1SYKA

Crystal structure of e230q mutant of camp-dependent protein kinase reveals unexpected apoenzyme conformation
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
350
structure length
348
Chain Sequence
GNAAAAKKGSEQESVKEFLAKAKEDFLKKWETPSQNTAQLDQFDRIKTLGTGSFGRVMLVKHKESGNHYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMVMEYVAGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGFAKRVKGRTWLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYQMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFATTDWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEEEIRVINEKCGKEFTEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords cAMP-dependent protein kinase, alpha-catalytic subunit
publication title Crystal structure of the E230Q mutant of cAMP-dependent protein kinase reveals an unexpected apoenzyme conformation and an extended N-terminal A helix.
pubmed doi rcsb
source organism Mus musculus
total genus 103
structure length 348
sequence length 350
chains with identical sequence B
ec nomenclature ec 2.7.11.11: cAMP-dependent protein kinase.
pdb deposition date 2004-04-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 1sykA01
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 1sykA02
3Q9ZA 3TDWA 2J51A 2YWPA 1YDRE 3NUYA 4MBIA 3EQFA 3VF8A 4N4SA 2XNOA 2ITQA 4KKEA 2OJ9A 4WRGA 4RWKA 4X7QA 2PK9A 3GU5A 3K2LA 1GZNA 4JRVA 4R5SA 5DR6A 1Q8UA 5F95A 3BKBA 4CMTA 5JMSA 3UP2A 4J8NA 3KKVA 4NH1A 4FT5A 3RALA 5HHWA 3F5GA 5HIBA 4FX3A 4I94A 1DM2A 4MXOA 3BPRA 4IWDA 5CVFA 4QP4A 3QD4A 3PIYA 2ESMA 3RK9A 2O2UA 4OUCA 4LMUA 5CU0A 4OT5A 4R1VA 3GNIB 2C1AA 2PVJA 3GBZA 2J0MB 3LFQA 1RDQE 5DG5A 3WBLA 2BRGA 3U51A 3UE4A 2UW3A 3ORNA 4K18A 3ZLYA 4DGGA 5EW3A 3C5IA 5GJDA 2PMNX 1JAMA 5CASA 4EH8A 3VWAA 1QPEA 5ACBC 4AZEA 4FSMA 3ENMA 5AP1A 4FVQA 4IWPA 1FVRA 4EYJA 4O7YA 5ETIA 5BVFA 3UIUA 5JEBA 5DYJA 3ENHA 2QCSA 2QURA 4H58A 2SRCA 4XS2A 5HIEA 2XNMA 4FR4A 3COMA 4YBKA 2HW7A 5AAFA 4FL3A 4XG6A 2Z7LA 3HEGA 3HUBA 5D9HA 3VS1A 4D0XA 3DV3A 5DT0A 4L67A 1Z5MA 3F3VA 3KF4A 3GB2A 4J97A 5FQDC 1WVYA 5KZ0A 5FUTA 2OF2A 3DB8A 5DT3A 2CGWA 4IAAA 3OF0A 3TJCA 3G6GA 4LGDA 1WBOA 3PJ3A 2QU6A 3R8MA 3R8UA 3GEQA 3K3IA 2W0JA 2B7AA 2XEYA 4XG8A 1U4DA 3KXGA 2HWOA 3BEGA 4JI9A 2IG7A 1E1XA 3ZRMA 4AFEA 4YURA 4AG8A 3RAWA 2B9HA 3KMMA 4IACA 3NNXA 4D2SA 1XH9A 3H9OA 5AX3A 3BGQA 3L8PA 4E4LA 3PXZA 3DBDA 3DBCA 2PUPA 5AJQA 3DKOA 5GINE 4HVDA 3EHAA 3NR9A 3P86A 5EM7A 4WSYA 3LLAA 3CTQA 2ZV7A 3A7HA 3WF8A 4J71A 5IA4A 2NNWB 1P4FA 5JFSA 3IO7A 4ZSLA 5CX9A 3Q9XA 2JIUA 2FVDA 4AZFA 4F9YA 2W06A 3MH1A 3BBTB 3IOPA 3R22A 1ZOGA 2QD9A 2WQOA 2HIWA 1WMKA 3R8PA 4BDCA 2CNUA 4IAIA 3FBVA 4FZDB 1GJOA 2UW0A 5EI2A 3A62A 2J0JA 4HW7A 3EQRA 4MEDA 5E8UA 4O91A 4Y46A 3EQBA 2GQRA 4FG8A 3C0IA 5CZIA 4MHAA 5L3AA 2PMLX 2ZV2A 3BLQA 5E8YA 5G1XA 5I3OA 5L4QA 4EOQA 3IDPA 4FVPA 2CGVA 3NRMA 4FT7A 5E8VA 3ZO3A 1Q62A 2UZNA 3CEKA 4EOKA 2XK7A 4HGLA 4AGDA 4IAKA 2ITZA 4L46A 4M69A 3CJGA 5KNJA 2OXXA 4S2ZA 2VTTA 4MXAA 3TIZA 3KULB 3K5VA 5TF9A 2QNJA 3AT4A 4C62A 5C8KA 4QMNA 3R7YA 3R7EA 4EH2A 4Z7GA 2PVKA 4C4IA 4EHGA 4PTCA 3KMWA 3KK8A 3A2CA 1W83A 4MH7A 5BVWA 2I6LA 3RPYA 4GT5A 3DBQA 5CU6A 3I81A 4GIHA 4K9YA 3BU5A 4RLKA 2Y4IB 1QMZA 2Y0AA 1H1WA 3UBDA 4NYEA 4X21A 3GVUA 4F9WA 3BE2A 1FVTA 1ZYJA 3F2NA 3KCFA 4OT6A 4UMUA 4RWIA 1Q61A 3GQLA 4YMJA 3DLZA 3O17A 4RJ7A 4A06A 4L53A 4ZS4A 5KMMA 2YM7A 4PPAA 3CXWA 5FLFA 1W98A 5HTCA 3RPSA 1K9AA 3CTHA 2GPHA 3R1YA 3IS5A 4GU6A 4TWPA 3H30A 3CD3A 2WU7A 3OROA 4UV0A 3ZFMA 4APPA 4DEIA 4D9UA 4ZZMA 4W8EA 2X8EA 5KHXA 3HVCA 4I4FA 4FSZA 2FB8A 2C3IB 4EHVA 5AR2A 1U5RA 3R8LA 3HA6A 4QMZA 1YXVA 1E9HA 2RG5A 3GCVA 3KGAA 3LXPA 4TL0A 1H24A 4Q5HA 3ET7A 4QTAA 4M0YA 3UVQA 5HX8A 5IEXA 2E9VA 3RPRA 4FG9A 4FVRA 3FC2A 3EJ1A 4HCTA 3FWQA 4KB8A 3F66A 5CXZA 1XH6A 4GCJA 1REKA 2C6OA 1KE9A 2JBPA 2VTAA 2WQBA 4EOMA 2H8HA 2XKFA 1NVSA 1M17A 3TV4A 2G1TA 3KULA 2HY81 1XKKA 2OIQA 3RHXA 2GNGA 3OP5A 2J6MA 3EZRA 4DLIA 4QTCA 5M55A 2EB3A 4OTFA 3G0EA 5IQFA 1YVJA 2C69A 1UNHA 4BWKA 4UALA 3GC7A 4YO4A 1H26A 3Q52A 3ZO2A 4DGNA 2OI4X 4DT9A 4N70A 4RSSA 2P4IA 3L8VA 4EJNA 4TRLA 4RFZA 1ERKA 2OJJA 4FOBA 4YJVA 3V5TA 3NUNA 2ITTA 4IJPA 3GU8A 3QBNA 4G2FA 3WE4A 2A19B 2WU6A 4R6VA 5J7HA 4W4YA 3CE3A 4R5YA 4JS8A 2XYUA 4FV3A 1PXLA 3VS0A 4HPUE 4QP2A 5C1QB 5J5SA 2VWXA 3BHUA 1V0OA 4FGBA 4G6NA 4PQNA 5A6NA 4M15A 2UVYA 3AD4A 5HESA 4ENXA 2C0TA 4XV1A 4MXYA 2VTNA 3NEWA 2H6DA 4U79A 1Y8YA 1ZOHA 4WNOA 3OOMA 4ZTNA 5FXRA 4C3PA 2YJSA 3HMIA 1J1BA 1JSTA 5KBQA 3MA6A 4NIFA 2JFMA 2Q0BA 4JVGA 1OKVA 4NK9A 5DRDA 3EQPA 2BDWA 2VN9A 3JXWA 3VUHA 4L3PA 4D4RA 2YIXA 3HUCA 3QTUA 4I5PA 2BR1A 4HVGA 3VO3A 2XUUA 3EN4A 2IZSA 2J5FA 3FZTA 3DOGA 4HNIA 4UXLA 3BCEA 5J79A 3DQXA 4RLLA 3HP5A 1BUHA 4O6EA 4CZYB 4FKPA 4CFWA 3GFWA 2XBAA 5A6OA 4JIKA 3SAYA 4NT4A 3ZYAA 4IDTA 2KTYA 1ZAOA 4PP9A 1Q41A 4TYGA 4GW8A 2P2IA 3JR1A 1O6LA 1XO2B 3IKAA 3RHKA 5AUXA 5ETFA 2G9XA 3FYKX 2WTDA 4YLKA 5IU2A 2YDIA 3TUBA 3NVMB 5IA1A 3T9IA 3BBWA 3RJCA 3AXWA 3ROYA 1URCA 2UZEA 4QQCA 3FKOA 3GCSA 5AUTA 5KKRB 3DCVA 4FTUA 3LLTA 1G8AA 2W9FB 2YERA 1BX6A 4D28A 4DHFA 1OBDA 3GENA 5AV3A 2X4FA 4IZ7A 4NTSA 2JITA 3RZFA 2E9NA 3UZTA 2GQGA 4XV9A 4LOPA 4RJ8A 4RQKA 3GUBA 3BI6A 2QC6A 2YM5A 4JX3A 3B8RA 4NWMA 4YU2A 3TUDA 1J7UA 1P5EA 4JX7A 2ZDUA 4LV8A 4ZXTA 4USEA 3UQCA 4BCIA 1CDKA 3HAMA 3R2YA 3UNKA 3NUSA 3VW8A 3DA6A 4M8TA 3TNIA 3MVJA 1A06A 1OM1A 3LFNA 3PRIA 3AC5A 2R5TA 3SRVB 4AZVA 4DH8A 3ORIA 5JGBA 4WNMA 4AE9A 4ZLYA 4KAOA 1APME 1S9IA 2NO3A 2UV2A 4K11A 5ANGA 4BDIA 5EM6A 3C1XA 4TYIA 4CEGA 1VR2A 4JIAA 4JQ8A 4HJOA 4AP7A 2VNWA 4AGWA 1GZ8A 1JSUA 3OXIA 2AUHA 3DXPA 3JVRA 1XHAA 3QZGA 3L9PA 4S33A 1M14A 2V55A 4YTHA 2VTJA 5HLPA 4K6ZA 2EXMA 4AUAA 1WBNA 4RA4A 5H3QA 4CFMA 5EYKA 4NEUA 3IGGA 4Y73A 3GU6A 2EB2A 3FXXA 1PHKA 1SVEA 3QTRA 2PZRA 4Q2AA 5L8LA 3E63A 2QR8A 4J95A 3N51A 4IB1A 2ZVAA 3VS4A 5FM2A 3DBFA 5AR3A 4DLJA 3U6HA 5AM6A 5IG1A 2C6KA 3JYAA 2QVSE 2OK1A 4OTHA 3OWJA 3O50A 4FKSA 2JGZA 2IW6A 3QD3A 2PZIA 4FTKA 1YQJA 4O0RA 4YSMA 4DEAA 4EEVA 3TKIA 3D83A 2CGUA 3EQHA 2V5QA 3NUUA 4U0IA 5DBXA 4MBLA 2XK8A 4BBMA 3LXLA 5FDXA 1J91A 3A61A 3DQWA 4DH3A 3RK5A 5LJJA 4JBQA 2R3FA 2Z7QA 2CKEA 2ITVA 5HVKA 2CJMA 3PP0A 3NUXA 3NDMA 5JT2A 4XOZA 3DS6A 3FMLA 5BVDA 4AXAA 3D5WA 5CU4A 4G3EA 3ORMA 3SRVA 5M09A 4L7FA 4JG8A 4PMSA 3LCTA 2B54A 5CZHA 2OJGA 1URWA 2IZUA 3RM7A 2OFUA 2JIIA 3WF6A 3AG9A 5AM7A 4XP3A 3FMNA 3H3CA 2HELA 3I5ZA 4XNEA 3ZBFA 3TG1A 1PF8A 2OLCA 4Y95A 3VC4A 2EWAA 5IQCA 4UY9A 5IDPA 4O6LA 5AUYA 5LVNA 2VWUA 4RT7A 4HVSA 1YKRA 3LHJA 5EKOA 3SXSA 4RA5A 5A4QA 1IR3A 4X2FA 3V04A 4O0TA 4ERWA 3UIBA 4ORKA 1RQQA 2O8YA 3QQFA 4RZWA 4B0GA 1PXPA 4HYUA 4OTDA 5DRBA 4EH6A 5IUIA 3NCGA 3VUMA 3F7WA 5BVEA 4KSQA 2R3IA 3O96A 2ITUA 2F7ZE 3QQHA 3EL8A 5EM5A 1FGIA 4WSQA 3HP2A 2BVAA 2Z8CA 4I3ZA 5AV1A 2WMRA 4IZAA 3FZRA 4IAYA 2OIDA 3FMEA 3UIMA 4CKRA 1P2AA 5DE2A 3HRFA 2XM8A 1K3AA 4F9CA 5EI8A 4CYJA 4ZTLA 2PPQA 3COIA 2GDOA 4EK8A 5TT7A 3LZBA 2GNFA 3CJFA 1JKTA 3MA3A 3PXRA 3O7LD 3WYYA 5ICPA 2XMYA 4KRDA 4WA9A 5CEQA 4DCEA 1W7HA 5HVJA 4G17A 3FQSA 4BC6A 2YM4A 3R01A 2VWIA 3TNPC 3LQ8A 4QMLA 5IPJA 4MAOA 3PY3A 3F3UA 3SD0A 3KL8A 1BL7A 4AN9A 4DAWA 3RP9A 4DBXA 4ZP5A 3TWJA 3QHWA 3JVSA 2GTNA 1JQHA 3EOCA 3Q5ZA 4K2RA 2RL5A 3C51A 4FKTA 3LFDA 3Q60A 3FDNA 2ZJWA 3QALE 2XJ2A 3IW8A 5FEQA 4OTRA 1KE5A 4I6BA 3QXOA 5C4LA 1J1CA 2ITOA 3GC0A 3OOGA 4FKLA 2YIWA 1YI6A 2J2IB 1JKSA 5JFVA 2B0QA 3A7FA 4AGCA 3QD2B 5BVOA 3HMMA 3PJCA 2W99B 2VO7A 4WRSA 4CV8A 4TT7A 2C5XA 1H4LA 4FNXA 1OVEA 1ATPE 1ZOEA 4QP6A 3UO6A 4F1TA 3QD0A 5ANOA 4FZFB 4TWCA 4V04A 4CKIA 2OJIA 3GGFA 3VUTA 2X2KA 3G2FA 1YWNA 3ZLXA 3ZRKA 4ANSA 3EWHA 4FKRA 4U44A 3HV5A 3WOWA 2V7AA 4EK5A 3BLRA 3ZEPA 3RGFA 2B9IA 4RQVA 4LOOA 2BFYA 2YM8A 4FIJA 4GYGA 4QP9A 2BHHA 1H8FA 1T45A 3QHRA 5HNBA 3PE1A 3FMDA 3O8UA 4Q9SA 4P5QA 4XP2A 4ZLOA 2C5YA 3OCTA 4XOYA 5CF4A 2XF0A 1H1SA 1QPDA 1SNXA 4MCVA 1EH4A 4J1RA 5J7BA 3H10A 4FZ7A 3SDJA 5EOLA 1OIYA 4P5ZA 4QMWA 2BZIB 1B6CB 5DI1A 3C4XA 5HU3A 2XK6A 4RVLA 5FXQA 5JGAA 5FWKK 4CQEA 3Q96A 3ZZEA 4RJ4A 1XQZA 4TKSA 4ERKA 3PWDA 5GIOE 5ACKA 2R7IA 4C37A 1UU8A 3VS3A 2BRMA 5CVHA 3F5PA 3FUPA 3IGOA 3ORKA 2QU5A 4YJUA 1G3NA 1JPAA 2UVXA 4YZCA 5F9EA 2Y4PA 3WF7A 2YABA 1TQMA 4C4HA 4BDJA 3VHKA 4CGAA 1B38A 4GK3A 5GZ8A 5JKGA 2QKRA 2XIZA 5I9UA 2B55A 4I22A 2OXYA 3DY7A 1PXIA 3KB7A 4FYOA 3PJ1A 4UZHA 3I7CA 3EMGA 3F3ZA 4GRBA 2ETKA 3IQ7A 4AZTA 4CZUA 1UU3A 3FLNC 4EKLA 3HX4A 5HG9A 4N0SA 4S34A 3UNJA 1Q5KA 4BYIA 3NAXA 4QQTA 4M12A 3H9RA 4TN6A 3S00A 4GKIA 2X0GA 4I6HA 4TTHB 3B2TA 5CS6A 4FL1A 3NUPA 5AP6A 3FMKA 2PVNA 3R04A 4DYMA 4RX8A 5EM8A 3G0FA 4LV5A 4K33A 4AN2A 4NJDA 4I5CA 3QZHA 3UQGA 4IB5A 4U97A 2QO7A 3VUDA 1ZYDA 4QNAA 4WHZA 3PA4A 2I0VA 3SX9A 4J7BA 1Q8YA 2B4SB 2X8DA 3Q4CA 5CWZA 5AA9A 2VGPA 4AA5A 4U9AA 2PZYA 2WQEA 3UOJA 1KV1A 2OFVA 5KMNA 3GOKA 4ONAA 5BMSA 5DWRA 3D0EA 2VO0A 1OUYA 4W9XA 5J9YA 2ZAZA 2BRHA 5D7VA 5M56A 5CALA 1TQIA 2Y7JA 4QP8A 4KIKB 1XJDA 3HDNA 4XJ0A 1U54A 4JBOA 4BYJA 4MF1A 2UZTA 1SM2A 4NM0A 3W2CA 4A7CA 1OMWA 3PXKA 1GIJA 2JFLA 3VQUA 2YAKA 3EN9A 5I9XA 5HO7A 5BYLA 3QTWA 2XBJA 4RGJA 3KXNA 4FSTA 5DMZA 3GP0A 5IQAA 4RJ3A 3W8QA 3EN6A 3L8XA 3MPMA 3FYJX 5T6KA 5BYYA 3LW0A 1WBSA 5DGZA 3MTFA 4GJ2A 4JQ7A 3TI1A 4Y5HA 4C58A 4D4SA 2J7TA 1NY3A 4ZMFA 3IECA 4ITHA 1M52A 5I4NA 4YTIA 3QRIA 3ZSIA 2BIYA 3RBWA 2R7BA 3HAVA 4JBPA 5AR5A 2VUWA 3UVRA 5E8WA 4GT3A 3OW3A 2WIPA 2YFXA 4FTMA 4X2KA 2Z02A 4PL4A 4JG7A 4CZTA 4KUJA 2XP2A 1GY3A 4O7VA 4ZTMA 3BX5A 4O7WA 2XK9A 4JDIA 4O0UA 3DTCA 3QGYA 4RFMA 3RNIA 2IO6A 2Y8OA 3EYGA 5A54A 3IDBA 2OW3A 3F5XA 4GSBA 3MYGA 2OICA 4XG7A 5DVRA 3R7GA 3OCGA 3R83A 4LUDA 1OL2A 2ACXA 4HCUA 4AT3A 4R77A 4KINA 4D1SA 4OBPA 1GAGA 4E8AA 5EQYA 5FEEA 5B0XA 4DFXE 5FBNC 1OL6A 5IUHA 5EQPA 3DBEA 3A99A 3QTQA 1H1PA 2DYLA 5E9EA 4DG3E 3MPTA 5CSPA 2C3KA 2YISA 3VRZA 3PXFA 2UZBA 2GS7A 1OL1A 5HE3A 3ZSHA 1KSWA 1PMUA 3FHRA 2CKOA 2KULA 3P9JA 3VS2A 3O71A 2W1IA 3MY5A 3N9XA 2R3MA 1PMNA 4GUBA 3LQ5A 3TEIA 3WZUA 4DT8A 5CAVA 4FSNA 3V5QA 3EN5A 3MFSA 3NMUF 3UNZA 3DZQA 4IBMA 3THBA 3VUIA 4JT3A 4JQEA 3SG8A 5FGKA 5I0BA 1MRYA 3PUPA 4FEXA 4IB3A 4WKQA 2XA4A 2X2MA 2R0IA 3DDQA 3HDMA 4QYYA 5E91A 4RIYA 5D10A 4RJ5A 1PYEA 4I92A 5ANDA 5HORA 5BMMA 3UO4A 5L8KA 3NUAA 3BGPA 1WBTA 4IC7A 2F49A 3QRUA 3AD6A 2JEDA 2ONLC 3NNWA 1ZMWA 3U4UA 4E93A 3TZ7A 2XKCA 5LOHA 3C13A 4TXCA 4LUEA 4OBQA 4DFLA 2WNTA 3KVWA 4O0VA 3AGLA 1YI4A 3CKWA 2WQMA 3PVWA 4RVTA 4WNPA 1J7LA 3MGYA 1XWSA 3R7OA 5J9LA 5EOBA 3UOHA 4IAFA 2R3RA 4F6WA 2A1AB 3MW1A 3ORZA 3RVGA 2CNQA 3QTSA 4II5A 2UZDA 3MH0A 2J0LA 4FEUA 2W1HA 3MESA 4DTAA 3TNQB 3HMPA 3I60A 1SZMA 3ZDUA 3KQ7A 4EZ5A 3QUDA 4U41A 4CMOA 3BYUA 4KBAA 4UZDA 5AP4A 3VNTA 2GMXA 3FSFA 4RC3A 4H39A 2A4LA 5A3XA 4C0TA 5JZJA 5K5NA 2OIBA 2VWYA 4NKSA 5J1VA 2O63A 4HZRA 3LQ3A 3OCBA 3SGCA 5M06A 3QQLA 4OBOA 4QYHA 4ZJIA 2YZAA 1U46A 4O0SA 3ERKA 4USDA 2PVLA 4UWYA 1OIQA 3RTPA 2VWVA 2FH9A 1NVRA 2BZJA 4E5WA 2YWVA 3VS6A 4FTRA 3Q32A 3E7OA 4AW5A 4N6YA 2WTKB 4NFNA 1ZXEA 2VWBA 1H0WA 3I4BA 2YAAA 2RFEA 2VTHA 3ZOSA 5KZIA 4BKJA 3ALNA 3NIZA 4IVCA 4JDHA 4YHTA 3ZO1A 2ZM3A 4FA2A 1OKWA 1IAHA 1YXTA 4HGTA 5HG8A 4DTBA 4H1MA 3P4KA 3HZTA 3ROCA 4CG8A 4KNBA 4MQ2A 4M69B 3FI4A 2UW7A 4YZBA 3FE3A 3QQKA 1OUKA 5TE0A 4I6QA 4L42A 4G6LA 4F65A 2ITXA 4IM0A 3CQEA 3NAYA 2RIOA 2C30A 4BBFA 4QMOA 3CQUA 5HKMA 4E4MA 4CFUA 4O7RA 3U6IA 3VN9A 4QQ5A 2ITYA 2ZM4A 1Y8GA 2JDRA 2QO9A 2BALA 3BQRA 3Q4UA 2F9GA 4ZSEA 4J52A 3W2OA 5LVMA 1XH5A 3AC8A 3ITZA 4FV7A 4K1BA 1YHWA 4Y5QA 2UZLA 2WGJA 1I44A 4YPDA 5EDQA 2UZVA 4IE9A 4CFVA 3QKLA 3FL5A 1WVWA 3BLHA 4B8LA 5JN2A 3A7IA 3NSZA 4FTJA 3RAIA 3VJNA 5A14A 4BY9E 1Y91A 4BI1A 3F2AA 4W4WA 2BTSA 3D5XA 3PA5A 2BILB 3ALOA 2QOBA 4YLLA 5KMIA 4RFYA 4WT6A 3C50A 2HOGA 5LXMA 4F7NA 3WZDA 3CPBA 2WTWA 3CTJA 5JQ5A 4FSUA 1YDTE 3OC1A 3U6JA 5JFXA 2YDJA 5M08A 3OG7A 3BV2A 4OGRA 4XG2A 4IVAA 4I24A 5FBOA 4M7IA 4NFMA 3REPA 3U4WA 3KMUA 4DEGA 1MQ4A 4XLVA 4C34A 3RNYA 2GS6A 1UWJA 4U80A 3LJ2A 4FTNA 2ZDTA 3LVPA 1Y6BA 2X4ZA 5GNKA 1CSNA 3D9VA 4FBXA 4IW0A 3R73A 4X6RA 3KEXA 4YJNA 4K77A 4A9YA 4DA5A 4C4EA 4BF2A 3OWLA 4WG5A 1P4OA 3AOXA 3FQEA 2XNPA 4DGLC 1REJA 3DAJA 2XVDA 3P7AA 4YUQA 3C4FA 4G9CA 3W2PA 4M13A 2PHKA 5A4EA 3SHEA 4RG0A 2EVAA 3EQCA 3P0MA 4ZTQA 1JOWB 4LL5A 4AQCA 2QLUA 1GNGA 5HU9A 3ZM4A 3N4TA 4XV2A 3LFBA 3P78A 3CLYA 1FINA 4FUXA 4HCVA 4IANA 4PL3A 4ZOGA 5E8ZA 1RW8A 4H3PA 4PWNA 1Q8TA 4DITA 4JL9A 1TQPA 4IADA 2Y6MA 4MWIA 4BTFA 4GJ3A 2V7OA 4S32A 1PYXA 2QOKA 3PA3A 4GK4A 4ACGA 2GNLA 4DH1A 3OXZA 4EOPA 5JH6A 2IPXA 3TDVA 3ETAA 3F69A 2I0EA 4BDEA 1JVPP 4NKAA 3ORPA 4IXPA 4AA0A 4F7JA 4BIEA 3GQIA 4QTDA 4BHZA 1PKGA 3GFEA 4EH9A 4O0YA 1UV5A 2AC3A 2WMQA 1OPLA 2UZOA 3EFLA 3U54A 2E2BA 4NIFB 4J53A 5EDPA 5EW9A 4O7LA 3F3TA 1KOAA 1Z9XA 4WBOA 4C2VA 4ID7A 3L9LA 2W1GA 2Q0NA 4MQ1A 4BTKA 3RWQA 3OVVA 5AUWA 4QMVA 3AMYA 4BZNA 4YBJA 4A9SA 2CN5A 3B2WA 4GT4A 2P2HA 3NZ0A 5LMBA 1L8TA 4L45A 4EOSA 4DFNA 3KA0A 3ZUUA 3E62A 3UPZA 3P23A 4E6QA 3VULA 4I0RA 1YXUA 2J9MA 2W4KA 3SOAA 3OZ6A 2XZSA 5FP5A 1Q24A 4LMNA 5CEPA 2NRUA 5CANA 4O82A 4C7TA 1DI9A 3ZC6A 4ZZNA 4C4GA 3R7UA 2B53A 3EKKA 5IEVA 3RPVA 4FUYA 4EJ7A 3NYOA 2YCQA 2QOHA 4QO9A 5H9BA 3MVHA 2QHNA 5LCJA 2OG8A 2XRWA 3A7JA 3QWJA 3W2RA 5KCVA 3PG1A 4LQMA 4QP1A 5ANEA 4BIBA 4X3FC 4YC8A 5CTPA 3ATTA 4NM5A 4QPSA 2X6DA 4RC4A 3ORLA 4I1ZA 3E3BX 4BDGA 3NWWA 3OT8A 1RJBA 4GH2A 3PFQA 1YI3A 5L6OA 3PXYA 4YZ9A 4H05A 1M7NA 2W5BA 3PTGA 3QQJA 4F09A 3M1SA 3EKNA 3MS9A 4NCTC 5BYZA 2J90A 5HI2A 5FDPA 3FLQA 2CNVA 2IZTA 3BE9A 5EHLA 3LKMA 2BRBA 1PW2A 2W1EA 5DIAA 4ZSAA 1S9JA 1T46A 4M67A 4W9WA 5HICA 2HWPA 3QWKA 4F4PA 1UKHA 4CTCA 3ZLSA 5EW8A 4PMPA 5F1ZA 2CCHA 1B39A 4HZSA 4O7ZA 3KN5A 3FMHA 3OW4A 1XH7A 4IJ9A 1OKYA 3DU8A 2C6MA 1OECA 4UWCA 4BCJA 3HMOA 5C8NA 4BGHA 4EOOA 3CY3A 4O21A 3CP9A 5IZFA 3UG1A 2W4JA 4FSWA 2R3KA 4QMSA 4CCUA 2UW8A 3DGKA 4Y72A 4RIXA 3R7VA 3TCPA 3A8WA 3V01A 4BICA 5DFPA 2G2HA 5CF8A 2R4BA 3UVPA 1Y6AA 4M84A 4YJTA 3WF5A 5C26A 2GNHA 4FKJA 2VX0A 3EFKA 2G15A 3CGFA 4YC6A 5AA8A 2WFYA 3WIKA 3FZ1A 2YIRA 4ZIMA 4BL1A 4JAIA 3MJ1A 2HW6A 4EK4A 5HE1A 2VWWA 4RPVA 5HLWA 3W1FA 5ETAA 2XKEA 2H9VA 4GVJA 2YCRA 2BRNA 1A48A 3LE6A 4FT0A 5TKDA 2QLQA 3C0HA 2WEVA 3QX4A 5FTQA 4HGEA 2VRXA 5C01A 3RAKA 4ZTSA 2B9FA 4BCGA 3G9NA 5M57A 3ZFYA 4MNFA 3ZRLA 3HA8A 2IWIA 4GKHA 4AW1A 4EI4A 3VAPA 4WNKA 5J95A 3TZMA 2IVVA 4W4VA 3E7VA 4UX9A 2GQSA 3ZDIA 4QYGA 1WVXA 3D7TB 4IFGA 3BEAA 4C35A 5CF6A 2BKZA 4DH7A 3HYHA 3FY0A 5E1EA 3F6XA 3FZOA 4QPAA 2YDKA 4L3JA 1NW1A 3LCOA 4O96A 4LGGA 3KRRA 4IWOA 4P90A 4I41A 2BAJA 2WB8A 1VYZA 3QXPA 4IHPA 2BPMA 3KU2A 3VS7A 4AF3A 4ANBA 1JBPE 3CGOA 3NW5A 2WOUA 4IDVA 1UA2A 2HY0A 5L2TA 3COKA 4EZ7A 4BWPA 2XB7A 3E64A 3TXOA 4C38A 4H3QA 3KXXA 3MY0A 3Q53A 4GS6A 3MI9A 2C0IA 5EH0A 4ZY4A 4MXXA 4LL0A 3PJ8A 4CNHA 3G33A 5E92A 3HKOA 2C3LA 2YIYA 5B2LA 5CLPA 5DEYA 2HENA 2WMWA 4X2JA 3R9DA 4BVUA 3PZEA 3OUKA 1NA7A 3KC3A 3QGWA 5IA5A 3RCDA 3P7CA 4ACDA 4F7LA 5GZAA 3ZM9A 4PMMA 1QCFA 4ZS0A 4QMQA 3BYSA 5I5ZA 4PRJA 2BIKB 2W17A 3UO5A 3AMBA 1JKKA 2BCJA 4LGHA 3ATSA 1O6YA 2R3HA 1UNGA 1IA8A 2Z7SA 3LFSA 3D15A 3WILA 4DFYA 3I5NA 5LMKC 4E5BA 3Q5IA 4NW5A 3E8DA 2CLQA 1PXOA 3D7TA 2Y9QA 1M7QA 3RCJA 4QNYA 4ZTRA 1BMKA 1PMEA 3O23A 2BUJA 3LOKA 4QRCA 4RJ6A 5H8EA 4E5AX 2BKKA 4X0MA 2FYSA 5CNNA 3NYNA 1FMKA 4EONA 2QONA 4OAUC 2RFNA 2W05A 4EOLA 5L2IA 3F88A 1MUOA 3BZ3A 2HK5A 4ZEGA 1H08A 1CTPE 1O6KA 2VWZA 4G5JA 5HGIA 2VO6A 5AUUA 2CDZA 1Q3DA 2P55A 4U40A 2ZYBA 4NW6A 4D1ZA 4EH5A 4FV2A 2HCKA 4AOIA 2XIKA 1V1KA 5HNGA 2PULA 4IC8A 2QOIA 4C3FA 1KV2A 3S0OA 1U59A 4R8QA 4UYAA 5A4CA 5I3RA 2YN8A 2FSLX 5I9YA 2QODA 4FEVA 4EWQA 1KOBA 2GS2A 3CKXA 3BIZA 3QKKA 4X2GA 4AE6A 4FEWA 5IKWA 5FXSA 4NU1A 1STCE 1OKZA 5CAOA 3AT3A 4U43A 5DOSA 4L44A 3R71A 3BELA 5GZ9A 2NRYA 5EYCA 2VNYA 2NPQA 3DPKA 5AEPA 5L6WL 3ORTA 2X81A 1JSVA 4G3GA 1H01A 4JRNA 4XX9A 2Z7RA 3U9CA 5E4HA 1LR4A 3PSCA 1Q8WA 4U3YA 4C59A 5A46A 5AV4A 4FMQA 2ITNA 3EQIA 3UMWA 4E6CA 2FSOX 2XKDA 3KXZA 4JNWA 4EORA 2RFSA 2YIQA 5LQFA 3PXQA 4YZNA 1GZKA 4KIQA 4FKQA 5DR9A 4HPTE 4MTAA 4TYHA 1DAYA 4IQ6A 3QQUA 3H0ZA 4YNEA 1SNUA 4QMPA 4BN1A 4C8BA 2GTMA 5IDNA 4DCAA 3GXLA 3Q2JA 4IH8A 5EI6A 4D2WA 4JJRA 3MB6A 5HTIA 5HG7A 3TN8A 1FVVA 2ZV8A 2XIXA 4BRXA 4FNYA 3SW4A 3F5UA 4J99A 2BZKB 5KX8A 3V51A 5KHWA 2XIYA 3DNDA 5HIDA 4NCTA 2E9UA 4QMMA 2ETRA 4D2RA 3ZTXA 1R78A 4O84A 2J0IA 1Q8ZA 5DH3A 3Q6UA 3V5JA 2IW9A 2W1ZA 5DNRA 2XM9A 5DN3A 3BRBA 4U7ZA 2YZLA 3G90X 4UB7A 5CSWA 3QA0A 4ZAUA 1ZRZA 2RFDA 3I79A 1PKDA 3QUEA 5E8TA 4EQMA 3IPHA 1SYKA 5KUPA 4F99A 1ZY4A 4FZAB 3IW7A 3QTIA 5E8SA 2IVTA 2P3GX 5DPVA 2ZM1A 3DDPA 4Y85A 5F20A 5HVYA 4E6DA 4BDFA 3O7LB 3NNUA 5DT4A 4KWPA 2WIHA 2C6LA 5HOAA 4DG0E 2O65A 3DXQA 3FQHA 4YP8A 4PMTA 4RVKA 1LEZA 2OF4A 2JBOA 3O51A 3P1AA 4FE2A 5HD4A 3HV4A 4GFOA 2W4OA 1OPKA 1L3RE 3P5KA 5AMNA 5M4IA 5KMLA 2QOFA 2W1DA 3RWPA 1ZY5A 1NXKA 3CQWA 4EWHA 4RMZA 2DS1A 5L2QA 2PU8A 4YR8A 2PY3A 4UMTA 2R3LA 3IG7A 3AD5A 5ANJA 3UODA 3W18A 3UC3A 4XV3A 3ZXZA 1JNKA 2BAQA 4AGUA 1IA9A 4ANLA 2WMUA 4RIWA 3IK3A 5M4UA 3O8TA 1CKIA 3SA0A 1U54B 1LEWA 3R1NA 2FUMA 5T3QA 4ACCA 2ZB1A 3MY1A 2J0KA 3TKHA 2QR7A 4ACMA 2EU9A 2WO6A 3PVUA 1G5SA 3PRFA 3HMNA 5CENA 3CD8A 5F94A 2W1FA 2YA9A 3R9NA 3BU3A 5K5XA 2HZNA 4BDHA 3FHIA 5LCKA 1P14A 4WUNA 5KO1A 2R3JA 3MFTA 2WD1A 4M14A 4PDSA 4P7EA 4FTIA 5B2MA 5E90A 3R00A 2P33A 3KRWA 4E26A 4AFJA 3TKUA 2FGIA 2ERZE 4TW9A 2LAVA 3C9WA 3VHEA 5AX9A 4YNOA 2VTMA 4W4XA 2BHEA 3FZPA 3FPQA 3BHVA 4DGOA 5IA0A 3SLSA 4ANOA 5LVOA 1J7IA 4G5PA 3G5DA 5CXHA 3DKFA 3QC4A 1UU7A 5EKNA 2YEXA 4N57A 1H28A 3VBQA 5CYIA 3ZUVA 2XH5A 4RX7A 5E1SA 5FP6A 3QRKA 2UW4A 5IF1A 3WIGA 3MN3A 3TIYA 4KBKA 4MYGA 3QFVA 1PXMA 1GOLA 3QC9A 4FGRA 1R1WA 2UZWE 4QOXA 3VBYA 3KREA 4D4YA 4LRMA 5HQ0A 4BCOA 5JGDA 4J8MA 2JAVA 2JKKA 4D2PA 4AAAA 5LMKA 1W84A 3MIYA 5IQGA 1R3CA 3V8TA 5AUZA 3H9FA 3D14A 4YZMA 4UYNA 4F0FA 4Z3VA 1OBGA 1ZMVA 3WI6A 3L1SA 3TNWA 5J5TA 3E87A 3KRJA 3FJQE 4CT2A 4BCKA 2W1CA 4YSJA 5CAPA 1OIRA 4G16A 1SVGA 3W8LA 3NYVA 1MQBA 4JXFA 4O27B 4A4XA 4GU9A 2ZV9A 3DNEA 4F6SA 3LCKA 3S3IA 4WD5A 2WXVA 4AS0A 2C3JA 3C5UA 5AR4A 4F7SA 3I1AA 4YHJA 3JPVA 4R78A 2Y6OA 5AR8A 4UEUA 3LMIA 1H1QA 3R7IA 4AT5A 4RIYB 3W2QA 5CT7A 4O2ZA 3R02A 4KA3A 4EHZA 5HZNA 5K0XA 3ORXA 3OCSA 4D4VA 3WF9A 4F70A 3QZFA 2UW5A 3H0YA 2RG6A 2BZHB 2PVYA 3BHYA 1Q3WA 2C5NA 1JLUE 4F1OA 4NZWB 5IQHA 4V0GB 2YACA 2YCFA 3QZIA 4DBNA 4L68A 4O83A 2VTOA 3POZA 5BUEA 3QUPA 3W10A 1NT2A 4PDYA 4DEBA 4XCUA 5M51A 2JDTA 2CCIA 2UW9A 4ALWA 4AU8A 3FLYA 1PRYA 3II5A 2C4GA 4BI0A 4O7NA 2ZB0A 2H34A 5GJGA 3C4ZA 3TV6A 5L2SA 4I6FA 3ZCLA 2JD5A 1R0PA 2I7QA 4UN0C 5AIRA 2G2IA 3KFAA 3QF9A 2IVSA 4WO5A 4PY1A 2WMXA 4MD8E 5FTGA 3ACKA 2CN8A 3DK7A 3LCDA 4RRVA 2I0YA 2PVFA 3A8XA 4AOJA 5IH6A 4X6QC 3KF7A 5D41A 4XG3A 2VTIA 3ODZX 2OBJA 1H07A 2Z60A 2YM6A 3DZOA 1Q4LA 4IX4A 3LPBA 2PWLA 4QQJA 3EZVA 1KE7A 2R3QA 3GCQA 2XK3A 3NCZA 5DA3A 5CEKA 1TKIA 3DB6A 3SV0A 2XJ1A 3PP1A 1F3MC 3QYZA 4E73A 4XBRA 4CYIA 1CKJA 4B6LA 5H8GA 4AZSA 3LXNA 4XG9A 4DFUA 3U55A 3M2WA 4WBBB 4ANNA 2XS0A 4O2PA 2C1BA 3OT3A 4V0GA 1UVRA 5EHYA 3LXKA 1BKXA 2WMBA 3Q3BA 1G8SA 3V5LA 3MFRA 1UU9A 2QG5A 3IW4A 2R3PA 3AQVA 4CT1A 3ODYX 5JK3A 2Y4IC 4MF0A 4IAZA 5HNIX 3DK3A 3FY2A 4G6OA 2XNEA 4IEBA 4AX8A 5ANKA 4ITJA 5CEIA 3RAHA 3DJ5A 2ITWA 4MD7E 1W82A 2PZ5A 2OGVA 3RM6A 4OTGA 5J9ZA 2JKMA 1YHSA 5IQEA 3FKNA 4H36A 5C03A 3KXMA 3NYXA 5L6PA 3SG9A 2W5HA 3QCQA 4HVHA 3U87A 1FPUA 2XCKA 2QOOA 2OU7A 3SKCA 4R3CA 3UJGA 4ALVA 4B4LA 3DAEA 5LWMA 2UUEA 4CFFA 2OXDA 4R7IA 3V8SA 2PUUA 4JBVA 5A4LA 2ITPA 5BQ0A 3OBGA 1Y57A 3ZONA 4A9RA 1OI9A 4EH3A 4O81A 4PV0A 4DG2E 1UKIA 3SC1A 3IW5A 3LFAA 3ULZA 1BL6A 3SXFA 3VUGA 4LM5A 5JZNA 5I9WA 4EC9A 5HTBA 4O7SA 2C68A 1ZWSA 3TNHA 3WZKA 4TY1A 4KRCA 4Y8DA 5D7AA 3JS2A 3K3JA 3I7BA 4O0WA 4PTGA 2VU3A 4YGAA 2YM3A 4ZTHA 2OKRA 4ZJJA 4J98A 3T8OA 4FTQA 2OZOA 5BUJA 3FI3A 4CQGA 1YXXA 2C0OA 2HAKA 4QMXA 3ZEWA 4EYMA 1OL7A 3R2BA 3DK6A 5CT0A 3G51A 4Z16A 5HCYA 3U9NA 3FV8A 3MTLA 4D2TA 4BCPA 1Z57A 3T9TA 4O7TA 1JWHA 5GIPE 3OMVA 2I1MA 5JQ8A 2O0UA 3NW7A 1VEBA 3QAME 3FAAA 3ZLWA 4RX9A 3LFFA 5G6VA 3WARA 4JG6A 2B1PA 4ALUA 5AP3A 3P7BA 3LFCA 4A07A 3G6HA 5M4CA 2PYWA 1R0EA 4E4NA 3KXHA 2BROA 4FTCA 4YJPA 4YJRA 3EB0A 2WMSA 4FKGA 3UMXA 1YDSE 3KRXA 3IONA 1WZYA 3E8EA 3EQGA 1FMOE 5LVPA 3GC8A 3DJ6A 4XEYA 5C27A 2VAGA 3ANQA 4FTAA 3ID6C 4BDDA 2IZRA 2BAKA 3ZUTA 4E3CA 3LAUA 4L7SA 4ZSJA 3UZRA 2QG7A 4FIEA 3ZHPC 2BFXA 4CRLA 1H1RA 3Q9YA 3Q6WA 3E5AA 1LPUA 4IM2A 5F4NA 4E6AA 5EFQA 2C6IA 2OJFE 3PWYA 4G34A 3BWJA 3ELJA 5M07A 3HGKA 4JLCA 5CQWA 3LMHA 4BZOA 3FLZA 3O0GA 4GV1A 4MK0A 3NVKI 4KS7A 5AAGA 3QU0A 5EHOA 3I0OA 4AZWA 5CAUA 3SW7A 4JDKA 2WTIA 3BV3A 1YXSA 2FSTX 4QT1A 3NGAA 4CG9A 5IQDA 2UW6A 3OWKA 1H25A 4OTQA 4FSRA 5FEDA 4CVAA 2X39A 2X8IA 3OXTA 2G01A 2VZ6A 4GK2A 3UYSA 4FKUA 4PNKA 4L3LA 3QCXA 4PDOA 2CMWA 4BCFA 4J96A 4ARKA 3TTIA 4C4FA 3B8QA 1ZLTA 4UMQA 5ETCA 3FLSA 2PE0A 2YCSA 2XIRA 4QP3A 3PYYA 2PE1A 4ACHA 3BGZA 4IZYA 4RVMA 4ASDA 3CC6A 3QLFA 4IX5A 5CSHA 4Z9LA 2WMAA 5HLNA 4GG5A 5GHVA 4C61A 5KKRC 1V0BA 3QRJA 3W33A 5CI6A 3EIDA 4D9TA 3FZSA 1KE8A 3FL4A 4AACA 1YOLA 1M2PA 3BU6A 3FXZA 3R9RA 2XYNA 4B7TA 4NUSA 5JFWA 1UWHA 4DE4A 1XBAA 3V5WA 4V01A 4C57A 3OTUA 5IH5A 4ENYA 3O2MA 4DN5A 3IOKA 1I09A 4TZRA 2RF9A 4E20A 4KS8A 4AW2A 4D5HA 2WAJA 4WIHA 1OL5A 5L8JA 3LIJA 2QOQA 4FV1A 3QTXA 4IM3A 2JDVA 4UXQA 3ZFXA 4FC0A 3E8NA 4UMRA 3R30A 3EFJA 3BWFA 3A7GA 1UNLA 1CKPA 4XHKB 2W7XA 3W2SA 4GYIA 3NIEA 3I6UA 1H27A 4XG4A 1MRUA 4TPTA 5JRSA 4L6QA 4PNIA 4WUAA 5IUGA 3KY2A 5ITAA 3KCKA 4BWXA 2OZAB 2V0DA 3D94A 3DJ7A 3PSBA 2R3GA 4BTJA 4HNFA 4GUEA 4IB0A 5H2UA 5DR2A 4U8ZA 4XH6A 4B99A 2VGOA 4IIRA 4YZDA 3FEGA 2LGCA 3QTZA 3VS5A 5CI7A 1VJYA 4XP0A 4RIXB 5B7VA 1SMHA 3ZU7A 5EYMA 4G3FA 4P4CA 4CXAA 1O9UA 1ZZLA 4WG4A 2H96A 4BZDA 2ONLA 3UTOA 4UBAA 2O5KA 3UOLA 4FV4A 2GNJA 3C4WA 3HV3A 4F0GA 3D5UA 1WBWA 3SVVA 3M42A 4U42A 2A27A 1JKLA 1A9UA 3PLSA 4E4XA 3QKMA 3WYXA 4GL9A 1Q97A 4DH5A 3S2PA 2BMCA 2XEZA 4MX9A 2PVHA 3LMGA 1OB3A 2HXQA 3S4QA 2VTLA 3EN7A 4FIGA 4G9RA 3ZS5A 2CSNA 1OIUA 4G1WA 4PF4A 2XJ0A 4Z55A 1AQ1A 5LMAA 3MV5A 2WELA 3WE8A 4XMOA 4BB4A 4IZ5A 4HVIA 2QO2A 4OTPA 4D55A 4O86A 4ZY6A 1AD5A 1GIHA 2AC5A 3CIKA 3RKBA 4KKGA 1DAWA 5AUVA 2X7OA 3HRCA 4FIHA 2AYPA 5HEZA 3GC9A 2JKQA 4KKHA 2GFCA 4CTBA 3JUHA 3QX2A 1XH8A 3PG3A 2GU8A 4XRJA 4CCBA 3V3VA 3SOCA 2OZAA 4KIPA 5CU3A 4ZZOA 4EQUA 2RSVA 4OLIA 2HXLA 1DS5A 3AGMA 3MVMA 1YWVA 3A60A 5FD2A 4YTFA 3N4UA 4DF3A 2R2PA 3HNGA 4XUFA 4PPCA 3S1HA 2CKQA 3MH3A 3CS9A 4QYFA 3QQGA 4HGSA 3TM0A 4EC8A 1WCCA 3MBLA 5EYDA 4BI2A 4LRKA 1U5QA 4APCA 3HECA 5T68A 2ZOQA 4C2WA 2UZUE 4H3BA 4BFMA 5A4TA 1H00A 3RMFA 1IRKA 1V0PA 4Y83A 5FTOA 4FK6A 3PIXA 4CKJA 4X2NA 5M4FA 1CMKE 2J4ZA 3MB7A 1NVQA 2EUFB 4QTEA 4I21A 2GHMA 2VTSA 2C5VA 2YJRA 4ANQA 2W96B 4FF8A 3OY1A 3SQQA 3HRBA 3KRLA 4NSTA 5AV0A 5CSXA 2JKOA 3TV7A 3BHHA 4CFXA 4G31A 2B9JA 3SXRA 2PE2A 4M0ZA 4A9UA 4FL2A 3T3UA 2V62A 4FYNA 2I0HA 1F0QA 4WG3A 1GIIA 5J1WA 3MFUA 4GMYA 4HYIA 2OWBA 2X7FA 4I5MA 5HBHA 3OWPA 4G3DA 5I9ZA 3PY1A 3VJOA 2QHMA 4BCQA 3D2IA 3I0QA 3LJ1A 5IQIA 4OTIA 4ASXA 5J87A 5IA2A 1QPJA 4F08A 4PL5A 2PZPA 2RGPA 5HX6A 2JIVA 4YPSA 5C9CA 4BDBA 3D2KA 5DHJA 5AR7A 3P08A 4EH4A 4O0XA 3TZ9A 4DFBA 2CLXA 3PVGA 3DXNA 3KVXA 3E88A 5KMKA 5HO6A 4XYFA 2R3OA 5BVKA 2ZMDA 1HOWA 2PMIA 3C7QA 4IMYA 4FTLA 5KBRA 3PSDA 2F7EE 3L8SA 2XNBA 4TYEA 2F57A 1BYGA 2VO3A 3GU4A 3AC3A 5IH4A 3IW6A 4QP7A 4FKVA 5CVGA 4IX6A 1MP8A 3VBWA 5IMXA 2HZ0A 2XRUA 3EFWA 1VYWA 3PIZA 2O3PA 4FV6A 5HE0A 3EYHA 4OW8A 1WBVA 2X6EA 1HCKA 5AP7A 4DEEA 1LUFA 5HG5A 3D7ZA 5DEWA 4L8MA 3RINA 3ZBXA 4KBCA 3FI8A 1OPJA 1PXNA 3HL7A 4S30A 1AGWA 4ZMEA 3PLAE 4WOVA 5EDRA 3AC2A 2DUVA 2HYYA 4NM7A 3UPXA 4E1ZA 4DC2A 3LCSA 3QA8A 3PE2A 4Z7HA 5JRQA 4TYJA 1K2PA 4YJOA 5J8IA 1W0XC 4RX5A 4FZ6A 3OEFX 4G3CA 4KIOA 4ZLZA 3OBJA 5BNJA 2XK4A 2J50A 4CV9A 4FKWA 3DTWA 4R3PA 3F7ZA 4MVFA 3EL7A 4C02A 3VVHA 4M97A 2PTKA 2B52A 4AN3A 5A9UA 4D1XA 4AOTA 3DFCB 4FKOA 4K8AA 3F3WA 4U81A 2UVZA 2XNGA 2X7GA 4I93A 2DWBA 5KE0A 4TYHB 4C36A 2A2AA 4JR3A 4X3FB 2PMOX 4DEDA 5HBEA 3V6RA 4FNWA 4FG7A 4JAJA 1ZYCA 2IN6A 4IFCA 4IVBA 4ASEA 4EK6A 4FT3A 2WTCA 3CCNA 4CSVA 1LP4A 4L9IA 3AT2A 4ZSGA 4YHFA 4H1JA 3HLLA 3NNVA 5AP0A 3OEZA 2EXCX 4CRSA 2R64A 5BUIA 4JOAA 3F82A 3HV6A 3FMJA 3S95A 2NP8A 4BGGA 4BGQA 4PX6A 2PSQA 5BX0A 3LJ0A 3KK9A 2QQ7A 1H0VA 3CY2A 5CF5A 2Q83A 3ZMMA 2VD5A 4EHEA 5DLSA 4U45A 5CU2A 5E7RA 4TNBA 4DTKA 2X2LA 3TTJA 3LM0A 5JSMA 4V05A 3MSSA 3PVBA 4N6ZA 2CKPA 3JY9A 3LM5A 4AW0A 4O1PA 5D12A 1YHVA 4CFNA 4RBLA 1ZYSA 1YOJA 2CGXA 5C4KA 1XR1A 2F4JA 4F9BA 3RZBA 1PY5A 3ZXTA 5K9IA 3R63A 5IISA 3V8WA 3H4JA 3VBVA 3F2RA 1KE6A 5K0KA 3GOPA 4FKIA 3GI3A 4YJSA 1IAJA 4ANMA 3ZH8A 4FIIA 3ZO4A 4HYHA 3FXWA 4PUZA 3L9NA 2BDFA 3TZ8A 1TVOA 4RIOA 3AC4A 2IVUA 3OHTA 1KUTA 1WBPA 3PPZA 4F63A 2X9EA 2GCDA 4M66A 4X3FA 4BBEA 4F0IA 4F64A 4BR3A 4PPBA 3RI1A 3NS9A 3IDCA 5EK7A 4FTTA 3GCUA 4JR7A 4K0YA 4A9TA 4ASZA 5IMEA 4KABA 1WFCA 4MXZA 4EKKA 3UQFA 4TNDA 3R21A 3OUNB 4I5HA 3BYMA 3Q2MA 4RIWB 5D1JA 2DQ7X 4IVDA 4YTCA 1PXJA 2I40A 4KSPA 4P2KA 4RC2A 4EUTA 4MWHA 4CLIA 1FGKA 5LARA 3DAKA 4DFZE 2JC6A 2FO0A 3ACJA 4QYEA 3R1SA 2F2CB 3TACA 3GT8A 1RE8A 5AP2A 2XNNA 4PP7A 5LVLA 1MRVA 3R6XA 4MD9E 3HV7A 3R8ZA 2VX3A 2CPKE 2GSFA 3ZZWA 5BPYA 1KWPA 4LRJA 3MWUA 2E9PA 5HCZA 4BCHA 3UOKA 5FG8A 4TWOA 5HD7A 2R9SA 1IEPA 2A0CX 4FOCA 2GNIA 4C4JA 2J5EA 3ANRA 4D0WA 3Q04A 2FA2A 3VF9A 2RKUA 4A4LA 3NX8A 2WKMA 3DT1A 4GIIA 3DKGA 1CM8A 2IW8A 4A4OA 2OH4A 3RK7A 4FI1A 5LWNA 4F1MA 3UGCA 1YOMA 3MH2A 3K54A 4NM3A 3RPOA 1YWRA 4AA4A 5AV2A 1R39A 3QRTA 2YHVA 3ULIA 4EBVA 4EOIA 4O1OA 4IX3A 4QMTA 3E92A 4R1YA 4NL0A 2XCHA 2C5OA 4FTOA 5CSVA 2VTRA 4PDPA 4FSQA 3UC4A 3CSVA 4ZK5A 3COHA 1M2RA 4I0SA 5AAEA 5IA3A 4PTEA 2R3NA 5HO8A 3OFMA 2G2FA 4X3JA 2VX1A 2JDOA 3CPCA 3DKCA 4XLIA 5ANIA 3A4OX 5KMJA 3TL8A 4YO6A 5EQEA 4RZVA 2OO8X 5M53A 3POOA 1BI7A 2F7XE 3WZEA 4BHNA 3PY0A 2ERKA 2WPAA 4BIDA 4FSYA 3P79A 4U6RA 4IWQA 5AFVA 2C6TA 5EG3A 4R7BA 3T3VA 1GZOA 4GFGA 3V6SA 1XBBA 4U3ZA 3R9HA 2QKWB 3R28A 2PVMA 4R3RA 4BKYA 1XBCA 3FMMA 4DEHA 4F9AA 2WEIA 5D11A 3GCPA 3BQCA 3C0GA 4QMYA 2W9ZB 1J3HA 4FV0A 4EZ3A 4EBWA 2PVRA 2V22A 1F5QA 3QCYA 4KD1A 2W5AA 1Q99A 2C6DA 4RWJA 4TWNA 3E3PA 3QCSA 3DFAA 5K4IA 4NTTA 2C47A 4L43A 4HOKA 1ZARA 3C4EA 3FPMA 4UMPA 3LFEA 3PZHA 3BHTA 4USFA 1BLXA 3UG2A 1YRPA 2OSCA 2IJMA 3I6WA 3NLBA 4ZY5A 5L2WA 3OS3A 4FNZA 3L9MA 4JDJA 3EQDA 3FLWA 3UDBA 3UYTA 4L00A 3Q4ZA 4FIFA 4YLJA 3ZSGA 1X8BA 4LG4A 4D5KA 3OD6X 2JAMA 3NW6A 5B2KA 1FOTA 3M11A 4Q9ZA 1HCLA 4MXCA 4DGMA 3G9LX 5CY3A 5IQBA 2E9OA 2WMTA 4R7HA 4AT4A 2VV9A 5AIKA 5I9VA 1OGUA 4GG7A 1VZOA 2F2UA 3VIDA 4GEOA 3VBTA 4EL9A 3QL8A 4XRLA 4RWLA 1SVHA 2WTVA 4OAVB 3E8CA 4EK3A 2OH0E 2WHBA 4FICA 4OTWA 4CLJA 5M44A 4YC3A 4E7WA 5BVNA 1PJKA 1OITA 3CR0A 2WMVA 2WZJA 2VTQA 3PJ2A 3MJ2A 4CMUA 1IASA 3PDTA 4BCMA 5CAQA 4BDKA 2P0CA 4DINA 1IG1A 4W8DA 3C4CA 4D58A 2Z2WA 4EOJA 4ITIA 3V5PA 2WTKC 2VTPA 3UZPA 4Q5EA 1YW2A 1ZMUA 2GHGA 3EH9A 1DI8A 1FQ1B 3UIXA 4YJQA 4B8MA 1FBNA 1ZYLA 4M68A 4QTBA 4C33A 4B9DA 2R0UA 4M3QA 3VUKA 2BTRA 5C8MA 3MPAA 5GJFA 2WOTA 1E1VA 1BI8A 3KN6A 2O64A 1XH4A 4LI5A 5CQUA 4LYNA 5K3YA 3FKLA 5E8XA 3R9OA 4D2VA 5KMOA 4CD0A 4EUUA 4MBJA 1OZ1A 4OR5A 3VRYA 1M2QA 2BDJA 5AADA 4BKZA 2HZ4A 5HBJA 2QOLA 4I4EA 3TJDA 3NPCA 3A4PA 4MNEB 3N4VA 5HCXA 3TUCA 5AP5A 2REIA 1PXKA 3R1QA 4FODA 4QD6A 2GFSA 3E93A 3W55A 2EXEA 1QL6A 2WTJA 5CNOA 3DLSA 5HE2A 4FEQA 3O8PA 5FM3A 2YLFA 5TOZA 3GU7A 4QPMA 4BTMA 4FV9A 2GHLA 4I20A 3OY3A 3MIAA 4KIKA 4AWIA 4FV5A 4UWBA 2YITA 4EH7A 5TR6A 2JDSA 3BYOA 3MDYA 3QLGA 3AC1A 2X9FA 4FV8A 3K5UA 3R8VA 3G15A 2HZIA 2WQNA 3Q9WA 5FRIA 3W16A 4O38A 3BYVA 2JLDA 3CBLA 3VW6A 3WZJA 2X1NA 4LOQA 1PMVA 2ETMA 4O22A 5IEYA 2QI8A 2FSMX 3F61A 3PPKA 3VBXA 3D4QA 4GFMA 3Q4TA 4GVAA 4I23A 4FK3A 4FT9A 4HYSA 3FC1X 5CEMA 4BCNA 3D5VA 2CHLA 3PPJA 5H8BA 5K4JA 2QOCA 2YLEA 3U8WA 3QYWA 4EQCA 5TO8A 3W32A 1ZZ2A 4MKCA 5AWMA 3AMAA 4QMUA 3UP7A 3OTVA 3FI2A 4L52A 4S31A 3MVLA 3R0TA 3ZC5A 4BDAA 3JY0A 1WAKA 4L01A 1ND4A 2ZMCA 4XBUA 1QPCA 1W8CA 4ZJVA 3TT0A 2PUNA 4LFIA 4F6UA 4MNEA 4U5JA 3F9NA 4NJ3A 4I0TA 5CEOA 3VQHA 2PUIA 2C6EA 2PL0A 3FSKA 4C3RA
chains in the Genus database with same CATH superfamily
3Q9ZA 3TDWA 2J51A 2YWPA 1YDRE 3NUYA 4MBIA 3EQFA 3VF8A 4N4SA 2XNOA 2ITQA 4KKEA 4DDIA 2OJ9A 4WRGA 4RWKA 4X7QA 2PK9A 3GU5A 3K2LA 1GZNA 4JRVA 4R5SA 5DR6A 1Q8UA 5F95A 3BKBA 4CMTA 5JMSA 3UP2A 4J8NA 3KKVA 4NH1A 4FT5A 3RALA 5HHWA 3F5GA 5HIBA 4FX3A 4I94A 1DM2A 4MXOA 3BPRA 4IWDA 5CVFA 4QP4A 3QD4A 3PIYA 2ESMA 3RK9A 2O2UA 4OUCA 4LMUA 5CU0A 4OT5A 4R1VA 3GNIB 2C1AA 2PVJA 3GBZA 2J0MB 3LFQA 1RDQE 5DG5A 3WBLA 2BRGA 3U51A 3UE4A 2UW3A 3ORNA 4K18A 3ZLYA 4DGGA 5EW3A 3C5IA 5GJDA 2PMNX 2NYAA 1JAMA 5CASA 4EH8A 3VWAA 1QPEA 5ACBC 4AZEA 4FSMA 3ENMA 5AP1A 4FVQA 4IWPA 1FVRA 4EYJA 4O7YA 5ETIA 5BVFA 3UIUA 5JEBA 5DYJA 3ENHA 2QCSA 2QURA 4H58A 3VONA 2SRCA 4XS2A 5HIEA 2XNMA 3W0NA 4FR4A 3COMA 4YBKA 2HW7A 5AAFA 4FL3A 4XG6A 2Z7LA 3HEGA 3HUBA 5D9HA 3VS1A 4D0XA 3DV3A 5DT0A 4L67A 1Z5MA 3F3VA 3KF4A 3GB2A 4J97A 5FQDC 1WVYA 5KZ0A 5FUTA 2OF2A 3DB8A 5DT3A 2CGWA 4IAAA 3OF0A 3TJCA 3G6GA 4LGDA 1WBOA 3PJ3A 2QU6A 3R8MA 3R8UA 3GEQA 3K3IA 2W0JA 2B7AA 2XEYA 4XG8A 1U4DA 3KXGA 2HWOA 3BEGA 4JI9A 2IG7A 1E1XA 3ZRMA 4AFEA 4YURA 4F78A 4AG8A 3RAWA 2B9HA 3KMMA 4IACA 3NNXA 4D2SA 1XH9A 3H9OA 5AX3A 3BGQA 3L8PA 4E4LA 3PXZA 3DBDA 3DBCA 2PUPA 5AJQA 3DKOA 5GINE 4HVDA 3EHAA 3NR9A 3P86A 5EM7A 4WSYA 3LLAA 4LV7A 3CTQA 2ZV7A 3A7HA 3WF8A 4J71A 5IA4A 2NNWB 1P4FA 5JFSA 3IO7A 4ZSLA 5CX9A 3Q9XA 2JIUA 2FVDA 4AZFA 4F9YA 2W06A 3MH1A 3BBTB 3IOPA 3R22A 1ZOGA 2QD9A 2WQOA 2HIWA 1WMKA 3R8PA 4BDCA 2CNUA 4IAIA 3FBVA 4FZDB 1GJOA 2UW0A 5EI2A 3A62A 2J0JA 4HW7A 3EQRA 4MEDA 5E8UA 4O91A 4Y46A 3EQBA 2GQRA 4FG8A 3C0IA 5CZIA 4MHAA 5L3AA 2PMLX 2ZV2A 3BLQA 2A98A 5E8YA 5G1XA 5I3OA 4EOQA 3IDPA 4FVPA 2CGVA 3NRMA 4FT7A 5E8VA 3ZO3A 1Q62A 2UZNA 3CEKA 4EOKA 2XK7A 4HGLA 4AGDA 4IAKA 2ITZA 4L46A 4M69A 3CJGA 5KNJA 2OXXA 4S2ZA 2VTTA 4MXAA 3TIZA 3KULB 3K5VA 5TF9A 2QNJA 3AT4A 4C62A 5C8KA 4QMNA 3R7YA 3R7EA 4EH2A 4Z7GA 2PVKA 4C4IA 4EHGA 4PTCA 3KMWA 3KK8A 3A2CA 1W83A 4MH7A 5BVWA 3W0SA 2I6LA 3RPYA 4GT5A 3DBQA 5CU6A 3I81A 4GIHA 4K9YA 3BU5A 4RLKA 2Y4IB 1QMZA 2Y0AA 1H1WA 3UBDA 4NYEA 4X21A 3GVUA 4F9WA 3BE2A 1FVTA 1ZYJA 3F2NA 3KCFA 4OT6A 4UMUA 4RWIA 1Q61A 3GQLA 4YMJA 3DLZA 3O17A 4RJ7A 4A06A 4L53A 4ZS4A 5KMMA 2YM7A 4PPAA 3CXWA 5FLFA 1W98A 5HTCA 3RPSA 1K9AA 3CTHA 2GPHA 3R1YA 3IS5A 4GU6A 4TWPA 3H30A 3CD3A 2WU7A 3OROA 4UV0A 3ZFMA 4APPA 4DEIA 4D9UA 4ZZMA 4W8EA 2X8EA 5KHXA 3HVCA 4I4FA 4FSZA 2FB8A 2C3IB 4EHVA 5AR2A 1U5RA 3R8LA 3HA6A 4QMZA 1YXVA 1E9HA 2RG5A 3GCVA 3KGAA 3LXPA 4TL0A 1H24A 4Q5HA 3ET7A 4QTAA 4M0YA 3UVQA 5HX8A 5IEXA 4JMQA 2E9VA 3RPRA 4FG9A 4FVRA 3FC2A 3EJ1A 4HCTA 3FWQA 4KB8A 3F66A 5CXZA 1XH6A 4GCJA 1REKA 2C6OA 1KE9A 2JBPA 2VTAA 2WQBA 4EOMA 2H8HA 2XKFA 1NVSA 1M17A 3TV4A 2G1TA 3KULA 2HY81 1XKKA 2OIQA 3RHXA 2GNGA 3OP5A 2J6MA 3EZRA 4DLIA 4QTCA 5M55A 2EB3A 4OTFA 3G0EA 5IQFA 1YVJA 2C69A 1UNHA 4BWKA 4UALA 3GC7A 4YO4A 1H26A 3Q52A 3ZO2A 4DGNA 2OI4X 4DT9A 4N70A 4RSSA 2P4IA 3L8VA 4EJNA 4TRLA 4RFZA 1ERKA 2OJJA 4FOBA 4YJVA 3V5TA 3NUNA 2ITTA 4IJPA 3GU8A 3QBNA 4G2FA 3WE4A 2A19B 2WU6A 4R6VA 5J7HA 4W4YA 4FJVA 3CE3A 4R5YA 4JS8A 2XYUA 4FV3A 1PXLA 3VS0A 4HPUE 4QP2A 5C1QB 5J5SA 2VWXA 3BHUA 1V0OA 4FGBA 4G6NA 4PQNA 5A6NA 4M15A 2UVYA 3AD4A 5HESA 4ENXA 2C0TA 4XV1A 4MXYA 2VTNA 3NEWA 2H6DA 4U79A 1Y8YA 1ZOHA 4WNOA 3OOMA 4ZTNA 5FXRA 4C3PA 2YJSA 3HMIA 1J1BA 1JSTA 5KBQA 3MA6A 4NIFA 2JFMA 2Q0BA 4JVGA 1OKVA 4NK9A 5DRDA 3EQPA 2BDWA 2VN9A 3JXWA 3VUHA 4L3PA 4D4RA 2YIXA 3HUCA 3QTUA 4I5PA 2BR1A 4HVGA 3VO3A 2XUUA 3EN4A 2IZSA 2J5FA 3FZTA 3DOGA 4HNIA 4UXLA 3BCEA 5J79A 3DQXA 4RLLA 3HP5A 1BUHA 4O6EA 4CZYB 4FKPA 4CFWA 3GFWA 2XBAA 5A6OA 4JIKA 3SAYA 4NT4A 3ZYAA 4IDTA 2KTYA 1ZAOA 4PP9A 1Q41A 4TYGA 4GW8A 2P2IA 3JR1A 1O6LA 1XO2B 3IKAA 3RHKA 5AUXA 5ETFA 2G9XA 3FYKX 2WTDA 4YLKA 5IU2A 2YDIA 3TUBA 3NVMB 5IA1A 3T9IA 3BBWA 3RJCA 3AXWA 3ROYA 1URCA 2UZEA 4QQCA 3FKOA 3GCSA 5AUTA 5KKRB 3DCVA 4FTUA 3LLTA 1G8AA 2W9FB 2YERA 1BX6A 4D28A 4DHFA 1OBDA 3GENA 5AV3A 2X4FA 4IZ7A 4NTSA 2JITA 3RZFA 2E9NA 3UZTA 2GQGA 4XV9A 4LOPA 4RJ8A 4RQKA 3GUBA 3BI6A 2QC6A 2YM5A 4JX3A 3B8RA 4NWMA 4YU2A 3TUDA 4DHJA 1J7UA 1P5EA 4JX7A 2ZDUA 4LV8A 4ZXTA 4USEA 3UQCA 4BCIA 1CDKA 3HAMA 3R2YA 3UNKA 3NUSA 3VW8A 3DA6A 4M8TA 3TNIA 3MVJA 1A06A 1OM1A 3LFNA 3PRIA 3AC5A 2R5TA 3SRVB 4AZVA 4DH8A 3ORIA 5JGBA 4WNMA 4AE9A 4ZLYA 4KAOA 1APME 1S9IA 2NO3A 2UV2A 4K11A 5ANGA 4BDIA 5EM6A 3C1XA 4TYIA 4CEGA 3BL9A 1VR2A 4JIAA 4JQ8A 4HJOA 4AP7A 2VNWA 4AGWA 4I6LA 1GZ8A 1JSUA 3OXIA 2AUHA 3DXPA 3JVRA 1XHAA 3QZGA 3L9PA 4S33A 1M14A 2V55A 4YTHA 2VTJA 5HLPA 4K6ZA 2EXMA 4AUAA 1WBNA 4RA4A 5H3QA 4CFMA 5EYKA 4NEUA 3IGGA 4Y73A 3GU6A 2EB2A 3FXXA 1PHKA 1SVEA 3QTRA 2PZRA 4Q2AA 3W0OA 5L8LA 3E63A 2QR8A 4J95A 3N51A 4IB1A 2ZVAA 3VS4A 5FM2A 3DBFA 5AR3A 4DLJA 3U6HA 5AM6A 5IG1A 2C6KA 3JYAA 2QVSE 2OK1A 4OTHA 3OWJA 3O50A 4FKSA 2JGZA 2IW6A 3QD3A 2PZIA 4FTKA 1YQJA 4O0RA 4YSMA 4DEAA 4EEVA 3TKIA 3D83A 2CGUA 3EQHA 2V5QA 3NUUA 4U0IA 5DBXA 4MBLA 2XK8A 4BBMA 3LXLA 5FDXA 1J91A 3A61A 3DQWA 4DH3A 3RK5A 5LJJA 4JBQA 2R3FA 2Z7QA 2CKEA 2ITVA 5HVKA 2CJMA 3PP0A 3NUXA 3NDMA 5JT2A 4XOZA 3DS6A 3FMLA 5BVDA 4AXAA 3D5WA 5CU4A 4G3EA 3ORMA 3SRVA 5M09A 4L7FA 4JG8A 4PMSA 3LCTA 2B54A 5CZHA 2OJGA 1URWA 2IZUA 3RM7A 2OFUA 2JIIA 3WF6A 3AG9A 5AM7A 4XP3A 3FMNA 3H3CA 2HELA 3I5ZA 4XNEA 3ZBFA 3TG1A 1PF8A 2OLCA 4Y95A 3VC4A 2EWAA 5IQCA 4UY9A 5IDPA 4O6LA 5AUYA 5LVNA 2VWUA 4RT7A 4HVSA 1YKRA 3LHJA 5EKOA 3SXSA 4RA5A 5A4QA 1IR3A 4X2FA 3V04A 4O0TA 4ERWA 3UIBA 4ORKA 1RQQA 2O8YA 3QQFA 4RZWA 4B0GA 1PXPA 4HYUA 4OTDA 5DRBA 4EH6A 5IUIA 3NCGA 3VUMA 3F7WA 5BVEA 4KSQA 2R3IA 3O96A 2ITUA 2F7ZE 3QQHA 3EL8A 5EM5A 1FGIA 4WSQA 4AXEA 3HP2A 1XMMA 2BVAA 2Z8CA 4I3ZA 5AV1A 2WMRA 5L4QA 4IZAA 3FZRA 4IAYA 2OIDA 3FMEA 3UIMA 4CKRA 1P2AA 5DE2A 3HRFA 2XM8A 1K3AA 4F9CA 5EI8A 4CYJA 4ZTLA 2PPQA 3COIA 2GDOA 4EK8A 5TT7A 3LZBA 2GNFA 2X0PA 1JKTA 3CJFA 3MA3A 3O7LD 3PXRA 3WYYA 5ICPA 2XMYA 4KRDA 4WA9A 5CEQA 4DCEA 1W7HA 5HVJA 4G17A 3FQSA 4BC6A 2YM4A 3R01A 2VWIA 3TNPC 3LQ8A 4QMLA 5IPJA 4MAOA 3PY3A 3F3UA 3SD0A 3KL8A 1BL7A 4AN9A 4DAWA 3RP9A 4DBXA 4ZP5A 3TWJA 3QHWA 3JVSA 2GTNA 1OGYA 1JQHA 3EOCA 3Q5ZA 3UDSA 4K2RA 2RL5A 3C51A 4FKTA 3LFDA 3Q60A 3FDNA 2ZJWA 3QALE 2XJ2A 3IW8A 5FEQA 4OTRA 1KE5A 4I6BA 3QXOA 5C4LA 1J1CA 2ITOA 3GC0A 3OOGA 4FKLA 2YIWA 1YI6A 2J2IB 1JKSA 5JFVA 2B0QA 3A7FA 4AGCA 3QD2B 5BVOA 3HMMA 3PJCA 2W99B 2VO7A 4WRSA 4CV8A 4TT7A 2C5XA 1H4LA 4FNXA 1OVEA 1ATPE 1ZOEA 4QP6A 3UO6A 4F1TA 3QD0A 5ANOA 4FZFB 4TWCA 4V04A 4CKIA 2OJIA 3GGFA 3VUTA 2X2KA 3G2FA 1YWNA 3ZLXA 3ZRKA 4ANSA 3EWHA 4FKRA 4U44A 3HV5A 3WOWA 2V7AA 4EK5A 3BLRA 3ZEPA 3RGFA 2B9IA 4RQVA 4LOOA 2BFYA 2YM8A 4FIJA 4GYGA 4QP9A 2BHHA 1H8FA 1T45A 3QHRA 5HNBA 3PE1A 3FMDA 3O8UA 4Q9SA 4P5QA 4XP2A 4ZLOA 2C5YA 3OCTA 4XOYA 5CF4A 2XF0A 1H1SA 1QPDA 1SNXA 4MCVA 1EH4A 4J1RA 5J7BA 3H10A 4FZ7A 3SDJA 5EOLA 1OIYA 4P5ZA 4QMWA 2BZIB 1B6CB 5DI1A 3C4XA 5HU3A 2XK6A 4RVLA 5FXQA 5JGAA 5FWKK 4CQEA 3Q96A 3ZZEA 4RJ4A 1XQZA 4TKSA 4ERKA 3PWDA 5GIOE 5ACKA 2R7IA 4C37A 1UU8A 3VS3A 2BRMA 5CVHA 3F5PA 3FUPA 3IGOA 3ORKA 2QU5A 4YJUA 1G3NA 1JPAA 2UVXA 4YZCA 5F9EA 2Y4PA 3WF7A 2YABA 1TQMA 4C4HA 4BDJA 3VHKA 4CGAA 1B38A 4GK3A 5GZ8A 5JKGA 2QKRA 2XIZA 5I9UA 2B55A 4I22A 2OXYA 3DY7A 1PXIA 3KB7A 4FYOA 3PJ1A 4UZHA 3I7CA 3EMGA 3F3ZA 4GRBA 2ETKA 3IQ7A 4AZTA 4CZUA 1UU3A 3FLNC 4EKLA 3HX4A 5HG9A 4N0SA 4S34A 3UNJA 1TFFA 1Q5KA 4BYIA 3NAXA 4QQTA 4M12A 3H9RA 4TN6A 3S00A 4GKIA 2X0GA 4I6HA 4TTHB 3B2TA 5CS6A 4FL1A 3NUPA 5AP6A 3FMKA 2PVNA 3R04A 4DYMA 4RX8A 5EM8A 3G0FA 4LV5A 4K33A 4AN2A 4NJDA 4I5CA 3QZHA 3UQGA 3PUFC 4IB5A 4U97A 2QO7A 3VUDA 1ZYDA 4QNAA 4WHZA 3PA4A 2I0VA 3SX9A 4J7BA 1Q8YA 2B4SB 2X8DA 3Q4CA 5CWZA 5AA9A 2VGPA 4AA5A 1W2DA 4U9AA 2PZYA 2WQEA 3UOJA 1KV1A 2OFVA 5KMNA 3GOKA 4ONAA 5BMSA 5DWRA 3D0EA 2VO0A 1OUYA 4W9XA 5J9YA 2ZAZA 2BRHA 5D7VA 5M56A 5CALA 1TQIA 2Y7JA 4QP8A 4KIKB 1XJDA 3HDNA 4XJ0A 1U54A 4JBOA 4BYJA 4MF1A 2UZTA 1SM2A 4NM0A 3W2CA 4A7CA 1OMWA 3PXKA 1GIJA 2JFLA 3VQUA 2YAKA 3EN9A 5I9XA 5HO7A 5BYLA 3QTWA 2XBJA 4RGJA 3BLAA 3KXNA 4FSTA 5DMZA 3GP0A 5IQAA 4RJ3A 3W8QA 3EN6A 3L8XA 3MPMA 3FYJX 5T6KA 5BYYA 3LW0A 1WBSA 5DGZA 3MTFA 4GJ2A 4JQ7A 3TI1A 4Y5HA 4C58A 4D4SA 2J7TA 1NY3A 4ZMFA 3IECA 4ITHA 1M52A 5I4NA 4YTIA 3QRIA 3ZSIA 2BIYA 3RBWA 2R7BA 3HAVA 4JBPA 5AR5A 2VUWA 3UVRA 5E8WA 4GT3A 3OW3A 2WIPA 2YFXA 4FTMA 4X2KA 2Z02A 4PL4A 4JG7A 4CZTA 4KUJA 2XP2A 1GY3A 4O7VA 4ZTMA 3BX5A 4O7WA 2XK9A 4JDIA 4O0UA 3DTCA 3QGYA 4RFMA 3RNIA 2IO6A 2Y8OA 3EYGA 5A54A 3IDBA 2OW3A 3F5XA 4GSBA 3MYGA 2OICA 4XG7A 5DVRA 3R7GA 3OCGA 3R83A 4LUDA 1OL2A 2ACXA 4HCUA 4AT3A 4R77A 4KINA 4D1SA 4OBPA 1GAGA 4E8AA 5EQYA 5FEEA 5B0XA 4DFXE 5FBNC 1OL6A 5IUHA 5EQPA 3DBEA 3A99A 3QTQA 1H1PA 2DYLA 5E9EA 4DG3E 3MPTA 5CSPA 2C3KA 2YISA 3VRZA 3PXFA 2UZBA 2GS7A 1OL1A 5HE3A 3ZSHA 1KSWA 1PMUA 3FHRA 2CKOA 2KULA 3P9JA 3VS2A 3O71A 2W1IA 3MY5A 3N9XA 2R3MA 1PMNA 4GUBA 3LQ5A 3TEIA 3WZUA 4DT8A 5CAVA 4FSNA 3V5QA 3EN5A 3MFSA 3NMUF 3UNZA 3DZQA 4IBMA 3THBA 3VUIA 4JT3A 4JQEA 3SG8A 5FGKA 5I0BA 1MRYA 3PUPA 4FEXA 4IB3A 4WKQA 2XA4A 2X2MA 2R0IA 3DDQA 3HDMA 4QYYA 5E91A 4RIYA 5D10A 4RJ5A 1PYEA 4I92A 5ANDA 5HORA 5BMMA 3UO4A 5L8KA 3NUAA 3BGPA 1WBTA 4IC7A 2F49A 3QRUA 3AD6A 2JEDA 2ONLC 3NNWA 1ZMWA 3U4UA 4E93A 3TZ7A 2XKCA 5LOHA 3C13A 4TXCA 4LUEA 4OBQA 4DFLA 2WNTA 3KVWA 4O0VA 3AGLA 1YI4A 3CKWA 2WQMA 3PVWA 4RVTA 4WNPA 1J7LA 3MGYA 1XWSA 3R7OA 5J9LA 5EOBA 3UOHA 4IAFA 2R3RA 4F6WA 2A1AB 3MW1A 3ORZA 3RVGA 2CNQA 3QTSA 4II5A 2UZDA 3P5JC 3MH0A 2J0LA 4FEUA 2W1HA 3MESA 4DTAA 3TNQB 3HMPA 3I60A 1SZMA 3ZDUA 3KQ7A 4EZ5A 3QUDA 4U41A 4CMOA 3BYUA 4KBAA 4UZDA 5AP4A 3VNTA 2GMXA 3FSFA 4RC3A 4H39A 2A4LA 5A3XA 4C0TA 5JZJA 5K5NA 2OIBA 2VWYA 4NKSA 5J1VA 2O63A 4HZRA 3LQ3A 3OCBA 3SGCA 5M06A 3QQLA 4OBOA 4QYHA 4ZJIA 2YZAA 1U46A 4O0SA 3ERKA 4USDA 2PVLA 4UWYA 1OIQA 3RTPA 2VWVA 2FH9A 1NVRA 2BZJA 4E5WA 2YWVA 3VS6A 4FTRA 3Q32A 3E7OA 4AW5A 4N6YA 2WTKB 4NFNA 1ZXEA 2VWBA 1H0WA 3I4BA 2YAAA 2RFEA 2VTHA 3ZOSA 5KZIA 4BKJA 3ALNA 3NIZA 4IVCA 4JDHA 4YHTA 3ZO1A 2ZM3A 4FA2A 1OKWA 1IAHA 1YXTA 4HGTA 5HG8A 4DTBA 4H1MA 3P4KA 3HZTA 3ROCA 4CG8A 4KNBA 4MQ2A 4M69B 3FI4A 2UW7A 4YZBA 3FE3A 3QQKA 1OUKA 5TE0A 4I6QA 4L42A 4G6LA 4F65A 2ITXA 4IM0A 3CQEA 3NAYA 2RIOA 2C30A 4BBFA 4QMOA 3CQUA 5HKMA 4E4MA 4CFUA 4O7RA 3U6IA 3VN9A 4QQ5A 2ITYA 2ZM4A 1Y8GA 2JDRA 2QO9A 2BALA 3BQRA 3Q4UA 2F9GA 4ZSEA 4J52A 3W2OA 5LVMA 1XH5A 3AC8A 3ITZA 4FV7A 4K1BA 1YHWA 4Y5QA 2UZLA 2WGJA 1I44A 4YPDA 5EDQA 2UZVA 4IE9A 4CFVA 3QKLA 3FL5A 1WVWA 3BLHA 4B8LA 5JN2A 3A7IA 3NSZA 4FTJA 3RAIA 3VJNA 5A14A 4BY9E 1Y91A 4BI1A 3F2AA 4W4WA 2BTSA 3D5XA 3PA5A 3AKLA 2BILB 3ALOA 2QOBA 4YLLA 5KMIA 4RFYA 4WT6A 3C50A 2HOGA 5LXMA 4F7NA 3WZDA 3CPBA 2WTWA 3CTJA 5JQ5A 4FSUA 1YDTE 3OC1A 3U6JA 5JFXA 2AQXA 2YDJA 5M08A 3OG7A 3BV2A 4OGRA 4XG2A 4IVAA 4I24A 5FBOA 4M7IA 4NFMA 3REPA 3U4WA 3KMUA 4DEGA 1MQ4A 4XLVA 4C34A 3RNYA 2GS6A 1UWJA 4U80A 3LJ2A 4FTNA 2ZDTA 3LVPA 1Y6BA 2X4ZA 5GNKA 1CSNA 3D9VA 4FBXA 4IW0A 3R73A 4X6RA 3KEXA 4YJNA 4K77A 4A9YA 4DA5A 4C4EA 4BF2A 3OWLA 4WG5A 1P4OA 3AOXA 3FQEA 2XNPA 4DGLC 1REJA 3DAJA 2XVDA 1TZDA 3P7AA 4YUQA 3C4FA 4G9CA 3W2PA 3TYKA 4M13A 2PHKA 5A4EA 3SHEA 4RG0A 2EVAA 3EQCA 3P0MA 4ZTQA 1JOWB 4LL5A 4AQCA 2QLUA 1GNGA 5HU9A 3ZM4A 3N4TA 4XV2A 3LFBA 3P78A 3CLYA 1FINA 4FUXA 4HCVA 4IANA 4PL3A 4ZOGA 5E8ZA 1RW8A 4H3PA 4PWNA 1Q8TA 4DITA 4JL9A 1TQPA 4IADA 2Y6MA 4MWIA 4BTFA 4GJ3A 2V7OA 4S32A 1PYXA 2QOKA 3PA3A 4GK4A 4ACGA 2GNLA 4DH1A 3OXZA 4EOPA 5JH6A 2IPXA 3TDVA 3ETAA 3F69A 2I0EA 4BDEA 1JVPP 4NKAA 3ORPA 4IXPA 4AA0A 4F7JA 4BIEA 3GQIA 4QTDA 4BHZA 1PKGA 3GFEA 4EH9A 3W0RA 4O0YA 1UV5A 2AC3A 2WMQA 1OPLA 2UZOA 3EFLA 3U54A 2E2BA 4NIFB 4J53A 5EDPA 5EW9A 4O7LA 3F3TA 1KOAA 1Z9XA 4WBOA 4C2VA 4ID7A 3L9LA 2W1GA 2Q0NA 4MQ1A 4BTKA 3RWQA 3OVVA 5AUWA 4QMVA 3AMYA 4BZNA 4YBJA 4A9SA 2CN5A 3B2WA 4GT4A 2P2HA 3NZ0A 5LMBA 1L8TA 4L45A 4EOSA 4DFNA 3KA0A 3ZUUA 3E62A 3UPZA 3P23A 4E6QA 3VULA 4I0RA 1YXUA 2J9MA 2W4KA 3SOAA 3OZ6A 2IF8A 2XZSA 5FP5A 1Q24A 4LMNA 5CEPA 2NRUA 5CANA 4O82A 4C7TA 1DI9A 3ZC6A 4ZZNA 3NFGB 4C4GA 3R7UA 2B53A 3EKKA 5IEVA 3RPVA 4FUYA 4EJ7A 3NYOA 2YCQA 2QOHA 4QO9A 5H9BA 3MVHA 2QHNA 5LCJA 2OG8A 2XRWA 3A7JA 3QWJA 3W2RA 5KCVA 3PG1A 4LQMA 4QP1A 5ANEA 4BIBA 4X3FC 4YC8A 5CTPA 3ATTA 4NM5A 4QPSA 2X6DA 4RC4A 3ORLA 4I1ZA 3E3BX 4BDGA 3NWWA 3OT8A 1RJBA 4GH2A 3PFQA 1YI3A 5L6OA 3PXYA 4YZ9A 4H05A 1M7NA 2W5BA 3PTGA 3QQJA 4F09A 3M1SA 3EKNA 3MS9A 4NCTC 5BYZA 2J90A 5HI2A 5FDPA 3FLQA 2CNVA 2IZTA 3BE9A 5EHLA 3LKMA 2BRBA 1PW2A 2W1EA 5DIAA 4ZSAA 1S9JA 1T46A 4M67A 4W9WA 4QDVA 5HICA 2HWPA 3QWKA 4F4PA 1UKHA 4CTCA 3ZLSA 5EW8A 4PMPA 5F1ZA 2CCHA 1B39A 4HZSA 4O7ZA 3KN5A 3FMHA 3OW4A 1XH7A 4IJ9A 1OKYA 3DU8A 2C6MA 1OECA 4UWCA 4BCJA 3HMOA 4O4FA 4BGHA 4EOOA 3CY3A 5C8NA 4O21A 3CP9A 5IZFA 3UG1A 2W4JA 4FSWA 2R3KA 4QMSA 4CCUA 2UW8A 3DGKA 4Y72A 4RIXA 3R7VA 3TCPA 3A8WA 3V01A 4BICA 5DFPA 2G2HA 5CF8A 2R4BA 3UVPA 1Y6AA 4M84A 4YJTA 3WF5A 5C26A 2GNHA 4FKJA 2VX0A 3EFKA 2G15A 3CGFA 4YC6A 5AA8A 2WFYA 3WIKA 3FZ1A 2YIRA 4ZIMA 4BL1A 4JAIA 3MJ1A 2HW6A 4EK4A 5HE1A 2VWWA 4RPVA 5HLWA 3W1FA 5ETAA 2XKEA 2H9VA 4GVJA 2YCRA 2BRNA 1A48A 3LE6A 4FT0A 5TKDA 2QLQA 3C0HA 2WEVA 3QX4A 5FTQA 4HGEA 2VRXA 5C01A 3RAKA 4ZTSA 2B9FA 4BCGA 3G9NA 5M57A 3ZFYA 4MNFA 3ZRLA 3HA8A 2IWIA 4GKHA 4AW1A 4EI4A 3VAPA 4WNKA 5J95A 3TZMA 2IVVA 4W4VA 3E7VA 4UX9A 2GQSA 3ZDIA 4QYGA 1WVXA 3D7TB 4IFGA 3BEAA 4C35A 5CF6A 2BKZA 4DH7A 3HYHA 3FY0A 5E1EA 3F6XA 3FZOA 4QPAA 2YDKA 4L3JA 1NW1A 3LCOA 4O96A 4LGGA 3KRRA 4IWOA 4P90A 4I41A 2BAJA 2WB8A 1VYZA 1W2FA 3QXPA 2BPMA 3KU2A 4IHPA 3VS7A 4AF3A 4ANBA 1JBPE 3CGOA 3NW5A 2WOUA 4IDVA 1UA2A 2HY0A 5L2TA 3COKA 4EZ7A 4BWPA 2XB7A 3E64A 3TXOA 4C38A 4H3QA 3KXXA 3MY0A 3Q53A 4GS6A 3MI9A 2C0IA 5EH0A 4ZY4A 4MXXA 4AXFA 4LL0A 3PJ8A 4CNHA 3G33A 5E92A 3HKOA 2C3LA 2YIYA 5B2LA 5CLPA 5DEYA 2HENA 2WMWA 4X2JA 3R9DA 4BVUA 3PZEA 3OUKA 1NA7A 3KC3A 3QGWA 5IA5A 3RCDA 3P7CA 4ACDA 4F7LA 5GZAA 3ZM9A 4PMMA 1QCFA 4ZS0A 4QMQA<