3FQSA

Crystal structure of spleen tyrosine kinase complexed with r406
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
277
structure length
268
Chain Sequence
b'VYLDRKLLTLEDKELGSGNFGTVKKGYYQMKKVVKTVAVKILKPALKDELLAEANVMQQLDNPYIVRMIGICEAESWMLVMEMAELGPLNKYLQQNRHVKDKNIIELVHQVSMGMKYLEESNFVHRDLAARNVLLVTQHYAKISDFGLSKALRADENYYKAKWPVKWYAPECINYYKFSSKSDVWSFGVLMWEAFSYGQKPYRGMKGSEVTAMLEKGERMGCPAGCPREMYDLMNLCWTYDVENRPGFAAVELRLRNYYYDVVNEGHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Tyrosine-protein kinase SYK
publication title Structural insights for design of potent spleen tyrosine kinase inhibitors from crystallographic analysis of three inhibitor complexes.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 92
structure length 268
sequence length 277
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2009-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3fqsA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3fqsA01
4FT5A 4KINA 4YHTA 4NW6A 1PXOA 3O2MA 4ARKA 3W2PA 2W1EA 2XUUA 3QA8A 4FTQA 4UMRA 5I9VA 5D10A 3A2CA 1IEPA 2QOQA 3BX5A 1YDSE 2EXMA 3UYSA 5HX8A 3PPJA 1SNUA 3QX2A 5DH3A 4M7IA 3MVHA 3FZRA 2VRXA 5EDQA 4EOOA 4USEA 3OT8A 4JRVA 5AR5A 2E9VA 4KD1A 1R39A 4I3ZA 5JT2A 3L9PA 3HMMA 4UWCA 4F63A 2BCJA 4XOZA 4FL2A 5C4KA 4XV2A 1STCE 4ZSEA 3Q5IA 5KKRC 5CF5A 2VNYA 2XIRA 1Q97A 4GU6A 3VRZA 4DBXA 3EN9A 4DH8A 3GQIA 4YZ9A 4S34A 2OI4X 3FUPA 3KULB 3JUHA 3FI8A 4ZLZA 1U54A 4FMQA 2JFMA 2P0CA 4MF0A 4QMWA 4TYJA 2VX0A 3SX9A 2P2HA 2YHVA 1Q8WA 3GC7A 3S1HA 3DBQA 3D5XA 2HY81 4MD9E 5AR2A 2CGUA 2QG7A 3OWJA 3R8LA 3CS9A 3EIDA 4G3FA 2QKRA 3HZTA 4IZ5A 2BHEA 3UC3A 3EMGA 5JQ5A 1KOAA 3EKKA 4BVUA 1Q3DA 4TWNA 4BCOA 1W7HA 5J7BA 4FL1A 1M7NA 5IQIA 4GKHA 4DEAA 4U80A 3Q53A 3FWQA 3L8XA 4W4WA 3ZMMA 1SVHA 4JJRA 3BIZA 3A60A 4ANSA 4PNIA 3NUSA 1H0VA 2XK8A 1VEBA 3MPMA 3NW5A 1H8FA 5DFPA 3FYJX 3VVHA 4R7BA 3OMVA 3KRWA 5K0XA 2UUEA 4EC9A 5HO7A 4MKCA 3GNIB 4IE9A 1SVGA 4BC6A 2XIYA 5M07A 1DAYA 4FKOA 5DR2A 2WTVA 2XNOA 5EYMA 2J0JA 4MQ1A 5JRSA 4FV0A 1K2PA 4C3FA 5J87A 3P7BA 1OBDA 3Q6UA 4TWOA 2HENA 4PTGA 3V51A 4ZSLA 4LOQA 3FAAA 1JWHA 5HCXA 4KABA 1KV2A 4DEHA 4B0GA 4CCBA 5E90A 3IW5A 3HV4A 2F9GA 4FKPA 5L6PA 4A4XA 3FLZA 3PYYA 4C57A 3E8EA 3V5QA 2OXXA 4KSPA 5IEXA 5HD7A 4CFFA 4O7NA 4FT9A 4YTIA 1YI3A 5BVEA 3PFQA 4ZIMA 3IO7A 3FY0A 3GOKA 1R0PA 4V0GA 4KB8A 5ETIA 4DGMA 4FSWA 2J5FA 4U81A 2Z7QA 4CT2A 3KK9A 2GHMA 3MPAA 3PSBA 2OIDA 3UMWA 4RBLA 4ANMA 4ZSGA 2W1FA 4XX9A 4DFNA 1UU8A 3HV5A 1WVWA 5AX3A 4KS8A 4FI1A 2CKEA 3WE4A 2P55A 2GDOA 2WMBA 3BHHA 4MNEA 4K0YA 3ZLSA 2J90A 5CU6A 5ANIA 3WF5A 4ZTNA 1NW1A 4O86A 2B9FA 5A6OA 3FI4A 4GEOA 2UW6A 3CJFA 4QPAA 3MTLA 2J7TA 3VJOA 2OW3A 3C4EA 4R77A 3KF7A 2YIWA 3QTWA 3F82A 4XP0A 4G6LA 3NCGA 3PRIA 4YSMA 4AOIA 4F99A 4TNBA 1I44A 3LMHA 5CSWA 5A6NA 2NPQA 2R3OA 3HA8A 2IW8A 3FEGA 5E8TA 3Q5ZA 4YLJA 5HLPA 2VTSA 5HO8A 2SRCA 5BYLA 3UVRA 4M97A 3OG7A 4RWKA 5J9YA 3ORXA 3OZ6A 2XF0A 4ITJA 3HVCA 3D15A 3COIA 4FKVA 4K1BA 4PPAA 4ZP5A 5BVKA 2C6EA 3NYVA 5AUZA 3RBWA 3UZPA 5KMKA 4BDFA 4F09A 1OKVA 5LMKC 2ETMA 3T9IA 3GC9A 4GMYA 4EHZA 3DLSA 5EG3A 2CCHA 4EHEA 5JH6A 4JIAA 4D4SA 5C01A 4EOPA 4LL5A 1R0EA 4JR3A 3UJGA 2VTNA 2BPMA 4D55A 5L8KA 3QF9A 3W2SA 3UPXA 5EM5A 4O7WA 2I0VA 3ROCA 3RAIA 4ZJJA 4LMUA 4EK3A 2Y6OA 3N9XA 4W8DA 4ACDA 1BL6A 4PL4A 2OXYA 3GU8A 2ITZA 3P86A 4EWHA 2UVXA 4S2ZA 4X3FA 1H27A 2C30A 4LQMA 4F4PA 4EOIA 3N4TA 4A07A 5FDPA 1PRYA 5E1EA 4YTHA 3BGZA 5JQ8A 2QU6A 5KUPA 3NAYA 4ENXA 1CSNA 2XZSA 4BGHA 4BB4A 3R9DA 3VBQA 2I0YA 1E9HA 4LRJA 4ZTLA 5EDRA 5B2LA 3IONA 3QCSA 4LGDA 4Q9SA 5LXMA 5AIRA 5HCYA 2F57A 2W5BA 1Q8UA 3FV8A 3FMLA 4Y72A 4NM3A 3BYUA 2R3RA 4FV8A 2Y6MA 4AU8A 4CTCA 1QPDA 4H36A 2R7IA 4BWXA 2GS6A 2B53A 1OUYA 4IACA 1M14A 3TIYA 2PK9A 3DZOA 3LW0A 3MH3A 4U79A 4YJNA 3AD4A 3W8QA 5CI7A 5AUTA 4IW0A 2R0IA 2Z02A 2WTIA 4ZTSA 4V04A 2XJ2A 4FEWA 3DNEA 4EUUA 4C7TA 3W2QA 2X0GA 4UYNA 4U7ZA 3RGFA 2WMRA 4ZSAA 5J5TA 5KNJA 3GU6A 2GMXA 3QAME 4AW2A 1PMVA 4Z3VA 4R1VA 5FUTA 4ASZA 5M09A 4BYJA 5AV4A 5B2MA 2JDRA 4FSNA 4O7RA 3T3UA 4PP9A 5CYIA 4Y8DA 5A46A 5CTPA 3UDBA 3QBNA 2CLXA 3ZFXA 2VTPA 1OIQA 5JFSA 3VUTA 3BBTB 4PNKA 5DT0A 4YLKA 4IZAA 4YBJA 3SHEA 2X2LA 4JAJA 3EH9A 3CTQA 3M42A 1NVRA 5CZHA 5AV1A 5AUWA 5HG5A 4D5KA 3HMNA 3W55A 5JMSA 5LVMA 3E8DA 2F4JA 2PVKA 1URCA 4O0XA 4IC8A 3MYGA 2OGVA 1P14A 2WQMA 1WZYA 4Q2AA 2ZV9A 3TUBA 3F7WA 3UQCA 3IOKA 5ACKA 4EOQA 5HI2A 2DQ7X 2VO7A 4FC0A 3MA3A 3L8PA 4I5MA 2WO6A 5KO1A 4B8MA 4ANLA 1JKKA 2RFEA 2WMAA 2WMXA 2WTCA 4I0RA 4A9UA 3KQ7A 4FR4A 2BDWA 2ERKA 3F5UA 3MVMA 1PYEA 3QRJA 3Q9WA 4I5HA 4EONA 4BBEA 3QALE 5E1SA 4BI1A 1V0BA 1UU3A 2QR8A 5AR3A 4FV3A 4ZJIA 3FXZA 3S0OA 4AGUA 4O0SA 3FMEA 3IW7A 5DT3A 3TNWA 3TNPC 4EOKA 3DNDA 4PY1A 2Y4IC 4YJPA 3NVMB 3OWLA 4BTFA 1M7QA 3AC4A 3AT4A 1IASA 4UWYA 3DKOA 2WU7A 4YO4A 2AC3A 4ERKA 1GZ8A 3BI6A 3LFSA 2YJSA 3OY3A 4BI0A 4QOXA 1QPJA 2I40A 4WSQA 5HLWA 3UOJA 5AFVA 5EW9A 3HAVA 2YM6A 3ZONA 1VYZA 4CZUA 4CCUA 3HRBA 4CQEA 4NTTA 4AGWA 4G3DA 4IX5A 4DTAA 4Q9ZA 2VWIA 2IZTA 2BMCA 3POOA 4HGSA 1FVVA 4P5ZA 3R63A 4DFUA 2YAKA 5FGKA 2PZYA 5IQFA 4WG4A 3TIZA 3FMNA 1PMEA 3LQ3A 4ORKA 3ID6C 4TYHA 3KRXA 3UIUA 3QTQA 1DM2A 3UNKA 1Y57A 3QTIA 2XBJA 4FVRA 3R2BA 4UZDA 2OBJA 3PJ1A 4HCVA 3UZTA 4PTEA 3QD3A 1BX6A 1REJA 4RLKA 2XIZA 1JAMA 2PVNA 4F9WA 2W99B 2PVLA 5TR6A 2W06A 2BAQA 3SDJA 2PUIA 5GZ8A 3CGFA 3PG1A 3O8TA 2BDJA 2XVDA 4D58A 2RL5A 3C0IA 3FL5A 4J53A 4O6LA 3UNZA 4D5HA 4HYIA 4NM5A 5CU4A 4APPA 4I92A 4CYIA 4EHGA 3R73A 3BLQA 5EHYA 2R3JA 3ZC5A 4HVIA 2XBAA 2YWPA 3OWKA 3PXQA 3UVPA 3OP5A 3DBCA 2WGJA 4YZMA 5GJFA 1ZWSA 5HGIA 4DYMA 4O7SA 4Z7GA 3HMIA 3LFNA 3LLTA 2PMIA 4JDKA 1ZYLA 5EOBA 5EW3A 1B38A 3L9NA 4GYGA 4GK3A 4C4HA 4PMTA 3MB6A 4B4LA 4DFYA 4KRDA 3DK3A 5K5NA 3LJ2A 2WNTA 1H1SA 2PL0A 2IVVA 3OEFX 4KRCA 5HKMA 4XBRA 3RK7A 2CMWA 3B8RA 3TNIA 1WBOA 4NYEA 1B39A 3EQPA 1OVEA 2BAKA 3QYWA 1JKTA 4X2FA 3AQVA 4F9YA 4FKUA 4P5QA 3BZ3A 4FL3A 4AOJA 3G6GA 5JGBA 5AIKA 3R9RA 5H8BA 4BCGA 5LCJA 1ATPE 1PMUA 4QNAA 1YWNA 2RFDA 4FNXA 4WBBB 4I21A 4CEGA 3KMUA 4MVFA 4XUFA 4AZEA 4EK4A 4E6AA 4AW1A 2VTLA 4EH4A 3LE6A 3ALOA 4GIIA 5CVHA 4BCPA 4R7HA 2E9OA 4U43A 3VBYA 3MGYA 2DUVA 3HRCA 3OUKA 3VO3A 3F88A 1H08A 2QOCA 3Q2JA 1H1WA 4F0GA 3VW8A 2UVYA 4JBPA 2YDJA 4LM5A 3ZUTA 2OJIA 3PP1A 3R00A 4CZYB 5L8LA 5IQGA 4JG7A 3IW4A 3SW4A 5DIAA 4FSRA 3JYAA 4LMNA 2HW6A 4KUJA 2JKMA 3D83A 1URWA 3V5LA 3CBLA 3OTUA 1ZYDA 4QP9A 4DG0E 3R28A 4NCTA 2ZDUA 2VGPA 1K9AA 3V01A 4FEUA 4JQEA 4R6VA 3W2OA 4BCFA 2QODA 4BIEA 2W9ZB 3ZO1A 3E88A 4XRLA 1FGIA 2QURA 2GNHA 3G0FA 5CU2A 2RIOA 4EKKA 3G9LX 3O23A 3TNHA 2YZLA 5FLFA 3DTCA 4IAIA 4L8MA 1PXNA 5C9CA 5G1XA 3NAXA 5DHJA 5FXSA 3OFMA 2VWUA 2IZRA 3R7GA 3NYXA 1Q41A 4PP7A 2UW8A 3GUBA 4YNOA 3KMMA 3IGOA 4GYIA 4EHVA 3SG8A 4FGRA 4IMYA 3CE3A 3I7BA 4IVAA 5DBXA 3BHYA 4ZZNA 3ZDUA 5L6OA 4N57A 3RZFA 2GTMA 3HUBA 3ZBXA 4EJ7A 3C1XA 5E92A 2F2UA 3FSKA 5IG1A 3FLQA 4NT4A 5IQEA 2Z60A 2JIUA 5DI1A 5E8UA 3WYXA 2PE2A 2CKQA 4EH6A 4RX5A 3EYGA 3ROYA 4F9AA 3VS6A 5CT7A 1OGUA 5AP3A 4YC8A 4L9IA 4P4CA 3TNQB 3TXOA 2BZHB 4CGAA 3D14A 4C58A 1OUKA 3ZC6A 2I0HA 4EH8A 4I0TA 2XS0A 5AM6A 3ULIA 1Q4LA 2YIXA 3SD0A 4AZTA 5EKOA 4MX9A 2PY3A 4MXXA 2GFSA 3MFTA 5FTOA 3UYTA 3U9CA 2PYWA 3PA3A 4QO9A 3VC4A 1IR3A 3PXFA 4RIWB 3RPRA 5C1QB 1GZKA 5H8EA 4EH7A 4BGGA 4JXFA 3O8UA 2JGZA 3QTUA 2VWBA 2IO6A 3K3IA 3LIJA 4Q5EA 3ACJA 4X2GA 3L9LA 3VHEA 4IBMA 2WMUA 4H3QA 1L3RE 4MBJA 2ZB1A 3CQEA 1F3MC 3KGAA 2FSTX 3OF0A 4RFMA 5KKRB 1YW2A 3NRMA 1HOWA 1LP4A 2RG5A 3AC8A 4N70A 1ZZ2A 1YHVA 2W17A 1KE9A 5IQAA 3ETAA 3MVJA 3PXKA 3PA4A 3VS7A 4QP7A 4W9WA 4RFZA 2BZJA 4PV0A 4AT3A 2XNNA 3O7LB 1PKGA 4ANQA 4IIRA 4LRMA 4TRLA 4FSMA 4BF2A 3HGKA 4XHKB 5DWRA 3NSZA 1M52A 3NEWA 4JS8A 3U55A 3ORMA 3RCDA 4XG4A 2GNIA 2ZMCA 3HAMA 3MIAA 1YOMA 4OW8A 3DT1A 3BYMA 5H9BA 3C9WA 4QMXA 2UW9A 2UV2A 4FTAA 4EC8A 3HKOA 4KBCA 4E93A 4DFBA 4GV1A 2KULA 3WYYA 4AP7A 3KREA 3FI3A 4EJNA 3NLBA 4IVCA 4WNMA 3R7YA 4PDSA 1VYWA 4FSUA 2R5TA 3VULA 3DKGA 3Q9XA 3ZRKA 4O82A 5IH5A 3F5PA 3MFSA 4MCVA 4DF3A 4FV9A 3IG7A 3A4PA 3D5UA 1ZLTA 3QZIA 2YM8A 3QD2B 2C3JA 3LCOA 4AFJA 3QTSA 1O9UA 4IQ6A 3ZLWA 4MD7E 1E1XA 2J0KA 4I0SA 5FBNC 4JX7A 4CKRA 1H4LA 5CSVA 3TM0A 5TO8A 1P4OA 3HMOA 4JRNA 5LVNA 5DOSA 2X9FA 4I6BA 1OPJA 3KCFA 3BGPA 4L68A 5BMSA 3G6HA 4XG9A 4YJOA 5DYJA 4D2RA 5D7VA 3ENHA 3HRFA 2UZLA 3PXZA 5IH6A 5KHXA 2RF9A 2R3IA 3M2WA 4NEUA 4DEIA 4ZLOA 4RJ8A 1KOBA 4DCAA 4YJQA 2WEVA 3ZSIA 3HP2A 4JQ8A 1H28A 4PMSA 2VTHA 2OJ9A 4BZDA 4AG8A 3MI9A 3FMDA 3Q4UA 2JC6A 1HCLA 4C37A 2CCIA 1LEZA 1WMKA 1NA7A 4I94A 2B4SB 1PXIA 2OO8X 2WIHA 3FZSA 1IA9A 5DA3A 3ZXTA 4G31A 1SZMA 2YCSA 3NUXA 4ACGA 3K54A 5CANA 3FMJA 4E5BA 3C51A 3DBEA 3AD6A 4BDKA 4XRJA 3OS3A 4UMPA 2RGPA 3OY1A 4R3PA 4FBXA 1MRVA 1KV1A 4HOKA 4BTKA 3I0QA 2QOFA 5IZFA 3GP0A 4ZZOA 2QI8A 4YMJA 2CHLA 3EN5A 5TT7A 2GSFA 3WE8A 4IH8A 3RWPA 4H1JA 3A99A 3TL8A 5M56A 3FDNA 2WOUA 3TI1A 4AUAA 5FDXA 2IZSA 4B8LA 1XWSA 3ZZWA 5M51A 4QP4A 2X9EA 2ITNA 3BWFA 4GKIA 2UZWE 5BQ0A 3TTJA 4HVHA 4RIOA 1TVOA 4ZTRA 3LHJA 3Q96A 4UXQA 2HXLA 3UOHA 2YDIA 2VN9A 4IJPA 5E8SA 2J51A 3NS9A 2QO7A 3RAKA 3ZM4A 1FINA 1OM1A 2BRBA 1XH6A 5KBQA 4I20A 2XH5A 3EN4A 2CDZA 2A1AB 3RJCA 5JN2A 3NWWA 4X6RA 3ELJA 5LVPA 3RI1A 3PRFA 3PJCA 3PWDA 3LJ0A 2GNGA 2CNUA 3V8WA 2VX3A 3DFCB 5KE0A 3SG9A 5CEOA 3I5ZA 3Q52A 5CS6A 2OH4A 4D1ZA 3CJGA 1ZMWA 4XYFA 4GT5A 2FGIA 2X39A 2C6OA 5M08A 1WBVA 4A06A 4LGHA 2X4FA 4CFNA 1UA2A 2BRGA 4JIKA 3EWHA 2Q0BA 2W1DA 4S32A 2C69A 5DRBA 3O7LD 4O21A 2WHBA 5EYKA 4ZZMA 1JVPP 4F0FA 4J98A 3GCVA 4FT7A 5BVOA 5E8WA 3ZOSA 3PJ2A 4HPTE 4BDAA 2C4GA 2JLDA 2WFYA 3KRLA 4K33A 4EOMA 3E87A 3RALA 3DLZA 3E63A 2UVZA 4PX6A 4CVAA 2CKPA 4HGEA 4ZS4A 4DG3E 2J50A 4O1PA 3R04A 4IC7A 1JSTA 3ORTA 4BZOA 2CJMA 3HP5A 2HCKA 4MBLA 3FXXA 4O96A 5IEVA 4KA3A 4YZCA 3QZFA 4IB3A 5LVOA 4MNFA 4YSJA 2I0EA 5FWKK 3AC1A 5DGZA 4BCIA 1SYKA 3IDPA 4NSTA 4BTMA 3PVUA 3RAHA 2E2BA 2EXEA 2PZPA 2PULA 4RGJA 4BDEA 5KMNA 1J91A 2XM8A 3MBLA 4FG8A 4BKYA 4D2WA 2A27A 4GK4A 2OH0E 2XB7A 4YBKA 3GFEA 4B99A 2Y4PA 4FTLA 5HD4A 3R30A 4BBMA 2R64A 2ZM4A 3L9MA 3PXYA 1H25A 3R21A 4FTOA 4UYAA 3IOPA 5T3QA 5BYYA 5K4IA 4DT9A 4APCA 4GK2A 3ORNA 5CNOA 4UN0C 1U4DA 2JDVA 4ACHA 2VTIA 3PLSA 2XEYA 5GINE 2ZM1A 3HNGA 2UZUE 4BCNA 4C4JA 4ERWA 3ERKA 5ANOA 2ZJWA 3VBXA 4F6UA 4IADA 3R0TA 4EI4A 4P2KA 4QTEA 5CALA 1JSUA 4C4FA 3G15A 1R1WA 5BVNA 4R5YA 2P2IA 2GNJA 2ZDTA 3BWJA 3DDPA 1J7IA 4KKGA 4EK8A 3DAJA 4MEDA 1XO2B 1OPLA 3QQJA 4X3FC 3D7ZA 3PVWA 3SV0A 2IW9A 4E6QA 4LG4A 4QMSA 2QHNA 2W4KA 4V01A 2JDSA 3UVQA 2NNWB 3O0GA 4E8AA 5HICA 4QTDA 4XBUA 3MESA 5H8GA 1U59A 4ZTQA 3FY2A 4OR5A 3VIDA 3F5XA 4IX4A 4EKLA 4KIOA 3H0ZA 4QMUA 4GFMA 3UG2A 1ZOGA 4KBAA 2W05A 3G9NA 5J95A 3VUGA 3NUNA 5HVYA 3NUAA 4NZWB 3LMGA 4AN3A 4YPDA 2QOHA 3UC4A 4CFXA 1YHWA 4C0TA 4DH7A 4WD5A 4CRLA 2LAVA 1BYGA 2YAAA 3WZDA 4JVGA 3F3VA 4BY9E 1YQJA 4EH9A 4XLVA 2BKKA 2PVYA 3BEGA 3W2CA 3S3IA 1PHKA 4RA4A 4ASEA 3M11A 5HNGA 4ZJVA 4ZOGA 5AR4A 1KWPA 5DG5A 5K5XA 3TUDA 3JR1A 3FYKX 2YEXA 3GEQA 3C4ZA 2VAGA 2I1MA 4AA5A 3RK5A 4ENYA 4I41A 5ACBC 4BDGA 4I4FA 2XNEA 4OLIA 5E8YA 5CEQA 2W1GA 5AX9A 4EQUA 2IG7A 2J2IB 1JLUE 1MRYA 4EQMA 1LUFA 3QX4A 4CT1A 2B9IA 2V55A 3ZBFA 5JFXA 4X6QC 3DQXA 3SOCA 4RFYA 2UW3A 1BMKA 4AOTA 3PIYA 3N4UA 1H24A 2R3LA 3KK8A 3OCGA 1WBWA 1H07A 3JVSA 3ORPA 3QUDA 3GT8A 4XJ0A 5JGAA 3D7TA 5JK3A 2ITTA 3D5VA 3D5WA 4C4GA 3EQCA 3EQBA 4NWMA 5EYCA 5HLNA 5HIBA 4AS0A 1QPCA 2ITXA 5IISA 3TN8A 2JBPA 5DN3A 2B1PA 1RE8A 2BKZA 3Q04A 3CD3A 3FLNC 4XCUA 3VJNA 3MY1A 4C35A 3Q60A 4PL5A 1F5QA 4DBNA 2ZMDA 1OKWA 3CY3A 3PJ8A 4RJ3A 4WBOA 4Y85A 5EM8A 1BL7A 3UO5A 1CMKE 3B8QA 2PTKA 2B0QA 4EEVA 4GG5A 4ONAA 3H30A 4AX8A 4YGAA 4FEQA 4G3CA 2QKWB 5CSPA 5KMIA 1YXVA 3EFKA 3PJ3A 4M67A 3R1YA 4B6LA 2PU8A 4UV0A 1Q62A 5CEMA 3C13A 2C1BA 5I9WA 3WZEA 3ET7A 4N6ZA 3ANQA 2WOTA 1X8BA 2EB2A 2NRYA 4BDJA 3ZFMA 2WTJA 4RG0A 4FZ6A 4TYIA 5C4LA 4C62A 4HPUE 3EQHA 3V5TA 5AV2A 4D1XA 2WEIA 4O7YA 4BWKA 2C6DA 2W4JA 4FTRA 5FQDC 3QL8A 4DH3A 4DEBA 5IA4A 3E3BX 3UODA 2GNFA 1ERKA 3Q4ZA 3RPOA 4O7ZA 3QRTA 3ZRLA 3D2IA 4EZ5A 3LFEA 2XYNA 3MIYA 4C2WA 1M2PA 1T45A 5EW8A 5FEQA 3VS5A 2QR7A 2HAKA 3NPCA 5AP5A 2J0LA 4L52A 5FEDA 4M69B 1R3CA 2PMOX 5FXQA 1P5EA 3NNWA 3PPKA 3FC2A 3G33A 3RPSA 4IAKA 5IUIA 3HUCA 3KVWA 3KMWA 4FV6A 4AGCA 1EH4A 2WMTA 2YA9A 2Y8OA 4Y46A 1UWJA 3ZCLA 5HTIA 3R83A 1FVTA 4G6NA 4IDVA 1O6LA 4FSZA 3BU3A 4AWIA 3U8WA 3NW6A 2CN8A 3DBFA 2BDFA 3R8VA 3I0OA 4I5CA 3PUPA 4ACCA 4DH1A 4PDYA 4LOOA 2WZJA 4YZDA 3KU2A 5DEYA 3MB7A 4RIYA 4BYIA 1MRUA 1XR1A 4J71A 3BEAA 4F7SA 3AC3A 3PA5A 4L42A 1KUTA 3HMPA 3OXTA 2CGWA 1BKXA 3ZFYA 4QMPA 1H00A 4FTJA 4KAOA 2JD5A 2CPKE 1YI6A 4X2NA 3HEGA 1SVEA 4K6ZA 4FT0A 3L1SA 4NUSA 3AMYA 2ETRA 2PHKA 5HVKA 2UZOA 4BR3A 3PSCA 3LJ1A 1UKIA 4RZWA 4DINA 3LCDA 3N4VA 4K8AA 2OF2A 3KXNA 2W1ZA 5TKDA 2O65A 3OT3A 4GW8A 4MD8E 4OBOA 2IVUA 5BX0A 5FXRA 5ITAA 2GTNA 1YRPA 3D2KA 5L2SA 4EK6A 5GNKA 5C8MA 4ALVA 3PVBA 4HZRA 3NUYA 5KCVA 2ONLC 2QLQA 3NX8A 2V62A 2XK9A 4GH2A 2ETKA 4QMLA 3UOLA 4HGTA 3QCQA 4U3YA 3R9OA 3THBA 3KXZA 4IFCA 5E7RA 4KS7A 3RHXA 3PLAE 2JDTA 2JAMA 4F1MA 5B2KA 5IA3A 3TKHA 3KC3A 4GUBA 3C4XA 5FRIA 4BN1A 1QMZA 2GNLA 3AGMA 3ULZA 2UW7A 3MFUA 1IAHA 2O5KA 4CNHA 3GQLA 4KKHA 2YIQA 1JKLA 4YJRA 2YLEA 3UOKA 4IFGA 5M53A 1WBSA 2UW0A 4MYGA 3W33A 3LFBA 1OB3A 4LFIA 2O0UA 1PXKA 3GCQA 4WG5A 4KIKB 4FA2A 3R22A 5M06A 4FIGA 5JFWA 2XK6A 4G3EA 2OJGA 5AP6A 4D9TA 4MTAA 3GCSA 3JS2A 1CKJA 3QQKA 4XLIA 2QOBA 3C0HA 4GJ2A 5ETAA 5FTQA 3TACA 4E4NA 2XJ1A 4FV5A 4EBWA 5K4JA 1JPAA 4I22A 4TZRA 4GL9A 3EQRA 2Z2WA 4L44A 3MWUA 4TN6A 3D0EA 4XV9A 2WMVA 4NU1A 5E8XA 4R3CA 3OW4A 3QYZA 4YZNA 4ID7A 4K77A 3FI2A 2X7FA 3JY0A 3MTFA 3OROA 4DGLC 4F6WA 4Z7HA 5GZAA 4D9UA 1PW2A 2JBOA 1DS5A 4J8NA 3VN9A 3TZ8A 4Z55A 4ZY4A 1IG1A 3LOKA 2PUUA 3QXOA 4FEXA 1P2AA 2R4BA 4Z9LA 3DS6A 2XNGA 4KSQA 2QO9A 4NKAA 4QPMA 2G9XA 5AUVA 4QQJA 3UIBA 2JIIA 3RM7A 4ZMEA 4GG7A 1XBBA 2WTKC 5HCZA 2R3NA 1G5SA 1F0QA 4CTBA 3I5NA 3KF4A 3OHTA 1YWRA 3NGAA 3VBVA 4AZFA 4U3ZA 2X6EA 4NFNA 4S30A 4E6CA 2QVSE 2OZOA 4LYNA 3BHTA 3MV5A 3KN5A 2HIWA 3F2NA 4O7TA 3EN7A 3VUMA 3QCXA 1BUHA 3VUIA 3T9TA 1V0PA 2JKOA 3DXQA 2PZRA 5HVJA 4FZDB 4BIDA 4FKJA 4QMOA 4IWQA 4D2SA 3ORZA 1H1PA 4IDTA 5ETFA 1CDKA 1XH8A 5DR9A 4NM0A 3DB6A 5CENA 4A7CA 1Y6BA 3UP2A 4FUXA 2QQ7A 2X7GA 2ERZE 3D94A 4D4RA 3KXXA 4QPSA 1ZARA 5IKWA 3PY0A 4DH5A 2W96B 3CP9A 4Z16A 4JI9A 4E4XA 5J1VA 1YOLA 3ZSGA 4EL9A 4UB7A 3BV3A 3GENA 4FOBA 4DGOA 1H0WA 3TCPA 3VNTA 3UP7A 3GVUA 3K5UA 4OTQA 4RX9A 2C6LA 3S4QA 2GU8A 4MBIA 5IU2A 4YZBA 3IQ7A 4MXZA 4U42A 3HDMA 4HVGA 1YHSA 4XS2A 5M4UA 3NR9A 3OXZA 2AUHA 3A61A 4Y5HA 1XJDA 3TUCA 3UTOA 1FVRA 4J99A 2PMLX 5DLSA 2ZV2A 4PPCA 3F66A 3HYHA 1U54B 2Y9QA 4AA0A 4C2VA 5LMBA 1TQIA 2RKUA 4QP3A 4KKEA 5F1ZA 3V5WA 2WQEA 5LJJA 5E8ZA 3MY0A 1G8AA 1FMKA 5JKGA 3ZH8A 1Q8TA 4O27B 4ZTHA 3NIEA 3KULA 4BDCA 5I3RA 2XCKA 1LPUA 4WKQA 3BQRA 3H4JA 3VUKA 4O0VA 3RNYA 4C02A 1J7UA 3RKBA 3SAYA 4DITA 3ZZEA 1XHAA 4EOJA 2A19B 4BL1A 4C59A 4HYUA 2WPAA 3ZLYA 3IW6A 1BI7A 4RWLA 5F20A 3ZYAA 4CMTA 2BTSA 3HA6A 4XEYA 4UALA 4BDIA 3AC5A 5KMMA 3QQUA 2OFUA 4IB0A 4FYNA 3TTIA 3SVVA 1VR2A 3ZEPA 2UZBA 4IZ7A 3NVKI 3F6XA 2CNVA 2BAJA 3FPMA 4XH6A 4IAZA 4OTIA 5C8NA 5ANEA 4ZXTA 2BROA 4DFZE 4IEBA 5HE0A 4FIEA 4BI2A 1Q61A 1PXJA 2JKQA 4JLCA 4QYHA 4PMMA 4FK3A 2W0JA 3QLGA 3RWQA 1PY5A 2VD5A 5D1JA 3ZTXA 2HZ0A 5FTGA 2XA4A 4TKSA 4LV5A 3U54A 2IVTA 3P5KA 5F94A 3T3VA 3KL8A 4WRSA 4Y73A 5I4NA 2FO0A 4FTTA 4YJUA 5ANGA 3WI6A 3N51A 4M12A 5IUHA 1AD5A 4FZAB 4UMQA 4XNEA 4DAWA 4F6SA 2G15A 4M66A 2FYSA 3QQHA 3BHUA 3RZBA 2IVSA 3QWJA 5AR7A 4U45A 4KIQA 3CSVA 4V0GB 1UWHA 4Y5QA 1XH5A 4AA4A 4PQNA 3FZTA 3QC4A 4UZHA 3WZUA 3QUEA 3DA6A 3E8NA 4YHFA 5F95A 4QMQA 2PVMA 1OZ1A 3V3VA 5KMOA 5CLPA 2YM5A 3TKUA 2W5AA 3E8CA 4X0MA 4MAOA 4L46A 2OZAB 4WUAA 4AFEA 4KBKA 4YP8A 2V5QA 4Y83A 2C6MA 1ZRZA 2C47A 3DJ5A 3H9OA 2ZOQA 4X2JA 2WQNA 2BFXA 4JL9A 2ITWA 1OL2A 2JITA 5CXHA 3RNIA 3VQUA 4AZSA 3A8XA 5BVWA 2OSCA 3PE1A 3V6SA 2BTRA 3P23A 2I7QA 4MQ2A 2X8IA 3OVVA 4XG3A 2IZUA 1CKIA 4FSYA 5AP2A 3W2RA 3D4QA 4BDBA 2YN8A 4FV7A 4W9XA 3KFAA 5TF9A 3LFAA 4ITIA 4TYEA 1K3AA 5M4IA 4IVDA 3UQFA 3CR0A 3PTGA 5ANDA 5HG7A 4FT3A 1M2RA 1YWVA 1U5RA 2X81A 4FK6A 4OBQA 3R8ZA 1GY3A 4E5AX 4LUDA 3C0GA 4EOLA 3Q4TA 4CG9A 3AXWA 4BRXA 3FLYA 4LI5A 4DC2A 4WNPA 1UVRA 2C3KA 2W7XA 5I9XA 2OICA 3HX4A 4TT7A 2VO6A 1H01A 4FZFB 4Q5HA 4XOYA 5B0XA 4A9SA 5ETCA 2XMYA 3P08A 4MH7A 5KMJA 4QYYA 4U44A 4EYMA 4JBVA 3Q2MA 4F9BA 2YM7A 2CNQA 4X3FB 2P3GX 3CY2A 3EHAA 3MDYA 3SLSA 5IQHA 1OL6A 2O63A 2PE0A 2RG6A 4YURA 5AJQA 2PVHA 4FNZA 4IJ9A 5JZNA 5HBHA 3BU5A 3EQFA 4IHPA 5JRQA 3I60A 4L6QA 3DV3A 2F7ZE 4RC2A 5J8IA 2JFLA 3TDWA 1WBTA 2O3PA 3PG3A 3R01A 2R9SA 4FTMA 4OTFA 1WBPA 4TL0A 4ALWA 5CEPA 5C8KA 1ZYCA 2HZNA 3OUNB 2ZB0A 4RC4A 5DVRA 3WBLA 4O83A 2XKDA 4G1WA 3SW7A 4QYFA 2YLFA 2VV9A 4HYSA 1W98A 4GT4A 3RPVA 3EL7A 4M69A 3CKWA 3FZ1A 5M4FA 1GIJA 2BZKB 1RJBA 4FVPA 1RDQE 2X6DA 4OTPA 4EUTA 4J96A 4YC3A 3E3PA 2YM4A 4O0TA 4CFMA 4D4YA 4RWIA 2XK3A 2RSVA 1VZOA 2VO0A 4D1SA 4U0IA 5BVDA 4W4XA 4ACMA 1GIHA 3DXNA 4QYEA 4FZ7A 4AGDA 2QOOA 3S00A 1Z5MA 3DK6A 3U6HA 2ZV8A 4G9RA 4II5A 2G2HA 1Q99A 4E7WA 4UY9A 1OKZA 4MXAA 3WIKA 2CGXA 4BWPA 5I9YA 4L7FA 3I6WA 2YM3A 4IAAA 2RFSA 3CGOA 4CSVA 5EH0A 3GCUA 3R7VA 4A9RA 1S9JA 4E4LA 2X2KA 3MJ2A 2C3LA 4X7QA 5L3AA 4FOCA 3UZRA 4DEEA 5CAVA 4QTCA 1UKHA 3II5A 4HCTA 4FTNA 1A06A 3LCSA 2PVJA 4LOPA 1M17A 3JY9A 1WBNA 4CFVA 1ZYSA 2VTMA 4MXYA 5HE1A 3VS0A 3TZMA 2J6MA 4C61A 3G0EA 4CRSA 4DE4A 1KSWA 3BYVA 4DGNA 1WVXA 3ODZX 1J1BA 5JEBA 3R2YA 4H39A 3R02A 2PMNX 3U9NA 3WF8A 1O6KA 2HW7A 4OTHA 5EQPA 2UZNA 3QD4A 3U87A 4E1ZA 1OL7A 5HG9A 4F70A 4I93A 3KRJA 2XKFA 4I24A 3Q4CA 4XG7A 5DR6A 4AN9A 4BCQA 4DEDA 1OECA 3TZ7A 3CC6A 3HL7A 4OAUC 5I9ZA 3LMIA 2H96A 3I79A 3F3ZA 3L8SA 1ZY5A 3BCEA 3R7EA 4BCMA 4G3GA 1JOWB 4WA9A 2R3GA 2Z8CA 3C7QA 1Q8YA 4QMMA 1CKPA 2XRUA 3QHWA 3U6JA 4TWCA 2ZVAA 2PZIA 3GI3A 4JX3A 4O1OA 4OUCA 1ND4A 1CTPE 4OBPA 3IW8A 2H9VA 4YC6A 3FMMA 4QD6A 4F7LA 4TXCA 4L01A 1OMWA 3VF9A 3VBTA 3IDCA 1CM8A 4JT3A 4GFOA 5I9UA 2QOIA 2VNWA 5I3OA 3DOGA 5CX9A 4O0YA 5FM3A 4C33A 4JDJA 3MS9A 2WIPA 3P7CA 4KIKA 2BZIB 3DY7A 2VTAA 2X8DA 3EZRA 1OKYA 4I6HA 3UIMA 1ZZLA 4AT5A 4F65A 1OI9A 3JXWA 3M1SA 4PUZA 4WG3A 4NK9A 2BR1A 4FKLA 4IX6A 4M3QA 4O2PA 5JSMA 2OG8A 4TYGA 4XV3A 5GZ9A 1H1QA 4LGGA 5EI2A 5EYDA 3MH1A 4BIBA 5IA2A 3GC0A 5IEYA 5E8VA 3LXNA 1HCKA 4BDHA 3FSFA 3F61A 3OCSA 3GC8A 1UNGA 4O2ZA 5BVFA 3A7FA 1XH9A 2EUFB 3UGCA 1UU9A 4BCHA 1ZMVA 2HK5A 4HNFA 4L00A 3FMKA 4GFGA 4YO6A 4C4IA 3NCZA 4QMVA 4F7NA 4IVBA 5BNJA 2HXQA 1LEWA 5AEPA 3EOCA 5L8JA 3C50A 1Y8YA 3R9HA 1XBCA 5HO6A 5A4TA 3GU7A 5IMXA 5BUIA 4PMPA 5C27A 3HV6A 2PWLA 4BHNA 3MJ1A 4G5PA 2Q0NA 2Z7SA 3BU6A 3SA0A 2GCDA 2X7OA 1TKIA 5IF1A 4ITHA 3AC2A 2FA2A 2B9JA 5AMNA 4DLJA 2W1HA 4G5JA 4F0IA 5AR8A 4W8EA 5AA9A 3JVRA 4ANBA 1IA8A 2H6DA 4F7JA 2HY0A 3O50A 5EKNA 5IQDA 4WIHA 4GCJA 1PXPA 2PPQA 3DZQA 3SRVB 2EXCX 3REPA 5M44A 4GU9A 5CSXA 3ITZA 1OIYA 5LVLA 4M0ZA 3RINA 1Q24A 1JQHA 4DTKA 2I6LA 2R3FA 1GJOA 2Y7JA 3C4WA 3R6XA 4O6EA 3PY3A 1MP8A 3IECA 4V05A 4K11A 4YJTA 3ZSHA 4CMUA 4IAYA 5HIDA 1YI4A 4R78A 5EHLA 4O0RA 4ANNA 3KXHA 3ZO2A 3EQDA 4A4OA 1I09A 1RQQA 3KB7A 4R8QA 2R3QA 5J5SA 5EQYA 2NRUA 4MWHA 3VWAA 2XJ0A 3P9JA 3VW6A 3GBZA 2YJRA 4RJ6A 5AM7A 3NNVA 3PPZA 3E93A 4IANA 4EOSA 2C6IA 4J1RA 4S33A 2AYPA 2W5HA 4DCEA 3FQHA 2O64A 4P7EA 3OD6X 3GCPA 4ASDA 1Q5KA 3P0MA 4JDHA 2WMSA 3O71A 4NH1A 1JBPE 2PE1A 2ZV7A 5FEEA 5F4NA 4F9CA 2GS7A 5CT0A 2XKCA 5IUGA 5AAFA 3F3WA 3CIKA 4XG8A 1SMHA 2WAJA 3SXSA 2UZTA 2X1NA 5AUXA 4FTKA 3BRBA 2PVFA 2FB8A 1GOLA 3GU5A 4HCUA 3LXLA 4D2TA 3IS5A 1TQMA 4R5SA 2YZAA 5IDPA 3IGGA 5KX8A 1XKKA 1ZOHA 2FH9A 4C4EA 2X2MA 3A7GA 3E5AA 2QOLA 4O81A 2J0MB 4FE2A 2BVAA 1XH7A 2WQOA 2Y4IB 3LFFA 5A14A 4ALUA 1GZNA 3EN6A 3COHA 3EFWA 4ZY5A 5C26A 1FGKA 1FPUA 4G9CA 1RW8A 3CTHA 2G01A 4IWPA 4FUYA 4A9TA 2QNJA 1GNGA 2R2PA 3MN3A 1PXMA 4I6QA 3WF7A 3QTZA 1YXSA 4AW5A 4F1OA 4C38A 5GJGA 3G51A 4JG8A 4USDA 4E6DA 4MWIA 4FG9A 2YDKA 4FIIA 2VWZA 4M14A 2W4OA 3RP9A 4FVQA 3EFLA 3FE3A 5HEZA 2Y0AA 3AMBA 2BRHA 3O17A 4NIFB 5HU9A 4DEGA 1OBGA 2XRWA 3MVLA 4AZVA 3OBGA 5H2UA 4O84A 1Q8ZA 5FM2A 1OL1A 1S9IA 4GIHA 3FJQE 2WTKB 3QU0A 2XK7A 2W9FB 4NL0A 3KRRA 2WQBA 3QKLA 5DE2A 5K0KA 2F49A 4I1ZA 4H58A 4RPVA 4F64A 4G34A 2WXVA 4J95A 5A54A 4TY1A 3OOGA 4IZYA 3QCYA 4L3PA 4XP2A 4E20A 3BHVA 4YTCA 4I4EA 4DFXE 5CF8A 3QZGA 3EKNA 4YNEA 5FD2A 4S31A 2C5XA 2HELA 2XM9A 3V5PA 2NP8A 4FNWA 4RVLA 3AOXA 4TNDA 5EI6A 3R7IA 2J9MA 5TE0A 2HOGA 3QC9A 4ZEGA 4DG2E 2VWVA 4PF4A 5IQCA 2OZAA 2OLCA 4RIXB 3A4OX 3ZUVA 5M55A 1APME 4N4SA 3U6IA 4FX3A 4LUEA 5DRDA 5M57A 2GPHA 3QGYA 4IWOA 3ZLXA 5IA1A 5TOZA 2GFCA 3QQGA 4GSBA 4Y95A 5J9ZA 1JNKA 3DK7A 2HZIA 3LVPA 2OU7A 3VQHA 3W18A 1B6CB 4WT6A 5AV3A 4RIWA 3R8MA 5A4EA 4IB1A 3AG9A 4PWNA 4UBAA 2P33A 4USFA 5J9LA 3H9FA 3ORKA 5IH4A 1L8TA 2YWVA 4WUNA 5JGDA 2B55A 2H8HA 4QQTA 3MSSA 2YISA 3WARA 4BZNA 5EOLA 4WOVA 3E64A 3NDMA 4M15A 4RWJA 1J1CA 5L6WL 2C68A 4ZAUA 2PSQA 4AACA 4MHAA 5BMMA 1UNHA 3TG1A 3EL8A 5CI6A 3RTPA 3R9NA 4O7LA 3R7UA 3D9VA 4NTSA 5I5ZA 3RCJA 5EM7A 3QFVA 4U9AA 2A0CX 5CAOA 2OJFE 4QP1A 3OC1A 3DGKA 3NUUA 3LM5A 4NJDA 1YOJA 3F9NA 3QKMA 5CAPA 3B2WA 3G90X 3ORLA 5AAEA 1T46A 2VWXA 5HIEA 3OXIA 2QD9A 3FKNA 3EFJA 3TDVA 4C3PA 4GT3A 3QGWA 4QMYA 5CWZA 1QL6A 1ZOEA 1FBNA 4OTRA 3H9RA 2WELA 3LQ5A 3K3JA 4FV4A 4TTHB 4FKWA 4GS6A 1KE8A 3AGLA 3K5VA 3F3TA 4FSQA 2YABA 1YXUA 3LPBA 4NM7A 3UPZA 3CQUA 3COMA 3LXPA 4FTUA 2UZDA 3A62A 3O96A 3QA0A 3BELA 5BPYA 3LCTA 2R3HA 4FV1A 3LQ8A 4CV9A 3PIXA 2PUPA 3PVGA 4RT7A 1YXXA 3MA6A 2EB3A 3ZO3A 4FTCA 3LFQA 3E7VA 1WFCA 3B2TA 4FV2A 4YJVA 4E73A 3WZKA 3UIXA 3SC1A 3IPHA 3AT2A 1PJKA 3PXRA 5LQFA 3NMUF 2Q83A 2UW5A 3C4CA 4CKIA 3HV7A 2IW6A 3AMAA 4PPBA 1GIIA 5KMLA 4L67A 4OTWA 3QTXA 2WTDA 2VTJA 5A9UA 2FSOX 3NYNA 2IPXA 4R1YA 2XCHA 4UWBA 3I6UA 1DI9A 5K3YA 4J7BA 5K9IA 2B52A 3FL4A 3PDTA 3QZHA 4KNBA 4PDOA 3EB0A 2JAVA 4QTAA 4U5JA 3DXPA 5A3XA 3NNUA 4DGGA 4UMTA 4GJ3A 1R78A 3P78A 5JZJA 4BCJA 2V22A 2CKOA 3GOPA 4XG2A 5IA0A 3VRYA 4GRBA 3TT0A 5HNBA 3R8UA 4CYJA 2UZVA 3FQSA 3HECA 2YACA 3QLFA 3TKIA 3ZU7A 4D4VA 3CKXA 5AAGA 1J3HA 3PE2A 1G8SA 2XNPA 4FG7A 4FKGA 4RQKA 5AA8A 1NT2A 3T8OA 1O6YA 3F5GA 3NNXA 5A4LA 3PY1A 2HZ4A 3DU8A 4EORA 3CQWA 2YERA 4NCTC 5CXZA 4D2PA 4IM2A 5AUUA 3MH2A 2QCSA 1G3NA 4MK0A 3KCKA 3NUPA 2J0IA 3POZA 5CEKA 4OTDA 4ZLYA 5KBRA 2R3MA 3BE9A 3NIZA 1FQ1B 5DNRA 3V8SA 1BI8A 4RQVA 3LM0A 3UNJA 4O7VA 4O22A 3R8PA 3PP0A 4FF8A 2WU6A 1P4FA 4QP2A 3UMXA 5D7AA 2FSMX 2IN6A 3DBDA 3LFDA 4FIHA 5KZIA 5LMKA 2XP2A 1AQ1A 3SXFA 4BTJA 5CVGA 3JPVA 1W8CA 2JIVA 2VTOA 5EK7A 4CV8A 2GQSA 3QRUA 3S95A 4I23A 4QQ5A 4JOAA 3VS2A 5J7HA 4BKZA 3FMHA 2HWPA 4IAFA 3NYOA 4U6RA 5CZIA 3WF9A 3Q9YA 3UO6A 4DHFA 3RM6A 5FP6A 3RMFA 3H10A 3DKFA 3ZXZA 2BFYA 4RLLA 2G1TA 4BGQA 3CTJA 4QNYA 4U40A 4IB5A 3LFCA 4QQCA 3TZ9A 1W0XC 4GVJA 1OITA 2C0IA 3V8TA 4EZ7A 3O51A 3E62A 2QG5A 2DS1A 2QLUA 3DJ6A 3Q32A 5E91A 3LAUA 3ZO4A 3DKCA 3A7HA 3PWYA 4E4MA 4EZ3A 1PXLA 5D41A 3DFAA 4RRVA 4CFWA 1YXTA 3K2LA 3FPQA 4HW7A 4QMNA 3I4BA 3P4KA 4M13A 1ZY4A 2C6TA 2QO2A 4M0YA 2HWOA 2CSNA 3OBJA 2FUMA 4U97A 4NW5A 1Y8GA 4LRKA 5HZNA 5LWMA 3AD5A 5L2WA 4AF3A 5HQ0A 5CVFA 3MW1A 2V7AA 3A8WA 4DT8A 2W1CA 3FHIA 3PSDA 5CEIA 1WVYA 2VWYA 3FKOA 3IK3A 4X21A 5AV0A 3TV6A 2EWAA 3QRIA 4QYGA 4FODA 4FTIA 4QTBA 3GFWA 5HNIX 2RFNA 4NFMA 4RJ4A 2DWBA 5EFQA 3SGCA 3V6RA 5D9HA 4FYOA 4I6FA 4M68A 4DLIA 3FXWA 4JR7A 2IJMA 4XP3A 3SRVA 5ICPA 5M4CA 2VTRA 4YU2A 4M84A 4IM3A 4RMZA 4B7TA 2ACXA 1A9UA 4WRGA 2C0OA 4E3CA 4ZTMA 5AADA 2OJJA 2CN5A 2VU3A 3DTWA 1DI8A 5BYZA 4DFLA 3GGFA 2Z7RA 3FZOA 5DPVA 5EI8A 4OT6A 5HTCA 4CFUA 3BYOA 3U51A 2G2FA 2VGOA 5CAUA 4G17A 2E9NA 1PF8A 5CU3A 3WZJA 3QHRA 4HNIA 3FHRA 4YLLA 1A48A 3ZRMA 3DAKA 4FICA 5FG8A 1XBAA 1Y91A 3R1SA 4K9YA 5ANJA 2ONLA 3SQQA 4AT4A 2ITQA 4BFMA 3E92A 2VX1A 4YUQA 2C5YA 2UZEA 4D2VA 1JSVA 2GQRA 4CG8A 4I5PA 2R7BA 1UNLA 3LZBA 4HGLA 4L3JA 5HE3A 3TV4A 4CZTA 1MQ4A 4NKSA 3C5IA 4R3RA 4RX7A 4CQGA 3F2RA 4OAVB 4W4YA 4QT1A 3QTRA 5D11A 3WOWA 4D28A 2ITOA 3BLHA 2YCFA 3DB8A 3ZDIA 5CU0A 5T6KA 4L43A 2CLQA 5LWNA 2NO3A 3PZEA 1KE7A 2ESMA 4C3RA 1ZYJA 5GIPE 5EHOA 4A4LA 4G16A 4GVAA 2OKRA 2BILB 2F7XE 5A4CA 2FSLX 3CPBA 4EBVA 2B9HA 5CNNA 5CSHA 1UV5A 1M2QA 1Y6AA 3TEIA 2QHMA 4CLJA 4RJ7A 3EYHA 3ZHPC 2ZM3A 4BBFA 1OIRA 5HE2A 3V04A 4CKJA 4EH2A 3W32A 2XYUA 2XIKA 4N0SA 3DAEA 4IWDA 5H3QA 3AT3A 3UBDA 4D0WA 4WO5A 5CF6A 4C34A 5B7VA 3Q3BA 4MNEB 5FBOA 3W8LA 3ATSA 3GXLA 4RVMA 2BRMA 2VO3A 4OTGA 4NIFA 3E7OA 4ZY6A 3R1QA 4AZWA 2OWBA 3D7TB 4H1MA 2JDOA 3C4FA 4X2KA 3VUHA 3OOMA 3IDBA 4RC3A 3VHKA 5AP0A 3COKA 3G2FA 4UEUA 3QD0A 3FZPA 3A7JA 3QUPA 4W4VA 4BHZA 4FIJA 4AXAA 2EU9A 3ANRA 4IXPA 4BICA 1MUOA 4XMOA 4QRCA 4RJ5A 4U41A 4U8ZA 4YHJA 5CAQA 4J8MA 3CD8A 5DT4A 4AW0A 1Q3WA 3CCNA 3QQLA 5GJDA 3F7ZA 5T68A 3VUDA 5BUEA 2BRNA 1OIUA 3BE2A 5G6VA 2C5NA 1OPKA 2DYLA 2YIRA 3MH0A 4JNWA 5HESA 4EWQA 3WIGA 4JBQA 4FKIA 1YDTE 3FBVA 2WKMA 3O8PA 4JAIA 4N6YA 2H34A 2OIQA 3FQEA 4AE9A 4CD0A 1NY3A 3ALNA 2PZ5A 4J52A 2B7AA 3RPYA 5KHWA 1J7LA 1IAJA 3ZM9A 4JBOA 4WNOA 5BUJA 1V0OA 2YITA 5LOHA 2AC5A 4QMTA 2A4LA 5HBJA 3KY2A 3L8VA 4H3BA 2V0DA 3QQFA 3FKLA 4RZVA 2C5VA 4QP8A 3CLYA 4FSTA 3RHKA 3CEKA 4TPTA 5KZ0A 4RIXA 3SXRA 3P79A 1Z57A 2E9UA 4G2FA 5L2QA 3H3CA 2R3PA 3BV2A 1BLXA 2O8YA 3EQGA 4RX8A 3I7CA 1WCCA 4AAAA 4L7SA 5IA5A 1GZOA 1NVSA 2XKEA 4UXLA 4UX9A 1PKDA 2BALA 1IRKA 3HLLA 4JDIA 4O0UA 3UQGA 5GIOE 2YCRA 2C5OA 2LGCA 3BGQA 4RVTA 3Q6WA 4DA5A 2REIA 3OCBA 4JG6A 2BIYA 3QRKA 4K2RA 4ZMFA 5AUYA 3F69A 2GS2A 3FLSA 2VTQA 5IPJA 4KIPA 3ZEWA 4FKTA 4MXOA 2Z7LA 4AQCA 1PMNA 4YR8A 3V5JA 3IKAA 3W10A 5IMEA 3F3UA 4FIFA 3U4UA 5EDPA 3UG1A 5LARA 3VS4A 4UMUA 1U5QA 4YJSA 3BQCA 4D0XA 5GHVA 2X4ZA 2F2CB 2ITVA 4JQ7A 2OXDA 2J4ZA 5ANKA 5L2IA 5F9EA 3GU4A 2XIXA 4QMZA 3RAWA 2ITPA 1E1VA 2J5EA 3Q9ZA 3SKCA 2OFVA 4AE6A 2WD1A 3UE4A 5J1WA 4K18A 1H1RA 2C1AA 4WNKA 1WAKA 5CQUA 4AN2A 1TQPA 4LV8A 3KXGA 3RVGA 3MY5A 1QCFA 2XK4A 5EQEA 1REKA 2XNBA 3VS3A 3ZS5A 2BIKB 4RIYB 1FOTA 5J79A 3RK9A 2F7EE 2BUJA 2ZAZA 4IX3A 5JFVA 4FEVA 1UU7A 5CF4A 4BDDA 3ODYX 2W1IA 2EVAA 1MQBA 1LR4A 3I1AA 1NXKA 4H05A 5IDNA 2HYYA 4FNYA 1SNXA 4L45A 5HTBA 2R0UA 5IQBA 4RVKA 3CPCA 2CGVA 2FVDA 2B54A 4FKRA 5E9EA 4QP6A 3WILA 3BPRA 4IM0A 3DDQA 3ZUUA 2E9PA 2O2UA 2C3IB 3VBWA 4G6OA 4O38A 2BHHA 4WSYA 2XNMA 2VWWA 2QOKA 3A7IA 3WF6A 4XV1A 3R71A 4E26A 4EYJA 4BCKA 4HVSA 1NVQA 5L4QA 2ITYA 5HHWA 3GB2A 3EZVA 4O0WA 3DCVA 3C5UA 4YTFA 5D12A 3W16A 3HV3A 3LXKA 3MFRA 3OEZA 3QKKA 4KWPA 2X8EA 5AP7A 1YDRE 2R3KA 4A9YA 4MF1A 5AWMA 3S2PA 5C03A 4RA5A 1JKSA 2JKKA 3BYSA 2PVRA 1PYXA 2GHLA 2JEDA 3KEXA 1GAGA 3P1AA 5LCKA 4HVDA 2VUWA 2QU5A 4NJ3A 4ZSJA 4BKJA 2WMWA 3DQWA 3P7AA 3PIZA 3QWKA 4HJOA 4CMOA 3LKMA 3ACKA 3VS1A 1Z9XA 4R7IA 4TWPA 4J97A 4EK5A 4H3PA 2WB8A 3EQIA 4PDPA 2OF4A 3BLRA 2QONA 2PUNA 2UW4A 3QXPA 3LCKA 4PTCA 3HDNA 2OIBA 3KN6A 4LL0A 4XG6A 3TJCA 3DPKA 4ANOA 1SM2A 2YIYA 2GHGA 3OTVA 2P4IA 2IWIA 5HG8A 1ZAOA 3NW7A 4MXCA 2WMQA 3ORIA 4CLIA 4ZK5A 4EQCA 1FMOE 2GQGA 4C8BA 1KE5A 3LLAA 4ZS0A 1U46A 1DAWA 3KXMA 5HX6A 3NZ0A 4C36A 3FLWA 2C0TA 2WTWA 5AP4A 2A2AA 4M8TA 4EH3A 5CASA 1W83A 4O91A 5EM6A 4DTBA 3OW3A 4HZSA 4FKQA 2QC6A 2YFXA 3KKVA 4L53A 5HBEA 4OGRA 4OT5A 4P90A 5CQWA 4ASXA 3FC1X 5DEWA 4F1TA 4FKSA 2VTTA 5DMZA 4PRJA 4TW9A 5HU3A 5HOAA 3EJ1A 3F2AA 1XQZA 3OWPA 4WHZA 5AP1A 4B9DA 1ZXEA 4TYHB 5A4QA 1H26A 2KTYA 1W84A 1OL5A 3TJDA 4CXAA 1ZMUA 3KA0A 1KE6A 1VJYA 3H0YA 3OCTA 4HYHA 4E5WA 3KVXA 3SOAA 3VF8A 3G5DA 1AGWA 5FP5A 3W1FA 3R7OA 4EH5A 3TWJA 4L3LA 5HORA 2XEZA 5E4HA 3UO4A 5LMAA 3MPTA 3R1NA 4RSSA 4F08A 3BKBA 3CXWA 1W82A 3I81A 3ATTA 3ENMA 3DJ7A 5CY3A 5I0BA 2G2IA 1YVJA 4FGBA 4GUEA 4PL3A 2OK1A 2C6KA 2ITUA 2VZ6A 4YPSA 3TV7A 1QPEA 4DN5A 2YCQA 2ZYBA 1XH4A 2V7OA 4X3JA 3PZHA 3U4WA 3VAPA 1V1KA 3BBWA 5L2TA 1YKRA
chains in the Genus database with same CATH superfamily
4FT5A 4KINA 4YHTA 4NW6A 1PXOA 3O2MA 4ARKA 3W2PA 2W1EA 2XUUA 3QA8A 4FTQA 4UMRA 5I9VA 5D10A 3A2CA 1IEPA 2QOQA 3BX5A 1YDSE 2EXMA 3UYSA 5HX8A 3PPJA 1SNUA 3QX2A 5DH3A 4M7IA 3MVHA 3FZRA 2VRXA 5EDQA 4EOOA 4USEA 3OT8A 4JRVA 5AR5A 2E9VA 4KD1A 1R39A 4I3ZA 5JT2A 3L9PA 3HMMA 4UWCA 4F63A 2BCJA 4XOZA 4FL2A 5C4KA 4XV2A 1STCE 4ZSEA 3Q5IA 5KKRC 5CF5A 2VNYA 2XIRA 1Q97A 4GU6A 3VRZA 4DBXA 3EN9A 4DH8A 3GQIA 4YZ9A 1W2FA 4S34A 2OI4X 3FUPA 3KULB 3JUHA 3FI8A 4ZLZA 1U54A 4FMQA 2JFMA 2P0CA 4MF0A 4QMWA 4TYJA 2VX0A 3SX9A 2P2HA 2YHVA 1Q8WA 3GC7A 3S1HA 3DBQA 3D5XA 2HY81 4MD9E 5AR2A 2CGUA 2QG7A 3OWJA 3R8LA 3CS9A 3EIDA 4G3FA 2QKRA 3HZTA 4IZ5A 2BHEA 3UC3A 3EMGA 5JQ5A 1KOAA 3EKKA 4BVUA 1Q3DA 4TWNA 4BCOA 1W7HA 5J7BA 4FL1A 1M7NA 5IQIA 4GKHA 4DEAA 4U80A 3Q53A 3FWQA 3L8XA 4W4WA 3ZMMA 1SVHA 4JJRA 3BIZA 3A60A 4ANSA 4PNIA 3NUSA 1H0VA 2XK8A 1VEBA 3MPMA 3NW5A 1H8FA 5DFPA 3FYJX 3VVHA 4R7BA 3OMVA 3KRWA 5K0XA 2UUEA 4EC9A 5HO7A 4MKCA 3GNIB 4IE9A 1SVGA 4BC6A 2XIYA 5M07A 1DAYA 4FKOA 5DR2A 2WTVA 2XNOA 5EYMA 2J0JA 4MQ1A 5JRSA 4FV0A 1K2PA 4C3FA 5J87A 3P7BA 1OBDA 3Q6UA 4TWOA 2HENA 4PTGA 3V51A 4ZSLA 4LOQA 3FAAA 1JWHA 5HCXA 4KABA 1KV2A 4DEHA 4B0GA 4CCBA 5E90A 3IW5A 3HV4A 2F9GA 4FKPA 5L6PA 4A4XA 3FLZA 3PYYA 4C57A 3E8EA 3V5QA 2OXXA 4KSPA 5IEXA 5HD7A 4CFFA 4O7NA 4FT9A 4YTIA 1YI3A 5BVEA 3PFQA 4ZIMA 3IO7A 3FY0A 3GOKA 1R0PA 4V0GA 4KB8A 5ETIA 4DGMA 4FSWA 2J5FA 4U81A 2Z7QA 4CT2A 3KK9A 2GHMA 3MPAA 3PSBA 2OIDA 3UMWA 4RBLA 4ANMA 4ZSGA 2W1FA 4XX9A 4DFNA 1UU8A 3HV5A 1WVWA 5AX3A 4KS8A 4FI1A 2CKEA 3WE4A 2P55A 2GDOA 2WMBA 3BHHA 4MNEA 4K0YA 3ZLSA 1XMMA 2J90A 5CU6A 5ANIA 3WF5A 4ZTNA 1NW1A 4O86A 2B9FA 5A6OA 3FI4A 4GEOA 2UW6A 3CJFA 4QPAA 3MTLA 2J7TA 3VJOA 2OW3A 3C4EA 4R77A 3KF7A 2YIWA 3QTWA 3F82A 4XP0A 4G6LA 3NCGA 3PRIA 4YSMA 4AOIA 4F99A 4TNBA 1I44A 3LMHA 5CSWA 5A6NA 2NPQA 2R3OA 3HA8A 2IW8A 3FEGA 5E8TA 3Q5ZA 4YLJA 5HLPA 2VTSA 5HO8A 2SRCA 5BYLA 3UVRA 4M97A 3OG7A 4RWKA 5J9YA 3ORXA 3OZ6A 2XF0A 4ITJA 3HVCA 3D15A 1W2CA 3COIA 4FKVA 4K1BA 4PPAA 4ZP5A 5BVKA 2C6EA 3NYVA 5AUZA 3RBWA 3UZPA 5KMKA 4BDFA 4F09A 1OKVA 5LMKC 2ETMA 3T9IA 2AEGA 3GC9A 4GMYA 4EHZA 3DLSA 5EG3A 2CCHA 4EHEA 5JH6A 4JIAA 4D4SA 5C01A 4EOPA 4LL5A 1R0EA 4JR3A 3UJGA 2VTNA 2BPMA 4D55A 5L8KA 3QF9A 3W2SA 3UPXA 5EM5A 4O7WA 2I0VA 3ROCA 3RAIA 4ZJJA 4LMUA 4EK3A 2Y6OA 3N9XA 4W8DA 4ACDA 1BL6A 4PL4A 2OXYA 3GU8A 2ITZA 3P86A 4EWHA 2UVXA 4S2ZA 4X3FA 1H27A 2C30A 4LQMA 4F4PA 4EOIA 3N4TA 4A07A 5FDPA 1PRYA 5E1EA 4YTHA 3BGZA 5JQ8A 2QU6A 5KUPA 3NAYA 4ENXA 1CSNA 2XZSA 4BGHA 4BB4A 3R9DA 3VBQA 2I0YA 1E9HA 4LRJA 4ZTLA 5EDRA 5B2LA 3IONA 3QCSA 4LGDA 4Q9SA 3W0PA 5LXMA 5AIRA 5HCYA 2F57A 2W5BA 1Q8UA 3FV8A 3FMLA 4Y72A 4NM3A 3BYUA 2R3RA 4FV8A 2Y6MA 4AU8A 4CTCA 1QPDA 4H36A 2R7IA 4BWXA 2GS6A 2B53A 1OUYA 4IACA 1M14A 3TIYA 2PK9A 3DZOA 3LW0A 3MH3A 4U79A 4YJNA 3AD4A 3W8QA 5CI7A 5AUTA 4IW0A 2R0IA 2Z02A 2WTIA 4ZTSA 4V04A 2XJ2A 4FEWA 3DNEA 4EUUA 4C7TA 3W2QA 2X0GA 4UYNA 4U7ZA 3RGFA 2WMRA 4ZSAA 5J5TA 5KNJA 3GU6A 2GMXA 3QAME 4AW2A 1PMVA 4Z3VA 4R1VA 5FUTA 4ASZA 4BJJB 5M09A 4BYJA 5AV4A 5B2MA 2JDRA 4FSNA 4O7RA 3T3UA 4PP9A 5CYIA 4Y8DA 5A46A 5CTPA 3UDBA 3QBNA 2CLXA 3ZFXA 2VTPA 1OIQA 5JFSA 3VUTA 3BBTB 4PNKA 5DT0A 4YLKA 4IZAA 4YBJA 3SHEA 2X2LA 4JAJA 3EH9A 3CTQA 3M42A 1NVRA 5CZHA 5AV1A 5AUWA 5HG5A 4D5KA 3HMNA 3W55A 5JMSA 5LVMA 3E8DA 2F4JA 2PVKA 1URCA 4O0XA 4IC8A 3MYGA 2OGVA 1P14A 2WQMA 1WZYA 4Q2AA 2ZV9A 3TUBA 3F7WA 3UQCA 3IOKA 5ACKA 4EOQA 5HI2A 2DQ7X 2VO7A 4FC0A 3MA3A 3L8PA 4I5MA 2WO6A 5KO1A 4B8MA 4ANLA 1JKKA 2RFEA 2WMAA 2WMXA 2WTCA 4I0RA 4A9UA 3KQ7A 4FR4A 2BDWA 2ERKA 3F5UA 3MVMA 1PYEA 3QRJA 3Q9WA 4I5HA 4EONA 4BBEA 3QALE 5E1SA 4BI1A 1V0BA 1UU3A 2QR8A 5AR3A 4FV3A 4ZJIA 3FXZA 3S0OA 4AGUA 4O0SA 3FMEA 3IW7A 5DT3A 3TNWA 3TNPC 4EOKA 3DNDA 4PY1A 2Y4IC 4YJPA 3NVMB 3OWLA 4BTFA 1M7QA 3AC4A 3AT4A 1IASA 4UWYA 3DKOA 2WU7A 4YO4A 3VONA 2AC3A 4ERKA 1GZ8A 3BI6A 3LFSA 2YJSA 3OY3A 4BI0A 4QOXA 1QPJA 2I40A 4WSQA 5HLWA 3UOJA 2XANA 2X0OA 5EW9A 3HAVA 5AFVA 2YM6A 3ZONA 1VYZA 4CZUA 4CCUA 3HRBA 4CQEA 4NTTA 4AGWA 4G3DA 4IX5A 3AKKA 4DTAA 4Q9ZA 2VWIA 2IZTA 2BMCA 3POOA 4HGSA 1FVVA 4P5ZA 3R63A 4DFUA 2YAKA 5FGKA 2PZYA 5IQFA 1G8KA 4WG4A 3TIZA 3FMNA 1PMEA 3LQ3A 4ORKA 3ID6C 4TYHA 3KRXA 3UIUA 3QTQA 1DM2A 3UNKA 1Y57A 3QTIA 2XBJA 4FVRA 3R2BA 4UZDA 2OBJA 3PJ1A 4HCVA 3UZTA 4PTEA 3QD3A 1BX6A 1REJA 4RLKA 2XIZA 1JAMA 2PVNA 4F9WA 2W99B 2PVLA 5TR6A 2W06A 2BAQA 3SDJA 2PUIA 5GZ8A 3CGFA 3PG1A 3O8TA 2BDJA 2XVDA 4D58A 2RL5A 3C0IA 3FL5A 4J53A 4O6LA 3UNZA 4D5HA 4HYIA 4NM5A 5CU4A 4APPA 4I92A 4CYIA 4EHGA 3R73A 3BLQA 5EHYA 2R3JA 3ZC5A 4HVIA 2XBAA 2YWPA 3OWKA 3PXQA 3UVPA 3OP5A 3DBCA 2WGJA 4YZMA 5GJFA 1ZWSA 5HGIA 4DYMA 4O7SA 4Z7GA 3HMIA 3LFNA 3LLTA 2PMIA 4JDKA 1ZYLA 5EOBA 5EW3A 1B38A 3PUFC 3L9NA 4GYGA 4GK3A 4C4HA 4PMTA 3MB6A 4B4LA 4DFYA 4KRDA 3DK3A 5K5NA 3LJ2A 2WNTA 1H1SA 2PL0A 2IVVA 3OEFX 4KRCA 5HKMA 1G8JA 4XBRA 3RK7A 2CMWA 3B8RA 3TNIA 1WBOA 4NYEA 1B39A 3EQPA 1OVEA 2BAKA 3QYWA 1JKTA 4X2FA 3AQVA 4F9YA 4FKUA 4P5QA 3BZ3A 4FL3A 4AOJA 3G6GA 5JGBA 5AIKA 3R9RA 5H8BA 4BCGA 5LCJA 1ATPE 1PMUA 4QNAA 1YWNA 2RFDA 4FNXA 4WBBB 4I21A 4CEGA 3KMUA 4MVFA 4XUFA 4AZEA 4EK4A 4E6AA 4AW1A 2VTLA 4EH4A 3LE6A 3ALOA 4GIIA 5CVHA 4BCPA 4R7HA 2E9OA 4U43A 3VBYA 3MGYA 2DUVA 3HRCA 3OUKA 3VO3A 3F88A 1H08A 2QOCA 3Q2JA 1H1WA 4F0GA 3VW8A 2UVYA 4JBPA 2YDJA 4LM5A 3ZUTA 2OJIA 3PP1A 3R00A 3TYKA 4CZYB 5L8LA 5IQGA 4JG7A 3IW4A 3SW4A 5DIAA 4FSRA 3JYAA 4LMNA 2HW6A 4KUJA 2JKMA 3D83A 1URWA 3V5LA 3CBLA 3OTUA 1ZYDA 4QP9A 4DG0E 3R28A 4NCTA 2ZDUA 2VGPA 1K9AA 4AQKA 3V01A 4FEUA 4JQEA 4R6VA 3W2OA 4BCFA 2QODA 4BIEA 2W9ZB 3ZO1A 3E88A 4XRLA 1FGIA 2QURA 2GNHA 3G0FA 5CU2A 2RIOA 4EKKA 3G9LX 3O23A 3TNHA 2YZLA 5FLFA 3DTCA 4IAIA 4L8MA 1PXNA 5C9CA 5G1XA 3NAXA 5DHJA 5FXSA 3OFMA 2VWUA 2IZRA 3R7GA 3NYXA 1Q41A 4PP7A 2UW8A 3GUBA 4YNOA 3KMMA 3IGOA 4GYIA 4EHVA 3SG8A 4FGRA 4IMYA 3CE3A 3I7BA 4IVAA 5DBXA 3BHYA 4ZZNA 3ZDUA 5L6OA 4N57A 3RZFA 2GTMA 3HUBA 3ZBXA 4EJ7A 3C1XA 5E92A 2F2UA 3FSKA 5IG1A 3FLQA 4NT4A 5IQEA 2Z60A 2JIUA 5DI1A 5E8UA 3WYXA 2PE2A 2CKQA 4EH6A 4RX5A 3EYGA 3ROYA 4F9AA 3VS6A 5CT7A 1OGUA 5AP3A 4YC8A 4L9IA 4P4CA 3TNQB 3TXOA 2BZHB 4CGAA 3D14A 4C58A 1OUKA 3ZC6A 2I0HA 4EH8A 4I0TA 2XS0A 5AM6A 3ULIA 4FRFA 1Q4LA 2YIXA 3SD0A 4AZTA 5EKOA 4MX9A 2PY3A 4MXXA 2GFSA 3MFTA 5FTOA 3UYTA 3U9CA 2PYWA 3PA3A 4QO9A 3VC4A 1IR3A 3PXFA 4RIWB 3RPRA 5C1QB 1GZKA 5H8EA 4EH7A 4BGGA 4JXFA 4DHJA 3O8UA 2JGZA 3QTUA 2VWBA 2IO6A 3K3IA 3LIJA 4Q5EA 3ACJA 4X2GA 3L9LA 3VHEA 4IBMA 2WMUA 4H3QA 1L3RE 4MBJA 2ZB1A 3CQEA 1F3MC 3KGAA 2FSTX 3OF0A 4RFMA 5KKRB 1YW2A 3NRMA 1HOWA 2IEWA 1LP4A 2RG5A 3AC8A 4N70A 1ZZ2A 1YHVA 2W17A 1KE9A 5IQAA 3ETAA 3MVJA 3PXKA 3PA4A 3VS7A 4QP7A 4W9WA 2X0QA 2BZJA 4PV0A 4RFZA 4AT3A 2XNNA 3O7LB 1PKGA 4ANQA 4IIRA 4LRMA 4TRLA 4FSMA 4BF2A 3HGKA 4XHKB 5DWRA 3NSZA 1M52A 3NEWA 4JS8A 3U55A 3ORMA 3RCDA 4XG4A 2GNIA 2ZMCA 3HAMA 3MIAA 1YOMA 4OW8A 3DT1A 3BYMA 5H9BA 3C9WA 4QMXA 2UW9A 2UV2A 4FTAA 4EC8A 3HKOA 4KBCA 4E93A 4DFBA 4GV1A 2KULA 3WYYA 4AP7A 3KREA 3FI3A 4EJNA 3NLBA 4IVCA 4WNMA 3R7YA 4PDSA 1VYWA 4FSUA 2R5TA 3VULA 3DKGA 3Q9XA 3ZRKA 4O82A 5IH5A 3F5PA 3MFSA 4MCVA 4DF3A 4FV9A 3IG7A 3A4PA 3D5UA 1ZLTA 3QZIA 2YM8A 3QD2B 2C3JA 3LCOA 4AFJA 3QTSA 1O9UA 4IQ6A 3ZLWA 4MD7E 1E1XA 2J0KA 4I0SA 5FBNC 4JX7A 4CKRA 1H4LA 5CSVA 3TM0A 5TO8A 1P4OA 3HMOA 4JRNA 5LVNA 5DOSA 2X9FA 4I6BA 1OPJA 3KCFA 3BGPA 4L68A 5BMSA 3G6HA 4XG9A 4YJOA 5DYJA 4D2RA 5D7VA 3ENHA 3HRFA 2UZLA 3PXZA 5IH6A 5KHXA 2RF9A 2R3IA 3M2WA 4NEUA 4DEIA 4ZLOA 4RJ8A 1KOBA 4DCAA 4YJQA 2WEVA 3ZSIA 3HP2A 4JQ8A 1H28A 4PMSA 2VTHA 2OJ9A 4BZDA 4AG8A 3MI9A 3FMDA 3Q4UA 2JC6A 1HCLA 4C37A 2CCIA 1LEZA 1WMKA 1NA7A 4I94A 2B4SB 1PXIA 2OO8X 2WIHA 3FZSA 1IA9A 5DA3A 3ZXTA 4G31A 1SZMA 2YCSA 3NUXA 4ACGA 3K54A 5CANA 3FMJA 4E5BA 3C51A 3DBEA 3AD6A 4BDKA 4XRJA 3OS3A 4UMPA 2RGPA 3OY1A 4R3PA 4FBXA 1MRVA 1KV1A 4HOKA 4BTKA 3I0QA 2QOFA 5IZFA 3GP0A 4ZZOA 2QI8A 4YMJA 2CHLA 3EN5A 5TT7A 2GSFA 3WE8A 4IH8A 3RWPA 4H1JA 3A99A 3TL8A 5M56A 3FDNA 2WOUA 3TI1A 4AUAA 5FDXA 2IZSA 4B8LA 1XWSA 3ZZWA 5M51A 4QP4A 2X9EA 2ITNA 3BWFA 4GKIA 2UZWE 5BQ0A 3TTJA 4HVHA 4RIOA 1TVOA 4ZTRA 3LHJA 3Q96A 4UXQA 2HXLA 3UOHA 2YDIA 2VN9A 4IJPA 5E8SA 2J51A 3NS9A 3BLAA 2QO7A 3RAKA 3ZM4A 1FINA 1OM1A 2BRBA 1XH6A 5KBQA 4I20A 2XH5A 3EN4A 2CDZA 2A1AB 3RJCA 5JN2A 3NWWA 4X6RA 3ELJA 5LVPA 3RI1A 3PRFA 3PJCA 3PWDA 3LJ0A 2GNGA 2CNUA 3V8WA 2VX3A 3DFCB 5KE0A 3SG9A 5CEOA 3I5ZA 3Q52A 5CS6A 2OH4A 4D1ZA 3CJGA 1ZMWA 4XYFA 4GT5A 2FGIA 2X39A 2C6OA 5M08A 1WBVA 4A06A 4LGHA 2X4FA 4CFNA 1UA2A 2BRGA 4JIKA 3EWHA 2Q0BA 2W1DA 4S32A 2C69A 5DRBA 3O7LD 4O21A 2WHBA 5EYKA 4ZZMA 1JVPP 4F0FA 4J98A 3GCVA 4FT7A 5BVOA 5E8WA 3ZOSA 3PJ2A 4HPTE 4BDAA 2C4GA 2JLDA 2WFYA 3KRLA 4K33A 4EOMA 3E87A 3RALA 3DLZA 3E63A 2UVZA 4PX6A 4CVAA 2CKPA 4HGEA 4ZS4A 4DG3E 2J50A 4O1PA 3R04A 4IC7A 1JSTA 3ORTA 4BZOA 2CJMA 3HP5A 2HCKA 4MBLA 3FXXA 4O96A 5IEVA 4KA3A 4YZCA 3QZFA 4IB3A 5LVOA 4MNFA 4YSJA 2I0EA 5FWKK 3AC1A 5DGZA 4BCIA 1SYKA 3IDPA 4NSTA 4BTMA 3PVUA 3RAHA 2E2BA 2EXEA 2PZPA 2PULA 4RGJA 1XMLA 4BDEA 5KMNA 1J91A 2XM8A 3MBLA 4FG8A 4BKYA 4D2WA 2A27A 4GK4A 2OH0E 2XB7A 4YBKA 3GFEA 4B99A 2Y4PA 4FTLA 5HD4A 3R30A 4BBMA 2R64A 2ZM4A 3L9MA 3PXYA 1H25A 3R21A 4FTOA 4UYAA 3IOPA 5T3QA 5BYYA 5K4IA 4DT9A 4APCA 4GK2A 3ORNA 5CNOA 4UN0C 1U4DA 2JDVA 4ACHA 2VTIA 3PLSA 2XEYA 5GINE 2ZM1A 3HNGA 2UZUE 4BCNA 4C4JA 4ERWA 3ERKA 5ANOA 4FJVA 2ZJWA 3VBXA 4F6UA 4IADA 3R0TA 4EI4A 4P2KA 4QTEA 5CALA 1JSUA 4C4FA 3G15A 1R1WA 4QDEA 5BVNA 1OGYA 4R5YA 2P2IA 2GNJA 2ZDTA 3BWJA 3DDPA 1J7IA 4KKGA 4EK8A 3DAJA 4MEDA 1XO2B 1OPLA 3QQJA 4X3FC 3D7ZA 3PVWA 3SV0A 2XARA 2IW9A 4E6QA 4LG4A 4QMSA 2QHNA 2W4KA 4V01A 2JDSA 3UVQA 2NNWB 3O0GA 4E8AA 5HICA 4QTDA 4XBUA 3MESA 5H8GA 1U59A 4ZTQA 3FY2A 4OR5A 3VIDA 3F5XA 4IX4A 4EKLA 4KIOA 3H0ZA 4QMUA 4GFMA 3UG2A 1ZOGA 4KBAA 2W05A 3G9NA 5J95A 3VUGA 3NUNA 5HVYA 3NUAA 4NZWB 3LMGA 4AN3A 4YPDA 2QOHA 3UC4A 4CFXA 1YHWA 4C0TA 4DH7A 4WD5A 4CRLA 2LAVA 1BYGA 2YAAA 3WZDA 4JVGA 3F3VA 4BY9E 1YQJA 4EH9A 4XLVA 3TMOA 2BKKA 2PVYA 3BEGA 3W2CA 3S3IA 1PHKA 4RA4A 4ASEA 3M11A 5HNGA 4ZJVA 4ZOGA 5AR4A 1KWPA 5DG5A 5K5XA 3TUDA 3JR1A 3FYKX 2YEXA 3GEQA 3C4ZA 2VAGA 2I1MA 4AA5A 3RK5A 4ENYA 4I41A 5ACBC 4BDGA 4I4FA 2XNEA 4OLIA 5E8YA 5CEQA 2W1GA 5AX9A 4EQUA 2IG7A 2J2IB 1JLUE 1MRYA 4EQMA 1LUFA 3QX4A 4CT1A 2B9IA 2V55A 3ZBFA 5JFXA 4X6QC 3DQXA 3SOCA 4RFYA 2UW3A 1BMKA 4AOTA 3PIYA 3N4UA 1H24A 2R3LA 3KK8A 3OCGA 1WBWA 1H07A 3JVSA 3ORPA 3QUDA 3GT8A 4XJ0A 5JGAA 3BL7A 3D7TA 5JK3A 2ITTA 3D5VA 3D5WA 4C4GA 3EQCA 3EQBA 4NWMA 5EYCA 5HLNA 5HIBA 4AS0A 1QPCA 2ITXA 5IISA 3TN8A 2JBPA 5DN3A 2B1PA 1RE8A 2BKZA 3Q04A 3CD3A 3FLNC 4XCUA 3VJNA 3MY1A 4C35A 3Q60A 4PL5A 1F5QA 4DBNA 2ZMDA 1OKWA 3CY3A 3PJ8A 4RJ3A 4WBOA 4Y85A 5EM8A 1BL7A 3UO5A 1CMKE 3B8QA 2PTKA 2B0QA 4EEVA 4GG5A 4ONAA 3H30A 4AX8A 4YGAA 4FEQA 4G3CA 2QKWB 5CSPA 5KMIA 1YXVA 3EFKA 3PJ3A 4M67A 3R1YA 4B6LA 2PU8A 4UV0A 1Q62A 5CEMA 3C13A 2C1BA 5I9WA 3WZEA 3ET7A 4N6ZA 3ANQA 2WOTA 1X8BA 2EB2A 2NRYA 4BDJA 3ZFMA 2WTJA 4RG0A 4FZ6A 4TYIA 5C4LA 4C62A 4HPUE 3EQHA 3V5TA 5AV2A 4D1XA 2WEIA 4O7YA 4DHIB 4BWKA 2C6DA 2W4JA 4FTRA 5FQDC 3QL8A 4DH3A 4DEBA 5IA4A 3E3BX 3UODA 2GNFA 1ERKA 3Q4ZA 3RPOA 4O7ZA 3QRTA 3ZRLA 3D2IA 4EZ5A 3LFEA 2XYNA 3MIYA 4C2WA 1M2PA 1T45A 5EW8A 5FEQA 3VS5A 2QR7A 2HAKA 3NPCA 5AP5A 2J0LA 4L52A 5FEDA 4M69B 1R3CA 2PMOX 5FXQA 1P5EA 1ST0A 3NNWA 3PPKA 3FC2A 3G33A 3RPSA 4IAKA 5IUIA 3HUCA 3KVWA 3KMWA 4FV6A 4AGCA 1EH4A 2WMTA 2YA9A 2Y8OA 4Y46A 1UWJA 3ZCLA 5HTIA 3R83A 1FVTA 4G6NA 4IDVA 1O6LA 4FSZA 3BU3A 4AWIA 3U8WA 3NW6A 2CN8A 3DBFA 2BDFA 3R8VA 3I0OA 4I5CA 3PUPA 4ACCA 4DH1A 4PDYA 4LOOA 2WZJA 4YZDA 3KU2A 5DEYA 3MB7A 4RIYA 4BYIA 1MRUA 1XR1A 4J71A 3BEAA 4F7SA 3AC3A 3PA5A 4L42A 1KUTA 3HMPA 3OXTA 2CGWA 1BKXA 3ZFYA 4QMPA 1H00A 4FTJA 4KAOA 2JD5A 2CPKE 1YI6A 4X2NA 3HEGA 1SVEA 4K6ZA 4FT0A 4LDTA 3L1SA 4NUSA 3AMYA 2ETRA 2PHKA 5HVKA 2UZOA 4BR3A 3PSCA 3LJ1A 1UKIA 4RZWA 4DINA 3LCDA 3N4VA 4K8AA 2OF2A 3KXNA 2W1ZA 5TKDA 2O65A 3OT3A 4GW8A 4MD8E 4OBOA 2IVUA 5BX0A 5FXRA 5ITAA 2GTNA 1YRPA 3D2KA 5L2SA 4EK6A 5GNKA 5C8MA 4ALVA 3PVBA 4HZRA 3NUYA 5KCVA 2ONLC 2QLQA 3NX8A 2V62A 2XK9A 4GH2A 2ETKA 4QMLA 3UOLA 4HGTA 3QCQA 4U3YA 3R9OA 3THBA 3KXZA 4IFCA 5E7RA 4KS7A 3RHXA 3PLAE 2JDTA 2JAMA 4F1MA 5B2KA 5IA3A 3TKHA 3KC3A 4GUBA 3C4XA 5FRIA 4BN1A 1QMZA 2GNLA 3AGMA 3ULZA 2UW7A 3MFUA 1IAHA 2O5KA 4CNHA 3GQLA 4KKHA 2YIQA 1JKLA 4YJRA 2YLEA 3UOKA 4IFGA 5M53A 1WBSA 2UW0A 4MYGA 3W33A 3LFBA 1OB3A 4LFIA 2O0UA 1PXKA 3GCQA 4WG5A 4KIKB 4FA2A 3R22A 5M06A 4FIGA 5JFWA 2XK6A 4G3EA 2OJGA 5AP6A 4D9TA 4MTAA 3GCSA 3JS2A 1CKJA 3QQKA 4XLIA 2QOBA 3C0HA 4GJ2A 5ETAA 5FTQA 3TACA 4E4NA 2XJ1A 4FV5A 4EBWA 5K4JA 2XALA 1JPAA 4I22A 4TZRA 4GL9A 3EQRA 2Z2WA 4L44A 3MWUA 4TN6A 3D0EA 4XV9A 2WMVA 4NU1A 5E8XA 4R3CA 3OW4A 3QYZA 4YZNA 4ID7A 4K77A 3FI2A 2X7FA 3JY0A 3MTFA 3OROA 4DGLC 4F6WA 4Z7HA 5GZAA 4D9UA 1PW2A 2JBOA 1DS5A 4J8NA 3VN9A 3TZ8A 4Z55A 4ZY4A 1IG1A 3LOKA 2PUUA 3QXOA 4FEXA 1P2AA 2R4BA 4Z9LA 3DS6A 2XNGA 4KSQA 2QO9A 4NKAA 4QPMA 2G9XA 5AUVA 4QQJA 3UIBA 2JIIA 3RM7A 4ZMEA 4GG7A 1XBBA 2WTKC 5HCZA 2R3NA 1G5SA 1F0QA 4CTBA 3I5NA 3KIOC 3KF4A 3OHTA 1YWRA 3NGAA 3VBVA 4AZFA 4U3ZA 2X6EA 4NFNA 4S30A 4E6CA 2QVSE 2OZOA 4LYNA 3BHTA 3MV5A 3KN5A 2HIWA 3F2NA 4O7TA 3EN7A 3VUMA 3QCXA 1BUHA 3VUIA 3T9TA 1V0PA 2JKOA 3DXQA 2PZRA 5HVJA 4FZDB 4BIDA 4FKJA 4QMOA 4IWQA 4D2SA 3ORZA 3AKJA 1H1PA 4IDTA 5ETFA 1CDKA 1XH8A 5DR9A 4NM0A 3DB6A 5CENA 4A7CA 1Y6BA 3UP2A 4FUXA 2QQ7A 2X7GA 2ERZE 3D94A 4D4RA 3KXXA 4QPSA 1ZARA 5IKWA 3PY0A 4DH5A 2W96B 3CP9A 4Z16A 4JI9A 4E4XA 5J1VA 1YOLA 3ZSGA 4EL9A 4UB7A 3BV3A 3GENA 4FOBA 4DGOA 1H0WA 3TCPA 3VNTA 3UP7A 3GVUA 3K5UA 4OTQA 4RX9A 2C6LA 3S4QA 2GU8A 4MBIA 5IU2A 4YZBA 3IQ7A 4MXZA 4U42A 3HDMA 4HVGA 1YHSA 4XS2A 5M4UA 3NR9A 3OXZA 2AUHA 3A61A 4Y5HA 1XJDA 3TUCA 3UTOA 1FVRA 4J99A 2PMLX 5DLSA 3W0SA 2ZV2A 4PPCA 3F66A 3HYHA 1U54B 2Y9QA 4AA0A 4C2VA 5LMBA 1TQIA 2RKUA 4QP3A 4KKEA 5F1ZA 3V5WA 2WQEA 5LJJA 5E8ZA 3MY0A 1G8AA