1SYKA

Crystal structure of e230q mutant of camp-dependent protein kinase reveals unexpected apoenzyme conformation
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
350
structure length
348
Chain Sequence
GNAAAAKKGSEQESVKEFLAKAKEDFLKKWETPSQNTAQLDQFDRIKTLGTGSFGRVMLVKHKESGNHYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMVMEYVAGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGFAKRVKGRTWLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYQMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFATTDWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEEEIRVINEKCGKEFTEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords cAMP-dependent protein kinase, alpha-catalytic subunit
publication title Crystal structure of the E230Q mutant of cAMP-dependent protein kinase reveals an unexpected apoenzyme conformation and an extended N-terminal A helix.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transferase
total genus 103
structure length 348
sequence length 350
chains with identical sequence B
ec nomenclature ec 2.7.11.11: cAMP-dependent protein kinase.
pdb deposition date 2004-04-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 1sykA01
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 1sykA02
4WG5A 2I0YA 4E8AA 2P0CA 4F9YA 1W83A 4R7BA 3DBDA 4IAYA 3R8VA 3MFTA 5TT7A 1H08A 5L8JA 3G90X 2R3HA 3O23A 5C03A 4E5WA 4PMTA 4JDJA 1PXNA 2PVMA 4AZEA 4GW8A 4F99A 3VULA 1WAKA 2GNLA 4NIFB 5FXSA 4S34A 5HO7A 4QP9A 3FSKA 1WZYA 4F7JA 3R9RA 3UIMA 5AM6A 4DLJA 3GU6A 3G2FA 1FPUA 5DWRA 3CPBA 2RFNA 3R2BA 1M2QA 5ETFA 3UNZA 1S9JA 3RAWA 5BYZA 3ZXTA 3IG7A 5IQEA 5HVJA 4C61A 4X2KA 5HD4A 4L45A 5HX6A 1XWSA 4V05A 1R1WA 3DT1A 4HNFA 5J79A 5T6KA 4IAAA 2WMSA 5LMKA 1PJKA 4BGQA 2EXEA 2JGZA 4QMYA 2QOKA 4NW6A 4DTBA 4KBKA 4YSMA 5J87A 2CHLA 3ETAA 3V8WA 3WOWA 2Y9QA 2JIVA 2UW7A 4DBNA 5HG9A 2OF2A 3O7LB 3RM7A 3DPKA 3WYXA 2C5YA 3IW6A 4CLJA 5IMEA 2QQ7A 4OT6A 5G6VA 1XR1A 5FTQA 2B9JA 3NUAA 4O84A 4C33A 4ANNA 3NIZA 2X9FA 1M7QA 5DG5A 2XRWA 2W1CA 1OI9A 2VTLA 3Q4UA 5BUIA 4LOQA 3F66A 4UWCA 5EG3A 4EWQA 4RJ4A 4NIFA 4KS7A 4NZWB 2OJIA 4NM0A 5FBOA 2XCHA 3AXWA 4XBRA 4UN0C 1Q41A 3KRJA 2BUJA 4RVKA 1Q8TA 2YM3A 2R3MA 1M14A 2C0IA 3F88A 4FF8A 3TDWA 3L1SA 2WMVA 3H30A 3BYSA 3D15A 3W2OA 4CLIA 4BI2A 5KMKA 2IZUA 4XUFA 4K1BA 4ZZOA 3FUPA 5EHYA 3NYNA 3RAKA 2BIYA 2QKRA 4BWKA 4QMMA 3UMWA 4HVHA 3F2AA 3PPZA 3R73A 4ALWA 3AGLA 4OW8A 1OVEA 3IO7A 1VR2A 3ZEPA 5J1VA 1SVHA 1TQIA 4S31A 5IUIA 4B7TA 4WG3A 4OGRA 1P5EA 4Z9LA 4BWPA 3M42A 4M8TA 5AX9A 5H8EA 3NUYA 1HCKA 1JBPE 2XRUA 4PUZA 3C0IA 1YI3A 4AT4A 4WNKA 4AA4A 4JX7A 4FEQA 4B8LA 4QQTA 2YEXA 3E8CA 3H9OA 4BTJA 5C26A 1Y6BA 4P7EA 3TV7A 3GCVA 3F5GA 3LM0A 4WUNA 5DLSA 4A4LA 3QKKA 4R7HA 2VTQA 3ORMA 5I9YA 5LQFA 4FNWA 4FT0A 4IEBA 1WBVA 3MS9A 4O6LA 3RI1A 5AAEA 3LW0A 3FZRA 3PG1A 4O83A 2Q0BA 4YZCA 5KMMA 5AV3A 5J7HA 3FV8A 2WTKB 3ORNA 3TZ7A 3DNDA 5EW9A 3ULZA 3VS1A 4FUXA 3ERKA 3WZDA 2VO7A 1Q8ZA 5ANGA 5HE0A 5FD2A 5HU3A 3I7BA 2FO0A 3HLLA 1XKKA 5AUZA 5BUEA 2IJMA 3QQLA 2UZUE 2WOUA 1MRUA 2ZVAA 3LXKA 4YLJA 5J5SA 3F3VA 3QGYA 4MNEB 4XEYA 4XJ0A 3P5KA 2YAKA 3SA0A 3T9IA 4NM7A 4YJTA 4ACMA 3MV5A 4FSWA 3FMMA 2SRCA 4HW7A 4BR3A 4F63A 3HX4A 3HP5A 2I0VA 2F57A 2PY3A 5FWKK 5FDPA 4HGEA 2GS6A 2PMOX 3C7QA 3SV0A 3WARA 3EHAA 3PLAE 4EJ7A 3FMJA 1PXJA 2R3GA 3FQSA 3A7IA 1NW1A 3OWJA 3REPA 3GC8A 2CSNA 1UNLA 2ERZE 5HNBA 5M51A 3PDTA 4DITA 1FVRA 4EH6A 4EQCA 2HY81 4DLIA 4BY9E 2XKEA 3AC5A 2VTTA 2QR7A 4MXCA 5BVWA 1PMNA 4FG9A 5E8SA 1RW8A 4QMTA 2NRYA 4FKTA 1BI7A 3QXPA 3BYOA 4FL1A 1YDRE 4ZK5A 3V04A 5A4CA 3QU0A 2BDJA 4F6WA 2V5QA 3DA6A 4D2PA 3QYWA 3MB7A 4HCUA 4J52A 2JAVA 3F3TA 3Q53A 3M11A 4H36A 5A4EA 5CEIA 3ZM4A 1GIHA 4U5JA 3Q4CA 4LMUA 4XH6A 4ZXTA 2QO9A 5DN3A 3VS7A 2XNPA 1BUHA 1YDSE 4S2ZA 4RX8A 1LUFA 3PVUA 3UQFA 4L67A 4ZTHA 3R8UA 1FGKA 4DEAA 2BMCA 5I9XA 4JG6A 2XCKA 3VUTA 4ZOGA 5JEBA 2UV2A 4MNEA 2RG5A 4QP6A 1VEBA 1ZOGA 3LXNA 3I81A 3PA5A 5H3QA 5HE1A 5JN2A 3SD0A 3T3UA 4EOPA 1Q3DA 4DH8A 1NVRA 3H4JA 2XBJA 3FQHA 5KCVA 2HWOA 1T45A 5HCZA 4BTMA 4A9SA 4TPTA 3VBQA 2J0JA 4RQKA 4X6RA 5CI6A 5HIDA 4ZTMA 4ZSLA 4EOQA 5AFVA 1M2PA 3MA6A 2WIHA 1OZ1A 3FY2A 4PL5A 4HZSA 4BKZA 1KOBA 5DR9A 3THBA 5CVHA 3MFRA 3LFSA 3MH1A 3TTIA 5CENA 5M57A 3OS3A 4CFNA 4DFUA 2J0KA 3PXYA 4G3CA 5EYDA 5DGZA 3CP9A 5I9WA 4FG8A 4R78A 2X7GA 3AC3A 2WQOA 2GNHA 1JAMA 3PVWA 3ZDIA 4M97A 1JVPP 4BN1A 2OW3A 2HYYA 2ESMA 3EWHA 2DWBA 4FG7A 3Q2MA 3TV6A 3EOCA 3POOA 3MY1A 3EKNA 5AADA 3UE4A 4RX9A 4G9RA 4D0WA 4EOLA 3LMGA 1KV2A 3VS6A 3PXKA 4D1XA 4OBOA 3BBTB 2IW6A 4AUAA 5JKGA 3TZMA 3EL7A 3DK6A 3DTWA 3QRJA 4MD8E 4ZLOA 3D2IA 3HMMA 4J71A 2Y0AA 3PWYA 4PDPA 4WNPA 4L52A 4IAFA 4RIOA 1ZMWA 4FBXA 5CY3A 4W8EA 3DDPA 1R0PA 5EYMA 4LL5A 4F1TA 1MRYA 4FSQA 5JMSA 2W1EA 4CFXA 4DTKA 3HP2A 3BX5A 4Y83A 1M7NA 3S4QA 3F69A 4L7SA 5DFPA 3FLYA 4AW1A 1VJYA 3IECA 4O22A 5CAOA 3LJ1A 3CGFA 3NX8A 4AZWA 4AX8A 3UQCA 3W32A 2YN8A 4GVJA 4WSYA 5HGIA 2LGCA 5JZJA 1TQPA 4YZMA 3FMEA 1Q8UA 5HTBA 3BQCA 3JR1A 4JIKA 2WEVA 5CU0A 3CLYA 2B9FA 5FLFA 5B7VA 2W99B 4XG7A 4C0TA 2CN8A 3DBCA 3FHRA 5DEYA 5EI2A 4BC6A 2OLCA 3HNGA 1DAYA 2WMTA 2DUVA 3V5WA 4D5HA 4QPSA 4FSRA 4I0RA 4EBWA 4OLIA 1G5SA 1QPJA 4EQUA 2VAGA 1YI6A 5E92A 3OOMA 4GEOA 4FIFA 4LMNA 3GEQA 3EYHA 5F20A 1LPUA 3CKWA 2E9OA 1A06A 4YJQA 4FE2A 3OC1A 4F64A 4QQCA 3UYTA 4O27B 4O6EA 1H1PA 3DXPA 4C3RA 3VBWA 4C62A 4GKIA 3C51A 2C5NA 4BDAA 2YCSA 5LVOA 5BYYA 2R0IA 2WMQA 3IGOA 2WTJA 4J95A 2YWPA 3C50A 4IACA 4XX9A 1IA8A 4JIAA 3UOHA 4A06A 4ANSA 4E5BA 5KHXA 4A07A 4NEUA 4YBKA 4C2WA 2J5FA 4MH7A 4L7FA 3COKA 2XEYA 4PF4A 3AC4A 1YI4A 1ZRZA 3FXWA 4QMLA 2BRGA 3BGZA 3V51A 4DAWA 4FKUA 4CMUA 3G9LX 3D94A 2Q0NA 3VUGA 4ERWA 3UVQA 3O8TA 2CKPA 3H0YA 4OBPA 1OMWA 4FIIA 3P4KA 3JS2A 3FKNA 4K6ZA 4QRCA 2CDZA 5DR6A 2BRHA 4PNKA 4I93A 5CASA 4DFNA 3OG7A 1WFCA 3FEGA 3SW4A 2R7BA 5ETAA 4NCTC 3WZEA 3CJGA 4QMXA 3E3PA 5IA2A 1ZARA 4KUJA 1DI9A 4GFGA 3G51A 5J7BA 3EMGA 3TI1A 4EUUA 5JFVA 3D83A 2XP2A 3A8XA 4DFZE 4USEA 3L9PA 4W4WA 4ZSEA 2OH0E 2UZOA 2LAVA 2X6DA 4YNOA 4FNXA 3HA8A 2G2IA 4FIEA 4O7YA 3CC6A 3Q96A 4PDYA 4Y8DA 4EH4A 4CCBA 4QMVA 4WUAA 3WBLA 3A7HA 4AE9A 1UNGA 2QOFA 3DB6A 3GC0A 3MPMA 4RJ7A 5EOLA 5IUGA 1YWNA 4AN9A 3A4PA 3NDMA 3ZSGA 1YXVA 1FQ1B 2VX0A 5AR5A 3ZCLA 3TDVA 3MIYA 4RVLA 5M4IA 3IK3A 1GNGA 3BHUA 5JZNA 4GU6A 4O0TA 2GNFA 3R6XA 2WZJA 2J0MB 3KY2A 5CU6A 4O82A 4EOMA 3HAMA 4CFUA 5BVDA 4RT7A 4DGLC 3VHKA 2UZDA 3QLFA 2EXMA 3HV3A 2VO3A 3I0OA 4FT7A 4JAJA 4M66A 1OIYA 4NM5A 1WVYA 5CU2A 4DEGA 4JQ7A 5IEXA 3JXWA 2XKFA 4QYEA 3QZGA 2PVKA 3UO6A 2F7ZE 5KBQA 3OFMA 3E8EA 2ZOQA 4JDKA 1CKJA 3QTZA 4F9AA 2GS7A 3GC7A 2XA4A 4AN3A 4IE9A 2VUWA 4LFIA 3I6WA 3AMBA 3GQIA 4IANA 3SXFA 1X8BA 4E4LA 1UWHA 4DE4A 3QCXA 3HVCA 3RCJA 4CRSA 2GNGA 2FSOX 2XNBA 4FSUA 4MHAA 3DDQA 4IMYA 4KKEA 3LFCA 2J0LA 4O0XA 3PZHA 1M52A 2ERKA 3WIKA 5IUHA 4XG9A 3ZH8A 3C1XA 4KD1A 4K33A 3ORPA 4I6BA 4DG2E 2ITNA 3R8ZA 5CX9A 1XH6A 5LMKC 5EQYA 2BALA 2P33A 5J5TA 1KWPA 1B39A 4FX3A 4OTHA 3NR9A 3ZS5A 4XLVA 4PY1A 4YPDA 3OBJA 3AGMA 4UYNA 4FVPA 1I44A 4OBQA 2HXLA 3QD0A 2VTMA 4WBOA 4FV1A 3IDBA 3MBLA 4D58A 1LP4A 2F2CB 4BZDA 2XB7A 4I6FA 3KCFA 5IZFA 3R01A 3D0EA 3WF9A 4C2VA 2XIZA 4NU1A 4R3RA 4BCIA 3C4CA 2ITPA 4MTAA 2C1AA 2FUMA 2UZVA 4IZ5A 4UYAA 3IW4A 5CALA 3ZFYA 2VU3A 5C8KA 4FYOA 2UW4A 4R6VA 3LXLA 3S0OA 4ZMEA 2R3KA 4BCPA 1OL5A 4U80A 2RL5A 2WPAA 1G3NA 3PWDA 5AAFA 3W10A 5KBRA 4FEVA 2GHLA 3A2CA 4ZY6A 3EFJA 5CNNA 3COHA 4MXOA 1QMZA 3ANRA 5KZ0A 5AUXA 2I7QA 3PA4A 4FL3A 4I24A 5E1EA 3SG9A 2PZRA 2QO2A 2O8YA 5DYJA 4ZJIA 3ORKA 1WCCA 4I4EA 3RPOA 5FTGA 1LEZA 5M4UA 1YVJA 4D2RA 1GIIA 4FT5A 1FMKA 4RVTA 1ZZ2A 2YIRA 4LOOA 4IWPA 2WQEA 5HIBA 1BLXA 2CCIA 3KVWA 3DXQA 3UOLA 4QMWA 3PVBA 2C5OA 3VC4A 3O8PA 4L3LA 3R0TA 3HYHA 5DT4A 3E8DA 4GK4A 4GG7A 4L53A 2YIWA 3NEWA 3PYYA 3Q9YA 3UVPA 4CCUA 3DB8A 5BQ0A 1E1XA 1DS5A 4Q5EA 4RWKA 2QG5A 3F7ZA 1UVRA 3QUDA 5DIAA 3BU6A 4IM0A 4QMQA 5B0XA 2XBAA 4JXFA 2IZRA 4YJUA 3W33A 4AZTA 4O7SA 3LFDA 2IPXA 5CEOA 3VAPA 3IW5A 3QL8A 3SC1A 4MD7E 5BNJA 4MWIA 3G0FA 4ZS4A 2CN5A 4C35A 3TJDA 4W4XA 5L8LA 3QTRA 3ATSA 2BILB 4M84A 3FZPA 2AYPA 1WBWA 2BZIB 1AD5A 2GTNA 4BFMA 5DI1A 3G0EA 1Y6AA 4J7BA 3LCSA 4FKJA 4I4FA 1OIRA 2IZSA 3S2PA 4YJNA 1E9HA 2C3KA 4FKIA 2GCDA 2FGIA 1R0EA 1GZNA 3IDCA 3LAUA 4ZTLA 3FMKA 2CLXA 1BI8A 1CSNA 4PP7A 3AT2A 3AQVA 3ROYA 2QCSA 5L2IA 3OCBA 3VF9A 4O38A 4P90A 4BDEA 2ITWA 3QQFA 5K0KA 3T3VA 3VNTA 3RZBA 3D4QA 3PTGA 4OTDA 5EH0A 3GCQA 4XG2A 3DOGA 2C69A 3ZLYA 2JIUA 4QYYA 4YZ9A 2A19B 2ZAZA 4F9WA 2OZAB 5DRDA 4DBXA 4DCAA 5ANIA 4C02A 4M68A 4MKCA 1W82A 3LQ3A 4I6QA 4M0YA 5GHVA 5JGAA 5D7VA 1Q8YA 1W8CA 2YM6A 4E6AA 1Z57A 5GZ9A 4KBAA 4YJRA 4H58A 4E20A 5I9ZA 2CGXA 3TZ9A 1CM8A 3V3VA 3KA0A 2ITVA 2C30A 3POZA 5J9ZA 1JKLA 1YXXA 2XK8A 3BYMA 4TYGA 4YSJA 5CAPA 5E9EA 2WTKC 5A46A 4BB4A 2O2UA 3UODA 4BGHA 3Q32A 3BGPA 2WEIA 4CMOA 4OAUC 3E87A 4WNOA 2GDOA 2YHVA 4JBVA 4EC8A 4JX3A 3OWPA 4O91A 4P2KA 4UY9A 1Q8WA 2WXVA 3U55A 5EKNA 3BLHA 3ZUVA 2QU6A 1SMHA 3GFEA 3I60A 5CXZA 2OIQA 2ITQA 4PV0A 2G2FA 1S9IA 3AD4A 3FKLA 3GXLA 2BHEA 2E9NA 3QXOA 5HI2A 2XYUA 1O6LA 3GU5A 3BE2A 3N51A 4UMQA 5KMNA 5C4LA 5IQHA 2YM4A 1YW2A 3TIYA 3KF7A 2UZLA 4GIIA 1T46A 4XOYA 4RA5A 1STCE 3ZDUA 4DEEA 1O6YA 4F7NA 2BZJA 2Z7RA 3QQGA 3O17A 2QU5A 3V5LA 5CF6A 4BDIA 2OZAA 2PZIA 1ZWSA 5EFQA 2EU9A 3SGCA 3SLSA 4KBCA 1RDQE 3IW7A 5CTPA 3EN7A 3GT8A 4ACGA 4NTTA 3B2TA 4I1ZA 4ZMFA 1ZOHA 2R3LA 1H00A 4FTOA 2J5EA 4R1YA 2WIPA 1SM2A 4B9DA 4O2ZA 3QRKA 4U6RA 4V01A 2ACXA 3SVVA 3R9HA 3UJGA 2VTSA 3FYJX 3ID6C 5CEKA 1OL2A 4G6LA 4PX6A 5EOBA 4RMZA 1JKKA 2PVHA 4FL2A 5C8NA 3V01A 4EC9A 3F2RA 1FGIA 4CT2A 3SOAA 1A9UA 3R02A 3DKOA 4KKHA 3OW4A 4PP9A 5CAQA 4QP4A 1KE9A 4X2GA 4R3PA 1YRPA 2H34A 3NW7A 4E6DA 4WIHA 2AUHA 4ZLZA 4AAAA 1A48A 3OP5A 4DH7A 5BVFA 3L8PA 3Q9WA 2BFXA 1JLUE 4MXZA 2BPMA 2RF9A 4I94A 3HMOA 4RC2A 1TVOA 1Q97A 2J7TA 4L44A 3SKCA 4FKQA 3VS0A 2WQNA 5AR3A 1GIJA 1M17A 3AG9A 3D7TB 3ORLA 1OIUA 4HGLA 4M12A 3CPCA 3GOPA 4FTKA 1BMKA 3DQWA 4FV4A 3L8VA 2BRBA 3PIXA 3U6IA 2UVYA 2XK4A 3OZ6A 4IB5A 3W1FA 2C1BA 3R30A 4FKRA 3FMLA 5KX8A 2JKMA 3BZ3A 4BDGA 4KIKB 3PSDA 4LUEA 4FYNA 3JY9A 1SNUA 4QQ5A 3RAHA 4Y95A 4IVAA 3DKCA 3QWKA 4FZFB 3ZBFA 5D9HA 3FLWA 4HGSA 1H0WA 3GVUA 4JNWA 5D41A 4I0SA 4YC3A 1OIQA 3K3IA 1ZMUA 4YO4A 1RQQA 1MUOA 3H9FA 2PWLA 4H1JA 4M0ZA 5DNRA 4FTUA 4GIHA 2FH9A 5M4FA 3BHTA 1MQBA 5C4KA 1KE5A 5ANEA 4BIBA 5LXMA 4FKGA 2QLUA 4EI4A 4BCMA 2WTVA 2QR8A 2XNMA 4HPUE 5CT0A 3VUHA 2P4IA 3FC1X 3SXRA 4Z7HA 4G31A 3MYGA 4FT3A 2W4JA 2GMXA 4H3BA 4D1ZA 3A7FA 3UMXA 5GNKA 4GUBA 5HD7A 4GMYA 3U6JA 3PE1A 5J9LA 4AFEA 3LOKA 3ANQA 4DC2A 2B9IA 1KE8A 3D7TA 1JKTA 3Q9ZA 4IWQA 5AV2A 3ZBXA 2GNIA 2VWWA 3A61A 2HXQA 2W7XA 1ATPE 4ZP5A 4DEIA 4QTEA 4IB3A 3R7VA 2IW9A 4AU8A 2UW0A 4KIKA 1SVEA 4ZTQA 4GUEA 3F3WA 5H2UA 4J53A 2HZNA 2R3FA 5I9UA 4ASZA 4DGMA 4DGGA 2WMXA 4JBQA 2XM9A 1Y91A 4YJOA 3HEGA 3QQJA 4TT7A 3DBQA 2QOHA 4AT5A 4LRJA 4Y85A 2W9ZB 1MP8A 5E91A 2O0UA 2YWVA 3FPMA 2I0EA 3E64A 5FBNC 1YXUA 1O9UA 2GSFA 3NPCA 4USDA 3FWQA 4AXAA 1Y8YA 4GCJA 3FZTA 4UWBA 4FIGA 3EFWA 3QTWA 2W4KA 2XJ1A 5CXHA 5M06A 2PUUA 4BL1A 1G8AA 1V0PA 4C4IA 2W9FB 5CU3A 3UC4A 4TRLA 3NCZA 3O7LD 4DFYA 3FL4A 3OW3A 3ZZWA 5HESA 1GZ8A 1J3HA 2W5BA 5I9VA 1H28A 1KE6A 2ITYA 3KK9A 4TXCA 5M4CA 3KC3A 4CKJA 4BYJA 3UNKA 2QO7A 2X2KA 4HJOA 3NUSA 3ORZA 3ZLWA 2BTSA 4GVAA 3FZOA 3MPAA 4OUCA 2HK5A 1NVSA 4NSTA 3UIUA 4CZUA 2VWUA 2R64A 1MQ4A 4GYIA 2Z7SA 2R4BA 4CTCA 3FI2A 4IX4A 3MVMA 4ASEA 4RJ8A 3KMMA 3SXSA 1CDKA 3WZUA 3EFLA 2NP8A 3NYOA 2JDVA 3TNQB 4DHFA 5KNJA 4IW0A 2P55A 4AOIA 5LCJA 5AR2A 4EOIA 4FODA 2OO8X 4D2SA 5I4NA 5IA3A 3QTQA 3GCSA 2XK9A 4Q2AA 3NRMA 4FV9A 4EYMA 5M53A 2GS2A 4ZLYA 2XYNA 4IWOA 5JRSA 4QNYA 4J1RA 4L43A 4RJ6A 4EZ7A 3UO4A 5HVKA 3FMHA 2QVSE 3A62A 3FAAA 3LCOA 4FZ6A 4KABA 4PMSA 4TW9A 5ETIA 4DH3A 1JSUA 2CPKE 2G2HA 1PHKA 2UW9A 4M7IA 3ZU7A 5IA5A 2RGPA 4KIQA 3C4WA 3TM0A 3EQHA 2ZV2A 3PJ3A 4CV9A 4Z16A 4AW0A 5AUUA 3PXFA 4XNEA 5I0BA 1UKHA 3EQGA 3ZMMA 3ZTXA 2J0IA 5A9UA 3VQHA 4CT1A 2VTHA 4DFLA 5GZ8A 2PTKA 5A4LA 2PZYA 1YHWA 2HCKA 2DQ7X 4DFXE 4UMRA 2UW6A 1JSVA 3Q4TA 5CEPA 4TYIA 3BWJA 4AZVA 2XK6A 3HL7A 3OCSA 4EHGA 3UG1A 1EH4A 3EL8A 4V0GB 5AEPA 4YMJA 4E4XA 3VIDA 4EH5A 5IA0A 4UZDA 1E1VA 3MVHA 1CTPE 2ZDUA 2XNEA 4EHEA 5HEZA 3O51A 3ODYX 4KKGA 4E93A 2UW5A 4GK2A 3NUNA 3EFKA 4QPMA 2HOGA 2BDWA 4FV0A 4XV2A 2YITA 1H1QA 3C4FA 4JAIA 3K3JA 3VBXA 3GI3A 5HE2A 2VV9A 4GSBA 1OPLA 4FUYA 3FLZA 3QAME 4LGGA 4HPTE 4F65A 3P1AA 1PF8A 3D7ZA 4EJNA 2JITA 4OTGA 2ITZA 3PJCA 1UWJA 3V5PA 3SW7A 4H3PA 2BZHB 3QUPA 4B99A 4EZ5A 2PVFA 4S32A 1WVXA 4P4CA 3CSVA 4MAOA 2YZLA 2E9UA 4D0XA 1BX6A 4G3GA 3EN5A 4L42A 4R8QA 5K4JA 2A0CX 5JH6A 4RFYA 2B0QA 4GT3A 3QA0A 4CG9A 4WBBB 3NYVA 4BHNA 4K11A 3P23A 2C6IA 3ZSHA 5IA4A 3QBNA 5EI8A 5JSMA 2PMIA 2B7AA 1ZY4A 4V0GA 3TKIA 3FE3A 3ZONA 2C3LA 4ACDA 1R78A 4YTFA 3LMIA 4IXPA 1BYGA 5L6PA 4PDOA 2YJSA 4K8AA 2WAJA 4AG8A 2UVZA 1F0QA 4EQMA 2BKZA 2XIXA 3RK9A 4LUDA 2Y7JA 5ACKA 2RFSA 4MD9E 3VQUA 1OUYA 3PY0A 2XVDA 4L9IA 3PPKA 3W8QA 2V55A 4WO5A 2Y6OA 3MN3A 4E7WA 5L4QA 3DQXA 4FSMA 5AR7A 2X1NA 1HCLA 3QRTA 3RINA 4C3FA 4GJ3A 4GH2A 4X2NA 3KXXA 3G6GA 3GQLA 3BHYA 3DLZA 5TKDA 4D4VA 4ZZMA 4DCEA 5AA9A 4FV8A 1BL6A 1FBNA 1HOWA 2YABA 3LPBA 4IFGA 4APPA 4EUTA 3KU2A 2I0HA 4IB1A 3OTVA 4O7NA 5IQAA 3D5WA 4IADA 4E4MA 2BRNA 1JSTA 3HA6A 3QCYA 4QTAA 4EKKA 5DA3A 4KRCA 4K9YA 3QZFA 4MX9A 3ZUTA 4TWOA 4CV8A 3LM5A 3FYKX 2PZ5A 1WBNA 3K54A 4Y73A 2JKKA 3W2SA 4I21A 4O7ZA 1YOJA 4O0RA 3CGOA 4CFFA 5ETCA 5FP5A 3QX2A 4ZSAA 3DZQA 4FEXA 2J51A 2BIKB 3BPRA 5AP2A 4IAZA 4ACCA 1GJOA 5T3QA 3V6SA 4ZSJA 2PVYA 4NYEA 4TWCA 3KXGA 3LFBA 3P08A 2NPQA 5I3RA 2C6LA 4S33A 4UXLA 4X0MA 3GU7A 4LV5A 3QD2B 1SVGA 3FPQA 3DXNA 5HU9A 4ZS0A 1Q61A 4ZTNA 4L8MA 3C5UA 4P5QA 4AOJA 2HAKA 4FKLA 2OIDA 5HLPA 4QYHA 3PUPA 5CVFA 5AP5A 3V8SA 2JKOA 2XS0A 4LL0A 2VTAA 4LV8A 5FTOA 1Y57A 3RPSA 2YFXA 3UZRA 4BGGA 2IW8A 4IWDA 3RGFA 2XMYA 4GFOA 5ITAA 5GIPE 2W1GA 2B1PA 2XZSA 5DOSA 3O96A 4XP2A 2F7XE 2FYSA 3MB6A 2QHMA 4FZDB 2HZ0A 3GBZA 4FTRA 4JQEA 4LOPA 4MQ2A 2VRXA 2VGPA 3PXZA 3TZ8A 3RK7A 1Q99A 2H9VA 2YLEA 3DS6A 2Z7QA 3F61A 5BPYA 2PPQA 4BDDA 2BAKA 4YURA 3EZRA 5AP6A 4DGNA 3AT4A 4E6QA 2YIQA 2PZPA 3UZPA 1B38A 2FB8A 2HW7A 1XBCA 3A99A 5EYKA 4RRVA 4ENYA 2VNWA 3KULB 3WZKA 3V5QA 4ENXA 3FQEA 3FMNA 3OOGA 2G9XA 2B52A 4HVGA 3NVMB 3DAJA 3QRIA 5JFXA 4IC7A 2ZV9A 4M14A 4QP3A 4E73A 5EI6A 5BVNA 2O64A 1VYWA 2B55A 2WQMA 5DE2A 5IH6A 4QYGA 2QI8A 4BCGA 5J8IA 1KE7A 2VX3A 4PDSA 4HGTA 4X3FB 1H1RA 3ZC6A 4ZJVA 1JNKA 5JQ5A 2VNYA 4IIRA 5DPVA 3LZBA 5HKMA 4DT8A 5A4TA 3TUBA 5FG8A 3F3ZA 3F2NA 4I3ZA 3VUDA 3W8LA 3MESA 5F94A 4XBUA 2ITUA 2NNWB 3NCGA 3L9MA 4CD0A 3O2MA 3OEFX 2P2IA 2QOIA 2RFDA 2ZYBA 5C8MA 2JAMA 4CKIA 4XOZA 4JBPA 4AW2A 3SG8A 1REJA 3ITZA 1YWRA 3WF8A 4ID7A 3TL8A 4HYUA 5FXQA 3PPJA 3LE6A 3CJFA 5K4IA 2C6OA 3CKXA 5F4NA 3VJOA 4FK3A 2ITTA 4QP1A 1DI8A 3C0GA 5IPJA 4MQ1A 3LHJA 3IKAA 2OKRA 4EH8A 3MPTA 4RIYB 3HKOA 4U3ZA 3KF4A 4ALVA 1FMOE 4CFVA 4IZYA 4W4VA 4ACHA 3KULA 5CF8A 5EM8A 3RKBA 2ZB0A 5EW3A 4MF1A 4D2TA 3W2CA 3U6HA 5CF5A 3O0GA 3R04A 2Y4IB 4LGDA 3FZSA 4YLLA 4YR8A 5JK3A 3PSBA 4A7CA 1XH7A 3PJ2A 3CTHA 4KA3A 1PMVA 2WHBA 2OH4A 4OTWA 2R9SA 4AE6A 2UZEA 2VTOA 4X3FA 4I92A 2REIA 4G3DA 2C6TA 2UW8A 5HICA 1LR4A 5E8WA 4H3QA 4JBOA 4BCJA 3M1SA 3NS9A 5FP6A 3ZSIA 1W0XC 5GJDA 2PSQA 3UIBA 4MCVA 3R8LA 3BYUA 3AC1A 1H07A 5AIKA 3O8UA 5E8VA 3VRYA 5EDRA 4I41A 4KB8A 5EYCA 2CGUA 2E9VA 4FA2A 4BZNA 5IQBA 2QOOA 1UU3A 3GGFA 2WMWA 3QQUA 4GJ2A 4FK6A 3FKOA 4RJ3A 4UBAA 4UV0A 3ZYAA 2VTPA 5EM6A 5HHWA 3QRUA 2XF0A 1V0OA 3DGKA 2HELA 4ALUA 4YZNA 4B0GA 5JGBA 4XV1A 4QQJA 3CQUA 3S95A 1TKIA 3CTJA 1GOLA 4ASDA 2C3IB 3ZHPC 4RIYA 2C5VA 3R1NA 4OTRA 2WOTA 2WKMA 1CMKE 2XNGA 3FSFA 5L2QA 4F7LA 5JGDA 2OXDA 2QONA 2CKOA 4YC8A 5AA8A 5CNOA 3VS2A 2RIOA 2OBJA 3NAXA 2W0JA 2ZV8A 3TJCA 2ONLA 5CLPA 5HG8A 3CCNA 3KEXA 4ITJA 4O7VA 2J90A 5HCXA 2W1IA 4C38A 3U51A 4E1ZA 3FMDA 4FVRA 5L2SA 3C5IA 3IGGA 3DBEA 4J96A 3G33A 4WNMA 5DT3A 4BDCA 4JT3A 4IAIA 3UNJA 2YCQA 4FKVA 4I23A 3BE9A 1NXKA 3LQ5A 3R00A 4WRGA 3B8RA 5HBHA 3F3UA 5EK7A 4ZAUA 4MWHA 3RM6A 3EQFA 5FM3A 3BLRA 4U41A 4RX5A 5LVMA 3QCSA 5I5ZA 1XJDA 3VW6A 1K3AA 5BYLA 1ND4A 1OPJA 2PUIA 5B2MA 3VBTA 3CS9A 1PYEA 4UALA 3U4WA 4AZSA 3NNVA 4PPCA 2X6EA 2JKQA 3P86A 4O2PA 5IEYA 4O1OA 4IZ7A 4KWPA 3NMUF 2GQGA 1ZZLA 4J99A 3PRFA 1H1WA 1YOMA 3I5NA 3GFWA 2PHKA 3I79A 3WF5A 4GS6A 1OKYA 1OL1A 3LCDA 2ZMCA 4RA4A 4U0IA 4IX3A 4JL9A 2XKDA 3R8PA 4BBMA 3GP0A 3R63A 4AP7A 3ORTA 4L68A 3VWAA 3WYYA 3IOPA 4PPBA 3DCVA 5HCYA 4DH5A 3HUBA 1XH9A 1H8FA 4P5ZA 3C4ZA 3E93A 5E8ZA 4F0IA 1J1CA 3CR0A 1W98A 4D28A 3DKGA 4A4XA 4GT4A 3RPRA 4O7WA 3PRIA 5AP3A 3EIDA 4QOXA 3ZZEA 4D4SA 4O7LA 2Z8CA 3GB2A 1PRYA 3DK3A 5FQDC 2EB3A 3HDNA 5JT2A 3CY3A 3L8XA 2YM5A 2X0GA 3K2LA 4Z7GA 3NW6A 3HZTA 2GNJA 4YC6A 4EK4A 2WB8A 2XKCA 2C6EA 4L6QA 3ALOA 5M07A 3KK8A 5AUWA 4BKYA 4I5MA 4MVFA 1URCA 2W96B 4GG5A 4HYIA 4FEWA 4JR7A 5I3OA 4ZZNA 5AAGA 3TUCA 3R9OA 2X4ZA 2CKEA 4RGJA 4AOTA 3S00A 1PXPA 3RP9A 5KMJA 5A14A 4FGBA 3BEAA 2O5KA 5FEEA 4WOVA 4QMOA 3LFFA 4XV3A 5DHJA 4F70A 2R3IA 4J97A 2UUEA 4WRSA 3L9NA 3DFCB 4M15A 1ERKA 3DJ6A 5CQUA 4FTTA 1IG1A 2CGWA 2PE2A 3QZHA 1P4OA 4U40A 4O0WA 3ZOSA 4X2JA 4D9UA 1K9AA 3QKLA 4O1PA 1KSWA 3HDMA 2C5XA 4DT9A 2FA2A 4Z3VA 4IJ9A 2I40A 3O71A 2PVNA 4N4SA 4C34A 4FKPA 5K0XA 4EK6A 3BCEA 4CMTA 5BMSA 4AACA 4O81A 4Y46A 2OJGA 5AV1A 2PMNX 3WF6A 4F9BA 5HVYA 4L46A 2OSCA 4ANQA 4F9CA 4U9AA 5D7AA 1GY3A 4H39A 1RJBA 5C9CA 2PU8A 3VS3A 4QPAA 1P2AA 3JPVA 3OHTA 4ITHA 4XP0A 3KREA 3EQIA 2FSTX 4O21A 3R9NA 4OTQA 1NVQA 3S3IA 3AC8A 1FINA 4CYJA 2OK1A 2R5TA 3WZJA 2VWZA 3OF0A 3QA8A 4E6CA 4YUQA 2X39A 3ACKA 5EDPA 4A4OA 3ULIA 2C3JA 2X8EA 4HOKA 2PMLX 4RZWA 4AA0A 4YBJA 4U8ZA 4D55A 3ZLXA 3VJNA 2B4SB 3Q9XA 4ANLA 3P7BA 4JJRA 4WD5A 4JRVA 2CLQA 3KN6A 1JPAA 3EQPA 3HAVA 4HNIA 4R7IA 4CQGA 1TQMA 3NLBA 5A6NA 3KGAA 4PL3A 2JFMA 2R0UA 4CEGA 3UVRA 5KMLA 2KTYA 3ENHA 2WMRA 4XMOA 2CGVA 2GFSA 1ZYCA 5EDQA 5J1WA 5DEWA 4AFJA 1ZMVA 3ELJA 2ZJWA 2HZ4A 4AWIA 3KXHA 4FNZA 2IVTA 3Q60A 4JQ8A 2AC3A 3C4EA 3CIKA 2ZM4A 3TCPA 3PY1A 3Q6WA 3BHVA 3C13A 3KXNA 3QD4A 3QWJA 3PVGA 2JDOA 3SX9A 2F2UA 2CJMA 4K2RA 3RAIA 4U81A 2QHNA 4HVSA 5CEQA 3GNIB 5KMOA 4O7RA 4DFBA 2WTIA 3G15A 4YTCA 5K5NA 4A9RA 4KAOA 5CWZA 5KUPA 4G16A 4IM3A 4RIXB 3R7IA 4PNIA 5D1JA 4BCOA 4KSQA 1FOTA 3EZVA 4QMZA 4CRLA 5IQDA 4CQEA 3OXTA 2V22A 4A9UA 4O0UA 1H25A 3I4BA 5LARA 4YZDA 4HYSA 3VHEA 4C4JA 2OU7A 3KQ7A 5AR4A 2HZIA 2X4FA 2VZ6A 4FV7A 1Q24A 4BTFA 2RKUA 2XIYA 2NRUA 3E3BX 3UP7A 4H05A 3HMIA 3NIEA 3QYZA 4ZTRA 3RTPA 3K5UA 3R7YA 2JIIA 5D10A 3QFVA 3GCPA 2UZWE 3TNPC 2XK7A 4JS8A 3LFNA 3TKUA 3NUUA 4RWLA 5C27A 2QG7A 4QMSA 5CYIA 5TR6A 3WIGA 4JRNA 4QMUA 4NKSA 4EHZA 4N0SA 3RNIA 4AGDA 3VVHA 4BIEA 3VW8A 3U54A 2W1ZA 2GU8A 3OD6X 1PXKA 2YDJA 4YJVA 5FUTA 2VWXA 1NY3A 3VBYA 4L3PA 3V5JA 3JY0A 3WILA 1OKVA 4BCHA 5F9EA 2F9GA 1JKSA 4YO6A 5HBEA 4DH1A 3RPYA 1SYKA 4G5JA 2W1FA 2WTWA 3MTLA 5AMNA 5K5XA 1UU8A 2BAJA 2BRMA 2EWAA 3K5VA 3KRRA 4NT4A 4QO9A 4RC4A 3V6RA 4RIXA 4FV3A 4XYFA 2YERA 4YTHA 4BRXA 1F5QA 5DRBA 4C4FA 2R2PA 1G8SA 2ZV7A 3BQRA 4LRKA 5IA1A 1J1BA 1ZYJA 3IPHA 2A27A 5FM2A 2A1AB 3FDNA 4Y5HA 4TWPA 5DBXA 2ETRA 2WMBA 3P7AA 2R3NA 4IBMA 2IVVA 2WU6A 3WE4A 2C6DA 1KV1A 1WVWA 5IQFA 1U59A 2CCHA 5IU2A 3AMAA 2BHHA 5KMIA 2QODA 5AP0A 4U97A 5AUVA 4MXAA 2YCRA 4JI9A 4D1SA 1WBOA 1DM2A 2GHMA 4GYGA 4RPVA 4D2VA 2W05A 4FV2A 5CSVA 3H10A 5L8KA 5TO8A 3V8TA 3COMA 2QD9A 4BBFA 3Q5IA 2WMAA 4JOAA 2C6MA 3LVPA 5LOHA 3W55A 1OUKA 4AGCA 5CAUA 5ANOA 2J9MA 1J7IA 3PIYA 4C57A 5HLWA 3DBFA 4PWNA 2IWIA 3N4UA 4O0YA 4APCA 4NFNA 4IX6A 4KINA 5C1QB 4PTCA 3R1SA 3B2WA 3BU5A 3TIZA 4EH9A 1R39A 1ZY5A 3MSSA 2YDIA 2BFYA 5IQCA 3BBWA 4BDJA 3E7VA 5LMAA 2WD1A 3MFUA 2F49A 5CF4A 5GIOE 4IJPA 2YA9A 4KIPA 4BDKA 5HTCA 3OT8A 3RVGA 4R1VA 5F95A 2C6KA 3FLNC 2Y6MA 4GL9A 3MA3A 2WGJA 3EH9A 5FEDA 5M44A 4KNBA 2JDSA 4K18A 4N6YA 4F0GA 5IEVA 5EQPA 4NM3A 1AQ1A 3E7OA 1ZAOA 3BGQA 3KN5A 4B6LA 4C59A 1IASA 3MFSA 2OJ9A 2BROA 2UZNA 3NNUA 1YQJA 4WSQA 3RHXA 5CSPA 4NK9A 2A2AA 2BR1A 4NWMA 4BYIA 3NWWA 4D5KA 1JWHA 3KVXA 5AV4A 2WFYA 3QTIA 5ICPA 3QF9A 5AX3A 3LJ2A 5J95A 1ZYSA 4IH8A 1V0BA 3UG2A 4G9CA 3F5PA 1FVVA 1YHSA 2IVUA 3RNYA 2J2IB 5FDXA 3N9XA 4RC3A 2YISA 5E8UA 3TKHA 2YZAA 1JOWB 3GCUA 3OT3A 4W4YA 5FRIA 4RWIA 5CANA 3RK5A 1UKIA 2X81A 2QKWB 3DAEA 4QP7A 4C58A 3R2YA 4J8MA 2QC6A 4X3FC 1NT2A 1PXLA 4EK3A 3OROA 4UEUA 3HGKA 1U54B 3R9DA 2RSVA 4IM2A 4YHJA 4E26A 4TTHB 1PMUA 3ZRLA 1QPEA 4KS8A 5IDPA 3EQRA 4KIOA 3KB7A 5HE3A 1ZOEA 3R8MA 4BI0A 4C8BA 4CZTA 4EK8A 3HRFA 3ACJA 2YIXA 4YNEA 3CQWA 2OGVA 3GU8A 5H8BA 1Q5KA 2V7OA 4U44A 5ANJA 1ZXEA 4FKSA 2R7IA 3VS5A 3DY7A 3FL5A 1WBTA 3MVJA 5FGKA 3TACA 5KO1A 3TWJA 4LYNA 5GINE 3UP2A 3UO5A 1OM1A 3DNEA 2OG8A 3TNIA 3UDBA 3HV4A 4KRDA 2VX1A 4EL9A 4GK3A 5IQIA 5K9IA 3MH3A 5EHOA 3OXZA 2X7OA 2RG6A 1OITA 2HENA 3W18A 2H96A 2OWBA 1GZKA 4KSPA 4UXQA 4CNHA 4FSYA 2VWIA 4DEBA 3KRXA 4RZVA 4QTBA 5IMXA 3CD3A 5KKRB 3FJQE 3BI6A 2R3PA 2ONLC 3F5UA 3Q4ZA 3QGWA 4XRLA 5EM7A 2OXYA 5F1ZA 3RWQA 2Y4IC 4BCKA 3BHHA 2YIYA 4JVGA 3UIXA 4G6OA 2JC6A 5HBJA 4MBJA 2Z60A 5IQGA 2JBPA 2W1HA 3KXMA 4D2WA 3ZC5A 2RFEA 4RIWB 2IZTA 3CTQA 4H1MA 5AJQA 1U54A 3BWFA 4FEUA 4Q5HA 4YHTA 3LFAA 3Q3BA 3QHWA 4Q9SA 4ZEGA 3CEKA 5CSWA 1XO2B 2CNQA 4QTDA 5E4HA 5T68A 5EW8A 3A7JA 4LQMA 4FC0A 5E8TA 5BVOA 2GPHA 4FKWA 2NO3A 3LLTA 3G5DA 5TE0A 3RALA 3SQQA 2UW3A 2XK3A 4N70A 3RCDA 4HVDA 3QTXA 3NZ0A 4OR5A 4I5CA 5CI7A 4RX7A 4RQVA 3ZO4A 4TYJA 2JBOA 3R7EA 4E4NA 3LMHA 4EKLA 3FI3A 4C7TA 4EONA 5IG1A 3RJCA 2PUNA 2W5AA 4IC8A 4NFMA 1XBBA 4WA9A 3BV2A 4EOKA 5HG5A 2OJJA 5CT7A 3TTJA 2HWPA 3Q52A 4RVMA 2HY0A 4RWJA 5D12A 4M13A 5ANKA 4HZRA 4EH2A 1XHAA 2C0TA 4HCVA 2JD5A 5HNIX 4GFMA 4C4GA 3D5VA 4DEHA 4FTQA 4CXAA 5A4QA 5BUJA 1UNHA 5DMZA 3Q04A 3NSZA 4UWYA 2PYWA 5K3YA 2H6DA 3KRLA 2GFCA 4FV6A 4IDVA 4L00A 3IONA 3OWKA 5LJJA 4G3EA 2VTNA 4RIWA 2A4LA 3C0HA 3RPVA 5BMMA 4ARKA 5A54A 3D5XA 1OPKA 4NJDA 4FICA 1IR3A 2CMWA 3CQEA 3ZRKA 5M08A 5B2LA 4FI1A 3O50A 3D14A 1MRVA 3ET7A 3ALNA 5LVNA 2YLFA 2E9PA 3COIA 4LI5A 4BTKA 4AGUA 2G15A 4YJSA 4WHZA 3MH0A 1UU7A 1URWA 2YACA 1YXTA 3BU3A 4O96A 4U7ZA 4WKQA 4LGHA 1GZOA 5AP1A 4ZIMA 4AA5A 4JG7A 4F7SA 2GTMA 4MBLA 4FIHA 4FNYA 4AW5A 4YLKA 3EQBA 1YWVA 3BYVA 4C4HA 4EK5A 1CKIA 4ERKA 4F0FA 3MY5A 4IDTA 3NNXA 3MWUA 4CG8A 3JUHA 1OGUA 2WELA 3BKBA 5GJFA 4G3FA 1VZOA 4D4YA 3ZO2A 4GKHA 3E5AA 3R83A 3L8SA 1O6KA 2UZBA 4FIJA 3MY0A 5IF1A 4XRJA 3I0QA 4XLIA 3TV4A 3EN4A 3CD8A 3QTSA 3MVLA 3NAYA 5HO8A 1PKDA 1OBGA 4YPSA 2QOCA 1U5RA 4FT9A 1YOLA 3IS5A 3PA3A 1H24A 4U3YA 2PVJA 3UBDA 4FZAB 2BDFA 2O65A 5JRQA 2ITOA 4FV5A 2VGOA 3OWLA 4X3JA 4TYHB 4BCQA 2BCJA 5HQ0A 5HX8A 3ZFXA 4BCNA 2YM7A 4Y5QA 5CAVA 1PW2A 5BX0A 4AT3A 3FLSA 4NKAA 3H3CA 1JQHA 3BEGA 3I7CA 3QX4A 1I09A 2IO6A 2XJ2A 5TOZA 1XH4A 4I22A 4DINA 4BIDA 2CNUA 3HRBA 3T8OA 4TL0A 1L3RE 4F1MA 3UGCA 2V7AA 3ORIA 3F6XA 4EHVA 2R3RA 4L01A 1W7HA 3Q5ZA 3W2PA 4YTIA 4Z55A 3VF8A 2ITXA 3ZO3A 3DJ5A 4RSSA 3ZXZA 3P9JA 3R7GA 3PSCA 3QQKA 4FMQA 3OCGA 1OL6A 4FVQA 1H27A 2QURA 4UMTA 1YKRA 4PMPA 2HW6A 2F4JA 3R1YA 2XNOA 2Z2WA 4CYIA 3LLAA 2C47A 3DKFA 4TWNA 1REKA 2OXXA 3W2RA 2F7EE 2V0DA 1PY5A 3ODZX 5CVGA 4BVUA 4CGAA 4J8NA 3P78A 2I1MA 4YJPA 3UPZA 4ANOA 2B9HA 3QZIA 4PRJA 4QT1A 3WE8A 1OECA 4IB0A 2BVAA 1K2PA 2Q83A 4BICA 4O86A 4CVAA 2Y4PA 2KULA 5HOAA 4LRMA 5CEMA 3QC9A 4XP3A 3SRVB 4IQ6A 3P79A 2W5HA 5KZIA 4JG8A 3R7OA 4TYHA 3PP0A 1IEPA 1V1KA 3UTOA 3MJ2A 4MNFA 2JEDA 2R3OA 3PZEA 4PTGA 3N4VA 5J9YA 4YGAA 3PG3A 5AIRA 5JFWA 3DU8A 4GV1A 2WNTA 3F5XA 4E3CA 2UZTA 2W1DA 3KKVA 4C37A 2OIBA 3EN6A 3E88A 3I6UA 3WF7A 4ONAA 3VS4A 2VN9A 3R22A 2XJ0A 5LWNA 3Q6UA 1QPCA 3PLSA 3QKMA 2DYLA 5L2TA 3GENA 1GAGA 5TF9A 2OICA 3V5TA 5A3XA 3VO3A 2PUPA 2QLQA 2EVAA 3I1AA 4MEDA 4OTFA 1PKGA 3NUPA 5CU4A 3TNWA 4AF3A 1H1SA 4UB7A 1Q3WA 3ATTA 3HMNA 3RBWA 3PY3A 3NGAA 2X7FA 4CTBA 3P0MA 4EWHA 2E2BA 4JLCA 2QOBA 2YM8A 2EUFB 3KL8A 4ZJJA 2Y8OA 4YZBA 4I6HA 5CSHA 4EZ3A 1F3MC 4FR4A 4FSTA 3TXOA 4U42A 2WU7A 5LVPA 3IW8A 4WG4A 1PXMA 1RE8A 3JVRA 3LFQA 3OUKA 4MF0A 5C01A 3PIZA 3FHIA 4G5PA 3OXIA 3VN9A 3OEZA 2EXCX 2C0OA 3AMYA 4C4EA 2VTJA 3SRVA 3ZRMA 4IFCA 2UVXA 1UA2A 2XIKA 1U5QA 3E62A 3M2WA 4C3PA 4IHPA 3MIAA 4QYFA 3DLSA 3W2QA 2Z7LA 4BBEA 4DF3A 4FTAA 5KE0A 4TNBA 4IVCA 2BKKA 3NVKI 2PVLA 1YDTE 2OI4X 5DT0A 1Y8GA 4BCFA 1R3CA 5B2KA 4DEDA 3UQGA 2X8IA 5AP4A 1IAHA 4I20A 4XG4A 3EJ1A 4BZOA 3EQCA 3TG1A 4ORKA 4F09A 3MGYA 5JFSA 2W4OA 1H26A 4E5AX 2PE1A 4U79A 3DZOA 4R77A 4ZSGA 1WMKA 3R71A 4J98A 4O0SA 4A9TA 3LKMA 5H9BA 5CZIA 2VWVA 3BIZA 3C9WA 4AQCA 2CKQA 3FI4A 5AM7A 3FI8A 4M69B 3OVVA 5IDNA 2ETMA 2QNJA 4DA5A 5EHLA 4IVDA 3F7WA 5FXRA 3BRBA 3QALE 3UC3A 4BDBA 4BF2A 3NNWA 3F9NA 4EH7A 4IAKA 4ZY4A 1Q62A 4O7TA 4QP2A 2PL0A 5AP7A 3VUIA 4D4RA 4N57A 3SDJA 3VUKA 4CZYB 3ORXA 4X21A 2ZM3A 5L6OA 3KRWA 5HORA 2W06A 2JDRA 3OCTA 3OUNB 1XQZA 4I5PA 5E7RA 3GOKA 3WI6A 4EYJA 3GC9A 4ITIA 4NH1A 5BVEA 4W8DA 4CKRA 4MBIA 2VO0A 3U9NA 4EBVA 3BELA 5CS6A 1QPDA 4XHKB 4N6ZA 4FSNA 4C36A 2ZB1A 5LCKA 2ZDTA 5ACBC 5AUTA 2P2HA 2J6MA 4YP8A 5KHWA 4Q9ZA 2PVRA 1PXOA 2G1TA 3VRZA 4U43A 1UV5A 3F82A 5LMBA 3C4XA 2QOLA 3IOKA 3HRCA 3PJ8A 4RJ5A 2YJRA 3S1HA 1OB3A 3TNHA 3OY1A 2Z02A 4OAVB 3A8WA 1J91A 4ZTSA 4GU9A 5BVKA 4W9XA 4TYEA 4USFA 5CQWA 4M69A 2JFLA 4FOCA 3HV5A 4TZRA 4F6SA 3VBVA 5IH5A 4B8MA 2VWYA 2P3GX 4ZY5A 2OF4A 2X2MA 3U4UA 2YAAA 4LG4A 3W16A 3E92A 4M67A 3T9TA 1Q4LA 1CKPA 2OFVA 2I6LA 3D5UA 3EB0A 3G9NA 1VYZA 3H9RA 1XBAA 4G34A 3PP1A 1M2RA 1H01A 2B54A 3FC2A 4FGRA 5AWMA 4G17A 2B53A 3UZTA 3MW1A 2XEZA 4BDHA 2WTCA 3JVSA 5HLNA 4HCTA 2O3PA 4PQNA 4ASXA 1H4LA 3UYSA 4DGOA 3SAYA 4HYHA 3A7GA 3RWPA 1APME 1DAWA 1OL7A 2FSMX 5EQEA 1PXIA 2IN6A 3EN9A 4CFWA 4BHZA 3A4OX 4XCUA 4TKSA 3QD3A 2GHGA 5JQ8A 3AOXA 4DTAA 4RFZA 4IVBA 4EORA 2VO6A 1SNXA 4MK0A 1KOAA 3LJ0A 4FZ7A 2VD5A 4RLLA 5CSXA 5D11A 4I5HA 4EH3A 4GT5A 4G6NA 3AD6A 4WT6A 1YHVA 4JDHA 4AGWA 3TUDA 1PYXA 4FTMA 4PTEA 5AV0A 3ZO1A 3PJ1A 3LXPA 4FOBA 5E90A 5EKOA 1OBDA 3FXXA 5HNGA 5M55A 5L3AA 4ANMA 5E8YA 3UOJA 4QMNA 3U87A 4R3CA 3A60A 1ZYDA 2V62A 5HTIA 4G2FA 2XH5A 4K0YA 3PE2A 3QLGA 3KXZA 2X9EA 4BKJA 3ZM9A 2WQBA 4IX5A 4MYGA 2J4ZA 4DG3E 2W17A 5E8XA 5M09A 4ANBA 3FY0A 2H8HA 3QHRA 3BLQA 1QL6A 2WO6A 2O63A 3NUXA 5EM5A 3HV6A 4QMPA 4PMMA 5FEQA 5H8GA 3R7UA 3Q2JA 4XG8A 4FKOA 4I0TA 4HVIA 3JYAA 3DJ7A 2JLDA 3GU4A 1WBSA 5L6WL 2G01A 4F08A 3I5ZA 3B8QA 3LIJA 1BL7A 4AN2A 2X2LA 1OKWA 5DR2A 2EB2A 1ZLTA 4XG6A 1BKXA 3U9CA 4II5A 3SHEA 1WBPA 3QQHA 3ZFMA 3LCKA 3E8NA 2ZMDA 3CXWA 3KMUA 3DAKA 1W84A 3R21A 4MXXA 2C4GA 3RMFA 4AZFA 3FBVA 1IRKA 3CBLA 4U45A 3DK7A 3ZLSA 2X8DA 3OTUA 2BZKB 4RFMA 3R28A 4UMPA 3RHKA 3HECA 3R1QA 4QP8A 3FLQA 3KCKA 3ZUUA 3ZEWA 3NYXA 4TN6A 1P4FA 1OKZA 4X6QC 4D9TA 4W9WA 3AC2A 5DH3A 4DN5A 4YU2A 4JR3A 1IAJA 1IA9A 2BTRA 2ETKA 2VTIA 3L9LA 3MJ1A 1Z5MA 2VWBA 5IKWA 3HMPA 3G6HA 4CFMA 5HZNA 1J7LA 4Y72A 3U8WA 2XNNA 3FXZA 4OTIA 3MH2A 3SOCA 4BI1A 1L8TA 5KKRC 2PK9A 1AGWA 1XH8A 2XUUA 3BV3A 4DG0E 3OMVA 4FTCA 1B6CB 3KMWA 5E1SA 3P7CA 1H0VA 5A6OA 2PE0A 4GRBA 1U4DA 4S30A 4UZHA 5ANDA 4FTNA 2R3QA 2QOQA 3AD5A 3LFEA 3IQ7A 2C68A 1P14A 3D9VA 3TN8A 5AUYA 4EEVA 2IVSA 4TNDA 4UX9A 4X2FA 2GQSA 4R5YA 1J7UA 4FTJA 2IG7A 3TEIA 2JDTA 3PXQA 4TY1A 2CNVA 3H0ZA 2DS1A 2XIRA 4OTPA 4L3JA 2OZOA 3LQ8A 1PMEA 3EQDA 3HUCA 2FVDA 3UOKA 3ENMA 3HV7A 4A9YA 3OBGA 3MDYA 5M56A 3GUBA 3NW5A 3QCQA 3CE3A 2YDKA 4K77A 3DTCA 4F6UA 4XS2A 2WMUA 4NW5A 5HO6A 2FSLX 1NA7A 4YHFA 4CSVA 4NTSA 2R3JA 4BDFA 3UPXA 3IDPA 2WTDA 3OY3A 4QTCA 5G1XA 3VUMA 5IH4A 3MI9A 4NUSA 5HIEA 4F1OA 1KUTA 4G1WA 1QCFA 3QC4A 5GJGA 4IZAA 3RZFA 2PULA 4M3QA 2BAQA 1Z9XA 2HIWA 4LM5A 4V04A 2AC5A 4NCTA 4NJ3A 3QTUA 3ROCA 3TT0A 5LWMA 3E63A 4EOOA 4RLKA 1FVTA 1SZMA 5CZHA 2GQRA 2OFUA 3CY2A 4PPAA 4UMUA 4OT5A 5L2WA 3FZ1A 5LVLA 4RG0A 4FTLA 3PXRA 3AT3A 4FTIA 5IISA 4FSZA 1ZYLA 1YXSA 2J50A 5HG7A 4DYMA 2VTRA 4QD6A 1XH5A 2ZM1A 3DFAA 4XV9A 3D2KA 4XG3A 4AS0A 4F4PA 5AR8A 2OJFE 4MXYA 4NL0A 3KFAA 3EYGA 4RBLA 3EKKA 4X7QA 4JDIA 4BWXA 3DV3A 3II5A 4EOJA 2XM8A 4QNAA 5DVRA 4B4LA 5GZAA 3N4TA 4O0VA 4R5SA 4PL4A 3PFQA 4EOSA 3MTFA 1LEWA 2YCFA 1UU9A 1U46A 3LCTA 3QUEA
chains in the Genus database with same CATH superfamily
4WG5A 2I0YA 4E8AA 3AKJA 2P0CA 4F9YA 1W83A 4R7BA 3DBDA 4IAYA 3R8VA 3MFTA 5TT7A 1H08A 5L8JA 3G90X 2R3HA 3O23A 5C03A 4E5WA 4PMTA 4JDJA 1PXNA 2PVMA 4AZEA 4GW8A 4F99A 3VULA 1WAKA 2GNLA 4NIFB 5FXSA 4S34A 5HO7A 4QP9A 3FSKA 1WZYA 4F7JA 3R9RA 3UIMA 5AM6A 4DLJA 3GU6A 3G2FA 1FPUA 5DWRA 3CPBA 2RFNA 3R2BA 1M2QA 5ETFA 3UNZA 1S9JA 3RAWA 5BYZA 3ZXTA 3IG7A 5IQEA 5HVJA 4C61A 4X2KA 5HD4A 4L45A 5HX6A 1XWSA 4V05A 1R1WA 3DT1A 4HNFA 5J79A 5T6KA 4IAAA 2WMSA 5LMKA 1PJKA 4BGQA 2EXEA 2JGZA 4QMYA 2QOKA 4QDEA 4NW6A 4DTBA 4KBKA 4YSMA 5J87A 2CHLA 3ETAA 3V8WA 3WOWA 2Y9QA 2JIVA 2UW7A 4DBNA 5HG9A 2OF2A 3O7LB 3RM7A 3DPKA 3WYXA 2C5YA 3IW6A 4CLJA 5IMEA 2QQ7A 4OT6A 5G6VA 1XR1A 5FTQA 2B9JA 3NUAA 4O84A 4C33A 4ANNA 3NIZA 2X9FA 1M7QA 5DG5A 2XRWA 2W1CA 1OI9A 2VTLA 3Q4UA 5BUIA 4LOQA 3F66A 4UWCA 5EG3A 4EWQA 4RJ4A 4NIFA 4KS7A 4NZWB 2OJIA 4NM0A 5FBOA 2XCHA 3AXWA 4XBRA 4UN0C 1Q41A 3KRJA 2BUJA 3BL9A 4RVKA 1Q8TA 2YM3A 2R3MA 1M14A 2C0IA 3F88A 4FF8A 3TDWA 3L1SA 2WMVA 3H30A 3BYSA 3D15A 3W2OA 4CLIA 4BI2A 5KMKA 2IZUA 4XUFA 4K1BA 4ZZOA 3FUPA 5EHYA 3NYNA 3RAKA 2BIYA 2QKRA 4BWKA 4QMMA 3UMWA 4HVHA 3F2AA 3PPZA 3R73A 4ALWA 3AGLA 4OW8A 1OVEA 3IO7A 1VR2A 3ZEPA 5J1VA 1SVHA 1TQIA 4S31A 5IUIA 4B7TA 4WG3A 4OGRA 1P5EA 4Z9LA 4BWPA 3M42A 4M8TA 5AX9A 5H8EA 3NUYA 1HCKA 1JBPE 2XRUA 4PUZA 3C0IA 1YI3A 4AT4A 4WNKA 4AA4A 4JX7A 4FEQA 4B8LA 4QQTA 2YEXA 3E8CA 3H9OA 4BTJA 5C26A 1Y6BA 4P7EA 3TV7A 3GCVA 3F5GA 3LM0A 4WUNA 5DLSA 4A4LA 3QKKA 4R7HA 2VTQA 3ORMA 5I9YA 5LQFA 4FNWA 4FT0A 4IEBA 1WBVA 3MS9A 4O6LA 3RI1A 5AAEA 3LW0A 3FZRA 3PG1A 4O83A 2Q0BA 4YZCA 5KMMA 5AV3A 5J7HA 3FV8A 2WTKB 3ORNA 3TZ7A 3DNDA 5EW9A 3ULZA 3VS1A 4FUXA 3ERKA 3WZDA 2VO7A 1Q8ZA 5ANGA 5HE0A 5FD2A 5HU3A 3I7BA 2FO0A 3HLLA 1XKKA 5AUZA 5BUEA 2IJMA 3QQLA 2UZUE 2WOUA 1MRUA 2ZVAA 3LXKA 4YLJA 5J5SA 3F3VA 3QGYA 4MNEB 4XEYA 4XJ0A 3P5KA 2YAKA 3SA0A 3T9IA 4NM7A 4YJTA 4ACMA 3MV5A 4FSWA 3FMMA 2SRCA 4HW7A 4BR3A 4F63A 3HX4A 3HP5A 2I0VA 2F57A 2PY3A 5FWKK 5FDPA 4HGEA 2GS6A 2PMOX 3C7QA 3SV0A 3WARA 3EHAA 3PLAE 4EJ7A 3FMJA 1PXJA 2R3GA 3FQSA 3A7IA 1NW1A 3OWJA 3REPA 3GC8A 2CSNA 1UNLA 2ERZE 5HNBA 5M51A 3PDTA 4DITA 1FVRA 4EH6A 4EQCA 2HY81 4DLIA 4BY9E 2XKEA 3AC5A 2VTTA 2QR7A 4MXCA 5BVWA 1PMNA 4FG9A 5E8SA 1RW8A 4QMTA 2NRYA 4FKTA 1BI7A 3QXPA 3BYOA 4FL1A 1YDRE 4ZK5A 3V04A 5A4CA 3QU0A 2BDJA 4F6WA 2V5QA 3DA6A 4D2PA 3QYWA 3MB7A 4HCUA 4J52A 2JAVA 3F3TA 3Q53A 3M11A 4H36A 5A4EA 5CEIA 3ZM4A 1GIHA 4U5JA 3Q4CA 4LMUA 4XH6A 4ZXTA 2QO9A 2AQXA 5DN3A 2XNPA 3VS7A 1BUHA 1YDSE 4S2ZA 4RX8A 1LUFA 3PVUA 3UQFA 4L67A 4ZTHA 3R8UA 1FGKA 4DEAA 2BMCA 5I9XA 4JG6A 2XCKA 3VUTA 4ZOGA 5JEBA 2UV2A 4MNEA 2RG5A 4QP6A 1VEBA 1ZOGA 3W0MA 3LXNA 3I81A 3NFFB 3PA5A 5H3QA 5HE1A 5JN2A 3SD0A 3T3UA 4EOPA 1Q3DA 4DH8A 1NVRA 3H4JA 2XBJA 3FQHA 5KCVA 2HWOA 1T45A 5HCZA 4BTMA 4A9SA 4TPTA 3VBQA 2J0JA 4RQKA 4X6RA 4O4FA 5CI6A 5HIDA 4ZSLA 4EOQA 4ZTMA 1M2PA 5AFVA 3MA6A 2WIHA 1OZ1A 3FY2A 4PL5A 4HZSA 4BKZA 1KOBA 5DR9A 3THBA 5CVHA 3MFRA 3LFSA 3MH1A 3TTIA 5CENA 5M57A 3OS3A 4CFNA 4DFUA 2J0KA 3PXYA 4G3CA 5EYDA 1G8JA 5DGZA 3CP9A 5I9WA 4FG8A 4R78A 2X7GA 3AC3A 2WQOA 2GNHA 1JAMA 3PVWA 3ZDIA 4M97A 1JVPP 4BN1A 2OW3A 2HYYA 2ESMA 3EWHA 2DWBA 4FG7A 3Q2MA 3TV6A 3EOCA 3POOA 3MY1A 3EKNA 5AADA 3UE4A 4RX9A 4G9RA 4D0WA 4EOLA 3LMGA 1KV2A 3VS6A 3PXKA 4D1XA 4OBOA 3BBTB 2IW6A 4AUAA 5JKGA 3TZMA 3EL7A 3DK6A 3DTWA 3QRJA 4MD8E 4ZLOA 3D2IA 3HMMA 4J71A 2Y0AA 3PWYA 4PDPA 4WNPA 4L52A 4IAFA 4RIOA 1ZMWA 4FBXA 5CY3A 4W8EA 3DDPA 1R0PA 5EYMA 4LL5A 4F1TA 1MRYA 4FSQA 5JMSA 2W1EA 4CFXA 4DTKA 3HP2A 3BX5A 4Y83A 2ZFYA 1M7NA 3S4QA 3F69A 4L7SA 5DFPA 3FLYA 4AW1A 1VJYA 3IECA 4O22A 5CAOA 3LJ1A 3CGFA 3NX8A 4AZWA 4AX8A 3UQCA 3W32A 2YN8A 4GVJA 4WSYA 5HGIA 2LGCA 5JZJA 1TQPA 4YZMA 3FMEA 1Q8UA 5HTBA 3BQCA 3JR1A 4JIKA 2WEVA 5CU0A 3CLYA 2B9FA 5FLFA 5B7VA 2W99B 4XG7A 4C0TA 2CN8A 3DBCA 3FHRA 5DEYA 5EI2A 4BC6A 2OLCA 3HNGA 1DAYA 2WMTA 2DUVA 3V5WA 4D5HA 4QPSA 4FSRA 4I0RA 4EBWA 4OLIA 1G5SA 1QPJA 4EQUA 2VAGA 1XMMA 1YI6A 5E92A 3OOMA 4GEOA 4FIFA 4LMNA 3GEQA 3EYHA 5F20A 1LPUA 3CKWA 2E9OA 1A06A 4YJQA 4FE2A 3OC1A 4F64A 4QQCA 3UYTA 4O27B 4O6EA 1H1PA 3DXPA 4C3RA 3VBWA 4C62A 4GKIA 3C51A 2C5NA 4BDAA 2YCSA 5LVOA 5BYYA 2R0IA 2WMQA 3IGOA 2WTJA 4J95A 2YWPA 3C50A 4IACA 4XX9A 1IA8A 4JIAA 3UOHA 4A06A 4ANSA 4E5BA 5KHXA 4A07A 4NEUA 4YBKA 4C2WA 2J5FA 1W2FA 4MH7A 4L7FA 3COKA 2XEYA 4PF4A 3AC4A 1YI4A 1ZRZA 3FXWA 4QMLA 2BRGA 3BGZA 3V51A 4DAWA 4FKUA 4CMUA 3G9LX 3D94A 2Q0NA 3VUGA 4ERWA 3UVQA 3O8TA 2CKPA 3H0YA 4OBPA 1OMWA 4FIIA 3P4KA 3JS2A 3FKNA 4K6ZA 4QRCA 2CDZA 5DR6A 2BRHA 4PNKA 4I93A 5CASA 4DFNA 3OG7A 1WFCA 3AKKA 3FEGA 3SW4A 2R7BA 5ETAA 4NCTC 3WZEA 3CJGA 4QMXA 3E3PA 5IA2A 1ZARA 4KUJA 1DI9A 4GFGA 3G51A 5J7BA 3EMGA 3TI1A 4EUUA 2XAOA 5JFVA 3D83A 2XP2A 3A8XA 4DFZE 4USEA 3L9PA 4W4WA 4ZSEA 2OH0E 2UZOA 2LAVA 2X6DA 3W0SA 4YNOA 4FNXA 3HA8A 2G2IA 4FIEA 4O7YA 3CC6A 3Q96A 4PDYA 4Y8DA 4EH4A 3VONA 4CCBA 4QMVA 4WUAA 3WBLA 3A7HA 4AE9A 1UNGA 2QOFA 3DB6A 3GC0A 3MPMA 4RJ7A 5EOLA 5IUGA 1YWNA 4AN9A 3A4PA 3NDMA 3ZSGA 1YXVA 1FQ1B 2VX0A 5AR5A 3ZCLA 3TDVA 3MIYA 4RVLA 5M4IA 3IK3A 1GNGA 3BHUA 1W2DA 4GU6A 5JZNA 4O0TA 2GNFA 3R6XA 2WZJA 2J0MB 3KY2A 5CU6A 4O82A 4EOMA 3HAMA 4CFUA 5BVDA 4RT7A 4DGLC 3VHKA 2UZDA 3QLFA 2EXMA 3HV3A 2VO3A 3I0OA 4FT7A 4JAJA 4M66A 1OIYA 4NM5A 1WVYA 5CU2A 4DEGA 4JQ7A 5IEXA 3JXWA 2XKFA 4QYEA 3QZGA 2PVKA 3UO6A 2F7ZE 5KBQA 3OFMA 3E8EA 2ZOQA 4JDKA 1CKJA 3QTZA 4F9AA 2GS7A 3GC7A 2XA4A 4AN3A 4IE9A 2VUWA 4LFIA 3I6WA 3AMBA 3GQIA 4IANA 3SXFA 1X8BA 4E4LA 1UWHA 4DE4A 3QCXA 3HVCA 3RCJA 4CRSA 2GNGA 2FSOX 2XNBA 4FSUA 4MHAA 3DDQA 4IMYA 4KKEA 3LFCA 2J0LA 4O0XA 3PZHA 1M52A 2ERKA 3WIKA 5IUHA 4XG9A 3ZH8A 3C1XA 4KD1A 4K33A 3ORPA 4I6BA 4DG2E 2ITNA 3R8ZA 2XAMA 5CX9A 1XH6A 5LMKC 5EQYA 2BALA 2P33A 5J5TA 1KWPA 1B39A 4FX3A 4OTHA 3NR9A 3ZS5A 3UDZA 4XLVA 4PY1A 4YPDA 3OBJA 3AGMA 4UYNA 4FVPA 1I44A 4OBQA 2HXLA 3QD0A 2VTMA 4WBOA 4FV1A 3IDBA 3MBLA 4D58A 1LP4A 2F2CB 4BZDA 2XB7A 4I6FA 3KCFA 5IZFA 3R01A 3D0EA 3WF9A 4C2VA 2XIZA 4NU1A 4R3RA 4BCIA 3C4CA 2ITPA 4MTAA 2C1AA 2FUMA 2UZVA 4IZ5A 4UYAA 3IW4A 5CALA 3ZFYA 2VU3A 5C8KA 4FYOA 2UW4A 4R6VA 3LXLA 3S0OA 4ZMEA 2R3KA 4LDTA 4BCPA 1OL5A 4U80A 2RL5A 2WPAA 1G3NA 3PWDA 5AAFA 3W10A 5KBRA 4FEVA 2GHLA 3A2CA 4ZY6A 3EFJA 5CNNA 3COHA 4MXOA 1QMZA 3ANRA 5KZ0A 5AUXA 2I7QA 3PA4A 4FL3A 4QEBA 4I24A 5E1EA 3SG9A 2PZRA 2QO2A 3TMOA 2O8YA 5DYJA 4ZJIA 3ORKA 1WCCA 4I4EA 3RPOA 5FTGA 1LEZA 5M4UA 1YVJA 4D2RA 1GIIA 4FT5A 1FMKA 4RVTA 1ZZ2A 2YIRA 4LOOA 4IWPA 2WQEA 5HIBA 1BLXA 2CCIA 3KVWA 3DXQA 3UOLA 4QMWA 3PVBA 2C5OA 3VC4A 3O8PA 4L3LA 3R0TA 3HYHA 5DT4A 3E8DA 4GK4A 4GG7A 4L53A 2YIWA 3NEWA 3PYYA 3Q9YA 3UVPA 4CCUA 3DB8A 5BQ0A 1E1XA 1DS5A 4Q5EA 4RWKA 2QG5A 3F7ZA 1UVRA 3QUDA 5DIAA 3BU6A 4IM0A 4QMQA 5B0XA 2XBAA 4JXFA 2IZRA 4YJUA 3W33A 4AZTA 2AEGA 3LFDA 2IPXA 4O7SA 3NFGB 5CEOA 3VAPA 3IW5A 3QL8A 3SC1A 4MD7E 5BNJA 4MWIA 3G0FA 4ZS4A 2CN5A 4C35A 3TJDA 4W4XA 5L8LA 3QTRA 3ATSA 2BILB 4M84A 3FZPA 2AYPA 1WBWA 2BZIB 1AD5A 2GTNA 4BFMA 5DI1A 3G0EA 1Y6AA 4J7BA 3LCSA 4FKJA 4I4FA 1OIRA 2IZSA 3S2PA 4YJNA 1E9HA 2C3KA 4FKIA 2GCDA 2FGIA 1R0EA 1GZNA 3IDCA 3LAUA 4ZTLA 3FMKA 2CLXA 1BI8A 1CSNA 4PP7A 3AT2A 3AQVA 3ROYA 2QCSA 5L2IA 3OCBA 3VF9A 4O38A 4P90A 4BDEA 2ITWA 3QQFA 1VLRA 5K0KA 3T3VA 3VNTA 3RZBA 3W0QA 3D4QA 3PTGA 4OTDA 5EH0A 3GCQA 4XG2A 3DOGA 2C69A 3ZLYA 2JIUA 4QYYA 4YZ9A 2A19B 2ZAZA 4F9WA 2OZAB 5DRDA 4DBXA 4DCAA 5ANIA 4C02A 4M68A 4MKCA 1W82A 3PUFC 3LQ3A 4I6QA 4M0YA 5GHVA 5JGAA 5D7VA 1Q8YA 1W8CA 2YM6A 4E6AA 1Z57A 5GZ9A 4KBAA 4YJRA 4H58A 4E20A 5I9ZA 2CGXA 3TZ9A 1CM8A 3V3VA 3KA0A 2ITVA 2C30A 3POZA 5J9ZA 1JKLA 1YXXA 2XK8A 3BYMA 4TYGA 4YSJA 5CAPA 5E9EA 2WTKC 5A46A 4BB4A 2O2UA 3UODA 4BGHA 3Q32A 3BGPA 2WEIA 4CMOA 4OAUC 3E87A 4WNOA 2GDOA 2YHVA 4JBVA 4EC8A 4JX3A 3OWPA 4O91A 4P2KA 4UY9A 1Q8WA 2WXVA 3U55A 5EKNA 3BLHA 3ZUVA 2QU6A 1SMHA 3GFEA 3I60A 5CXZA 2OIQA 2ITQA 4PV0A 2G2FA 1S9IA 3AD4A 3FKLA 3GXLA 2BHEA 2E9NA 3QXOA 5HI2A 2XYUA 1O6LA 3GU5A 3BE2A 3N51A 4UMQA 5KMNA 5C4LA 5IQHA 2YM4A 1YW2A 3TIYA 3KF7A 2UZLA 4GIIA 1T46A 4XOYA 4RA5A 4AQKA 3W0NA 1STCE 3ZDUA 4DEEA 1O6YA 4F7NA 2BZJA 2Z7RA 3QQGA 3O17A 2QU5A 3V5LA 5CF6A 4BDIA 2OZAA 2PZIA 1ZWSA 5EFQA 2EU9A 3SGCA 3SLSA 4KBCA 1RDQE 3IW7A 5CTPA 3EN7A 3GT8A 4ACGA 4NTTA 2X0OA 3B2TA 4I1ZA 4ZMFA 1ZOHA 2R3LA 1H00A 4FTOA 2J5EA 4R1YA 2WIPA 3BLAA 1SM2A 4O4DA 4B9DA 4O2ZA 3QRKA 4U6RA 4V01A 2ACXA 3SVVA 3R9HA 3UJGA 2VTSA 3FYJX 3ID6C 5CEKA 1OL2A 4G6LA 4PX6A 5EOBA 4RMZA 1JKKA 2PVHA 4FL2A 5C8NA 3V01A 4EC9A 3F2RA 1FGIA 4CT2A 3SOAA 1A9UA 3R02A 3DKOA 4KKHA 3OW4A 4PP9A 5CAQA 4QP4A 1KE9A 4X2GA 4R3PA 1YRPA 2H34A 3NW7A 4E6DA 4WIHA 2AUHA 4ZLZA 4AAAA 1A48A 3OP5A 4DH7A 5BVFA 3L8PA 3Q9WA 2BFXA 1JLUE 4MXZA 2BPMA 2RF9A 4I94A 3HMOA 4RC2A 1TVOA 1Q97A 2J7TA 4L44A 3SKCA 4FKQA 3VS0A 2WQNA 5AR3A 1GIJA 1M17A 3AG9A 3D7TB 3ORLA 1OIUA 4HGLA 4M12A 3CPCA 3GOPA 4FTKA 1BMKA 3DQWA 4FV4A 3L8VA 2BRBA 3PIXA 3U6IA 2UVYA 2XK4A 3OZ6A 4IB5A 3W1FA 3PFYA 2C1BA 3R30A 4FKRA 3FMLA 5KX8A 2JKMA 4LV7A 3BZ3A 4BDGA 4KIKB 3PSDA 4LUEA 4FYNA 3JY9A 1SNUA 4QQ5A 3RAHA 4Y95A 4IVAA 3DKCA 3QWKA 4FZFB 3ZBFA 5D9HA 3FLWA 4HGSA 1H0WA 3GVUA 4JNWA 5D41A 4I0SA 4YC3A 1OIQA 3K3IA 1ZMUA 4YO4A 1G8KA 1RQQA 1MUOA 3H9FA 2PWLA 4H1JA 4M0ZA 5DNRA 4FTUA 4GIHA 2FH9A 5M4FA 3BHTA 1MQBA 5C4KA 1KE5A 5ANEA 4BIBA 5LXMA 4FKGA 2QLUA 4EI4A 4BCMA 2WTVA 2QR8A 2XNMA 4HPUE 5CT0A 3VUHA 4AXDA 2P4IA 3FC1X 3SXRA 4Z7HA 4G31A 3MYGA 4FT3A 2W4JA 2GMXA 4H3BA 4D1ZA 3A7FA 3UMXA 5GNKA 4GUBA 5HD7A 4GMYA 3U6JA 3PE1A 5J9LA 4AFEA 3LOKA 3ANQA 4DC2A 2B9IA 1KE8A 3D7TA 1JKTA 3Q9ZA 4IWQA 5AV2A 3ZBXA 2GNIA 2VWWA 3A61A 2HXQA 2W7XA 1ATPE 4ZP5A 4DEIA 4QTEA 4IB3A 3R7VA 2IW9A 4AU8A 3BL7A 2UW0A 4KIKA 1SVEA 4ZTQA 4GUEA 3F3WA 5H2UA 4J53A 2HZNA 2R3FA 5I9UA 4ASZA 4DGMA 4DGGA 2WMXA 4JBQA 2XM9A 1Y91A 4YJOA 3HEGA 3QQJA 4TT7A 3DBQA 2QOHA 4AT5A 4LRJA 4Y85A 4F78A 2W9ZB 1MP8A 5E91A 2O0UA 2YWVA 3FPMA 2I0EA 3E64A 5FBNC 1YXUA 1O9UA 2GSFA 3NPCA 4USDA 3FWQA 4AXAA 1Y8YA 4GCJA 3FZTA 3P5JC 4UWBA 4FIGA 3EFWA 3QTWA 2W4KA 2XJ1A 5CXHA 5M06A 2PUUA 4BL1A 1G8AA 1V0PA 4C4IA 2W9FB 5CU3A 3UC4A 4TRLA 3NCZA 3O7LD 4DFYA 3FL4A 3OW3A 3ZZWA 5HESA 1GZ8A 1J3HA 2W5BA 5I9VA 1H28A 1KE6A 2ITYA 3KK9A 2X0QA 4TXCA 5M4CA 3KC3A 4CKJA 4BYJA 3UNKA 2QO7A 2X2KA 4HJOA 3NUSA 3ORZA 3ZLWA 2BTSA 4GVAA 3FZOA 3MPAA 4OUCA 2HK5A 1NVSA 4NSTA 3UIUA 4CZUA 2VWUA 2R64A 1MQ4A 4GYIA 2Z7SA 2R4BA 4CTCA 3FI2A 4IX4A 3MVMA 4ASEA 4RJ8A 3KMMA 3SXSA 1CDKA 3WZUA 3EFLA 2NP8A 3NYOA 2JDVA 3TNQB 4DHFA 5KNJA 4IW0A 2P55A 4AOIA 5LCJA 5AR2A 4EOIA 4FODA 2OO8X 4D2SA 5I4NA 5IA3A 3QTQA 3GCSA 2XK9A 4Q2AA 3NRMA 4FV9A 4EYMA 5M53A 2GS2A 4AXFA 1ST4A 4ZLYA 2XYNA 4IWOA 5JRSA 4QNYA 4J1RA 4L43A 4RJ6A 4EZ7A 3UO4A 5HVKA 3FMHA 4DDIA 2QVSE 3A62A 3FAAA 3LCOA 4FZ6A 4KABA 4PMSA 4TW9A 5ETIA 4DH3A 1JSUA 2CPKE 2G2HA 1PHKA 2UW9A 4M7IA 3ZU7A 5IA5A 2RGPA 4KIQA 3C4WA 3TM0A 3EQHA 2ZV2A 3PJ3A 4CV9A 4Z16A 4AW0A 5AUUA 3PXFA 4XNEA 5I0BA 1UKHA 3EQGA 3ZMMA 3ZTXA 2J0IA 5A9UA 3VQHA 4CT1A 2VTHA 4DFLA 5GZ8A 2PTKA 5A4LA 2PZYA 1YHWA 2HCKA 2DQ7X 4DFXE 4UMRA 2UW6A 1JSVA 3Q4TA 5CEPA 4TYIA 3BWJA 4AZVA 2XK6A 3HL7A 3OCSA 4EHGA 3UG1A 1EH4A 3EL8A 4V0GB 5AEPA 4YMJA 4E4XA 3VIDA 2IF8A 4EH5A 5IA0A 4UZDA 1E1VA 3MVHA 1CTPE 2ZDUA 2XNEA 4EHEA 5HEZA 3O51A 3ODYX 4KKGA 4E93A 2UW5A 4GK2A 3NUNA 3EFKA 4QPMA 2HOGA 2BDWA 4FV0A 4XV2A 2YITA 1H1QA 3C4FA 4JAIA 3K3JA 3VBXA 3GI3A 5HE2A 2VV9A 4GSBA 1OPLA 4FUYA 3FLZA 3QAME 4LGGA 4HPTE 4F65A 3P1AA 1PF8A 3D7ZA 4EJNA 2JITA 4OTGA 2ITZA 3PJCA 4DHZA 1UWJA 3V5PA 3SW7A 4H3PA 2BZHB 3QUPA 4B99A 4EZ5A 2PVFA 4S32A 1WVXA 4P4CA 3CSVA 4MAOA 2YZLA 2E9UA 4D0XA 1BX6A 4G3GA 3EN5A 4L42A 4R8QA 5K4JA 2A0CX 5JH6A 4RFYA 2B0QA 4GT3A 3QA0A 4CG9A 4WBBB 3NYVA 4BHNA 4K11A 3P23A 2C6IA 3ZSHA 5IA4A 3QBNA 5EI8A 5JSMA 2PMIA 2B7AA 1ZY4A 4V0GA 3TKIA 3FE3A 3ZONA 2C3LA 4ACDA 1R78A 4YTFA 3LMIA 4IXPA 1BYGA 5L6PA 4PDOA 2YJSA 4K8AA 2WAJA 4AG8A 2UVZA 1F0QA 4EQMA 2BKZA 2XIXA 3RK9A 4LUDA 2Y7JA 5ACKA 2RFSA 4MD9E 3VQUA 1OUYA 3PY0A 2XVDA 4L9IA 3PPKA 3W8QA 2V55A 4WO5A 2Y6OA 3MN3A 4E7WA 5L4QA 3DQXA 4FSMA 5AR7A 2X1NA 1HCLA 3QRTA 3RINA 4C3FA 4GJ3A 4GH2A 4X2NA 3KXXA 3G6GA 3GQLA 3BHYA 3DLZA 5TKDA 4D4VA 4ZZMA 4DCEA 5AA9A 4FV8A 1BL6A 1FBNA 1HOWA 2YABA 3LPBA 4IFGA 4APPA 4EUTA 3KU2A 2I0HA 4IB1A 3OTVA 4O7NA 5IQAA 3D5WA 4IADA 4E4MA 2BRNA 1JSTA 3HA6A 3QCYA 4QTAA 4EKKA 5DA3A 4KRCA 4K9YA 3QZFA 4MX9A 3ZUTA 4TWOA 4CV8A 3LM5A 3FYKX 2PZ5A 1WBNA 3K54A 4Y73A 2JKKA 3W2SA 4I21A 4O7ZA 1YOJA 4O0RA 3CGOA 4CFFA 5ETCA 5FP5A 3QX2A 4ZSAA 3DZQA 4FEXA 4AAYA 2J51A 2BIKB 3BPRA 5AP2A 4IAZA 4ACCA 1GJOA 5T3QA 3V6SA 4ZSJA 2PVYA 4NYEA 4TWCA 3KXGA 3LFBA 3P08A 2NPQA 5I3RA 2C6LA 4S33A 4UXLA 4X0MA 5BV3A 3GU7A 4LV5A 3QD2B 1SVGA 3FPQA 3DXNA 5HU9A 4ZS0A 1Q61A 4ZTNA 4L8MA 3C5UA 4P5QA 4AOJA 2HAKA 4FKLA 2OIDA 5HLPA 4QYHA 3PUPA 5CVFA 5AP5A 3V8SA 2JKOA 2XS0A 4LL0A 2VTAA 4LV8A 5FTOA 1Y57A 3RPSA 2YFXA 3UZRA 4BGGA 2IW8A 4IWDA 3RGFA 2XMYA 4GFOA 5ITAA 5GIPE 2W1GA 2B1PA 2XZSA 5DOSA 3O96A 4XP2A 2F7XE 2FYSA 3MB6A 2QHMA 4FZDB 3W0OA 2HZ0A 3GBZA 4FTRA 4JQEA 4LOPA 4MQ2A 2VRXA 2VGPA 3PXZA 3TZ8A 3RK7A 1Q99A 2H9VA 2YLEA 3DS6A 2Z7QA 3F61A 5BPYA 2PPQA 4BDDA 2BAKA 4YURA 3EZRA 5AP6A 4DGNA 3AT4A 4E6QA 2YIQA 2PZPA 3UZPA 1B38A 2FB8A 2HW7A 1XBCA 3A99A 5EYKA 4RRVA 4ENYA 2VNWA 3KULB 3WZKA 3V5QA 4ENXA 3FQEA 3FMNA 3OOGA 2G9XA 2B52A 4HVGA 3NVMB 3DAJA 3QRIA 5JFXA 4IC7A 2ZV9A 4M14A 4QP3A 4E73A 5EI6A 5BVNA 2O64A 1VYWA 2B55A 2WQMA 5DE2A 5IH6A 4QYGA 2QI8A 4BCGA 5J8IA 1KE7A 2VX3A 4PDSA 4HGTA 4X3FB 1H1RA 3ZC6A 4ZJVA 1JNKA 5JQ5A 2A98A 2VNYA 4IIRA 5DPVA 3LZBA 5HKMA 4DT8A 5A4TA 3TUBA 5FG8A 3F3ZA 3F2NA 4I3ZA 3VUDA 3W8LA 3MESA 5F94A 4XBUA 2ITUA 2NNWB 3NCGA 3L9MA 4CD0A 4AXCA 3O2MA 3OEFX 2P2IA 2QOIA 2RFDA 2ZYBA 5C8MA 2JAMA 4CKIA 4XOZA 4JBPA 4AW2A 3SG8A 1REJA 3ITZA 1YWRA 3WF8A 4ID7A 3TL8A 4HYUA 5FXQA 3PPJA 3LE6A 3CJFA 5K4IA 2C6OA 3CKXA 5F4NA 3VJOA 4FK3A 2ITTA 4QP1A