO3A 3O71A 4O0VA 1NW1A 3R9RA 4AN3A 2YCRA 4FKVA 5HTCA 4F6SA 3DPKA 5KKRB 4CFUA 3UNZA 3VQUA 2YIRA 3R7OA 1SMHA 5LVOA 5E9EA 1CKJA 4AS0A 5AUYA 2XYUA 3U9CA 3G33A 5EYMA 5ETAA 4QT1A 3CS9A 3V8SA 2QQ7A 2ZM1A 3PPZA 4F09A 3TNWA 3BELA 4FT0A 3ZH8A 5E8SA 4TYHB
chains in the Genus database with same CATH superfamily
3QD0A 5AA9A 3QA0A 4AACA 2GQGA 1PKGA 4GT3A 5AUXA 3PVBA 4MTAA 1TFFA 4KWPA 3G6HA 2OO8X 3NR9A 4ZTNA 5KMIA 5EHYA 2X2LA 4TT7A 3TNHA 4BDEA 4YLKA 4YJTA 3QCQA 4LL5A 3LOKA 2PU8A 2Y4IC 1PMNA 3DBEA 4ZTLA 3OY3A 2Q0BA 2Y8OA 3BU3A 3NYXA 3FLWA 4Y85A 2UW5A 5H8BA 5GZ8A 4O0YA 1ZZ2A 2C6IA 2R3FA 3ORNA 3ZUVA 3C4FA 4QQ5A 5CF4A 2C5XA 3OOMA 1FBNA 2Z02A 1MRUA 4DFLA 3BEAA 4NUSA 3F2NA 3BLQA 1KE6A 4KBCA 4U3ZA 4ERKA 3NNUA 5EDQA 1WFCA 2I7QA 3FDNA 4A07A 2R3MA 3CGOA 3DK7A 5FEQA 3OF0A 4O4EA 1TQIA 4XOZA 2W1EA 4QQCA 4Y72A 3TZMA 3QKLA 5D7AA 1PW2A 3ZEWA 3M11A 1GZNA 3QQLA 3MJ2A 4WG5A 4EK8A 4TPTA 3GENA 2YZLA 2RFDA 4LV5A 4BDBA 3UZPA 1W84A 4NFMA 3VIDA 3EQRA 3R00A 1NY3A 5DOSA 1AD5A 3KMWA 5HIDA 3PUFC 3DDPA 4DGNA 4YHTA 4JAJA 1XH5A 2RF9A 2AUHA 3FI4A 3KXGA 4MF0A 3FAAA 3KK9A 3GU8A 3A8WA 2OZAB 4OTGA 3TV4A 4O81A 3FZOA 4B6LA 2X4FA 4QMSA 1H1PA 3BYOA 3VBTA 2YM6A 4HGLA 5E7RA 4MKCA 4PY1A 3ZSIA 1JNKA 5L6WL 2JC6A 4C4EA 4AOTA 3ZSGA 3JYAA 5CU4A 4J98A 3UP7A 4TWPA 1XWSA 4RJ3A 4EOLA 3HAMA 4EH8A 4P4CA 4MBJA 4QTBA 4F0IA 3VUKA 4YNOA 3A8XA 4OBPA 2QG5A 2YFXA 3C0HA 4NTSA 5JFVA 3K5UA 2J0KA 3O2MA 2ITVA 3EWHA 3PPKA 4PL5A 4WNOA 5BVDA 5FGKA 1BL7A 4JMQA 4JR7A 1H27A 4EQUA 5DIAA 4FT3A 4JIAA 4ANLA 3BLAA 3L8XA 2J6MA 3LCSA 3R9NA 4X2NA 1OUYA 3BHYA 2C5NA 5AX9A 3ZLWA 5CU2A 3KKVA 2UZDA 1DS5A 4IZ5A 1Y6AA 4JLCA 3ZM4A 2AC5A 3PY3A 4MQ2A 4NM0A 5E90A 4WNMA 4LUDA 4XHKB 3TIYA 5A4LA 3TG1A 4CEGA 3NWWA 1KE9A 4G6LA 3KCFA 4W8EA 5DPVA 2F7EE 3FXZA 3H30A 3GI3A 1XH9A 2FSTX 4C4HA 3LZBA 2G9XA 4DH5A 5EI2A 5HKMA 4RWJA 3MYGA 4M67A 5HG7A 1ST0A 3MVHA 1U5RA 3R7UA 3CTQA 4GEOA 4LMNA 1UU8A 3W33A 1OZ1A 5DRDA 5E8YA 5A4QA 3QWKA 3MH3A 2A98A 4CYIA 4JXFA 4JRVA 4E6DA 4X7QA 2W96B 5T68A 2Z7RA 3JUHA 2C1AA 3GT8A 5B2LA 4ANMA 2UVYA 1JQHA 2X6EA 3B8QA 4EOJA 3UO5A 3UOKA 2JDVA 2VTAA 4BDFA 4NM7A 3TUBA 5CWZA 1YHWA 3KY2A 4GL9A 4O2ZA 3PVGA 2W1DA 3RPYA 5LCKA 5M4UA 3A7GA 3UZTA 4UYNA 2Q83A 2F7XE 4QP8A 1VJYA 5LWMA 2PE0A 5FQDC 4FOBA 3BKBA 3F3UA 4EQMA 5M56A 3F7ZA 3ZEPA 5HZNA 4CMTA 2BKKA 4DT9A 2QO7A 2PZPA 1OIQA 3E7VA 3E92A 3HV6A 3FJQE 3IDCA 4RIWA 4U7ZA 4UWYA 3ATSA 2UZNA 4QNYA 2EUFB 2UW8A 3AT3A 4FL1A 1BL6A 4I21A 4HVDA 4BCKA 4F64A 3D4QA 3BU5A 1FVTA 3ENMA 5C03A 2QODA 2YLFA 5AP6A 3CKXA 4M84A 4YSMA 4GRBA 3H10A 1DAYA 3ORMA 3KRXA 4WD5A 4FKGA 3JS2A 2FUMA 3ORKA 4V05A 2WMTA 3DBQA 4O6LA 1JKKA 2CKQA 3RHKA 2VWIA 3BV3A 4AT4A 3HVCA 5AP5A 2XMYA 2ZDTA 4I3ZA 4PMTA 5IMXA 2QOKA 2ITXA 4P7EA 3AKLA 4O0SA 2BHHA 3DKGA 4BCJA 3MIAA 3WILA 4BIBA 2PVHA 3C7QA 4DFXE 3CJGA 1JVPP 4IB0A 3PA5A 3ZTXA 4YBJA 2B55A 3ERKA 1H24A 3SRVA 4MWHA 1LEWA 4DGMA 4V01A 2W0JA 3RZFA 5KE0A 2XK7A 4G31A 2C6KA 1TQPA 3WF5A 4BB4A 3LPBA 1Q8YA 4OLIA 3Q32A 3D7TA 4C4JA 4AW2A 4YU2A 3NGAA 5GZAA 4OAVB 3PDTA 5LVPA 4MX9A 1AGWA 4O0WA 5DR9A 4FNZA 1BI7A 1DI8A 3GNIB 3LVPA 3EZVA 3EOCA 4MBLA 2ZDUA 3QTUA 4O4BB 5JGDA 2QURA 4AZEA 1OUKA 4XYFA 3SKCA 3FUPA 2VTJA 2QHMA 3UMWA 1FQ1B 4D2TA 3UOJA 4IAKA 3SHEA 5CEOA 4RLLA 3LFBA 4QMWA 2OH0E 5JEBA 5CS6A 2EVAA 2BZKB 2G15A 3ITZA 1SNUA 2ZM3A 3L9MA 4BCPA 2UZTA 4H05A 4K33A 5HCZA 3V5PA 4FG7A 2HOGA 1JSTA 4YHFA 2Z7LA 4TYJA 2PWLA 4D0WA 3P78A 3RZBA 1H1SA 1VYZA 3P0MA 3SX9A 2Y6MA 2ZV2A 1YOLA 4LFIA 5FEDA 4AXCA 4AQCA 2FVDA 3BL7A 3V5WA 5HIBA 1OITA 4MH7A 1BYGA 4DG2E 4R7IA 2UVZA 2YM5A 2GTMA 4YURA 3ET7A 4QDVA 2IPXA 5IF1A 4IBMA 1B39A 5JKGA 4QMUA 2C0OA 4XOYA 3PWDA 4QMVA 5JZJA 1CDKA 1VYWA 3LFAA 3S95A 4FTQA 3PWYA 2QOLA 3CP9A 3K5VA 3LLAA 3QYZA 4BCHA 4CNHA 5IQCA 3CD3A 2BR1A 4S33A 2BROA 4FSMA 3REPA 4J52A 5GJGA 4PNKA 5CEIA 3TNPC 2WHBA 2ITNA 4ACHA 2YIYA 3ZMMA 1UKHA 1UNHA 5CSWA 4AX8A 5J79A 2XK9A 4N4SA 3KXMA 3EQFA 2ERKA 4KD1A 1UU9A 2QLUA 5KZIA 4ERWA 2YIWA 5E4HA 2QLQA 3QTWA 4ITHA 3HRCA 1MQ4A 4IDTA 2IO6A 4BCOA 4M14A 3EQDA 1OL7A 3PJ2A 1SVEA 2F2UA 5FM2A 4O0RA 3TDWA 2PE1A 3BQCA 4U9AA 4RGJA 4IWQA 4L8MA 5HCYA 3NAYA 5EHLA 3MPTA 5BVKA 4FKOA 3BRBA 4ALWA 4EH2A 5BVOA 5M4IA 3FLYA 5HORA 4GMYA 2IWIA 2VWBA 3HA6A 4GV1A 2X2MA 5A4CA 4WA9A 5EFQA 5CNOA 1ERKA 2PVKA 3P23A 4F1MA 4W4YA 4WSYA 2ZMDA 4C58A 3FL4A 4EK6A 1H07A 4FV9A 3GQLA 4DT8A 3NMUF 4FK6A 4WHZA 3FI2A 4KAOA 1R0PA 3CSVA 4AXEA 3BYVA 1ZLTA 4ZJJA 4E3CA 4DG0E 1BLXA 3OBGA 5HLPA 2QHNA 4ACDA 4Z3VA 3KRLA 4DHFA 2Y9QA 2EXCX 3GEQA 3P4KA 4IFCA 4KSQA 4MWIA 1VR2A 3EMGA 4A4LA 5BYLA 5E8ZA 4BCQA 2C30A 2RFNA 1VEBA 2HZ4A 2QVSE 4Y83A 4XCUA 4QMLA 4YZNA 4DAWA 4L42A 2ITWA 4CGAA 4FICA 2XEYA 1LP4A 3CXWA 4NH1A 2OJJA 2H96A 1P2AA 2XJ0A 1GNGA 1YWVA 2BKZA 4UZDA 2B9FA 2OIBA 3V5LA 4IADA 5HICA 3QUDA 3D7ZA 4B8MA 4LMUA 1Z9XA 4H3QA 5GJFA 5AUWA 4XLIA 2VTIA 3OC1A 2BAJA 3E8NA 2W1GA 1WBPA 3MESA 5C8NA 2VX3A 4RX5A 1GIHA 3W2SA 3UZRA 5CAPA 4NKSA 3MW1A 2XANA 3FSKA 4YZCA 5TKDA 1WBTA 4JDIA 3KULB 3SAYA 2PZRA 2P4IA 4ZZNA 1OGYA 3V01A 5KMNA 3FEGA 3CBLA 3LFFA 3WZDA 4G6NA 4BI0A 4JDHA 2Z7SA 2IVUA 4QDEA 1S9IA 4DC2A 1O6LA 1PXJA 4JQEA 2WIHA 3ZRLA 4TYEA 3M1SA 3V3VA 1YW2A 4GVAA 2CKEA 4B4LA 2X39A 5D1JA 4Z7GA 3U8WA 4D28A 3ZRKA 5CEKA 3R01A 3OT3A 5JRQA 2VTNA 3NVMB 4WBBB 4TNDA 1FPUA 2HZ0A 3GCSA 4LRMA 3RTPA 1KOAA 5IMEA 3ZM9A 1YQJA 2PVRA 2F49A 4K6ZA 3TNIA 5KMMA 3GCUA 2VNYA 2OFUA 3ZRMA 2IVTA 4ENXA 3UODA 5IDPA 5BQ0A 4C8BA 3ULZA 3KVWA 4W9XA 2ZOQA 3PLSA 2CDZA 4MNEA 2C3LA 4KB8A 3WI6A 3DGKA 2I0VA 2C6EA 3IDPA 3NUSA 4DLJA 3W0QA 3H4JA 2OSCA 2OZOA 4WBOA 3BI6A 3O96A 3OXTA 2BUJA 2I6LA 5EKOA 4O7WA 4O4FA 3KFAA 3CCNA 2QR8A 4KSPA 2W4OA 5LARA 4MQ1A 2GHLA 3RVGA 5HQ0A 1H26A 4R6VA 3VUDA 5C4LA 2O3PA 4FIEA 3BCEA 4FNYA 2E9UA 3DB6A 5ACKA 3R63A 3E8EA 4C34A 1EH4A 1MQBA 3NNWA 4PTGA 2J0LA 3ZO3A 3MBLA 5F95A 3TNQB 4FL2A 5HD7A 2ETKA 1ZY5A 3O51A 3OS3A 4ZJIA 4FR4A 4FG8A 3BBWA 4I92A 4TWNA 3SGCA 3GCPA 5FD2A 2PYWA 2CN5A 5M4CA 1YI4A 4I24A 4C2VA 4FTLA 2AQXA 4MXXA 3OROA 4AQKA 4E73A 2GCDA 4BBEA 3VW8A 5DT0A 4I6QA 4BWKA 4PMSA 3S0OA 4S34A 4C35A 3RCDA 4ZLZA 2IZSA 4IZ7A 3T9IA 2EWAA 2J5FA 4R5SA 4O0TA 4KIQA 2BALA 4X0MA 5CENA 5J9ZA 3B2TA 5AIRA 4E20A 2P33A 5DNRA 5K3YA 4BF2A 2YJRA 4NFNA 3TKUA 4GVJA 2R7BA 4MVFA 3MS9A 3QRJA 3GFWA 3MPAA 3MDYA 4QMOA 2OGVA 3CQWA 5EH0A 4X2KA 2IZTA 3O23A 2XIRA 3GQIA 3SXFA 3DLZA 3ZS5A 2J51A 2JGZA 3W2CA 2JFLA 4M66A 4JL9A 3IW6A 3MN3A 3A7IA 3NCZA 2V7AA 5C8MA 5AEPA 4FEWA 3F7WA 3ZO2A 2GNJA 4E1ZA 5BUJA 5CEMA 3TI1A 3HECA 4U43A 5AP1A 5M4FA 2H6DA 1QCFA 2VUWA 1Y91A 3DK3A 4HPTE 3U87A 2B7AA 3HMOA 2PUIA 4R7HA 4CCUA 2C69A 3MTLA 4BDAA 2VO7A 3D2IA 5C8KA 4H36A 3FLNC 2W9FB 3T8OA 5CNNA 3HUBA 3P7AA 3VAPA 5F4NA 1ST4A 4C36A 1W2FA 4FJVA 3BQRA 2IEWA 4O4DA 3VW6A 4GS6A 3FLSA 4PF4A 4EBVA 3MB7A 3KXXA 3F2RA 5DEWA 4AUAA 2VO0A 2ZV7A 4RMZA 1BUHA 1OL2A 2F4JA 3WOWA 2R3LA 2W1CA 4AFEA 1UKIA 4O7LA 1MRYA 3FL5A 4NCTA 4DHZA 4NJ3A 2OW3A 2JKOA 4S31A 3EKKA 2ZVAA 5FDPA 4A4XA 4NL0A 4RBLA 1XR1A 3LCDA 4FKUA 5DT4A 3P79A 4ACMA 2VWUA 2VX1A 2W4JA 3POZA 1H0WA 3F88A 2CNQA 1WVYA 2ZMCA 3FSFA 3R9HA 3FMJA 4OTIA 4ZSGA 3MV5A 3UIMA 2Z60A 4GYIA 4CQGA 4Y5QA 4A9TA 1XH6A 3HV7A 3PVWA 3RP9A 3QCYA 4IZAA 3ZC5A 4CFFA 2IG7A 4D2WA 1OKZA 5HD4A 1BI8A 4AN9A 5IA3A 4HYUA 2J0MB 4XV1A 5I3OA 4IC8A 3I0OA 5BVFA 2OBJA 5J9LA 4C3FA 4R3RA 2VWVA 4AZVA 3BYMA 5ICPA 4M13A 5DYJA 4I6BA 3ZC6A 4E5BA 2R3GA 5BVWA 3BGQA 5LMKC 3HGKA 2C1BA 4YO4A 2PPQA 3T3UA 2XKCA 4X3FA 1YKRA 4F9YA 4F7NA 2WTKB 5M53A 5IA2A 4E5WA 3PSBA 3EN4A 1XHAA 5AFVA 4Y46A 4WIHA 3CC6A 3C0GA 3PE1A 4B0GA 4QP7A 4XJ0A 4MD9E 2IW6A 3W8QA 3FHRA 4YC6A 4OT6A 2X4ZA 2ZYBA 4CFVA 2XK6A 2YM7A 2EXEA 3CQEA 4OTWA 1ZOGA 1U54A 2C5OA 2JITA 5DR2A 5CSXA 4O0XA 1FVRA 1JKLA 4RFZA 4WNPA 3EL7A 4QYHA 3COKA 4GU9A 2ZV9A 3M2WA 4GT5A 4DINA 4DF3A 3ULIA 4CFWA 4F08A 2FSMX 4EORA 3RPVA 4I4EA 4HCTA 4CG9A 1G3NA 3AMYA 4HOKA 4FNWA 4RJ5A 2C47A 3VBVA 1BKXA 3RK9A 2BHEA 2BZIB 4RSSA 4MBIA 2BRNA 3VUTA 4LYNA 4L3LA 4NW5A 1FMKA 3ACJA 1UNLA 3IQ7A 1R3CA 5EM6A 5IH4A 4QD6A 3LFCA 1Y8YA 3UVQA 1LEZA 3BGPA 3QXOA 2VU3A 3UNJA 3TKIA 5IISA 2UW4A 2QONA 4FIIA 4BTJA 2R64A 1NVQA 4RVTA 4RWKA 4CKIA 4DYMA 5HE0A 5FUTA 4U0IA 5GHVA 3E8DA 3HMIA 4DCEA 4RT7A 4M8TA 5CXZA 3MFSA 3E3BX 3C13A 3W0PA 2OI4X 4I0SA 1PXPA 2IF8A 3VUGA 3NRMA 2PHKA 3NEWA 3QZFA 2BDFA 3QYWA 2YIXA 3FZ1A 4OTPA 4AGCA 2A0CX 3GGFA 2HXLA 4I41A 5EDPA 4EJNA 2EB3A 2XARA 4BL1A 3PSCA 3FLZA 1Q3WA 5BMSA 3D2KA 4ZTHA 2WU6A 5ANJA 5IG1A 1IR3A 3KEXA 4DGLC 4BR3A 4ZEGA 2H9VA 2VX0A 3I6WA 3ORZA 2BFYA 5J7HA 4CLIA 5KMLA 2CMWA 4L53A 5DGZA 4NWMA 3UBDA 5AV0A 2X9FA 2XRUA 3FPQA 4MXYA 4DH3A 5A14A 2XK3A 4FVPA 3NUXA 3GVUA 4BVUA 3Q9ZA 4ZZOA 3CTHA 4YC3A 3UE4A 5G1XA 4YHJA 1PRYA 5JGBA 3OBJA 3ORTA 2JEDA 3P08A 4FL3A 2FB8A 5CALA 5IA1A 3N4UA 4L43A 5EI6A 4BI1A 3FMDA 5E8UA 4PX6A 3NW5A 1V0PA 3W18A 4DTAA 3BE9A 4HGSA 4ZK5A 4DEEA 4AGUA 3RHXA 2OLCA 2BZHB 1Q8UA 3C4CA 3O0GA 2FSLX 3HMMA 3R1SA 2G2FA 4J8NA 3WF7A 2AYPA 5AIKA 4EHZA 4F6UA 1J7UA 3MWUA 2JKQA 5DH3A 3AKKA 3R6XA 4FV3A 5DR6A 4IB3A 3ODZX 3DNDA 3EKNA 3O17A 4L9IA 3QRIA 2KULA 2RGPA 4ARKA 2X7GA 1YHSA 4ITJA 3N4VA 3R83A 4X6RA 4R77A 4C3RA 3RMFA 5AR4A 3RALA 3UQCA 3TZ8A 2XZSA 1PMUA 4IWPA 3F66A 4BDJA 3CY2A 2W7XA 5HG9A 4IX5A 2XAMA 4F63A 1CKPA 3IS5A 4ZOGA 1Z5MA 4CFNA 3GC8A 3HRFA 3E8CA 3GXLA 5D9HA 3PRIA 4JJRA 5CU3A 3NSZA 3UIUA 4JBOA 4I5CA 3EN6A 4YZDA 5IQBA 3QA8A 2P2IA 4U8ZA 2ZJWA 4QMPA 4H1MA 3LKMA 5HE3A 2YAKA 5CSVA 2GHMA 4X6QC 4IVCA 5AWMA 5LMAA 4EWQA 4L44A 3ZDUA 5G6VA 1Q3DA 4U40A 2VV9A 2PUPA 1W83A 3LFSA 4RZWA 4RA5A 2VTMA 1ZYJA 4FRFA 4UEUA 4BC6A 5F9EA 2YLEA 4RC3A 4R7BA 1OBGA 2W06A 4JX7A 3R8PA 3D7TB 4IWOA 3VS3A 5A9UA 3MI9A 2IZUA 2W9ZB 3BPRA 3COIA 4IAZA 2X9EA 2PVJA 2BRMA 4RC2A 3JXWA 3QQJA 3OWKA 4OR5A 3G0EA 3BL9A 4E5AX 4D9TA 2ERZE 2RIOA 3PLAE 3QX2A 4OTRA 5B2MA 3S1HA 3COHA 5CYIA 1Q4LA 4DG3E 3E62A 3SD0A 5M06A 4AWIA 5TOZA 5ANOA 4EH6A 4MYGA 3NAXA 3CPBA 2YM4A 4YP8A 5A4EA 4QMZA 2OH4A 3A99A 3LFDA 4IM3A 2QOOA 4F0FA 1FMOE 4L45A 1PXIA 4M7IA 1WBSA 3OTVA 4AE9A 4ZSEA 2WMSA 4EHGA 5H8GA 5CU0A 4HJOA 3AT4A 5HO8A 2FA2A 2ITZA 3A2CA 3VVHA 4QMXA 2C6OA 3TV6A 2OF4A 2J4ZA 5HESA 1OL1A 1XJDA 4JT3A 3GUBA 4QYGA 4RZVA 5HI2A 2UZBA 2PVFA 3HRBA 4QYYA 4CT2A 3FI8A 4RFYA 4W9WA 3RWPA 2Y7JA 1W82A 2R2PA 3DTCA 3NUYA 2GFSA 4G5JA 4W4WA 1H00A 5FBNC 5K0KA 1IA9A 2DQ7X 3MIYA 2C4GA 4GK3A 3TDVA 4DHIB 5AR8A 3SXSA 4ACGA 4YLJA 3KXNA 4BBMA 3H9RA 4FTCA 3U6JA 5IU2A 1YXUA 3L9LA 4R1YA 1UA2A 4UWBA 2R3OA 3UGCA 3IOPA 4F0GA 4FX3A 1OKYA 2G2HA 4DH7A 3OTUA 3ZUUA 1J7LA 4R3CA 4XG8A 4EKKA 4BJJA 3ZDIA 4EZ3A 4EUUA 1M17A 3I60A 3OWJA 4ACCA 4QO9A 4JS8A 4ZY4A 4ANBA 2WQNA 4UX9A 3AC2A 3COMA 3OOGA 4IVDA 5FP5A 3VS0A 1XH8A 3KMMA 3G51A 3KRJA 1YRPA 2GNLA 3G6GA 5IQIA 4OTQA 4Q2AA 2ZM4A 4CRSA 4Q9ZA 4O7TA 3UPXA 3D9VA 4BGHA 4UYAA 2E9NA 2RFEA 4C33A 2YCQA 3L8SA 2JKMA 2UV2A 1GIJA 3RK5A 2QU5A 3V8TA 4AGWA 4UXQA 5HVJA 3EH9A 3U51A 1F3MC 2QO2A 3BV2A 1TVOA 5HX6A 4PL4A 3LM0A 2J90A 3W8LA 4RIXB 3PIXA 4FGBA 2FH9A 4I5MA 4O7ZA 2QOHA 3FXXA 2W5HA 3JPVA 3QKKA 3EJ1A 4IAAA 3LMHA 5AAFA 4HZSA 2DWBA 3AGMA 3TN8A 4CV8A 3SOCA 5HHWA 2R3HA 3NS9A 4G1WA 1DAWA 4RX7A 4D4SA 5L8KA 1K9AA 3HAVA 4DBXA 3QQFA 2IZRA 4Q9SA 4W4VA 4AOJA 2ACXA 1Q41A 1Q8WA 2R3QA 4I22A 5EKNA 5LJJA 3DTWA 3ZONA 2BPMA 4QTCA 3A62A 2PMNX 3EQPA 5B0XA 2PL0A 3FQSA 3GU6A 5ANEA 5HCXA 5J1VA 3EQGA 3BEGA 2X0QA 3UTOA 2X7OA 3R04A 1YVJA 4FZAB 3KB7A 5DG5A 3UC4A 2X2KA 3ID6C 4ASEA 5HG8A 2WGJA 2Y4IB 2P55A 3FYKX 5BVNA 2IJMA 4YTHA 3QTRA 2B9IA 4QP4A 4AOIA 5HNIX 1GAGA 4O27B 4XNEA 3OG7A 4QPMA 4O4CA 5FP6A 4WG4A 4C37A 2VTRA 4BZDA 5B7VA 2E9VA 5JZNA 2WEIA 2Z8CA 2GSFA 4CZTA 2YN8A 3PG1A 4OUCA 4K0YA 1J7IA 3BLHA 3MPMA 2QKWB 2WEVA 4FV2A 1OPLA 1M7QA 5FDXA 4M3QA 2PULA 4BBFA 4M0YA 4CD0A 4LM5A 3RPRA 2HY0A 2UW9A 3VS1A 5KUPA 2YDIA 4EC9A 5KMJA 2OZAA 2JDTA 1YOMA 3RWQA 4EH5A 1ZWSA 3U4WA 3AC3A 4FSRA 4UMUA 4AG8A 2WXVA 2WMBA 4QMTA 3WE8A 3L8VA 4QQTA 4DFNA 4HVGA 5CF6A 3QZGA 2XJ1A 4BDIA 3W0SA 5CVGA 3ZBFA 4IVBA 4C2WA 2PTKA 3DFAA 3MH2A 4ZTMA 3HZTA 3PYYA 1J1CA 3W2RA 2CN8A 3BU6A 4QTAA 4GK4A 3ANQA 1ZXEA 1MRVA 2X8IA 3FLQA 2I40A 4I94A 3UQGA 3SA0A 2UZLA 2J0JA 1JSVA 2B54A 4I0RA 3IOKA 5HO7A 3DAKA 4AE6A 1O9UA 4BHZA 1UWHA 4L46A 3IW5A 4A9UA 4O82A 2GNFA 5EW9A 1LUFA 3ETAA 2HY81 3BHUA 5BVEA 1KE8A 3G9NA 2YAAA 3JVRA 5IA4A 2ETMA 4BDCA 3V51A 4FC0A 4HCUA 4YZBA 4PWNA 4XV3A 4H3PA 3CTJA 4XP0A 4J53A 4KIPA 3VRZA 4HYIA 5HEZA 4FZ6A 3II5A 2HZIA 3W10A 3UYSA 2OXXA 4LDTA 2OFVA 4AA4A 5A46A 4U5JA 2RKUA 2WNTA 4OBQA 3DU8A 5AADA 1WBOA 2XNOA 4UMTA 2YCSA 3F3WA 3HV3A 4U81A 2R0UA 1OIYA 4FODA 2HWOA 1U5QA 4FV5A 4XP3A 4YBKA 4ZY6A 4KUJA 4O7YA 4AU8A 4EH3A 2WIPA 4AFJA 2BTRA 3DQWA 3WIKA 4EYJA 3PIYA 4BDDA 3GOPA 3KXZA 2O8YA 3ZO1A 2OJGA 4JG6A 5ANDA 4YGAA 4G9CA 3RJCA 5IEVA 1LPUA 2YDKA 3ATTA 5D41A 4XRLA 4J8MA 4Y95A 1Q8TA 5KMOA 3NUAA 5GIPE 1Q8ZA 3TZ7A 4ZLYA 4FMQA 1RJBA 3FMMA 5IQEA 3C4WA 3RKBA 3Q4UA 4HYSA 3VUMA 3UO6A 1ZZLA 4GG7A 4D0XA 4JBVA 3ZOSA 3UOHA 3ZYAA 4DTBA 1Q24A 3NCGA 1OIUA 3QD2B 4S30A 4K11A 1HCLA 2PZYA 2QR7A 3FBVA 3P86A 4JBPA 4BDKA 5FBOA 4CSVA 4GKIA 1R39A 3EZRA 2XNEA 3BE2A 3L8PA 2F2CB 1JOWB 4FV6A 2PVNA 4IAIA 4FEVA 5FTQA 4FNXA 3GB2A 4FV7A 5CU6A 3P9JA 4BIDA 4FSWA 2HENA 3TEIA 1RDQE 2G01A 4DEDA 4CXAA 2CNVA 1YWNA 3L9NA 3ORIA 3ZCLA 3PZHA 4H3BA 4CZUA 2WPAA 2GTNA 5TF9A 5CASA 4XP2A 4IM0A 2YCFA 2JDOA 3P5KA 1TZDA 4ALUA 5GZ9A 2UVXA 2B9JA 1K2PA 2OK1A 3C4XA 2X6DA 2WMRA 5AP7A 3PJCA 4GYGA 3VBYA 3WE4A 3P7BA 2OXYA 2NRUA 2GS2A 3QQKA 4U3YA 2JAMA 3IG7A 4IANA 4F78A 4PPBA 5L2QA 2VNWA 3BLRA 3R0TA 1ZYLA 5FRIA 4GJ2A 4LRJA 5AAEA 4YTIA 2F9GA 4L7SA 2WMWA 1JAMA 3VS4A 4AZFA 3ZZEA 4FSUA 1UVRA 1OMWA 1OPKA 2REIA 3Q4ZA 3AD4A 3Q04A 3SRVB 2XNNA 5KNJA 4X3FB 2WMXA 2UUEA 3EL8A 1SM2A 5HNGA 4UN0C 3EN9A 1TQMA 4D1ZA 5KO1A 2ITPA 3DAEA 3QTIA 3LCTA 5CZIA 2IN6A 3QQUA 4IHPA 2JLDA 3VBXA 5K4JA 3PA3A 3PXYA 3QRTA 4YJRA 2XF0A 4DTKA 5JMSA 3AC4A 2HZNA 3DOGA 4D58A 3ZU7A 4ZY5A 2C5VA 4PDOA 4FV0A 5EM8A 5T6KA 1A48A 3HL7A 5CTPA 2P2HA 4C3PA 3AT2A 4PV0A 4QQJA 4YUQA 3CQUA 1OB3A 2W4KA 4FV1A 1V0OA 4PDPA 4YO6A 2C6LA 2J2IB 5JT2A 3FMKA 4OTDA 4C57A 4EZ7A 3F69A 2HK5A 3O7LB 5HLNA 2WTDA 3BYUA 5DWRA 1Y57A 2W5AA 1R0EA 3F5UA 2A27A 4ZSLA 1QMZA 2O0UA 2B53A 3NPCA 2A19B 3KXHA 3OXIA 3BX5A 3FZRA 3QTQA 3DKCA 4FSNA 3W2OA 4P2KA