3FQHA

Crystal structure of spleen tyrosine kinase complexed with a 2-substituted 7-azaindole
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
272
structure length
262
Chain Sequence
VYLDRKLLTLEDKELGTVKKGYYQMKKVVKTVAVKILKPALKDELLAEANVMQQLDNPYIVRMIGICEAESWMLVMEMAELGPLNKYLQQNRHVKDKNIIELVHQVSMGMKYLEESNFVHRDLAARNVLLVTQHYAKISDFGLSKALRADENYYKAQTHGKWPVKWYAPECINYYKFSSKSDVWSFGVLMWEAFSYGQKPYRGMKGSEVTAMLEKGERMGCPAGCPREMYDLMNLCWTYDVENRPGFAAVELRLRNYYYDVV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords Tyrosine-protein kinase SYK
publication title Structural insights for design of potent spleen tyrosine kinase inhibitors from crystallographic analysis of three inhibitor complexes.
pubmed doi rcsb
source organism Homo sapiens
total genus 92
structure length 262
sequence length 272
chains with identical sequence B
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2009-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3fqhA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3fqhA01
2XNPA 2XYNA 2R3JA 4GMYA 4BDCA 5A46A 5J1WA 1L8TA 5IMXA 3VW8A 3A62A 3PIZA 4R7BA 3R7GA 2FSLX 2C6IA 5AP2A 4QP7A 3PXZA 4O27B 3I0QA 1O6LA 1REJA 4FUYA 4L9IA 2ESMA 4OT5A 4P2KA 1XHAA 4HNFA 1YVJA 3MV5A 2BHHA 4AOTA 2C6EA 3E8DA 5HO8A 4UMTA 5ACKA 1FMOE 4ANLA 4XJ0A 4Z7GA 5T68A 4FTNA 3S0OA 1Q8ZA 2W1GA 3EFJA 1K9AA 4IE9A 4AZSA 3VUTA 2XRUA 4BB4A 4EJ7A 4FV5A 2B53A 3RP9A 5A9UA 4RIOA 4PDYA 1P2AA 5CSVA 5H2UA 2OJ9A 5LVPA 1SZMA 3RMFA 4FF8A 4FMQA 4C7TA 2J5EA 3I7CA 3CY3A 3MN3A 3BRBA 1MRYA 4TYJA 4BN1A 5KNJA 3DQWA 3EYHA 4RSSA 3R7YA 4FVRA 3PJ1A 2R3HA 3TUBA 4K77A 5AA9A 2R3OA 3CD8A 5GZAA 3OBGA 3UIMA 3C4EA 3EN6A 3ZTXA 4QQJA 4BTKA 1FVTA 4QMZA 4CCUA 2YCFA 4AFJA 3PIXA 2RFNA 3TV4A 2O3PA 3E7OA 2EVAA 4S2ZA 3TDVA 2Z2WA 5IA3A 2O5KA 2WQNA 3HECA 4R77A 4WUAA 2GQSA 3EN9A 1MRVA 3BLRA 3TN8A 1BUHA 4XV1A 3QD4A 2PZYA 5IQHA 3N4TA 4QP3A 4JX3A 4QYHA 2IZTA 1H07A 3AGMA 3NUNA 1KE6A 3ZBXA 5HORA 2XJ2A 4X2FA 4DEAA 5F95A 3VW6A 2RKUA 3SG9A 3ORLA 4QMTA 2ZYBA 2DYLA 4QMMA 3HAMA 2J0LA 2JDTA 4EKLA 1FGKA 5JKGA 4OTQA 4QTBA 4XOYA 3I4BA 4USFA 4I5PA 4RT7A 4MK0A 3RPVA 1W8CA 3FWQA 4EK3A 3BHHA 1OM1A 2JKKA 2ITOA 4TXCA 4ZJJA 2UZEA 2X4FA 2JEDA 4NJ3A 3L8SA 3UZPA 5ANKA 3MIYA 4I5MA 5M44A 3LFDA 2VD5A 4Y46A 3WZKA 4ACCA 2R7BA 5IKWA 2C3KA 1A06A 2QLUA 4ZIMA 5IQDA 1AQ1A 3MB6A 4MBLA 5L2IA 4QTCA 4C34A 4DAWA 1NVRA 4U0IA 3EQBA 3LJ1A 4K18A 3NW5A 4FGRA 2ITUA 4BRXA 4DN5A 3LFCA 4EH6A 4S30A 4XP0A 3UO4A 5CI7A 4A9YA 3DTCA 2Z7RA 3LFFA 4RIXB 3FZOA 1BMKA 3BGQA 4MTAA 4NUSA 3NYNA 3U8WA 4JDHA 4FE2A 1VEBA 3AOXA 4YJUA 3UG2A 1JVPP 3VC4A 1YHVA 2VU3A 3MY0A 3Q96A 1APME 5HIBA 2UZNA 3JXWA 4PPCA 4ASXA 3NMUF 4BICA 3VUGA 4BTFA 3KRRA 1PXLA 3G33A 3DJ6A 4IWDA 4XHKB 3TDWA 4DT8A 3HMNA 3L9PA 1ZY4A 5CVHA 3CSVA 4X3JA 5HNIX 4RLLA 3AC8A 3QU0A 5FEDA 1WBSA 3SRVB 3Q9ZA 5HG5A 2Y7JA 4HCUA 4KKEA 4NYEA 3KRJA 5IQIA 3LCDA 4GCJA 5AP0A 4E20A 2CGVA 2SRCA 2E9PA 2OFUA 5DG5A 4V01A 2WTKC 3OWJA 4F4PA 4ACHA 5CEOA 3DNEA 4DEBA 4FKQA 4U42A 1UV5A 4C58A 3MFRA 3K2LA 1F0QA 4ZK5A 3MESA 3E92A 5CU3A 3TL8A 4F7SA 2QC6A 4W4XA 3FV8A 4PPAA 1VZOA 4BDIA 1GAGA 1ZOHA 4QP8A 4NFNA 5C27A 1RW8A 4I6BA 4DEHA 3DQXA 1H4LA 5LCKA 1CKPA 3ATSA 2P2IA 2J2IB 5AIRA 4J8MA 1NW1A 4G3CA 5C1QB 3QYWA 3HMPA 4GFGA 2JAVA 3D4QA 4BDGA 2IW9A 4RC4A 3R9OA 4IAAA 4AXAA 4D9TA 2F7EE 3QTRA 4JBVA 4QRCA 5E8UA 2QCSA 3QTSA 3CE3A 1M14A 2VTIA 4UMPA 3NIZA 5T6KA 5HEZA 1XJDA 2G9XA 2YM4A 5HIEA 5M4IA 3E5AA 3G0EA 1E9HA 3I0OA 3LJ2A 4GS6A 2C6KA 3F61A 4L43A 3SKCA 3T3VA 2PHKA 4UZDA 2OKRA 3LCTA 4MXCA 2NRUA 4YJTA 4WO5A 4IAKA 1M2RA 3R1YA 4CRSA 5LMKC 4FVPA 2XKCA 2W1DA 4QTAA 1ZZLA 2UZOA 2WTDA 4LRJA 4QNAA 5KCVA 4GEOA 3W10A 2GQGA 3ZYAA 4BR3A 4R3PA 1T45A 1R39A 3A8XA 5HLPA 3SOAA 4HGLA 5FGKA 2C6OA 5FWKK 3R63A 3OROA 4RX5A 3BHYA 5JSMA 3MSSA 2YM6A 4H1JA 1DS5A 2R3RA 1JNKA 3LQ3A 3E64A 2BAJA 5KUPA 4O6LA 1H27A 5EM5A 3O8PA 2P4IA 3FC1X 3OY1A 1OKYA 3QCYA 5J7BA 3TTIA 4YTCA 1H0WA 1ZRZA 2J51A 3VBXA 3CQWA 1PXJA 2XIXA 5M56A 3ZUVA 3U6IA 1Y91A 3MGYA 5HOAA 4CSVA 2XNEA 2PE1A 5JZNA 4I0SA 4F0FA 5G1XA 3F2RA 3CY2A 1JOWB 1YXUA 3LQ5A 3JR1A 4C35A 4YPSA 5AM6A 3PLAE 3F3TA 4O1OA 3OBJA 3IONA 1KE5A 4LOOA 2UW7A 3KKVA 4AE9A 2W99B 4FKRA 3QD0A 3QX2A 2PMLX 2BFYA 2ZDUA 4FR4A 2GNGA 4FTAA 4NSTA 3DTWA 4X6QC 2WFYA 2IWIA 2X2KA 4CT1A 4L01A 2YITA 4RIWA 1UNGA 1LPUA 4C37A 3RAWA 3KVXA 3V5QA 1R0PA 2PK9A 4DG2E 4IVAA 4S34A 3OZ6A 1JQHA 3TWJA 3DS6A 5BNJA 1H0VA 2B7AA 3QXPA 4FNWA 4OTFA 5DE2A 3FHIA 4BBEA 1B38A 3CJFA 3R6XA 3VS6A 4FEWA 2PVRA 5CU4A 4FOCA 4ZSAA 2G2FA 3PXQA 4IHPA 3VJNA 5IH5A 4QP9A 3RHKA 4IX5A 4BCFA 4W9WA 4LRKA 2JBPA 3LQ8A 3ANQA 3PPZA 3G2FA 3IOKA 4I6HA 4I6QA 2B9JA 3Q5ZA 4O7LA 2PE0A 4L7FA 3VIDA 4CXAA 3FLYA 4FK6A 1BL6A 5F9EA 4G3FA 3O8UA 5JFWA 4MD9E 2ITPA 2R7IA 4P7EA 4XV9A 3TACA 2XJ0A 4AOIA 4DH1A 1SVGA 1X8BA 3H10A 3D83A 3MPAA 2PUPA 1ZARA 1VYWA 3DU8A 3C0GA 4FT7A 3DDPA 4I4FA 4F63A 5L6PA 4R3RA 1Q24A 3V8WA 3P78A 4RIXA 3REPA 1SVEA 2XK9A 4LMNA 3C4WA 5L6WL 3RHXA 3VJOA 3PWDA 1OGUA 4Q5EA 3SLSA 3W8QA 2PSQA 2QG5A 2V62A 1SMHA 1UKHA 2CLXA 3G6HA 3QTIA 4PRJA 4DE4A 4IWPA 4FTKA 2BKKA 3BQCA 4WIHA 3CTJA 5EOBA 4BCGA 2OZOA 3WZEA 4ANNA 4BHZA 4ZZOA 3IDPA 5HG8A 4BDKA 5A3XA 4U9AA 2BAQA 2GPHA 4HVDA 4MXXA 1XBBA 4RX9A 4TYHA 4D2RA 3SRVA 4HYHA 3ZBFA 3F5UA 4EZ5A 2E2BA 5B2MA 2WQBA 1WBPA 3L8XA 2WMUA 5DEWA 4HVGA 1KE8A 4DG0E 3O2MA 4GFMA 3ROYA 1Z5MA 3N51A 3OOMA 4GVJA 4TPTA 2BDJA 4Y85A 3UMXA 4HW7A 3U55A 3R1SA 5AP7A 3SXRA 4IACA 4AZTA 2V7AA 5DLSA 2FH9A 3FI2A 3ETAA 3PUPA 3ZRKA 4AN3A 3UP7A 2QO7A 4BIDA 3GI3A 3QKLA 3VUMA 2X4ZA 4U97A 4IX6A 5E8SA 3NUSA 4OTHA 4N57A 3F88A 2F2CB 1TVOA 4WKQA 1V0PA 3VHKA 4NM3A 2BRMA 4OBPA 5CENA 3DXQA 5C03A 1F3MC 3ZDUA 3PPJA 3ZUTA 2W1CA 2ZB1A 3LE6A 5AA8A 4L53A 4IJ9A 4C4GA 4CYIA 2QO9A 5AV3A 4I5CA 4OTDA 5FXRA 4PTEA 1A48A 4NWMA 1YDSE 1SM2A 1W83A 2QURA 1WZYA 2YIXA 4UX9A 5KMMA 2OICA 1YOJA 4Y73A 3GC0A 4OTGA 4EOKA 1ZMWA 4ZTSA 3VF8A 3RKBA 2C6TA 3KA0A 4KSQA 5D41A 3DCVA 3LFNA 3OFMA 5FXQA 1YXSA 4BCQA 2RFEA 2XIZA 3AXWA 4GKIA 4TKSA 1YI3A 4XG4A 4X0MA 3O96A 4L46A 5JQ8A 4NTSA 4J97A 2YLEA 4R7IA 3P86A 3NGAA 5CXHA 2QKWB 4DGLC 4EWQA 1H01A 4EH2A 5L6OA 3GB2A 2PU8A 4YBJA 4UBAA 4DTKA 2FO0A 3KK9A 5DT4A 3D7TB 5I5ZA 2R3MA 4IB5A 2VTPA 5EM7A 4HCTA 4E3CA 1QMZA 2YIWA 2UZBA 1YDRE 2I40A 2NRYA 3Q04A 1Q8TA 1YWNA 5CI6A 5ANGA 4U5JA 4EK5A 3DV3A 4KINA 2XEYA 5F94A 4L6QA 2HOGA 1KOBA 4ZXTA 4TNBA 3GCVA 3UNKA 3PLSA 4ZMFA 4TRLA 4Q2AA 4QMUA 5L8JA 1FVVA 3BI6A 3AC5A 4FT9A 3ZO1A 3ZSHA 5K9IA 2YCQA 3O0GA 5I9ZA 3QHRA 5CX9A 4A9TA 3R28A 3PIYA 3TNQB 5L4QA 5K5NA 2HXLA 3F5GA 3GU6A 3KXNA 3OHTA 4I4EA 4YU2A 5C8NA 4YLKA 4FT0A 2VTTA 3C4ZA 4JBPA 2UVZA 4UB7A 1IEPA 4YHTA 3O50A 2C0IA 3OVVA 4M66A 3F5XA 4PP9A 3TZ7A 3W2RA 3OS3A 2EUFB 2W5BA 4C61A 3OTVA 4WD5A 1W0XC 4ZLZA 4FKTA 4BCMA 4EQCA 5HTCA 3H0YA 1DAYA 1OL1A 4GW8A 5FM3A 5HE1A 3PXYA 4CD0A 2LAVA 2X9FA 3HDMA 4YR8A 2CNQA 3WYYA 5J1VA 5A4LA 3TG1A 3ORMA 5A6OA 2F49A 4DITA 1ZYLA 2VX0A 4HZRA 1WCCA 4HZSA 2AC3A 2YLFA 4FI1A 3OWKA 5JN2A 3FZ1A 4J1RA 5AAFA 2CKOA 3KXZA 3QZIA 4IQ6A 4FTMA 5DOSA 3CCNA 3HRBA 2YDJA 3HNGA 3QZGA 4D9UA 1J7UA 4KIKA 4NM7A 2W96B 2UW5A 4C36A 2BRNA 3R2BA 5DBXA 4KD1A 5CAUA 4CVAA 2P2HA 1PXIA 2ITXA 4AWIA 2GNHA 3CGOA 5ICPA 1ZYJA 3C51A 4O7RA 5HG9A 3MH2A 3ORXA 4MBIA 3I81A 4UMQA 5GZ8A 3UOLA 5LVOA 3MH0A 3HRCA 3MVLA 2GNIA 2J50A 3I5NA 5AP3A 5BUIA 2VWUA 1H1SA 3NUPA 3QF9A 4XS2A 1PKGA 5TKDA 3LFAA 2H96A 2YWPA 1ND4A 2W1ZA 4RFZA 2XNNA 2WKMA 3GENA 2Z60A 3MPTA 4D0XA 5CZIA 2B4SB 3BV2A 4YJSA 4PY1A 1Q61A 4NL0A 4GK2A 1VR2A 4A7CA 4J98A 4LUEA 5KMIA 2RGPA 5DH3A 4P5ZA 5HD7A 3QCXA 2YN8A 3COHA 3MFTA 3TKIA 5E8YA 3R21A 2YIQA 2ZV2A 2EXCX 3DBCA 3UVQA 5K0KA 3MY5A 3PZEA 4AZFA 1XO2B 4KS8A 4M0YA 2PZRA 4G16A 1YOLA 3IW4A 1L3RE 3FMDA 4EQMA 4X7QA 1XH4A 1XKKA 4ZTMA 5BMSA 3R8LA 4YP8A 3HMIA 3UIBA 4TWPA 2IW8A 1QPDA 4AW2A 2JKMA 5CAVA 4JG8A 2CCIA 3LMHA 2XNBA 3MTFA 3BHUA 3UTOA 2C69A 3UNZA 3U9CA 4OTWA 3EQHA 4TN6A 4WNMA 1K3AA 1J7IA 4FL3A 3SVVA 4BCNA 2UZLA 2R2PA 5E91A 3ZU7A 1R3CA 5AX3A 2JIIA 5CALA 5H8EA 4MYGA 4KWPA 4D1ZA 3EQPA 1CTPE 2FB8A 3HA6A 5BPYA 3UGCA 2NPQA 1XH8A 3MVHA 3UIUA 4PDOA 1HOWA 4NW6A 3R7UA 4TW9A 3CQUA 4L44A 4A06A 4BYIA 4MEDA 3MH1A 5HNBA 3ITZA 4QMQA 1SNXA 2G01A 5M4UA 1H26A 3D7TA 3Q9WA 2W17A 2HZIA 4MVFA 4PV0A 2C5XA 2UZDA 2WIPA 3W32A 3ENHA 1IG1A 5DN3A 4BDBA 3OT8A 1FINA 3OEZA 4CT2A 4EOPA 4D2WA 2E9UA 4WBOA 4FIGA 4EHEA 3KY2A 4EHGA 4D4VA 3GU4A 5LJJA 2QR8A 5IQBA 1W7HA 2OIDA 5DRDA 3MBLA 3WZUA 3EHAA 2WMRA 2ETRA 2F7XE 3EL8A 5JH6A 3CC6A 2Z02A 2B52A 5A14A 3KREA 2H34A 2OXYA 4HGEA 3RPRA 2B9HA 1NY3A 2PVKA 4JI9A 3VS2A 4FV3A 5D11A 4UN0C 3PWYA 3PSDA 3VQHA 3DK6A 4QOXA 5CU2A 3FYKX 4KSPA 5EK7A 5FTGA 4CTBA 3OXIA 4XRLA 5DRBA 4X2JA 4GU6A 5BUEA 5CNOA 4IB0A 3VULA 3TM0A 3EFWA 3ODZX 4FTIA 2WTKB 3PY1A 4ITIA 5LVNA 4TYEA 3RINA 4D1SA 4F9WA 5ANJA 3G9LX 3QTZA 2ZDTA 4BFMA 1PMEA 5LVLA 4YJQA 3WYXA 3SD0A 5JFXA 3D5VA 5EHYA 5ETCA 4GJ2A 5EYMA 4NTTA 4BTJA 3MPMA 4MNEB 4TWCA 4FT5A 4XG2A 5HI2A 4J8NA 3UYSA 4FV6A 4IDTA 4IVCA 2PVMA 4A9RA 4HVIA 5JQ5A 4DEIA 1GIJA 2VNWA 1YI6A 5CU0A 3ET7A 4O0VA 3PYYA 5AAEA 4LM5A 2YZLA 1KSWA 4BF2A 4USEA 4L3LA 3ZXTA 3S1HA 3VS5A 4IZ5A 1V0OA 3RPOA 2CGWA 5I9WA 2YERA 3AD5A 3BU6A 5DT0A 4KNBA 5M4CA 2YJRA 3WF7A 4I6FA 5DI1A 4N6ZA 1J1BA 2YM5A 5H8BA 2OW3A 4JLCA 1ZXEA 5JEBA 5D7VA 5ETFA 4FEVA 3FYJX 2QHMA 5KMNA 4KAOA 4RJ7A 3LJ0A 3PVWA 4W8EA 4NT4A 5GZ9A 5TR6A 3V51A 4EWHA 1FQ1B 5AV0A 4FV8A 1W84A 1ZAOA 1B6CB 1S9JA 2G1TA 3EL7A 5D9HA 5FEQA 4D4YA 3MH3A 4FKLA 4FTRA 5IF1A 2JDOA 3DKCA 1R78A 2VTAA 5AUUA 5E8ZA 2WNTA 3NEWA 2PY3A 2JKQA 2R3NA 2PE2A 3ZSIA 4C62A 4O84A 4FA2A 4ZMEA 1AD5A 4YO6A 3RALA 3AC4A 5JT2A 3FPQA 3CS9A 5AM7A 4FV4A 2C6MA 2QQ7A 1M2PA 3VBVA 3M11A 5BVFA 3ALOA 2OGVA 5EFQA 5AFVA 5FUTA 3AG9A 3H0ZA 3FI8A 3ID6C 4EH4A 2HZNA 3QQUA 3PP0A 4TNDA 1Y8YA 2XYUA 3EFKA 4D55A 4F1MA 4E4NA 3FZTA 4MBJA 2CMWA 3C0HA 3BELA 4RLKA 4CMTA 4RWKA 1PHKA 5C01A 4NKSA 1OPJA 4FT3A 4QQTA 4RA5A 4D1XA 1LEZA 4DTAA 2WMBA 5FEEA 5B2KA 3R8VA 4H3QA 3KXHA 3ZCLA 3BHTA 3QXOA 5I9YA 2F9GA 4KA3A 2RG5A 4RX8A 2R0IA 2W7XA 5CF5A 1OVEA 2REIA 1JSUA 3G0FA 5E1SA 4D0WA 4BGHA 2WQMA 2YFXA 4WA9A 3RAIA 3ZEWA 3HX4A 3UJGA 3BGPA 1M7NA 4IVDA 2EXMA 3A8WA 4S32A 3GC7A 4WNPA 5FM2A 4EJNA 5E9EA 3U51A 4L3JA 4HGTA 4CG8A 3D5XA 4A4OA 3MB7A 4FV1A 3RTPA 4E5AX 4HJOA 3FHRA 3BU3A 2XBJA 1W98A 2BCJA 4UWBA 5JRSA 4GVAA 2YHVA 5CZHA 5EDRA 4AA4A 4ZSJA 5I0BA 3MY1A 4C3FA 4FL2A 3V6RA 3VRYA 5BVDA 4FSZA 3IO7A 1YXTA 4F65A 2CKPA 2OJJA 1DI9A 2PZ5A 4G6NA 2X6DA 4G3EA 2C68A 5DFPA 4ERKA 4S31A 3VUDA 3EOCA 3QTWA 4M8TA 3ZC6A 4DH3A 3LMIA 1UVRA 2WMAA 1M52A 4IAFA 3E62A 4RVLA 3DJ7A 5HKMA 3SA0A 3AMYA 4H1MA 5TE0A 3UP2A 3DBQA 5BVEA 4EH8A 2HY81 5M53A 2QLQA 2VZ6A 3GQIA 3GU5A 3OMVA 3PPKA 4LUDA 4WG5A 3ZO3A 3P7AA 4DH7A 3ATTA 5EKNA 4O7SA 5JGBA 2X6EA 3THBA 4FV2A 2O64A 4ZTLA 4DGOA 4ENXA 1WVXA 3HEGA 2W4OA 3GFWA 3QRJA 2VO6A 4W8DA 2ITNA 2XF0A 5HBHA 4AT3A 2IVTA 2WOUA 3F3WA 3LHJA 4I0RA 4ASDA 3FMJA 4R7HA 2XM9A 2Q83A 4NCTC 2Q0BA 3FAAA 3AT2A 4O0WA 2AC5A 4ZLYA 2HENA 4X2NA 3GOPA 4DFZE 4FZ6A 4FNZA 5JGAA 4L67A 2WU6A 2C1BA 2AUHA 2RF9A 4EONA 2GS6A 4AS0A 4DLIA 4E1ZA 2QO2A 4O22A 1IRKA 5J8IA 4PMMA 2R3QA 2Z8CA 1PF8A 2YAKA 5K4JA 2E9NA 4RFMA 3KF4A 4YC8A 4N4SA 3TZ9A 3T9IA 3R7VA 5CEKA 3ORTA 4GYIA 3R9HA 4E93A 3O8TA 5EI8A 4BTMA 3DLSA 3BEGA 4M67A 1DI8A 2CHLA 3MA3A 4FNXA 2ETMA 2A19B 2GMXA 3A7HA 5E90A 4AZEA 4PDPA 4JBOA 4CZTA 3AC1A 3SX9A 3S00A 1LP4A 5LARA 3W8LA 1XBCA 2VX1A 3FJQE 4PNKA 3Q32A 5HG7A 4RJ5A 5DEYA 2OBJA 4FSTA 3GC8A 1GZKA 4XBUA 2OWBA 4ZJIA 4EK8A 5LMKA 2BZJA 4KBAA 3VS3A 3F3ZA 5D7AA 1U5RA 2OJIA 2XZSA 3LOKA 3PJ8A 2J4ZA 3FMEA 2Y4IC 2CPKE 2PUUA 4FEXA 3RWPA 3MI9A 4Q9ZA 5AUTA 4GUBA 1ZMUA 5AMNA 1CM8A 2EB2A 2PMIA 3GFEA 3PG1A 2WAJA 1P5EA 3QKKA 5HTIA 3UNJA 2WEVA 4IW0A 5CEQA 3W18A 2OZAB 3ZZEA 2JITA 5AR8A 3RCDA 2W1HA 3GCSA 3PDTA 4MX9A 4M14A 4FG9A 4O81A 3NNUA 3CQEA 4XBRA 3RK7A 4JXFA 5BYYA 4HPTE 5J7HA 1PXKA 4I1ZA 3NW7A 5H3QA 2BROA 4QP2A 3KC3A 4IX4A 4YJPA 4IM3A 5LMAA 2IVSA 2IO6A 3C4CA 3KL8A 3OCTA 4XG7A 4C0TA 2XK4A 3A4OX 3BBWA 4RWJA 4XV3A 3ZFYA 4FKVA 3DZQA 4OGRA 5AR7A 4APPA 1TQIA 5HESA 3OG7A 2ZMDA 3P7CA 3TIYA 3EKKA 4FKSA 5JRQA 3R9RA 1IASA 3HV4A 3V04A 2WU7A 4MWIA 3A7JA 4CFUA 4EHZA 3W1FA 2WMXA 2VV9A 4E73A 1JLUE 2WELA 4IBMA 3Q3BA 3GEQA 1H8FA 1UNLA 4I0TA 3ZFXA 2JC6A 4H58A 1SYKA 1MP8A 3E63A 4O0RA 5HCXA 1UU3A 2I0VA 5HIDA 5I3OA 3SW4A 4JRNA 2F4JA 4CKJA 5KKRC 3MA6A 4O7NA 4L8MA 5EQPA 1WFCA 4MXOA 3QC4A 4O38A 4L3PA 3PSBA 3MJ1A 4GIHA 3NAYA 2O65A 2VWIA 4AU8A 1E1VA 3QRIA 4EOSA 3CEKA 5J9ZA 5JK3A 3W16A 2GFCA 2ACXA 3PXFA 2RSVA 2GNLA 4FIJA 4F9BA 4QQCA 4F9CA 4EHVA 3PA3A 3VUIA 5C4KA 5AAGA 3R30A 2JDVA 4WSQA 4BVUA 1MRUA 5HE3A 5HD4A 3L8VA 4AGUA 1UWHA 3SDJA 2X39A 4RRVA 3HP5A 3OCGA 3NW6A 3L9MA 2XJ1A 2PZIA 3HV5A 3BPRA 4AA5A 3S4QA 2BR1A 4R1VA 4ZSGA 3GOKA 1ZZ2A 3NVMB 2G2IA 4A07A 4FYNA 4HVSA 2PVNA 4FSUA 3KULB 3NR9A 4GYGA 5J9YA 3W33A 3NNXA 4JBQA 3U6JA 3SXSA 2H8HA 2G2HA 5AX9A 4A9SA 3D14A 4C57A 4F64A 3KXGA 4GIIA 3DBDA 3MFSA 5D1JA 5IQGA 2Z7QA 4ALVA 1AGWA 3ALNA 4DCEA 5EI2A 4XV2A 3VBQA 5EYDA 2ITZA 3IS5A 5KO1A 5GIOE 2W9ZB 5HQ0A 5KX8A 2OSCA 3FMLA 4U40A 2BHEA 5DYJA 4JAIA 4OAVB 5FBOA 4QMSA 4AW5A 3UE4A 4C4HA 2VTJA 3UZRA 3KRXA 5DT3A 4C38A 5B7VA 1Q8UA 3Q2MA 4WRGA 4EC9A 4E6QA 4ACMA 3GCQA 5AUWA 3LFEA 3R73A 2BUJA 4YZDA 4CNHA 4RA4A 2FUMA 3KB7A 3R2YA 1U54B 4RVKA 1OPLA 5FTOA 2J0IA 4IDVA 4EUUA 4BI2A 4FTJA 1OIRA 3T3UA 4QQ5A 4EOOA 1PKDA 3P08A 4X3FC 2J9MA 3ZDIA 4D58A 3PY0A 5CEPA 1PMUA 2BPMA 5IA2A 3QC9A 4XG9A 2CNVA 2HZ4A 3C9WA 3OY3A 2PVLA 5FLFA 5CAPA 4U41A 3PRIA 4I21A 1BKXA 2V22A 2Y0AA 5L3AA 1XH5A 2JDSA 2XBAA 5CAQA 1H00A 3UC3A 3MW1A 5HTBA 3S2PA 1XR1A 3FSFA 3G90X 3SOCA 5A6NA 4FNYA 2UZVA 4RJ3A 5BVWA 2PL0A 5AR5A 5AR4A 4F1OA 4BZNA 2IZUA 3C4XA 2WTCA 2XK8A 3DJ5A 3QRKA 5E8VA 4BZDA 5KMLA 4Z55A 3DLZA 4F09A 2C6LA 2QOKA 3JS2A 5L8LA 2VUWA 4FKWA 3DAJA 5M06A 4BKZA 3U87A 1Z57A 3KU2A 4QP6A 3FKLA 5I9XA 4R78A 2YIRA 3LXPA 1QCFA 1ZYSA 1G3NA 3Q60A 1YWRA 4CRLA 3ZLXA 5J5TA 1BYGA 5M4FA 4GKHA 2J0MB 5AUXA 3EYGA 4I3ZA 1PMVA 3DBEA 4I93A 5EDPA 2QI8A 4O0XA 2P55A 5BYZA 5FRIA 4Z16A 4NK9A 4LQMA 4O0SA 2YM3A 4YPDA 3UO5A 1UKIA 2OZAA 5HO6A 1KWPA 5C8KA 1O9UA 3NUXA 4G9CA 4IZ7A 1ZYDA 5KE0A 4B7TA 2VWXA 2BALA 5K3YA 1Q3DA 2CLQA 3H9RA 3IW7A 4RC3A 3FZSA 3II5A 4N6YA 4EOJA 5IUHA 3QBNA 2F57A 2J5FA 4AAAA 1QL6A 4GUEA 2YA9A 3VS1A 5IH6A 4C4EA 3RNYA 4LGHA 4XCUA 4F7JA 1XH6A 3NYVA 2ITWA 4OT6A 4CFFA 3FI4A 3P23A 1GIHA 4U7ZA 3P79A 4QT1A 3VAPA 2XVDA 4R5YA 3TJCA 5LWNA 3BZ3A 3TNPC 5IQFA 4NU1A 5HLWA 1OL2A 3I6UA 2ZV7A 3NYXA 3MVMA 3QUEA 4FTUA 4O21A 4AGWA 4C33A 3I79A 2W1EA 4WRSA 2ITQA 4HYIA 3BKBA 4XH6A 4C3RA 4C8BA 2ETKA 3VS4A 4U44A 3BBTB 3P7BA 5TO8A 3EN5A 3W2OA 4I24A 4KB8A 4FKPA 4ZY6A 2GHMA 2OH0E 3BEAA 4NZWB 2VO3A 4FV0A 2HW6A 2HYYA 5FBNC 4QYYA 1J3HA 4ONAA 3KCKA 4WSYA 4WNOA 3B2WA 4PMPA 4RVTA 4PX6A 5HX6A 2W05A 3ZUUA 4YSJA 1JPAA 3DAEA 3POZA 5DNRA 2JKOA 1Y6AA 4ZY4A 3FQHA 1KE7A 4OAUC 3EJ1A 1OL7A 4MXYA 3FLNC 2XS0A 4YLJA 2LGCA 5IA5A 3OWPA 1LUFA 1JAMA 2HCKA 2P3GX 3DPKA 4GU9A 2RFSA 4IM2A 2ZV8A 4LV5A 3R7IA 3V5JA 4D4RA 4E4MA 3OOGA 4CGAA 4M7IA 1MQ4A 3QD2B 4ZJVA 2GS2A 4EQUA 3E3BX 4L68A 2V5QA 5KZIA 3QTQA 4GRBA 3D7ZA 1H28A 3NS9A 1BL7A 3E3PA 4JX7A 4ZTHA 1OBGA 4RIYB 4FSWA 3KULA 2Y4PA 3FKOA 4FTLA 2GFSA 4AE6A 2R3GA 3LIJA 1T46A 2EXEA 4F1TA 5IQCA 2WB8A 3PSCA 3DDQA 1V0BA 3NRMA 3ZM9A 4HYSA 3VBTA 4RJ8A 4W4WA 1ZOEA 2ITTA 3DB8A 3BWJA 3HKOA 4BCOA 4F08A 4UMRA 5CXZA 3ENMA 1KUTA 3FMNA 4ACDA 3EQIA 4G31A 4BGGA 3L8PA 1H1QA 2P0CA 2RL5A 4KIOA 2HZ0A 3A4PA 4P4CA 2XCHA 4V0GB 1STCE 4ORKA 4C2WA 5I9UA 2QOLA 5E92A 2B0QA 4O0UA 4XG6A 3G9NA 5DVRA 3QWKA 4FTTA 1U54A 3KRLA 5AV1A 1J91A 1QPEA 4R5SA 2VTOA 4AOJA 4CCBA 1IR3A 4DTBA 4ZP5A 3A99A 5CF6A 1JKLA 4RQKA 1GJOA 1UA2A 2XCKA 5CANA 2W9FB 2YZAA 5DHJA 4QYGA 1NXKA 3ACJA 3QQJA 3HA8A 4CFMA 1GZ8A 3HAVA 1IA9A 1WAKA 4M69B 4AW1A 4PDSA 4DINA 4G6LA 4KBKA 3FZRA 3VQUA 3ROCA 3ZFMA 4CFNA 2GQRA 1U5QA 2H9VA 3BU5A 1V1KA 2B9IA 3GNIB 4GG7A 1CDKA 4O86A 5CLPA 4O7TA 3R7OA 5E1EA 2Y9QA 2Z7SA 4AF3A 4ZLOA 5LMBA 1YW2A 5GJDA 4RWIA 4I23A 4J96A 5G6VA 5J95A 4PUZA 1UWJA 4K33A 4QPSA 4XUFA 3ZO4A 2FSMX 5HCYA 4CV9A 1JSVA 5K5XA 4JG7A 2VTSA 3OT3A 1CKJA 3TNHA 5TT7A 3UQGA 4EORA 3PA4A 5HU3A 1OITA 2X8DA 4FKJA 3WILA 4I41A 4M0ZA 1XQZA 3KXXA 4E6CA 4AP7A 3R71A 3V8TA 4L7SA 2X81A 4GT4A 4MKCA 3GQLA 3WIGA 2C1AA 3LZBA 5AV4A 5H9BA 5HX8A 1PXOA 1Y6BA 4QMPA 5M55A 3BE2A 3ZXZA 3SXFA 1SNUA 2OG8A 4RGJA 4BWKA 3ZONA 3R8UA 4E4XA 2YDIA 3RBWA 4YTFA 5FD2A 2ZB0A 1U4DA 4XLIA 1Z9XA 5DGZA 4BWXA 4PQNA 1NVQA 1URCA 1Q5KA 1OL6A 5EYCA 3OP5A 4MHAA 4Z7HA 2H6DA 2WOTA 2A2AA 3OC1A 2IJMA 3MDYA 4GL9A 3BHVA 4OLIA 5EYKA 4ZTRA 5BMMA 3TV6A 3V5WA 5IQEA 1UNHA 3F7WA 3VBWA 3FQEA 4C02A 4MWHA 3HUBA 3PE1A 1JKKA 2VWWA 4FOBA 4U79A 3C5UA 4XP2A 3QZFA 3QD3A 1H25A 3MYGA 2UW9A 4HOKA 3E8NA 2C4GA 1PXNA 4FTOA 3QLFA 3LM5A 1FVRA 3CTHA 3GT8A 4IB3A 4J52A 1OIUA 4C4FA 3TCPA 3HV3A 3SW7A 3FI3A 1YQJA 3BV3A 3CD3A 1NT2A 3NUAA 4YZ9A 4K9YA 3UODA 1M2QA 2ITYA 3BE9A 3LXKA 1F5QA 3OF0A 3JY0A 3UPZA 3DXPA 3QLGA 3DBFA 4IANA 3L9LA 4G1WA 4BDEA 1WBWA 2QG7A 3FXWA 4R3CA 1PYEA 4FTQA 3EN4A 4JQ7A 3TIZA 3W2CA 4AG8A 3SG8A 1XWSA 3H3CA 2XKDA 1Q62A 4H36A 3HMMA 5AWMA 3BQRA 2WEIA 4FIEA 2WMTA 2VX3A 3H30A 2UVXA 3RPYA 3HV6A 4DFNA 2DUVA 3DGKA 4QP1A 1RE8A 5HE2A 2WHBA 2OF4A 3BLHA 4A4LA 4CFXA 4RIYA 2E9VA 3O51A 2WTJA 3GCPA 4X2GA 3D15A 3RM6A 3UG1A 3G51A 4EKKA 1GY3A 3IG7A 3DAKA 3U6HA 2Y4IB 3ZLYA 2J90A 2HXQA 4RZWA 4DGNA 3HV7A 5LVMA 3EWHA 5IG1A 3DNDA 5C4LA 3LLTA 3E7VA 1Y57A 4P90A 5AP1A 3LKMA 4IC8A 4NIFB 2YM7A 4ZOGA 4IFCA 2VTQA 2YEXA 3AD4A 3IK3A 4YTHA 2X8IA 2YACA 1W82A 3QWJA 4UYAA 1M7QA 3IPHA 2IVUA 2VRXA 3V6SA 2VGPA 4DEEA 2JFLA 5CF4A 3QZHA 4M97A 2XRWA 1LEWA 3EMGA 1Q41A 4FSRA 2JIUA 2UZWE 3RNIA 3D0EA 4V0GA 4D2SA 3KN6A 4O7VA 3DB6A 5DWRA 3LXLA 5HVKA 4U43A 5AR2A 3E8EA 4W9XA 4U3YA 3QALE 3E93A 1Y8GA 2QOQA 2BFXA 4G3DA 3ODYX 4ZSEA 3GXLA 1GZNA 4DHFA 3R9NA 4IX3A 1KV2A 2BKZA 2ZVAA 5M09A 2NP8A 4G3GA 4KS7A 3U4UA 4M69A 5BQ0A 4TT7A 3F6XA 4X21A 3VBYA 2F7ZE 4G17A 4FSQA 4QO9A 2JAMA 5KBRA 2BIYA 2YABA 4IJPA 2B9FA 4DFYA 4G5PA 2GU8A 4Y5HA 2HW7A 3O17A 4RJ6A 1WBOA 4MXAA 4BBFA 4EI4A 2WXVA 4TYIA 3CKXA 2C3LA 5DR6A 5J79A 5KKRB 3L1SA 4LL5A 5CVGA 4YURA 2OU7A 5IEXA 5K0XA 3KMMA 5AP4A 3SGCA 2C5YA 5HCZA 5J9LA 3JVRA 4D5HA 3TKHA 1OKWA 4E6AA 3LCSA 2BTRA 3ULIA 3P1AA 3Q2JA 3KCFA 2FGIA 3F5PA 2GDOA 4D4SA 3TXOA 3UYTA 3DT1A 2W1FA 3CTQA 1OB3A 3RK9A 3C0IA 4NFMA 2Y8OA 4QMNA 4MD8E 3FXZA 5T3QA 3F7ZA 3BCEA 3KGAA 4Z3VA 4FC0A 3TEIA 4IXPA 4ANOA 4YJNA 2XNMA 2IPXA 1OIQA 2PVYA 4ZZNA 2WPAA 5CSXA 5HBJA 4YJVA 3C5IA 1ATPE 3QX4A 5EHOA 3G6GA 3UOJA 3VRZA 1CMKE 3DFAA 3LFQA 3PXKA 4YC3A 5AUYA 4ANQA 4GH2A 4ITJA 2W06A 4B6LA 2XNOA 3OUKA 4MXZA 3M1SA 2W4JA 5IA0A 1OI9A 3PVBA 2R3IA 2OF2A 4X2KA 3OXZA 4RG0A 4QMXA 3RGFA 4N0SA 3LW0A 1PXMA 5I9VA 4BCKA 4OTPA 4DFBA 3TKUA 1WBNA 3FXXA 4X6RA 3PRFA 3KN5A 4U3ZA 3V3VA 1OPKA 2R4BA 2J0JA 3M2WA 3QGWA 3RM7A 4LRMA 3OD6X 3SC1A 4O7YA 3NDMA 3QHWA 3N4UA 3UOKA 4RX7A 4XNEA 3NAXA 2JDRA 4ZZMA 1ZMVA 2OJGA 4JS8A 4TYGA 2C0OA 3Q4ZA 1Q3WA 3GUBA 3SV0A 2JD5A 4U6RA 4UWYA 1IAJA 4YTIA 3KF7A 1Q97A 3NSZA 2W1IA 4MF1A 4N70A 4TWNA 1JKSA 2R3PA 1PMNA 3CIKA 4NW5A 4QPMA 4X3FB 5CWZA 4C59A 5IU2A 3P4KA 2WTWA 2OH4A 2XA4A 4LG4A 4EK4A 4OBOA 3Q4CA 2QOFA 2PMNX 4F99A 2ONLC 4CMUA 3KVWA 3LCOA 4AGCA 1ZWSA 2OO8X 5ANDA 3QCSA 4BBMA 4UYNA 2O63A 4EEVA 5CY3A 4EYMA 3VS7A 4RQVA 4CQEA 1Q99A 4XP3A 4EOQA 4EOLA 4YO4A 2PTKA 2QVSE 2OIBA 2XNGA 3QYZA 4KABA 2QOOA 4LL0A 3T9TA 3MFUA 3VNTA 3FLSA 5A4QA 2AYPA 4DC2A 4PTGA 1WVWA 3EQCA 3EB0A 4XRJA 4YUQA 4QP4A 3ELJA 3F3UA 3H9FA 1VJYA 4LI5A 3D5UA 5EH0A 4DA5A 3GU7A 4F6SA 4WNKA 5FDPA 5IZFA 4Y8DA 4LV8A 4GK4A 3R01A 4NIFA 1OZ1A 3COKA 3F69A 3UPXA 3EQRA 1HCKA 3E8CA 1DAWA 3A7FA 2YDKA 3KMWA 3N9XA 4A4XA 2W5AA 5J5SA 1WMKA 2Z7LA 1S9IA 1JSTA 2X7FA 3ORIA 4BDDA 4YBKA 2B55A 1JBPE 2DQ7X 2ZM1A 3F82A 4LGDA 4D5KA 1J7LA 4J99A 4MCVA 4H05A 3AQVA 2ZAZA 3P5KA 5EHLA 2P33A 2ZM4A 4R1YA 3UVRA 3QL8A 4FUXA 4ITHA 5D10A 2HWPA 4QTDA 4DGGA 3C1XA 3ZO2A 3K54A 4FTCA 5JMSA 2OXDA 2C47A 4MNEA 4XG3A 4LGGA 4FV7A 4JIAA 5EI6A 4AUAA 1YDTE 3EZRA 4KUJA 2WTIA 4EH9A 2HAKA 2XK6A 4FYOA 4MQ1A 4AZVA 4BDJA 5BVOA 2YJSA 4QMLA 3B8RA 3PJ3A 2UW4A 4DFLA 4EZ7A 4U45A 3UIXA 4QNYA 2YM8A 3SHEA 2XB7A 3CPCA 1XH9A 4AGDA 3ORZA 4RIWB 1Q8WA 2WQOA 5D12A 3DKFA 3LVPA 4PTCA 4TZRA 3DXNA 3PVGA 4C4IA 3O23A 4FBXA 3R9DA 3FMKA 1TKIA 1QPCA 4B8LA 4DEGA 3TJDA 2WMWA 3R02A 3JVSA 4M84A 4W4VA 4YHJA 3IW5A 4Y83A 2GCDA 2Y6OA 3G5DA 4G6OA 4OTIA 3DOGA 3D2KA 4II5A 4MF0A 5FDXA 2UZTA 3KK8A 2IZRA 4NM0A 4Y72A 4C4JA 3FUPA 1ERKA 4O83A 1G5SA 5HGIA 2XK7A 3SQQA 2GHGA 3FE3A 2R3FA 4EOMA 4FKIA 4IZYA 4I20A 2OLCA 2GHLA 5GJGA 3FY0A 3COIA 3QKMA 2YCRA 4B0GA 3A7IA 4M3QA 2Q0NA 3WBLA 4ASEA 2VTMA 4C2VA 5GJFA 2PYWA 5TOZA 4JAJA 4EYJA 3BYVA 4EH3A 5E8WA 5A4TA 2NNWB 5CU6A 4KIQA 2BAKA 4I94A 1IAHA 4JRVA 4O7WA 4IADA 4A9UA 4APCA 5JFSA 4YJRA 2OIQA 4HCVA 3IECA 3DK7A 4ALWA 5IDNA 4TWOA 4JVGA 4BC6A 3UZTA 3BYMA 3CPBA 2G15A 3F2NA 5HE0A 2QKRA 5C9CA 1OIYA 4DT9A 1OMWA 4TYHB 4FZAB 3PG3A 3TUCA 5CSPA 4TTHB 3NUUA 5EKOA 1PJKA 1GIIA 3NZ0A 5IPJA 2OXXA 2ZJWA 4BIBA 3KXMA 3OXTA 5EW8A 4BHNA 2FVDA 4X3FA 5F1ZA 3UQFA 4J95A 5E7RA 4D2PA 1TQPA 4K11A 1R1WA 4FK3A 3ZM4A 5BVNA 2F2UA 2VWBA 4LMUA 2WTVA 2ZOQA 3C4FA 3IOPA 4IFGA 3VO3A 4EOIA 5A54A 4UXLA 3EH9A 4K0YA 2GNFA 3IDBA 3ZOSA 5LOHA 2XMYA 3FY2A 3PJCA 2VWYA 5AR3A 3VUHA 5DIAA 4D2VA 3MVJA 2NO3A 2UV2A 4XLVA 4ARKA 3AC2A 1HCLA 2C30A 4M13A 4BI0A 4QMOA 3RWQA 5HBEA 4DBXA 5FQDC 3TI1A 3PZHA 2UZUE 1G8AA 4DH5A 3AMAA 2JIVA 3FDNA 4UALA 2I7QA 2C5OA 1P4FA 2PVJA 2XP2A 3BX5A 3NCGA 1J1CA 2UW0A 4FZDB 4QYFA 3R83A 4EC8A 5EM8A 4ZSLA 4BKJA 4FODA 3CJGA 5B2LA 3WOWA 3FLWA 1ZLTA 4JQ8A 5CSHA 4BYJA 2CDZA 1OUKA 2CN8A 3DZOA 4KBCA 3FC2A 4IH8A 1OKZA 4K8AA 2C5NA 3R00A 1G8SA 3DY7A 3NCZA 3Q52A 4FSNA 1YOMA 4LFIA 3RPSA 3LPBA 3GBZA 4J53A 3NX8A 4KIPA 3QGYA 2IVVA 2BZHB 5ITAA 4B9DA 4CLJA 4DFXE 3ZLWA 4NH1A 4RBLA 4AQCA 1NVSA 1UU7A 3IKAA 3QUPA 4S33A 4KKGA 3I60A 1E1XA 1GNGA 2BRGA 1Q8YA 5BX0A 4NJDA 3H4JA 3WF8A 1U46A 4H39A 4PMTA 4WG4A 1YHSA 5CTPA 3R22A 4HVHA 4RMZA 4ZEGA 4BY9E 3AD6A 3CP9A 5CT7A 1LR4A 4K2RA 3WE8A 1ZYCA 5I3RA 2WQEA 4HNIA 1PRYA 3UQCA 5DPVA 3F2AA 2GNJA 3WF9A 4F6WA 1RJBA 1PXPA 2BTSA 4JT3A 2ZM3A 3PP1A 4YZNA 4HPUE 2ITVA 5EQYA 2X7GA 2PVFA 2UVYA 2QU6A 3QQLA 3FBVA 3R0TA 4WOVA 3V5LA 3F3VA 3RI1A 4QYEA 4BCHA 5LXMA 1PY5A 4YGAA 4ZTNA 3TNIA 3W2PA 2VAGA 4I22A 1TQMA 2VTNA 3HRFA 5EM6A 3ZH8A 4ASZA 4Q9SA 5H8GA 3QQHA 4PL5A 5IMEA 5F20A 3R7EA 1GZOA 2BILB 2EU9A 2WMVA 3MWUA 4H3PA 3MS9A 4IEBA 4JIKA 4ZAUA 4U80A 3GVUA 1DM2A 5CQWA 4Z9LA 5ACBC 3RAHA 4E7WA 2DS1A 5A4CA 4OUCA 4DLJA 3WI6A 2CNUA 5M08A 1B39A 4CLIA 3OEFX 5HLNA 5IUGA 3ORPA 3W2QA 3W2SA 4KIKB 3IGOA 2BZIB 5KBQA 2C3JA 2PZPA 3AGLA 2PUIA 4Y95A 4IAYA 3HDNA 4RWLA 4MNFA 1FOTA 5KHXA 4F7NA 4JDJA 1RDQE 2GTMA 2OK1A 4YHFA 5M57A 2BMCA 4OTRA 2VN9A 3DFCB 3POOA 4RJ4A 4TY1A 3VS0A 5FG8A 4GSBA 2BIKB 4WHZA 4F9YA 2GS7A 3JY9A 4FG7A 2CGUA 2QONA 3PE2A 1XBAA 4O91A 1P14A 3ZLSA 5EQEA 1CSNA 4ZS0A 4BCPA 3LFBA 3ZMMA 2HWOA 4YC6A 4F0IA 3D2IA 4GK3A 3C50A 3QQKA 4ZTQA 4BDFA 3FEGA 4XG8A 1YWVA 4GG5A 5FP5A 4R6VA 4FG8A 4CZUA 4G2FA 3AC3A 5M51A 3KRWA 4FSYA 4B99A 1CKIA 1YI4A 2DWBA 4F7LA 2V7OA 4EZ3A 3PFQA 4ANMA 3OUNB 2WD1A 4DG3E 4Y5QA 4CEGA 4E6DA 4FSMA 2VO0A 3IW8A 4EH5A 1ZY5A 4UV0A 3RZFA 1FGIA 3R04A 5FXSA 1PW2A 2R9SA 1MUOA 5KMOA 5M07A 4FIIA 5DA3A 2VTLA 4RZVA 3I1AA 4M12A 2XUUA 3EQGA 2QOHA 5KMKA 2WO6A 5CF8A 4JL9A 3QUDA 5TF9A 5CASA 4PL3A 3RCJA 5EW3A 3TZ8A 2QNJA 3QRUA 4CV8A 2VTRA 2I1MA 2FYSA 3OTUA 3UDBA 3Q6UA 3ZSGA 5E8XA 5K4IA 4E5WA 4YMJA 5I4NA 3MIAA 3PA5A 4HYUA 1SVHA 3UMWA 5JGDA 1K2PA 1KV1A 1YRPA 4YNEA 2BDWA 3ZHPC 4QTEA 5IEYA 2WMSA 2PVHA 3JUHA 5L2QA 3ZRMA 2VTHA 4ALUA 4AT4A 5BUJA 2ERZE 4ERWA 4W4YA 3MTLA 4EH7A 1IA8A 4JDIA 4HGSA 4PPBA 5HNGA 3BLQA 3Q5IA 4MD7E 5CEIA 5L8KA 2X9EA 4MQ2A 2HIWA 2XKEA 2I0EA 4RFYA 4TL0A 4AFEA 4I92A 5AP6A 4DYMA 2R3KA 5CT0A 3KMUA 5HVJA 1H1RA 4WBBB 2IN6A 1BX6A 3NNVA 3QA8A 2W4KA 5IA1A 1I44A 2B1PA 3CXWA 4AZWA 4O7ZA 3NNWA 4G34A 3LAUA 2VGOA 3E87A 2QODA 3PY3A 1H1PA 2XM8A 5IH4A 3C13A 2I0HA 4K1BA 3HZTA 4AACA 2RIOA 4CZYB 4AW0A 5DR9A 3BIZA 3O7LB 2VWZA 3CBLA 3O71A 3ERKA 3NVKI 4BIEA 1R0EA 1U59A 3WZJA 2A1AB 4F6UA 5BYLA 2EWAA 2A0CX 1RQQA 3OW3A 2J0KA 4PP7A 5GIPE 2XEZA 4USDA 3ANRA 4EBVA 4BKYA 5A4EA 3FKNA 3M42A 5IUIA 5LQFA 4FKGA 3QAME 3WARA 4QMWA 3QTXA 2X7OA 1GOLA 2GTNA 3IQ7A 3GCUA 3PTGA 5CYIA 4J71A 4DEDA 1JWHA 2BVAA 3A2CA 2FA2A 3TV7A 4FX3A 4IC7A 5KZ0A 5ANOA 2WIHA 3FLZA 2QHNA 4O2ZA 5CVFA 3FMMA 2O8YA 2CSNA 4D28A 3A7GA 1O6YA 3FLQA 1OBDA 2JGZA 3LXNA 4OW8A 5C8MA 4GFOA 2CKEA 4OR5A 2C6DA 2YCSA 2YAAA 3B2TA 3ZRLA 4IIRA 4QPAA 3C7QA 2X0GA 2IZSA 2KTYA 3NWWA 1MQBA 3NUYA 3PVUA 4CKRA 4B4LA 3Q9YA 3UBDA 3PJ2A 1FBNA 3FQSA 3ZS5A 4CFWA 4IMYA 4NKAA 3ZZWA 4G9RA 1UU9A 4AN2A 2GSFA 4IB1A 3VN9A 3D9VA 1YXVA 3P0MA 2W5HA 1KOAA 4BWPA 2R64A 3Q9XA 4WT6A 1VYZA 2PMOX 5IA4A 3NYOA 2UW6A 3ACKA 3F66A 3OWLA 3TT0A 4FZFB 5HU9A 3ORNA 1OUYA 2B54A 2UUEA 2FSOX 4BGQA 4I5HA 4GJ3A 2YIYA 5EDQA 3S3IA 1H08A 4UEUA 5CQUA 4BL1A 5KMJA 3HP2A 4FIHA 5CNNA 4IAZA 3RZBA 2PUNA 2A27A 3UC4A 3ZC5A 3OCBA 3QFVA 1Q4LA 2QU5A 3R8ZA 2QOBA 4YZCA 4CKIA 3A61A 2WMQA 4MAOA 4P5QA 3QQFA 2A4LA 2IG7A 3I7BA 2UW8A 4L52A 4E8AA 1YKRA 5HZNA 3FL5A 3K3JA 2X2MA 1I09A 1OKVA 1P4OA 2QD9A 2R5TA 2RFDA 3A60A 3GU8A 4L42A 4M15A 4YNOA 3UOHA 4AA0A 3NLBA 4IWQA 3ULZA 1FPUA 1H24A 4L00A 3WF6A 4L45A 3F9NA 2KULA 4YJOA 4AT5A 4DCAA 3VHEA 4E4LA 2JFMA 4CFVA 2C3IB 3UVPA 4UY9A 1REKA 3FPMA 4UZHA 3S95A 5IEVA 2HY0A 5L2WA 3HGKA 1BI7A 4NM5A 2FSTX 4FKOA 3T8OA 2ZV9A 4ACGA 2XIYA 4YLLA 4O2PA 3CGFA 2OI4X 3KEXA 3TZMA 3R1NA 5HICA 4K6ZA 1QPJA 4PMSA 5IDPA 3FL4A 4LOQA 4RVMA 5IQAA 4DFUA 5BVKA 2R0UA 4YZBA 5F4NA 2CCHA 3HLLA 5JFVA 2ZMCA 2X1NA 3JPVA 4GT5A 4V04A 3I5ZA 2WGJA 5EW9A 3H9OA 3W55A 2V55A 4EBWA 2O2UA 3ZEPA 3CR0A 3LFSA 3K5UA 4UMUA 4DF3A 1FMKA 3ORKA 2V0DA 4LOPA 5GINE 4FGBA 2VWVA 4UWCA 3BGZA 1ZOGA 1O6KA 3PXRA 3RK5A 3LMGA 5AJQA 4RPVA 3FSKA 4FEQA 4E26A 3EQFA 4FVQA 3TUDA 5HO7A 5IISA 4IAIA 1PYXA 5J87A 3V5PA 3BYOA 4MH7A 1WBTA 2YISA 3FZPA 4PWNA 3V5TA 4PL4A 3EIDA 5LWMA 4XYFA 4FIFA 3IW6A 3LM0A 4IWOA 3LLAA 3Q53A 4FKUA 2X8EA 2BDFA 5EG3A 2UW3A 5AP5A 1KE9A 4ID7A 4O0TA 3TNWA 3QCQA 3B8QA 5HVYA 2HELA 3Q6WA 3WF5A 3EN7A 4EK6A 3BYUA 4J7BA 4O82A 4BCIA 4EUTA 3V8SA 5AUVA 2CKQA 1BLXA 2IW6A 1OECA 3NPCA 2X2LA 4ANSA 4QMYA 3BWFA 4M68A 4XOZA 3SAYA 1WBVA 2OFVA 3P9JA 3I6WA 3WE4A 4F0GA 4Q5HA 4OBQA 4XMOA 1JKTA 2XKFA 2XK3A 3U4WA 2JLDA 2PULA 3HMOA 3DA6A 4GV1A 1YXXA 5ETIA 4E5BA 4F9AA 2PPQA 4D2TA 3QQGA 2QOCA 2VO7A 4FZ7A 4CQGA 2OJFE 4ZY5A 3QA0A 3EFLA 1M17A 4QMVA 4BZOA 2XIKA 3COMA 3RJCA 4XEYA 3RVGA 2JBOA 3HL7A 3R8PA 3TTJA 2ONLA 1H1WA 4B8MA 4F70A 3QRTA 3GC9A 1EH4A 5AADA 3EQDA 3QTUA 5KHWA 3L9NA 4ENYA 2J7TA 4BI1A 5DMZA 4JG6A 4WG3A 5GHVA 2E9OA 3Q4TA 4CMOA 4DBNA 4EL9A 2ERKA 1UU8A 2O0UA 4IM0A 4LYNA 5FP6A 3R8MA 5HHWA 3DK3A 4H3BA 3AT3A 3GP0A 3V01A 3KFAA 3KQ7A 4C3PA 1OL5A 2Y6MA 3LCKA 4KRCA 5AEPA 4U81A 3VWAA 4YZMA 3CKWA 4CYJA 3D5WA 2BRBA 3N4VA 3UO6A 2CJMA 4FL1A 5DR2A 3CLYA 5CEMA 3D94A 3NIEA 3Q4UA 5ANEA 5CS6A 5AV2A 4CTCA 3HUCA 4IVBA 5CSWA 4AN9A 4V05A 4FEUA 4XX9A 4GT3A 2WZJA 4NEUA 3K3IA 4JNWA 2XH5A 4AX8A 2YWVA 3BYSA 4YSMA 5ANIA 3R1QA 3IDCA 2RG6A 1A9UA 2C0TA 5FTQA 4DGMA 4ZS4A 3GGFA 2J6MA 3DKOA 4JR7A 4WUNA 5AIKA 3VUKA 4NCTA 2R3LA 3JYAA 4FICA 2BZKB 2C5VA 4O1PA 5JZJA 3VF9A 4JDKA 5B0XA 4JR3A 4JQEA 5E4HA 4FV9A 3G15A 4R8QA 5GNKA 4PNIA 4CG9A 5CAOA 3VVHA 1XH7A 5EOLA 4BDAA 4PF4A 4BDHA 3E88A 1BI8A 2BRHA 2I0YA 4JJRA 2PWLA 2XIRA 3EKNA 4U8ZA 3U9NA 3RAKA 4ANBA 5LCJA 2I6LA 2VNYA 2CGXA 2QOIA 3AT4A 3HVCA 1NA7A 3WZDA 4O6EA 5L2TA 3FMHA 2QR7A 4KKHA 4RC2A 1YHWA 3HYHA 3OW4A 3MJ2A 5ETAA 5AUZA 5C26A 1URWA 2EB3A 3U54A 3IGGA 2CN5A 3WIKA 3DKGA 5L2SA 2W0JA 4O0YA 4G5JA 2HK5A 3AMBA 1WVYA 4DH8A 3OCSA 4QD6A 4JOAA 3K5VA 4IZAA 3EZVA 5E8TA 4UXQA 4KRDA 4BCJA 3O7LD 4O96A
chains in the Genus database with same CATH superfamily
2XNPA 2XYNA 2R3JA 4GMYA 4BDCA 5A46A 5J1WA 1L8TA 5IMXA 3VW8A 3A62A 3PIZA 4R7BA 3R7GA 2FSLX 2C6IA 5AP2A 4QP7A 3PXZA 4O27B 3I0QA 1O6LA 1REJA 4FUYA 4L9IA 4I6LA 2ESMA 4OT5A 4P2KA 1XHAA 4HNFA 1YVJA 3MV5A 2BHHA 4AOTA 2C6EA 3E8DA 5HO8A 4UMTA 5ACKA 1FMOE 4ANLA 4XJ0A 4Z7GA 5T68A 4FTNA 3S0OA 1Q8ZA 2W1GA 3EFJA 1K9AA 4IE9A 4AZSA 3VUTA 2XRUA 4BB4A 4EJ7A 4FV5A 2B53A 3RP9A 5A9UA 4RIOA 4PDYA 1P2AA 5CSVA 5H2UA 2OJ9A 5LVPA 1SZMA 3RMFA 4FF8A 4FMQA 4C7TA 2J5EA 3I7CA 3CY3A 3MN3A 3BRBA 1MRYA 4TYJA 4BN1A 5KNJA 3DQWA 3EYHA 4RSSA 3R7YA 4FVRA 3PJ1A 2R3HA 3TUBA 4K77A 5AA9A 2R3OA 3CD8A 5GZAA 3OBGA 3UIMA 3C4EA 3EN6A 3ZTXA 4QQJA 2ZFYA 4BTKA 1FVTA 3AKJA 4QMZA 4CCUA 2YCFA 4AFJA 3PIXA 2RFNA 3TV4A 2O3PA 3E7OA 2EVAA 4S2ZA 3TDVA 2Z2WA 5IA3A 2O5KA 2WQNA 3HECA 4R77A 4WUAA 2GQSA 3EN9A 1MRVA 1W2FA 3BLRA 3TN8A 1BUHA 4XV1A 3QD4A 2PZYA 5IQHA 3N4TA 4QP3A 4JX3A 4QYHA 2IZTA 1H07A 3AGMA 3NUNA 1KE6A 3ZBXA 5HORA 2XJ2A 4X2FA 4DEAA 5F95A 3VW6A 2RKUA 3SG9A 3ORLA 4QMTA 2ZYBA 2DYLA 4QMMA 3HAMA 2J0LA 2JDTA 4EKLA 1FGKA 5JKGA 4OTQA 4QTBA 4XOYA 3I4BA 4USFA 4I5PA 4RT7A 4MK0A 3RPVA 1W8CA 3FWQA 4EK3A 3BHHA 1OM1A 2JKKA 2ITOA 4TXCA 4ZJJA 2UZEA 1OGYA 2X4FA 2JEDA 4NJ3A 3L8SA 3UZPA 5ANKA 3MIYA 4I5MA 5M44A 3LFDA 2VD5A 4Y46A 3WZKA 4ACCA 2R7BA 5IKWA 2C3KA 1A06A 2QLUA 4ZIMA 5IQDA 1AQ1A 3MB6A 4MBLA 5L2IA 4QTCA 4C34A 4DAWA 1NVRA 4U0IA 3EQBA 3LJ1A 4K18A 2X0QA 3BLAA 3NW5A 4FGRA 2ITUA 4BRXA 4DN5A 3LFCA 4EH6A 4S30A 4XP0A 3UO4A 5CI7A 4A9YA 3DTCA 2Z7RA 3LFFA 4RIXB 3FZOA 1BMKA 3BGQA 4MTAA 4NUSA 3NYNA 3U8WA 4JDHA 4FE2A 1VEBA 3AOXA 4YJUA 3UG2A 1JVPP 3VC4A 1YHVA 2VU3A 3MY0A 3Q96A 1APME 5HIBA 2UZNA 3JXWA 4PPCA 4ASXA 3NMUF 4BICA 3VUGA 4BTFA 3KRRA 1PXLA 3G33A 3DJ6A 4IWDA 4XHKB 3TDWA 4DT8A 3HMNA 3L9PA 1ZY4A 5CVHA 3CSVA 4X3JA 5HNIX 4RLLA 3AC8A 3QU0A 5FEDA 1WBSA 3SRVB 3Q9ZA 5HG5A 2Y7JA 4HCUA 4KKEA 4NYEA 3KRJA 5IQIA 3LCDA 4GCJA 5AP0A 4E20A 2CGVA 2SRCA 2E9PA 2OFUA 5DG5A 4V01A 2WTKC 3OWJA 4F4PA 4ACHA 5CEOA 3DNEA 4DEBA 4FKQA 4U42A 1UV5A 4C58A 3MFRA 3K2LA 1F0QA 4ZK5A 3MESA 3E92A 5CU3A 3TL8A 4F7SA 2QC6A 4W4XA 3FV8A 4PPAA 1VZOA 4BDIA 1GAGA 4DDIA 1ZOHA 4QP8A 4NFNA 5C27A 1RW8A 4I6BA 4DEHA 3DQXA 1H4LA 5LCKA 1CKPA 3ATSA 2P2IA 2J2IB 5AIRA 4J8MA 1NW1A 4G3CA 5C1QB 3QYWA 3HMPA 4GFGA 2JAVA 3D4QA 4BDGA 2IW9A 4RC4A 3R9OA 4IAAA 4AXAA 4D9TA 2F7EE 3QTRA 4JBVA 4QRCA 3TMOA 5E8UA 2QCSA 3QTSA 3CE3A 1M14A 2VTIA 4UMPA 3NIZA 5T6KA 5HEZA 1XJDA 2G9XA 2YM4A 5HIEA 5M4IA 3E5AA 3G0EA 1E9HA 3I0OA 3LJ2A 4GS6A 2C6KA 3F61A 4L43A 3SKCA 3T3VA 2PHKA 4UZDA 2OKRA 3LCTA 4MXCA 2NRUA 4YJTA 4WO5A 4IAKA 1M2RA 3R1YA 4CRSA 5LMKC 4FVPA 2XKCA 4AXCA 2W1DA 4QTAA 1ZZLA 2UZOA 2WTDA 4LRJA 4QNAA 5KCVA 4GEOA 3W10A 2GQGA 3ZYAA 4BR3A 4R3PA 1T45A 1R39A 3A8XA 5HLPA 3SOAA 4HGLA 5FGKA 2C6OA 5FWKK 3R63A 3OROA 4RX5A 3BHYA 5JSMA 3MSSA 2YM6A 4H1JA 1DS5A 2R3RA 1JNKA 3LQ3A 3E64A 2BAJA 5KUPA 4O6LA 1H27A 5EM5A 3O8PA 2P4IA 3FC1X 3OY1A 1OKYA 3QCYA 5J7BA 3TTIA 4YTCA 1H0WA 1ZRZA 2J51A 3VBXA 3CQWA 1PXJA 2XIXA 5M56A 3ZUVA 3U6IA 1Y91A 3MGYA 5HOAA 4CSVA 2XNEA 2PE1A 5JZNA 4I0SA 4F0FA 5G1XA 3F2RA 1JOWB 3CY2A 1YXUA 3LQ5A 3JR1A 4C35A 4YPSA 5AM6A 3PLAE 3F3TA 4O1OA 3OBJA 3IONA 1KE5A 4LOOA 2UW7A 3KKVA 4AE9A 2W99B 4FKRA 3QD0A 3QX2A 2PMLX 2BFYA 2ZDUA 4FR4A 2GNGA 4FTAA 4NSTA 3DTWA 4X6QC 2WFYA 2IWIA 2X2KA 4CT1A 4L01A 2YITA 4RIWA 1UNGA 1LPUA 4C37A 3RAWA 3KVXA 3V5QA 1R0PA 2PK9A 4DG2E 4IVAA 4S34A 3OZ6A 1JQHA 3TWJA 3DS6A 5BNJA 1H0VA 2B7AA 3QXPA 4FNWA 4OTFA 5DE2A 3FHIA 4BBEA 1B38A 3CJFA 3R6XA 3VS6A 3AKLA 4FEWA 2PVRA 5CU4A 4FOCA 4ZSAA 2G2FA 3PXQA 4IHPA 3VJNA 5IH5A 4QP9A 3RHKA 4IX5A 4BCFA 4W9WA 4LRKA 2JBPA 3LQ8A 3ANQA 3PPZA 3G2FA 3IOKA 4I6HA 4I6QA 2B9JA 3Q5ZA 4O7LA 2PE0A 4L7FA 3VIDA 4CXAA 3FLYA 4FK6A 1BL6A 5F9EA 4G3FA 3O8UA 5JFWA 4MD9E 2ITPA 2R7IA 4P7EA 4XV9A 3TACA 2XJ0A 4AOIA 4DH1A 1SVGA 1X8BA 3H10A 3D83A 3MPAA 2NYAA 1ZARA 1VYWA 3DU8A 3C0GA 4FT7A 3DDPA 4I4FA 4F63A 5L6PA 4R3RA 1Q24A 3V8WA 3P78A 4RIXA 3REPA 1SVEA 2XK9A 4LMNA 3C4WA 5L6WL 3RHXA 3VJOA 3PWDA 1OGUA 4Q5EA 3SLSA 3W8QA 2PSQA 2QG5A 2V62A 1SMHA 1UKHA 2CLXA 3G6HA 3QTIA 4PRJA 4DE4A 4IWPA 4FTKA 2BKKA 3BQCA 4WIHA 3CTJA 5EOBA 4BCGA 2OZOA 3WZEA 4ANNA 4BHZA 4ZZOA 3IDPA 5HG8A 4BDKA 5A3XA 4U9AA 2BAQA 2GPHA 3UDTA 4HVDA 4MXXA 1XBBA 4RX9A 3O5AA 4TYHA 4D2RA 3SRVA 4HYHA 3ZBFA 3F5UA 4EZ5A 2E2BA 5B2MA 2WQBA 1WBPA 3L8XA 2WMUA 5DEWA 4HVGA 1KE8A 4DG0E 3O2MA 4GFMA 3ROYA 1Z5MA 3N51A 3OOMA 4GVJA 4TPTA 2BDJA 4Y85A 3UMXA 4HW7A 3U55A 3R1SA 5AP7A 3SXRA 4IACA 4AZTA 2V7AA 5DLSA 2FH9A 3FI2A 3ETAA 3PUPA 3ZRKA 4AN3A 3UP7A 2QO7A 4BIDA 3NFGB 3GI3A 3QKLA 3VUMA 2X4ZA 4U97A 4IX6A 5E8SA 4QEBA 3NUSA 4OTHA 4N57A 3F88A 2F2CB 1TVOA 4WKQA 1V0PA 3VHKA 4NM3A 2BRMA 4OBPA 5CENA 3DXQA 5C03A 1F3MC 3ZDUA 3PPJA 3ZUTA 2W1CA 2ZB1A 3LE6A 5AA8A 4L53A 4IJ9A 4C4GA 4CYIA 2QO9A 5AV3A 4I5CA 4OTDA 5FXRA 4PTEA 1A48A 4NWMA 1YDSE 1SM2A 1W83A 2QURA 1WZYA 2YIXA 4UX9A 5KMMA 2OICA 1YOJA 4Y73A 3GC0A 4OTGA 4EOKA 1ZMWA 4ZTSA 3VF8A 3RKBA 2XAOA 2C6TA 3KA0A 4KSQA 5D41A 3DCVA 3LFNA 3OFMA 5FXQA 1YXSA 4BCQA 2RFEA 2XIZA 3AXWA 4GKIA 4TKSA 1YI3A 4XG4A 4X0MA 3O96A 4L46A 5JQ8A 4NTSA 4J97A 2YLEA 4R7IA 3P86A 3NGAA 5CXHA 2QKWB 4DGLC 4EWQA 1H01A 4EH2A 5L6OA 3GB2A 2PU8A 4YBJA 4UBAA 4DTKA 2FO0A 3KK9A 5DT4A 3D7TB 5I5ZA 2R3MA 4IB5A 2VTPA 5EM7A 4HCTA 4E3CA 1QMZA 2YIWA 2UZBA 1YDRE 2I40A 2NRYA 3Q04A 1Q8TA 1YWNA 5CI6A 5ANGA 4U5JA 4EK5A 3DV3A 4KINA 2XEYA 5F94A 4L6QA 1ST4A 2HOGA 1KOBA 4ZXTA 4TNBA 3GCVA 3UNKA 3PLSA 4ZMFA 4TRLA 4Q2AA 4QMUA 5L8JA 1FVVA 3BI6A 3AC5A 4FT9A 3ZO1A 3ZSHA 5K9IA 2YCQA 3O0GA 5I9ZA 3QHRA 5CX9A 4A9TA 3R28A 3PIYA 3TNQB 5L4QA 5K5NA 2HXLA 3F5GA 3GU6A 3KXNA 3OHTA 4I4EA 4YU2A 5C8NA 4YLKA 4FT0A 2VTTA 3UDSA 3C4ZA 4JBPA 2UVZA 4UB7A 1IEPA 4YHTA 3O50A 2C0IA 3OVVA 4M66A 3F5XA 4PP9A 3TZ7A 3W2RA 3OS3A 2EUFB 2W5BA 4C61A 3OTVA 4WD5A 1W0XC 4ZLZA 4FKTA 4BCMA 4EQCA 5HTCA 3H0YA 1DAYA 1OL1A 4GW8A 5FM3A 5HE1A 3PXYA 4CD0A 4JMQA 2LAVA 2X9FA 3HDMA 4YR8A 2CNQA 3WYYA 2XAMA 5J1VA 5A4LA 3TG1A 3ORMA 5A6OA 2F49A 4DITA 1ZYLA 2VX0A 4HZRA 1WCCA 4HZSA 2AC3A 2YLFA 4FI1A 3OWKA 5JN2A 3FZ1A 4J1RA 5AAFA 2CKOA 3KXZA 3QZIA 4IQ6A 4FTMA 5DOSA 3CCNA 3HRBA 4FJVA 2YDJA 3HNGA 3QZGA 4D9UA 1J7UA 4KIKA 4NM7A 2W96B 2UW5A 4C36A 2BRNA 3R2BA 5DBXA 4KD1A 5CAUA 4CVAA 2P2HA 1PXIA 2ITXA 4AWIA 2GNHA 3BL9A 3CGOA 5ICPA 1ZYJA 3C51A 4O7RA 5HG9A 3MH2A 3ORXA 4MBIA 3I81A 4UMQA 5GZ8A 3UOLA 5LVOA 3MH0A 3HRCA 3MVLA 4DHJA 2GNIA 2J50A 3I5NA 5AP3A 5BUIA 2VWUA 1H1SA 3NUPA 3QF9A 4XS2A 1PKGA 5TKDA 3LFAA 2H96A 2PUPA 2YWPA 1ND4A 2W1ZA 4RFZA 2XNNA 2WKMA 3GENA 2Z60A 3MPTA 4D0XA 5CZIA 2B4SB 3BV2A 4O4BB 4YJSA 4PY1A 1Q61A 4NL0A 4GK2A 1VR2A 4A7CA 4J98A 4LUEA 5KMIA 2RGPA 5DH3A 4P5ZA 5HD7A 3QCXA 2YN8A 3COHA 3MFTA 3TKIA 1G8KA 5E8YA 3R21A 2YIQA 2ZV2A 2EXCX 3DBCA 3UVQA 5K0KA 3MY5A 3PZEA 4AZFA 1XO2B 4KS8A 4M0YA 2PZRA 4G16A 1YOLA 3IW4A 1L3RE 3FMDA 4EQMA 4X7QA 1XH4A 1XKKA 4ZTMA 5BMSA 3R8LA 4YP8A 3HMIA 3UIBA 4TWPA 2IW8A 1QPDA 4AW2A 2JKMA 5CAVA 4JG8A 2CCIA 3LMHA 2XNBA 3MTFA 3BHUA 3UTOA 2C69A 3UNZA 3U9CA 4OTWA 3EQHA 4TN6A 4WNMA 1K3AA 1J7IA 4FL3A 3SVVA 4BCNA 2UZLA 2R2PA 5E91A 3ZU7A 1R3CA 5AX3A 2JIIA 5CALA 5H8EA 4MYGA 4KWPA 4D1ZA 3EQPA 1CTPE 2FB8A 3HA6A 5BPYA 3UGCA 2NPQA 1XH8A 3MVHA 3UIUA 4PDOA 1HOWA 4NW6A 3R7UA 4TW9A 3CQUA 4L44A 4A06A 4BYIA 4MEDA 3MH1A 5HNBA 3ITZA 4QMQA 1SNXA 2G01A 5M4UA 1H26A 3D7TA 3Q9WA 2W17A 2HZIA 4MVFA 4PV0A 2C5XA 2UZDA 2WIPA 3W32A 3ENHA 1IG1A 5DN3A 4BDBA 3OT8A 1FINA 3OEZA 4CT2A 4EOPA 4D2WA 1W2DA 2E9UA 4WBOA 4FIGA 4EHEA 3KY2A 4EHGA 4D4VA 3GU4A 5LJJA 2QR8A 5IQBA 1W7HA 2OIDA 5DRDA 3MBLA 3WZUA 3EHAA 2WMRA 2ETRA 2F7XE 3EL8A 5JH6A 3CC6A 2Z02A 2B52A 5A14A 3KREA 2H34A 2OXYA 4HGEA 3RPRA 2B9HA 1NY3A 2PVKA 4JI9A 3VS2A 4FV3A 5D11A 4UN0C 3PWYA 3PSDA 3VQHA 3DK6A 4QOXA 5CU2A 3FYKX 4KSPA 5EK7A 5FTGA 4CTBA 3OXIA 4XRLA 5DRBA 4X2JA 4GU6A 5BUEA 5CNOA 4IB0A 3VULA 3TM0A 3EFWA 3ODZX 4FTIA 2WTKB 3PY1A 4ITIA 5LVNA 4TYEA 3RINA 4D1SA 4F9WA 5ANJA 3G9LX 3QTZA 2X0OA 2ZDTA 4BFMA 1PMEA 5LVLA 4YJQA 3WYXA 3SD0A 5JFXA 3D5VA 5EHYA 5ETCA 4GJ2A 5EYMA 4NTTA 4BTJA 3MPMA 4MNEB 4TWCA 4FT5A 4XG2A 5HI2A 4J8NA 3UYSA 4FV6A 4IDTA 4IVCA 2PVMA 4A9RA 4HVIA 5JQ5A 4MUQA 4DEIA 1GIJA 2VNWA 1YI6A 5CU0A 3ET7A 4O0VA 3PYYA 5AAEA 4LM5A 2YZLA 1KSWA 4BF2A 4USEA 4L3LA 3ZXTA 3S1HA 3VS5A 4IZ5A 1V0OA 3RPOA 2CGWA 5I9WA 2YERA 3AD5A 3BU6A 5DT0A 4KNBA 5M4CA 2YJRA 3WF7A 4I6FA 5DI1A 4N6ZA 1J1BA 2YM5A 5H8BA 2OW3A 4JLCA 1ZXEA 5JEBA 5D7VA 5ETFA 4FEVA 3FYJX 2QHMA 5KMNA 4KAOA 4RJ7A 3LJ0A 3PVWA 4W8EA 4NT4A 5GZ9A 5TR6A 3V51A 4EWHA 1FQ1B 5AV0A 4FV8A 1W84A 1ZAOA 1B6CB 1S9JA 2G1TA 3EL7A 5D9HA 5FEQA 4D4YA 3MH3A 4FKLA 4FTRA 5IF1A 2JDOA 3DKCA 1R78A 2VTAA 5AUUA 5E8ZA 2WNTA 3NEWA 2PY3A 2JKQA 2R3NA 2PE2A 3ZSIA 4C62A 4O84A 4FA2A 4ZMEA 1AD5A 4YO6A 3RALA 3AC4A 5JT2A 3FPQA 3CS9A 5AM7A 4FV4A 2C6MA 2QQ7A 1M2PA 3VBVA 3M11A 5BVFA 3ALOA 2OGVA 5EFQA 5AFVA 5FUTA 3AG9A 3H0ZA 3FI8A 3ID6C 4EH4A 2HZNA 3QQUA 3PP0A 4TNDA 1Y8YA 2XYUA 3EFKA 4D55A 4F1MA 4E4NA 3FZTA 4MBJA 2CMWA 3C0HA 3BELA 4RLKA 4CMTA 4RWKA 1PHKA 5C01A 4NKSA 1OPJA 4FT3A 4QQTA 4RA5A 4D1XA 1LEZA 4DTAA 2WMBA 5FEEA 5B2KA 3R8VA 4H3QA 3KXHA 3ZCLA 3BHTA 3QXOA 5I9YA 2F9GA 4KA3A 2RG5A 4RX8A 2R0IA 2W7XA 5CF5A 1OVEA 2REIA 1JSUA 3G0FA 5E1SA 4D0WA 4BGHA 2WQMA 2YFXA 4WA9A 3RAIA 3ZEWA 3HX4A 3UJGA 3BGPA 1M7NA 4IVDA 2EXMA 3A8WA 4S32A 3GC7A 4WNPA 5FM2A 4EJNA 5E9EA 3U51A 4L3JA 4HGTA 4CG8A 3D5XA 3PFYA 4A4OA 3MB7A 4FV1A 3RTPA 1G8JA 4E5AX 4HJOA 3FHRA 3BU3A 2XBJA 1W98A 2BCJA 4UWBA 5JRSA 4GVAA 2YHVA 5CZHA 5EDRA 4AA4A 4ZSJA 5I0BA 3MY1A 4C3FA 4FL2A 3V6RA 3VRYA 5BVDA 4FSZA 3IO7A 1YXTA 4F65A 2CKPA 2OJJA 1DI9A 2PZ5A 4G6NA 2X6DA 4G3EA 2C68A 5DFPA 4ERKA 4S31A 3VUDA 3EOCA 3QTWA 4M8TA 3ZC6A 4DH3A 3LMIA 1UVRA 2WMAA 1M52A 4IAFA 3E62A 4RVLA 3DJ7A 5HKMA 3SA0A 3AMYA 4H1MA 5TE0A 3UP2A 3DBQA 5BVEA 4EH8A 2HY81 5M53A 2QLQA 2VZ6A 3GQIA 3GU5A 3OMVA 3PPKA 4LUDA 4WG5A 3ZO3A 3P7AA 4DH7A 3ATTA 5EKNA 4O7SA 5JGBA 2X6EA 3THBA 4FV2A 2O64A 4ZTLA 4DGOA 4ENXA 1WVXA 3HEGA 2W4OA 3GFWA 3QRJA 2VO6A 4W8DA 2ITNA 2XF0A 5HBHA 4AT3A 4QDVA 2IVTA 2WOUA 3F3WA 3LHJA 4I0RA 4ASDA 3FMJA 4R7HA 2XM9A 2Q83A 4NCTC 2Q0BA 3FAAA 3AT2A 4O0WA 2AC5A 4ZLYA 2HENA 4X2NA 3GOPA 4DFZE 4FZ6A 4FNZA 5JGAA 4L67A 2WU6A 2C1BA 2AUHA 2RF9A 4EONA 2GS6A 2X0PA 4AS0A 4DLIA 4E1ZA 2QO2A 4O22A 1IRKA 5J8IA 4PMMA 2R3QA 2Z8CA 1PF8A 2YAKA 5K4JA 2E9NA 4RFMA 3KF4A 4YC8A 4N4SA 3TZ9A 3T9IA 3R7VA 5CEKA 3ORTA 4GYIA 3R9HA 4E93A 3O8TA 3W0NA 5EI8A 4BTMA 3P5JC 3DLSA 3BEGA 4M67A 1DI8A 2CHLA 3MA3A 4FNXA 2ETMA 2A19B 2GMXA 3A7HA 2XANA 5E90A 4AZEA 4PDPA 4JBOA 4CZTA 3AC1A 3SX9A 3S00A 1LP4A 5LARA 3W8LA 1XBCA 2VX1A 3FJQE 4PNKA 3Q32A 5HG7A 4RJ5A 5DEYA 2OBJA 4FSTA 3GC8A 1GZKA 4XBUA 2OWBA 4ZJIA 4EK8A 5LMKA 2BZJA 4KBAA 3VS3A 3F3ZA 5D7AA 1U5RA 2OJIA 2XZSA 3LOKA 3PJ8A 2J4ZA 3FMEA 2Y4IC 2CPKE 2PUUA 4FEXA 3RWPA 3MI9A 4Q9ZA 5AUTA 4GUBA 1ZMUA 5AMNA 1CM8A 2EB2A 2PMIA 3GFEA 3PG1A 2WAJA 1P5EA 3QKKA 5HTIA 3UNJA 2WEVA 4IW0A 5CEQA 3W18A 2OZAB 3ZZEA 2JITA 5AR8A 3RCDA 2W1HA 3GCSA 3PDTA 4MX9A 4M14A 4FG9A 4O81A 3NNUA 3CQEA 4XBRA 3RK7A 4JXFA 5BYYA 4HPTE 5J7HA 1PXKA 4I1ZA 3NW7A 5H3QA 2BROA 4QP2A 3KC3A 4IX4A 4YJPA 4IM3A 5LMAA 2IVSA 2IO6A 3C4CA 3KL8A 3OCTA 4XG7A 4C0TA 2XK4A 3A4OX 3BBWA 4RWJA 4XV3A 3ZFYA 4FKVA 3PUFC 3DZQA 4OGRA 5AR7A 4APPA 1TQIA 5HESA 3OG7A 2ZMDA 3P7CA 3TIYA 3EKKA 4FKSA 5JRQA 3R9RA 1IASA 3HV4A 3V04A 2WU7A 4MWIA 3A7JA 4CFUA 4EHZA 3W1FA 2WMXA 2VV9A 4E73A 1JLUE 2WELA 4IBMA 3Q3BA 3GEQA 1H8FA 1UNLA 4I0TA 3ZFXA 2JC6A 4H58A 1SYKA 1MP8A 3E63A 4O0RA 5HCXA 1UU3A 2I0VA 5HIDA 5I3OA 3SW4A 4JRNA 2F4JA 4CKJA 5KKRC 3MA6A 4O7NA 4L8MA 5EQPA 1WFCA 4MXOA 3QC4A 4O38A 4L3PA 3PSBA 3MJ1A 4GIHA 3NAYA 2O65A 2VWIA 4AU8A 1E1VA 3QRIA 4EOSA 3CEKA 5J9ZA 5JK3A 3W16A 2GFCA 2ACXA 3PXFA 2RSVA 2GNLA 4FIJA 4F9BA 4QQCA 4F9CA 4EHVA 3PA3A 3VUIA 5C4KA 5AAGA 3R30A 2JDVA 4WSQA 4BVUA 1MRUA 5HE3A 5HD4A 3L8VA 4AGUA 1UWHA 3SDJA 2X39A 4RRVA 3HP5A 3OCGA 3NW6A 3L9MA 2XJ1A 2PZIA 3HV5A 2XARA 3AKKA 3BPRA 4AA5A 3S4QA 2BR1A 4R1VA 4ZSGA 3GOKA 1ZZ2A 3NVMB 2G2IA 4A07A 4FYNA 4HVSA 2PVNA 4FSUA 3KULB 3NR9A 4GYGA 5J9YA 3W33A 3NNXA 4JBQA 3U6JA 3SXSA 2H8HA 2G2HA 5AX9A 4A9SA 3D14A 4C57A 4F64A 3KXGA 4GIIA 3DBDA 3MFSA 5D1JA 5IQGA 4QDEA 2Z7QA 4ALVA 1AGWA 3ALNA 4DCEA 5EI2A 4XV2A 3VBQA 5EYDA 2ITZA 3IS5A 5KO1A 5GIOE 2W9ZB 5HQ0A 5KX8A 2OSCA 3FMLA 4U40A 2BHEA 5DYJA 4JAIA 4OAVB 5FBOA 4QMSA 4AW5A 3UE4A 4C4HA 2VTJA 3UZRA 3KRXA 5DT3A 4C38A 5B7VA 1Q8UA 3Q2MA 4WRGA 4EC9A 4E6QA 4ACMA 3GCQA 5AUWA 3LFEA 3R73A 2BUJA 4YZDA 4CNHA 4RA4A 2FUMA 3KB7A 3R2YA 1U54B 4RVKA 1OPLA 5FTOA 2J0IA 4IDVA 4EUUA 4BI2A 4FTJA 1OIRA 3T3UA 4QQ5A 4EOOA 1PKDA 3P08A 4X3FC 2J9MA 3ZDIA 4D58A 3PY0A 5CEPA 1PMUA 2BPMA 5IA2A 3QC9A 4XG9A 2CNVA 2HZ4A 3C9WA 3OY3A 2PVLA 5FLFA 5CAPA 4U41A 3PRIA 4I21A 1BKXA 2V22A 2Y0AA 5L3AA 1XH5A 2JDSA 2XBAA 5CAQA 1H00A 3UC3A 3MW1A 5HTBA 3S2PA 1XR1A 3FSFA 3G90X 3SOCA 5A6NA 4FNYA 2UZVA 4RJ3A 5BVWA 2PL0A 5AR5A 5AR4A 4F1OA 4BZNA 2IZUA 3C4XA 2WTCA 2XK8A 3DJ5A 3QRKA 5E8VA 4BZDA 5KMLA 4Z55A 3DLZA 4F09A 2C6LA 2QOKA 3JS2A 3NFFB 5L8LA 2VUWA 4FKWA 3DAJA 1XMLA 5M06A 4BKZA 3U87A 1Z57A 3KU2A 4QP6A 3FKLA 5I9XA 4R78A 2YIRA 3LXPA 1QCFA 1ZYSA 1G3NA 3Q60A 1YWRA 4CRLA 3ZLXA 5J5TA 1BYGA 5M4FA 4GKHA 2J0MB 5AUXA 3EYGA 4I3ZA 1PMVA 3DBEA 4I93A 5EDPA 2QI8A 4O0XA 2P55A 5BYZA 5FRIA 4Z16A 4NK9A 4LQMA 4O0SA 2YM3A 4YPDA 3UO5A 1UKIA 2OZAA 5HO6A 1KWPA 5C8KA 1O9UA 3NUXA 4G9CA 4IZ7A 1ZYDA 5KE0A 4B7TA 2VWXA 2BALA 5K3YA 1Q3DA 2CLQA 3H9RA 3IW7A 4RC3A 3FZSA 3II5A 4N6YA 4EOJA 5IUHA 3QBNA 2F57A 2J5FA 4AAAA 1QL6A 4GUEA 2YA9A 3VS1A 5IH6A 4C4EA 3RNYA 4LGHA 4XCUA 4F7JA 1XH6A 3NYVA 2ITWA 4OT6A 4CFFA 3FI4A 3P23A 1GIHA 4U7ZA 3P79A 4QT1A 3VAPA 2XVDA 4R5YA 3TJCA 5LWNA 3BZ3A 3TNPC 5IQFA 4NU1A 5HLWA 3W0QA 1OL2A 3I6UA 2ZV7A 3NYXA 3MVMA 3QUEA 4FTUA 4O21A 4AGWA 4C33A 3I79A 2W1EA 4WRSA 2ITQA 4HYIA 3BKBA 4XH6A 4C3RA 4C8BA 2ETKA 3VS4A 4U44A 4BJJB 3BBTB 3P7BA 5TO8A 3EN5A 3W2OA 4I24A 4KB8A 4FKPA 4ZY6A 3W0OA 2GHMA 2OH0E 3BEAA 4NZWB 2VO3A 4FV0A 2HW6A 2HYYA