3MH2A

Mutagenesis of p38 map kinase establishes key roles of phe169 in function and structural dynamics and reveals a novel dfg-out state
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
348
structure length
330
Chain Sequence
RPTFYRQELNKTIWEVPERYQNLSPVGGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDYGTRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mutagenesis of p38alpha MAP kinase establishes key roles of Phe169 in function and structural dynamics and reveals a novel DFG-OUT state.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Mitogen-activated protein kinase 14
total genus 103
structure length 330
sequence length 348
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2010-04-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3mh2A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3mh2A01
3VRZA 1I44A 1PXKA 4FG7A 1WMKA 2ZMCA 4GT3A 5CF5A 5DMZA 5M53A 2BRNA 4FIEA 4X3FB 2VNYA 4DF3A 2I0HA 3IKAA 1Q3WA 5DA3A 2GQSA 1ZXEA 1SZMA 3ORXA 3FL5A 3V3VA 4G31A 2XNEA 5HICA 4F1TA 4XNEA 1Q8UA 3QKKA 3VUTA 3ZC6A 3FZRA 4UALA 3BV2A 1UA2A 1M17A 2I40A 3CPBA 2V7OA 2F49A 4CXAA 4DEIA 1WBOA 3QA0A 3UYTA 4YGAA 3DK3A 3NUNA 5AFVA 3A7IA 2QOIA 2BILB 4B4LA 3DB6A 4FK3A 2UW9A 4RX5A 3U6HA 4ANLA 1OIQA 3QX2A 3TUBA 3BWFA 4PPAA 3U87A 5JFSA 3QCYA 4JBPA 1GAGA 5TE0A 3KQ7A 3C1XA 3PYYA 4XX9A 1URCA 5M4FA 4PMPA 5A6NA 2QOKA 4F64A 4MAOA 4QP6A 1A48A 4W8DA 3RZBA 3VS1A 4YJPA 3NLBA 4Y95A 3OCTA 1T45A 5H9BA 3NEWA 2Q83A 2C6OA 4CRLA 1APME 4FIHA 4F70A 2W1ZA 4X6RA 2PVMA 3I60A 3RCJA 5LVPA 2W06A 4PDOA 2YCQA 4Z7GA 4D58A 4O7VA 4JAIA 4O7WA 4MX9A 2JLDA 5L4QA 1Z57A 2HWOA 4FSZA 3F3UA 1UNLA 4DE4A 1HCLA 5ETIA 4JLCA 1YQJA 4FTTA 3VS7A 4XG6A 5M4UA 2I0VA 1ZMVA 4O7ZA 3QRTA 4G17A 1XHAA 4FV3A 3DLSA 3QZHA 4HZRA 1U5QA 3DKGA 3H4JA 3G51A 4D55A 4BDDA 1H1RA 5E7RA 4PP9A 2UW3A 3DZOA 5JFWA 4C58A 4NH1A 1P14A 3QA8A 3QUDA 2B7AA 2IO6A 2XK4A 3KXZA 3PY1A 3QYZA 3PPKA 4OT5A 4I5CA 1W8CA 1SMHA 2V5QA 3F2NA 4ARKA 5F9EA 2PUPA 1Y57A 5JFXA 4XG4A 4ZTLA 3F3ZA 3RK9A 3ROYA 1NVSA 5HO7A 4CV9A 3NPCA 3D94A 5FDXA 5C8NA 4FT7A 1UNHA 3BLRA 3PSBA 2XJ0A 5FD2A 1XWSA 2W0JA 1GY3A 2B9FA 2O63A 2WO6A 3PVUA 4RIOA 2FSTX 3LXPA 1E9HA 4WNMA 4O0RA 4XOZA 5AUWA 5J5TA 3UODA 2XK7A 2PUIA 3ACKA 4EOIA 3GCVA 3KRJA 5DOSA 3S95A 4WUNA 3IOPA 1XBCA 3EN9A 4GH2A 3RNIA 3IECA 5BUEA 4PPBA 4RC2A 3FI2A 4U41A 4P5QA 1M52A 2WU6A 4UXLA 3BYMA 2ITNA 5C8MA 2P4IA 4ZS0A 3VUIA 3QLGA 1OMWA 3NW5A 3UP7A 2WU7A 1IA9A 4V0GB 5HE2A 4O7YA 3RNYA 2W1GA 3GOKA 4H39A 4WO5A 3R7YA 4BL1A 5CF6A 4FI1A 4BDGA 1OKYA 4YSJA 2VTRA 2OFUA 5HU9A 3PWYA 4LUEA 4NWMA 4C4GA 4C2VA 4TTHB 4NTSA 4C57A 3G0EA 1JVPP 3QGYA 2ZV9A 4L3PA 2BDJA 5C03A 3WILA 4V05A 2BAKA 4RG0A 4Y73A 4Z3VA 4YTHA 5EM5A 3V04A 3BLQA 3K3IA 4KKHA 4E6QA 4R78A 4FTQA 2ITPA 3LCSA 5D9HA 4AZFA 4B99A 5E1EA 1Q99A 1RE8A 2X39A 2VWZA 2OGVA 4FV4A 3KVWA 4UEUA 4QMQA 4FKRA 5EHYA 2CGUA 4HOKA 4AQCA 2IPXA 3QWJA 1B38A 3SOCA 4ZZMA 4AE6A 3QKLA 3B8QA 3SC1A 4TKSA 3QTRA 4KS8A 3SW4A 4BFMA 4FGRA 3EL7A 3D2IA 4F0IA 4G3EA 4GK3A 3LCKA 4CEGA 3I4BA 1G3NA 1YXXA 2YA9A 4FV2A 4CQGA 3FEGA 4ACGA 4H3BA 3OCSA 1NY3A 1PXIA 4QT1A 3UC3A 2GHGA 5BVFA 4MD7E 3AXWA 3R6XA 5AP0A 1YI6A 2Z7QA 4MD8E 2WPAA 5CXHA 1R0PA 4ZLZA 3C0HA 4KAOA 5CZIA 4X3JA 4CFNA 3HMNA 1YDTE 2BAJA 1BL7A 2R5TA 1Y6BA 4YJRA 3V8SA 4D2SA 3UMWA 1ERKA 4BCOA 2NRYA 2JD5A 4ZSGA 3LM0A 3P7CA 1P5EA 3CC6A 4QYYA 4KNBA 4JR3A 4OTIA 3C4WA 3EN5A 2GTMA 1J7LA 4XYFA 3KCFA 1ZOHA 3IW6A 2VAGA 4LV5A 3OY3A 2VWVA 2XRUA 2YACA 4UWCA 1OI9A 4ZZOA 2X2KA 4UMQA 3H3CA 4BI2A 4ITHA 3QQKA 4EYMA 3NWWA 5A54A 3LCOA 3CXWA 3LXLA 3NUXA 3MA6A 3PXRA 4R8QA 4DGGA 4EH4A 4OAVB 3ZUUA 4IZ7A 3EFLA 4JDIA 3LFSA 2IW9A 5AP6A 1NXKA 3E62A 4F6WA 4EKKA 2BRHA 5E8VA 4F08A 3Q9WA 4ZY6A 1UVRA 4R6VA 4DFZE 4EQUA 5A9UA 3QQGA 3FQSA 3SXRA 4QYEA 3FWQA 5G1XA 4B9DA 4Z16A 5I9YA 5JH6A 3R63A 4A9UA 5IF1A 2XKDA 1YXSA 5EM6A 3RPVA 3KRWA 3MVHA 3OW4A 4YJQA 5AUZA 4MQ2A 5ICPA 1NT2A 4U9AA 4YTCA 2QQ7A 1B6CB 3MGYA 2Y4IC 3ORMA 5FP6A 3TWJA 1IASA 1YVJA 3OHTA 4G6OA 4FT9A 3ZSHA 4C59A 4CCUA 3V5QA 4PWNA 4I4EA 4Y8DA 3UIUA 3KFAA 5DGZA 2QU5A 3HP5A 3TV6A 4AZEA 4EOOA 5IZFA 2A19B 1H4LA 2C3IB 2HXLA 2J5FA 4ZTRA 4G2FA 4XV1A 4QMOA 2B9IA 5DT4A 1XBAA 5FXSA 1NVRA 1GOLA 4YSMA 4BCIA 2YIXA 4E6CA 1Q24A 5B0XA 4MBLA 3MTLA 5HLWA 3PLSA 4IM0A 4JXFA 5CU4A 3TKHA 3PVWA 2RG6A 4CLIA 3ULZA 1PMVA 3PA4A 4U8ZA 1FMKA 4NK9A 5EFQA 4F7NA 2H6DA 3QD4A 2XVDA 4CLJA 2GHMA 5BMMA 4CMOA 2FUMA 3PPJA 4D4YA 2DWBA 2OZAA 5JMSA 4RIYB 1V1KA 2QKRA 2WMUA 1PXOA 1P2AA 1WBTA 3O23A 4YNEA 2IVTA 4ZTQA 3DB8A 4ASDA 3JR1A 4QNYA 4Z55A 3FYKX 3GI3A 5EW3A 4LMUA 2HZ4A 3FYJX 3S4QA 1SYKA 3ZEWA 3LOKA 4ENXA 3VQHA 4AW5A 2E9UA 2WZJA 3C4XA 4OTWA 4EOMA 4USFA 3D5XA 2QOOA 5DWRA 4BZNA 2VNWA 3W2RA 2X9FA 3DK6A 3ZSIA 3ENHA 2NRUA 3ORKA 3FLYA 3KULA 3UIMA 4C3RA 5L2WA 3NW6A 4KKGA 3ZBFA 2HOGA 4ITJA 4KIOA 5AMNA 4DEDA 5IA2A 2JAMA 1JNKA 2GDOA 4O2ZA 2GFSA 3F88A 3VW6A 2BPMA 4RBLA 1G8AA 2XEZA 3RHXA 3DY7A 3EKKA 3G6HA 4TNDA 4UMTA 3C4CA 5JGDA 1VYZA 1B39A 1DI9A 1JKTA 4QMUA 4EYJA 2WMBA 4H1MA 3BQRA 3RTPA 3HV5A 4XG8A 4F9YA 1GJOA 2PVHA 3EQFA 5CANA 4GCJA 3EN6A 4FSYA 1GZKA 3COKA 2C30A 2VTJA 4X2JA 3EHAA 3BGQA 4H36A 4FV9A 4FTRA 4KA3A 3FLWA 4ACCA 4AOIA 3EFKA 4IAFA 1JQHA 4CCBA 4F7LA 1CKPA 2JBPA 2VTSA 1LEWA 2W9ZB 3DQWA 4FOCA 4RQVA 1JBPE 3VC4A 4I22A 3WZUA 4U3ZA 4DH7A 4MXZA 3Q4CA 4OLIA 3SA0A 3TZ8A 2VWUA 4Y46A 2Z60A 2C5XA 3ZXZA 4F7SA 3CTQA 2ZVAA 4ALWA 1ZMWA 4M0YA 1M14A 2JBOA 4R3CA 3QHRA 3KN5A 1SVEA 4JG8A 4OAUC 3E64A 1OPLA 1E1VA 3ERKA 2GMXA 4X21A 5HESA 4G5PA 1YWVA 2PVLA 3Q2JA 5B2KA 3LFNA 5DR2A 4X6QC 3BIZA 2JIVA 4AX8A 2R3MA 2ZM1A 2BVAA 3O51A 4BBMA 2R4BA 2UUEA 5EYKA 5KO1A 4UMRA 2W4KA 3DNDA 4NM5A 3RM6A 2WIHA 1WZYA 4F0FA 3MIYA 1JPAA 3L8SA 3ZZWA 4HVSA 1UV5A 3POZA 4DTKA 1REKA 3NUPA 3F7ZA 5HVYA 4ZY5A 3EQIA 3ZLWA 4LV8A 3BI6A 5ANIA 4WSQA 2XK6A 3FZ1A 3RAIA 3IW4A 4O86A 1M2RA 1JAMA 1QPEA 3HVCA 3ORPA 2AC3A 5IUGA 1VJYA 3P79A 5K5XA 3BGZA 4O6EA 2OLCA 3MI9A 4ALUA 2NO3A 3LJ1A 2PUUA 3E63A 3OEZA 4HNFA 2WTWA 4QQ5A 3JPVA 4JR7A 4XS2A 2JDTA 3COHA 3HV6A 3EKNA 2R3JA 2VO0A 3HX4A 3JVRA 4FV0A 3VUHA 4EL9A 2P3GX 2BR1A 4RJ8A 4K0YA 3MH2A 3R7EA 4BYIA 5HLNA 1WBVA 4R7BA 3WZDA 2VTPA 4AU8A 3LAUA 5HCXA 3R21A 3TNHA 4C38A 1J1BA 5DH3A 2LAVA 4WRGA 4LUDA 4K8AA 5E8XA 3MIAA 4AW0A 3BU5A 5FM3A 2F2CB 5B2LA 3DAJA 2C68A 4Y5QA 5KKRC 1R39A 5J87A 5JN2A 3N4TA 4XV3A 4B0GA 5GHVA 3O2MA 3JUHA 4C4IA 4QTCA 3VBYA 2REIA 2GNGA 5A4QA 3OD6X 1YHVA 4DFUA 3SHEA 4NYEA 3FPMA 3E8DA 1U5RA 3KF4A 5M4IA 4TPTA 5AR8A 3R9HA 3NGAA 3D83A 2VZ6A 2J90A 3K54A 1XO2B 2BHEA 2BZHB 4EZ7A 4IVCA 2W1DA 1ZY4A 4FICA 3U6JA 1U54B 3WZKA 3PZHA 4FBXA 3RPOA 2YWPA 3FI4A 4O21A 5BVDA 3ROCA 4AE9A 3GFWA 5KHWA 3ID6C 1CDKA 1H0VA 4MF0A 5CI6A 4GKIA 4TY1A 4YJUA 1F3MC 4JI9A 4RA5A 4USDA 2E9NA 3LCDA 3MW1A 3QLFA 4JIKA 2JFMA 2R3IA 2UVZA 4GT5A 5CF8A 1Q41A 1QMZA 3GQIA 4YC3A 4D1SA 1YXTA 3C9WA 3W32A 4EHVA 2IJMA 2VWBA 3OUNB 2R64A 4CGAA 4UY9A 4BDKA 2J7TA 2NP8A 1OBDA 1Y91A 4TWCA 2FH9A 4IVBA 5E91A 4RWKA 5C1QB 1ND4A 4R77A 2I0EA 3LPBA 3NNXA 4JDHA 3ENMA 3SXSA 1LPUA 4DCAA 4NTTA 2B53A 1XH9A 4AN9A 3MSSA 4V04A 2OG8A 4TXCA 4RSSA 3OWJA 5IH5A 4EOSA 2J0IA 5EI8A 2BTRA 1OITA 2Y6OA 2XJ2A 3E3PA 1JLUE 4JQ8A 3HMMA 4FTKA 1ZAOA 5M51A 4PL5A 4QPAA 2YIRA 3C51A 3BU6A 4L42A 3TI1A 4F0GA 4F7JA 3HNGA 4NM7A 3THBA 5BYLA 3A7HA 4HGLA 5ETFA 3SW7A 5L8JA 4FIFA 5IA3A 5HG9A 4I6HA 3V6RA 4JS8A 3UZRA 4LFIA 3VRYA 1ZWSA 4LOPA 3AD5A 2HZIA 3UJGA 5E9EA 3CS9A 4FNWA 4I21A 5ANEA 3G6GA 4AW1A 4ZLOA 1YI3A 2Y9QA 4N70A 4HGTA 3EQGA 4E26A 2XKCA 2YLFA 1WBSA 4MK0A 3S00A 5C4KA 3PY3A 3R7VA 2H8HA 5B7VA 2AYPA 5LMBA 2J0JA 1PXPA 2GSFA 2ONLA 3FZOA 1XH8A 3KK9A 4HCUA 5BVEA 5H2UA 3QD0A 4EH2A 3MN3A 4ERWA 3ZEPA 4DLJA 2X4ZA 3DOGA 3AC2A 4QMPA 2W5BA 4IE9A 1RJBA 3ULIA 4ZAUA 4FTJA 3PIZA 4BCQA 4E4MA 5CSVA 4BGHA 4USEA 4CFUA 4I92A 3M11A 3QD3A 3FAAA 4ZP5A 4RC4A 4AS0A 3OTUA 4JRNA 1UU8A 1WBPA 4IB3A 4PTEA 1E1XA 3R7GA 3QL8A 4RRVA 4ACDA 4GFGA 3UPZA 3P86A 1XJDA 3F2AA 2E9VA 4FSMA 3GEQA 4LRMA 5CSXA 4KKEA 4I3ZA 4C02A 5AA8A 4PX6A 3FKNA 2J4ZA 4O1OA 4N57A 4D1ZA 4EORA 3HMIA 4EOKA 2GCDA 3EZRA 4BR3A 5KMMA 1OL7A 3BX5A 3Q9YA 2PVFA 4NL0A 3RJCA 5JRQA 3GP0A 3QXPA 1YI4A 3BGPA 4KWPA 3SVVA 3TDWA 3QC9A 4F65A 4YO4A 2HW6A 3GC9A 4LL5A 4E5AX 4EHEA 4DFXE 4G5JA 3AG9A 2PVRA 5EW8A 4C4FA 4XP2A 4JIAA 4RZWA 4FTUA 2EUFB 4O84A 1A06A 5TF9A 4ZSJA 2PWLA 2VWYA 4W4XA 5HORA 2CKPA 3DXQA 5HLPA 4XLIA 3PJCA 5IDNA 4PF4A 5EQEA 1TQPA 3KXXA 1CMKE 4U40A 4UB7A 3FPQA 2V22A 3ACJA 3V6SA 3V8WA 4EC9A 4TZRA 3CCNA 3PDTA 1HOWA 3QTUA 3AC4A 3OP5A 2FA2A 4HCVA 5IA5A 4BTJA 4DFLA 5CI7A 3WARA 3ZU7A 2J2IB 3C4FA 4HPUE 4M68A 4H05A 3R9RA 3Q6UA 4MTAA 5L8KA 2CGXA 4IWOA 4U44A 2XNGA 1YHWA 2XNBA 2OFVA 4QP4A 4QP1A 2GU8A 3CPCA 4EK4A 1KUTA 4FT5A 4BF2A 2Y4PA 2X7GA 4O0VA 4AZWA 2BKKA 5CX9A 3B8RA 3K5VA 2QOBA 4YC6A 3RKBA 1RDQE 2ZV2A 4M13A 2ITVA 5JEBA 1KE8A 1J91A 3KEXA 1P4OA 3QZGA 2WB8A 3O71A 4RZVA 3NYVA 4OTHA 3FY2A 4G6LA 5IQIA 4IDTA 4HYHA 4LMNA 4ANNA 4EH3A 4HJOA 5EQPA 1O6KA 4TYHB 3BLHA 2ETMA 5GZ9A 5IKWA 4PDSA 2DQ7X 1UNGA 5IH4A 3NS9A 2OJGA 3MWUA 4TN6A 2GQRA 3ZXTA 5FRIA 3CD3A 4ONAA 3LJ2A 4R3PA 4BCHA 3RWQA 2PZ5A 2PZRA 3AMBA 2PVNA 2QOLA 3PIYA 5CT0A 1R1WA 4O0WA 1PYXA 3P7AA 4RMZA 4XCUA 4CQEA 4IIRA 5K3YA 2PMNX 4LOOA 2OBJA 1GZOA 2W7XA 3TTJA 3DQXA 5AR3A 5GJFA 4C8BA 5CSPA 5CAOA 4IVAA 3F7WA 3RALA 3D7TA 4W9XA 2VGPA 4WNKA 3WE8A 1UKHA 4NCTA 1CSNA 3NMUF 1PJKA 4KIKB 4FMQA 4AP7A 3VN9A 1OPKA 1WBWA 1VZOA 4F4PA 2OZOA 2VD5A 2WTKC 3H9OA 2DUVA 3FLNC 4GT4A 5F95A 2VUWA 3AC8A 5HCZA 2O8YA 5A4LA 3VS5A 2PK9A 5CEIA 3UNKA 5CEOA 4XBUA 1DI8A 5JQ8A 1VR2A 5KZIA 4GIIA 2XIRA 1M7QA 4LI5A 1OKVA 1OM1A 4IB0A 3PPZA 4J52A 3R00A 1MRUA 4L43A 1XQZA 3MB7A 3R8ZA 3QHWA 3UIXA 5HU3A 3FXXA 2HYYA 4WHZA 3UE4A 4NKAA 3UMXA 3L8PA 4RVMA 4DGLC 4KIQA 2QLUA 3A8WA 4AA4A 3KMMA 3OW3A 4ALVA 3U9NA 4ACMA 2PTKA 4K18A 4N6YA 4W4YA 5IU2A 2BDWA 3GCQA 4KINA 4F9WA 3VS6A 3CE3A 5IG1A 3U54A 2R3FA 2XNOA 4EEVA 3ZO3A 2R3GA 4BBFA 3GC7A 2X4FA 4FSNA 2W1CA 5TR6A 2Z7RA 1REJA 3MH0A 4C37A 4CG9A 5BMSA 5KMJA 3GQLA 3P5KA 3E88A 4LYNA 3IW8A 3LFFA 4K33A 5CLPA 5EI6A 1RQQA 3NSZA 3SRVB 1OIYA 2CN8A 4G16A 5CXZA 1WFCA 3BZ3A 4BKYA 3PXFA 4RJ6A 4JX3A 4QQTA 3NX8A 4JAJA 3ORZA 3OXZA 3QCXA 4IBMA 5LARA 4GYIA 4BTKA 4WUAA 3R02A 4DGNA 4IX6A 4FV5A 4L46A 3Q32A 3TG1A 3UOLA 3HMPA 5GIOE 4DH3A 3HRBA 4I41A 2IW6A 2UW6A 4M15A 3UG1A 4C4JA 3PWDA 5FLFA 4DLIA 4EQMA 5CU2A 4OW8A 2OZAB 4CZUA 3A60A 1JWHA 4JOAA 2VU3A 4RFYA 3ZRMA 3D7ZA 2YZAA 2WMWA 4M97A 4EK8A 4ZZNA 2IW8A 3PJ8A 3AQVA 4IXPA 3TCPA 4BCGA 3R2YA 3SX9A 4FTLA 5I9ZA 1SVGA 4ZOGA 3D2KA 3PP1A 3IK3A 3FHIA 3F5PA 3ORIA 1BYGA 2G2HA 2G9XA 3D15A 2ITTA 2JKQA 5AV3A 2W5AA 2LGCA 1ZYJA 5HI2A 2DYLA 4YZNA 1U46A 5ANDA 3U6IA 4DFNA 2ZV8A 2W99B 2PPQA 1KWPA 4G9RA 4O7NA 4HGEA 4J7BA 5L2IA 1WVYA 1M7NA 3KVXA 3MPMA 5C26A 3MVMA 3AC5A 5ACBC 4HYUA 3AT2A 3DKCA 2Y6MA 1BL6A 3FL4A 3G0FA 3JS2A 4BICA 2GTNA 5LMKA 1K3AA 5A14A 4UWBA 5BQ0A 2WXVA 4BWXA 4A06A 1G8SA 4FEQA 2OJJA 2VTLA 3TV4A 3W8LA 5AEPA 2JITA 2BHHA 2UW4A 4XV2A 3HDMA 1OVEA 2PE1A 3IG7A 3MV5A 4O6LA 1ZYCA 5FBNC 5GZAA 2PVKA 3UBDA 2YIWA 3DNEA 5K0XA 3FQHA 4KIPA 4KB8A 2R3OA 2BFXA 1TQMA 2YITA 3KB7A 3PJ2A 5HGIA 5BVNA 2VWXA 2I0YA 5C9CA 3ZMMA 4RC3A 3PRIA 2JGZA 3RPRA 1ZOEA 2ESMA 2BFYA 1JSTA 2GFCA 2R3PA 5J9YA 2QNJA 3EQDA 4UMUA 1OL2A 4IH8A 4JNWA 4M3QA 5EDPA 3MB6A 4YBKA 3F3WA 4A9YA 3TNWA 3LMIA 2BKZA 5J7BA 3MFSA 2C6EA 4BCJA 3EQPA 3VW8A 4O7TA 5EOBA 4BDBA 4EC8A 2OK1A 3UZTA 2QCSA 4EBVA 4HVHA 3FKOA 3IW5A 2IG7A 5AV4A 4CVAA 3LQ5A 4O0UA 3QU0A 4OTDA 3SOAA 2C4GA 4UX9A 4D5HA 4FYNA 2ZM4A 2R3RA 2YHVA 2P2HA 3NYXA 4K77A 4EHGA 4RFMA 1QPDA 4UXQA 3Q4TA 4FKJA 3HUBA 2CNVA 2VTNA 3QTXA 4JDJA 5E4HA 3ORLA 3I0OA 3ZDUA 2HAKA 5M4CA 3FI8A 5LQFA 4L3LA 5J9LA 3EQRA 5IEVA 3HECA 3OCBA 3KU2A 2CKEA 5EM7A 4ZTHA 2V55A 5EQYA 2W17A 3MA3A 4U3YA 3TEIA 1UWJA 5BNJA 3ITZA 4R3RA 2WMQA 3SD0A 2UZVA 3EL8A 1XKKA 3FHRA 5T6KA 3R8LA 1L8TA 4G34A 4FV1A 4GG5A 4KSQA 4FL2A 5AV1A 2JEDA 4XOYA 5EM8A 4ZSEA 3A62A 2ITOA 3M2WA 5CAPA 5CNNA 2PHKA 3UVQA 4EOJA 4ZMEA 2C1BA 3DBCA 1CM8A 1H25A 3R8UA 3CQEA 4ZEGA 4IANA 4QYGA 2PZYA 2B52A 5FXRA 1V0PA 3SV0A 4FKPA 3FQEA 3KXNA 3R1QA 3TN8A 4A9RA 2GQGA 4PDPA 4TYIA 3ZTXA 4C7TA 3KGAA 2WKMA 3O7LB 5A4EA 1X8BA 3QQJA 4KSPA 2XIKA 3KF7A 2YABA 4GU9A 4L9IA 4I4FA 1Z5MA 5F1ZA 3NVKI 4HVDA 5LMKC 1ZLTA 3R04A 1R78A 1KE6A 4I0SA 4I0TA 2PL0A 5A6OA 4QMSA 4I0RA 3ORTA 2XJ1A 4LGHA 4WIHA 3QGWA 4RJ7A 2OF4A 2ETRA 5M57A 5KMNA 4MXOA 3UG2A 3DJ5A 1H08A 4AWIA 2XF0A 1ZARA 4RJ3A 5KMLA 2W5HA 2ZAZA 3LCTA 4FSQA 4Y5HA 3WE4A 5FEQA 5CEMA 2ZM3A 3CTJA 3GCSA 3Q9XA 3NUSA 3SXFA 2C6TA 3O7LD 3WYXA 3ZYAA 2WMRA 4P5ZA 5CTPA 5L6WL 3R7UA 3SGCA 5A3XA 3R0TA 5IQDA 4KABA 3DBDA 4FEWA 3Q4ZA 2X0GA 3R1YA 3QCQA 2W1FA 3DDPA 5DE2A 5CU3A 2IZUA 2QI8A 4JBQA 5AIRA 3IDCA 2YM4A 3KK8A 5KMKA 5J1VA 3P9JA 4EOQA 5EW9A 3ZO2A 3MVLA 5I5ZA 3NAXA 5AJQA 4XLVA 5L6PA 4WNOA 1YWNA 5CENA 2RIOA 1O6LA 2VTMA 4GS6A 3N9XA 3KKVA 4FL1A 4BDEA 3DBFA 4AFEA 5DR6A 1WVWA 2WTVA 2G01A 4RIWB 5H8EA 1YOLA 2X2MA 3BEAA 3C0IA 5ANKA 1ZOGA 2HIWA 2VV9A 3FDNA 1MQBA 4YZCA 4GEOA 2KTYA 1Y8YA 4IB5A 1OZ1A 5CYIA 5DBXA 3C5UA 5E1SA 5C8KA 2QU6A 1O6YA 5DT0A 3DDQA 4U80A 4CSVA 2JKKA 3BQCA 1IRKA 1ZYDA 4NW6A 3G2FA 1H27A 4RVLA 3T3UA 4QMNA 4X7QA 4EH9A 3LMGA 2E9PA 2YM5A 2ZOQA 3L9MA 4IW0A 4MXYA 1F0QA 3UTOA 5HTCA 3NNWA 2B4SB 5HG8A 4BVUA 2CKQA 2NNWB 2WQOA 4YBJA 5EHLA 3HRFA 4L68A 4F9CA 3FMDA 3QQFA 2EXCX 4FTIA 3BEGA 3NR9A 2C0IA 5H3QA 3SAYA 2X8DA 3TJDA 2WQMA 4NEUA 3D0EA 3ZLYA 5CVFA 1BI8A 1H1PA 5AP2A 1L3RE 2B1PA 3NNVA 5CVHA 5GNKA 4DTAA 3AMAA 4IJPA 4FIIA 4BIDA 3QTIA 3QUEA 3OF0A 4CFFA 3QRKA 4R7HA 2F7XE 2YDJA 2UZOA 2QVSE 4FIGA 4EJNA 3O8PA 5DT3A 1VEBA 2IN6A 3L8VA 3MBLA 4PV0A 3ZZEA 4FE2A 4A4OA 1UWHA 4ASZA 3K2LA 3F3VA 3WIKA 3LQ3A 4FVRA 3S1HA 2GNHA 3IONA 4BCMA 5FTOA 5J1WA 3NZ0A 4IAAA 1OGUA 4MVFA 3TZMA 3OVVA 1FVRA 2BIKB 4C4HA 5D11A 2BDFA 3SQQA 3VJNA 4XRJA 4UMPA 4O96A 1TQIA 2B9HA 4JG7A 4PL3A 5AR7A 1GZNA 4R1YA 4JJRA 4D4RA 4FZ7A 4MXXA 4U43A 4U7ZA 1Q8YA 3D7TB 3GB2A 3HP2A 4CTBA 4QMXA 2QOFA 4X2FA 3F82A 4YJNA 2ITWA 2OICA 4YO6A 1YOJA 3CBLA 4JL9A 3FZPA 4ANQA 3KY2A 3QAME 3I5ZA 2V7AA 2XIYA 5EG3A 2WIPA 3JVSA 3EN7A 4FC0A 3TZ9A 4II5A 4GJ3A 1I09A 3NYNA 4GL9A 4OT6A 3SG8A 3AD6A 4FZFB 3DAKA 3KULB 5JGAA 3CLYA 3QWKA 3KRRA 5JQ5A 3FMNA 2JIIA 3DV3A 1J7UA 3V5LA 1A9UA 2NPQA 3ZO4A 2XRWA 1MP8A 4FGBA 3W2CA 1BX6A 5FUTA 4J95A 2PUNA 1IR3A 4L8MA 1QCFA 2BRGA 4M14A 3O50A 4RJ4A 4EJ7A 4YHFA 5HTIA 3PA5A 3QRIA 3AT4A 4KBCA 3T9TA 4JX7A 2QC6A 4M0ZA 1KSWA 3DBEA 5HD4A 4IZ5A 4EQCA 1Y8GA 2YEXA 4OBQA 1NVQA 2VRXA 2XIXA 3H9RA 4ZSLA 5HO8A 3KXMA 4AA0A 4UWYA 4AT4A 5IA4A 5KHXA 5M55A 4EBWA 5F94A 3ODYX 3BHVA 3DLZA 1ZZ2A 4C33A 4YHJA 2VO6A 4OTRA 4IJ9A 4WA9A 3GC0A 4I94A 3TKIA 5LJJA 5KZ0A 3BHTA 4BCKA 5BYZA 2OXDA 2J5EA 3E87A 2XNNA 4M66A 4MXAA 4H3QA 4FKWA 5KMOA 4AFJA 3D5WA 4E7WA 4IX4A 3DBQA 2OU7A 4IVDA 1G5SA 2Z7SA 4FX3A 2PMLX 3MS9A 4FKTA 3ZFMA 3R7OA 2VO7A 1AD5A 2C3KA 3COIA 1H1WA 3DK7A 5HG7A 4FR4A 4RLLA 2CLXA 3RWPA 4YZBA 4FV6A 4XG9A 4PY1A 1H1SA 3QD2B 4I5PA 4CG8A 4B8LA 5IQFA 5HNIX 3RBWA 4BKZA 1LP4A 2WQBA 4ZJVA 3PVBA 4D2RA 1PYEA 5FEEA 2HENA 2JDSA 5FTQA 4B6LA 5CF4A 3UDBA 4BDAA 2GHLA 3P7BA 1LEZA 1FBNA 4IX5A 3MPTA 2F9GA 2R3NA 3D5UA 3QTWA 3VF8A 2KULA 3ODZX 3MY0A 1DAYA 3HDNA 4X2KA 5DIAA 3FLSA 2PMOX 4UYAA 5HEZA 2CNUA 3AMYA 1OKZA 5I3RA 4EI4A 2X2LA 2R7IA 2JKMA 4H58A 2QR7A 1F5QA 4RVTA 4PP7A 3OUKA 5KE0A 1FVTA 4C34A 1OUKA 3I5NA 4IC8A 4ITIA 4C35A 4N4SA 2XNPA 3R01A 5CSWA 4F6UA 4DFBA 4BCPA 2CPKE 2WGJA 5HVKA 2GNLA 5J8IA 3PE1A 3OT8A 1PRYA 3R1NA 4R5SA 5FGKA 2C6DA 5M08A 2GPHA 1YRPA 4FODA 2A2AA 4L6QA 3TNIA 1URWA 5DRDA 4DITA 2WELA 4EZ3A 3DA6A 1Q8ZA 1W82A 5LCJA 3U55A 3W18A 5DEWA 4XP3A 1U54A 2WMSA 4E3CA 5A4CA 4ZS4A 3SRVA 4F09A 2YIYA 4MBJA 1PW2A 2JKOA 2VTIA 3R8VA 4M8TA 3TUCA 3W55A 2Z8CA 3CEKA 5FWKK 1GIHA 2OH4A 2G15A 2ONLC 4MWIA 3OFMA 4C0TA 1VYWA 3C7QA 5TKDA 3GU6A 4ASXA 3CP9A 1PF8A 1WVXA 2OJFE 5TO8A 5GIPE 3OS3A 5DHJA 1JKLA 2Y7JA 3E7OA 4XHKB 1W0XC 2XUUA 5EYDA 2BRBA 2QKWB 3QFVA 1Y6AA 1K2PA 3OY1A 2QO2A 2YFXA 5M07A 4DG3E 4CZTA 1Q4LA 4K9YA 4A9TA 2O65A 4TYJA 4L7SA 3H9FA 2XKEA 1PXLA 3GU7A 3QX4A 2QOHA 4YLLA 4I20A 3WF8A 5AV2A 4NJ3A 1JKKA 3U51A 4AZVA 4BDIA 3ZCLA 1UU3A 4E8AA 5LWNA 2BMCA 4FNZA 4IX3A 4O83A 2WTIA 2ZB0A 5CVGA 4CMUA 4NZWB 1YKRA 4RVKA 2ERKA 3JXWA 4AT3A 1UKIA 1QPCA 3GUBA 5E8YA 3VNTA 3LFEA 4WT6A 1Q8WA 3IGGA 5KBQA 4D4VA 4O0XA 2HZNA 4ERKA 3PIXA 3RZFA 5LVMA 5AAFA 2CCHA 4FKUA 5DPVA 2XM8A 3QRUA 2SRCA 3IQ7A 4BCFA 4J53A 3PE2A 3EMGA 4XV9A 3UVRA 2XBJA 3IOKA 5LXMA 5FM2A 3R9DA 4QP9A 1V0OA 3ZRKA 4GRBA 2B0QA 2UZDA 3KA0A 4FZDB 5ETAA 3DXPA 5HIEA 4JT3A 2UZUE 5EI2A 3V01A 3RAKA 4W8EA 4EHZA 4DHFA 4TRLA 2OIBA 4E4LA 1OBGA 2E2BA 2X7FA 3N4VA 2BROA 2J50A 3RHKA 3BYSA 2VTAA 3HV3A 5CQWA 4ACHA 4G1WA 4IAIA 3LFCA 5E90A 1FGKA 4J8NA 3QQUA 4FT3A 4H1JA 4YJSA 3SDJA 4ZLYA 3MESA 4DBXA 3H30A 3MDYA 5HIDA 4CKIA 4FEVA 3N4UA 2Q0NA 3E5AA 2OF2A 3QALE 3I7BA 5CQUA 1ZMUA 4GIHA 2B54A 5L3AA 2G1TA 3Q5IA 3QRJA 5T68A 3VJOA 3OMVA 3C5IA 1ZZLA 3EZVA 1XH4A 4FV7A 2QHMA 2UW0A 3NYOA 3V5TA 4BZDA 5M06A 5EHOA 2HCKA 2UZNA 3LFDA 3LZBA 4J96A 2CGVA 4EWHA 5AAGA 4DG0E 1T46A 4IWPA 5E8WA 2YERA 4FKGA 4LRKA 3V5PA 5F4NA 2QR8A 3GBZA 4FKIA 4RIXA 4WRSA 3RMFA 2J0MB 2PU8A 3A2CA 3H0ZA 2YCFA 4K11A 4GV1A 3E8EA 5EDQA 1JSVA 4AOTA 3NIZA 2X6DA 2WAJA 3JY9A 4TWPA 4YUQA 1Q62A 4AACA 4BB4A 4D28A 3TM0A 3MH1A 2W96B 4ZTNA 4V01A 3OWKA 1KOAA 1J1CA 3ANQA 4ORKA 2C6IA 4GK2A 2WEIA 5IQBA 3NUAA 3T3VA 2R3HA 2I7QA 5IH6A 4O7SA 3I79A 2QO9A 4RT7A 2OXYA 1PMNA 4IZYA 4JRVA 3VBXA 4ZSAA 4E73A 4OBPA 3Q6WA 4O0TA 4HNIA 4NKSA 1K9AA 5HHWA 4EOLA 2QO7A 3ZM9A 1FMOE 3BHYA 3DAEA 4MNFA 3D4QA 3O8UA 3PTGA 2XZSA 2PVYA 2R3LA 5IA0A 3C50A 2QHNA 3KXGA 2WOTA 4JVGA 4P2KA 5CT7A 1OIRA 5JFVA 1STCE 5C01A 3TZ7A 1U59A 3LXKA 4HZSA 3W2QA 4HYIA 3FMHA 4XP0A 4BDCA 3OTVA 4BDHA 4Q9SA 5BUIA 5KKRB 3TIYA 4FTAA 1OKWA 3HZTA 3B2TA 3UQCA 4TL0A 1GZ8A 3KMUA 4GU6A 3OEFX 3H0YA 3PP0A 4PMSA 4BZOA 5IQGA 4DINA 3D9VA 5KCVA 2IZTA 4J1RA 3DPKA 4OGRA 3PG3A 3P0MA 3QQLA 5D41A 1WBNA 2VTQA 4K2RA 2W4OA 5CU0A 3LW0A 3CQWA 5CEQA 2RL5A 3GT8A 2C6LA 3P1AA 4HVIA 2AC5A 5E8TA 3TV7A 4EK3A 4P7EA 2ACXA 2QLQA 4HPTE 2YAKA 4NCTC 3RGFA 1YOMA 3JYAA 4M69A 4FKQA 3FSKA 5K9IA 4CV8A 2QG5A 4PPCA 4D0WA 4NM0A 4BWPA 4TT7A 2JFLA 4CRSA 3PSCA 3QCSA 5D10A 4FSWA 3NDMA 3O96A 4FZAB 4G3FA 2F2UA 1SNXA 4KD1A 4IQ6A 5L8LA 3DCVA 1PKGA 4JDKA 3OZ6A 1OB3A 2XNMA 4JBOA 2CGWA 4NW5A 3F5XA 4QNAA 5ETCA 2CNQA 1ZYSA 1DS5A 4TYEA 5KMIA 3GNIB 4DH5A 4YTFA 3CTHA 4MD9E 3ATTA 2WMTA 2HZ0A 3FMJA 4KIKA 3RPYA 3WF6A 4E5BA 4ZY4A 3FUPA 4WOVA 4MEDA 3ZHPC 3PRFA 4KRDA 5AV0A 3ZONA 3LE6A 3VF9A 2BUJA 4RA4A 4D9TA 2HK5A 2H34A 2XK9A 3W33A 2XKFA 3KXHA 1ZY5A 3FMKA 4FNYA 4PTCA 4RWIA 2WTKB 3BYOA 3OCGA 4L7FA 4BGGA 2R7BA 2PY3A 4G6NA 4QMYA 3UP2A 1SVHA 1Z9XA 2ITQA 4QQCA 2BZKB 5AM6A 3VBVA 1ZRZA 4BRXA 4O82A 4BKJA 1W7HA 4UZDA 3TKUA 4C2WA 5CAUA 3HAMA 5JGBA 4WKQA 2W1IA 4FTCA 1BI7A 4IAZA 4ZJJA 4P4CA 4PNKA 3DKOA 5EYCA 3UNJA 5D12A 4GUEA 3WIGA 2XCKA 4EK5A 5AADA 3UO5A 2XK3A 3TJCA 3VS2A 1U4DA 4CKJA 3BU3A 4L3JA 1FOTA 4LOQA 2X8IA 4MBIA 2FGIA 4GFMA 4QMTA 5KBRA 1YXUA 3OG7A 2BTSA 2EU9A 5AX9A 5DNRA 4ASEA 2IZRA 2QG7A 2Q0BA 4IADA 3FMEA 3PY0A 4FF8A 4FYOA 4S34A 4W4VA 3VQUA 2OW3A 5J7HA 3TDVA 5JSMA 2OSCA 3A4PA 3I7CA 1FGIA 3HL7A 3R71A 3CGFA 4FA2A 4O2PA 3A8XA 4FOBA 2Y0AA 4BBEA 4DG2E 2E9OA 2ZJWA 5CAQA 3HV4A 5EDRA 1NA7A 2P55A 5AUYA 3DJ6A 3TNPC 2A0CX 2WQNA 1W83A 4IC7A 4APPA 5C4LA 1JKSA 1H24A 5L2TA 2UVXA 4OTQA 4BWKA 4D5KA 3FZTA 4I23A 4O91A 5LWMA 3BPRA 4LGGA 5EOLA 3HUCA 1J7IA 1Q61A 3W8QA 4UN0C 4IWDA 4FIJA 4DH1A 2WOUA 3CY2A 4M67A 3ZM4A 5J95A 1OECA 3AC3A 3HGKA 3CIKA 3FZSA 2YN8A 3UGCA 1WCCA 3QTSA 2CMWA 2WQEA 5CY3A 4ZIMA 3L1SA 2W1HA 3DT1A 5DEYA 3EYGA 4U45A 4D0XA 3UVPA 3ZBXA 2QODA 3DTCA 5AP7A 4F9BA 3ZLXA 3Q60A 2UZWE 4IFGA 5IMXA 3TT0A 3VBQA 2BZIB 4BTFA 1Q3DA 2YLEA 1M2QA 2JAVA 1OPJA 4DTBA 2PSQA 3ORNA 4GW8A 3RM7A 2IZSA 1FVVA 4NIFA 4EWQA 4IAKA 4UZHA 2VN9A 1R3CA 2UVYA 5AR4A 4YURA 2EXMA 3UOJA 4JBVA 2OJIA 2QURA 4APCA 3QZIA 3B2WA 4DT8A 2C6MA 3EFWA 3F6XA 2W9FB 4ENYA 2RFEA 4DC2A 5LVOA 4MQ1A 3NVMB 2C1AA 4L00A 3I1AA 2PZPA 2YM6A 4AZSA 3ATSA 3IO7A 4BCNA 4CNHA 1XBBA 5BYYA 4QMMA 3HAVA 5BVKA 3ZFYA 2FB8A 4HVGA 5ITAA 1S9IA 4ANMA 4E1ZA 4UYNA 1H8FA 3F5GA 1PMUA 3E92A 2BRMA 3U4WA 4GKHA 4ZK5A 3TNQB 4IM3A 3GU8A 3AC1A 4F1OA 2GS6A 2R0IA 3TXOA 5M44A 3GU4A 2UZEA 2WD1A 3EN4A 4RPVA 4FV8A 1GIIA 1UU9A 4NSTA 5HKMA 4AXAA 2WNTA 4XG3A 2XEYA 4YZMA 3FXWA 2YISA 2FSMX 4ZJIA 4LG4A 1MUOA 5EKOA 5IQCA 4S32A 4MH7A 3PVGA 5KNJA 5DFPA 5A46A 4Q2AA 3C4EA 3BE9A 3OWPA 1KV2A 2ERZE 2F4JA 3UQFA 2XIZA 5I9WA 4NU1A 3HEGA 2ETKA 3EYHA 2OO8X 3E7VA 2B55A 1V0BA 3Q4UA 4RIWA 4OUCA 5JT2A 4XRLA 5FTGA 3PLAE 2UZTA 5ANJA 2J0KA 2OH0E 4ZTSA 4BN1A 1OL1A 3DTWA 4AOJA 5C27A 4IEBA 2V62A 4QMWA 2WTJA 3MJ1A 2WMXA 4G3DA 5IQEA 4HYSA 3ETAA 2YDKA 3RVGA 2Y4IB 4TWNA 5IUIA 3PZEA 1OUYA 1JOWB 4L01A 3A4OX 1R0EA 4J71A 4AT5A 4CKRA 2UW5A 2V0DA 3DFCB 3IDPA 4RLKA 1YXVA 4WSYA 1YDRE 4AAAA 2GNIA 5AUXA 4Q5HA 4YP8A 3COMA 2XM9A 4QD6A 4EH6A 3SG9A 4NJDA 4EH7A 1HCKA 4FT0A 4XH6A 2RGPA 4A7CA 4NFNA 5J9ZA 4KRCA 3VAPA 2PE2A 2FSLX 2YDIA 2HWPA 4O0YA 3T9IA 3W2PA 3ZC5A 3BHUA 3FMLA 3FSFA 5K0KA 4I6QA 2EB2A 1PHKA 3NIEA 1BKXA 4PMTA 3NUUA 4Y85A 4O27B 3PXKA 5IQHA 3FLZA 1H00A 3VS3A 4D2VA 3KCKA 2UV2A 3G90X 4PTGA 3ZLSA 4YU2A 3LLAA 5K5NA 3RAHA 4D4SA 2OJ9A 5ANOA 5FG8A 5IMEA 3CSVA 2F57A 2O64A 3EFJA 3R1SA 4PL4A 4RWJA 4FUYA 1MRVA 3CR0A 1PY5A 4LM5A 3LKMA 4CT2A 3OT3A 1WAKA 2WTCA 5FXQA 4QMVA 4NT4A 4LGDA 3ELJA 2CSNA 2HXQA 2JDVA 3C4ZA 3DU8A 3HA6A 4BI1A 3OWLA 1YHSA 3CKXA 4O38A 3DGKA 4RIXB 5AP3A 4GK4A 4PRJA 3I81A 3S2PA 5DI1A 3WI6A 2WMAA 3P4KA 3FJQE 2R3KA 4X0MA 1PXNA 5CASA 3OC1A 4MWHA 3D5VA 3GCPA 3PA3A 3KRLA 1OL5A 2ITZA 1QPJA 3BYVA 3IS5A 1XH5A 3WZEA 3OXTA 1EH4A 3I6WA 3IDBA 2CHLA 3T8OA 3LFBA 2P2IA 2YJRA 2ZV7A 5HX6A 2A4LA 1ZYLA 2C3LA 3VO3A 3G33A 4OTPA 4DEAA 4FTMA 4HW7A 3Q96A 4KBAA 3JY0A 3TIZA 4BTMA 4PMMA 4IHPA 3E93A 3GENA 3MPAA 5HO6A 3BHHA 4YJTA 5LVNA 3DXNA 5J5SA 1O9UA 2XMYA 4MNEA 4RGJA 3Q53A 3BCEA 4MKCA 4AZTA 3GGFA 2H96A 5CZHA 3GOPA 4LRJA 4E93A 2JDRA 3RPSA 3QBNA 4FK6A 4C4EA 5CEPA 2HELA 2W4JA 2RKUA 1KV1A 3WZJA 3I6UA 4FG9A 3AGLA 3MJ2A 4BY9E 2A1AB 1DAWA 2UZLA 1YDSE 3LFAA 5FEDA 2P0CA 4MYGA 3Q3BA 5H8BA 1QL6A 3II5A 4RWLA 3R28A 3MH3A 3FI3A 4EH5A 1ATPE 3QTQA 1BMKA 2C47A 3WF7A 5L2SA 2UW8A 4DBNA 3QXOA 3L9NA 5JZNA 3BRBA 3MVJA 4M12A 3VULA 4WNPA 2RFSA 4FUXA 3OXIA 2EB3A 2YJSA 3FKLA 3QTZA 3IGOA 3QYWA 4HGSA 3ZOSA 3RCDA 1W84A 4QP3A 4BI0A 2QD9A 3Q2MA 3MY5A 4ZMFA 1IG1A 4C62A 2ZYBA 2I6LA 3NUYA 4R7IA 1TKIA 2Z02A 3O0GA 3BV3A 1KE9A 3R2BA 5KX8A 1OL6A 4CFWA 3ANRA 4U6RA 3Q52A 3PFQA 3D14A 3FLQA 3O8TA 3PJ3A 4FZ6A 3FXZA 2WMVA 3W1FA 3RINA 5HCYA 3F61A 1PMEA 2YIQA 5HD7A 1RW8A 2VTHA 3LVPA 5LCKA 2J51A 3CD8A 3W10A 2O0UA 2O5KA 2X8EA 3FC1X 4B7TA 4YLKA 2JDOA 2QOQA 2A27A 4OBOA 4RX9A 4BDFA 2BIYA 4AF3A 4E5WA 4U42A 5G6VA 3OBJA 2FYSA 3U4UA 3BBTB 5GJGA 1SM2A 2VWIA 2J9MA 3FV8A 4M84A 4FNXA 3UOKA 4EOPA 2X6EA 4CMTA 5AR2A 4I24A 5JZJA 3EQBA 4XMOA 3ET7A 4YPSA 2FO0A 5HE1A 3ZS5A 4EH8A 2HY81 2QONA 4I6BA 3QF9A 4BYJA 4EZ5A 3V51A 5K4JA 4I6FA 2C5YA 1Q8TA 5L6OA 4W4WA 3R8MA 2IWIA 4QYHA 4FKSA 3R30A 4X2NA 2ITYA 2UZBA 4G9CA 4L44A 5ACKA 4FKLA 3G9NA 3TL8A 4RQKA 5CS6A 2WTDA 3VUGA 3TTIA 3RAWA 5I9XA 3LQ8A 4JG6A 4WBBB 4O0SA 4YZ9A 5HE3A 4QTDA 5IA1A 1H26A 4TYGA 5JKGA 1KOBA 3EQCA 5HBJA 4U79A 5HQ0A 4IACA 4DEBA 4AN2A 3C13A 1H07A 3P78A 5I0BA 5DG5A 3DZQA 3BYUA 4I5MA 3LLTA 3EWHA 4DEHA 3LXNA 2C6KA 5HZNA 3IW7A 3S0OA 3F69A 4C61A 4AG8A 5F20A 3UYSA 3ZH8A 5DYJA 3QZFA 3NCGA 4Q5EA 5GINE 4EKLA 3KN6A 3HYHA 4J8MA 4F6SA 4X3FA 5AP4A 4RFZA 3U9CA 4FVPA 2VTTA 3FY0A 4GSBA 3KL8A 2ZDUA 2CCIA 2ITXA 2X1NA 4BIEA 5IQAA 1XH6A 3VUDA 4KUJA 4K1BA 3HV7A 4IM2A 3R9OA 2CJMA 4ANOA 4FTNA 2J0LA 4DEGA 4DEEA 1BUHA 3LM5A 5IUHA 4CD0A 1IEPA 1KE7A 3HA8A 3VS0A 4TNBA 4V0GA 4M69B 4B8MA 1CTPE 4QMZA 5AUVA 4D1XA 5JRSA 3ZRLA 1NW1A 4Z9LA 4C3PA 5KUPA 3KREA 3F2RA 3A7JA 4J99A 3OBGA 4GG7A 5I4NA 2VWWA 3UC4A 4F99A 4S2ZA 2DS1A 2FSOX 4DFYA 4YHTA 3I0QA 1H28A 3EOCA 5AUUA 4I1ZA 4G3GA 2OIQA 4OTGA 3W2SA 2J6MA 3OROA 2B9JA 2C5OA 2ITUA 3L9LA 3PSDA 4OR5A 5LOHA 3E8CA 1DM2A 2C0OA 2O3PA 5CSHA 4CFMA 4IFCA 4CT1A 4E6DA 2R0UA 4P90A 4QTBA 4BHZA 5AX3A 4BDJA 5DVRA 2R3QA 4A4LA 4I93A 4CTCA 3GU5A 4U97A 3UO6A 3QC4A 5HNGA 2XYNA 2BAQA 3WF9A 4XG7A 3CQUA 4C3FA 2BZJA 2PE0A 4MF1A 5CWZA 2XS0A 2VGOA 4GFOA 4FEXA 4N6ZA 3CJFA 3GXLA 5BVOA 2XP2A 4O22A 2XK8A 3OOMA 3UPXA 3AGMA 5HBEA 3FBVA 4L53A 3UIBA 2OKRA 5AWMA 1AQ1A 4N0SA 2C3JA 4S30A 2OXXA 5E8UA 4X3FC 5I9UA 4YTIA 4DN5A 4F63A 3LMHA 4IB1A 4RX7A 2CDZA 3NRMA 3VWAA 4DH8A 2PYWA 3V8TA 4WG5A 3LFQA 4F1MA 4Z7HA 2XBAA 2RF9A 4TWOA 4EK6A 4XBRA 4QO9A 3IPHA 3A7FA 5HIBA 4IDVA 3H10A 1PXJA 3Q9ZA 4M7IA 4WG3A 4X2GA 3KC3A 2RG5A 3FC2A 4L67A 3HKOA 4HCTA 3UZPA 3AD4A 5I3OA 3ZFXA 4QP2A 3A61A 3ALNA 2O2UA 4ANSA 1S9JA 2ZB1A 4YPDA 5ANGA 1XH7A 4YNOA 5D7AA 2IVUA 2BCJA 4DGMA 4KS7A 2W05A 2FVDA 5EYMA 3LHJA 1IA8A 2RSVA 3NNUA 2YM7A 3HLLA 4S31A 4Y72A 4DCEA 4DT9A 2YCSA 2RFNA 5HE0A 3WBLA 5FDPA 2UW7A 3HMOA 5IISA 3R83A 1GIJA 3G9LX 3R73A 4IWQA 3ZUVA 2R9SA 4PDYA 4FKVA 4D2WA 2YWVA 3EB0A 4O1PA 3W2OA 3POOA 4QPSA 5HG5A 2CN5A 2H9VA 3WOWA 2C5VA 3CKWA 3Q5ZA 5FQDC 3TUDA 4U5JA 4GJ2A 4NUSA 5AP5A 2YZLA 4QQJA 4JQ7A 3ZO1A 5M56A 1M2PA 2GS7A 4JQEA 1SNUA 3BKBA 3KRXA 4QMLA 4CFXA 4YLJA 2VX1A 1UU7A 3G5DA 3M42A 2WEVA 2AUHA 2VTOA 3ZSGA 3EH9A 3F66A 2XH5A 4O7RA 1FPUA 2I1MA 4UV0A 5AIKA 4O7LA 1YWRA 3PG1A 5HX8A 5IPJA 5T3QA 3QUPA 3W16A 2X7OA 3F9NA 3MYGA 3BWJA 4FL3A 5CNOA 1W98A 4OTFA 3EQHA 3UO4A 3K3JA 1GNGA 4GVAA 1MQ4A 4NIFB 1XR1A 4RX8A 2PMIA 4J97A 2Z2WA 3U8WA 3WF5A 2X9EA 3GCUA 4A4XA 2XCHA 5J79A 3A7GA 4YMJA 2JC6A 4MCVA 5TOZA 3FMMA 3VBWA 3UNZA 3FE3A 4CZYB 4W9WA 4PNIA 1PXMA 1FINA 4CFVA 2P33A 3VBTA 4QYFA 5HOAA 4D2TA 4AW2A 3F3TA 3QQHA 1LUFA 1P4FA 3AOXA 3V5WA 3F5UA 2GS2A 4RIYA 4WD5A 3RP9A 2BALA 1PKDA 3DJ7A 3QKMA 4FKOA 3VHKA 3BELA 4FSUA 4RJ5A 5E92A 5IEYA 4BHNA 2VX0A 5FP5A 2YCRA 2OIDA 3NCZA 4H3PA 4WG4A 2G2IA 4C36A 5H8GA 4YR8A 1FQ1B 5CALA 3RK5A 1JSUA 3L9PA 4KBKA 2XB7A 3Q04A 4A9SA 4BIBA 2VO3A 3R22A 5L2QA 4U81A 4IZAA 4GUBA 4YJVA 5JK3A 3CJGA 5TT7A 5AP1A 5FBOA 4IAYA 5GJDA 5HBHA 5AM7A 1BLXA 4FVQA 4AN3A 5BPYA 4O81A 4AGWA 4YJOA 3VVHA 5B2MA 3RI1A 3MY1A 3NW7A 4NFMA 4DAWA 4ZXTA 3N51A 4MHAA 1H0WA 4XG2A 5K4IA 3R7IA 1H1QA 2ZMDA 4AGDA 4CYJA 3R8PA 1LR4A 1OIUA 2OWBA 4GYGA 2EXEA 3C0GA 3V5JA 3PXZA 4NM3A 4Y83A 5CU6A 2XA4A 5HVJA 1IAHA 4AGUA 4F9AA 4L45A 1J3HA 4FTOA 2GNJA 3VS4A 5BUJA 3GVUA 3CY3A 2C69A 2CLQA 4I5HA 4ANBA 5EKNA 3HRCA 3RK7A 5AR5A 4S33A 4R1VA 3BBWA 4WBOA 3MTFA 1CKIA 4TW9A 2F7EE 2C0TA 3DS6A 4QPMA 4EONA 2G2FA 2X81A 2R2PA 4QRCA 4AGCA 4XUFA 4CYIA 3O17A 4GMYA 2WFYA 3ALOA 1TVOA 2VX3A 2IVSA 4QTAA 5BVWA 4A07A 4E20A 2ZDTA 4QOXA 5DN3A 3EIDA 5BX0A 1Q5KA 2XYUA 4FSTA 5GZ8A 4FEUA 2IVVA 3PJ1A 5HNBA 3SKCA 2W1EA 4D2PA 1AGWA 4DA5A 3LJ0A 1CKJA 3MFRA 4UBAA 1IAJA 3UOHA 2Y8OA 4E4NA 4EUUA 4DGOA 3CGOA 4TYHA 5D7VA 5E8SA 2PVJA 4FG8A 4ID7A 2RFDA 5AAEA 2OI4X 3PXQA 4ZTMA 2CKOA 4R5YA 3UQGA 3MFTA 2YM3A 4PUZA 2QOCA 4J98A 5LVLA 3S3IA 5AUTA 3TACA 4AUAA 3ZDIA 5EH0A 3K5UA 1Q97A 2C5NA 2PZIA 3DKFA 3MFUA 3GC8A 4XEYA 3VHEA 4Q9ZA 3NAYA 5A4TA 2GNFA 3LIJA 3E3BX 3M1SA 4U0IA 2EWAA 4MXCA 3E8NA 4BC6A 4YC8A 5CEKA 2F7ZE 2HW7A 4YZDA 5I9VA 5DR9A 2YAAA 5HTBA 3VUKA 4IMYA 4XJ0A 3G15A 4EUTA 4GVJA 1MRYA 2WHBA 3OOGA 4E6AA 3ZUTA 4QP8A 4AA5A 2YM8A 3WYYA 2Z7LA 5EK7A 3A99A 5E8ZA 4D9UA 5DLSA 3EJ1A 4E4XA 3AT3A 4QP7A 5D1JA 5DRBA 5IDPA 4K6ZA 3VUMA 3R9NA 2HY0A 2EVAA 3REPA 1YW2A 2JIUA 3DFAA 4G3CA 4MNEB 4LL0A 4LQMA 5AA9A 5IEXA 3SLSA 3GFEA 5LMAA 2PULA 1KE5A 3PXYA 4L52A 3VIDA 5CAVA 4DYMA 3KMWA 3P08A 5M09A 3PUPA 4BGQA 3L8XA 4FSRA 4QTEA 3BE2A 3P23A 4PQNA 1H01A
chains in the Genus database with same CATH superfamily
3VRZA 1I44A 1PXKA 4FG7A 1WMKA 2ZMCA 4GT3A 5CF5A 5DMZA 5M53A 2BRNA 4FIEA 4X3FB 2VNYA 4DF3A 2I0HA 3IKAA 1Q3WA 5DA3A 2GQSA 1ZXEA 1SZMA 3ORXA 3FL5A 3V3VA 4BJJA 4G31A 2XNEA 5HICA 4F1TA 4XNEA 1Q8UA 3QKKA 1TFFA 3VUTA 3ZC6A 3FZRA 4UALA 3BV2A 1UA2A 1M17A 2I40A 3CPBA 2V7OA 2F49A 4CXAA 4DEIA 1WBOA 3QA0A 3UYTA 4YGAA 3DK3A 4LV7A 3NUNA 5AFVA 3A7IA 2QOIA 2BILB 4B4LA 3DB6A 4FK3A 2UW9A 4RX5A 3U6HA 4ANLA 1OIQA 3QX2A 3TUBA 3BWFA 4PPAA 3U87A 5JFSA 3QCYA 4JBPA 1GAGA 5TE0A 3KQ7A 3C1XA 3PYYA 4XX9A 1URCA 5M4FA 4PMPA 5A6NA 2QOKA 4F64A 4MAOA 4QP6A 1A48A 4W8DA 3RZBA 3VS1A 4DHIB 4YJPA 3NLBA 4Y95A 3OCTA 1T45A 5H9BA 3NEWA 2Q83A 2C6OA 4CRLA 1APME 4FIHA 4F70A 2W1ZA 4X6RA 2PVMA 3I60A 3RCJA 5LVPA 2W06A 4PDOA 2YCQA 4Z7GA 4D58A 4O7VA 4JAIA 4O7WA 4MX9A 2JLDA 5L4QA 1Z57A 2HWOA 4FSZA 3F3UA 1UNLA 4DE4A 1HCLA 5ETIA 4JLCA 1YQJA 4FTTA 3VS7A 4XG6A 5M4UA 2I0VA 1ZMVA 4O7ZA 3QRTA 4G17A 4AXEA 2AQXA 1XHAA 4FV3A 3DLSA 3QZHA 4HZRA 1U5QA 3DKGA 3H4JA 3G51A 4D55A 4BDDA 1H1RA 5E7RA 4PP9A 2UW3A 3DZOA 5JFWA 4C58A 4NH1A 1P14A 3QA8A 3QUDA 2B7AA 2IO6A 2XK4A 3KXZA 3PY1A 3QYZA 3PPKA 4OT5A 4I5CA 1W8CA 1SMHA 2V5QA 3F2NA 4ARKA 5F9EA 2PUPA 2A98A 1Y57A 5JFXA 4XG4A 4ZTLA 3F3ZA 3RK9A 3ROYA 1NVSA 5HO7A 4CV9A 3NPCA 3UDZA 3D94A 5FDXA 5C8NA 4FT7A 1UNHA 3BLRA 3PSBA 2XJ0A 5FD2A 1XWSA 1ST0A 2W0JA 1GY3A 2B9FA 2O63A 2WO6A 3PVUA 4RIOA 2FSTX 3LXPA 1E9HA 4WNMA 4O0RA 4XOZA 4O4BB 5J5TA 3UODA 2XK7A 2PUIA 3ACKA 4EOIA 3GCVA 3KRJA 5DOSA 3S95A 4WUNA 3IOPA 1XBCA 3EN9A 4GH2A 3RNIA 3IECA 5BUEA 4PPBA 4RC2A 3FI2A 4U41A 4P5QA 1M52A 2WU6A 4UXLA 3BYMA 2ITNA 5C8MA 2P4IA 4ZS0A 3VUIA 3QLGA 1OMWA 3NW5A 3UP7A 2WU7A 1IA9A 4V0GB 5HE2A 4O7YA 3RNYA 2W1GA 3GOKA 4H39A 4WO5A 3R7YA 4BL1A 5CF6A 4FI1A 4BDGA 1OKYA 4YSJA 2VTRA 2OFUA 5HU9A 3PWYA 4LUEA 4NWMA 4C4GA 4C2VA 4TTHB 4NTSA 4C57A 3G0EA 1JVPP 3QGYA 2ZV9A 4L3PA 2BDJA 5C03A 3WILA 4V05A 2BAKA 4RG0A 4Y73A 4Z3VA 4YTHA 5EM5A 3V04A 3BLQA 3K3IA 4KKHA 4E6QA 4R78A 4FTQA 2ITPA 3LCSA 5D9HA 4AZFA 4B99A 5E1EA 1Q99A 1RE8A 2X39A 2VWZA 2OGVA 4FV4A 3KVWA 4UEUA 4QMQA 4FKRA 4AQKA 5EHYA 2CGUA 4HOKA 4AQCA 2IPXA 4JMQA 3QWJA 1B38A 3SOCA 4ZZMA 4AE6A 3QKLA 3B8QA 3SC1A 4TKSA 3QTRA 4KS8A 3SW4A 4BFMA 4FGRA 3EL7A 3D2IA 4F0IA 4G3EA 1W2CA 4GK3A 3LCKA 4CEGA 3I4BA 1G3NA 1YXXA 2YA9A 4FV2A 4CQGA 3FEGA 4ACGA 4QEBA 4H3BA 3OCSA 1NY3A 1PXIA 4QT1A 3UC3A 2GHGA 5BVFA 4MD7E 3AXWA 3R6XA 5AP0A 1YI6A 2Z7QA 4MD8E 2WPAA 5CXHA 1R0PA 4ZLZA 3C0HA 4KAOA 5CZIA 4X3JA 4CFNA 3HMNA 1YDTE 2BAJA 1BL7A 2R5TA 1Y6BA 4YJRA 3V8SA 4D2SA 3UMWA 1ERKA 4BCOA 2NRYA 2JD5A 4ZSGA 3LM0A 3P7CA 3NFFB 1P5EA 3CC6A 4QYYA 4KNBA 4JR3A 4OTIA 3C4WA 3EN5A 2GTMA 1J7LA 4XYFA 3KCFA 1ZOHA 3IW6A 2VAGA 4LV5A 3OY3A 2VWVA 2XRUA 3TYKA 2YACA 4UWCA 1OI9A 4ZZOA 2X2KA 4UMQA 3H3CA 4BI2A 4ITHA 3QQKA 4EYMA 3NWWA 5A54A 3LCOA 3CXWA 3LXLA 3NUXA 3MA6A 3PXRA 4R8QA 4DGGA 4EH4A 4OAVB 3ZUUA 4IZ7A 3EFLA 4JDIA 3LFSA 2IW9A 5AP6A 1NXKA 3E62A 4F6WA 4EKKA 2BRHA 5E8VA 4F08A 3Q9WA 4ZY6A 1UVRA 4R6VA 4DFZE 4EQUA 5A9UA 3QQGA 3FQSA 3SXRA 4QYEA 3FWQA 5G1XA 4B9DA 4Z16A 5I9YA 5JH6A 3R63A 4A9UA 5IF1A 2XKDA 1YXSA 5EM6A 3RPVA 3KRWA 3MVHA 3OW4A 4YJQA 5AUZA 4MQ2A 5ICPA 1NT2A 4U9AA 4YTCA 2QQ7A 1B6CB 3MGYA 2Y4IC 3ORMA 5FP6A 3TWJA 1IASA 1YVJA 3OHTA 4G6OA 4FT9A 3ZSHA 4C59A 4CCUA 3V5QA 4PWNA 4I4EA 4Y8DA 3UIUA 3KFAA 5DGZA 2QU5A 3HP5A 3TV6A 4AZEA 4EOOA 5IZFA 2A19B 1H4LA 2C3IB 2HXLA 2J5FA 4ZTRA 4G2FA 4XV1A 4QMOA 2B9IA 5DT4A 1XBAA 5FXSA 1NVRA 1GOLA 4YSMA 4BCIA 2YIXA 4E6CA 1Q24A 4O4DA 5B0XA 4MBLA 3MTLA 5HLWA 3PLSA 4IM0A 4JXFA 5CU4A 3TKHA 3PVWA 2RG6A 4CLIA 3ULZA 1PMVA 3PA4A 4U8ZA 1FMKA 4NK9A 5EFQA 4F7NA 2H6DA 3QD4A 2XVDA 4CLJA 2GHMA 5BMMA 4CMOA 2FUMA 3PPJA 4D4YA 2DWBA 2OZAA 5JMSA 4RIYB 1V1KA 2QKRA 2WMUA 1PXOA 1P2AA 1WBTA 3O23A 4YNEA 2IVTA 4ZTQA 3DB8A 4ASDA 3JR1A 4QNYA 4Z55A 3FYKX 3GI3A 5EW3A 4LMUA 2HZ4A 3FYJX 3S4QA 1SYKA 3ZEWA 3LOKA 4ENXA 3VQHA 4AW5A 2E9UA 2WZJA 3C4XA 4OTWA 4EOMA 4USFA 3D5XA 2QOOA 5DWRA 4BZNA 2VNWA 3W2RA 2X9FA 3DK6A 3ZSIA 3ENHA 2NRUA 3ORKA 3FLYA 3KULA 3UIMA 4C3RA 5L2WA 3NW6A 4KKGA 3ZBFA 2HOGA 4ITJA 4KIOA 5AMNA 4DEDA 5IA2A 2JAMA 1JNKA 2GDOA 4O2ZA 2GFSA 3F88A 3VW6A 2BPMA 4RBLA 1G8AA 2XEZA 3RHXA 3DY7A 3EKKA 3G6HA 4DHZA 4TNDA 4UMTA 3C4CA 5JGDA 1VYZA 1B39A 1DI9A 1JKTA 4QMUA 4EYJA 2WMBA 4H1MA 3BQRA 3RTPA 3HV5A 4XG8A 4F9YA 1GJOA 2PVHA 3EQFA 5CANA 4GCJA 3EN6A 4FSYA 1GZKA 3COKA 2C30A 2VTJA 4X2JA 3EHAA 3BGQA 4H36A 4FV9A 4FTRA 4KA3A 3FLWA 4ACCA 4AOIA 3EFKA 4IAFA 1JQHA 4CCBA 4F7LA 1CKPA 2JBPA 2VTSA 1LEWA 2W9ZB 3DQWA 4FOCA 4RQVA 1JBPE 3VC4A 4I22A 3WZUA 4U3ZA 4DH7A 4MXZA 3Q4CA 4OLIA 3SA0A 3TZ8A 2VWUA 4Y46A 2Z60A 2C5XA 3ZXZA 4F7SA 3CTQA 2ZVAA 4ALWA 1ZMWA 4M0YA 1M14A 2JBOA 4R3CA 3QHRA 3KN5A 1SVEA 4JG8A 4OAUC 3E64A 1OPLA 1E1VA 3ERKA 2GMXA 4X21A 5HESA 4G5PA 1YWVA 2PVLA 3Q2JA 5B2KA 3LFNA 5DR2A 2X0OA 4X6QC 3BIZA 2JIVA 4AX8A 2R3MA 2ZM1A 2BVAA 3O51A 4BBMA 2R4BA 2UUEA 5EYKA 5KO1A 4UMRA 2W4KA 3DNDA 4NM5A 3RM6A 2WIHA 1WZYA 4F0FA 3MIYA 1JPAA 3L8SA 3ZZWA 4HVSA 1UV5A 3POZA 4DTKA 1REKA 3NUPA 3F7ZA 5HVYA 4ZY5A 3EQIA 3ZLWA 4LV8A 3BI6A 4MUQA 5ANIA 4WSQA 2XK6A 3FZ1A 3RAIA 3IW4A 4O86A 1M2RA 1JAMA 1QPEA 3HVCA 3ORPA 2AC3A 5IUGA 1VJYA 3P79A 5K5XA 3BGZA 4O6EA 2OLCA 3MI9A 4ALUA 2NO3A 3LJ1A 2PUUA 3E63A 3OEZA 4HNFA 2WTWA 4QQ5A 3JPVA 4JR7A 4XS2A 2JDTA 3COHA 3HV6A 3EKNA 2R3JA 2VO0A 3HX4A 3JVRA 4FV0A 3VUHA 4EL9A 2P3GX 5BV3A 2BR1A 4QDVA 4RJ8A 4K0YA 3MH2A 3R7EA 4BYIA 5HLNA 1WBVA 4R7BA 3WZDA 2VTPA 4AU8A 3LAUA 5HCXA 3R21A 3TNHA 4C38A 1J1BA 5DH3A 2LAVA 4WRGA 4LUDA 4K8AA 5E8XA 3MIAA 4AW0A 3BU5A 5FM3A 2F2CB 5B2LA 3DAJA 2C68A 4Y5QA 5KKRC 1R39A 5J87A 5JN2A 3N4TA 4XV3A 4B0GA 5GHVA 3O2MA 3JUHA 4C4IA 4QTCA 3VBYA 2REIA 2GNGA 5A4QA 3OD6X 1YHVA 4DFUA 3SHEA 4NYEA 3FPMA 3E8DA 1U5RA 3KF4A 5M4IA 4TPTA 5AR8A 3R9HA 3NGAA 3D83A 2VZ6A 2J90A 3K54A 1XO2B 2BHEA 2BZHB 4EZ7A 4IVCA 2W1DA 1ZY4A 4FICA 3U6JA 1U54B 3WZKA 3PZHA 4FBXA 3RPOA 2YWPA 3FI4A 4O21A 5BVDA 3ROCA 4AE9A 3GFWA 5KHWA 3ID6C 1CDKA 1H0VA 4MF0A 5CI6A 4GKIA 4TY1A 4YJUA 1F3MC 4JI9A 4RA5A 4USDA 2E9NA 3LCDA 3MW1A 3QLFA 4JIKA 2JFMA 2R3IA 2UVZA 4GT5A 1G8KA 5CF8A 1Q41A 1QMZA 3GQIA 4YC3A 4D1SA 1YXTA 3C9WA 3W32A 4EHVA 2IJMA 2VWBA 3OUNB 2R64A 4CGAA 4UY9A 4BDKA 2J7TA 2NP8A 1OBDA 1Y91A 4TWCA 2FH9A 4IVBA 3UDSA 5E91A 4RWKA 5C1QB 1ND4A 4R77A 2I0EA 3LPBA 3NNXA 4JDHA 3ENMA 3SXSA 1LPUA 4DCAA 4NTTA 2B53A 1XH9A 4AN9A 3MSSA 4V04A 2OG8A 4TXCA 4RSSA 3OWJA 5IH5A 4EOSA 2J0IA 5EI8A 2BTRA 1OITA 2Y6OA 2XJ2A 3E3PA 1JLUE 3KIOC 4JQ8A 3HMMA 4FTKA 1ZAOA 5M51A 4PL5A 4QPAA 2YIRA 3C51A 3BU6A 4L42A 3TI1A 4F0GA 4F7JA 3HNGA 4NM7A 3THBA 5BYLA 3A7HA 4HGLA 5ETFA 3SW7A 5L8JA 4FIFA 5IA3A 5HG9A 4I6HA 3V6RA 4JS8A 3UZRA 4LFIA 3VRYA 1ZWSA 4LOPA 3AD5A 2HZIA 3UJGA 5E9EA 3CS9A 4FNWA 4I21A 5ANEA 3G6GA 4AW1A 4ZLOA 1YI3A 2Y9QA 4N70A 4HGTA 3EQGA 4E26A 2XKCA 2YLFA 1WBSA 4MK0A 3S00A 5C4KA 3PY3A 3R7VA 2H8HA 5B7VA 2AYPA 5LMBA 2J0JA 1PXPA 2GSFA 2ONLA 3FZOA 1XH8A 3KK9A 4HCUA 5BVEA 5H2UA 3QD0A 4EH2A 3MN3A 4ERWA 3ZEPA 4DLJA 2X4ZA 3DOGA 3AC2A 4QMPA 2W5BA 4IE9A 1RJBA 3ULIA 4ZAUA 4FTJA 3PIZA 4BCQA 4E4MA 5CSVA 4BGHA 4USEA 4CFUA 4I92A 3M11A 3QD3A 3FAAA 4ZP5A 4RC4A 4AS0A 3OTUA 4JRNA 1UU8A 1WBPA 4IB3A 4PTEA 1E1XA 3R7GA 3QL8A 4RRVA 4ACDA 4GFGA 3UPZA 3P86A 1XJDA 3F2AA 2E9VA 4FSMA 3GEQA 4LRMA 5CSXA 4KKEA 4I3ZA 4C02A 5AA8A 4PX6A 3FKNA 2J4ZA 4O1OA 4N57A 4D1ZA 4EORA 3HMIA 4EOKA 2GCDA 3EZRA 4BR3A 5KMMA 1OL7A 3BX5A 3Q9YA 2PVFA 4NL0A 1XMLA 3RJCA 5JRQA 3GP0A 3QXPA 1YI4A 3BGPA 4KWPA 3SVVA 3TDWA 3QC9A 4F65A 4YO4A 2HW6A 3GC9A 4LL5A 4E5AX 4EHEA 1W2DA 4DFXE 4G5JA 3AG9A 2PVRA 5EW8A 4C4FA 4XP2A 4JIAA 4RZWA 2XALA 4FTUA 2EUFB 4O84A 1A06A 5TF9A 4ZSJA 4F78A 2PWLA 2VWYA 4W4XA 5HORA 2CKPA 3DXQA 5HLPA 4XLIA 3PJCA 5IDNA 4PF4A 5EQEA 1TQPA 3KXXA 1CMKE 4U40A 4UB7A 3FPQA 2V22A 3ACJA 3V6SA 3V8WA 4EC9A 4TZRA 3CCNA 3PDTA 1HOWA 3QTUA 3AC4A 3OP5A 2FA2A 4HCVA 5IA5A 4BTJA 4DFLA 5CI7A 3WARA 3ZU7A 2J2IB 3C4FA 4HPUE 4M68A 4H05A 3R9RA 3Q6UA 4MTAA 5L8KA 2CGXA 4IWOA 4U44A 2XNGA 1YHWA 2XNBA 2OFVA 2XANA 4QP4A 4QP1A 2GU8A 3CPCA 4EK4A 1KUTA 4FT5A 4BF2A 2Y4PA 2X7GA 4O0VA 4AZWA 2BKKA 5CX9A 3B8RA 3K5VA 2QOBA 4YC6A 3RKBA 1RDQE 2ZV2A 4M13A 2ITVA 5JEBA 1KE8A 1J91A 3KEXA 1P4OA 4BJJB 3QZGA 2WB8A 3O71A 4RZVA 3NYVA 4OTHA 3FY2A 4G6LA 5IQIA 4IDTA 4HYHA 4LMNA 4ANNA 4EH3A 4HJOA 5EQPA 1O6KA 4TYHB 3BLHA 2ETMA 5GZ9A 5IKWA 4PDSA 2DQ7X 1UNGA 5IH4A 3NS9A 2OJGA 3MWUA 4TN6A 2GQRA 3ZXTA 5FRIA 3CD3A 4ONAA 3LJ2A 4R3PA 4BCHA 3RWQA 2PZ5A 2PZRA 3AMBA 2PVNA 2QOLA 3PIYA 5CT0A 1R1WA 4O0WA 1PYXA 3P7AA 4RMZA 4XCUA 4CQEA 4IIRA 5K3YA 2PMNX 4LOOA 2OBJA 1GZOA 2W7XA 3TTJA 3DQXA 5AR3A 5GJFA 4C8BA 5CSPA 5CAOA 4IVAA 3F7WA 3RALA 3D7TA 4W9XA 2VGPA 4WNKA 3WE8A 1UKHA 4NCTA 1CSNA 3NMUF 1PJKA 4KIKB 4FMQA 4AP7A 3VN9A 1OPKA 1WBWA 1VZOA 4F4PA 2OZOA 2VD5A 2WTKC 3H9OA 2DUVA 3FLNC 4GT4A 5F95A 2VUWA 3AC8A 5HCZA 2O8YA 5A4LA 3VS5A 2PK9A 5CEIA 3UNKA 5CEOA 4XBUA 1DI8A 5JQ8A 1VR2A 5KZIA 4GIIA 2XIRA 1M7QA 4LI5A 1OKVA 1OM1A 4IB0A 3PPZA 4J52A 3R00A 1MRUA 4L43A 1XQZA 3MB7A 3R8ZA 3QHWA 3UIXA 5HU3A 3FXXA 2HYYA 4WHZA 3UE4A 4NKAA 3UMXA 3L8PA 4RVMA 4DGLC 4KIQA 2QLUA 3A8WA 4AA4A 3KMMA 3OW3A 4ALVA 3U9NA 4ACMA 2PTKA 4K18A 4N6YA 4W4YA 5IU2A 2BDWA 3GCQA 2XARA 4KINA 4F9WA 3VS6A 3CE3A 5IG1A 3U54A 2R3FA 2XNOA 4EEVA 3ZO3A 2R3GA 4BBFA 3GC7A 2X4FA 4FSNA 2W1CA 5TR6A 2Z7RA 1REJA 3MH0A 4C37A 4CG9A 5BMSA 5KMJA 3GQLA 3P5KA 3E88A 4LYNA 3IW8A 3LFFA 4K33A 5CLPA 5EI6A 1RQQA 3NSZA 3SRVB 1OIYA 2CN8A 4G16A 5CXZA 1WFCA 3BZ3A 4BKYA 3PXFA 4RJ6A 4JX3A 4QQTA 3NX8A 4JAJA 3ORZA 3OXZA 3QCXA 4IBMA 5LARA 4GYIA 4BTKA 4WUAA 3R02A 4DGNA 4IX6A 4FV5A 4L46A 3Q32A 3TG1A 3UOLA 3HMPA 5GIOE 4DH3A 3HRBA 4I41A 2IW6A 2UW6A 4M15A 3UG1A 4C4JA 3PWDA 5FLFA 4DLIA 4EQMA 5CU2A 4OW8A 2OZAB 4CZUA 3A60A 1JWHA 4JOAA 2VU3A 4RFYA 3ZRMA 3D7ZA 2YZAA 2WMWA 4M97A 4EK8A 4ZZNA 2IW8A 3PJ8A 3AQVA 4IXPA 3TCPA 4BCGA 3R2YA 3SX9A 4FTLA 5I9ZA 1SVGA 4ZOGA 3D2KA 3PP1A 3IK3A 3FHIA 3F5PA 3ORIA 1BYGA 2G2HA 2G9XA 3D15A 2ITTA 2JKQA 5AV3A 4LDTA 2W5AA 2LGCA 1ZYJA 5HI2A 2DYLA 4YZNA 1U46A 5ANDA 3U6IA 4DFNA 4DDGA 2ZV8A 2W99B 2PPQA 1KWPA 4G9RA 4O7NA 4HGEA 4J7BA 5L2IA 1WVYA 1M7NA 3KVXA 3MPMA 5C26A 3MVMA 3AC5A 5ACBC 4HYUA 3AT2A 3DKCA 2Y6MA 1BL6A 3FL4A 3G0FA 3JS2A 4BICA 2GTNA 5LMKA 1K3AA 5A14A 4UWBA 5BQ0A 2WXVA 4BWXA 4A06A 1G8SA 4FEQA 2OJJA 2VTLA 3TV4A 3W8LA 5AEPA 2JITA 2BHHA 2UW4A 4XV2A 3HDMA 1OVEA 2PE1A 3IG7A 3MV5A 4O6LA 1ZYCA 5FBNC 5GZAA 2PVKA 3UBDA 2YIWA 3DNEA 5K0XA 3FQHA 4KIPA 4KB8A 2R3OA 2BFXA 1TQMA 2YITA 3KB7A 3PJ2A 5HGIA 5BVNA 2VWXA 2I0YA 5C9CA 3ZMMA 4RC3A 3PRIA 2JGZA 3RPRA 1ZOEA 2ESMA 2BFYA 1JSTA 2GFCA 2R3PA 5J9YA 4AXFA 2QNJA 3EQDA 4UMUA 1OL2A 4IH8A 4AAYA 4JNWA 4M3QA 5EDPA 3MB6A 4YBKA 3F3WA 4A9YA 3TNWA 3LMIA 2BKZA 5J7BA 3MFSA 2C6EA 4BCJA 3EQPA 3VW8A 4O7TA 5EOBA 4BDBA 4EC8A 2OK1A 3UZTA 2QCSA 4EBVA 4HVHA 3FKOA 3IW5A 2IG7A 5AV4A 4CVAA 3LQ5A 4O0UA 3QU0A 4OTDA 3SOAA 2C4GA 4UX9A 4D5HA 4FYNA 2ZM4A 2R3RA 2YHVA 2P2HA 3NYXA 4K77A 4EHGA 4RFMA 1QPDA 4UXQA 3Q4TA 4FKJA 3HUBA 2CNVA 2VTNA 3QTXA 4JDJA 5E4HA 3ORLA 3I0OA 3ZDUA 2HAKA 5M4CA 3FI8A 5LQFA 4L3LA 5J9LA 3EQRA 5IEVA 3HECA 3OCBA 3KU2A 2CKEA 5EM7A 4ZTHA 2V55A 5EQYA 2W17A 3MA3A 4U3YA 3TEIA 1UWJA 5BNJA 3ITZA 4R3RA 2WMQA 3SD0A 2UZVA 3EL8A 1XKKA 3FHRA 5T6KA 3R8LA 1L8TA 4G34A 4FV1A 4GG5A 4KSQA 4FL2A 5AV1A 2JEDA 4XOYA 5EM8A 4ZSEA 3A62A 2ITOA 3M2WA 5CAPA 5CNNA 2PHKA 3UVQA 4EOJA 4ZMEA 2C1BA 3DBCA 1CM8A 1H25A 3R8UA 3CQEA 4ZEGA 4IANA 4QYGA 2PZYA 2B52A 5FXRA 1V0PA 3SV0A 4FKPA 3FQEA 3KXNA 3R1QA 3TN8A 4A9RA 2GQGA 4PDPA 4TYIA 3ZTXA 4C7TA 3KGAA 2WKMA 3O7LB 5A4EA 1X8BA 3QQJA 4KSPA 2XIKA 3KF7A 2YABA 4GU9A 4L9IA 4I4FA 1Z5MA 5F1ZA 3AKLA 3NVKI 4HVDA 5LMKC 1ZLTA 3R04A 1R78A 1KE6A 4I0SA 4I0TA 2PL0A 5A6OA 4QMSA 4I0RA 3ORTA 2XJ1A 4LGHA 4WIHA 3QGWA 4RJ7A 2OF4A 2ETRA 5M57A 5KMNA 4MXOA 3UG2A 3DJ5A 1H08A 4AWIA 2XF0A 1ZARA 4RJ3A 5KMLA 2W5HA 2ZAZA 3LCTA 4FSQA 4Y5HA 3WE4A 5FEQA 5CEMA 2ZM3A 3CTJA 3GCSA 3Q9XA 3NUSA 3SXFA 2C6TA 3O7LD 3WYXA 3ZYAA 2WMRA 4P5ZA 4O4CA 5CTPA 5L6WL 3R7UA 3SGCA 5A3XA 3R0TA 5IQDA 4KABA 3DBDA 4FEWA 3Q4ZA 2X0GA 3R1YA 3QCQA 2W1FA 3DDPA 5DE2A 5CU3A 2IZUA 2QI8A 4JBQA 5AIRA 3IDCA 2YM4A 3KK8A 5KMKA 5J1VA 2AEGA 3P9JA 4EOQA 5EW9A 3ZO2A 3MVLA 5I5ZA 3NAXA 5AJQA 4XLVA 5L6PA 4WNOA 1YWNA 5CENA 2RIOA 1O6LA 2VTMA 4GS6A 3N9XA 3KKVA 4FL1A 4BDEA 3DBFA 4AFEA 5DR6A 1WVWA 2WTVA 2G01A 4RIWB 5H8EA 1YOLA 2X2MA 3BEAA 3C0IA 5ANKA 1ZOGA 2HIWA 2VV9A 3FDNA 1MQBA 4YZCA 4GEOA 2KTYA 1Y8YA 4IB5A 1OZ1A 5CYIA 5DBXA 3C5UA 5E1SA 5C8KA 2QU6A 1O6YA 5DT0A 3DDQA 4U80A 4CSVA 2JKKA 3BQCA 1IRKA 1ZYDA 4NW6A 3G2FA 1H27A 4RVLA 3T3UA 4QMNA 4X7QA 4EH9A 3LMGA 2E9PA 2YM5A 2ZOQA 3L9MA 4IW0A 4MXYA 1F0QA 3UTOA 5HTCA 3NNWA 2B4SB 5HG8A 4BVUA 2CKQA 2NNWB 2WQOA 4YBJA 5EHLA 3HRFA 4L68A 4F9CA 3FMDA 4O4EA 3QQFA 2EXCX 4FTIA 3BEGA 3NR9A 2C0IA 5H3QA 3SAYA 2X8DA 3TJDA 2WQMA 4NEUA 3D0EA 3ZLYA 3PFYA 3VONA 5CVFA 1BI8A 4QDEA 1H1PA 5AP2A 1L3RE 2B1PA 3NNVA 5CVHA 5GNKA 4DTAA 3AMAA 4IJPA 4FIIA 4BIDA 3QTIA 3QUEA 3OF0A 4CFFA 3QRKA 4R7HA 2F7XE 2YDJA 2UZOA 2QVSE 4FIGA 4EJNA 3O8PA 5DT3A 1VEBA 2IN6A 3L8VA 3MBLA 4PV0A 3ZZEA 4FE2A 4A4OA 1UWHA 4ASZA 3K2LA 3F3VA 3WIKA 3LQ3A 4FVRA 3S1HA 2GNHA 3IONA 4BCMA 5FTOA 5J1WA 3NZ0A 4IAAA 1OGUA 4MVFA 3TZMA 3OVVA 1FVRA 2BIKB 4C4HA 3UDTA 5D11A 2BDFA 3SQQA 3VJNA 4XRJA 4UMPA 4O96A 1TQIA 2B9HA 4JG7A 4PL3A 5AR7A 1GZNA 4R1YA 4JJRA 4D4RA 3W0PA 4FZ7A 4MXXA 4U43A 4U7ZA 1Q8YA 3D7TB 3GB2A 3HP2A 4CTBA 4QMXA 2QOFA 4X2FA 3F82A 4YJNA 2ITWA 2OICA 4YO6A 1YOJA 3CBLA 4JL9A 3FZPA 4ANQA 3KY2A 3QAME 3I5ZA 2V7AA 2XIYA 5EG3A 2WIPA 3JVSA 3EN7A 4FC0A 3TZ9A 4II5A 4GJ3A 1I09A 3NYNA 4GL9A 4OT6A 3SG8A 3AD6A 4FZFB 3DAKA 3KULB 5JGAA 3CLYA 3QWKA 3KRRA 5JQ5A 3FMNA 2JIIA 3DV3A 1J7UA 3V5LA 1A9UA 2NPQA 3ZO4A 2XRWA 1MP8A 4FGBA 3W2CA 1BX6A 5FUTA 4J95A 2PUNA 1IR3A 4L8MA 1QCFA 2BRGA 4M14A 3O50A 4RJ4A 4EJ7A 4YHFA 5HTIA 3PA5A 3QRIA 3AT4A 4KBCA 3T9TA 4JX7A 2QC6A 4M0ZA 1KSWA 3DBEA 5HD4A 4IZ5A 4EQCA 1Y8GA 2YEXA