3FQHA

Crystal structure of spleen tyrosine kinase complexed with a 2-substituted 7-azaindole
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
272
structure length
262
Chain Sequence
VYLDRKLLTLEDKELGTVKKGYYQMKKVVKTVAVKILKPALKDELLAEANVMQQLDNPYIVRMIGICEAESWMLVMEMAELGPLNKYLQQNRHVKDKNIIELVHQVSMGMKYLEESNFVHRDLAARNVLLVTQHYAKISDFGLSKALRADENYYKAQTHGKWPVKWYAPECINYYKFSSKSDVWSFGVLMWEAFSYGQKPYRGMKGSEVTAMLEKGERMGCPAGCPREMYDLMNLCWTYDVENRPGFAAVELRLRNYYYDVV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Tyrosine-protein kinase SYK
publication title Structural insights for design of potent spleen tyrosine kinase inhibitors from crystallographic analysis of three inhibitor complexes.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 92
structure length 262
sequence length 272
chains with identical sequence B
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2009-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3fqhA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3fqhA01
4IMYA 4XP0A 2B9IA 3V3VA 4DEHA 5JEBA 5FDPA 4NKAA 4FEXA 2W1HA 4V04A 2PZ5A 2REIA 3FY2A 4IJ9A 3Q4ZA 4CZUA 4QMLA 4RQKA 4JLCA 3EKNA 2PUUA 4FV6A 5EYDA 3GI3A 3VQUA 2GNFA 2YIYA 3A7HA 1U46A 3D9VA 3QGWA 3FZ1A 1GZ8A 4F64A 2VO3A 3RALA 4GEOA 4B99A 3QD2B 3DAEA 4AAAA 2XBAA 1XO2B 2BILB 4LL5A 3QQHA 5F94A 4F9BA 3LHJA 5CF6A 3V5LA 2XM9A 4EQCA 2VWZA 4A06A 5HCXA 4CT1A 4TN6A 5CAPA 5FWKK 1I44A 4PWNA 4E7WA 3BGZA 3EN5A 5J7HA 3FMJA 2BR1A 4O2ZA 4OTGA 4YJTA 2OO8X 4NM7A 3F3UA 2EVAA 5CU3A 2JDRA 4FKQA 3PVWA 5DRBA 3R9DA 4O22A 3F5GA 2OXYA 1OL7A 4FG7A 5CXHA 2NRUA 3I4BA 4E20A 5CVHA 2B54A 2VTAA 3DJ5A 3LCOA 3OBJA 1XHAA 4FZ6A 4M0YA 4Y46A 4I23A 2R0UA 1BLXA 2UZVA 3ULIA 3VS2A 5TF9A 4KIKB 5BMMA 3KQ7A 3OC1A 3LXLA 2PMIA 4P5QA 5EM7A 3SX9A 3DLZA 4QTDA 3E8CA 3FKOA 2G15A 4CLIA 2VWBA 2YEXA 3VO3A 4FIFA 5ANIA 3F3TA 3WZEA 3FHRA 2C6OA 3HL7A 2W1IA 2YJRA 2WMRA 4RJ4A 1KOAA 3CQWA 2PZRA 3LMGA 5HLWA 2X2LA 2OLCA 2F7EE 4FKOA 2OG8A 3OBGA 3VN9A 3MI9A 3UIBA 1QPJA 4KD1A 2HZ0A 3IS5A 4QTCA 4FZAB 5ANDA 3ZM9A 3JPVA 3BRBA 3DBCA 3I79A 5HCZA 3RNYA 4FTTA 3EB0A 2WELA 3ZO2A 4YZCA 4FVRA 1YDRE 3OWPA 4K11A 3EN9A 1XH9A 2R3OA 5EH0A 2WTKC 4BCKA 5IUGA 4ZSAA 3DFCB 5KHXA 3VF8A 5JZNA 2JDOA 5AFVA 5IQCA 5K5NA 2IW8A 3DDQA 3UNZA 3S1HA 2BRNA 1RE8A 4BCOA 2GDOA 4MNEB 1O6YA 5IMXA 2PVYA 4QP8A 4IBMA 4JR3A 1YXXA 5EW9A 4CQGA 3OCGA 1OKYA 2C6IA 3PP1A 4D2VA 4RA4A 5BX0A 3BX5A 1GZNA 3O23A 4FSZA 2IPXA 4BBMA 5JRQA 2QNJA 5H8BA 2WTJA 3DPKA 5LMAA 4O83A 4I22A 3F7ZA 4UMQA 3AMAA 3H0YA 3RI1A 3ZSGA 4CG9A 3PXQA 5HNBA 2OFUA 3ODZX 4FKSA 2Y4PA 3KU2A 4PP7A 4FSMA 3KCFA 3B8QA 3UGCA 4U8ZA 3UMXA 1YXUA 3CGOA 1PJKA 5AJQA 4IB0A 5IKWA 4I21A 4DFZE 2VTHA 3IW6A 4KNBA 4GKIA 3DBFA 4ZMFA 4K18A 4IVAA 3BEGA 4HYSA 4EHGA 4FV1A 4ACMA 2QD9A 2P0CA 1J3HA 3G6HA 3QD4A 1R1WA 5FLFA 3VUHA 2XEZA 5HX8A 4FTKA 2WMSA 4GFOA 2HY81 4BDGA 3UZRA 4ZTRA 1J7UA 3JVRA 3HV5A 5CANA 1SVEA 5M09A 3G90X 2A27A 4RIWA 3DKCA 4X2NA 5AA8A 3FLNC 4GK2A 3ACJA 5CI6A 3TT0A 4EOLA 3TZ7A 4R78A 5KZ0A 3TJDA 5CAUA 3D5WA 1KE5A 4D5HA 3QRTA 4AW0A 2HW7A 2QKRA 2E9OA 5ACBC 3KEXA 3NEWA 3KREA 2I0EA 5HU9A 4X3JA 2ZVAA 5K4JA 1KE6A 4Z7HA 3V01A 5LWNA 4C02A 1RDQE 2IVSA 3PG3A 3OUKA 2CNVA 1OUYA 2IN6A 2FSLX 3RP9A 4GK3A 3ZLXA 3LZBA 3KVWA 4GIIA 2JDSA 3CIKA 5CEIA 3VC4A 3HUCA 2LAVA 3R9RA 1JLUE 4ALWA 3H9OA 1PKDA 4EK3A 2W7XA 2CNUA 2YDKA 4FVQA 4L67A 4X6QC 3I0OA 4O1OA 4PF4A 1NT2A 1XBCA 4WD5A 2ONLC 4C3RA 1YVJA 3KF7A 2OIBA 3POZA 1L8TA 4BCMA 1GIJA 3F2NA 3LFFA 5ETFA 4MQ2A 1WVYA 2XH5A 4TYGA 5T3QA 4FEVA 4NJ3A 4FNXA 5FXSA 4O7VA 3T3UA 1YDTE 4CT2A 3WZKA 3I6WA 4ARKA 4B0GA 3ATTA 3CGFA 4GKHA 2R64A 2F49A 3MDYA 2EU9A 4EOQA 3ZLWA 4W8DA 2C4GA 4ANQA 4HVGA 4Q2AA 3RAHA 1DI8A 1OGUA 4TT7A 3RK9A 2Y8OA 2W5BA 3IGOA 1F0QA 1YWNA 3M42A 2X81A 4CLJA 2BZHB 3A8XA 4GV1A 5GZAA 2UW3A 5JKGA 2WQNA 3ZM4A 4HGSA 4R8QA 1H0VA 2IVTA 3VS3A 5KE0A 3R9NA 2FA2A 1XWSA 2VNWA 4G17A 2R5TA 3RM7A 5IU2A 3LFBA 4E4NA 3KC3A 4C4GA 2XK7A 5CLPA 4WUNA 4KIOA 4DHFA 4O7LA 2O3PA 4GG7A 4DH8A 1UU9A 2WMVA 4C36A 2VWYA 1REKA 3TJCA 1WBTA 1PF8A 3LVPA 3M1SA 5HLNA 3VHEA 2UW7A 2W05A 1JSVA 3BKBA 4C61A 4MBJA 4QYHA 5KKRB 2VZ6A 5A4QA 2X1NA 2VWUA 2JKKA 4IHPA 3MVJA 3ANQA 5HD4A 3VAPA 2ZV2A 3KXMA 4PMMA 1OL6A 5GNKA 5JQ8A 2FSMX 3V51A 4BCPA 1IEPA 3FZPA 4FYOA 3DK6A 2VTTA 2W1EA 4GS6A 4WG4A 2BMCA 2NPQA 3EQPA 5KHWA 5CX9A 5L8LA 3EQGA 2HYYA 4Y8DA 2WMTA 5F95A 2B0QA 3O2MA 4FE2A 3HP5A 5IQGA 2C0IA 3VBWA 1M17A 3QCQA 5EHOA 4APPA 4O27B 4G3GA 3TKHA 5C4KA 3O8TA 1PY5A 2XF0A 4I5MA 3LKMA 3AC2A 3PFQA 3SVVA 3D7TB 3R7EA 3E7OA 1MUOA 2BHHA 4XG9A 4CKIA 5M08A 1IA9A 1E1VA 4AZSA 4C35A 4RSSA 1F5QA 4WHZA 3FI4A 4BZDA 4RC4A 4M12A 5M53A 3R8MA 4I20A 4MWIA 3QZFA 3ZH8A 3ZO4A 3WYYA 2H34A 4DBXA 4J96A 4WG3A 2ITPA 3K5VA 4L6QA 3QRJA 5DH3A 3LJ0A 1SMHA 3NGAA 4AGCA 4J97A 5HG5A 5DN3A 3HMPA 3GCUA 4FOCA 2E9NA 4IEBA 1W84A 2X6DA 2X9FA 1IR3A 2UZOA 5ETAA 2OJFE 2PVNA 1EH4A 1WBPA 4S2ZA 5LJJA 3P7AA 3QC4A 3TTJA 3RPVA 2ESMA 4GYGA 3TNHA 5FQDC 4NM0A 2DWBA 1L3RE 4RMZA 2QI8A 2Z60A 4F9YA 4JL9A 4FEQA 5JQ5A 5L6WL 2VX0A 3D5VA 3Q9YA 3R01A 4I6QA 3G51A 1H0WA 4U80A 1GOLA 1VYWA 3R28A 4U41A 2YM5A 3RKBA 3ZRLA 3ZXTA 2X0GA 5EDQA 4OGRA 3GNIB 3AXWA 4OTQA 5CU2A 3C7QA 4NM3A 4F9CA 2IW6A 2YCQA 3QTQA 3FJQE 2UZUE 3W10A 4BDIA 3CY2A 2ETKA 2VTRA 3KN5A 3MIYA 3NW6A 3QHRA 4MK0A 4E73A 4UMRA 4KSQA 2R3IA 5M06A 3AC1A 2YIWA 2HWOA 3EH9A 2ZB0A 3DU8A 3GXLA 2WO6A 4O86A 3EIDA 3FQEA 3PVUA 4PV0A 4BDCA 1H26A 3SLSA 2YM6A 2YCFA 4YU2A 5ANOA 3Q6UA 2GU8A 2QOOA 4X3FA 4AGDA 3UBDA 5IDPA 2Z7SA 4FV0A 3WF9A 4LOQA 4C4HA 3ZO3A 4JJRA 1VEBA 3D83A 2UUEA 1TQPA 4O2PA 4PP9A 5ICPA 3L9PA 1BL6A 3AQVA 2J0MB 3GFEA 2BRHA 2X39A 1V0OA 4FA2A 5IUHA 5EM5A 4FZFB 4KRDA 2XZSA 1ZOHA 3WF8A 4U7ZA 5FEDA 4ALUA 2UW4A 4CFVA 4FV2A 2AYPA 4XS2A 2RG6A 4CEGA 1Q8ZA 5EHLA 1LR4A 3MESA 3ZSIA 3PE2A 4H39A 4OTFA 3R7OA 3RK5A 4GW8A 2Q83A 4FZ7A 4TNDA 3THBA 4BN1A 4RVTA 4ZTLA 1YKRA 4BGQA 5KX8A 4YO6A 5D11A 3EOCA 4M69A 2OU7A 4QP2A 4QMSA 1H1RA 4BICA 4EOPA 3UO5A 5LWMA 4ZS4A 2PWLA 3C13A 3A7IA 3Q32A 3KA0A 1S9JA 3KULB 3MY1A 4PDPA 4RFYA 5CS6A 3SKCA 3PJ8A 2UZTA 2JFLA 1QPCA 2WTKB 3ZZEA 5KCVA 1HOWA 2G9XA 3FI3A 5A3XA 2OI4X 2VUWA 4MNFA 1CKJA 5LVMA 4GCJA 1FVVA 1MQBA 4WUAA 4L7SA 2NRYA 3EQCA 3KCKA 4DH3A 3EWHA 4AQCA 4A7CA 1SNXA 2W1FA 3GGFA 4ZSJA 3T9IA 3KK8A 3EHAA 3R1NA 4AX8A 3VBTA 2G2IA 4IAYA 1K2PA 1M52A 3ZBXA 4DGGA 4XLIA 3S0OA 5CEMA 4AFEA 4IC7A 3QQGA 1XBBA 4D0WA 4R6VA 4X7QA 3HKOA 5HVJA 5AP1A 4BCJA 2W4KA 5E9EA 1W83A 3KXXA 3BQCA 4XRLA 3EYGA 3OVVA 3QHWA 3HA6A 3BYUA 4A9YA 2P55A 2F57A 5HKMA 2V5QA 1GIIA 2Z7RA 3DAKA 3BI6A 3EQHA 3FHIA 3H9FA 3NAXA 4D4RA 1H24A 5M4FA 2PZYA 1YI4A 2RSVA 4QYEA 3CPCA 5GIPE 4ZZOA 2J0IA 5DRDA 4AN3A 1P2AA 1H07A 2GS2A 2A2AA 3NAYA 4G2FA 1UKIA 1CDKA 3FMMA 1OPLA 2PYWA 5GIOE 4FSWA 5HIEA 3IQ7A 4C59A 2XJ0A 2OK1A 3HNGA 4NKSA 5GZ8A 4U42A 4L43A 3AD5A 3QTXA 2WMWA 2WMQA 3ROCA 4BKYA 5IQFA 3ZLYA 4ANLA 2WEVA 4IWPA 2CKPA 2Y0AA 5IZFA 5HLPA 3R8LA 4U0IA 5EW8A 3GC0A 3U8WA 2WMUA 5JSMA 1PXOA 2B55A 3LFEA 4XV1A 5J9LA 2BAKA 4AT4A 2A0CX 2QO2A 4DTKA 3NIEA 3UG1A 4EHVA 2DQ7X 2F9GA 5F9EA 3N4TA 1PXMA 3JY0A 5H9BA 1P4OA 2CPKE 2W5AA 3QUEA 3WI6A 2OIQA 4PTEA 1H28A 3BGQA 3GCVA 3PYYA 4GG5A 4RVMA 3AMBA 5EI2A 5CEQA 3HLLA 3Q3BA 3RJCA 3TKUA 5J9YA 3BU3A 4ANSA 2CHLA 2QG5A 4EQMA 3HAVA 3EYHA 1ZYLA 1YI3A 4AE9A 3UJGA 5CNNA 4RQVA 2J5EA 2RFEA 3FMHA 5BUEA 3D4QA 3DDPA 1JAMA 1H1PA 4HPUE 1VJYA 5BMSA 5HIBA 1KWPA 4QT1A 5HG9A 1PXLA 5FD2A 3ELJA 3LOKA 5K0KA 4NYEA 2YZAA 3UIMA 1TKIA 2KULA 1PXJA 2XCHA 3PWYA 3VS5A 3BHVA 3KK9A 2GQSA 3P0MA 3OXIA 2BAQA 2BTRA 5DYJA 4NM5A 4WRSA 2WTCA 1NA7A 4EKKA 4FL2A 4JX7A 1KV2A 1U4DA 2XIYA 4L52A 4M3QA 5IISA 4G3DA 3G0EA 3BE2A 5EM8A 4JIAA 4DGOA 2XRUA 4BI1A 5AP4A 4YTFA 2R3HA 2CMWA 3DB6A 4FKWA 4O7SA 4YZBA 2W0JA 5LCKA 2PVFA 4G9RA 5GJGA 2PMLX 2P3GX 2WQEA 3NCZA 3GQLA 4D4YA 1BL7A 4C2WA 3DB8A 1UWHA 2QLUA 2QO7A 4OBPA 4GJ3A 2ZMCA 1UVRA 3D7ZA 1ZZ2A 3H3CA 3K3IA 2QOCA 1H1WA 4RIYB 5IA3A 4UALA 3WZJA 3ORNA 4G6OA 2YITA 2J7TA 4B4LA 4DINA 4DT8A 1HCLA 3VS1A 1URWA 3AGMA 3DXQA 4GT4A 3ALOA 5E7RA 3OWKA 1UNHA 4XCUA 3WF5A 4B6LA 2YZLA 4JQ8A 4O7ZA 5EK7A 5H8GA 3WIGA 4PDYA 4HZSA 2OBJA 2JGZA 4TWCA 3VUDA 4A9RA 4C4IA 3I6UA 4ENYA 5LVOA 4QMZA 4WO5A 3K2LA 3RCJA 2W5HA 2R3NA 5CVFA 2C6DA 5KNJA 4M84A 2F4JA 3OHTA 5ANGA 4OLIA 2G01A 4EH3A 4P5ZA 4RLLA 4P4CA 1H00A 3FY0A 3ZDUA 3SA0A 2ONLA 4XG3A 2R3FA 3HUBA 3I1AA 4QTAA 5HHWA 4BTMA 3FI2A 4FICA 2A1AB 3JR1A 4YHFA 4X0MA 4TZRA 3U4WA 3R22A 3L9LA 3WOWA 4I24A 2OJJA 4XP2A 3E92A 4PPCA 5B0XA 3RTPA 4CRSA 3LMHA 5GHVA 3FEGA 4II5A 3R2BA 2VU3A 4KKHA 3PTGA 3D14A 3NW7A 3FPMA 5DA3A 3NSZA 4NT4A 3IDPA 4BIDA 2EXCX 5DE2A 2ZMDA 3DNDA 3EMGA 5AP3A 4OTWA 3UP7A 3FKNA 2VTJA 3D94A 3L1SA 5CNOA 1M7NA 3W2SA 3W8LA 5A46A 5FTGA 4BI2A 3PPZA 3QTRA 3QLGA 1ZOEA 3UO4A 4QNYA 5I5ZA 2VO6A 1WVWA 2J5FA 4KRCA 2J90A 2C6MA 3R7IA 1OUKA 1PMUA 4YJUA 4IM0A 4MXYA 4QOXA 2VTNA 5HTIA 1IA8A 2YM8A 2J6MA 3PZEA 2X9EA 4QMMA 5G1XA 4B7TA 3CD8A 4EZ5A 2HZ4A 3E3PA 2HELA 5DGZA 5E8TA 4C3FA 4GL9A 4L01A 4BDEA 3KRLA 5DR2A 3SXSA 3QQKA 2R3MA 3KKVA 2DS1A 3N9XA 2XJ1A 3LXNA 3OY1A 3RZBA 4J8MA 5KMLA 4E4LA 5A9UA 1Q8WA 1ZXEA 2JDTA 1XH5A 2GNJA 2Y6OA 5CZHA 1PYXA 3FXWA 2QONA 2C6LA 3OS3A 5AR7A 1JQHA 1Q61A 3F3VA 3UNJA 5CVGA 2RF9A 1B6CB 3SOAA 2R7IA 2WQMA 3DNEA 5H3QA 4BIEA 3SHEA 4D5KA 1OVEA 1U5RA 2HENA 3ZDIA 2J50A 4O38A 3V6SA 5FP5A 4APCA 4C7TA 4F7NA 5LVPA 1JSTA 3WZDA 1JKKA 3AT4A 1Y6AA 2JEDA 3PUPA 5I9WA 3MGYA 3CSVA 3EQFA 2FVDA 5KMOA 1UNGA 3KY2A 4W4XA 4L00A 1Q3DA 1LP4A 3PDTA 4L3JA 4V0GA 4TXCA 5L2SA 4NW5A 2RL5A 3NNVA 4X2FA 3D2IA 4R5YA 3ZUVA 2YAAA 3FQHA 3DV3A 3EFKA 4FK3A 3WILA 4CZYB 4O81A 3DY7A 3Q60A 3ZOSA 4YC6A 2PVKA 4YC8A 5FP6A 5HI2A 1IAJA 5CTPA 3ZMMA 4Z3VA 3P7BA 4PUZA 2GNLA 4FSTA 1OZ1A 4R3RA 4ZJJA 5A4LA 5CWZA 5A4CA 3TNPC 2WAJA 4ZTMA 4F6WA 4ZTNA 3QU0A 5AV3A 2RIOA 5I9YA 4FTAA 3DZQA 1UWJA 4FT7A 2VGOA 3P79A 4F0IA 3MY0A 3QF9A 4FV9A 2E9VA 3IONA 3FLSA 4GRBA 1MQ4A 3QZGA 3UYSA 4F7SA 2BFXA 1VR2A 4KBCA 4IVCA 3KN6A 2JITA 4JI9A 2YIRA 2PPQA 1PYEA 3IECA 3F66A 4RX5A 5AP2A 3BZ3A 3DXPA 1GNGA 3DQWA 1SM2A 2XIRA 4O84A 3SV0A 1AQ1A 4QP7A 4ANMA 5E1EA 4J71A 2I7QA 5JFSA 2J0LA 5DR9A 4IVBA 2I1MA 4DBNA 4I5HA 3E8EA 4EZ3A 3AG9A 1TQIA 2JFMA 2OXDA 3A61A 3QCSA 4OTRA 2XMYA 5FBNC 4O0VA 3FLYA 2B9HA 3PSCA 4G16A 4QYYA 4XMOA 4QMXA 4M97A 2UVYA 3QRKA 4OT5A 3QTZA 4BDHA 4AZFA 2QG7A 3HYHA 5K0XA 3MBLA 4O0YA 4O6LA 1Y57A 1MRVA 4FT3A 5FEEA 3SG8A 2XK9A 4U81A 5AAEA 2QO9A 2B4SB 3NS9A 4FG9A 1PMNA 4WT6A 3HRBA 3SGCA 2IZTA 1T46A 3QKLA 4ZEGA 2BHEA 3TWJA 3GOKA 1YW2A 2HZIA 2PY3A 4Z55A 4M14A 5LMBA 4A9TA 3SG9A 2IWIA 2VO7A 2JKQA 5JN2A 4LRMA 4L8MA 3IDBA 4ZP5A 5AV1A 2IW9A 3VULA 3RHKA 2HK5A 4LGDA 3KVXA 4F08A 5HE3A 4B8LA 5BVNA 4FV7A 5K4IA 5FTQA 4JQ7A 2P4IA 4S31A 4D2TA 2PMOX 3KXGA 4AN9A 4HYUA 3E5AA 3V6RA 4UMUA 1FMOE 2BPMA 1CTPE 3NRMA 2C5XA 3FZTA 4DEDA 3UPZA 4D9UA 3COIA 5HO6A 4EORA 2WHBA 2IVVA 3UVPA 2GQRA 4D1ZA 3UNKA 3MPAA 3FMDA 5HX6A 4IX6A 4BHNA 3EQRA 4PNIA 3QTIA 5L2TA 4I5CA 5DI1A 4QP4A 4ZTHA 4EC8A 3UIUA 3SW7A 3O96A 3PA4A 2PUPA 3EN6A 4IM2A 4YZNA 4AW2A 3ZU7A 3R7UA 2VX3A 1DM2A 5AUYA 4MHAA 4JBPA 2ITYA 2C5OA 3GC7A 1R3CA 5HZNA 1YOMA 3ZSHA 4EK4A 1FMKA 4RIWB 3GCQA 4GUEA 4M7IA 2R3JA 3NUSA 4FOBA 4DLIA 1XH6A 2E2BA 3NVMB 2XJ2A 4FR4A 2P2IA 5DEWA 4ZY5A 4NCTA 4BCFA 5AA9A 2O2UA 3ORIA 4L45A 4BWPA 4E93A 3VUTA 3NR9A 1T45A 2YERA 2YABA 3LAUA 3AMYA 3CE3A 3QLFA 4I1ZA 3VS4A 4YGAA 2FGIA 4RVLA 4X21A 5EG3A 4AW5A 3DKFA 4C38A 4C37A 1OI9A 4FSQA 5HQ0A 4GFMA 4IADA 3RPSA 3CXWA 1FQ1B 3I7CA 3IO7A 4IACA 4TTHB 4FSNA 4QNAA 4XJ0A 3TN8A 4BDDA 4BDBA 1ZRZA 4ASDA 4PDOA 3IW8A 4PMTA 1ERKA 2JIIA 3HRCA 2V7OA 3A7GA 2Q0BA 4CSVA 2R2PA 3R8ZA 3GOPA 3EZVA 2YWVA 3MWUA 4OW8A 4FIIA 1XKKA 3OXZA 3U9CA 1NW1A 4DFUA 5KMJA 3NUUA 4IDTA 3ZLSA 2GQGA 1REJA 2XKDA 4J52A 1Q99A 3EZRA 3ZEWA 4DT9A 3UMWA 1Q62A 2R9SA 4D28A 2B52A 1OKVA 3QA0A 5DMZA 4D4SA 4EOKA 3RK7A 3VS6A 3Q9ZA 4YJNA 5C27A 3DA6A 3IPHA 2YA9A 1JOWB 4ACDA 3FUPA 1RQQA 1ZYCA 2JLDA 3D5XA 4M0ZA 3RHXA 1DI9A 4DYMA 1M14A 2O8YA 2J4ZA 3ZFYA 4TWPA 2W1ZA 1GY3A 4JQEA 4O7WA 3IDCA 4XP3A 5FXQA 1ZAOA 4E6AA 4Y73A 5B2MA 1SVGA 3A62A 3HMMA 4IB3A 5BPYA 5FG8A 5T6KA 3WF6A 1GAGA 5LXMA 3BYMA 4X2JA 1WBNA 3R21A 3EJ1A 5GINE 4BCNA 1O6KA 3AOXA 3F3WA 3IKAA 3QYZA 4TYJA 3C51A 3VBXA 5A6OA 4DGNA 3UP2A 3EN4A 4O21A 2UZLA 3TNWA 5IQHA 3KXHA 3E7VA 4KIPA 5IQDA 3HDNA 4B8MA 1PXPA 3AGLA 1XBAA 2OZAA 2EB2A 3MB6A 3SRVA 4CGAA 1BI7A 4H1JA 1R0EA 4W9WA 3E93A 3OT3A 4DFBA 4DA5A 3O8PA 2BDJA 5EYCA 2BRGA 4YO4A 2WGJA 2ITUA 4EOMA 2X2MA 5JRSA 4HVDA 4K9YA 2YACA 2QOFA 1KSWA 5AR2A 3TTIA 3P08A 5JZJA 3FMNA 4FC0A 5HVKA 1CMKE 4TNBA 2NO3A 1OPKA 3KRXA 3PY0A 3FSKA 4FT0A 5I9UA 4I3ZA 1Q3WA 2XYUA 3MA6A 4OTHA 4YJSA 5L4QA 3A7JA 5J1VA 4AOTA 2UW0A 3FLQA 1P14A 4FTJA 1JKTA 3LLTA 4BL1A 2W17A 4QMYA 4FNWA 3R7YA 3F5UA 3GC8A 3A4OX 5CYIA 3PIZA 3SXFA 1ZLTA 3V5PA 5J5TA 3KMUA 3II5A 4FSYA 4XYFA 1TQMA 3LXPA 4TWNA 3P9JA 2YAKA 3B2TA 4E5WA 2GFSA 4W8EA 3FQSA 3PIXA 5J95A 4S32A 4C34A 2YDJA 1FGIA 4FMQA 3LJ1A 3PZHA 4YP8A 4EH8A 1B39A 1NVRA 4YJPA 4S33A 2HWPA 4FIEA 3RAWA 5E8UA 4FGRA 4X2KA 3VRYA 3VJOA 4ONAA 2J9MA 3WIKA 2WMBA 3R9OA 4CKRA 2XM8A 2PVLA 5LMKC 3QFVA 2ZM4A 1SNUA 2BALA 1PHKA 2CCHA 2YM3A 3F61A 4O0SA 4WNMA 3UYTA 5EDPA 2I0HA 3F7WA 3PSDA 1Q97A 1XQZA 3LFQA 4OBQA 4PRJA 4AT5A 5FM3A 5KMIA 3G33A 1IG1A 2OIDA 3MFRA 4BCIA 3QTWA 2WTWA 3MPTA 4RJ3A 5FXRA 3D5UA 4RBLA 4DFYA 4FI1A 4MAOA 4MBIA 4IWQA 1XH4A 3BIZA 5KBRA 3TV7A 2V22A 5TR6A 3LQ3A 2V62A 4UYNA 5ETCA 5AUZA 5EYKA 4ZTSA 2G2HA 2VNYA 2QOBA 4H3PA 4A9SA 2HXQA 3CC6A 3DTWA 3MTFA 4QP6A 4FTNA 3PE1A 3P4KA 4RRVA 1ZMUA 3IG7A 2XNBA 3UODA 3VUIA 5CF4A 4PPBA 2XK8A 5IEYA 3UDBA 3ULZA 4EHEA 2ZDTA 4CFUA 3VW8A 4XX9A 1WVXA 4DCAA 1PMVA 4NFNA 3KB7A 3ZBFA 3EKKA 5D12A 4ZSGA 1SYKA 1OITA 5IF1A 2VO0A 4IAAA 3HV3A 3NDMA 3FMEA 3GVUA 3WE4A 2C3KA 2QKWB 3MFUA 4RX7A 3DTCA 5HU3A 3FBVA 3TACA 2XK6A 2G1TA 2PSQA 2VWVA 3OOGA 4LV8A 5KMNA 1SZMA 3GFWA 1FVRA 2WXVA 3DCVA 3FSFA 3I0QA 4FV4A 4J53A 4UBAA 4C0TA 3LQ5A 5JGAA 3S00A 2BRMA 3Q53A 1JNKA 4PTCA 2F7ZE 5IG1A 1QMZA 4J99A 3VF9A 2PE1A 1BMKA 3FMKA 4X3FB 1H08A 2CLQA 3P1AA 4CYJA 4MX9A 4WNKA 5IQAA 4LMUA 5IQEA 4QP1A 4Q5HA 4AS0A 4G5PA 5BYYA 1A9UA 3H9RA 5B2KA 3O71A 4I0RA 4XRJA 4MBLA 3CBLA 4EYJA 1RJBA 4CFXA 4BF2A 4MXAA 5L2WA 4O7TA 3S95A 3NNXA 2X7FA 5LOHA 4U97A 3BYOA 4IX4A 1GIHA 1J7LA 4ERWA 4N0SA 5HD7A 2R3GA 3QRIA 2C30A 2R3LA 3MIAA 4GT5A 1BX6A 3EFWA 5CU4A 3T3VA 3OG7A 1Y6BA 2RFDA 3M2WA 1DAYA 4JX3A 3V8WA 2ITWA 1H27A 4YZDA 4E5BA 3HEGA 2JKMA 2J51A 1QL6A 1J7IA 3QUDA 5AX3A 1OL5A 2UZWE 4BB4A 3WZUA 4R7BA 2C68A 3GCSA 1R39A 4CV8A 4KIQA 1VYZA 4X6RA 4F4PA 3QZHA 3PPKA 4NFMA 4F99A 3FC2A 4F7LA 4ZSEA 3HDMA 4NU1A 1V0BA 3FDNA 2HW6A 4HVHA 4KKGA 2Y9QA 2UVXA 3C4CA 3Q4CA 4KBKA 3NUAA 3U9NA 4LUDA 4GUBA 5DPVA 4PL5A 2QHNA 3A7FA 2UW5A 3FXXA 2WU6A 4RWLA 4RZVA 4OT6A 3MSSA 5DHJA 5H2UA 3CP9A 1R78A 3SAYA 3DBEA 3BQRA 4JDHA 4P7EA 1SVHA 4F9WA 3C50A 4JVGA 2QLQA 3WBLA 3KL8A 4QMPA 2BUJA 3R0TA 4I92A 3F6XA 5C01A 3A99A 4NZWB 3RPRA 5I3RA 4QPMA 1ND4A 4BKZA 2YLEA 3TUCA 4LMNA 3H4JA 3BBWA 4FNYA 4PDSA 3UQCA 3H10A 4JG7A 5CAQA 4EH6A 2VTQA 3W18A 4FKRA 4EWQA 3H30A 2WFYA 3Q96A 3W2OA 3BWFA 4ITIA 4ITJA 1FPUA 4BZOA 2YM4A 3TNQB 4I6FA 2W9FB 2B9FA 4AG8A 4P2KA 1DAWA 4RJ8A 4Y83A 2C6KA 4IANA 3UQGA 5HE2A 2XK4A 4FBXA 4LL0A 3CQUA 2ERZE 3JY9A 5DVRA 1ATPE 4GU9A 5K5XA 4DF3A 1LEWA 2A4LA 4G3CA 3K5UA 1AGWA 2ITVA 4GVAA 4O0TA 3MFSA 4C4EA 5IA4A 4U43A 3AC3A 3DZOA 2BVAA 5CQUA 4UXLA 4I4FA 4DEGA 4ERKA 5KMMA 2XIXA 4YC3A 3L9NA 4JS8A 2XVDA 5BUJA 1H1QA 4FV8A 3ZRMA 4CZTA 5TKDA 4NCTC 3F2RA 4QMWA 1WBVA 5E8XA 4FV3A 2X8DA 4UWBA 5C8KA 4N6YA 2PHKA 3GCPA 3I81A 3MH2A 3FC1X 1HCKA 3FI8A 3TNIA 5IH4A 5DT0A 2BFYA 5M4CA 4Z9LA 2CSNA 3Q2JA 4FKUA 3L8PA 5ETIA 4HCVA 4LI5A 2C5NA 3MH1A 4YPDA 1P5EA 1VZOA 2DUVA 4YTHA 3L8VA 3UIXA 4BKJA 4LQMA 2YM7A 4H36A 4YTCA 4IZ5A 2OICA 3OCSA 4IX5A 5M07A 3HV6A 3V8SA 4EL9A 3D2KA 3EL8A 3L9MA 4M15A 3C4WA 2CGUA 4NH1A 4P90A 1OKWA 2BIKB 4YSJA 2ZB1A 3F2AA 3RNIA 2B9JA 4K8AA 4L42A 3AC4A 4RG0A 2GCDA 5EDRA 5L6PA 2E9PA 3C5IA 4RPVA 5IEXA 4TYHA 4CRLA 4XV2A 5AP0A 3ACKA 4D55A 2YLFA 4A4OA 4R5SA 4BCGA 3RWPA 2Z02A 3TV4A 4BR3A 4FZDB 5CASA 3AD6A 4CV9A 1MP8A 2Y4IC 3CS9A 1A06A 2FSTX 2IO6A 3AC8A 3WF7A 5JGBA 3LM5A 2JC6A 5JFWA 2Z7QA 4L7FA 4ITHA 4CD0A 5ITAA 3N4UA 1STCE 3DJ6A 4QPAA 1W98A 3KXNA 4KB8A 4RIXA 4GVJA 4H1MA 5CT7A 2ETMA 5AX9A 3UVRA 2C6TA 2BCJA 5HO7A 4ZLYA 2GNGA 5AUXA 3LCSA 1WCCA 3R83A 1PW2A 4I94A 3BV2A 4O7YA 4L44A 3PIYA 2BAJA 3PXKA 4IWOA 4Y85A 5E90A 4DCEA 2BIYA 5BVFA 5K9IA 4YMJA 4BWXA 5J1WA 5I9VA 1PXKA 4H05A 1JSUA 4CMTA 4ID7A 4C62A 4ZJVA 4IX3A 3ORXA 5AUVA 3CTHA 4LOPA 4BTFA 3V5TA 5HTCA 3FPQA 4DITA 2XKFA 2GHGA 3HMNA 4G6LA 4AGUA 2WNTA 4XG7A 3ALNA 3ZC5A 4EBWA 1BYGA 3DLSA 3C4FA 4KWPA 4XG6A 4EHZA 4RWJA 3A8WA 3HMIA 3LCTA 3MV5A 4QQ5A 5KZIA 4IIRA 2WEIA 5CU6A 3KFAA 2O5KA 5CI7A 4C58A 2ITXA 4XV9A 2YCRA 2EXEA 4ANBA 5TT7A 4PPAA 5KBQA 3P5KA 2W1GA 5J8IA 2HAKA 4GFGA 4FKVA 1XR1A 3NW5A 2ITOA 3RM6A 2YJSA 4HCTA 2Y6MA 4E4XA 4M67A 3NVKI 1Z57A 3IGGA 5HGIA 3WYXA 1IASA 5CF5A 4NIFA 5IA0A 2JKOA 2UW9A 2XBJA 3O7LB 4FV5A 3V5QA 3QGYA 3SQQA 4AFJA 4B9DA 5DEYA 2VRXA 3BHTA 3KRJA 2OFVA 2OJGA 3UZPA 3WARA 1NXKA 4DEAA 2BKKA 2NP8A 3I7BA 2DYLA 4J95A 4PMPA 4DEEA 3OW4A 4BGGA 4ENXA 4BDJA 5AV4A 4O7NA 2OH0E 5FDXA 1U54A 4MQ1A 3QBNA 1K3AA 3R00A 5E4HA 4MD9E 4DEBA 4JDIA 4R1VA 5GJDA 4HYIA 2IZSA 4BIBA 4ZLZA 4MVFA 4XOYA 3F88A 1PRYA 2WPAA 3GU6A 4I41A 2Q0NA 1OECA 4I4EA 4WSYA 4A4XA 3PY3A 4FL1A 4FTOA 5AUWA 1W7HA 1O6LA 1ZWSA 3MS9A 5D9HA 5FTOA 5LVNA 4QTEA 3E3BX 3KF4A 4D58A 3NNWA 4FTIA 5L3AA 2XKEA 1Y8YA 3PSBA 2HCKA 4FKJA 2CN5A 5I9XA 2I40A 1OL1A 1RW8A 2XRWA 4JBOA 4ZIMA 2R3KA 2ITZA 4CTBA 4Z7GA 3OTVA 3QQLA 4PL4A 4WNPA 2UW8A 3TZ8A 2W9ZB 3UQFA 4BZNA 2PE2A 3HAMA 3QAME 4FTCA 2BDWA 4M8TA 4JG8A 3ZO1A 5HCYA 4YBJA 3QWKA 3TM0A 4OUCA 2WTVA 3F82A 4FTMA 5HBHA 4IAIA 4AZEA 1QPDA 3FZOA 4E3CA 1G8SA 4FKTA 4V0GB 4DLJA 1ZY5A 4EK8A 3Q9XA 3VS7A 5CSPA 4NEUA 4RFZA 5FGKA 3NUPA 5EKOA 3DQXA 5LMKA 4HCUA 3VUGA 4R3PA 5L8KA 3OWLA 4LRJA 4AW1A 4BBEA 1LPUA 1BKXA 3EQBA 4TW9A 1M2RA 3VUMA 3V5WA 1JKSA 3U54A 3RPYA 4ZJIA 2UZNA 3RBWA 2RFNA 2BROA 3NLBA 2IZUA 1OIUA 4OTIA 3W2PA 5L2IA 5EYMA 3LW0A 4DH5A 3GENA 4CFFA 4MD7E 5AV0A 1YXSA 1UKHA 2CKEA 1BUHA 3L8SA 1ZOGA 2AUHA 4JRNA 5KKRC 5GZ9A 4YJOA 1JBPE 4F1TA 2XNGA 4H3BA 4QMTA 5FEQA 4W4WA 3QQJA 4CCBA 5BUIA 4LUEA 1YDSE 5HOAA 4ANOA 3OTUA 4AZVA 2LGCA 1DS5A 4D1SA 3NNUA 3LMIA 3HECA 3QKKA 5AR5A 4IXPA 3NIZA 5E92A 5DOSA 4IFGA 4CFMA 4G31A 5ANEA 3GU7A 1LEZA 4U3ZA 4AA0A 4RJ7A 4AWIA 3C0IA 4JBQA 4F70A 3F3ZA 4FSUA 4TY1A 5HE1A 3A60A 2FYSA 4ACCA 3HV4A 4E6QA 1Q41A 4CCUA 4FEUA 5JK3A 4AP7A 3HX4A 5JGDA 2RGPA 5CSHA 2WTDA 1ZY4A 3BU5A 4DH1A 3CQEA 1PMEA 3PJCA 2I0YA 3TL8A 4C57A 2C47A 3MB7A 5HORA 2CJMA 2PVHA 3DKGA 3KRWA 3DS6A 2JIUA 3Q2MA 3LFAA 2OH4A 4EOJA 4TL0A 3W16A 4RJ5A 1ZMVA 5IH6A 1Q8YA 4KUJA 4KS7A 2VTPA 4BI0A 4ZZMA 2XKCA 3VVHA 4NTTA 4IAFA 4IVDA 4X2GA 3COHA 3M11A 4MCVA 2EXMA 4YNEA 5EM6A 4V05A 2V0DA 3TIZA 3ZRKA 2SRCA 5BNJA 3FXZA 3T8OA 3ZUTA 4YR8A 2W96B 4EUTA 4ASEA 2QC6A 3W1FA 3GT8A 4WKQA 4C4FA 2VTIA 3QXOA 3GEQA 4GT3A 1H1SA 4XG8A 4ZY6A 5BYLA 5FM2A 1MRUA 1OIRA 1Y91A 1FGKA 4S34A 3CTJA 4DFNA 4JAJA 4QMQA 5AEPA 2FH9A 3RPOA 3C4ZA 5T68A 1KOBA 3QXPA 4BFMA 5KO1A 4IE9A 3G2FA 3NX8A 4NTSA 2F2UA 4YHTA 4GH2A 5E1SA 1J1BA 3F69A 4WOVA 3ZZWA 2FB8A 4FT9A 4DTAA 3C0GA 1OBGA 3S3IA 1KE7A 1PXNA 2OF4A 1YHWA 1E9HA 5CU0A 3BELA 4W9XA 5CQWA 2OF2A 4H3QA 3DXNA 4RFMA 4E5AX 2GHMA 3VHKA 1BI8A 2UZEA 4MXXA 3QZIA 3UOHA 3REPA 5DT3A 2XUUA 4D2SA 3LCKA 1WAKA 4YHJA 5DIAA 1JVPP 3OUNB 4L46A 3Q04A 3K3JA 4YJQA 2QURA 4HVSA 4AA5A 1Q4LA 4BCHA 4BYJA 5BQ0A 4DAWA 2X8EA 2VTOA 3KXZA 2IVUA 2QOHA 4RVKA 4CFWA 2CCIA 4O82A 3R02A 4JR7A 4IW0A 2Y7JA 3BLRA 4Q9SA 3RGFA 4BBFA 4QQJA 4U44A 4CXAA 1ZYDA 2C3IB 2GNIA 3FZRA 4QYGA 2NNWB 4FTRA 4IJPA 4YURA 3BYVA 2ZV7A 4W4VA 1OL2A 1OIQA 5A54A 4AT3A 3FLZA 3GP0A 1YXVA 3EN7A 3JUHA 3P78A 2UVZA 4FGBA 2EWAA 4ALVA 1K9AA 1MRYA 1WBWA 4BVUA 2O64A 2VGPA 4HGTA 3R7VA 3E88A 4DH7A 5FUTA 3F5XA 3ETAA 4A9UA 5A4EA 4ZY4A 3PA3A 5A6NA 1P4FA 3QX2A 4YLLA 5HESA 3W2RA 3GU5A 2WOTA 3SC1A 3I60A 5A14A 4BC6A 3IOPA 3RVGA 4F9AA 3HV7A 2ZOQA 3LXKA 3ZCLA 3Q52A 3O17A 2JIVA 2XCKA 4WSQA 3VBQA 4CTCA 1Q8UA 4HVIA 4ZLOA 2CKQA 2ITQA 3POOA 1YXTA 4JDKA 3U6JA 5HIDA 5J9ZA 4QRCA 2BKZA 3NCGA 4EBVA 5E8WA 1NVQA 2PE0A 1H4LA 3CEKA 3R1YA 3UOKA 4C33A 4EOIA 1W82A 4BY9E 2XIKA 5B2LA 4D9TA 1A48A 3VQHA 4YLKA 4IZYA 2X4ZA 3MH3A 3F5PA 2Y4IB 3ENMA 5ANJA 3VBVA 5HBJA 2XEYA 5EQYA 4QQTA 4I5PA 1XJDA 4YNOA 3BCEA 4DC2A 5IA1A 4RIOA 4E1ZA 5AAGA 3OT8A 2WB8A 3PJ2A 4FF8A 3T9TA 4D2PA 4IQ6A 2YHVA 3QD3A 3TV6A 3MY5A 4BCQA 2XNNA 2W1CA 1URCA 4PNKA 3IW7A 5IH5A 3AT3A 3SD0A 4GJ2A 4GSBA 4ZK5A 2OZAB 4MF1A 1E1XA 3SRVB 1GJOA 4ZTQA 2R3PA 1G8AA 2F2CB 4KS8A 3ORKA 4KIKA 1R0PA 4EZ7A 2I0VA 4FG8A 3C4EA 5M57A 1PXIA 3Q5ZA 5E91A 5HBEA 3MA3A 3LQ8A 4RZWA 4MF0A 1U59A 4PL3A 2BDFA 2VV9A 1UU3A 1TVOA 5IQIA 3NMUF 3DGKA 5DR6A 4YUQA 4AGWA 2JAVA 5BVEA 5D41A 2YIXA 3OD6X 5M56A 3KRRA 4DEIA 1NVSA 4UZHA 3PPJA 3R8UA 4QMOA 2PZIA 5HO8A 1H8FA 2QODA 3UO6A 1G3NA 5CXZA 2ERKA 5HEZA 3BYSA 4OAUC 3D0EA 1V1KA 4GU6A 4HNIA 4FODA 3SW4A 3U87A 3OF0A 4GMYA 3U4UA 3ZC6A 4QP3A 4U40A 2OXXA 5AIKA 3EQIA 2W4OA 5E8ZA 4F6SA 5E8SA 4QMUA 4O96A 5C4LA 2QOLA 3E63A 5CAOA 5DNRA 4EOSA 2VWWA 3OWJA 4MNEA 4BDKA 2Z8CA 3DBQA 5AR4A 3G5DA 3QD0A 2R0IA 2WD1A 1APME 2XNEA 1B38A 4KA3A 4XG4A 3GBZA 4NL0A 1Q5KA 2B7AA 4MD8E 3LE6A 4K33A 4KINA 4XV3A 4EH2A 2C0OA 4YZMA 3O50A 3CKWA 5B7VA 4EC9A 4IZAA 4IFCA 5I0BA 3VUKA 3HMOA 4U9AA 4EH7A 4EQUA 2WZJA 3CJGA 5I9ZA 4RX9A 3R1QA 3W33A 5HG8A 2Z7LA 3E87A 3TUBA 3C4XA 3PVGA 3HRFA 4IWDA 5J87A 3A2CA 4EI4A 1X8BA 3CTQA 3MVHA 3PLAE 2C3JA 4UMTA 4AU8A 1FOTA 3FYKX 3C1XA 5D1JA 4PY1A 5F4NA 3V04A 3ZONA 4F7JA 2VTSA 1F3MC 3LCDA 4RGJA 4RWKA 4XHKB 4FT5A 1KE9A 4EH4A 3UOJA 3R1SA 1ZYJA 3OXTA 4U6RA 1UV5A 3N51A 3OW3A 3MN3A 3OZ6A 5IA2A 4HZRA 3COMA 3EL7A 3DFAA 4ORKA 3AD4A 4J98A 5DLSA 3UC3A 3CLYA 5HE0A 3QUPA 2XIZA 4FUYA 2GFCA 3R71A 3PXFA 5CSWA 1XH8A 4UWCA 1Z5MA 1UU7A 3OEZA 3PXRA 4C4JA 3V5JA 4L9IA 4TYIA 3QC9A 4UWYA 3UC4A 5HVYA 4BYIA 4QMNA 2AC5A 4AACA 4JG6A 5HTBA 2WIHA 3S4QA 2PTKA 2B1PA 1Q24A 3QQUA 5EKNA 3U55A 3PXZA 4F1MA 3FV8A 4S30A 2YISA 4J1RA 4KSPA 4WBOA 4IDVA 3ORZA 3RMFA 2ZV9A 3OCTA 3K54A 5BVDA 3Q4TA 4XG2A 3G9NA 5AM7A 4R3CA 3NPCA 4F09A 4YTIA 1PKGA 2C1BA 4Y5QA 3ZEPA 3O8UA 1M2PA 4MXZA 3NYVA 4D2RA 4G3FA 4E6DA 3GC9A 4JRVA 5JT2A 2EUFB 4G9CA 3PG1A 2CGXA 1W8CA 3MH0A 4EUUA 4Y5HA 2H8HA 5EOBA 4YJRA 4IZ7A 2CKOA 3LLAA 2GTMA 4EH9A 4C8BA 2ETRA 5AADA 1S9IA 4AE6A 4KAOA 4HGEA 5I3OA 2ZDUA 5G6VA 1YOJA 3L8XA 4KBAA 4AUAA 4QQCA 1IAHA 4G5JA 2YCSA 3I5NA 3Q4UA 3DT1A 4MYGA 2C69A 3LPBA 4O0WA 4ACGA 5EFQA 2OGVA 1ZYSA 4C3PA 2BZJA 2VWIA 3PY1A 4U79A 3P86A 3NYOA 3RWQA 4Y72A 4CKJA 3FL4A 3OY3A 3HA8A 3JXWA 4MTAA 4DG3E 1J91A 3COKA 3O51A 4YJVA 4EJ7A 5CZIA 5D10A 2PK9A 3ZHPC 1LUFA 4BHZA 4E8AA 3U6HA 5L2QA 3MJ1A 5IPJA 4YBKA 3DKOA 2OWBA 2QCSA 5KMKA 3BBTB 2PULA 4Z16A 2QU6A 2WTIA 4L68A 4IH8A 4D0XA 3F9NA 3OOMA 4HJOA 2OJ9A 5BVKA 5C03A 3U51A 2O65A 1YI6A 2B53A 4RX8A 1JPAA 3ORPA 4YPSA 4FK6A 5AV2A 4IM3A 3VW6A 2QOIA 4M69B 3FZSA 3QALE 4EH5A 2XK3A 2GSFA 4KABA 5CENA 5IA5A 1KV1A 2HZNA 5AM6A 2JAMA 2X2KA 3G15A 1UA2A 4I93A 4AF3A 5CSVA 2VD5A 3O0GA 1AD5A 3QCXA 4K1BA 4CQEA 4EK5A 4EKLA 2JD5A 3R04A 4J8NA 3TDVA 2KTYA 2V7AA 1NY3A 4RLKA 4K6ZA 4FIHA 4MXOA 4A4LA 5CY3A 3TIYA 5IMEA 4FUXA 4O6EA 3QWJA 3D7TA 4O1PA 5BVOA 5TO8A 3FMLA 5DFPA 4DGMA 4RJ6A 4E6CA 3CJFA 3NYNA 2X7OA 4N4SA 2A19B 2HOGA 1UU8A 1WZYA 5IUIA 4BWKA 5A4TA 5C1QB 5J7BA 3CCNA 4CNHA 4UV0A 3GU8A 1J1CA 4MKCA 5HG7A 4PMSA 4CYIA 4UMPA 2VTMA 3QTUA 3LIJA 3S2PA 4LRKA 3RINA 5C8NA 3QL8A 1KE8A 3NUNA 4AA4A 2YWPA 1I09A 5JMSA 3ORLA 5JFVA 4JT3A 4FNZA 4LGGA 5EQPA 3P7CA 3PA5A 2IJMA 3ODYX 3TG1A 1JWHA 2I6LA 4BTKA 1UNLA 4JAIA 2WMAA 4BDAA 2PVJA 3BLHA 3ORTA 2R7BA 3RCDA 2UZDA 4M66A 2QOQA 4TYHB 5EQEA 4NJDA 3RAIA 3EFLA 5AP7A 3TXOA 3GQIA 4LOOA 4I0TA 3E62A 4DE4A 3A4PA 3HP2A 2X7GA 3BHHA 2JBPA 3NUXA 5L8JA 4BDFA 2JDVA 2W1DA 4HPTE 3ZYAA 2WU7A 5M4IA 2CGVA 3R8PA 2XYNA 4N6ZA 4RIXB 1H25A 4JOAA 3R73A 2BRBA 4XLVA 3CR0A 2QVSE 3ZFXA 2ITNA 4ACHA 4F0GA 4RT7A 4FKPA 4OBOA 4GIHA 3C5UA 3E8NA 2FUMA 4Y95A 2H6DA 1ZMWA 4PTGA 5ANKA 3O7LD 5LCJA 2YN8A 3FKLA 3FL5A 2GTNA 4IAZA 5AP6A 3VBYA 3W2QA 2HIWA 3PP0A 1M2QA 5M55A 1H01A 4AZWA 2XB7A 4U45A 1YQJA 4JDJA 2RFSA 5DBXA 4J7BA 1Y8GA 2C6EA 4C2VA 2XNPA 4FTQA 3BEAA 3C0HA 3QX4A 3TEIA 2QR7A 3LJ2A 4M13A 3ZTXA 2OJIA 4XEYA 4AOIA 3ERKA 3TZ9A 3ROYA 4GYIA 5CSXA 2OKRA 3TZMA 3QCYA 1CKIA 4DGLC 4USEA 5IDNA 4FKLA 3QKMA 2XNOA 4PQNA 2BTSA 3D15A 4R1YA 3MJ2A 5H8EA 4QD6A 2GS7A 4IC8A 3W2CA 1YRPA 4ASZA 5EI8A 4WNOA 3PJ1A 1GZOA 2QQ7A 4FX3A 2CLXA 3BE9A 3R30A 1WFCA 2PU8A 4HNFA 3BU6A 4F1OA 3OROA 2GPHA 2ZJWA 3H0ZA 4NK9A 4WA9A 4E26A 3MW1A 4FTLA 2R3QA 4NW6A 3MTLA 5IEVA 3KULA 4O0UA 4ZOGA 5AWMA 4OAVB 2C5YA 3E8DA 5LVLA 4LGHA 5E8VA 4V01A 4WRGA 4AXAA 4NIFB 4D1XA 4QPSA 3PJ3A 3R63A 3JYAA 2XA4A 4DG0E 4FEWA 2HXLA 2PZPA 5BYZA 4QP9A 4FSRA 3VWAA 4O91A 4HYHA 3LFDA 3I5ZA 5M4UA 5L6OA 4TRLA 3KMWA 3ENHA 4IB5A 5AR3A 2ZM1A 1U54B 3DBDA 3LFCA 2WMXA 4ZMEA 3CPBA 2CDZA 1M7QA 3G6GA 4FYNA 5M44A 4G3EA 3ET7A 2PL0A 3P23A 5I4NA 1V0PA 4CMOA 3UVQA 4EK6A 3ZS5A 4UXQA 5E8YA 2R4BA 2JBOA 2FSOX 3TUDA 4UYAA 1W0XC 4EEVA 3TKIA 3PWDA 4I0SA 3EFJA 2UV2A 4TKSA 4XBRA 3R9HA 1YWVA 3QRUA 4LYNA 4BGHA 5J5SA 3FYJX 5BVWA 3NUYA 4H58A 3AC5A 4BTJA 2GMXA 4MXCA 3TI1A 2W99B 5IQBA 2P33A 3TDWA 4G6NA 4I6BA 3BLQA 3OFMA 2ACXA 4JIKA 2QU5A 5EOLA 4L3LA 2PVRA 1CSNA 3GUBA 2AC3A 5AUUA 4G34A 3IOKA 4Q9ZA 5EI6A 5AAFA 4UY9A 2ZAZA 3IW4A 4MEDA 4O7RA 3Q9WA 3KMMA 4OTPA 2OSCA 3BV3A 2PVMA 4ZSLA 3MFTA 4U5JA 4UN0C 3UPXA 4RA5A 5CEPA 2BZKB 4HOKA 4EOOA 4TPTA 3ZUUA 4JNWA 3DK7A 2WIPA 2XS0A 4USFA 3ATSA 5CEOA 2WOUA 2GNHA 1FBNA 1O9UA 2XNMA 4R7HA 2ZYBA 5TE0A 4DTBA 3R6XA 3BGPA 4RC2A 4RC3A 3R2YA 3C9WA 4K77A 3EQDA 4WIHA 2J0KA 2RKUA 3PRFA 4ANNA 3SOCA 1OB3A 5DT4A 4QMVA 4O0RA 2BZIB 2G2FA 2CNQA 3HGKA 3QQFA 3UG2A 5LQFA 2IZRA 2PUIA 4USDA 4CG8A 3R7GA 1CKPA 5C26A 4GK4A 3CY3A 3RZFA 4N57A 4KKEA 4DG2E 3RAKA 2W4JA 3PVBA 1OPJA 3Q5IA 3DK3A 2VWXA 3ITZA 4EWHA 1Z9XA 5DWRA 1WBSA 3JVSA 4IB1A 4F65A 1ZARA 4UEUA 5CALA 1OKZA 1WBOA 3SXRA 4FVPA 1OMWA 2QHMA 4M68A 2E9UA 3W55A 3GU4A 2J2IB 1YHSA 3MYGA 5CT0A 4MH7A 4K0YA 4YLJA 3DOGA 4AZTA 1YHVA 3MPMA 4PX6A 2OW3A 4D4VA 5K3YA 2GHLA 1GZKA 2YDIA 4HGLA 2WQBA 4LV5A 3OEFX 3R8VA 3DJ7A 2CGWA 2VN9A 4XUFA 4ZS0A 4ZAUA 4QYFA 4R77A 3LM0A 4MWHA 4NWMA 3TCPA 1QPEA 3BWJA 4XNEA 2PUNA 3W8QA 5D7AA 2VAGA 1YWRA 4N70A 3KGAA 4Q5EA 4DN5A 2EB3A 5D7VA 2J0JA 2YFXA 5FBOA 4UB7A 4ZZNA 4UZDA 4EYMA 5CEKA 4I6HA 3DAJA 2QR8A 4RIYA 3QA8A 5HNIX 2R3RA 4YZ9A 3SDJA 5KUPA 2H9VA 3UTOA 5GJFA 3UOLA 3B8RA 4TYEA 3VRZA 3V8TA 3WE8A 4FIJA 2Z2WA 4FKGA 2PMNX 1ZZLA 4G1WA 3BHUA 3G0FA 1G5SA 2F7XE 4YSMA 3U6IA 5C8MA 4ASXA 4CVAA 1YOLA 4CMUA 4WBBB 4LFIA 3FE3A 3B2WA 4NUSA 3PLSA 4R7IA 2X8IA 4FL3A 4DFLA 4TWOA 4W4YA 4IAKA 2VX1A 3BHYA 2CN8A 4BRXA 2ZM3A 5CF8A 3FAAA 4LG4A 5F1ZA 1XH7A 4K2RA 4UX9A 2GS6A 5F20A 5FRIA 3QYWA 4JXFA 2WKMA 4DFXE 2C5VA 4D2WA 5JH6A 3NWWA 1FVTA 4FKIA 4FIGA 2O63A 3G9LX 4O0XA 2O0UA 3FWQA 1KUTA 5AMNA 2C3LA 4FTUA 3E64A 5EW3A 2VTLA 4QTBA 4RWIA 3OCBA 3LFNA 4OR5A 3UE4A 4NSTA 3ZXZA 3ID6C 1JKLA 4AOJA 2ZV8A 1FINA 3UZTA 4L3PA 4L53A 2XP2A 2ITTA 4XH6A 1QCFA 4EJNA 4JBVA 1U5QA 4XBUA 2W06A 3VIDA 3PXYA 4F6UA 5CAVA 2OZOA 5LARA 2UW6A 5TOZA 2FO0A 3ORMA 2C0TA 2RG5A 4F0FA 5JFXA 3VJNA 3BPRA 1IRKA 5AIRA 2H96A 4WG5A 3GB2A 4LM5A 5M51A 2C1AA 1OM1A 2YIQA 3CD3A 2HY0A 2IG7A 2V55A 5EHYA 3W32A 1Q8TA 5AR8A 3OP5A 4X3FC 1OIYA 4XOZA 2QOKA 1OBDA 5HICA 2X6EA 4E4MA 4F63A 1WMKA 3CKXA 3Q6WA 4A07A 3LFSA 3ANRA 3NZ0A 3OMVA 4HW7A 4U3YA 3MVLA 5AP5A 3VNTA 3VS0A 3AT2A 3JS2A 3HZTA 2WQOA 3IK3A 4QO9A 3QTSA 5ACKA 2X4FA 5DG5A 3PRIA 1CM8A 4AN2A 2P2HA 3IW5A 4ZXTA 4EONA 3FLWA 5HNGA 4CFNA 4OTDA 2UZBA 3N4VA 5AUTA 5J79A 5C9CA 3HVCA 3NYXA 3ZFMA 3MVMA
chains in the Genus database with same CATH superfamily
4IMYA 4XP0A 2B9IA 3V3VA 4DEHA 5JEBA 5FDPA 4NKAA 4FEXA 2W1HA 4V04A 2PZ5A 2REIA 3FY2A 4IJ9A 3Q4ZA 4CZUA 4QMLA 4RQKA 4JLCA 3EKNA 2PUUA 4FV6A 5EYDA 3GI3A 3VQUA 2GNFA 2YIYA 3A7HA 1U46A 3D9VA 3QGWA 3FZ1A 1GZ8A 4F64A 2VO3A 3RALA 4GEOA 4B99A 3QD2B 3DAEA 4AAAA 2XBAA 1XO2B 2BILB 4LL5A 3QQHA 5F94A 4F9BA 3LHJA 5CF6A 3V5LA 2XM9A 4EQCA 2VWZA 4A06A 5HCXA 4CT1A 4TN6A 5CAPA 5FWKK 1I44A 4PWNA 4E7WA 3BGZA 3EN5A 5J7HA 3FMJA 2BR1A 4O2ZA 4OTGA 4YJTA 2OO8X 4NM7A 3F3UA 2EVAA 5CU3A 2JDRA 4FKQA 3PVWA 5DRBA 3R9DA 4O22A 3F5GA 2OXYA 1OL7A 4FG7A 5CXHA 2NRUA 3I4BA 4E20A 5CVHA 2B54A 2VTAA 3DJ5A 3LCOA 3OBJA 1XHAA 4FZ6A 4M0YA 4Y46A 4I23A 2R0UA 1BLXA 2UZVA 3ULIA 3VS2A 5TF9A 4DDGA 4KIKB 5BMMA 3KQ7A 3OC1A 3LXLA 2PMIA 4P5QA 5EM7A 3SX9A 3DLZA 4QTDA 3E8CA 3FKOA 2G15A 4CLIA 2VWBA 3PFYA 2YEXA 3VO3A 4FIFA 5ANIA 3F3TA 3WZEA 3FHRA 2C6OA 3HL7A 2W1IA 2YJRA 2WMRA 4RJ4A 1KOAA 3CQWA 2PZRA 3LMGA 5HLWA 2X2LA 2OLCA 2F7EE 4FKOA 2OG8A 3OBGA 3VN9A 3MI9A 3UIBA 1QPJA 4KD1A 2HZ0A 3IS5A 4QTCA 4FZAB 5ANDA 3ZM9A 3JPVA 3BRBA 3DBCA 3I79A 5HCZA 3RNYA 4FTTA 3EB0A 2WELA 3ZO2A 4YZCA 4FVRA 1YDRE 3OWPA 4K11A 3EN9A 1XH9A 2R3OA 5EH0A 2WTKC 4BCKA 5IUGA 4ZSAA 3DFCB 5KHXA 3VF8A 5JZNA 2JDOA 5AFVA 5IQCA 5K5NA 2IW8A 3DDQA 3UNZA 3S1HA 2BRNA 1RE8A 4BCOA 2GDOA 4MNEB 1O6YA 5IMXA 2PVYA 4QP8A 4IBMA 4JR3A 1YXXA 5EW9A 4CQGA 3OCGA 1OKYA 2C6IA 3PP1A 4D2VA 4RA4A 5BX0A 3BX5A 1GZNA 3O23A 4FSZA 2IPXA 4BBMA 5JRQA 2QNJA 5H8BA 2WTJA 3DPKA 5LMAA 4O83A 4I22A 3F7ZA 4UMQA 3AMAA 3H0YA 3RI1A 3ZSGA 4CG9A 3PXQA 5HNBA 2OFUA 3ODZX 4FKSA 2Y4PA 3KU2A 4PP7A 4FSMA 3KCFA 3B8QA 3UGCA 4U8ZA 3UMXA 1YXUA 3CGOA 1PJKA 5AJQA 4IB0A 5IKWA 4I21A 4LV7A 4DFZE 2VTHA 3IW6A 4KNBA 4GKIA 3DBFA 4ZMFA 4K18A 4IVAA 3BEGA 4HYSA 4EHGA 4FV1A 4ACMA 2QD9A 2AEGA 2P0CA 1J3HA 3G6HA 3QD4A 4O4EA 1R1WA 5FLFA 3VUHA 2XEZA 5HX8A 4FTKA 2WMSA 4GFOA 2HY81 4BDGA 3UZRA 4ZTRA 1J7UA 3JVRA 3HV5A 5CANA 1SVEA 5M09A 3G90X 2A27A 4RIWA 3DKCA 4X2NA 5AA8A 3FLNC 4GK2A 3ACJA 5CI6A 3TT0A 4EOLA 3TZ7A 4R78A 5KZ0A 3TJDA 5CAUA 3D5WA 1KE5A 4D5HA 3QRTA 4AW0A 2HW7A 2QKRA 2E9OA 5ACBC 3KEXA 3NEWA 3KREA 2I0EA 5HU9A 1TFFA 4X3JA 2ZVAA 5K4JA 1KE6A 4Z7HA 3V01A 5LWNA 4C02A 3W0NA 1RDQE 2IVSA 3PG3A 3OUKA 2CNVA 1OUYA 2IN6A 2FSLX 3RP9A 4GK3A 3ZLXA 3LZBA 3KVWA 4GIIA 2JDSA 3CIKA 5CEIA 1W2FA 3VC4A 3HUCA 2LAVA 3R9RA 1JLUE 4ALWA 3H9OA 1PKDA 4EK3A 2W7XA 2CNUA 2YDKA 4FVQA 4L67A 4X6QC 3I0OA 4O1OA 4PF4A 1NT2A 1XBCA 4WD5A 2ONLC 4C3RA 1YVJA 3KF7A 2OIBA 3POZA 1L8TA 4BCMA 1GIJA 3F2NA 3LFFA 5ETFA 4MQ2A 1WVYA 2XH5A 4TYGA 5T3QA 4FEVA 2X0QA 4NJ3A 4FNXA 5FXSA 4O7VA 3T3UA 1YDTE 4CT2A 3WZKA 3I6WA 4ARKA 4B0GA 3ATTA 3CGFA 4GKHA 2R64A 2F49A 3MDYA 2EU9A 4EOQA 4AXFA 3ZLWA 4W8DA 2C4GA 4ANQA 4HVGA 4Q2AA 3RAHA 1DI8A 1OGUA 4TT7A 3RK9A 2Y8OA 2W5BA 3IGOA 1F0QA 1YWNA 3M42A 2X81A 4CLJA 2BZHB 3A8XA 4GV1A 5GZAA 2UW3A 5JKGA 2WQNA 3ZM4A 4HGSA 4R8QA 2XAOA 1H0VA 2IVTA 3VS3A 5KE0A 3R9NA 2FA2A 1XWSA 2VNWA 4G17A 2R5TA 3RM7A 5IU2A 3LFBA 4E4NA 3KC3A 4C4GA 2XK7A 5CLPA 4WUNA 4KIOA 4DHFA 4O7LA 2O3PA 4GG7A 4DH8A 1UU9A 2WMVA 4C36A 2VWYA 1REKA 3TJCA 1WBTA 1PF8A 3LVPA 3M1SA 5HLNA 3VHEA 2UW7A 2W05A 1JSVA 3BKBA 4C61A 4MBJA 4QYHA 5KKRB 2VZ6A 5A4QA 2X1NA 2VWUA 2JKKA 4IHPA 3MVJA 3ANQA 5HD4A 3VAPA 2ZV2A 3KXMA 4PMMA 1OL6A 5GNKA 5JQ8A 2FSMX 3V51A 4BCPA 1IEPA 3FZPA 4FYOA 3DK6A 2VTTA 2W1EA 4GS6A 4WG4A 2BMCA 2NPQA 3EQPA 5KHWA 5CX9A 5L8LA 3EQGA 2HYYA 4Y8DA 2WMTA 5F95A 2B0QA 3O2MA 4FE2A 3HP5A 5IQGA 2C0IA 3VBWA 1M17A 3QCQA 5EHOA 4APPA 4O27B 2X0OA 4G3GA 3TKHA 5C4KA 3O8TA 1PY5A 2XF0A 4I5MA 3LKMA 3AC2A 4AXCA 3PFQA 3SVVA 1XMMA 3D7TB 3R7EA 3E7OA 1MUOA 2BHHA 4XG9A 4CKIA 5M08A 1IA9A 1E1VA 4AZSA 4C35A 4RSSA 1F5QA 4WHZA 3FI4A 4BZDA 4RC4A 4M12A 5M53A 3R8MA 4I20A 4MWIA 3QZFA 3ZH8A 3ZO4A 3WYYA 2H34A 4DBXA 4J96A 4WG3A 2ITPA 3K5VA 4L6QA 3QRJA 5DH3A 3LJ0A 1SMHA 3NGAA 4AGCA 4J97A 5HG5A 5DN3A 3HMPA 3GCUA 4FOCA 2E9NA 4IEBA 1W84A 2X6DA 2X9FA 1IR3A 2UZOA 5ETAA 2OJFE 2PVNA 1EH4A 1WBPA 4S2ZA 5LJJA 3P7AA 3QC4A 3TTJA 3RPVA 2ESMA 4GYGA 3TNHA 5FQDC 4NM0A 2DWBA 1L3RE 4RMZA 2QI8A 2Z60A 4F9YA 1W2CA 4JL9A 4FEQA 5JQ5A 5L6WL 2VX0A 3D5VA 3Q9YA 3R01A 4I6QA 3G51A 1H0WA 4U80A 1GOLA 1VYWA 3R28A 4U41A 2YM5A 3RKBA 3ZRLA 3ZXTA 4QDEA 2X0GA 5EDQA 4OGRA 3GNIB 3AXWA 4OTQA 5CU2A 3C7QA 4NM3A 4F9CA 2IW6A 2YCQA 3QTQA 3BL7A 3FJQE 2UZUE 3W10A 4BDIA 3CY2A 2ETKA 2VTRA 3KN5A 3MIYA 3NW6A 3QHRA 4MK0A 4E73A 4UMRA 4KSQA 2R3IA 5M06A 3AC1A 2YIWA 2HWOA 3EH9A 4AXDA 2ZB0A 3DU8A 3GXLA 2WO6A 4O86A 3EIDA 3FQEA 3PVUA 4PV0A 4BDCA 1H26A 3SLSA 2YM6A 2YCFA 4YU2A 5ANOA 3Q6UA 2GU8A 2QOOA 4X3FA 4AGDA 3UBDA 5IDPA 2Z7SA 4FV0A 3WF9A 4LOQA 4C4HA 3ZO3A 4JJRA 1VEBA 3D83A 2UUEA 1TQPA 4O2PA 4PP9A 5ICPA 3L9PA 1BL6A 3AQVA 2J0MB 3GFEA 2BRHA 2X39A 1V0OA 4FA2A 5IUHA 5EM5A 4JMQA 4FZFB 4KRDA 2XZSA 1ZOHA 3WF8A 4U7ZA 5FEDA 4ALUA 2UW4A 4CFVA 4FV2A 2AYPA 4XS2A 2RG6A 4CEGA 1Q8ZA 5EHLA 1LR4A 3MESA 3ZSIA 3PE2A 4H39A 4OTFA 3R7OA 3RK5A 4GW8A 2Q83A 4FZ7A 4TNDA 3THBA 4BN1A 4RVTA 4ZTLA 1YKRA 4BGQA 5KX8A 4YO6A 5D11A 3EOCA 4M69A 2OU7A 4QP2A 4QMSA 1H1RA 4BICA 4EOPA 3UO5A 5LWMA 4ZS4A 2PWLA 3C13A 3A7IA 3Q32A 3KA0A 1S9JA 3KULB 3MY1A 4PDPA 4RFYA 5CS6A 3SKCA 3PJ8A 2UZTA 2JFLA 1QPCA 2WTKB 3ZZEA 5KCVA 1HOWA 2G9XA 3FI3A 5A3XA 2OI4X 2VUWA 4MNFA 1CKJA 5LVMA 4GCJA 1FVVA 1MQBA 4WUAA 4L7SA 2NRYA 3EQCA 3KCKA 4DH3A 3EWHA 4AQCA 1G8KA 4A7CA 1SNXA 2W1FA 3GGFA 4ZSJA 3T9IA 3KK8A 3EHAA 3R1NA 4AX8A 3VBTA 2G2IA 4IAYA 1K2PA 1M52A 3ZBXA 4DGGA 4XLIA 3S0OA 5CEMA 4AFEA 4IC7A 3QQGA 1XBBA 4D0WA 4R6VA 4X7QA 3HKOA 5HVJA 5AP1A 4BCJA 2W4KA 5E9EA 1W83A 3KXXA 3BQCA 4XRLA 3EYGA 3OVVA 3QHWA 3HA6A 3BYUA 4A9YA 2P55A 2F57A 5HKMA 2V5QA 1GIIA 2Z7RA 3DAKA 3BI6A 3EQHA 3FHIA 3H9FA 3NAXA 4D4RA 1H24A 5M4FA 2PZYA 1YI4A 2RSVA 4QYEA 3CPCA 5GIPE 4ZZOA 2J0IA 5DRDA 4AN3A 1P2AA 1H07A 2GS2A 2A2AA 3NAYA 4G2FA 1UKIA 1CDKA 3FMMA 1OPLA 2PYWA 5GIOE 4FSWA 5HIEA 3IQ7A 4C59A 2XJ0A 2OK1A 3HNGA 4NKSA 5GZ8A 4U42A 4L43A 3AD5A 3QTXA 2WMWA 2WMQA 3ROCA 4BKYA 5IQFA 3ZLYA 4ANLA 2WEVA 4IWPA 2CKPA 2Y0AA 5IZFA 2NYAA 5HLPA 3R8LA 4U0IA 5EW8A 3GC0A 3U8WA 2WMUA 5JSMA 1PXOA 2B55A 3LFEA 4XV1A 5J9LA 2BAKA 4AT4A 2A0CX 2QO2A 4DTKA 3NIEA 3UG1A 4EHVA 2DQ7X 2F9GA 5F9EA 3N4TA 1PXMA 3JY0A 5H9BA 1P4OA 2CPKE 2W5AA 3QUEA 3WI6A 2OIQA 4PTEA 1H28A 3BGQA 3GCVA 3PYYA 4GG5A 4RVMA 3AMBA 5EI2A 5CEQA 3HLLA 3Q3BA 3RJCA 3TKUA 5J9YA 3BU3A 4ANSA 2CHLA 2QG5A 4EQMA 3HAVA 3EYHA 1ZYLA 1YI3A 4AE9A 3UJGA 5CNNA 4RQVA 2J5EA 2RFEA 3FMHA 5BUEA 3D4QA 3DDPA 1JAMA 1H1PA 4HPUE 1VJYA 5BMSA 5HIBA 1KWPA 4QT1A 5HG9A 1PXLA 5FD2A 3ELJA 3LOKA 5K0KA 4NYEA 2YZAA 3UIMA 1TKIA 2KULA 1PXJA 2XCHA 3PWYA 3VS5A 3BHVA 3KK9A 2GQSA 3P0MA 3OXIA 2BAQA 2BTRA 5DYJA 4NM5A 4WRSA 2WTCA 1NA7A 4EKKA 4FL2A 4JX7A 1KV2A 1U4DA 2XIYA 4L52A 4M3QA 5IISA 4G3DA 3G0EA 3BE2A 5EM8A 4JIAA 4DGOA 2XRUA 3AKJA 4BI1A 5AP4A 4YTFA 2R3HA 2CMWA 3DB6A 4FKWA 4O7SA 4YZBA 2W0JA 5LCKA 2PVFA 4G9RA 5GJGA 2PMLX 2P3GX 2WQEA 3NCZA 3GQLA 4D4YA 1BL7A 4C2WA 3DB8A 1UWHA 2QLUA 2QO7A 4OBPA 1ST0A 4GJ3A 2ZMCA 1UVRA 3D7ZA 1ZZ2A 3H3CA 3K3IA 2QOCA 1H1WA 4RIYB 5IA3A 4UALA 3WZJA 3ORNA 4G6OA 2YITA 2J7TA 4B4LA 4DINA 4DT8A 1HCLA 3VS1A 1URWA 3AGMA 3DXQA 4GT4A 3ALOA 5E7RA 3OWKA 1UNHA 4XCUA 3WF5A 4B6LA 2YZLA 4JQ8A 4O7ZA 5EK7A 5H8GA 3WIGA 4PDYA 4HZSA 2OBJA 2JGZA 4TWCA 3VUDA 4A9RA 4C4IA 3I6UA 4ENYA 5LVOA 4QMZA 4WO5A 3K2LA 3RCJA 2W5HA 2R3NA 5CVFA 2C6DA 5KNJA 4M84A 2F4JA 3OHTA 5ANGA 4OLIA 2G01A 4EH3A 1OGYA 4P5ZA 4RLLA 4P4CA 1H00A 3FY0A 3ZDUA 3SA0A 2ONLA 4XG3A 2R3FA 3HUBA 3I1AA 4QTAA 5HHWA 4BTMA 3FI2A 4FICA 2A1AB 3JR1A 4YHFA 4X0MA 1G8JA 4TZRA 3U4WA 3R22A 3L9LA 3WOWA 4I24A 2OJJA 4XP2A 3E92A 4PPCA 5B0XA 3RTPA 4CRSA 3LMHA 5GHVA 3FEGA 4II5A 3R2BA 2VU3A 4KKHA 3PTGA 3D14A 3NW7A 3FPMA 5DA3A 3NSZA 4NT4A 3IDPA 4BIDA 2EXCX 5DE2A 2ZMDA 3DNDA 3EMGA 5AP3A 4OTWA 4LDTA 3UP7A 3FKNA 2VTJA 3D94A 3L1SA 5CNOA 1M7NA 3W2SA 3W8LA 5A46A 5FTGA 4BI2A 1ST4A 3PPZA 3QTRA 3QLGA 1ZOEA 3UO4A 4QNYA 5I5ZA 2VO6A 1WVWA 2J5FA 4KRCA 2J90A 2C6MA 3R7IA 1OUKA 1PMUA 4YJUA 4IM0A 4MXYA 4QOXA 2VTNA 5HTIA 1IA8A 2YM8A 2J6MA 3PZEA 2X9EA 4QMMA 5G1XA 4B7TA 3CD8A 4EZ5A 2HZ4A 3E3PA 2HELA 5DGZA 5E8TA 4C3FA 4GL9A 4L01A 4BDEA 3KRLA 5DR2A 3SXSA 3QQKA 2R3MA 3KKVA 2DS1A 3N9XA 2XJ1A 3LXNA 3OY1A 3RZBA 4J8MA 5KMLA 4E4LA 5A9UA 1Q8WA 1ZXEA 2JDTA 1XH5A 2GNJA 2Y6OA 5CZHA 1PYXA 3FXWA 2QONA 2C6LA 3OS3A 5AR7A 1JQHA 1Q61A 3F3VA 3UNJA 5CVGA 2RF9A 1B6CB 3SOAA 2R7IA 2WQMA 3DNEA 5H3QA 4BIEA 3W0MA 3SHEA 4D5KA 1OVEA 1U5RA 2HENA 3ZDIA 2J50A 4O38A 3V6SA 5FP5A 4APCA 4C7TA 4F7NA 5LVPA 1JSTA 3WZDA 1JKKA 3AT4A 1Y6AA 2JEDA 3PUPA 5I9WA 3MGYA 3CSVA 3EQFA 2FVDA 5KMOA 1UNGA 3KY2A 4W4XA 3UDZA 4L00A 1Q3DA 1LP4A 3PDTA 4L3JA 4V0GA 4TXCA 5L2SA 4NW5A 2RL5A 3NNVA 4X2FA 3D2IA 4R5YA 3ZUVA 2YAAA 3FQHA 3DV3A 3EFKA 4FK3A 3WILA 4CZYB 4O81A 3DY7A 3Q60A 3ZOSA 4YC6A 2PVKA 4YC8A 5FP6A 5HI2A 1IAJA 5CTPA 3ZMMA 4Z3VA 4QDVA 3P7BA 4PUZA 2GNLA 4FSTA 1OZ1A 4R3RA 4ZJJA 5A4LA 5CWZA 5A4CA 3TNPC 2WAJA 4ZTMA 4F6WA 4ZTNA 3QU0A 5AV3A 2RIOA 5I9YA 4FTAA 3DZQA 1UWJA 4FT7A 2VGOA 3P79A 4F0IA 3MY0A 3QF9A 4FV9A 2E9VA 2A98A 3IONA 3FLSA 4GRBA 1MQ4A 3QZGA 3UYSA 4F7SA 2BFXA 1VR2A 4KBCA 4IVCA 3KN6A 2JITA 4JI9A 2YIRA 2PPQA 1PYEA 3IECA 3F66A 4RX5A 5AP2A 3BZ3A 3DXPA 1GNGA 3DQWA 1SM2A 2XIRA 4O84A 3SV0A 1AQ1A 4QP7A 4ANMA 5E1EA 4J71A 2I7QA 5JFSA 2J0LA 5DR9A 4IVBA 2I1MA 4DBNA 4I5HA 3E8EA 4EZ3A 3AG9A 1TQIA 2JFMA 2OXDA 3A61A 3QCSA 4OTRA 2XMYA 5FBNC 4O0VA 3FLYA 2B9HA 3W0QA 3PSCA 4G16A 4QYYA 4XMOA 4QMXA 4M97A 2UVYA 3QRKA 4OT5A 3QTZA 4BDHA 4AZFA 2QG7A 3HYHA 5K0XA 3MBLA 4O0YA 4O6LA 1Y57A 1MRVA 4FT3A 5FEEA 3SG8A 2XK9A 4U81A 5AAEA 2QO9A 2B4SB 3NS9A 4FG9A 1PMNA 4WT6A 3HRBA 3SGCA 2IZTA 1T46A 3QKLA 4ZEGA 2BHEA 3TWJA 3GOKA 1YW2A 2HZIA 2PY3A 4Z55A 4M14A 5LMBA 4A9TA 3SG9A 2IWIA 2VO7A 2JKQA 5JN2A 4LRMA 4BJJB 4L8MA 3IDBA 4ZP5A 5AV1A 2IW9A 3VULA 3RHKA 2HK5A 4LGDA 3KVXA 4F08A 5HE3A 4B8LA 5BVNA 4FV7A 5K4IA 5FTQA 4JQ7A 2P4IA 4S31A 4D2TA 2PMOX 3KXGA 4AN9A 4HYUA 3E5AA 3V6RA 4UMUA 1FMOE 2BPMA 1CTPE 3NRMA 4AQKA 2C5XA 3FZTA 4DEDA 3UPZA 4D9UA 3COIA 5HO6A 4EORA 2WHBA 2IVVA 3UVPA 2GQRA 4D1ZA 3UNKA 4MUQA 3MPAA 3FMDA 5HX6A 4IX6A 4BHNA 3EQRA 4PNIA 3QTIA 5L2TA 4I5CA 5DI1A 4QP4A 4ZTHA 4AAYA 4EC8A 3UIUA 3SW7A 3O96A 3PA4A 2PUPA 3EN6A 4IM2A 4YZNA 4AW2A 3ZU7A 3R7UA 2VX3A 1DM2A 5AUYA 4MHAA 4JBPA 2ITYA 2C5OA 3GC7A 1R3CA 5HZNA 1YOMA 3ZSHA 4EK4A 1FMKA 4RIWB 3GCQA 4GUEA 4M7IA 2R3JA 3NUSA 4FOBA 4DLIA 1XH6A 2E2BA 3NVMB 2XJ2A 4FR4A 2P2IA 5DEWA 4ZY5A 4NCTA 4BCFA 5AA9A 2O2UA 3ORIA 4L45A 4BWPA 4E93A 3VUTA 3NR9A 1T45A 2YERA 2YABA 3LAUA 3AMYA 3CE3A 3QLFA 4I1ZA 3VS4A 4YGAA 2FGIA 4RVLA 4X21A 5EG3A 4AW5A 3DKFA 4C38A 4C37A 1OI9A 4FSQA 5HQ0A 4GFMA 4IADA 3RPSA 3CXWA 1FQ1B 3I7CA 2XANA 3IO7A 4IACA 4TTHB 4FSNA 4QNAA 4XJ0A 3TN8A 4BDDA 4BDBA 1ZRZA 4ASDA 4PDOA 3IW8A 4PMTA 1ERKA 2JIIA 3HRCA 2V7OA 3A7GA 2Q0BA 4CSVA 2R2PA 3R8ZA 3GOPA 3EZVA 2YWVA 3MWUA 4OW8A 4FIIA 1XKKA 3OXZA 3U9CA 1NW1A 4DFUA 5KMJA 3NUUA 4IDTA 3ZLSA 2GQGA 1REJA 2XKDA 4J52A 1Q99A 3EZRA 3ZEWA 4DT9A 3UMWA 1Q62A 2R9SA 4D28A 2B52A 1OKVA 3QA0A 5DMZA 4D4SA 4EOKA 3RK7A 3VS6A 3Q9ZA 4YJNA 5C27A 3DA6A 3IPHA 2YA9A 1JOWB 4ACDA 3FUPA 1RQQA 1ZYCA 2JLDA 3D5XA 4M0ZA 3RHXA 1DI9A 4DYMA 1M14A 2O8YA 2J4ZA 3ZFYA 4TWPA 2W1ZA 1GY3A 4JQEA 4O7WA 3IDCA 4XP3A 5FXQA 1ZAOA 4E6AA 4Y73A 5B2MA 1SVGA 3A62A 3HMMA 4IB3A 5BPYA 5FG8A 5T6KA 3WF6A 1GAGA 5LXMA 3BYMA 4X2JA 1WBNA 3R21A 3EJ1A 5GINE 4BCNA 1O6KA 3AOXA 3F3WA 3IKAA 3QYZA 4TYJA 3C51A 3VBXA 5A6OA 4DGNA 3UP2A 3EN4A 4O21A 2UZLA 3TNWA 5IQHA 3KXHA 3E7VA 4KIPA 3BL9A 3HDNA 5IQDA 4B8MA 1PXPA 3AGLA 1XBAA 2OZAA 2EB2A 3MB6A 3SRVA 4CGAA 1BI7A 4H1JA 1R0EA 4W9WA 3E93A 3OT3A 4DFBA 4DA5A 3O8PA 2BDJA 5EYCA 2BRGA 4YO4A 2WGJA 2ITUA 4EOMA 2X2MA 5JRSA 4HVDA 4K9YA 2YACA 2QOFA 1KSWA 5AR2A 3TTIA 3P08A 5JZJA 3FMNA 4FC0A 5HVKA 1CMKE 4TNBA 2NO3A 1OPKA 3KRXA 3PY0A 3FSKA 4FT0A 5I9UA 4I3ZA 1Q3WA 2XYUA 3MA6A 4OTHA 4YJSA 5L4QA 3A7JA 5J1VA 4AOTA 2UW0A 3FLQA 1P14A 4FTJA 1JKTA 3LLTA 4BL1A 2W17A 3AKKA 4QMYA 4FNWA 3R7YA 3F5UA 3GC8A 3A4OX 5CYIA 3PIZA 3SXFA 1ZLTA 3V5PA 5J5TA 3KMUA 3II5A 4FSYA 4XYFA 1TQMA 3LXPA 4TWNA 3P9JA 2ZFYA 2YAKA 3B2TA 4E5WA 2GFSA 4W8EA 3FQSA 3PIXA 5J95A 4S32A 4C34A 2YDJA 1FGIA 4FMQA 3LJ1A 3PZHA 4YP8A 4EH8A 1B39A 1NVRA 4YJPA 4S33A 2HWPA 4FIEA 3RAWA 5E8UA 4FGRA 4X2KA 3VRYA 3VJOA 4ONAA 2J9MA 3WIKA 2WMBA 3R9OA 4CKRA 2XM8A 2PVLA 5LMKC 3QFVA 2ZM4A 1SNUA 2BALA 1PHKA 2CCHA 2YM3A 3F61A 4O0SA 4WNMA 3UYTA 5EDPA 2I0HA 3F7WA 3PSDA 1Q97A 1XQZA 3LFQA 4OBQA 4PRJA 4AT5A 5FM3A 5KMIA 3G33A 1IG1A 2OIDA 3MFRA 4BCIA 3QTWA 2WTWA 3MPTA 4RJ3A 5FXRA 3D5UA 4RBLA 4DFYA 4FI1A 4MAOA 4MBIA 4IWQA 1XH4A 3BIZA 5KBRA 3TV7A 2V22A 5TR6A 3LQ3A 2V62A 4UYNA 5ETCA 2XARA 5AUZA 5EYKA 4ZTSA 2G2HA 2VNYA 2QOBA 4H3PA 4A9SA 2HXQA 3CC6A 3DTWA 3MTFA 4QP6A 4FTNA 3O5AA 3PE1A 3P4KA 4RRVA 1ZMUA 3IG7A 2XNBA 3UODA 3VUIA 5CF4A 4PPBA 2XK8A 4AXEA 5IEYA 3UDBA 3ULZA 4EHEA 2ZDTA 4CFUA 3VW8A 4XX9A 1WVXA 4DCAA 1PMVA 4NFNA 3KB7A 3ZBFA 3EKKA 5D12A 4ZSGA 1SYKA 1OITA 5IF1A 2VO0A 4IAAA 3HV3A 3NDMA 3FMEA 3GVUA 3WE4A 2C3KA 2QKWB 3MFUA 4RX7A 3DTCA 5HU3A 3FBVA 3TACA 2XK6A 2G1TA 2PSQA 2VWVA 3OOGA 4LV8A 5KMNA 1SZMA 3GFWA 1FVRA 2WXVA 3DCVA 3FSFA 3I0QA 4FV4A 4J53A 4UBAA 4C0TA 3LQ5A 5JGAA 3S00A 2BRMA 3Q53A 1JNKA 4PTCA 2F7ZE 5IG1A 1QMZA 4J99A 3VF9A 2PE1A 1BMKA 3FMKA 4X3FB 1H08A 2CLQA 3P1AA 4CYJA 4MX9A 4WNKA 5IQAA 4LMUA 5IQEA 4QP1A 4Q5HA 4AS0A 4G5PA 5BYYA 1A9UA 3H9RA 5B2KA 3O71A 4I0RA 4XRJA 4MBLA 3CBLA 4EYJA 1RJBA 4CFXA 4BF2A 4MXAA 5L2WA 4O7TA 3S95A 3NNXA 2X7FA 5LOHA 4U97A 3BYOA 4IX4A 1GIHA 1J7LA 4ERWA 4N0SA 5HD7A 2R3GA 3QRIA 2C30A 2R3LA 3MIAA 4GT5A 1BX6A 3EFWA 5CU4A 3T3VA 3OG7A 1Y6BA 2RFDA 3M2WA 1DAYA 4JX3A 3V8WA 2ITWA 1H27A 4YZDA 4E5BA 3HEGA 2JKMA 2J51A 1QL6A 1J7IA 3QUDA 5AX3A 1OL5A 2UZWE 4BB4A 3WZUA 4R7BA 2C68A 3GCSA 1R39A 4CV8A 4KIQA 3NFFB 1VYZA 4X6RA 4F4PA 3QZHA 3PPKA 4NFMA 4F99A 3FC2A 4F7LA 4ZSEA 3HDMA 4NU1A 1V0BA 3FDNA 2HW6A 4HVHA 4KKGA 2Y9QA 2UVXA 3C4CA 3Q4CA 4KBKA 3NUAA 3U9NA 4LUDA 4GUBA 5DPVA 4PL5A 2QHNA 3A7FA