4RX8A

Syk catalytic domain complexed with a potent triazine inhibitor2
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
275
structure length
269
Chain Sequence
YLDRKLLTLEDKELGSGNFGTVKKGYYQMKKVVKTVAVKILKPALKDELLAEANVMQQLDNPYIVRMIGICEAESWMLVMEMAELGPLNKYLQQNRHVTDKNIIELVHQVSMGMKYLEESNFVHRDLAARNVLLVTQHYAKISDFGLSKALRADENYYKAQTGKWPVKWYAPECINYYKFSSKSDVWSFGVLMWEAFSYGQKPYRGMKGSEVTAMLEKGERMGCPAGCPREMYDLMNLCWTYDVENRPGFAAVELRLRNYYYDVVNHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase/transferase inhibitor
molecule keywords Tyrosine-protein kinase SYK
publication title Discovery and profiling of a selective and efficacious syk inhibitor.
pubmed doi rcsb
source organism Homo sapiens
total genus 89
structure length 269
sequence length 275
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2014-12-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4rx8A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4rx8A01
3E7OA 3FI3A 3N9XA 1M7QA 4F7LA 1RW8A 4PF4A 5DNRA 4HOKA 5LMKC 3H9OA 4C2VA 3W2SA 4RC4A 2YLEA 3R9OA 5CSVA 3VO3A 4CRLA 3PIXA 2XNEA 3EQGA 4WSQA 3WZDA 3UVPA 4IAAA 4QMUA 2X6DA 4U40A 4ANNA 1WBSA 3EQHA 3E5AA 5EK7A 3UPXA 3QXPA 5EM8A 1TQIA 5BMSA 4FV6A 4C38A 3ETAA 4N6YA 1LPUA 4O0VA 4YJOA 5AA9A 1XBCA 3UMWA 3LFNA 1IAHA 4LFIA 4IWOA 2RGPA 4RZVA 1QPDA 1ZZ2A 4B4LA 4XOZA 2W06A 5JRSA 4FZ7A 5FG8A 4CFNA 4D4YA 2VAGA 3BCEA 3QCQA 5F1ZA 5JZNA 4YMJA 4YPDA 1OKYA 4FVRA 5H2UA 3PJCA 2BIKB 3DZOA 3VBVA 5KKRC 3E87A 3QLGA 3AMYA 3KA0A 3UYTA 4TL0A 2QONA 3Q53A 2C68A 2IWIA 5AX3A 2CHLA 5BVNA 4FT5A 3IW8A 3OOMA 4FKPA 4M69A 5T3QA 5CYIA 3F2AA 5CEIA 3R7OA 2VZ6A 5IMEA 5EFQA 5C4KA 3I6UA 3AMAA 4FIFA 3EQRA 3KCFA 4ZTLA 1JVPP 3SG9A 2HY81 3ZRKA 3ZH8A 2REIA 4TYGA 4F7NA 2DWBA 4A9TA 3PWDA 3UO4A 4BIBA 3R04A 3MH1A 4RIXB 2X2MA 3QQKA 5EW9A 3L8PA 3ZXTA 2VO6A 4JAIA 2EU9A 5JRQA 2W99B 3TZ9A 1YW2A 4EUTA 2GSFA 4ASDA 4DA5A 4BDFA 4JDJA 5AFVA 3P08A 3NUXA 5IEVA 4NYEA 3HEGA 4JR3A 4TNBA 4H3PA 3W8QA 2HOGA 4EK5A 3LMIA 3HRFA 3ACKA 3QKMA 3R22A 1Q8ZA 3PY3A 3VRYA 3R28A 2WTWA 2QC6A 2YACA 2B7AA 2QOQA 4UWYA 1PW2A 4YZ9A 5FWKK 3ZXZA 5AAGA 2XK8A 5JZJA 1GIIA 1YWVA 2J0IA 4WG3A 3F61A 4I6QA 3MJ1A 3VHEA 5IA0A 5JH6A 4G31A 4PNIA 4MD9E 2B4SB 4GEOA 2ONLA 4KIPA 5BUIA 1I44A 2GTMA 5E8SA 3PLAE 4PRJA 4IXPA 4NJDA 4UYNA 5EDPA 4DTAA 3VUIA 3EZVA 4YJVA 1FMOE 4F63A 1J7IA 1UNGA 3LLAA 4APCA 4J52A 5IA1A 2PL0A 4WUNA 1KOBA 3RNIA 4Q9SA 4BTJA 1ZWSA 4JG8A 5HGIA 4GYIA 1AD5A 1XH8A 1XO2B 3IKAA 4FL2A 4LQMA 4QMMA 5HIDA 4EBVA 4LOPA 4ZLZA 3MI9A 5AEPA 3Q2JA 2W17A 5GIPE 4G5PA 5EOLA 2XK7A 4UMQA 3PE2A 3DBEA 4OR5A 4TYHA 3UTOA 1QPEA 4D1SA 5BUJA 4JBQA 2GQRA 3EFLA 4FV2A 2XKEA 4IVBA 2G9XA 4OW8A 4XBUA 2WQMA 5A3XA 2G01A 2WMRA 2B54A 4FG8A 5IDNA 1PXNA 3DTCA 4JIKA 1SZMA 5FEDA 3JXWA 3QQFA 2UZUE 4KIOA 4CZYB 1V0BA 3FV8A 4I4EA 5C9CA 2C5YA 4AN9A 4PWNA 3G6GA 4IAFA 4UEUA 5FTGA 4QQCA 3MYGA 4RX5A 2DYLA 4YURA 4ZTNA 4XP0A 4FTKA 3R7EA 4JX3A 4E5WA 4S31A 2W1HA 4JXFA 2PE1A 3FQSA 3DGKA 4LM5A 4B9DA 3P1AA 4F65A 4F70A 1BL6A 3IO7A 3TZ8A 2GS2A 3P5KA 4IX6A 1U46A 2OIBA 4B8MA 4BWXA 2FSTX 1GIJA 3GFEA 4E7WA 1M14A 3IOKA 4D2TA 4ZSLA 2FSLX 3AC4A 3RPYA 2R7IA 3OBJA 4BDJA 4IM2A 2HZNA 4ZY5A 5CALA 2PMNX 2XF0A 4FKLA 2H8HA 3PDTA 1M2QA 4TKSA 5IISA 3VS3A 1G3NA 5CZHA 3NYNA 5A6OA 4I0SA 1TQPA 1UNHA 3I60A 3KK9A 4LRJA 3I81A 3KK8A 4FKOA 2JITA 4BICA 4H05A 2WELA 5AR4A 4J1RA 4MQ1A 4M13A 3W2RA 2OZAB 2V7OA 4GFOA 2O0UA 3UQFA 3ZSIA 2JEDA 5C8KA 3QTQA 4MXAA 4GIIA 3BHVA 3A7FA 2R3KA 4KBKA 4BCNA 3BZ3A 1URWA 4BDAA 2J4ZA 2WKMA 3S0OA 2NRUA 2BROA 1ZYDA 3VN9A 2F7XE 3U6HA 4FL3A 4TXCA 3HX4A 3R7UA 1WBPA 4KSPA 4V0GB 3DJ6A 1PXKA 4EWQA 1U59A 4WNKA 2XKCA 3H9FA 5IH5A 3P0MA 2YAAA 1WBOA 4CD0A 1UWHA 3QKKA 3OXIA 5HCZA 2XKFA 5JQ5A 3R73A 1V0PA 3GQLA 3QXOA 4U79A 3ZBFA 5KCVA 2PSQA 4JNWA 4RLKA 4QMXA 3FLZA 1WBTA 4ZS0A 2VD5A 3IGOA 1K9AA 3PUPA 3WF6A 4BDIA 2PZRA 3DK7A 3OTVA 1H08A 3HGKA 4O7WA 4A07A 4IB3A 2OXDA 3V5WA 4CMOA 2CLQA 1CKIA 1JPAA 3VS6A 3QGYA 5CQWA 4AUAA 4DH3A 3DFAA 3M11A 3BU5A 2ZM3A 2OJFE 5EI2A 3CD8A 4BYJA 3HAMA 3JS2A 4O83A 4FKSA 4UV0A 4FT9A 4MWIA 4QMSA 4ERWA 1VZOA 4O84A 4X2FA 2GDOA 3QRIA 4YHFA 1KWPA 3D0EA 2C4GA 2KULA 4CQGA 1Q99A 1M52A 5CAVA 1DAYA 4WBOA 3QLFA 5FGKA 4XV1A 4YJTA 3PZEA 2YN8A 2SRCA 3N4VA 1ZYSA 4IACA 5FM3A 4BCFA 3FY0A 4BC6A 4BGQA 2CKPA 5BMMA 2BRNA 4G3GA 5AP6A 4DE4A 1JQHA 1J7LA 4N6ZA 4QTDA 2UZEA 4AFJA 4ANSA 3ZYAA 1GOLA 4ZTSA 1ZY4A 3Q4CA 2ZOQA 3MTFA 3OOGA 4H1MA 3R7IA 4KKGA 3LFAA 3G5DA 2WMXA 3NUNA 4F09A 5LJJA 3PG1A 3QD0A 1OL6A 4GYGA 5IQEA 4PL4A 5IH6A 5IUHA 2RG5A 5IPJA 2GFCA 3QD4A 4JAJA 4DEGA 1Q24A 3DK3A 3BELA 1NXKA 1K2PA 1YXUA 2Y9QA 1R78A 4PUZA 3VS0A 3MVMA 1CKPA 5IQAA 4KB8A 4NT4A 4I24A 4YJSA 5C4LA 3MVHA 3V01A 4IZYA 4FE2A 3C5IA 3G33A 3LXPA 2YFXA 4NM3A 5EI6A 2GHGA 4XNEA 3PRFA 4OTFA 2P3GX 2QODA 4ZIMA 3LW0A 5CEMA 3PA5A 3NSZA 2QU5A 4FTNA 3IECA 4ZS4A 3VW6A 1BI7A 2VTRA 1JWHA 2OZAA 4GV1A 4OLIA 2C3KA 3C13A 4FT3A 4AS0A 4E6QA 2YIQA 3QTIA 1OL5A 2O5KA 2OJGA 3TUCA 3D15A 5LVPA 4KBAA 4LGGA 3UMXA 5M07A 4M68A 4TWOA 5CX9A 4YJNA 3DLZA 1XH9A 4LV8A 4V0GA 5FXQA 4HVHA 4ID7A 2WTKB 3VS7A 5KHXA 3FLYA 4FMQA 4G17A 3NS9A 2XIZA 2C6OA 1WFCA 3GU5A 5AUVA 4EH7A 2GS6A 2WFYA 3UIBA 1OKZA 2C30A 3MWUA 2XA4A 4MWHA 1PMEA 3HMIA 1LUFA 2P33A 3C0GA 4YZMA 3V51A 4EK8A 4G5JA 4D4SA 4EQMA 4AT5A 4IFCA 3MSSA 4PL5A 4QMVA 2QO9A 4BFMA 3O71A 3L9MA 1XBBA 3E88A 4R5SA 3NGAA 1HCLA 2R7BA 4UWCA 5CANA 4YLJA 4EORA 4FSMA 3QZHA 4FICA 5J95A 4CG9A 5IQHA 4YZCA 3Q9XA 4KD1A 4MXXA 3UNJA 4JDHA 3HV4A 2W1IA 5HLNA 5ETCA 3TKUA 3UG2A 3FY2A 2BZKB 2YM8A 4YTIA 1H1PA 4I92A 1BKXA 2VRXA 3D94A 3PXFA 3VF9A 2C6LA 5IG1A 1KOAA 4XJ0A 1XJDA 3HMOA 5M4IA 1Q61A 3UQGA 3TCPA 1SVGA 2OIQA 3SX9A 1XWSA 5FLFA 4USEA 4LYNA 4YLKA 4EYMA 4R3CA 2GNHA 4O21A 4XG9A 4CYJA 3KQ7A 3EIDA 4FSZA 3A7HA 5E9EA 3R7VA 3MPTA 3BGQA 4ZP5A 2WB8A 3FLSA 4IAZA 3S3IA 4DITA 2W0JA 3NYVA 1OKWA 4HJOA 3QTWA 1OPKA 3F2RA 4MD8E 4M3QA 5HE1A 3A62A 3ZO4A 4FTTA 3GT8A 2XCHA 3DNDA 3AC8A 3U6JA 5IKWA 2WMQA 1ZYLA 4XG3A 3QZGA 4AOJA 5L6WL 3BKBA 3PXKA 4CFWA 4ASEA 1VYZA 3FZ1A 3P7BA 3QZFA 2AC3A 1PYXA 2UW9A 1O9UA 2BZHB 3KY2A 4FTQA 4IANA 3QA0A 5K5NA 2PU8A 3L8VA 2XIYA 1IEPA 5HHWA 2G2IA 2JDTA 1E1XA 4QT1A 4EH3A 3ELJA 4L01A 4UN0C 3ZEWA 5IEYA 2WOUA 4NKAA 4NCTA 5AADA 5KMNA 2AC5A 2PVNA 4K33A 5GJFA 5C1QB 4F6WA 2I40A 4FTOA 2C6DA 3QUEA 4O0YA 4PNKA 5TT7A 4C02A 4DEHA 4E8AA 4U0IA 1R0EA 5DG5A 3SGCA 2Z7RA 2UVYA 3LCTA 4CEGA 3FMKA 1E1VA 2GNIA 3ZCLA 4S33A 5D7AA 5KZ0A 4TWNA 1UU3A 4FX3A 5TO8A 2VWWA 3R1YA 1ATPE 5HKMA 3UIUA 2JFMA 4W4VA 4MK0A 5AA8A 3NMUF 4FTMA 3LXKA 4CSVA 4AE9A 2YM5A 3GEQA 4FKGA 5AIRA 4BDHA 4FIIA 3Q4ZA 3C4WA 2H9VA 1ZMWA 3IK3A 3HUCA 4F64A 3R7GA 4D4VA 4XS2A 4V01A 4EONA 5KZIA 3W18A 2AYPA 2C5NA 1JBPE 5JKGA 3EFWA 2R4BA 3LCSA 2Y4IC 4C4EA 5JFSA 2YHVA 2YCQA 2ITWA 4UB7A 3ZUUA 5CEPA 4DFXE 4A4XA 1GZNA 3E64A 2BILB 3QTZA 3VWAA 4DTBA 2UZBA 3FLWA 4FTCA 1DI9A 2X6EA 2NRYA 3O50A 3QHWA 4MTAA 1YXSA 1VYWA 2X7OA 2ONLC 4YZDA 1AGWA 2C5VA 5TR6A 1OBDA 4PQNA 1SNXA 4FKWA 3FDNA 3PXRA 4YC3A 2Z7QA 3EOCA 3SQQA 1H27A 2EXCX 4JLCA 5CVHA 1CDKA 5AV2A 3R02A 4CCUA 1ZZLA 4RJ6A 3LE6A 2IVSA 3DTWA 3NRMA 4ZZNA 2X8IA 4XYFA 3QTUA 3DBQA 4RWIA 3OUNB 3VS1A 2OJJA 4C61A 4IE9A 4L3LA 1S9JA 4GUEA 1UU9A 2VTAA 3O0GA 5AP3A 4RMZA 4RIYB 3R8LA 3DB8A 3IQ7A 3NIZA 1UV5A 5HX6A 4YTCA 3ZC6A 4DT9A 1KUTA 3COKA 4D1XA 3ODYX 4AX8A 3TWJA 1OIRA 3A61A 2VTLA 1H07A 3SW4A 3KXGA 4CKJA 2GNJA 3LLTA 4BBFA 3B8QA 3WIGA 1W84A 4F4PA 5BYZA 3VBXA 4PP9A 2XJ2A 4O91A 4BCHA 3NW7A 4J97A 5H9BA 4R78A 4DH8A 2O3PA 3FXZA 4DH1A 4EWHA 4LRMA 4U6RA 4ALVA 4ONAA 5E8VA 2HZIA 3AC1A 2Y0AA 2B53A 2HYYA 4O81A 3R30A 3QCSA 3O8TA 4KS7A 4F0FA 1O6KA 5FUTA 4GJ3A 4JR7A 2C5XA 3PIZA 4IVDA 1M2PA 1DS5A 5EYKA 1M2RA 4UY9A 3TT0A 4MBLA 3R71A 1IG1A 3TTJA 4FODA 4ZSGA 5LVLA 3W1FA 4BGHA 4ACMA 3IOPA 3DBCA 2X9EA 5T68A 5FBNC 3NUYA 2PZPA 2I0VA 4G34A 4XLVA 3SKCA 5CWZA 3WYXA 1Q5KA 2BHHA 5L2WA 4FEVA 1Q8YA 3LJ2A 4QYGA 3OCGA 2Y6OA 3ZSHA 1BI8A 2YZAA 1SNUA 2BKKA 3I4BA 4RT7A 2R3FA 2JIIA 2ZV2A 5ACKA 5ANOA 2YDIA 1NVQA 3PVGA 5CF4A 3AMBA 4YLLA 4FV9A 4TTHB 4X2NA 4XP2A 4IHPA 2CN8A 4C57A 4GKIA 1Q62A 3Q4UA 1ZXEA 2JKQA 2O2UA 4RC2A 4C33A 3EN9A 4O7LA 4XCUA 5C8NA 3QQGA 5CZIA 4C35A 3O96A 3S4QA 4GVJA 4AOIA 4AP7A 3HAVA 3N4TA 4A9RA 2R0IA 2A0CX 3OMVA 4FGRA 3FMMA 4ZY4A 2BTSA 2BALA 2GHLA 3EKNA 3TEIA 3OF0A 2C5OA 4DCAA 4BDKA 2QD9A 3FZRA 4NFNA 2C69A 4G2FA 5M4CA 5DRBA 5AUZA 2F7EE 4EOQA 1KE5A 4QMWA 4KSQA 1FBNA 3EQFA 3P7AA 5ETAA 3LIJA 5M06A 5FM2A 4F7SA 2WU6A 5F9EA 4PV0A 3RK5A 4WO5A 2UZNA 1GNGA 5CS6A 3BU6A 4XV9A 3GGFA 3RJCA 2ETRA 3F82A 1HCKA 3LJ1A 4HCVA 4QNAA 3R63A 5ANKA 3FQHA 3U9NA 4TYIA 2BAJA 4OTRA 5CI6A 4HZSA 3FZOA 3MGYA 2FYSA 3HMPA 3R6XA 4WNMA 4NU1A 5CSHA 4IM3A 4I0TA 2JAMA 2X4ZA 3RK7A 3BHTA 3MBLA 4G16A 4RLLA 4U43A 5G1XA 2WGJA 2R3LA 2FO0A 3QYZA 3DAKA 1ZAOA 4ITJA 2OI4X 4K18A 4MF0A 4CMTA 1G8AA 4RIYA 4CT1A 4DFYA 3DU8A 3CD3A 5B2MA 4YTHA 2WPAA 3DJ5A 2WTJA 4AA4A 2HWOA 3SXSA 3SVVA 2VNYA 4EOLA 4H39A 5I5ZA 2Y7JA 4OGRA 3GU6A 5DT3A 3W32A 4CZUA 4IWQA 1XH6A 4GJ2A 4P2KA 2VNWA 4YBJA 4EH9A 3EN7A 3Q04A 3OZ6A 1JOWB 2QR8A 4HGTA 2R3MA 4M84A 2YIYA 3CGFA 1U5RA 3UGCA 4DEEA 5HO8A 3SC1A 4W4XA 3QRKA 1IAJA 4LRKA 5KMIA 2XNMA 1GY3A 4Y85A 4PMPA 4KUJA 3HRCA 4QPMA 3U8WA 4QP6A 5LARA 2A1AB 5HO6A 4D4RA 2PUNA 1P14A 3O51A 1YI3A 5HNIX 1XQZA 1JSUA 3JUHA 4CFFA 4FSWA 1PJKA 3R0TA 3KVWA 3NVKI 4DYMA 1H01A 4EK4A 4XV3A 5CTPA 1YI6A 1H1RA 4R7HA 3UPZA 3ZO1A 2C6MA 2IJMA 3DXQA 2W1GA 2JDSA 3H9RA 4YBKA 4F08A 5I9VA 4WD5A 4WSYA 2J9MA 4BYIA 3DT1A 2CMWA 4TYHB 3FMEA 4YNOA 4CLJA 5GZAA 4EOIA 4DFNA 3QUDA 4V04A 2RFNA 4O7VA 3KFAA 4FSUA 2QHNA 2YIRA 4IVAA 5GZ9A 3BEGA 5CENA 5EHYA 2OSCA 5DOSA 3UVQA 3O2MA 2Z7LA 5HG7A 5DEWA 4YO4A 4EZ5A 4L42A 1MP8A 3QZIA 4LMUA 2BUJA 1H26A 5E1EA 4ZZMA 5K3YA 5M09A 1WBVA 4RFZA 4OBPA 5CXHA 1PKDA 3M42A 4BTKA 3UO5A 2UW0A 2ETKA 4RIWB 1J1CA 1QL6A 2W1CA 5BVWA 4JQ8A 3TNHA 4DT8A 4R1YA 4ALWA 4YSJA 4FV0A 4UMRA 2X2KA 1XH7A 2W05A 1EH4A 3MIAA 3DY7A 2VTIA 2BAQA 3R83A 4TZRA 5DWRA 5HU3A 4YSMA 3QRTA 3LM5A 3FL5A 4AAAA 1PYEA 1RE8A 3BV2A 4ACGA 5JMSA 1UA2A 2B55A 2XEZA 1OB3A 1XHAA 2HAKA 4FTUA 5T6KA 4EUUA 5BPYA 1WBNA 4P5ZA 1U4DA 2IZTA 5HE3A 3U9CA 3PXYA 4XG4A 5F95A 2QOLA 3MV5A 1UVRA 2P4IA 5M55A 1NT2A 1UWJA 3DKFA 3EQBA 4U8ZA 2RIOA 2QOIA 3AT3A 5DH3A 4R5YA 4GSBA 3F7ZA 3R8UA 5EG3A 4L67A 3OVVA 2X81A 5AMNA 5A4EA 3ORTA 1JNKA 3S2PA 3UOKA 5I3RA 3T8OA 3HYHA 3K3JA 3P78A 3I0QA 3TJDA 4AFEA 3IDBA 4J8NA 2ZJWA 2ZDUA 4J99A 2GCDA 2Q0BA 4UALA 4YTFA 1OUKA 2WQNA 5A4CA 1OIQA 2X4FA 3MA3A 3SHEA 3FHRA 4KNBA 3UC4A 4UMPA 3CSVA 3AT2A 1LP4A 4ASXA 4EH2A 3FZPA 4K0YA 5AUXA 5L8JA 3DPKA 3CE3A 5AUYA 3VJNA 2V62A 4QPSA 1Y8GA 5AR3A 1P5EA 5HD4A 3FMLA 2UUEA 3KMMA 4ALUA 5DPVA 4UXQA 1F3MC 2DQ7X 3CC6A 4DG2E 5D7VA 5HU9A 1F5QA 2IVVA 1YXVA 5AIKA 1W98A 4BI1A 1MUOA 3B8RA 5BYLA 3PTGA 2JDRA 3QU0A 3FI2A 2W4KA 3ZLSA 5CVGA 2PWLA 3ZDUA 4FKVA 5AP4A 3IPHA 5EKOA 3ORLA 3THBA 3DK6A 5GIOE 5KUPA 2YAKA 2ZYBA 5GHVA 5C01A 4AGCA 4JRNA 3JPVA 3DS6A 4I94A 3GU7A 1NY3A 2FB8A 2V5QA 2WMBA 3ALOA 3BHUA 4PPAA 5CSXA 5ICPA 5ANIA 3OC1A 4H1JA 4CMUA 2JBOA 4B0GA 2PVMA 3LFQA 2XNOA 4X2KA 4HPTE 5DA3A 2PVFA 4DLIA 4DF3A 5DI1A 4L3PA 2B9IA 1NVRA 2J0KA 5CU6A 2QKWB 4BCMA 5CVFA 3RPOA 1ZYJA 3FQEA 5IUGA 2BR1A 5A54A 4R77A 2CJMA 3V8WA 4RX9A 5BVDA 5M56A 4TRLA 5HCYA 1H1WA 1Q3DA 2E9NA 3EYGA 3VHKA 3EQCA 3FMNA 4FTAA 4NCTC 3GOKA 4AGUA 5F94A 3DDPA 3NUUA 4JT3A 4KS8A 3OT3A 4P4CA 3HP5A 4C62A 4QMNA 4I23A 4BKJA 4HYUA 2EB2A 3EWHA 3ORZA 4KIKB 2BMCA 3KMWA 3OWJA 3OFMA 2PUPA 3LHJA 1OVEA 3Q9ZA 3BLHA 4X2GA 5C8MA 4R6VA 5KX8A 4RIWA 4TNDA 3IDCA 5E4HA 3RAHA 2WTKC 4NTSA 4IADA 4QYHA 2QOHA 4USDA 1H1SA 1XR1A 4HCTA 4UX9A 4A9SA 2PVJA 2GQGA 5E8XA 5KE0A 1H4LA 3CQEA 3IS5A 5DT4A 4MHAA 3NYOA 5JT2A 3TDWA 5A6NA 3BLRA 4MXZA 4N57A 1Y91A 4DH7A 5HLWA 2PZIA 2VWIA 5HBHA 3KXXA 4EOKA 2YCSA 4Z7GA 3IW6A 5DVRA 5J1VA 3TKHA 4FUYA 3IONA 3NW5A 4EJNA 4FTIA 2XCKA 5EHOA 2GMXA 2ITZA 2OFUA 5HG5A 2IPXA 4GU6A 4RGJA 3QRUA 3MB6A 5EM7A 3VQUA 1YDRE 3VS2A 3F3VA 4EKKA 4FUXA 3U6IA 4I41A 3AC3A 4G3EA 4QP9A 4XMOA 1L8TA 4O22A 1Y6BA 5AAFA 3RP9A 4X7QA 5IMXA 4M67A 3PVUA 2QHMA 4LOQA 1REKA 3Q96A 4CTBA 3M1SA 1H0VA 3A4OX 2I0YA 2JIUA 3DAJA 3R1QA 5AR7A 3TNPC 5A4LA 5LOHA 4FVQA 4Y95A 4HYHA 2NP8A 2A27A 3HP2A 4RA5A 3ORIA 3EL8A 4BN1A 4H3BA 3ALNA 4W4YA 3BBWA 4M0YA 2XRWA 4GH2A 4O82A 4FV3A 5J5TA 2JC6A 3CY2A 3NNXA 1H28A 2FA2A 2IW8A 3FI8A 4QMPA 3GCPA 2XNNA 4XRLA 2RF9A 2BRGA 3LCOA 4AN3A 2PULA 3CTHA 3C50A 4XG8A 2OXYA 3W2OA 3PPJA 3VUGA 4PDOA 4FZ6A 3E8NA 3VW8A 2OLCA 5AUUA 4O1OA 4S34A 4E4XA 3EFJA 5EYCA 3UE4A 3OW4A 2JLDA 3R8MA 1J91A 3H0YA 4DC2A 3S1HA 4E26A 3UQCA 3DBFA 5BVEA 4ZJJA 2CGWA 3UNKA 4DHFA 2C6KA 4J96A 4GU9A 4E5BA 3BQRA 4RWJA 3DFCB 3UYSA 2VWYA 3VUKA 3K2LA 4IAKA 3TL8A 3C5UA 3D5UA 4C3RA 5DFPA 1W0XC 4FSRA 4CNHA 4UYAA 5L2QA 4BCPA 1XBAA 1YHSA 2C0OA 4PMTA 2G15A 4Y5HA 2OG8A 3PA3A 4CFVA 4I20A 4KAOA 4GIHA 1KSWA 2OJIA 1I09A 3EN6A 4U42A 1A9UA 1LEZA 4KIKA 5E8UA 4J8MA 4PMSA 5IH4A 1SVHA 3EQPA 4FBXA 4FT0A 3UIXA 3ZBXA 1QMZA 5AV0A 5D1JA 5HNBA 3RKBA 2QOOA 2YDKA 3IGGA 3ANRA 2Z2WA 2F7ZE 4GW8A 3LXNA 5AJQA 5I9YA 4KKEA 5FTOA 1FGIA 3G51A 5IUIA 4AGDA 3E3BX 3T3VA 2IZSA 3CLYA 3PWYA 4MKCA 4EL9A 2E9VA 5EW3A 4RVMA 4AQCA 4TYEA 1CM8A 2VTMA 2FH9A 4BCGA 4QTEA 2V22A 2YEXA 3RWPA 2R3JA 4RJ3A 2OGVA 3FLQA 2X7GA 3G0EA 3PY1A 3Q5ZA 3FKOA 5J9LA 3O17A 1TKIA 5DLSA 5AM7A 3ZEPA 4JS8A 3E7VA 4M8TA 2CPKE 2O8YA 1YOLA 2YM3A 4F9BA 2JBPA 2CNQA 5EDQA 3PPKA 3EQIA 4TN6A 1WBWA 4GFGA 4RG0A 3WIKA 2YERA 1ZMUA 4QNYA 2XK9A 1YWRA 4EHVA 3GC9A 3OROA 3BHHA 3UNZA 1MQ4A 4O7NA 3QHRA 1JKSA 5JEBA 4IX5A 4BZNA 3N4UA 3KCKA 2VX0A 3BLQA 3R7YA 3MDYA 4WBBB 1A48A 4D5HA 3CCNA 3NUPA 2VWXA 1GIHA 2XZSA 2UZWE 2VWBA 1U5QA 2AUHA 3GB2A 4I6BA 2HWPA 2F57A 3G2FA 3C0IA 3UBDA 1IASA 4JJRA 2HCKA 3CR0A 5I9UA 5FP5A 3QQHA 5ACBC 2WAJA 3KRJA 1Q3WA 4QP3A 4X0MA 4JG7A 3L8SA 5HIEA 3KRWA 4HPUE 5I9WA 2XIRA 3EN4A 4RPVA 3PVWA 1OM1A 4WHZA 1TVOA 5CI7A 5E92A 3S00A 2CNVA 4JQ7A 2C0IA 3VC4A 3KXHA 2PMIA 3BQCA 3RINA 4Y46A 3W2CA 4Q5EA 5DR2A 5M4FA 3KVXA 3TV7A 5L2IA 3JR1A 3E63A 4QQ5A 2C6EA 4UZHA 3UOLA 2E2BA 1PXPA 4RIOA 2Q83A 3KKVA 3C4XA 5HZNA 5LVMA 2HIWA 3OG7A 4E1ZA 5LCJA 3NX8A 4EI4A 4C4HA 4D2VA 3FMHA 3BYUA 4FIJA 4R3RA 4LI5A 4KRCA 3KMUA 5GNKA 2R2PA 2R3RA 3F6XA 3HA6A 3II5A 4L53A 4OTGA 5DYJA 3CQUA 4BIEA 5HE2A 3A99A 4BDGA 2J0MB 3P86A 3WF9A 4X3FB 1T45A 4MF1A 4QP2A 4EZ3A 3ZONA 4AW2A 4MYGA 1CTPE 4AOTA 3GI3A 2VUWA 2VWVA 4IB1A 3A7IA 2C6IA 3CPBA 3EB0A 3PFQA 5AUWA 2ZMDA 3C9WA 4K11A 3WOWA 5IA2A 4EQCA 5J5SA 1PXMA 2FVDA 2H96A 5D41A 4EOPA 3C4EA 2WD1A 3ID6C 2C47A 3H4JA 2ZV9A 1JKTA 1GZ8A 4AF3A 3SDJA 3DXPA 2QO7A 3F3UA 2UW4A 1UU8A 4LMNA 5AR8A 3V6RA 2W1ZA 4IB5A 1KE7A 2JAVA 4DGMA 4OBQA 3V5PA 4IX4A 2UZDA 3LQ8A 4O86A 4QD6A 3PLSA 4G3CA 5IEXA 3KEXA 4GRBA 4E4LA 3Q9WA 4N0SA 2WXVA 4QRCA 3KF4A 5DHJA 5I9XA 4L3JA 5GINE 1A06A 2OICA 2VGOA 3MFUA 2GNLA 4C4GA 4XH6A 4HVDA 4BY9E 4RQVA 2WTCA 4D2PA 5JFWA 2W7XA 2WO6A 4PDSA 4FKJA 5E8YA 3BIZA 3UODA 3GNIB 4O1PA 4FNZA 3KRLA 4FR4A 4FT7A 4L44A 4JX7A 1JSTA 5A9UA 1DM2A 3SW7A 2VTSA 3BYSA 3FSKA 3ZM9A 4E6AA 2OXXA 4BWPA 2ZB0A 3PYYA 3FAAA 4DTKA 5HX8A 4ANMA 4D28A 4IVCA 4U80A 2UV2A 1PMUA 3RPVA 3W33A 3K5UA 4M7IA 4UWBA 4BBEA 5L3AA 5EQYA 3R00A 3UOJA 1OITA 2VX1A 3WF5A 2QLQA 4IDVA 2JGZA 2P0CA 5FXRA 4QYFA 2WTIA 3FHIA 3NNUA 4IAIA 5CNNA 3E8EA 2JKMA 3BYMA 5LXMA 2IO6A 5E91A 3R2YA 3UJGA 4D5KA 3BBTB 4AE6A 3I1AA 2Z02A 4J7BA 3VBQA 2QU6A 5M51A 4E4NA 1GJOA 1LR4A 3F88A 3FPMA 3ZUVA 3HV6A 1CMKE 1T46A 2XM9A 3DAEA 5H8GA 1IA8A 3D4QA 4C4FA 5LCKA 4BTFA 3Q32A 4JG6A 4MX9A 3T3UA 3CGOA 3LM0A 3TKIA 4F1MA 3NAYA 3ORMA 4QTAA 2WMAA 2R0UA 4C58A 3NUAA 4KIQA 3KN5A 3TUBA 2G1TA 4AACA 4A06A 5L6PA 4QO9A 4R1VA 2CDZA 4LG4A 2WIPA 3QWKA 3MESA 4WG5A 5HVKA 3PP0A 2GQSA 5IA5A 4AW5A 4ITHA 3E8DA 4I6FA 1ZRZA 5CU3A 2PVKA 2Y4PA 2A4LA 3F2NA 3QFVA 3FPQA 2WMTA 3Q60A 4YZBA 4DGNA 3QGWA 4EH6A 1KV1A 2E9UA 3CIKA 4KABA 5AR5A 1Q8TA 3IDPA 3U51A 4JDKA 3R8ZA 4X3FA 3TM0A 1W7HA 1G8SA 2B9FA 4FG7A 4RVLA 4TPTA 2ITVA 2Z7SA 3H10A 5DE2A 2JDOA 3B2WA 3ACJA 4W8DA 4NH1A 5JGAA 3PSDA 2P2HA 4IZ5A 3P23A 2RSVA 3E92A 5CAQA 3BI6A 4RJ7A 5JK3A 4O0WA 2CCIA 2W1DA 5IQFA 2ACXA 3F69A 4MH7A 1PHKA 3MH3A 4L52A 4C59A 4AZSA 3TV6A 3V8SA 2UZLA 4TY1A 4GS6A 2VN9A 3MVLA 4AT4A 3HDNA 5HI2A 4AA0A 4BWKA 5CSPA 4U3ZA 3K3IA 3FI4A 2VTJA 2ERZE 2PVHA 4N4SA 4ACCA 4AN2A 4ANOA 1YKRA 3MFRA 4M14A 4Z3VA 2ITXA 2IW9A 4NM0A 5CEOA 5EQPA 3F3TA 4FV7A 3RMFA 3ZFMA 4S2ZA 5EHLA 3KRXA 1H00A 2OW3A 3FZTA 3MPAA 4RVKA 3ZC5A 1U54A 4IFGA 3FXWA 5CNOA 5J79A 1PXIA 4FNWA 4XRJA 5LVNA 2QURA 4MNFA 2FSMX 2PE0A 4FC0A 1NW1A 1OI9A 1URCA 4NW5A 4PPBA 4F99A 3MH0A 3UZTA 2C1BA 4AW1A 1ZOHA 3E8CA 3Q2MA 4FEXA 3BWFA 3PE1A 4HNFA 2W96B 4L00A 4L43A 2QO2A 2R3IA 3AD4A 3KREA 2O63A 4B7TA 5JFVA 3F5UA 1YXXA 5CAOA 2YABA 2GHMA 3RHKA 4D55A 3WF7A 3HUBA 1Z9XA 5L2SA 4JIAA 4K1BA 4QMLA 4QQTA 3RAWA 4ACHA 3NNVA 5D11A 4R8QA 3N51A 1GAGA 3TV4A 3WE8A 2W9ZB 1MRYA 3GCQA 3PJ1A 4FYNA 3LVPA 2VTQA 3LAUA 4WOVA 4OT6A 4ORKA 4DGOA 4F9AA 3EKKA 2UW5A 5J9ZA 2CLXA 2QKRA 1Q97A 1OBGA 3OP5A 4NIFA 4YNEA 5J7BA 4EK6A 1PXJA 2BRBA 4ZSEA 4Y5QA 5EW8A 4H3QA 3QTXA 2IZUA 3DB6A 5D10A 2ITPA 5ANGA 4ARKA 5DBXA 2PMLX 3U55A 1PXOA 5KMLA 3QBNA 2IVUA 4JI9A 4C4IA 3QRJA 1YDTE 3HV7A 3PJ2A 4I3ZA 1FGKA 4JBOA 4K8AA 4V05A 3V5QA 4FOCA 3HNGA 4RWLA 2YISA 2PPQA 2FUMA 3T9IA 3ORKA 3DXNA 1MRUA 2EXMA 2VTHA 4CT2A 4MNEA 5M57A 3SG8A 1OL1A 1VR2A 2EVAA 3A7GA 3BX5A 2XMYA 4AT3A 1PMVA 3UZRA 2BRMA 3GENA 4JVGA 4B8LA 4C3FA 5BQ0A 5HVJA 2BZJA 5CSWA 4CFXA 5J7HA 5DR6A 1IR3A 5CEKA 2CKOA 2BVAA 1XKKA 3RHXA 4CV9A 4NUSA 3I5NA 4FK3A 5CXZA 3BYVA 2WIHA 2X8DA 3IW7A 3R21A 5DR9A 3Q5IA 4DBXA 2W1EA 1FVTA 4MEDA 3OEZA 4ZLOA 4FEWA 2NNWB 3FWQA 1RJBA 4BI2A 3V8TA 3W8LA 4AZFA 4EOSA 3NAXA 4I4FA 5ETIA 4GCJA 5KBQA 4YGAA 4D2WA 2I0EA 1YQJA 3EQDA 3QCXA 4CVAA 5M4UA 5A46A 1J7UA 5TF9A 2XK4A 3KRRA 4PX6A 2R3NA 3QYWA 4NM7A 3ZLWA 3FEGA 4J71A 4F7JA 5BX0A 5I0BA 4MXCA 3BEAA 3DQWA 3R8VA 3D2KA 1JAMA 3CJFA 1JKLA 2W5BA 4L7FA 5JSMA 3FC2A 3G6HA 3V5JA 3HRBA 2B9HA 3LMHA 4FGBA 2CN5A 5KBRA 4BZOA 1Z5MA 2GNFA 1PF8A 3OWPA 4C37A 3KXZA 4RBLA 3DZQA 4U97A 5FDXA 3OW3A 4CRSA 3ATSA 4W9WA 2WMWA 5CQUA 3FKLA 4BCKA 4GVAA 5HEZA 4M15A 3RVGA 2CSNA 4BDEA 3WZJA 2I0HA 3IW5A 4JL9A 4A9YA 2WTVA 2EUFB 4FG9A 2C1AA 4FIEA 2WEIA 3D2IA 2RFDA 4L8MA 3HMMA 4I5MA 2CGXA 1UNLA 3O23A 1XH4A 3ANQA 4G3FA 3AQVA 4AA5A 4ZOGA 3LFEA 4OAVB 3ORXA 3RWQA 3Q6WA 3ENHA 4L7SA 1P2AA 3MS9A 2XIKA 2QG5A 2V0DA 3I6WA 2C3JA 2FGIA 2ETMA 3KF7A 3MY0A 5L8KA 4IC7A 3ULZA 4EOMA 4NL0A 4XP3A 1ZMVA 3OXTA 2HW7A 2R3PA 5AP2A 3AOXA 4AZWA 2JKOA 4PPCA 2F4JA 2YM6A 2IVTA 4FZAB 4S30A 2PZYA 3UDBA 4PTGA 1OUYA 4A9UA 4FKIA 2XJ1A 3KGAA 4XEYA 4DINA 4I5PA 1ERKA 1QCFA 3VBYA 4EH4A 4R7BA 3ZLXA 4CYIA 4C8BA 3WZEA 3F3ZA 1RQQA 2VWUA 2YWVA 3M2WA 1BL7A 4IAYA 1PMNA 4KBCA 3C0HA 2W5HA 3QD3A 3QTSA 1SMHA 4GFMA 4K77A 2H6DA 3WZUA 4YP8A 2BAKA 2A19B 5HBJA 2IN6A 3DLSA 4RX8A 4YO6A 5HCXA 4HGSA 5TKDA 3TIZA 5KMJA 2HELA 3KU2A 5EM5A 4XX9A 3COIA 4TT7A 4CTCA 1CSNA 2ZDTA 1YOJA 2LGCA 3R1NA 4OTHA 2XRUA 5HG8A 2VO7A 3RZFA 2WMSA 3CKWA 4GMYA 3F5GA 3F9NA 4UMTA 3ORNA 3QUPA 3VNTA 1ZOGA 4I5CA 4WA9A 4NK9A 3PXZA 1W83A 5EOBA 3OXZA 2O64A 4PDPA 2WQEA 2J2IB 1H0WA 2W4OA 3L9LA 3AGLA 4LV5A 3MN3A 3HECA 4RFMA 3GCSA 4EKLA 4KA3A 3MY5A 2LAVA 3CS9A 4QP4A 1Q41A 3NUSA 3BU3A 4GT4A 5F4NA 1FVVA 5HVYA 4QQJA 3SXRA 4O0UA 4J98A 4DEDA 2Y6MA 2UW8A 3FUPA 3MVJA 3RI1A 4F6SA 3RZBA 4IZAA 3W55A 4FEUA 3SLSA 1REJA 4ANQA 5LQFA 4U44A 3F5XA 4L6QA 2X7FA 5ANJA 3E93A 2UW3A 3FMJA 4JQEA 5CASA 4LUDA 4RX7A 1TQMA 4R7IA 3FBVA 1GZKA 5KO1A 3PJ3A 4ZAUA 4KWPA 1B6CB 3AD5A 5IA4A 4DG0E 4I93A 4YC6A 4BZDA 3AC2A 5J8IA 5KMOA 4ZTQA 5FQDC 4EHEA 4J95A 3LQ3A 4IH8A 3I5ZA 5C27A 3F66A 4X6RA 2PZ5A 2R64A 5BVOA 2C3IB 4QP8A 4EYJA 4NWMA 2DUVA 4LGDA 3F3WA 4X21A 5LMBA 4N70A 3CTJA 2X0GA 3LFSA 3OS3A 4G3DA 1YVJA 4WIHA 4W8EA 4EJ7A 2E9OA 1YDSE 5B7VA 3B2TA 2WEVA 2C6TA 3DKCA 5DGZA 3WYYA 4A4OA 2V55A 4M66A 5TOZA 3ORPA 4IEBA 2WHBA 3CTQA 4ZTHA 2F2CB 2QOKA 5AP0A 4OTWA 3Q4TA 4F9YA 4ZMFA 2ZV7A 4JOAA 5D12A 3D5XA 3KC3A 3AGMA 3QX2A 2ZAZA 3HV5A 2Z60A 3P79A 3VAPA 1YRPA 3VUHA 2IW6A 2OBJA 2YM4A 4GT3A 2YWPA 3LZBA 3ZU7A 3QD2B 4K9YA 2VTNA 3DJ7A 5EI8A 2RKUA 4KRDA 1OL2A 3PSBA 1R3CA 4C34A 2ZM1A 3L8XA 3RM6A 1XH5A 2HK5A 1J3HA 3QA8A 4QTBA 4YJRA 4DCEA 3IG7A 4BTMA 4DEBA 2JFLA 4BKZA 5KHWA 2R5TA 4IZ7A 4E3CA 5HTCA 1G5SA 4PY1A 3ZRLA 2HZ0A 4USFA 5AV3A 4DEIA 3RM7A 5DMZA 3ET7A 1CKJA 4Y73A 4G9CA 4QYYA 1FMKA 3MH2A 5AAEA 5HLPA 4FK6A 5I4NA 3CXWA 2E9PA 2BRHA 4I22A 5AWMA 2W5AA 2XNBA 3RAIA 2I7QA 2OJ9A 3UZPA 2X1NA 3TTIA 2HENA 4IX3A 3WI6A 4M12A 4CGAA 4BIDA 3OY1A 4EK3A 3ZFYA 3K5VA 1V0OA 5I3OA 2YIXA 3VIDA 3ZRMA 4QMQA 5IA3A 3O8PA 4C0TA 3JY0A 3ULIA 4DFZE 1FQ1B 4EC8A 2XK3A 3U54A 2YZLA 3VBTA 4QP7A 4BR3A 3R9HA 3TN8A 4Z16A 3LCDA 2PMOX 4FV1A 4IJPA 4BF2A 4L68A 4CV8A 3QTRA 4TW9A 5LVOA 4I5HA 3D7TB 4OTIA 5B2LA 4GKHA 3BRBA 3NDMA 4Y83A 5E8ZA 3BGZA 2ITYA 2JD5A 4OUCA 1YHWA 2UZTA 3QCYA 5H8EA 3FL4A 2BKZA 2DS1A 4CZTA 4U41A 4P7EA 4Q9ZA 2XB7A 4E20A 2IG7A 1WMKA 4BVUA 2YCRA 3QC4A 3BE2A 4QOXA 3NPCA 2R3QA 4CFMA 2CCHA 2XIXA 4X3FC 5EYMA 1P4OA 2ITOA 2I1MA 4O7RA 1QPCA 3OCTA 3LFBA 5IU2A 3U4UA 1NA7A 5HOAA 3O8UA 2P2IA 2WTDA 4UXLA 3U4WA 2J50A 1M17A 4FL1A 4WRGA 3V5LA 5CEQA 4HGEA 4ANBA 4E4MA 4I0RA 4FF8A 4RIXA 3TZMA 3DKOA 2QOBA 4H36A 3GXLA 3TNQB 5BNJA 1W8CA 3GCVA 2BFYA 2PY3A 1K3AA 4O2ZA 3C4FA 5CLPA 3RBWA 1M7NA 2BHEA 4RWKA 2QOFA 2VV9A 2YA9A 2EXEA 2QI8A 4FA2A 4CXAA 5IQBA 3ZO3A 3FXXA 4E6CA 5K0XA 5KKRB 4B6LA 4E93A 3RALA 3SD0A 4PTCA 2R9SA 3DNEA 2OH4A 4WUAA 4C36A 4ZXTA 1OPLA 3KXNA 5CU2A 1JKKA 2Y8OA 3D7ZA 4W9XA 5AP7A 1QPJA 3BHYA 1H8FA 3GU8A 4U5JA 3BYOA 4FEQA 4JBVA 3WF8A 2ZVAA 2OH0E 3EHAA 4UZDA 5GJDA 3R01A 4RFYA 5E8WA 2UVZA 4BHZA 5LWNA 4NFMA 1YXTA 3UIMA 3HL7A 2R3OA 2XM8A 3FSFA 3GCUA 3QKLA 4MBJA 4IQ6A 5H3QA 2B0QA 4W4WA 5B2KA 4AGWA 5E8TA 4AU8A 4AW0A 3MFTA 5IQCA 3MPMA 4OTDA 3RNYA 4YJPA 4HZRA 2QCSA 3ROCA 5J9YA 3V04A 1O6LA 5A14A 4NSTA 4D2SA 4ZTRA 4ERKA 3ITZA 4EHGA 2HXLA 2VO0A 2B9JA 4F1OA 3GQIA 3VUMA 4PDYA 5JQ8A 3CEKA 2WOTA 4EOJA 3KULB 5AP1A 4ANLA 4IB0A 3ZZWA 2I6LA 3TNWA 3LXLA 4UMUA 3ZDIA 1OGUA 3D14A 2VO3A 3G0FA 3LPBA 5CF6A 3W2QA 3KN6A 4F6UA 3C1XA 2GFSA 4MD7E 3RGFA 3SXFA 4YC8A 2PVRA 3SOAA 3CJGA 3ZMMA 1YWNA 3NYXA 1BX6A 2PUUA 3CQWA 4FOBA 3RTPA 3V5TA 4BCIA 5L8LA 4AXAA 5JGDA 2VTPA 3DDQA 3WBLA 3R2BA 4FKTA 5LWMA 3NNWA 3PZHA 4FNYA 3FYJX 4ASZA 4O0XA 5AM6A 3K54A 4QMZA 3D9VA 3EN5A 4WG4A 5CAPA 3V3VA 3D7TA 4EEVA 4DLJA 4F9WA 3CKXA 4O96A 5E90A 5HQ0A 3ZSGA 3NIEA 3PXQA 4CFUA 2HXQA 3BE9A 1W82A 2NO3A 3OCSA 4C3PA 2BIYA 2ZM4A 4JBPA 4E73A 4QTCA 3E62A 5I9ZA 4GK3A 2FSOX 2UW7A 2XUUA 5FRIA 3TZ7A 2A2AA 3ZUTA 4TYJA 2PYWA 4EQUA 3OWLA 5J1WA 1OPJA 4FIHA 4JDIA 2YJSA 3PJ8A 3MIYA 4H58A 3A8WA 4GK2A 5AP5A 3ZM4A 3VQHA 2R3HA 5LMKA 2ERKA 5HBEA 2XYUA 5BYYA 2BDFA 2UZVA 2BDWA 3ODZX 3UC3A 3GC7A 2CKQA 3LMGA 1VEBA 4MXYA 3COMA 2PE2A 5M53A 5CT7A 3FMDA 4FYOA 5HTBA 4HNIA 4FSYA 4UBAA 1STCE 1WVWA 2QLUA 2PTKA 3HV3A 4LL5A 4ACDA 4K2RA 4YHTA 1KE8A 3TI1A 1R39A 3AXWA 3GOPA 3L9NA 5KNJA 5FEQA 4Y8DA 1Q8UA 3H30A 3LOKA 3CY3A 3H3CA 4YR8A 2VU3A 3ZFXA 2J5EA 3C7QA 3MFSA 1SVEA 4AZVA 4CQEA 2YCFA 3NCGA 3PG3A 4L45A 5DEYA 4QMTA 4HVSA 3MY1A 4O6EA 3SA0A 3R9DA 2GTNA 3DV3A 4XUFA 4S32A 3VJOA 2QG7A 2RG6A 4U81A 4I21A 4NJ3A 4RZWA 5IF1A 2C0TA 3A4PA 3EMGA 4O0TA 4XG7A 3FC1X 4WRSA 5K9IA 3NCZA 4NM5A 3W2PA 1LEWA 4ZSAA 1MRVA 3UVRA 5HO7A 3G90X 4HGLA 4P5QA 4FSQA 4IJ9A 2WQBA 1SYKA 3I7BA 4HVGA 3I7CA 5CAUA 3PIYA 4D9TA 3QL8A 5CT0A 3BPRA 4NW6A 3FKNA 2VTTA 4MAOA 2EB3A 3TDVA 3IW4A 4X2JA 4ZLYA 4AZTA 3GVUA 5HG9A 3TNIA 3REPA 5J87A 5K4IA 2ITNA 5BUEA 4FZFB 4GK4A 3UP7A 4YZNA 4CCBA 2PK9A 3ERKA 2WMVA 5DRDA 3KULA 3OTUA 1PKGA 3GU4A 4Y72A 4P90A 4D0XA 4ZEGA 5JGBA 1P4FA 3VBWA 3DCVA 3EYHA 2X9FA 3A8XA 3GP0A 3DKGA 4A4LA 1WVXA 2B52A 2GU8A 3DQXA 1U54B 2G2HA 3L9PA 5E7RA 2YM7A 4WNOA 3R1SA 4OBOA 4O7TA 4LUEA 5DIAA 4U9AA 4D9UA 4EHZA 2QR7A 2J6MA 4PP7A 2XS0A 5DT0A 4KINA 3RCDA 3LFDA 2YIWA 5DN3A 4YHJA 2ZV8A 1Y57A 5EYDA 5HNGA 3SRVB 3VS5A 3WILA 1NVSA 5CU4A 1YHVA 3ZS5A 4BGGA 4O7ZA 4WKQA 1WCCA 2OF2A 2J51A 2JDVA 2O65A 4DGLC 3AC5A 4FV5A 3RK9A 3AG9A 5FXSA 3PSCA 2WMUA 5B0XA 3R8PA 5EQEA 1Y8YA 2EWAA 2V7AA 2OO8X 3PA4A 5FD2A 5FP6A 4ZJIA 3ZTXA 4O2PA 4BBMA 4HW7A 2VGPA 3JYAA 3PVBA 4F1TA 4ZMEA 1ND4A 4IW0A 3AT4A 4O38A 4BL1A 5AUTA 4AWIA 3OEFX 1OIYA 3C51A 3GFWA 4GG7A 3FZSA 1B39A 3GBZA 3NZ0A 3ZOSA 4QMYA 3E3PA 3TACA 5C26A 5F20A 4XBRA 4NIFB 2GNGA 3ZHPC 2YJRA 4AG8A 4F9CA 2F9GA 2R3GA 3F5PA 3UOHA 2XBAA 4Z9LA 2XK6A 4APPA 1R0PA 4F0IA 1JLUE 2RFSA 4FNXA 2XP2A 4IWPA 1Y6AA 3UP2A 3UG1A 3G15A 3OCBA 3SOCA 3VUTA 4B99A 3TUDA 4FTJA 4BB4A 4DBNA 4NEUA 2HZ4A 4DN5A 4BDCA 1J1BA 3WE4A 4DH5A 4ZTMA 2ITQA 3D5WA 2PVLA 2JKKA 3KL8A 2HW6A 2J90A 1AQ1A 5BVFA 1HOWA 3TJCA 5EH0A 5IZFA 4PTEA 1DAWA 1FINA 2VTOA 2XYNA 3OUKA 3EFKA 3TIYA 3VVHA 1ZLTA 4XV2A 4YUQA 5GJGA 3WARA 4I1ZA 2PHKA 4JRVA 3D83A 2ESMA 4MNEB 4F0GA 4HYSA 2C3LA 4LOOA 1Q4LA 4GL9A 1OKVA 5CU0A 2QNJA 3JVSA 1YOMA 1FPUA 4RQKA 4BHNA 2W1FA 2X39A 2QQ7A 3NWWA 4U3YA 2XEYA 5ITAA 1H1QA 5C03A 4E5AX 1R1WA 1GZOA 3MTLA 4FVPA 1KV2A 1ZYCA 4GUBA 4L46A 2P55A 2W9FB 3CP9A 4DEAA 4U7ZA 5BVKA 5E1SA 4MQ2A 4RJ8A 4QPAA 3S95A 3Q52A 4G1WA 5K0KA 3ROYA 5L2TA 2B1PA 2UW6A 3BWJA 4C7TA 4EBWA 3OHTA 3R9NA 2CNUA 4L9IA 3HA8A 3AD6A 4G6NA 5HICA 4YPSA 1OMWA 4LL0A 5JN2A 1V1KA 4CKIA 4U45A 2CKEA 2OZOA 2G2FA 4Q2AA 5LMAA 4BKYA 4FZDB 5KMKA 4NTTA 2UZOA 3MB7A 4FKUA 5HTIA 3KB7A 4BI0A 4GG5A 2XNGA 3Q6UA 2YITA 1WAKA 4E6DA 1OIUA 5EDRA 2XJ0A 2BDJA 2J7TA 1BMKA 2RL5A 3G9LX 3QALE 2VWZA 2Z8CA 4MVFA 2NPQA 2QOCA 4QP1A 3LQ5A 5JFXA 2ITTA 5AV1A 1H25A 3LFCA 4EH5A 5G6VA 3VUDA 3P7CA 5ETFA 4ZK5A 3F7WA 4DGGA 3ATTA 3DOGA 2BZIB 3SRVA 3SV0A 3VS4A 1BUHA 1F0QA 3JY9A 4Z55A 5KMMA 4FI1A 5L4QA 4MBIA 4ZY6A 3BV3A 4NZWB 4HVIA 3OBGA 3OWKA 3POOA 1PY5A 4ITIA 2Q0NA 4J53A 4KKHA 4NKSA 3RPRA 5A4QA 4FTLA 3HZTA 3OY3A 4DFLA 2BTRA 3ENMA 4IBMA 2VX3A 2UVXA 4RA4A 3EZRA 4EH8A 3COHA 5FTQA 3ZLYA 3EH9A 4PMMA 2XBJA 3RCJA 5K4JA 4G6OA 4WT6A 1PXLA 3VF8A 5GZ8A 1IRKA 4TWCA 3ZZEA 4IWDA 3QQJA 2GPHA 3L1SA 2OF4A 1WZYA 2H34A 5CF8A 4C4JA 3D5VA 3PP1A 1ZY5A 3OD6X 4XHKB 2ZB1A 4RJ4A 3A7JA 3VRZA 4EOOA 4OAUC 1FOTA 2XH5A 5M08A 2WQOA 3QX4A 4FSNA 4ZZOA 4HYIA 4XOYA 1OL7A 2HY0A 2J0JA 4RSSA 5EM6A 2PVYA 3QWJA 5AX9A 2OWBA 4BCJA 4Q5HA 4O7YA 4O27B 4DFBA 3I79A 1DI8A 5M44A 1UKIA 4BDBA 1WVYA 4R3PA 3WZKA 4IDTA 3POZA 3SAYA 5IDPA 3C4CA 3A60A 3LJ0A 3P9JA 4FIGA 2X8EA 4D2RA 3FLNC 4OT5A 1FVRA 2J5FA 2GS7A 2WNTA 3G9NA 2F49A 5IQGA 3O7LD 5D9HA 4CKRA 4RJ5A 4XLIA 2J0LA 1B38A 3NR9A 4MXOA 4CLIA 5L6OA 1APME 2RFEA 5FBOA 3LCKA 4AZEA 5A4TA 1SM2A 4ZJVA 4IC8A 4II5A 1Q8WA 4XG6A 2KTYA 3QQLA 2IZRA 4ENYA 3BGPA 5EKNA 3KXMA 3EJ1A 5HORA 3UO6A 4DAWA 2YDJA 3GC8A 3I0OA 2OU7A 1Z57A 5AR2A 4RVTA 2BPMA 2WZJA 4EZ7A 3OT8A 4G9RA 3QF9A 4OTPA 3NVMB 4IIRA 2BFXA 2JIVA 4FV8A 3NEWA 4M69B 4O0RA 3VULA 2XVDA 4O7SA 3W16A 3O7LB 4YJUA 1VJYA 3TG1A 1MQBA 5IQDA 1ZARA 2CGVA 4X6QC 3W10A 1OZ1A 3HVCA 4ZSJA 3HDMA 3FYKX 3GUBA 2F2UA 4WNPA 4X3JA 4BRXA 1JSVA 4BDDA 3CPCA 4M97A 4HCUA 2QVSE 4O6LA 5TE0A 5K5XA 2OKRA 4M0ZA 4EC9A 2X2LA 3PRIA 3HLLA 4G6LA 5HE0A 4D58A 2PUIA 3JVRA 2CGUA 3EL7A 4O0SA 4Z7HA 3PY0A 3H0ZA 3P4KA 4FKQA 4IM0A 3CBLA 1L3RE 3QC9A 5ANDA 4RC3A 3ZO2A 3HKOA 4MCVA 1S9IA 1YI4A 3LFFA 3QAME 5CY3A 3GC0A 4ENXA 2XNPA 5HD7A 1ZOEA 4DG3E 1O6YA 2BCJA 3A2CA 1BYGA 2Y4IB 4OTQA 3V6SA 2OFVA 2OIDA 3MA6A 5CF5A 4I6HA 3MW1A 4QYEA 3FE3A 4FTRA 3DA6A 1KE9A 1UKHA 3FJQE 3MJ2A 2OK1A 4FV4A 3C4ZA 4FKRA 2ZMCA 1BLXA 4IMYA 3RPSA 2ITUA 2WU7A 3U87A 4BCQA 3LKMA 5IQIA 4YJQA 3R9RA 4QMOA 4CG8A 5ANEA 3QQUA 4PL3A 4TWPA 1IA9A 3NLBA 2XKDA 4LGHA 4D1ZA 1E9HA 3PPZA 3DBDA 3T9TA 1UU7A 3Q9YA 2YLFA 1H24A 4C2WA 1KE6A 5HESA 5H8BA 4FSTA 3Q3BA 5AV4A 5FDPA 4BCOA 1PRYA 1OECA 4K6ZA 4D0WA 5HIBA 2W4JA 4XG2A 1RDQE 4RRVA 3HMNA 4A7CA 4YU2A 3NW6A 1X8BA 3TXOA 4DFUA 4GT5A 3RAKA 5FEEA
chains in the Genus database with same CATH superfamily
3E7OA 3FI3A 3N9XA 1M7QA 4F7LA 1RW8A 4PF4A 5DNRA 4HOKA 5LMKC 3H9OA 4C2VA 3W2SA 4RC4A 2YLEA 3R9OA 5CSVA 3VO3A 4CRLA 3PIXA 2XNEA 3EQGA 4WSQA 3WZDA 3UVPA 4IAAA 4QMUA 2X6DA 4U40A 4ANNA 1WBSA 3EQHA 3E5AA 5EK7A 3UPXA 3QXPA 5EM8A 1TQIA 5BMSA 4FV6A 1TZDA 4C38A 3ETAA 4N6YA 1LPUA 4O0VA 4YJOA 5AA9A 1XBCA 3UMWA 3LFNA 1IAHA 3VONA 4LFIA 4IWOA 2RGPA 4RZVA 1QPDA 1ZZ2A 4B4LA 4XOZA 2W06A 5JRSA 4FZ7A 5FG8A 4CFNA 4D4YA 2VAGA 3BCEA 3QCQA 5F1ZA 5JZNA 4YMJA 4YPDA 1OKYA 4FVRA 2X0QA 5H2UA 3PJCA 2BIKB 3DZOA 3VBVA 5KKRC 3E87A 3QLGA 3AMYA 3KA0A 3UYTA 4TL0A 2QONA 3Q53A 2C68A 2IWIA 5AX3A 2CHLA 5BVNA 4FT5A 3IW8A 3OOMA 4FKPA 4M69A 5T3QA 5CYIA 3F2AA 5CEIA 3R7OA 2VZ6A 5IMEA 5EFQA 5C4KA 3I6UA 3AMAA 4FIFA 3EQRA 3KCFA 4ZTLA 1JVPP 3SG9A 2HY81 3ZRKA 3ZH8A 2REIA 4TYGA 4F7NA 2DWBA 4A9TA 3PWDA 3UO4A 4BIBA 3R04A 3MH1A 4RIXB 2X2MA 3QQKA 5EW9A 3L8PA 3ZXTA 2VO6A 4JAIA 2EU9A 5JRQA 2W99B 3TZ9A 1YW2A 4EUTA 2GSFA 4ASDA 4DA5A 4BDFA 4JDJA 5AFVA 3P08A 3NUXA 5IEVA 4NYEA 3HEGA 4JR3A 4TNBA 4H3PA 3W8QA 2HOGA 4EK5A 3LMIA 3HRFA 3ACKA 3QKMA 3R22A 1Q8ZA 3PY3A 3VRYA 2XALA 3R28A 2WTWA 2QC6A 2YACA 2B7AA 2QOQA 4UWYA 1PW2A 4YZ9A 5FWKK 3ZXZA 5AAGA 2XK8A 5JZJA 1GIIA 1YWVA 2J0IA 4WG3A 3F61A 4I6QA 3MJ1A 3VHEA 5IA0A 5JH6A 4G31A 4PNIA 4MD9E 4BJJB 2B4SB 4GEOA 2ONLA 4KIPA 5BUIA 1I44A 2GTMA 5E8SA 3PLAE 4PRJA 4IXPA 4NJDA 4UYNA 5EDPA 4DTAA 3VUIA 3EZVA 4YJVA 1FMOE 4F63A 1J7IA 1UNGA 3LLAA 4APCA 4J52A 5IA1A 4O4BB 2PL0A 4WUNA 1KOBA 3RNIA 1XMMA 4Q9SA 4BTJA 1ZWSA 4JG8A 5HGIA 4GYIA 1AD5A 1XH8A 1XO2B 3IKAA 4FL2A 4LQMA 4QMMA 5HIDA 4EBVA 4LOPA 4ZLZA 3MI9A 5AEPA 3Q2JA 2W17A 3NFFB 5GIPE 4G5PA 5EOLA 2XK7A 4UMQA 3PE2A 3DBEA 4OR5A 4TYHA 3UTOA 1QPEA 2X0OA 4D1SA 5BUJA 4JBQA 2GQRA 3EFLA 4FV2A 2XKEA 4IVBA 2G9XA 4OW8A 4XBUA 2WQMA 5A3XA 2G01A 2WMRA 2B54A 4FG8A 5IDNA 1PXNA 3DTCA 4JIKA 1SZMA 5FEDA 3JXWA 3QQFA 2UZUE 4KIOA 4CZYB 1V0BA 3FV8A 4I4EA 5C9CA 2C5YA 4AN9A 4PWNA 3G6GA 4IAFA 4UEUA 5FTGA 4QQCA 3MYGA 4RX5A 2DYLA 4YURA 4ZTNA 4XP0A 4FTKA 3R7EA 4JX3A 4E5WA 4S31A 2W1HA 4JXFA 2PE1A 3FQSA 3DGKA 4LM5A 4B9DA 3P1AA 4F65A 4F70A 1BL6A 3IO7A 3TZ8A 2GS2A 3P5KA 4IX6A 1G8KA 1U46A 2OIBA 4B8MA 4BWXA 2FSTX 1GIJA 3GFEA 4E7WA 1M14A 3IOKA 4D2TA 4ZSLA 2FSLX 3AC4A 3RPYA 2R7IA 3OBJA 4BDJA 4IM2A 2HZNA 4ZY5A 5CALA 2PMNX 2XF0A 4FKLA 2H8HA 3PDTA 1M2QA 4TKSA 5IISA 3VS3A 1G3NA 5CZHA 3NYNA 5A6OA 4I0SA 1TQPA 1UNHA 3I60A 3KK9A 4LRJA 3BLAA 3I81A 3KK8A 4FKOA 2JITA 4BICA 4H05A 2WELA 5AR4A 4J1RA 4MQ1A 4M13A 3W2RA 2OZAB 2V7OA 4GFOA 2O0UA 3UQFA 3ZSIA 2JEDA 5C8KA 3QTQA 4MXAA 4GIIA 3BHVA 3A7FA 2R3KA 4KBKA 4BCNA 3BZ3A 1URWA 4BDAA 2J4ZA 2WKMA 3S0OA 2NRUA 2BROA 1ZYDA 3VN9A 2F7XE 3U6HA 4FL3A 4TXCA 3HX4A 3R7UA 1WBPA 4KSPA 4V0GB 3DJ6A 1PXKA 4EWQA 1U59A 4WNKA 2XKCA 3H9FA 5IH5A 3P0MA 2YAAA 1WBOA 4CD0A 1UWHA 3QKKA 3OXIA 5HCZA 2XKFA 5JQ5A 3R73A 1V0PA 3GQLA 3QXOA 4U79A 3ZBFA 5KCVA 2PSQA 4JNWA 4RLKA 4QMXA 3FLZA 1WBTA 4ZS0A 2VD5A 3UDZA 3IGOA 1K9AA 3PUPA 4BJJA 3WF6A 4BDIA 2PZRA 3DK7A 3OTVA 1H08A 3HGKA 4O7WA 4A07A 4IB3A 2OXDA 3V5WA 4CMOA 2CLQA 1CKIA 1JPAA 3VS6A 3QGYA 5CQWA 4AUAA 4DH3A 3DFAA 3M11A 3BU5A 2ZM3A 2OJFE 5EI2A 3CD8A 4BYJA 3HAMA 3JS2A 4O83A 4FKSA 4UV0A 4FT9A 4MWIA 4QMSA 4ERWA 1VZOA 4O84A 4X2FA 2GDOA 3QRIA 4YHFA 1KWPA 3D0EA 2C4GA 2KULA 4CQGA 1Q99A 1M52A 5CAVA 1DAYA 4WBOA 3QLFA 5FGKA 4XV1A 4YJTA 3NFGB 3PZEA 2YN8A 2SRCA 3N4VA 1ZYSA 4IACA 5FM3A 4BCFA 3FY0A 4BC6A 4BGQA 2CKPA 5BMMA 2BRNA 4G3GA 5AP6A 4DE4A 1JQHA 1J7LA 4N6ZA 4QTDA 2UZEA 4AFJA 4ANSA 3ZYAA 1GOLA 4ZTSA 1ZY4A 3Q4CA 2ZOQA 3MTFA 3OOGA 4H1MA 3R7IA 4KKGA 3LFAA 3G5DA 2WMXA 3NUNA 4F09A 5LJJA 3PG1A 3QD0A 1OL6A 4GYGA 5IQEA 4PL4A 5IH6A 5IUHA 2RG5A 5IPJA 2GFCA 3QD4A 4JAJA 4DEGA 1Q24A 3DK3A 3BELA 1NXKA 1K2PA 1YXUA 2Y9QA 1R78A 4PUZA 3VS0A 3MVMA 1CKPA 5IQAA 4KB8A 4NT4A 4I24A 4YJSA 5C4LA 3MVHA 3V01A 4IZYA 4FE2A 3C5IA 3W0RA 3G33A 3LXPA 2YFXA 4NM3A 5EI6A 2GHGA 4XNEA 3PRFA 4OTFA 2P3GX 2QODA 4ZIMA 3LW0A 5CEMA 3PA5A 3NSZA 2QU5A 4FTNA 3IECA 4ZS4A 3VW6A 1BI7A 2VTRA 1JWHA 2OZAA 4GV1A 4OLIA 2C3KA 3C13A 4DHJA 4FT3A 4AS0A 4E6QA 2YIQA 3QTIA 1OL5A 2O5KA 2OJGA 3TUCA 3D15A 5LVPA 4KBAA 4LGGA 3UMXA 5M07A 4M68A 4TWOA 5CX9A 4YJNA 3DLZA 1XH9A 4LV8A 4V0GA 5FXQA 4HVHA 4ID7A 2WTKB 3VS7A 5KHXA 3FLYA 4FMQA 4G17A 3NS9A 2XIZA 4AXFA 2C6OA 1WFCA 3GU5A 5AUVA 4EH7A 2GS6A 2WFYA 3UIBA 1OKZA 2C30A 3MWUA 2XA4A 4MWHA 1PMEA 3HMIA 1LUFA 2P33A 3C0GA 4YZMA 3V51A 4EK8A 4G5JA 4D4SA 4EQMA 4AT5A 4IFCA 3MSSA 4PL5A 4QMVA 2QO9A 4BFMA 3O71A 3L9MA 1XBBA 3E88A 4R5SA 3NGAA 1HCLA 2R7BA 4UWCA 5CANA 4YLJA 3PFYA 4EORA 4FSMA 3QZHA 4FICA 5J95A 4CG9A 5IQHA 4YZCA 3Q9XA 4KD1A 4MXXA 3UNJA 4JDHA 3HV4A 2W1IA 5HLNA 5ETCA 3TKUA 3UG2A 3FY2A 2BZKB 2YM8A 4YTIA 1H1PA 4I92A 4O4CA 1BKXA 2VRXA 3D94A 3PXFA 3VF9A 2C6LA 5IG1A 1KOAA 4XJ0A 1XJDA 3HMOA 5M4IA 1Q61A 3UQGA 3TCPA 1SVGA 2OIQA 3SX9A 1XWSA 5FLFA 4USEA 4LYNA 4YLKA 4EYMA 4R3CA 2GNHA 4O21A 4QDVA 4XG9A 4CYJA 3KQ7A 3EIDA 4FSZA 3A7HA 5E9EA 3R7VA 3MPTA 3BGQA 4ZP5A 2WB8A 3FLSA 4IAZA 3S3IA 4DITA 2W0JA 3NYVA 1OKWA 4HJOA 3QTWA 1OPKA 3F2RA 4MD8E 4M3QA 3UDSA 5HE1A 3A62A 3ZO4A 4FTTA 3GT8A 2XCHA 3DNDA 3AC8A 3U6JA 5IKWA 2WMQA 5BV3A 1ZYLA 4XG3A 3QZGA 4AOJA 5L6WL 3BKBA 3PXKA 4CFWA 4ASEA 1VYZA 3W0QA 3FZ1A 3P7BA 3QZFA 2AC3A 1PYXA 2UW9A 1O9UA 2BZHB 3KY2A 4FTQA 4IANA 3QA0A 5K5NA 2PU8A 3L8VA 2XIYA 1IEPA 5HHWA 2G2IA 2JDTA 1E1XA 4QT1A 4EH3A 4I6LA 3ELJA 4L01A 4UN0C 3ZEWA 5IEYA 2WOUA 4NKAA 4NCTA 5AADA 5KMNA 2AC5A 2PVNA 4K33A 5GJFA 5C1QB 4F6WA 2I40A 4FTOA 2C6DA 3QUEA 4O0YA 4PNKA 5TT7A 4C02A 4DEHA 4E8AA 4U0IA 1R0EA 5DG5A 3SGCA 2Z7RA 2UVYA 3LCTA 4CEGA 3FMKA 1E1VA 2GNIA 3ZCLA 4S33A 5D7AA 5KZ0A 4TWNA 1UU3A 4FX3A 5TO8A 2VWWA 3R1YA 1ATPE 5HKMA 3UIUA 2JFMA 4W4VA 4MK0A 5AA8A 3NMUF 4FTMA 3LXKA 4CSVA 4AE9A 2YM5A 3GEQA 4FKGA 5AIRA 4BDHA 4FIIA 3Q4ZA 3C4WA 2H9VA 1ZMWA 3IK3A 3HUCA 4F64A 3R7GA 4D4VA 4XS2A 4V01A 4EONA 5KZIA 3W18A 2AYPA 2C5NA 1JBPE 5JKGA 3EFWA 2R4BA 3LCSA 2Y4IC 4C4EA 5JFSA 2YHVA 2YCQA 2ITWA 4UB7A 3ZUUA 5CEPA 4DFXE 4A4XA 1GZNA 3E64A 2BILB 3QTZA 3VWAA 4DTBA 2UZBA 3FLWA 4FTCA 1DI9A 2X6EA 2NRYA 3O50A 3QHWA 4MTAA 1YXSA 1VYWA 2X7OA 2ONLC 4YZDA 1AGWA 2C5VA 5TR6A 1OBDA 4PQNA 1SNXA 4FKWA 3FDNA 3PXRA 4YC3A 2Z7QA 3EOCA 3SQQA 1H27A 2EXCX 4JLCA 5CVHA 1CDKA 5AV2A 3R02A 4CCUA 1ZZLA 4RJ6A 1VLRA 3LE6A 2IVSA 3DTWA 3NRMA 4ZZNA 2X8IA 4XYFA 3QTUA 3DBQA 4RWIA 3OUNB 3VS1A 2OJJA 4C61A 4IE9A 4L3LA 1S9JA 4GUEA 1UU9A 2VTAA 3O0GA 5AP3A 3KIOC 4RMZA 4RIYB 3R8LA 3DB8A 3IQ7A 3NIZA 1UV5A 5HX6A 4YTCA 3ZC6A 4DT9A 1KUTA 3COKA 4D1XA 3ODYX 4AX8A 3TWJA 1OIRA 3A61A 2VTLA 1H07A 3SW4A 3KXGA 4CKJA 2GNJA 3LLTA 4BBFA 3B8QA 3WIGA 1W84A 4F4PA 5BYZA 3VBXA 4PP9A 2XJ2A 4O91A 4BCHA 3NW7A 4J97A 5H9BA 4R78A 4DH8A 2O3PA 3FXZA 4DH1A 4EWHA 4LRMA 4U6RA 4ALVA 4ONAA 5E8VA 2HZIA 3AC1A 2Y0AA 2B53A 2HYYA 4O81A 3R30A 3QCSA 3O8TA 4KS7A 4F0FA 1O6KA 5FUTA 4GJ3A 4JR7A 2C5XA 3PIZA 4IVDA 1M2PA 1DS5A 5EYKA 1M2RA 4UY9A 3TT0A 4MBLA 3R71A 1IG1A 3TTJA 4FODA 4ZSGA 5LVLA 3W1FA 4BGHA 4ACMA 3IOPA 3DBCA 2X9EA 5T68A 5FBNC 3NUYA 2PZPA 2I0VA 4G34A 4XLVA 3SKCA 5CWZA 3WYXA 1Q5KA 2BHHA 5L2WA 4FEVA 1Q8YA 4DHZA 3LJ2A 4AAYA 4QYGA 3OCGA 2Y6OA 3ZSHA 1BI8A 2YZAA 1SNUA 2BKKA 3I4BA 4RT7A 2R3FA 2JIIA 2ZV2A 5ACKA 5ANOA 2YDIA 1NVQA 3PVGA 5CF4A 3AMBA 4YLLA 4FV9A 4TTHB 4X2NA 4XP2A 4IHPA 1W2FA 2CN8A 4C57A 4GKIA 1Q62A 3Q4UA 1ZXEA 2JKQA 2O2UA 4RC2A 4C33A 3EN9A 4O7LA 4XCUA 5C8NA 3QQGA 5CZIA 4C35A 3AKKA 3O96A 3S4QA 4GVJA 4AOIA 4AP7A 3HAVA 3N4TA 4A9RA 2R0IA 2A0CX 3OMVA 4FGRA 3FMMA 4ZY4A 2BTSA 2BALA 2GHLA 3EKNA 3W0MA 3TEIA 3OF0A 2C5OA 4DCAA 4BDKA 2QD9A 3FZRA 4NFNA 2C69A 4G2FA 5M4CA 5DRBA 5AUZA 2F7EE 4EOQA 1KE5A 4QMWA 4KSQA 1FBNA 3EQFA 3P7AA 5ETAA 3LIJA 5M06A 5FM2A 4F7SA 2WU6A 4ACDA 5F9EA 4PV0A 3RK5A 4WO5A 2UZNA 1GNGA 5CS6A 3BU6A 4XV9A 3GGFA 3RJCA 2ETRA 3F82A 1HCKA 3LJ1A 4HCVA 4QNAA 3R63A 5ANKA 3FQHA 3U9NA 4TYIA 2BAJA 4OTRA 5CI6A 4HZSA 3FZOA 3MGYA 2FYSA 3HMPA 3R6XA 4WNMA 4NU1A 5CSHA 4IM3A 4I0TA 2JAMA 2X4ZA 3RK7A 3BHTA 3MBLA 4G16A 4RLLA 4U43A 5G1XA 2WGJA 2R3LA 2FO0A 3QYZA 3DAKA 1ZAOA 4ITJA 2OI4X 4K18A 4MF0A 4CMTA 1G8AA 4RIYA 4CT1A 4DFYA 3DU8A 3CD3A 5B2MA 4YTHA 2WPAA 3DJ5A 2WTJA 4AA4A 2HWOA 3SXSA 3SVVA 2VNYA 4EOLA 4H39A 5I5ZA 2Y7JA 4OGRA 3GU6A 5DT3A 3W32A 4CZUA 4IWQA 1XH6A 4GJ2A 4P2KA 2VNWA 4YBJA 4EH9A 3EN7A 3Q04A 3OZ6A 1JOWB 2QR8A 4HGTA 2R3MA 4M84A 2YIYA 3CGFA 1U5RA 3UGCA 4DEEA 5HO8A 3SC1A 4W4XA 3QRKA 1IAJA 4LRKA 5KMIA 2XNMA 1GY3A 4Y85A 4PMPA 4KUJA 3HRCA 4QPMA 3U8WA 4QP6A 5LARA 2A1AB 5HO6A 4D4RA 2PUNA 1P14A 2IF8A 3O51A 1YI3A 5HNIX 1XQZA 1JSUA 3JUHA 4CFFA 4FSWA 1PJKA 3R0TA 3KVWA 3NVKI 4DYMA 1H01A 4EK4A 4XV3A 5CTPA 1YI6A 1H1RA 4R7HA 3UPZA 3ZO1A 2C6MA 2IJMA 3DXQA 2W1GA 2JDSA 3H9RA 4YBKA 4F08A 5I9VA 4WD5A 4WSYA 2J9MA 4BYIA 3DT1A 2CMWA 4TYHB 3FMEA 4YNOA 4CLJA 5GZAA 4EOIA 4DFNA 3QUDA 4V04A 2RFNA 4O7VA 3KFAA 4FSUA 2QHNA 2YIRA 4IVAA 5GZ9A 3BEGA 5CENA 5EHYA 2OSCA 3AKLA 5DOSA 3UVQA 3O2MA 2Z7LA 5HG7A 5DEWA 4YO4A 4EZ5A 4L42A 1MP8A 3QZIA 4LMUA 2BUJA 1H26A 5E1EA 4ZZMA 5K3YA 5M09A 1WBVA 4RFZA 4OBPA 5CXHA 1PKDA 3M42A 4BTKA 3UO5A 2UW0A 2ETKA 4RIWB 1J1CA 1QL6A 2W1CA 5BVWA 4JQ8A 3TNHA 4DT8A 4R1YA 4ALWA 4YSJA 4FV0A 4UMRA 2X2KA 1XH7A 2W05A 1EH4A 3MIAA 3DY7A 2VTIA 2BAQA 3R83A 4TZRA 5DWRA 5HU3A 4YSMA 3QRTA 3LM5A 3FL5A 4AAAA 1PYEA 1RE8A 3BV2A 4ACGA 5JMSA 1UA2A 2B55A 2XEZA 1OB3A 1XHAA 2HAKA 4FTUA 5T6KA 4EUUA 5BPYA 1WBNA 4P5ZA 1U4DA 2IZTA 5HE3A 3U9CA 3PXYA 4XG4A 5F95A 2QOLA 3MV5A 1UVRA 2P4IA 5M55A 1NT2A 1UWJA 3DKFA 3EQBA 4U8ZA 2RIOA 2QOIA 3AT3A 5DH3A 4R5YA 4GSBA 3F7ZA 3R8UA 5EG3A 4L67A 3OVVA 2X81A 5AMNA 5A4EA 3ORTA 1JNKA 3S2PA 3UOKA 5I3RA 3T8OA 3HYHA 3K3JA 2A98A 3P78A 3I0QA 3TJDA 4AFEA 3IDBA 4J8NA 2ZJWA 2ZDUA 4J99A 2GCDA 2Q0BA 4UALA 4YTFA 1OUKA 2WQNA 5A4CA 1OIQA 2X4FA 3MA3A 3SHEA 3FHRA 4KNBA 3UC4A 4UMPA 3CSVA 3AT2A 1LP4A 4ASXA 4EH2A 3FZPA 4K0YA 5AUXA 5L8JA 3DPKA 3CE3A 5AUYA 3VJNA 2V62A 4QPSA 1Y8GA 5AR3A 1P5EA 5HD4A 3FMLA 2UUEA 3KMMA 4ALUA 5DPVA 4UXQA 1F3MC 2DQ7X 3CC6A 4DG2E 5D7VA 5HU9A 4AQKA 1F5QA 2IVVA 1YXVA 5AIKA 1W98A 4BI1A 1MUOA 3B8RA 5BYLA 3PTGA 2JDRA 3QU0A 3FI2A 2W4KA 3ZLSA 5CVGA 2PWLA 3ZDUA 4FKVA 5AP4A 3IPHA 5EKOA 3ORLA 3THBA 3DK6A 5GIOE 5KUPA 2YAKA 2ZYBA 5GHVA 5C01A 4AGCA 4JRNA 3JPVA 3DS6A 4I94A 3GU7A 1NY3A 2FB8A 2V5QA 2WMBA 3ALOA 3BHUA 4PPAA 5CSXA 5ICPA 5ANIA 3OC1A 4H1JA 4CMUA 2JBOA 4B0GA 2PVMA 3LFQA 2XNOA 4X2KA 4HPTE 5DA3A 2PVFA 4DLIA 4DF3A 5DI1A 4L3PA 2B9IA 1NVRA 2J0KA 5CU6A 2QKWB 4BCMA 5CVFA 3RPOA 1ZYJA 3FQEA 5IUGA 2BR1A 5A54A 4R77A 2CJMA 3V8WA 4RX9A 5BVDA 5M56A 4TRLA 5HCYA 1H1WA 1Q3DA 2E9NA 3EYGA 3VHKA 3EQCA 3FMNA 4FTAA 4NCTC 3GOKA 4AGUA 5F94A 3DDPA 3NUUA 4JT3A 4KS8A 3OT3A 4P4CA 3HP5A 4C62A 4QMNA 4I23A 4BKJA 4HYUA 2EB2A 3EWHA 3ORZA 4KIKB 2BMCA 3KMWA 3OWJA 3OFMA 2PUPA 3LHJA 1OVEA 3Q9ZA 3BLHA 4X2GA 5C8MA 4R6VA 5KX8A 4RIWA 4TNDA 3IDCA 5E4HA 3RAHA 2WTKC 4NTSA 4IADA 4QYHA 2QOHA 4USDA 1H1SA 1XR1A 4HCTA 4UX9A 4A9SA 2PVJA 2GQGA 3AKJA 5E8XA 5KE0A 1H4LA 3CQEA 3IS5A 5DT4A 4MHAA 3NYOA 5JT2A 3TDWA 5A6NA 3BLRA 4MXZA 4N57A 1Y91A 4DH7A 5HLWA 2PZIA 2VWIA 5HBHA 3KXXA 4EOKA 2YCSA 4Z7GA 3IW6A 5DVRA 5J1VA 3TKHA 4FUYA 3IONA 3NW5A 4EJNA 4FTIA 2XCKA 5EHOA 2GMXA 2ITZA 2OFUA 5HG5A 2IPXA 4GU6A 4RGJA 3QRUA 3MB6A 5EM7A 3VQUA 1YDRE 3VS2A 3F3VA 4EKKA 4FUXA 3U6IA 4I41A 3AC3A 4G3EA 4QP9A 4XMOA 1G8JA 4O22A 1Y6BA 5AAFA 3RP9A 1L8TA 4X7QA 5IMXA 4M67A 3PVUA 4DHIB 2QHMA 4LOQA 1REKA 3Q96A 4CTBA 3M1SA 1H0VA 3A4OX 2I0YA 2JIUA 3DAJA 3R1QA 5AR7A 3TNPC 5A4LA 5LOHA 4FVQA 4Y95A 4HYHA 1ST4A 2NP8A 2A27A 3HP2A 4RA5A 3ORIA 3EL8A 4BN1A 4H3BA 3ALNA 4W4YA 3BBWA 4M0YA 2XRWA 4GH2A 4O82A 4FV3A 5J5TA 2JC6A 3CY2A 3NNXA 1H28A 2FA2A 2IW8A 3FI8A 4QMPA 3GCPA 2XNNA 4XRLA 2RF9A 2BRGA 3LCOA 4AN3A 2PULA 3CTHA 3C50A 4XG8A 2OXYA 3W2OA 3PPJA 3VUGA 4PDOA 4FZ6A 3E8NA 3VW8A 2OLCA 5AUUA 4O1OA 4S34A 4E4XA 3EFJA 5EYCA 3UE4A 3OW4A 2JLDA 3R8MA 1J91A 3H0YA 4DC2A 3S1HA 4E26A 3UQCA 3DBFA 5BVEA 4AXCA 4ZJJA 2CGWA 3UNKA 4DHFA 2C6KA 4J96A 4GU9A 4E5BA 3BQRA 4RWJA 3DFCB 1XMLA 3UYSA 2VWYA 3VUKA 3K2LA 4IAKA 3TL8A 3C5UA 3D5UA 4C3RA 5DFPA 3O5AA 1W0XC 4FSRA 4CNHA 4UYAA 5L2QA 4BCPA 1XBAA 1YHSA 2C0OA 4PMTA 2G15A 4Y5HA 2OG8A 3PA3A 4CFVA 4I20A 4KAOA 4GIHA 1KSWA 2OJIA 1I09A 3EN6A 4U42A 1A9UA 1LEZA 4KIKA 5E8UA 4J8MA 4PMSA 5IH4A 1SVHA 3EQPA 4FBXA 4FT0A 3UIXA 3ZBXA 1QMZA 5AV0A 5D1JA 5HNBA 3RKBA 2QOOA 2YDKA 3IGGA 3ANRA 2Z2WA 2F7ZE 4GW8A 3LXNA 5AJQA 5I9YA 4KKEA 5FTOA 1FGIA 3G51A 5IUIA 4AGDA 3E3BX 3T3VA 2IZSA 3CLYA 3PWYA 4MKCA 4EL9A 2E9VA 5EW3A 4RVMA 4AQCA 4TYEA 1CM8A 2VTMA 2FH9A 4BCGA 4QTEA 2V22A 2YEXA 3RWPA 2R3JA 4RJ3A 2OGVA 3FLQA 2X7GA 3G0EA 3PY1A 3Q5ZA 3FKOA 5J9LA 3O17A 1TKIA 5DLSA 5AM7A 3ZEPA 4JS8A 3E7VA 4M8TA 2CPKE 2O8YA 1YOLA 2YM3A 4F9BA 2JBPA 2CNQA 5EDQA 3PPKA 3EQIA 4TN6A 1WBWA 4GFGA 4RG0A 3WIKA 2YERA 1ZMUA 4QNYA 2XK9A 1YWRA 4EHVA 3GC9A 3OROA 3BHHA 3UNZA 1MQ4A 4O7NA 3QHRA 1JKSA 5JEBA 4IX5A 4BZNA 3N4UA 3KCKA 2VX0A 3BLQA 3R7YA 3MDYA 4WBBB 1A48A 4D5HA 3CCNA 3NUPA 2VWXA 1GIHA 2XZSA 2UZWE 2VWBA 1U5QA 2AUHA 3GB2A 4I6BA 2HWPA 2F57A 3G2FA 3C0IA 3UBDA 1IASA 4JJRA 2HCKA 3CR0A 5I9UA 5FP5A 3QQHA 5ACBC 2WAJA 3KRJA 1Q3WA 4QP3A 4X0MA 4JG7A 3L8SA 5HIEA 3KRWA 4HPUE 5I9WA 2XIRA 3EN4A 4RPVA 3PVWA 1OM1A 4WHZA 1TVOA 5CI7A 5E92A 3S00A 2CNVA 4JQ7A 2C0IA 3VC4A 3KXHA 2PMIA 3BQCA 3RINA 4Y46A 3W2CA 4Q5EA 5DR2A 5M4FA 3KVXA 3TV7A 5L2IA 3JR1A 3E63A 4QQ5A 2C6EA 4UZHA 3UOLA 2E2BA 1PXPA 4RIOA 2Q83A 3KKVA 3C4XA 5HZNA 5LVMA 2HIWA 3OG7A 4E1ZA 5LCJA 3NX8A 4EI4A 4C4HA 4D2VA 3FMHA 3BYUA 4FIJA 4R3RA 4LI5A 4KRCA 3KMUA 5GNKA 2R2PA 2R3RA 3F6XA 3HA6A 3II5A 4L53A 4OTGA 5DYJA 3CQUA 4BIEA 5HE2A 3A99A 4BDGA 2J0MB 3P86A 3WF9A 4X3FB 1T45A 4MF1A 4QP2A 4EZ3A 3ZONA 2XANA 4AW2A 4MYGA 1CTPE 4AOTA 3GI3A 2VUWA 2VWVA 4IB1A 3A7IA 2C6IA 3CPBA 3EB0A 3PFQA 5AUWA 2ZMDA 3C9WA 4K11A 3WOWA 5IA2A 4EQCA 5J5SA 1PXMA 2FVDA 2H96A 5D41A 4EOPA 3C4EA 2WD1A 3ID6C 2C47A 3H4JA 2ZV9A 1JKTA 1GZ8A 4AF3A 3SDJA 3DXPA 2QO7A 3F3UA 2UW4A 1UU8A 4LMNA 5AR8A 3V6RA 2W1ZA 4IB5A 1KE7A 2JAVA 4DGMA 4OBQA 3V5PA 4IX4A 2UZDA 3LQ8A 4O86A