1Q8ZA

The apoenzyme structure of the yeast sr protein kinase, sky1p
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
363
structure length
354
Chain Sequence
GYHPAFKGEPYKDARYILVRKLGWGHFSTVWLAKDMVNNTHVAMKIVRGDKVYTEAAEDEIKLLQRVNDADNTKEDSMGANHILKLLDHFNHKGPNGVHVVMVFEVLGENLLALIKKYEHRGIPLIYVKQISKQLLLGLDYMHRRCGIIHTDIKPENVLMEIVDSPENLIQIKIADLGNACWYDEHYTNSIQTREYRSPEVLLGAPWGCGADIWSTACLIFELITGDFLFETKDDDHIAQIIELLGELPSYLLRNGKYTRTFFNSLLRNISKLKFWPLEDVLTEKYKFSKDEAKEISDFLSPMLQLDPRKRADAGGLVNHPWLKDTLGMEEIRVPDRELYGSGSDIPGWFEEVR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SR Protein Kinase
publication title Nucleotide-Induced Conformational Changes in the Saccharomyces cerevisiae SR Protein Kinase, Sky1p, Revealed by X-Ray Crystallography
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transferase
total genus 106
structure length 354
sequence length 363
chains with identical sequence B
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2003-08-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 1q8zA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 1q8zA01
5JKGA 4XG4A 3QTXA 5HO7A 5ANGA 5JGDA 4FEWA 3W2RA 2BVAA 3FPMA 3SAYA 5KNJA 3ZO3A 1PXIA 3IK3A 4IE9A 2PWLA 3U55A 4AGUA 5AAEA 2IG7A 4P5QA 3U4WA 5CEQA 3SXFA 3QD4A 3HP5A 2QLQA 3UPZA 2YLFA 3CKXA 1R78A 4WKQA 3D5WA 3UVRA 1H28A 5EQYA 5GZAA 3FLNC 3BELA 4FV2A 4IDTA 1J7LA 4HYIA 4ZS0A 1HCLA 3VUGA 2QO2A 1CTPE 3DJ5A 2UZLA 2IVTA 4WUAA 3R73A 3TACA 3C4XA 3FMHA 5LCKA 3F3UA 3T3UA 4EBWA 4XV1A 5DGZA 4WG4A 2WMRA 3MA3A 4E6DA 4BIDA 1XH8A 4FYOA 3LXPA 4NM3A 1OIYA 2G1TA 3QQGA 5DOSA 4FT7A 2ITPA 2BIYA 1GY3A 4A9YA 1QPDA 3PLSA 3GU8A 3WI6A 2GNHA 2W96B 2WPAA 4B9DA 3R21A 3LFNA 5EW9A 1M14A 4O0WA 4TWOA 1XR1A 3GVUA 5J7BA 4EH6A 3JS2A 5CT0A 3DT1A 3OXIA 2XEZA 3CY3A 3PXZA 4O1PA 4ZSJA 2R7BA 3KL8A 5ANJA 1G8SA 4IVCA 1YOMA 2R4BA 5E91A 5HNIX 2WQBA 3R8PA 4CZYB 1R0EA 4XV9A 3EQDA 2X4ZA 4YNEA 4RLLA 3HV7A 4J53A 1W8CA 3FY0A 4L8MA 3LCKA 4RC4A 5CXHA 2ZM1A 3CLYA 3FKLA 3IKAA 5F94A 4Z9LA 3R8ZA 1RDQE 4M14A 5A54A 4AP7A 5FTQA 4RZVA 3VS5A 2VGOA 4FYNA 4RRVA 4M8TA 3FUPA 1L8TA 4EUUA 3QQHA 4HW7A 4A4LA 2VWWA 3PXQA 3SRVB 2H8HA 4R8QA 4DH5A 1OITA 3WIKA 3ID6C 4N4SA 3R9NA 3AGLA 5BYZA 4F6SA 4CV8A 3R1NA 3D7TB 3HDMA 4AA4A 4DT8A 4NM0A 1SZMA 1KWPA 1PHKA 4DH7A 4X21A 3OWLA 4G3EA 3VVHA 5K5NA 3L8VA 4Y8DA 4ANLA 2W9ZB 4DFNA 4RX9A 1SVHA 4WNKA 4KIOA 3SDJA 3VUIA 3TZ7A 5JMSA 3KREA 2PY3A 5IUIA 2IWIA 4G3FA 3VS3A 2WO6A 4IX4A 5FD2A 2WAJA 1XH9A 4BZOA 4UB7A 4MBJA 4A9UA 2UZNA 3K54A 3I6WA 4YSMA 5KMIA 4PMMA 5CQUA 3VS6A 2ZYBA 5F95A 4IAIA 3NR9A 3ZBXA 2QHMA 5AJQA 4G6OA 4BDIA 1KOAA 3R02A 2VNWA 4K33A 2HWPA 4XCUA 3VS4A 1V0BA 5DT4A 3VBVA 3EL7A 2UW6A 4FIEA 3LVPA 4EOSA 1OIQA 4YZNA 2HAKA 2C5NA 2OICA 4PL5A 4O0UA 4QMSA 4R3RA 1ZZLA 4GG5A 1PMVA 2UZBA 4DEHA 4O2PA 1Q8YA 1PXPA 3PXRA 5E8WA 2WQNA 5CAOA 3OW4A 2XNOA 3R1YA 4R7HA 4UX9A 3SG8A 2X2MA 3Q9YA 5ANKA 4IFCA 5TR6A 2P0CA 4D2RA 4QP9A 3V5TA 2YIXA 2JBPA 2YEXA 4FKPA 2IW8A 2XZSA 3BWFA 5H8EA 3UBDA 2GHMA 5I9VA 1BI8A 4UZHA 3WILA 1PXLA 3V5JA 4QP3A 5HE2A 4IANA 4C3RA 4L44A 2WMTA 4LM5A 2Y7JA 5AR4A 3H9FA 4FSMA 4B6LA 4FV0A 5I9XA 2YM7A 2X6EA 3E93A 3QKLA 1IASA 4F0FA 3H10A 4J97A 4B8MA 4DFXE 4MWIA 4IW0A 5IZFA 1IRKA 5C8MA 4OT6A 2X8DA 1H26A 1WBSA 2GPHA 3ORTA 4IFGA 4D1XA 1PMEA 3EFJA 4U97A 3Q4TA 5ITAA 4BDDA 3SKCA 3G0FA 3BE9A 1QMZA 5HOAA 2YERA 5CY3A 3I4BA 4QMNA 4W8EA 2C0TA 4BTJA 4O7TA 5CSXA 1KV1A 3DDQA 3E92A 3MWUA 4R6VA 3PDTA 1U59A 2JIUA 4CNHA 3OD6X 3OCBA 4WBBB 1SNUA 4CFMA 5IF1A 1OMWA 3RVGA 3DBQA 4DH1A 4FOCA 2VX0A 4RJ4A 3VHKA 3RALA 3I1AA 3TNIA 2CPKE 1STCE 4DTKA 2R3MA 3QTWA 3WF8A 4CQEA 4OTIA 5ICPA 2WU7A 1FBNA 1Q8WA 2CHLA 4C02A 4U44A 4AQCA 2ZOQA 3KF7A 2JAVA 3DKOA 3UNKA 3G33A 3GU4A 4HGLA 3JUHA 4G3GA 2HY81 1LUFA 2OJ9A 4IZ5A 3UVQA 4UN0C 5IG1A 2FO0A 2BFYA 4G17A 5J95A 4Z3VA 4FNYA 1OPKA 2WEIA 2JDRA 4YLJA 3SW7A 3EZVA 1ZAOA 3R01A 1FGKA 5LVNA 3GC0A 4RX8A 3LIJA 2QOHA 2PVFA 4BCQA 3RMFA 4BIEA 1YHSA 3A8XA 3QQJA 2UVYA 3OXTA 5EQEA 2ACXA 3SC1A 2OZAB 3EQIA 4KAOA 5EFQA 4AA5A 5HVKA 3NVKI 2VTAA 3FXXA 5FBOA 4XG3A 4H58A 2R5TA 2XIRA 5EM5A 5HX6A 3FMKA 4OTRA 3RBWA 3LFBA 3W2PA 3VW6A 1SVEA 3EN6A 3PA3A 4AE6A 3QALE 3C13A 3JY0A 4HYHA 5CS6A 3UNJA 3T9IA 4F4PA 4G9RA 4MXYA 2LAVA 1ND4A 3D5UA 3VS7A 4CFWA 4F7NA 4QTEA 2B55A 4X6RA 5AP4A 2EXCX 2QR8A 4O22A 4QTBA 5C1QB 4XHKB 5DIAA 4MQ1A 3RJCA 4OAUC 3NPCA 4BVUA 4NJ3A 4RIXA 1XBBA 4R3PA 3P7BA 3F3VA 4KIKA 4A9TA 5B2MA 2PSQA 4ANNA 3BU5A 4F1TA 1PYXA 3NX8A 1GZNA 1VR2A 3RM7A 2EXMA 4CXAA 2CCHA 1W83A 2J5FA 4F0IA 5ACBC 3I79A 3QRJA 4YTCA 2JD5A 1WBTA 3S0OA 3LOKA 2P2HA 3FZ1A 4U41A 3NYOA 4W4VA 3P79A 1H1WA 4FSNA 4GW8A 1FMKA 3EZRA 5ETCA 4DF3A 2GS6A 3MH0A 3EL8A 3W16A 2PUNA 3MB6A 4DGGA 1J91A 1EH4A 2ETKA 3GNIB 4RSSA 4BKZA 4XMOA 4E4NA 5HI2A 4EOLA 4GFGA 2WTIA 3HV4A 5CZIA 3WF5A 3MTFA 5IH6A 4UV0A 3TJDA 5CU0A 2V22A 1LP4A 3FXWA 3W18A 4ORKA 1YDRE 2IN6A 4YBKA 1ZOHA 2PVNA 4QMVA 2YDIA 2OH4A 4IB1A 5A6OA 2RGPA 2YCRA 3D2IA 3FXZA 3ULIA 2PVRA 3VS1A 5E4HA 3SGCA 4G31A 3ZLYA 4IC8A 4ZZMA 1Q8UA 3AGMA 1WCCA 5C01A 5AV0A 4NTTA 3ORPA 5HG9A 4O38A 4JS8A 4UBAA 2FSLX 3HECA 2BZIB 4AOIA 4BWXA 3A62A 2XNBA 4L42A 2GNIA 3PJ8A 2GNLA 4CCUA 5GZ8A 5IEVA 2Z02A 4USFA 2IO6A 3TNQB 1DS5A 1WBPA 3KY2A 2UW9A 3I7CA 3QTSA 3K2LA 3NUXA 4NM7A 5IA5A 3QCYA 2PK9A 2QU5A 5IA2A 4HYUA 4BYIA 2YIRA 2YISA 4J71A 3W32A 1YI6A 1H0WA 2W1ZA 3LXLA 4QQJA 3DAEA 3FZSA 4DTAA 4TY1A 3IS5A 5M4FA 4JDJA 4HGTA 1Q4LA 2GS7A 1BYGA 4LOQA 4QMMA 4YP8A 2QO7A 3H0ZA 4M66A 4MQ2A 3AC4A 3TV4A 1W82A 2XCHA 4AG8A 3M11A 3ZRKA 4PMSA 1J1BA 1OL6A 3LQ8A 3OTUA 4Z7GA 4BF2A 1OVEA 4E3CA 4E6CA 3EHAA 3LFAA 4OTDA 5JGAA 4HVGA 5HLPA 2B0QA 2G2FA 4XG8A 2ETRA 2Z2WA 4G6NA 4H1JA 2X1NA 4NCTC 5AP1A 4FTIA 2J90A 2P33A 3NZ0A 4U79A 4C58A 2R9SA 3F2NA 4Q5HA 4CQGA 4FZ7A 4ZXTA 4FKWA 1GIJA 5EW8A 2FSMX 4A9RA 4DEGA 5L8LA 2C3IB 3ALOA 2QOKA 4QPSA 5HG8A 4LYNA 2UV2A 1JNKA 5T6KA 4HJOA 1W0XC 3QTUA 1F3MC 5AA8A 4RVTA 1BKXA 2JDVA 3SD0A 2E9PA 3R00A 3ZRMA 4GG7A 4BTFA 2NNWB 4NW5A 5FUTA 3SVVA 4DCEA 2CGXA 2C6DA 4WBOA 1XHAA 2YLEA 4L43A 4A9SA 5A4LA 5A14A 5HKMA 1CKIA 2R3OA 4APCA 4RWJA 4TNDA 3EQFA 2HIWA 5CWZA 5FLFA 4AW1A 4BY9E 2R3QA 5IA0A 3C5UA 5L2SA 2C5XA 4MAOA 4TYGA 4C62A 3DAKA 3V5PA 3AMYA 3MBLA 4XH6A 2ERKA 3BYOA 5B0XA 4GK3A 2YIYA 3MFTA 5FDXA 2UZVA 5LVOA 1Q5KA 3AC8A 2QG7A 3G15A 4O7NA 5CANA 3TM0A 2ONLA 2ZV8A 4FTNA 3BHVA 5IH4A 2XEYA 1IA8A 1Q8TA 4RIYA 2YM4A 5CZHA 4QRCA 2ITQA 3DV3A 1E9HA 2F4JA 3PRFA 4MK0A 4PMPA 3ZONA 4DC2A 5C8KA 3UG1A 5B2LA 5C26A 5D11A 4BFMA 5HEZA 3F7ZA 3UOJA 4FSUA 4JBVA 1XH4A 1G5SA 5DVRA 2WOUA 1K3AA 1ZRZA 3P7AA 5AP3A 1XH6A 4YC8A 2HZIA 4QP8A 3ZZEA 5C27A 4FZDB 1E1XA 5CVHA 1PXMA 2PVKA 4J95A 4RGJA 4RJ8A 5JQ5A 5M4IA 1DI9A 4EH9A 3LFEA 5K4IA 1KUTA 3PJCA 2W4OA 4IWQA 2XK3A 5D1JA 4WA9A 1V1KA 3U6JA 3AT4A 4O7RA 4DFZE 4C4EA 4D0WA 2CJMA 3HZTA 4YMJA 4HPTE 4HVSA 1UV5A 2F7EE 3E64A 4QPMA 2C68A 2UW0A 2ZM3A 3GCVA 3CCNA 3FDNA 3PSCA 3KF4A 4I22A 4DYMA 2JLDA 4RJ3A 3GUBA 3M42A 4Z16A 4C4FA 3KA0A 4CTBA 3DOGA 3EKNA 3EQHA 2NP8A 2R3FA 3GXLA 2Z7RA 4FKVA 3W2OA 3O71A 3R1QA 4J96A 5DLSA 3MYGA 5BUJA 2B9FA 3T9TA 3SV0A 4I6FA 2C3JA 4CFVA 4I21A 3HV6A 4QMUA 4R77A 4XLVA 3R6XA 4EOJA 3KXXA 1GIHA 4BDHA 4QYFA 4CT1A 3F5PA 2WTKC 4I6HA 2W1DA 2XJ0A 5M53A 3PIZA 3GOPA 4AT3A 4U43A 5E92A 4O7VA 5CASA 3H0YA 3PXFA 3PPJA 5BVWA 3KXMA 4RPVA 4AF3A 5HESA 4XEYA 4CRSA 2J0LA 2XYUA 2X7OA 3MVLA 2Y4IB 2RFSA 4WG3A 4GJ2A 4Y5QA 3VBQA 3B8QA 5AM6A 1REKA 2YIWA 4L3PA 4ZTMA 5KX8A 3VQHA 3LFSA 3ZFMA 4C38A 4QP2A 4D1ZA 4XV3A 3TZ8A 5IQGA 2EXEA 5AV1A 2OSCA 2XNPA 1U5QA 3IW5A 4FVRA 4FKRA 4I5HA 4EQMA 5E8VA 1GNGA 1Z57A 3QGYA 3MB7A 2KTYA 3LXKA 3O23A 3TKHA 4Q5EA 5LVMA 3E7OA 4NEUA 3R8LA 3P7CA 4NFMA 3E3BX 4R1VA 4MXCA 4HCTA 4ANMA 4KA3A 2ZV2A 4GUEA 4F99A 2BUJA 3HNGA 4C3FA 1Q41A 5BNJA 5JQ8A 3L8SA 3FI2A 3IDBA 3KC3A 3NNWA 3A7HA 2QONA 2E9OA 2YN8A 3Q53A 5AEPA 3UZPA 4F63A 4X2GA 5A4CA 5KZIA 3AD4A 3CC6A 3QZFA 2Y4IC 1M2PA 3CTQA 4DA5A 3EB0A 3EWHA 3O8PA 1JAMA 2VZ6A 3LCSA 5GZ9A 3WOWA 4G9CA 4NL0A 4F08A 3EIDA 3O96A 5J1VA 2CNQA 2CGVA 2XJ1A 4E6AA 4BBEA 1R3CA 4FV4A 2ITNA 2OW3A 4NJDA 1S9IA 5LCJA 3COHA 2VO7A 1SYKA 5J8IA 4FZAB 3FHIA 3HRBA 4CG8A 2UZEA 3L1SA 1IG1A 4FOBA 3DTCA 1UU3A 1WZYA 4U8ZA 3D83A 2XKDA 4M0ZA 3GENA 4FKTA 4RIWB 5H8BA 1RJBA 3VW8A 3R83A 1U5RA 5AUYA 2QU6A 5LWNA 2H34A 3KULB 4NK9A 5CEMA 4CD0A 2JFMA 5A3XA 2J0KA 3TXOA 3OUNB 5KMKA 1VZOA 3ZM4A 1B6CB 5CU6A 3FMDA 4I0RA 4FG9A 3TTJA 3Q60A 5AIRA 2JKKA 2I0VA 2PUPA 4EH7A 3UQCA 2X39A 4FG8A 4PNIA 5HO8A 4W9WA 3ZDIA 2BHHA 3OBGA 4RX5A 5L2IA 3L8PA 3AD5A 4R5YA 2WTJA 4FODA 4X3FB 4L7FA 3I81A 4IB0A 4O7SA 5IISA 4UY9A 4QO9A 2X7GA 3POZA 4YJOA 4LOPA 3DXQA 4BDCA 3PY1A 3IOKA 3RINA 4B0GA 5IEXA 1QL6A 3EFKA 3MTLA 3NYXA 4F7SA 3MJ1A 5EYKA 5K4JA 5FG8A 3TZMA 3R22A 3ZXZA 3G2FA 4KKGA 4ZEGA 5D41A 3DBEA 4ASXA 2XNMA 4C36A 2HYYA 1JPAA 4UXQA 3U9NA 4DT9A 3I5NA 3Q2MA 3NW5A 2OO8X 3NS9A 3RHKA 1R1WA 4J8NA 3ZTXA 4FTQA 3UDBA 3MIYA 1YOJA 4M97A 3V8TA 3G6GA 3KXGA 3O17A 2DYLA 3ORZA 5EI8A 2EB3A 1YXVA 3E63A 4QTCA 5HCZA 3RNYA 3LJ1A 1V0OA 3R7GA 4II5A 5HBHA 1OIUA 4GYIA 2FB8A 1FVTA 4L6QA 3C0IA 4YNOA 4BBFA 4FTOA 5AR3A 3KCFA 2PMOX 2OWBA 3EKKA 4O0VA 1J7UA 3V01A 4PTEA 2HZ0A 4EZ7A 2CLQA 4U81A 3ET7A 5AIKA 5FP5A 3FYJX 4P4CA 2XM8A 3TCPA 3Q04A 3R1SA 3BHUA 4C59A 4PPBA 3PVUA 2W1IA 1ATPE 4L45A 4RBLA 4F6WA 3G5DA 4HCVA 2GHLA 4XS2A 3LHJA 5GIOE 1YQJA 5FDPA 4BWKA 1T46A 1WBNA 4KABA 2RFDA 4CRLA 5BYLA 3LFFA 5JSMA 4DBXA 2RIOA 4XRLA 4G3CA 3GC7A 1QPCA 5M56A 4M0YA 1P2AA 4BZDA 3RHXA 3OEFX 3UYTA 3TN8A 1FINA 5J9LA 3ORMA 3NDMA 4I0SA 4LMNA 2P55A 3DFAA 4YTIA 3N9XA 4XP2A 1TQIA 3QFVA 3KK9A 1P4OA 4FKSA 3WARA 5CF5A 3FI3A 3QX2A 2NPQA 5D10A 3DZQA 3F7WA 4EKKA 5JH6A 3ANQA 3F3TA 2QOQA 3BHYA 3AG9A 2PVMA 3CGFA 2BR1A 3MW1A 4ITJA 4LGDA 4AW2A 5A4TA 2ITUA 4O2ZA 3LM0A 4FKLA 3EQCA 1ZYJA 4RFZA 4XBUA 3U54A 4BCJA 4JQ7A 1BUHA 4KS7A 3AOXA 2R0UA 4LL0A 4X2JA 3EN9A 3OWJA 3LJ2A 3VJOA 2OGVA 4QTDA 4CFNA 3JPVA 3TKIA 3LLTA 2WEVA 5G1XA 2ITVA 2XBAA 2CGUA 3M1SA 4FT3A 4RWLA 1LEWA 4BKYA 5KO1A 2ETMA 3GU7A 3QCSA 2CLXA 1PYEA 4RQVA 4ALUA 5KCVA 2WOTA 1VYWA 3R7UA 1U4DA 2VO0A 5HX8A 4PQNA 3B8RA 3NSZA 3KN6A 3EQBA 5I3OA 3QC4A 4YJPA 3BU3A 1PXJA 2XIYA 1TKIA 4PPCA 3QAME 3QL8A 5E90A 2WMVA 1OKWA 3HRFA 5KHWA 4ZIMA 3A60A 4UYNA 4QYGA 2XA4A 1I44A 3A4OX 5DNRA 4DFBA 3PY0A 4AW0A 4ITHA 2NRYA 3QGWA 4GVJA 3LQ3A 4FX3A 4ARKA 1R0PA 4MXOA 2W5BA 2E9NA 3MVHA 4EH2A 4RT7A 4O6LA 3VS2A 4S33A 3BWJA 3S1HA 4MVFA 2ERZE 4M3QA 2XP2A 3CJGA 4KIQA 4J98A 4YHFA 4O7ZA 4FV7A 3DNDA 2C5OA 3II5A 4O7YA 4RVKA 5I4NA 3UIMA 1UNHA 3TG1A 4MKCA 1W84A 2WKMA 2I0EA 3U87A 3ZC6A 3HMIA 2W1HA 5AP2A 3VUHA 3MDYA 4PL4A 2GCDA 4M13A 3HYHA 4WUNA 1URCA 4DG0E 5HVJA 3LQ5A 4JBPA 5E8ZA 4RLKA 2B9IA 4FEUA 3R2BA 4FNZA 4H3BA 4WNOA 4X0MA 3ULZA 3TDWA 3QKKA 2XCKA 3DTWA 2E2BA 2UW7A 4GCJA 2A27A 2F49A 2IZUA 2AC3A 3OROA 2GSFA 5C03A 3FLWA 2C3LA 4BZNA 3MI9A 5FEQA 3ZBFA 2RG5A 2I6LA 2W05A 3AD6A 3D7TA 3PE1A 5EM7A 2W1CA 3MESA 4NTSA 2YFXA 4KS8A 2PVJA 3A7IA 4BN1A 5F1ZA 2UZUE 3KVXA 4IWPA 5IA1A 4JQEA 3HEGA 3QLFA 4WRGA 5AUWA 4BDJA 4FNWA 5JN2A 1TQMA 5HORA 4K9YA 1PMNA 4G1WA 4XNEA 3H4JA 5CALA 2HK5A 4N70A 5D7VA 4MNEB 5HD7A 3ENMA 3VULA 3WZEA 4FMQA 4JIKA 2G2HA 2VTIA 3FQHA 1Q99A 1WBOA 4C4GA 4AZVA 5CEIA 4O96A 3CQWA 3Q3BA 2OU7A 3UODA 1YWVA 5I3RA 5EDQA 1OB3A 3MFRA 1MRVA 4FTMA 4OBOA 4GKHA 1WVXA 2XM9A 4EOIA 2BILB 3PXKA 2B9HA 2ITXA 1PF8A 3NAYA 3RNIA 4D9TA 3TKUA 4LRMA 3MPMA 3G6HA 3UOHA 3V8WA 4ACGA 4RA4A 2EUFB 4K8AA 5AP7A 3Q52A 4IM3A 3V5LA 3SXSA 4GK4A 3JVRA 4NKSA 4QD6A 4EH3A 4C37A 4MXAA 4X3JA 2C0OA 4R5SA 4BGGA 3K3JA 4RJ7A 1GZOA 4OTGA 3GCPA 3VWAA 2BTSA 4I93A 4IX5A 5KMMA 4JX3A 4M69A 4D2WA 5CAVA 3QZGA 3QU0A 1KE8A 4KSQA 4LV8A 5A4EA 4C57A 3LE6A 2O8YA 2V7OA 3GOKA 3OHTA 3KEXA 3U8WA 3VRYA 4GVAA 5JFVA 2YCFA 2ITZA 2YAKA 3BGQA 3COKA 1TVOA 3ZEWA 3SA0A 4QP7A 3ATTA 3RPYA 3PUPA 3RKBA 2X9FA 4AZSA 4QMTA 3WYYA 4JG7A 1UWHA 4LG4A 3FKNA 5HVYA 2QLUA 5JRSA 1V0PA 4HCUA 3VUTA 3O8UA 2JAMA 3UOKA 5HIEA 1PKDA 4AZFA 5CU4A 2DWBA 4DTBA 4FR4A 3BLRA 3KRLA 5AUXA 2VTHA 4L9IA 5FEDA 2WQMA 3WF7A 2GHGA 3OUKA 2BZJA 4AFEA 3RM6A 2AC5A 4E5WA 1KSWA 1L3RE 2W99B 3P4KA 4UWBA 5K3YA 3V04A 2BKKA 3A2CA 5B7VA 5EW3A 3ZMMA 5J9YA 5DBXA 5EM8A 5K9IA 4EUTA 2BHEA 2YWPA 4I5MA 3GGFA 3QQUA 4CZTA 5D7AA 2GQSA 4H05A 4KBAA 4L7SA 5FP6A 3CD3A 4AN3A 1H08A 4FEVA 3A7GA 2ZMDA 4F9WA 2WQEA 3UYSA 1WFCA 5HIDA 3P0MA 3BE2A 2PE2A 1YWRA 3TNPC 4FV3A 4EONA 4FUXA 4LGHA 4OTFA 3VBYA 1H8FA 4MD7E 4P7EA 2QC6A 3F5XA 4G2FA 1OL7A 3K5UA 3QQKA 3WF9A 2C6OA 4D4VA 4FSZA 1J1CA 2OZAA 4Y73A 2G2IA 4FTLA 4BTMA 4JDIA 3MA6A 4PF4A 3VBTA 3G0EA 3S3IA 4H1MA 3TTIA 3PPZA 3PTGA 3RCDA 5JK3A 2XK9A 3FBVA 4LRKA 5AV4A 4N57A 5FXQA 3W2QA 3B2WA 4DEIA 3VAPA 3S95A 1H1QA 4ERWA 4XV2A 4IAZA 2W4KA 4XG7A 2WMAA 4IJPA 3DGKA 4XBRA 4EK4A 1HOWA 2VWIA 2OXXA 4JR7A 3OF0A 3HMMA 1ZMUA 1MRYA 2UUEA 3LPBA 3R9OA 4IZAA 4GT5A 4CT2A 4FKGA 4E5AX 4IQ6A 4O0XA 4UMPA 4O91A 4FV9A 3PLAE 3HUCA 3KRWA 3QD0A 1CDKA 4AZWA 4MBIA 3ZLWA 3DPKA 5CAQA 1YOLA 3VF8A 3L9MA 5CNOA 2VTPA 5JFXA 3TV6A 3R8UA 3QC9A 5FTOA 4EWHA 3UMWA 4N6ZA 2R3LA 4YZCA 2SRCA 3CQUA 1E1VA 5M09A 1OPLA 3COIA 2F2CB 4P5ZA 4Y5HA 3FZPA 2CN5A 3DU8A 5EOBA 3HMOA 4AN9A 5KMLA 5M57A 3FQSA 4CG9A 4EOKA 2C0IA 3Q4UA 3RAKA 4PUZA 4BKJA 4FZ6A 2R3IA 2XRWA 4V0GB 2YJSA 4I5PA 2YDJA 4FVQA 4S32A 4EHZA 4QMOA 2QNJA 3ZM9A 4FTUA 4E6QA 5JZJA 4KSPA 4DH3A 2XB7A 3NW6A 1SM2A 4FGBA 4RA5A 2HWOA 3UIXA 4E20A 1IAJA 3ZSIA 4KKEA 2JDOA 3PP0A 2B1PA 3IW6A 3UG2A 4CMTA 5EHYA 4DGNA 4QQCA 5AM7A 4C33A 3RPSA 2XUUA 4PP7A 2BRHA 2R3NA 2X4FA 3HLLA 4Z7HA 4FNXA 4N0SA 3R8MA 3O8TA 4XX9A 3LFDA 3ORNA 4APPA 3O7LD 3VN9A 4D5HA 4KUJA 2GQGA 3DCVA 4WRSA 5CI6A 3QWKA 3TEIA 3PY3A 2I7QA 1Q62A 4WD5A 3FSKA 4IWOA 3ZXTA 1H1SA 2X2LA 3GFEA 3FY2A 4GFMA 3R04A 4OBQA 4YC3A 2FSTX 2B4SB 3BI6A 4G6LA 3CJFA 4GK2A 3DKFA 2HXLA 3P1AA 4J8MA 4EOOA 4O81A 3V3VA 3WZKA 3EMGA 5GINE 1YVJA 5HNGA 2GTNA 4CZUA 4KIKB 1OL2A 1ZXEA 4JJRA 3CPCA 4JOAA 5EQPA 3V51A 2J0MB 3UC3A 4CYIA 2BFXA 4FL2A 2W4JA 4TZRA 1PW2A 4OUCA 4V01A 4YJQA 3A8WA 4I94A 3SXRA 4ID7A 1YI3A 3CPBA 2ITYA 3NIEA 4I4EA 4MCVA 4YLLA 2O5KA 2VGPA 4OW8A 2PU8A 5FEEA 3PYYA 1OZ1A 4MEDA 4L01A 3CS9A 4XG9A 4Y72A 5IUGA 1ZY5A 2WTCA 5AR7A 5J1WA 4Q9ZA 3PG1A 4WHZA 1FGIA 5EYMA 4IVBA 3Q4CA 2R3HA 3A61A 1CKPA 1GIIA 4HZRA 1JKKA 1RE8A 5ETIA 3ZLSA 2YWVA 5B2KA 2HW6A 3GCSA 4BGHA 4QMWA 1IA9A 3H9RA 4L68A 3DQWA 3FMNA 1CMKE 4QTAA 4FC0A 2C6MA 1P14A 3QUDA 4W8DA 4YZMA 4ANQA 5IU2A 4EJ7A 4JQ8A 3LAUA 4Y83A 4BC6A 2P4IA 4NYEA 2C5YA 3ETAA 4W4WA 4ASEA 4MF0A 5DEWA 4DEEA 5EM6A 1NVSA 2WNTA 5EKOA 2I40A 2OJJA 1OKVA 3BGZA 3P5KA 2BKZA 3F2AA 4X6QC 3MY1A 3GC8A 4H39A 4YJTA 5HTCA 4M15A 5BUIA 1ZYLA 4N6YA 4I4FA 2ZB1A 4ANSA 4CCBA 3D7ZA 5BQ0A 5CU2A 5KZ0A 4LUEA 1XKKA 1KE7A 1PXNA 2VTMA 3EQGA 3MPTA 3Q5IA 3C0GA 4IM0A 3FWQA 2V55A 4FV1A 3ZFYA 1M52A 4FVPA 5AP6A 5KHXA 4ZTQA 2CCIA 2WQOA 3FPQA 5BVNA 3C9WA 3Q9ZA 2WMBA 3PE2A 2H9VA 5G6VA 3VJNA 4BBMA 3UO4A 4ZAUA 3NUSA 1KE5A 3EN5A 4G16A 3R2YA 2XS0A 3PVWA 4EQCA 1PXOA 2X9EA 2OFUA 2VX3A 3D4QA 3N4UA 4EZ3A 3WBLA 4QQTA 5LXMA 4A07A 5C4KA 4DGOA 3F5GA 3CXWA 3F2RA 5EI2A 5KMNA 4FSTA 2DS1A 1UWJA 5H2UA 4DEDA 4EH4A 5KBQA 3QX4A 3H3CA 1XJDA 3Q2JA 3KMMA 4OTHA 1B38A 1UU9A 2OZOA 2QODA 4ASDA 4BL1A 4PPAA 5LVLA 3CIKA 4K18A 4FT5A 4QQ5A 3EN4A 1UA2A 1DM2A 4IAAA 1H01A 4HVDA 2QURA 3HAVA 3OTVA 1RQQA 1YW2A 4AT5A 4DINA 3V8SA 4EI4A 3V6RA 2F57A 3G9LX 4EEVA 5LMBA 4O27B 1O6KA 3UZTA 2HCKA 5DR9A 2W0JA 3MSSA 4LRJA 3C4WA 4KBKA 3UIUA 1H1PA 2VO6A 3ZUUA 4E8AA 1OBDA 4JNWA 3O51A 2IW9A 4BRXA 3Q32A 5HLWA 3ZSGA 3KRRA 3P9JA 4EORA 5LWMA 4G3DA 4NIFA 4NSTA 3LCTA 4QPAA 4AGCA 5JFWA 4YTFA 4D0XA 4BCNA 2REIA 4FTAA 1JKSA 4TW9A 1G8AA 4CFFA 2QKWB 1YXXA 1JOWB 2J2IB 3QUPA 5CSVA 2QOBA 1OKZA 4GUBA 3FLSA 2JC6A 2HELA 5CQWA 5TT7A 3UP7A 4FSQA 4AT4A 5L6OA 4NWMA 4LOOA 3CGOA 5T3QA 2XJ2A 3UQGA 2A4LA 3UOLA 4DG3E 3DLSA 3OY1A 3CEKA 3E62A 3IONA 3KXNA 4MXZA 3IGOA 1Q97A 2WMSA 4FV8A 4BGQA 2PYWA 5DH3A 4PNKA 2UZOA 2VWYA 3KKVA 4KBCA 4RIYB 4FKIA 4E5BA 5JT2A 4FEXA 5E1EA 3QTIA 3G9NA 3KN5A 4JIAA 4AOJA 2IVUA 4K1BA 4D1SA 4MX9A 4UYAA 2PZIA 2PUUA 2XK4A 2XYNA 5LMKC 3EQRA 4OGRA 4FK6A 4PTCA 4AZEA 5IQCA 2J51A 2C6IA 3KGAA 3L9PA 1CSNA 1Y8YA 5IDPA 2CN8A 4L46A 2GNGA 2XK7A 2X8IA 3H9OA 1MUOA 3F61A 5K0KA 5BVOA 3LM5A 3AC1A 4ZTSA 3BEAA 5C9CA 4FKUA 4DN5A 3MS9A 4RIOA 5DT3A 3AQVA 2W5HA 3VF9A 2CKEA 2C69A 2VTJA 3Q9WA 5L8JA 4D2SA 2R64A 5CVFA 4I24A 4K11A 1WVWA 2Y8OA 2JIIA 4D9UA 3ANRA 2OFVA 5HQ0A 3CR0A 4PDOA 4PV0A 4AX8A 4K2RA 2Z7LA 5KMOA 4AGDA 2VD5A 2YJRA 5EYCA 5HE1A 4IWDA 3ODYX 2CGWA 3PJ3A 1KV2A 3SOCA 2FVDA 3OC1A 2C47A 4ZTHA 3TV7A 5IUHA 3BLHA 4DGLC 3ITZA 5CF8A 4BDGA 2PUIA 4IMYA 3COMA 4FBXA 4TYHA 2GTMA 3E3PA 4IX3A 4YJSA 2EVAA 3E7VA 2PMNX 3NEWA 2WTVA 3AC5A 3C4CA 3NUAA 3VHEA 3CSVA 2ZM4A 3R28A 4IAYA 4IIRA 4Y46A 3E87A 3QTRA 2CKOA 4ACCA 4EH8A 4GT3A 3FZTA 1T45A 3Q5ZA 5J5SA 3BQRA 2C1BA 2G01A 1PKGA 4TN6A 1YDSE 4QOXA 2PTKA 3F6XA 3UPXA 4YZBA 4ALWA 1IAHA 2JKMA 2VN9A 1O9UA 2BRBA 1XBAA 3I0OA 4FSRA 2B52A 4BDKA 1ZYSA 4XOZA 1PRYA 2XKCA 4I0TA 5LOHA 3FMLA 4FIGA 3IG7A 3DFCB 3RAHA 3DZOA 3HL7A 2JIVA 3EOCA 3H30A 3QCXA 4JLCA 3OWPA 4PRJA 3PWYA 1Q8ZA 2H6DA 5E8YA 5M44A 3R71A 3IQ7A 4FV6A 3NIZA 3PP1A 4YO6A 5CSHA 1Y57A 4DGMA 4LMUA 3DS6A 5EKNA 3U6HA 1WBVA 3ATSA 5HIBA 3DB6A 3A7FA 4BCPA 3UC4A 3IDPA 2BROA 2Q0NA 4RWIA 1MRUA 4UEUA 5AR8A 3F69A 4ZSGA 4FA2A 2XBJA 2A19B 4FKOA 4IAKA 4IZ7A 2WXVA 1BMKA 4M84A 4BCGA 2XIKA 3GFWA 3FEGA 4DG2E 3I0QA 4ZLOA 2ZV7A 2QHNA 4F9CA 2F7XE 3RTPA 3UZRA 5GJGA 4OTWA 4U42A 1OL1A 1CM8A 4M67A 3ZCLA 4L3LA 2BRMA 4EYMA 1NXKA 4E4MA 4WSYA 3R9HA 5D12A 1U46A 5I0BA 5JEBA 2CSNA 3NW7A 3A99A 3KRJA 4USDA 4V05A 4WNMA 1OIRA 4BCMA 4RJ6A 3WYXA 4BB4A 2CNVA 4I1ZA 4OR5A 4D55A 5L3AA 4AACA 4R78A 4GIHA 2PZPA 4RWKA 2WTDA 3EFWA 2HZ4A 2W06A 4F7JA 4FKQA 5JRQA 2EU9A 3RWPA 2GU8A 3D94A 5F4NA 3NUPA 4KB8A 3KFAA 4AGWA 4C7TA 3NNXA 4IH8A 4U3YA 3HGKA 3NYVA 2XK6A 3C5IA 3CP9A 4C35A 3QHWA 2QO9A 3F5UA 3AC3A 4X3FC 1KE6A 1HCKA 4ENYA 2HW7A 2R2PA 4ASZA 4YJUA 5ANEA 2ZMCA 5AUZA 5L4QA 1Q61A 2PVYA 4FL3A 2XNEA 3D5VA 3IOPA 2C30A 2ZB0A 4AW5A 4DLJA 3NGAA 5AADA 3AC2A 3DJ7A 3O2MA 4D4RA 1LEZA 4CLJA 4ZMFA 4S34A 1M2QA 2BRNA 4NFNA 1U54B 2C4GA 4BWPA 4IXPA 3DLZA 4R7IA 3EQPA 4IDVA 3BZ3A 4O0SA 3QQFA 4W9XA 3LMIA 4F64A 3JVSA 3ACJA 2PE0A 2W1FA 2W9FB 4JG8A 4JL9A 4KINA 2WIPA 5CF4A 5I9YA 2QOFA 3C7QA 3KXHA 4O83A 5TOZA 3R7OA 3W33A 1NVQA 2IVVA 3NNVA 5C4LA 1K9AA 1P5EA 1URWA 1G3NA 2CKQA 2F2UA 2VWZA 4OT5A 2OIBA 2BIKB 3D2KA 4TNBA 2ZVAA 2Y0AA 4YSJA 5LJJA 3BLQA 5FM2A 5DE2A 2VTNA 1YDTE 5BX0A 2VU3A 3HRCA 3ZEPA 5M07A 3RK5A 5BVEA 4A7CA 4C2WA 2QQ7A 5IMXA 4BR3A 3FYKX 3ZYAA 4YJNA 1RW8A 2BDWA 3WZUA 4CMUA 3ZO4A 4I5CA 3FKOA 3ORXA 4HGEA 4PTGA 5CNNA 1H27A 1YRPA 2BCJA 4AZTA 4R7BA 2BDFA 4F9AA 2H96A 3P23A 2QR7A 3ORIA 2W1GA 1A06A 2R3RA 3PA5A 2C3KA 5HCYA 5J7HA 3T8OA 2VWVA 1O6YA 1NT2A 3MVMA 1J7IA 4S30A 4IX6A 4QYHA 4X2NA 4H36A 2EWAA 2YZAA 3S00A 3EH9A 3D15A 3DKCA 3UMXA 3VRZA 3BIZA 4B4LA 3C0HA 3DXPA 2UW3A 3W8LA 4Z55A 5A9UA 4TXCA 3LCOA 3GQIA 4UXLA 4C8BA 4YHJA 2WELA 3KQ7A 4MF1A 5I5ZA 1PMUA 3DDPA 3FE3A 3N51A 2W17A 4BI2A 3C4EA 4YBJA 5A6NA 3PZEA 4AWIA 4CVAA 5I9ZA 3QWJA 4UALA 3LCDA 5AAGA 5IQEA 3KXZA 4RJ5A 1VYZA 1X8BA 3VQUA 3VBWA 4C0TA 2Q0BA 2QD9A 2UW8A 4O84A 5ACKA 1R39A 5HICA 4GV1A 5HU3A 1OUYA 3QKMA 3PZHA 4PMTA 2V62A 4RMZA 3FMEA 2VV9A 3FLQA 4I41A 1JBPE 2Z8CA 4IADA 3RPVA 4FKJA 3TZ9A 4EC9A 4EHEA 4HVHA 5BPYA 2PZ5A 3UQFA 4E7WA 3DB8A 2QOOA 4F9BA 4QT1A 4ACMA 5ETFA 3R7VA 1QPEA 3OCTA 4EHVA 1ZYDA 2ESMA 2RFNA 2J4ZA 2W7XA 1XWSA 2Y4PA 2ZAZA 3OT3A 1A9UA 4S2ZA 5CT7A 5E9EA 5E8UA 3R9RA 1H25A 1ZY4A 2WFYA 4GEOA 5AR5A 5FM3A 5KE0A 3SRVA 2GMXA 1NY3A 4FIHA 4IJ9A 4C4JA 3CKWA 3ZZWA 1PY5A 4MNEA 2VUWA 4LGGA 2XK8A 4ANOA 4UZDA 5TE0A 3V5WA 3TJCA 1UNLA 3L9NA 4FF8A 5CLPA 4ALVA 2OF2A 2R3KA 2WMXA 2W1EA 3VUKA 2ITWA 4NH1A 2QOLA 3OBJA 5IKWA 3FAAA 4JVGA 2E9UA 3QRUA 1Y8GA 3ERKA 4IHPA 2GFCA 3U4UA 3SLSA 3ZUVA 5IEYA 4EWQA 2VWBA 1XH5A 1AQ1A 4K6ZA 5JZNA 4QMZA 3BCEA 3HDNA 2WHBA 4RX7A 5DRDA 3W55A 4O82A 5HCXA 3FHRA 5DI1A 2J9MA 3MFSA 3S2PA 3ENHA 5IQFA 5GIPE 3DBDA 2V7AA 4YURA 4BICA 4PDYA 4FG7A 2QOIA 2O63A 2XH5A 4C2VA 4RG0A 3DXNA 4TKSA 5HE3A 3QYWA 3R7YA 4IACA 2P3GX 3I60A 3TNHA 1M2RA 4JAIA 4NM5A 3BYSA 4FEQA 1IEPA 4USEA 4EOQA 2ZV9A 1BI7A 3QTQA 3TIZA 3WZJA 2IW6A 2BRGA 3GBZA 5IQBA 1F5QA 4F65A 2BAJA 1BLXA 4FV5A 3BHTA 3QA8A 4OLIA 3DY7A 4F9YA 5JFSA 4U80A 1OKYA 2RKUA 4IB5A 2C6KA 4UMQA 3OCGA 4L67A 2ITTA 5DWRA 2OXYA 4D2TA 2XVDA 5FTGA 5HE0A 4EOPA 5HU9A 4KRDA 5CVGA 2BAQA 3QYZA 3P08A 5EI6A 1ZZ2A 3UJGA 2FH9A 3BYUA 2B54A 2B7AA 4QMQA 2GNJA 4GH2A 3KCKA 4O0RA 4FSWA 3PIXA 3QQLA 2RL5A 5AMNA 2O0UA 3QF9A 3ZU7A 4DEBA 4X7QA 4BI0A 3MH1A 3UTOA 2OG8A 5DHJA 4ZTLA 3TNWA 2QG5A 4DFLA 4HNFA 2IZRA 4C3PA 1FPUA 1Q3DA 3RCJA 1GJOA 1Y91A 1JSVA 3PIYA 3QXPA 1YKRA 2PE1A 3SW4A 4FI1A 1ZOEA 4XLIA 3OZ6A 3MY0A 3DKGA 3VS0A 5EDPA 2FSOX 4ANBA 5HHWA 1UU7A 2WTWA 4C61A 3PFQA 3OP5A 3AT2A 4QNYA 1OPJA 5EYDA 5TKDA 3QTZA 2QKRA 1UU8A 3D5XA 4RFMA 5H9BA 1Z9XA 4FUYA 2C5VA 4R1YA 5GNKA 5HNBA 3R30A 5A4QA 4JBOA 3W2SA 2VRXA 4GU9A 2FGIA 3EJ1A 3F82A 3K3IA 4FT0A 1VEBA 3L9LA 4R3CA 4MBLA 2X0GA 3OW3A 3PSBA 3OEZA 3ORKA 3NWWA 4M12A 3OG7A 4XRJA 4AS0A 3GCQA 3IW7A 3PWDA 4NW6A 5CTPA 3ROCA 4GT4A 3E8CA 4K0YA 2XRUA 2FA2A 3HV5A 4M69B 4DAWA 2RG6A 4B99A 3TWJA 3OFMA 3Q4ZA 2JBOA 2YHVA 3HX4A 4F1MA 3O7LB 5AR2A 3GB2A 3VO3A 3VUMA 3DJ6A 4ZSLA 4H3PA 1XO2B 1SMHA 4I20A 3RPOA 4D58A 1M17A 2WZJA 3BBWA 5IA3A 3CTJA 1Z5MA 4XG2A 2VO3A 5AP5A 4IEBA 1NA7A 4AOTA 4ZLYA 3BV3A 4ITIA 4QYYA 2PHKA 2LGCA 3DBCA 2F7ZE 1WAKA 4OTQA 5CEKA 4I92A 2YABA 3Q6WA 1XH7A 3E8DA 4ZTNA 4J7BA 5L6PA 4MWHA 5J87A 3LXNA 5JGBA 4QNAA 4TWPA 3OMVA 3MH2A 3W8QA 4BDEA 5M4CA 3HVCA 3ELJA 4GJ3A 5AAFA 1QPJA 4TT7A 3OS3A 5E8SA 4DITA 4E1ZA 5DMZA 5M08A 3MY5A 4BHNA 2R3GA 2PMIA 2IVSA 4ZSEA 2FYSA 4QP1A 1XQZA 2UVXA 3PJ1A 4MH7A 5GJFA 3O0GA 4FGRA 4CV9A 4LL5A 3KVWA 4PWNA 3JYAA 2JITA 2YCSA 1DI8A 3FL5A 3RWQA 3GCUA 4I6BA 4IVDA 4PDPA 4O7LA 4FTCA 5FQDC 4DE4A 2NRUA 3NLBA 4GRBA 3DBFA 4YPSA 3KMWA 1UKIA 2X8EA 3RAIA 5A46A 5EG3A 4V0GA 5CF6A 4CFUA 4DFYA 5IQHA 3GP0A 5BVDA 5KKRB 5EDRA 3QRKA 2Z60A 3QCQA 2BDJA 3ACKA 3BGPA 1IR3A 2C1AA 5H3QA 2RSVA 3FI4A 5E7RA 3BBTB 3N4TA 4ZMEA 3UO6A 4G5JA 5IA4A 4FL1A 4O21A 1OECA 4M68A 4FSYA 2VX1A 1BX6A 4UWYA 3VBXA 2QVSE 1DAWA 4KKHA 4KWPA 4MYGA 4EK3A 2I0HA 2B9JA 2OXDA 5TO8A 5LVPA 1MP8A 5LMAA 5AUTA 1GOLA 3BKBA 4FIFA 2GFSA 3ZUTA 1Y6AA 5DFPA 1MQ4A 5TF9A 3NAXA 4DBNA 4E93A 3IGGA 3TUDA 1ZARA 2OKRA 2YIQA 5HBJA 1W98A 4AA0A 3IDCA 3R8VA 2A1AB 3QD3A 4AE9A 5M4UA 3LMGA 4AAAA 2BTRA 3QLGA 4NKAA 5ANDA 3O50A 4Y95A 3P78A 4NZWB 4ZLZA 4CGAA 4FTRA 4BDFA 2VTTA 4O0YA 3FQEA 5IDNA 5DYJA 3FJQE 4KRCA 3CQEA 3LMHA 5KKRC 4O86A 2YM6A 4NCTA 5CENA 4MD9E 3SG9A 3MGYA 2V5QA 5L2QA 3E8NA 4NU1A 4O1OA 3PXYA 4TYEA 4CTCA 4LI5A 1DAYA 5HD4A 4IAFA 5CAPA 3JR1A 1O6LA 3C4FA 3HMPA 2X81A 2A2AA 4J52A 3A4PA 3MJ2A 1BL6A 3S4QA 5ANIA 2YACA 4U40A 2XIXA 4CEGA 3BX5A 1TQPA 2OBJA 4HPUE 4ZK5A 4RIXB 5DA3A 5AA9A 2VTSA 3TIYA 4U0IA 4FTTA 2O3PA 5KMJA 4Q2AA 4RC2A 3NVMB 1OM1A 3A7JA 2AYPA 3C51A 1NVRA 3MIAA 4PP9A 5EK7A 5AUUA 1H4LA 2G9XA 1H0VA 1FOTA 4F6UA 4TYJA 2ITOA 4RVLA 4RFYA 3F9NA 5AWMA 4J99A 4ACDA 3RK7A 4ZJVA 3Q9XA 3FLZA 2VTLA 1ZOGA 4TRLA 4XG6A 2YCQA 3FMJA 3B2TA 3MV5A 3KRXA 3RP9A 3C4ZA 3CTHA 1ZMWA 3BEGA 4F09A 4TYIA 2JKQA 2OJFE 3BU6A 5LQFA 4XP3A 2J7TA 4EHGA 3FMMA 5DRBA 4CFXA 5CEOA 4E73A 4WO5A 3QZHA 3PSDA 4OAVB 2WGJA 5T68A 3RZBA 4UMRA 2YITA 4EJNA 4JXFA 4JDKA 5C8NA 1WVYA 3N4VA 3FL4A 5CXZA 1LR4A 4YHTA 3EFLA 5DR2A 3GU6A 1H07A 3DK7A 5ETAA 1JSTA 2R7IA 3PRIA 4Q9SA 3SQQA 3ZO1A 3U9CA 4W4YA 3NCZA 1BL7A 2UW5A 4QP6A 3QHRA 2IZSA 4XYFA 1NW1A 3W2CA 4ZY6A 3FZRA 3IPHA 2HXQA 3PPKA 3QD2B 4FIIA 3UIBA 4BCIA 4WSQA 3M2WA 3F3ZA 4ZZNA 2W5AA 2UZTA 3OT8A 3DK3A 4U3ZA 5DPVA 3R7IA 4CKRA 4O6EA 1FVRA 1YHVA 4EK5A 4I23A 3PVBA 3QRTA 5AV2A 4Y85A 3EN7A 4UMUA 4BCOA 4P2KA 3TL8A 3ALNA 1W7HA 2QI8A 3V5QA 5IQAA 4YZ9A 3R7EA 3PG3A 4EK6A 4WNPA 5H8GA 3OY3A 4EC8A 3HAMA 5AV3A 4V04A 3ZHPC 1PXKA 2C6LA 3LW0A 2IZTA 4AFJA 2O65A 2QOCA 2BZKB 5LMKA 2PVHA 2WIHA 1FQ1B 3ROYA 5CI7A 4D5KA 5IPJA 3JY9A 4TPTA 3JXWA 5ANOA 4BCHA 1VJYA 2JDTA 4KIPA 5GJDA 2VTOA 2R3PA 2WU6A 2XNGA 2IPXA 3OVVA 2JKOA 3ZSHA 1ZMVA 5LARA 3MN3A 4BDBA 4JAJA 3NYNA 5DN3A 3WIGA 4EOMA 4L53A 4JDHA 2OJGA 5CAUA 3KK8A 1ZYCA 3GT8A 4G5PA 2CNUA 2J6MA 2KULA 3R9DA 3TUCA 3C1XA 4GIIA 4YTHA 2OJIA 2OI4X 5I9UA 3ZO2A 2BPMA 3VIDA 4ZZOA 2GS2A 1GZKA 1M7QA 3TUBA 1JKLA 3GI3A 4S31A 1M7NA 2CKPA 1PJKA 2JEDA 4B7TA 3MFUA 3WF6A 3K5VA 2J5EA 5L2WA 4ZS4A 4AUAA 3TI1A 4X2FA 4LQMA 3MH3A 3T3VA 4C4IA 3I7BA 4CSVA 3E5AA 3Q96A 4GFOA 4YJRA 2WTKB 4FZFB 2CMWA 4JRVA 3ZLXA 1QCFA 3QUEA 2GQRA 4EH5A 4WIHA 5HG7A 5CEPA 4CKIA 5GHVA 3GC9A 4A4XA 1S9JA 3PJ2A 3RZFA 2E9VA 4O7WA 2YM8A 4DH8A 1APME 3BYVA 1YWNA 2Y6MA 3FC1X 4L3JA 2AUHA 2GDOA 4XP0A 4BDAA 1XBCA 4MD8E 4C4HA 1GAGA 2Y9QA 5M55A 3MPAA 4WT6A 4FTKA 3ZS5A 3WE8A 4YUQA 3GQLA 4HYSA 1K2PA 4GYGA 2O64A 5J79A 3BQCA 4XJ0A 4NT4A 4QMPA 1UNGA 4CKJA 5KBRA 5KUPA 5AFVA 1JLUE 5CX9A 3ZC5A 4E4LA 2BMCA 4NIFB 2UZDA 5FXRA 5DEYA 4EK8A 5CSPA 4X2KA 4MTAA 2BZHB 3NRMA 3LKMA 3LFQA 2YA9A 4CLIA 3E8EA 3DK6A 4E4XA 1H24A 3F3WA 4ENXA 2YM5A 4BIBA 5M51A 4ZJJA 2ONLC 2OIDA 5J5TA 4K77A 3PVGA 4OTPA 1YXUA 5AUVA 5IMEA 2Q83A 5DG5A 5EOLA 1Q24A 4ZOGA 4MHAA 2BALA 4YGAA 4F0GA 4F1OA 4WOVA 4QYEA 2VTRA 4OBPA 3VC4A 4RQKA 3Q6UA 3AMBA 3NUUA 4PY1A 3D14A 3F66A 4FIJA 5AX9A 4D4SA 3PA4A 5E8XA 3RK9A 4DLIA 2A0CX 4IM2A 3BHHA 3DA6A 4YLKA 1KOBA 3BV2A 4PX6A 4ZP5A 4RIWA 4H3QA 4DHFA 5IH5A 2NO3A 5FRIA 5IQIA 1FMOE 4ZY5A 3KULA 3HUBA 3VNTA 1JVPP 4IBMA 5BVKA 4BHZA 2XKFA 3UVPA 3ZH8A 3UGCA 4A4OA 4BI1A 2XIZA 4FT9A 4JBQA 3FI8A 1OL5A 4KD1A 1F0QA 4DEAA 1CKJA 3HA8A 5K5XA 3VUDA 3R63A 4CYJA 2ZJWA 4D28A 4QMYA 4U5JA 1A48A 4F7LA 2X7FA 4FTJA 1GZ8A 5EHOA 1JKTA 3ORLA 4EL9A 3TDVA 3UNZA 2PVLA 1H00A 2CDZA 1REJA 2WD1A 3P86A 4NUSA 4TTHB 4X3FA 5EHLA 4MNFA 1JWHA 5FBNC 1ZLTA 1Q3WA 2J0IA 4RZWA 5DR6A 4HVIA 3WE4A 4EQUA 2PMLX 3QXOA 4E26A 4GS6A 3IO7A 3QA0A 4TWCA 4D4YA 1SNXA 2ZDUA 3GEQA 4YO4A 2P2IA 3EYHA 3BRBA 4JT3A 2F9GA 3LZBA 4RVMA 4BYJA 2OF4A 4TYHB 4HOKA 5FWKK 4IVAA 3OWKA 1SVGA 2VWXA 3R0TA 4LV5A 5E8TA 1OBGA 2J50A 4HGSA 3GU5A 4RC3A 2PPQA 4MXXA 2JFLA 2RF9A 5D9HA 3U6IA 4JX7A 1LPUA 3E88A 4O0TA 4U9AA 5M06A 5E1SA 4YU2A 3THBA 4I6QA 3UP2A 2R3JA 3QZIA 4XOYA 5L6WL 4IZYA 5CU3A 4G34A 3I5ZA 2PZRA 3WZDA 4ZTRA 2GNFA 4U45A 4AU8A 3SHEA 1KE9A 2I1MA 3KMUA 4QP4A 2PULA 3RAWA 4BTKA 3D0EA 3OXZA 4FE2A 2B53A 4KNBA 4UMTA 2J0JA 3KU2A 4GKIA 3NUNA 1H1RA 2OLCA 4JRNA 3DAJA 3ODZX 4D2VA 1JSUA 3RPRA 3NCGA 1YXSA 2Z7SA 3IW8A 3DNEA 5EH0A 1J3HA 2QCSA 3REPA 4L52A 4YZDA 5HBEA 1UVRA 1U54A 2VTQA 2XMYA 2YAAA 1YXTA 3DQXA 3F88A 3LJ0A 4HNIA 4JI9A 3LFCA 5HO6A 3W10A 1OGUA 3AXWA 3HA6A 4FK3A 1YHWA 3SOAA 3ZFXA 4B8LA 4IB3A 4CMOA 5HTBA 3HKOA 3W1FA 4GMYA 4P90A 5HTIA 2RFEA 4BCKA 5HZNA 5BMMA 4L00A 4YJVA 2G15A 2R0IA 1MQBA 4C34A 3FZOA 5BUEA 2WMQA 3TT0A 4XUFA 4DCAA 1JQHA 3C50A 4J1RA 4D2PA 3G90X 3IW4A 1B39A 1WMKA 4I3ZA 3CY2A 2BAKA 2XNNA 2X6DA 5I9WA 1OI9A 3POOA 3NUYA 4QMLA 4A06A 2ZDTA 1P4FA 3OOMA 4ZY4A 5IQDA 5AP0A 3ZRLA 4PL3A 2OIQA 3LLAA 2IJMA 3NMUF 4EZ5A 3UE4A 5F9EA 1I09A 3FV8A 4HZSA 4GSBA 1ZWSA 4YR8A 5CSWA 2WB8A 4UWCA 3ZOSA 2C6EA 4AN2A 3U51A 4DFUA 2VAGA 1OUKA 5HG5A 2HENA 4EBVA 1WBWA 4F70A 4JG6A 5BYYA 2XKEA 2UVZA 4PDSA 3NNUA 5FXSA 2DQ7X 4ZSAA 3FC2A 3ZDUA 1ERKA 2DUVA 4FICA 3OCSA 4ACHA 2XF0A 3HP2A 2Y6OA 2I0YA 2YZLA 4GU6A 3HV3A 3RI1A 2O2UA 2FUMA 4M7IA 3V6SA 5BVFA 2HY0A 2JDSA 4LFIA 2WMUA 4BCFA 4U6RA 1YI4A 5L8KA 2Z7QA 3UO5A 4YC6A 5HLNA 3SX9A 2V0DA 2EB2A 3AMAA 2YDKA 4LUDA 5J9ZA 2WMWA 3EYGA 3CD8A 3BYMA 5K0XA 4ZJIA 3IECA 4TWNA 3KB7A 5AX3A 2JGZA 3CBLA 4ERKA 2OH0E 3D9VA 2UZWE 1FVVA 2YM3A 4EYJA 4IC7A 2OK1A 4WG5A 1UKHA 3L8XA 4YPDA 5L2TA 3HMNA 3FSFA 2HOGA 4GL9A 3CE3A 2VWUA 4TL0A 5HGIA 2PZYA 1Y6BA 2C6TA 2VNYA 3QBNA 5F20A 2UW4A 3MVJA 2HZNA 2PL0A 3FLYA 3OOGA 3RGFA 4EKLA 5BMSA 4QMXA 3BPRA 5FGKA 4AXAA 1AGWA 1AD5A 4JR3A 3G51A 4U7ZA 3QRIA 4ONAA 2X2KA 4W4XA 5DT0A 3I6UA 5CYIA 3AT3A
chains in the Genus database with same CATH superfamily
5JKGA 4XG4A 3QTXA 5HO7A 5ANGA 5JGDA 4FEWA 3W2RA 2BVAA 3FPMA 3SAYA 5KNJA 3ZO3A 1PXIA 3IK3A 4IE9A 2PWLA 3U55A 4AGUA 5AAEA 2IG7A 4P5QA 3U4WA 5CEQA 3SXFA 3QD4A 3HP5A 2QLQA 3UPZA 3KIOC 2YLFA 3CKXA 1R78A 4WKQA 3D5WA 3UVRA 1H28A 5EQYA 5GZAA 4BJJB 3FLNC 3BELA 4FV2A 4IDTA 1J7LA 4HYIA 4ZS0A 1HCLA 3VUGA 4AXCA 2QO2A 1CTPE 3DJ5A 2UZLA 2IVTA 4WUAA 3R73A 3TACA 3C4XA 3FMHA 5LCKA 1ST0A 3F3UA 3T3UA 4EBWA 4XV1A 5DGZA 4WG4A 2WMRA 3MA3A 4E6DA 4BIDA 1XH8A 4FYOA 3LXPA 4QDEA 4NM3A 1OIYA 2G1TA 3QQGA 5DOSA 4FT7A 2ITPA 2BIYA 1GY3A 4A9YA 1QPDA 3PLSA 3GU8A 3WI6A 2GNHA 2W96B 2WPAA 4B9DA 3R21A 3LFNA 5EW9A 1M14A 4O0WA 4TWOA 1XR1A 3GVUA 5J7BA 4EH6A 3JS2A 5CT0A 3DT1A 3OXIA 2XEZA 3CY3A 3PXZA 4O1PA 4ZSJA 2R7BA 3KL8A 5ANJA 1G8SA 4IVCA 1YOMA 3W0MA 2R4BA 5E91A 5HNIX 2WQBA 3R8PA 4CZYB 1R0EA 4XV9A 3EQDA 2X4ZA 3ML1A 4YNEA 4RLLA 3HV7A 4J53A 1W8CA 3FY0A 4L8MA 3LCKA 4RC4A 5CXHA 2ZM1A 3CLYA 3FKLA 3IKAA 5F94A 4Z9LA 3R8ZA 1RDQE 4M14A 5A54A 4AP7A 5FTQA 4I6LA 4RZVA 3VS5A 2VGOA 4FYNA 4RRVA 4M8TA 3FUPA 4O4EA 1L8TA 4EUUA 3QQHA 4HW7A 4A4LA 2VWWA 3PXQA 3SRVB 2H8HA 4R8QA 4DH5A 1OITA 3WIKA 3ID6C 4N4SA 3R9NA 3AGLA 5BYZA 4F6SA 1TFFA 4CV8A 3R1NA 3D7TB 3HDMA 4AA4A 4DT8A 4NM0A 1SZMA 1KWPA 1PHKA 4DH7A 4X21A 3OWLA 4G3EA 3VVHA 5K5NA 3L8VA 4Y8DA 4ANLA 2W9ZB 4DFNA 4RX9A 1SVHA 4WNKA 4KIOA 1W2FA 3SDJA 3VUIA 3TZ7A 5JMSA 3KREA 2PY3A 5IUIA 2IWIA 4G3FA 3VS3A 2WO6A 4IX4A 5FD2A 2WAJA 1XH9A 4BZOA 4UB7A 4MBJA 4A9UA 2UZNA 3K54A 3I6WA 4YSMA 5KMIA 4PMMA 5CQUA 3VS6A 2ZYBA 5F95A 4IAIA 3NR9A 3ZBXA 2QHMA 5AJQA 4G6OA 4BDIA 1KOAA 3R02A 2VNWA 4K33A 2HWPA 4XCUA 3VS4A 1V0BA 5DT4A 3VBVA 3EL7A 2UW6A 4FIEA 3LVPA 4EOSA 1OIQA 4YZNA 2HAKA 2C5NA 2OICA 4PL5A 4O0UA 4QMSA 4R3RA 1ZZLA 4GG5A 1PMVA 2UZBA 4DEHA 4O2PA 1Q8YA 1PXPA 3PXRA 5E8WA 2WQNA 5CAOA 3OW4A 2XNOA 3R1YA 4R7HA 4UX9A 3SG8A 2X2MA 3Q9YA 5ANKA 4IFCA 5TR6A 2P0CA 4D2RA 4QP9A 3V5TA 2YIXA 2JBPA 2YEXA 4FKPA 2IW8A 2XZSA 3BWFA 5H8EA 3UBDA 2GHMA 5I9VA 1BI8A 4UZHA 3WILA 1PXLA 3V5JA 4QP3A 5HE2A 4IANA 4C3RA 2X0PA 2WMTA 4L44A 4LM5A 2Y7JA 5AR4A 3H9FA 4FSMA 4B6LA 4FV0A 5I9XA 2YM7A 2X6EA 3E93A 3QKLA 1IASA 4F0FA 3H10A 4J97A 4B8MA 4DFXE 4MWIA 4IW0A 5IZFA 1IRKA 5C8MA 4OT6A 2X8DA 1H26A 1WBSA 2GPHA 3ORTA 4IFGA 4D1XA 1PMEA 3EFJA 4U97A 3Q4TA 5ITAA 4BDDA 3SKCA 3G0FA 3BE9A 1QMZA 5HOAA 2YERA 5CY3A 3I4BA 4QMNA 4W8EA 2C0TA 4BTJA 4O7TA 5CSXA 1KV1A 3DDQA 3E92A 3MWUA 4R6VA 3PDTA 4AXFA 1U59A 2JIUA 4CNHA 3OD6X 3OCBA 4WBBB 1SNUA 4CFMA 5IF1A 1OMWA 3RVGA 3DBQA 4DH1A 4FOCA 2VX0A 4RJ4A 3VHKA 3RALA 3I1AA 3TNIA 2CPKE 1STCE 4DTKA 2R3MA 3QTWA 3WF8A 4CQEA 4OTIA 5ICPA 2WU7A 1FBNA 1Q8WA 2CHLA 4C02A 4U44A 4AQCA 2ZOQA 3KF7A 2JAVA 3DKOA 3UNKA 3G33A 3GU4A 4HGLA 3JUHA 4G3GA 2HY81 1LUFA 2OJ9A 4IZ5A 3UVQA 4UN0C 5IG1A 2FO0A 2BFYA 4G17A 5J95A 4Z3VA 4FNYA 1OPKA 2WEIA 2JDRA 4YLJA 3SW7A 3EZVA 1ZAOA 3R01A 1FGKA 5LVNA 3GC0A 4RX8A 3LIJA 5BV3A 2QOHA 2PVFA 4BCQA 3RMFA 4BIEA 1YHSA 3A8XA 2NYAA 3QQJA 2UVYA 3OXTA 5EQEA 2ACXA 3SC1A 2OZAB 4DHZA 3EQIA 4KAOA 5EFQA 4AA5A 5HVKA 3NVKI 2VTAA 3FXXA 1OGYA 5FBOA 3BL9A 4XG3A 4H58A 2R5TA 2XIRA 5EM5A 5HX6A 3FMKA 4OTRA 3RBWA 3LFBA 3W2PA 3VW6A 1SVEA 3EN6A 3PA3A 4AE6A 3QALE 3C13A 3JY0A 4HYHA 5CS6A 3UNJA 3T9IA 4F4PA 4G9RA 4MXYA 2LAVA 1ND4A 3D5UA 3VS7A 4CFWA 4F7NA 4QTEA 2B55A 4X6RA 5AP4A 2EXCX 2QR8A 4O22A 4QTBA 5C1QB 4XHKB 5DIAA 4MQ1A 3RJCA 4OAUC 3NPCA 4BVUA 4NJ3A 4RIXA 1XBBA 4R3PA 3P7BA 3F3VA 4KIKA 4A9TA 5B2MA 2PSQA 4ANNA 3BU5A 4F1TA 1PYXA 3NX8A 1GZNA 1VR2A 3RM7A 2EXMA 4CXAA 2CCHA 1W83A 2J5FA 4F0IA 5ACBC 3I79A 3QRJA 4YTCA 2JD5A 1WBTA 3S0OA 3LOKA 2P2HA 3FZ1A 4U41A 3NYOA 4W4VA 3P79A 1H1WA 4FSNA 4GW8A 1FMKA 3EZRA 5ETCA 4DF3A 2GS6A 3MH0A 3EL8A 3W16A 2PUNA 3MB6A 3BLAA 4DGGA 1J91A 1EH4A 2ETKA 3GNIB 4RSSA 4BKZA 4XMOA 4E4NA 5HI2A 4EOLA 4GFGA 2WTIA 3HV4A 5CZIA 3WF5A 3MTFA 5IH6A 4UV0A 3TJDA 5CU0A 2V22A 1LP4A 3FXWA 3W18A 4ORKA 1YDRE 2IN6A 4YBKA 1ZOHA 2PVNA 4QMVA 2YDIA 2OH4A 4IB1A 5A6OA 2RGPA 2YCRA 3D2IA 3FXZA 3ULIA 2PVRA 3VS1A 5E4HA 3SGCA 4G31A 3ZLYA 4IC8A 4ZZMA 1Q8UA 3AGMA 1WCCA 5C01A 5AV0A 4NTTA 3ORPA 5HG9A 4O38A 4JS8A 4UBAA 2FSLX 3HECA 2BZIB 4AOIA 4BWXA 3A62A 2XNBA 4L42A 2GNIA 3PJ8A 2GNLA 4CCUA 5GZ8A 5IEVA 2Z02A 4O4BB 4USFA 2IO6A 3TNQB 1DS5A 1WBPA 3KY2A 2UW9A 3I7CA 3QTSA 3K2LA 3NUXA 4NM7A 5IA5A 3QCYA 4FJVA 2PK9A 2QU5A 5IA2A 4HYUA 4BYIA 2YIRA 2YISA 4J71A 3W32A 1YI6A 1H0WA 2W1ZA 3LXLA 4QQJA 3DAEA 3FZSA 4DTAA 4TY1A 3IS5A 5M4FA 4JDJA 4HGTA 1Q4LA 2GS7A 1BYGA 4LOQA 4QMMA 4YP8A 2QO7A 3H0ZA 4M66A 4MQ2A 3AC4A 3TV4A 1W82A 2XCHA 4AG8A 3M11A 3ZRKA 4PMSA 1J1BA 1OL6A 3LQ8A 3OTUA 4Z7GA 4BF2A 1OVEA 4E3CA 4E6CA 3EHAA 3LFAA 4OTDA 5JGAA 4AAYA 4HVGA 5HLPA 2B0QA 2G2FA 4XG8A 2ETRA 2Z2WA 4G6NA 4H1JA 2X1NA 4NCTC 5AP1A 4FTIA 2J90A 2P33A 3NZ0A 4U79A 4C58A 2R9SA 3F2NA 4Q5HA 4CQGA 4FZ7A 4ZXTA 4FKWA 1GIJA 5EW8A 2FSMX 4A9RA 4DEGA 5L8LA 2C3IB 3ALOA 2QOKA 4QPSA 5HG8A 4LYNA 2UV2A 1JNKA 5T6KA 4HJOA 1W0XC 3QTUA 1F3MC 5AA8A 4RVTA 1BKXA 2JDVA 3SD0A 2E9PA 3R00A 3ZRMA 4GG7A 4BTFA 2NNWB 4NW5A 5FUTA 3SVVA 4DCEA 2CGXA 2C6DA 4WBOA 1XHAA 2YLEA 4L43A 4A9SA 5A4LA 5A14A 5HKMA 1CKIA 2R3OA 4APCA 4RWJA 4TNDA 3EQFA 2HIWA 5CWZA 5FLFA 4AW1A 4BY9E 2R3QA 5IA0A 3C5UA 5L2SA 2C5XA 4MAOA 4TYGA 4C62A 3DAKA 3V5PA 3AMYA 3MBLA 4XH6A 2ERKA 3BYOA 5B0XA 4GK3A 2YIYA 3MFTA 5FDXA 2UZVA 5LVOA 1Q5KA 3AC8A 2QG7A 3G15A 4O7NA 5CANA 3TM0A 2ONLA 2ZV8A 4FTNA 3BHVA 5IH4A 2XEYA 1IA8A 1Q8TA 4RIYA 2YM4A 5CZHA 4QRCA 3AKKA 2ITQA 3DV3A 1E9HA 2F4JA 3PRFA 4MK0A 4PMPA 3ZONA 4DC2A 5C8KA 3UG1A 5B2LA 5C26A 5D11A 4BFMA 5HEZA 3F7ZA 3UOJA 4FSUA 4JBVA 1XH4A 1G5SA 5DVRA 2WOUA 1K3AA 1ZRZA 3P7AA 5AP3A 1XH6A 4YC8A 2HZIA 4QP8A 3ZZEA 5C27A 4FZDB 1E1XA 5CVHA 1PXMA 2PVKA 4J95A 4RGJA 4RJ8A 5JQ5A 5M4IA 1DI9A 4EH9A 3LFEA 5K4IA 1KUTA 3PJCA 2W4OA 4IWQA 2XK3A 5D1JA 4WA9A 1V1KA 3U6JA 3AT4A 4O7RA 4DFZE 4C4EA 4D0WA 2CJMA 3HZTA 4YMJA 4HPTE 4HVSA 1UV5A 2F7EE 3E64A 4QPMA 2C68A 2UW0A 2ZM3A 3GCVA 3CCNA 3FDNA 3PSCA 3KF4A 4I22A 4DYMA 2JLDA 4RJ3A 3GUBA 3M42A 4Z16A 4C4FA 3KA0A 4CTBA 3DOGA 3EKNA 3EQHA 2NP8A 2R3FA 3GXLA 2Z7RA 4FKVA 3W2OA 3O71A 3R1QA 4J96A 5DLSA 3MYGA 5BUJA 2B9FA 3T9TA 3SV0A 4I6FA 2C3JA 4CFVA 4I21A 3HV6A 4QMUA 4R77A 4XLVA 3R6XA 4EOJA 3KXXA 1GIHA 4BDHA 4QYFA 4CT1A 3F5PA 2WTKC 4I6HA 2W1DA 2XJ0A 5M53A 3PIZA 3GOPA 4AT3A 4U43A 5E92A 4O7VA 5CASA 3H0YA 3PXFA 3PPJA 5BVWA 3KXMA 4RPVA 4AF3A 5HESA 4XEYA 4CRSA 2J0LA 2XYUA 2X7OA 3MVLA 2Y4IB 2RFSA 4WG3A 4GJ2A 4Y5QA 3VBQA 3B8QA 5AM6A 1REKA 2YIWA 4L3PA 4ZTMA 5KX8A 3VQHA 3LFSA 3ZFMA 4C38A 4QP2A 4D1ZA 4XV3A 3TZ8A 5IQGA 2EXEA 5AV1A 2OSCA 2XNPA 1XMMA 1U5QA 3IW5A 4FVRA 4FKRA 4I5HA 4EQMA 5E8VA 1GNGA 1Z57A 3QGYA 3MB7A 2KTYA 3LXKA 3O23A 3TKHA 4Q5EA 5LVMA 3E7OA 4NEUA 3R8LA 3P7CA 4NFMA 3E3BX 4R1VA 4MXCA 4HCTA 4ANMA 4KA3A 2ZV2A 4GUEA 4F99A 2BUJA 3HNGA 4C3FA 1Q41A 5BNJA 5JQ8A 3L8SA 3FI2A 3IDBA 3KC3A 3NNWA 3A7HA 2QONA 2E9OA 2YN8A 3Q53A 5AEPA 3UZPA 4F63A 4X2GA 5A4CA 5KZIA 3AD4A 3CC6A 3QZFA 2Y4IC 1M2PA 3CTQA 4DA5A 3EB0A 3EWHA 3O8PA 1JAMA 2VZ6A 3LCSA 5GZ9A 3WOWA 4G9CA 4NL0A 4F08A 3EIDA 3O96A 3TZ9A 5J1VA 2CNQA 2CGVA 2XJ1A 4E6AA 4BBEA 1R3CA 4FV4A 2ITNA 2OW3A 4NJDA 1S9IA 5LCJA 3COHA 2VO7A 1SYKA 5J8IA 4FZAB 3FHIA 3HRBA 4CG8A 2UZEA 3L1SA 1IG1A 4FOBA 3DTCA 1UU3A 1WZYA 4U8ZA 3D83A 2XKDA 4M0ZA 3GENA 4FKTA 4RIWB 5H8BA 1RJBA 3VW8A 3R83A 1U5RA 5AUYA 2QU6A 5LWNA 2H34A 3KULB 4NK9A 5CEMA 4CD0A 2JFMA 5A3XA 2J0KA 3TXOA 3OUNB 5KMKA 1VZOA 3ZM4A 1B6CB 5CU6A 3FMDA 4I0RA 4FG9A 3TTJA 3Q60A 5AIRA 2JKKA 2I0VA 2PUPA 4EH7A 3UQCA 2X39A 4FG8A 4PNIA 5HO8A 4W9WA 3ZDIA 2BHHA 3OBGA 4RX5A 5L2IA 3L8PA 3AD5A 4R5YA 2WTJA 4FODA 4X3FB 4L7FA 3I81A 4IB0A 4O7SA 5IISA 4UY9A 4QO9A 2X7GA 3POZA 4YJOA 4LOPA 3DXQA 4BDCA 3PY1A 3IOKA 3RINA 4B0GA 5IEXA 1QL6A 3EFKA 3MTLA 3NYXA 4F7SA 3MJ1A 5EYKA 5K4JA 5FG8A 3TZMA 3R22A 3ZXZA 3G2FA 4KKGA 4ZEGA 5D41A 3DBEA 4ASXA 2XNMA 4C36A 2HYYA 1JPAA 4UXQA 3U9NA 4DT9A 3I5NA 3Q2MA 3NW5A 2OO8X 3NS9A 3RHKA 1R1WA 4J8NA 3ZTXA 4FTQA 3UDBA 3MIYA 1YOJA 4M97A 3V8TA 3G6GA 4DDIA 3KXGA 3O17A 2DYLA 3ORZA 5EI8A 2EB3A 1YXVA 3E63A 4QTCA 5HCZA 3RNYA 3W0PA 3LJ1A 1V0OA 3R7GA 4II5A 5HBHA 1OIUA 4GYIA 2FB8A 1FVTA 4L6QA 3C0IA 4YNOA 4BBFA 4FTOA 5AR3A 3KCFA 2PMOX 2OWBA 3EKKA 4O0VA 1J7UA 3V01A 4PTEA 2HZ0A 4EZ7A 2CLQA 4U81A 3ET7A 5AIKA 5FP5A 3FYJX 4P4CA 2XM8A 3TCPA 3Q04A 3R1SA 3BHUA 4C59A 4PPBA 3PVUA 2W1IA 1ATPE 4L45A 4RBLA 4F6WA 3G5DA 4HCVA 2GHLA 4XS2A 3LHJA 5GIOE 1YQJA 5FDPA 1XMLA 4BWKA 1T46A 4DDGA 1WBNA 4KABA 2RFDA 4CRLA 5BYLA 3LFFA 5JSMA 4DBXA 2RIOA 4XRLA 4G3CA 3GC7A 1QPCA 5M56A 1VLRA 4M0YA 1P2AA 4AQKA 4BZDA 3RHXA 3OEFX 3UYTA 3TN8A 1FINA 5J9LA 3ORMA 3NDMA 4I0SA 4LMNA 2P55A 3DFAA 4YTIA 3N9XA 4XP2A 1TQIA 3QFVA 3KK9A 1P4OA 4FKSA 3WARA 5CF5A 3FI3A 3QX2A 2NPQA 5D10A 3DZQA 3F7WA 4EKKA 5JH6A 3ANQA 3F3TA 2QOQA 3BHYA 3AG9A 2PVMA 3CGFA 2BR1A 3MW1A 4ITJA 4AXDA 4LGDA 4AW2A 5A4TA 2ITUA 4O2ZA 3LM0A 4FKLA 3EQCA 1ZYJA 4RFZA 4XBUA 3U54A 4BCJA 4JQ7A 1BUHA 4KS7A 3AOXA 2R0UA 4LL0A 4X2JA 3EN9A 3OWJA 3LJ2A 3VJOA 2OGVA 4QTDA 4CFNA 3JPVA 3TKIA 3LLTA 2WEVA 5G1XA 2ITVA 2XBAA 2CGUA 3M1SA 4FT3A 4RWLA 4LDTA 1LEWA 4BKYA 5KO1A 2ETMA 3GU7A 3QCSA 2CLXA 1PYEA 4RQVA 4ALUA 5KCVA 2WOTA 1VYWA 3R7UA 4BJJA 1U4DA 2VO0A 5HX8A 4PQNA 3B8RA 3NSZA 3KN6A 3EQBA 5I3OA 3QC4A 4YJPA 3BU3A 1PXJA 2XIYA 1TKIA 4PPCA 3QAME 3QL8A 5E90A 2WMVA 1OKWA 3HRFA 5KHWA 4ZIMA 3A60A 4UYNA 4QYGA 2XA4A 1I44A 3A4OX 5DNRA 4DFBA 3PY0A 4AW0A 4ITHA 2NRYA 3QGWA 4GVJA 3LQ3A 4FX3A 4ARKA 1R0PA 4MXOA 2W5BA 2E9NA 3MVHA 4EH2A 4RT7A 2XAOA 4O6LA 3VS2A 4S33A 3BWJA 3S1HA 4MVFA 2ERZE 4M3QA 2XP2A 3CJGA 4KIQA 4J98A 4YHFA 4O7ZA 4FV7A 3DNDA 2C5OA 3II5A 4O7YA 4RVKA 5I4NA 3UIMA 1UNHA 3TG1A 4MKCA 1W84A 2WKMA 2I0EA 3U87A 3ZC6A 3HMIA 2W1HA 5AP2A 3VUHA 3MDYA 4PL4A 2GCDA 4M13A 3HYHA 4WUNA 1URCA 4DG0E 5HVJA 3LQ5A 4JBPA 5E8ZA 4RLKA 2B9IA 4FEUA 3R2BA 4FNZA 4H3BA 4WNOA 4X0MA 3ULZA 3TDWA 3QKKA 2XCKA 3DTWA 2E2BA 2UW7A 4GCJA 2A27A 2F49A 2IZUA 2AC3A 3OROA 2GSFA 5C03A 3FLWA 2C3LA 4BZNA 3MI9A 5FEQA 3ZBFA 2RG5A 2I6LA 2W05A 3AD6A 3D7TA 3PE1A 5EM7A 2W1CA 3MESA 4NTSA 2YFXA 4KS8A 2PVJA 3A7IA 4BN1A 5F1ZA 2UZUE 3KVXA 4IWPA 5IA1A 4JQEA 3HEGA 3QLFA 4WRGA 5AUWA 4BDJA 4FNWA 5JN2A 1TQMA 5HORA 4K9YA 1PMNA 4G1WA 4XNEA 3H4JA 5CALA 2HK5A 4N70A 5D7VA 4MNEB 5HD7A 3ENMA 3VULA 3WZEA 4FMQA 1G8JA 4JIKA 2G2HA 2VTIA 3FQHA 1Q99A 1WBOA 4C4GA 4AZVA 5CEIA 4O96A 3PFYA 3CQWA 3Q3BA 2OU7A 3UODA 1YWVA 5I3RA 5EDQA 1OB3A 3MFRA 1MRVA 4FTMA 4OBOA 4GKHA 1WVXA 2XM9A 4EOIA 2BILB 3PXKA 2B9HA 2ITXA 1PF8A 3NAYA 3RNIA 4D9TA 3TKUA 4LRMA 3MPMA 3G6HA 3UOHA 3V8WA 4ACGA 4RA4A 2EUFB 4K8AA 5AP7A 3Q52A 4IM3A 3V5LA 3SXSA 4GK4A 3JVRA 4NKSA 4QD6A 4EH3A 3P5JC 4C37A 4MXAA 4X3JA 2C0OA 4R5SA 4BGGA 3K3JA 4RJ7A 1GZOA 4OTGA 3GCPA 3VWAA 2BTSA 4I93A 4IX5A 5KMMA 4JX3A 4M69A 4D2WA 5CAVA 3QZGA 3TMOA 3QU0A 1KE8A 4KSQA 4LV8A 5A4EA 4C57A 3LE6A 2O8YA 2V7OA 3GOKA 3OHTA 3KEXA 3U8WA 3VRYA 4GVAA 5JFVA 2YCFA 2ITZA 2YAKA 3BGQA 3COKA 1TVOA 3ZEWA 3SA0A 4QP7A 3ATTA 3RPYA 3PUPA 4O4DA 2X9FA 3RKBA 4AZSA 4QMTA 3WYYA 4JG7A 1UWHA 4LG4A 3FKNA 5HVYA 2QLUA 5JRSA 1V0PA 4HCUA 3VUTA 3O8UA 2JAMA 3UOKA 5HIEA 1PKDA 4AZFA 5CU4A 2DWBA 4DTBA 4FR4A 3BLRA 3KRLA 5AUXA 2VTHA 4L9IA 5FEDA 2WQMA 3WF7A 2GHGA 3OUKA 2BZJA 4AFEA 3RM6A 2AC5A 4E5WA 1KSWA 1L3RE 2W99B 3P4KA 4UWBA 5K3YA 3V04A 2BKKA 3A2CA 5B7VA 5EW3A 3ZMMA 5J9YA 5DBXA 5EM8A 5K9IA 4EUTA 2BHEA 2YWPA 4I5MA 3GGFA 3QQUA 4CZTA 5D7AA 2GQSA 4H05A 4KBAA 4L7SA 5FP6A 3CD3A 4AN3A 1H08A 4FEVA 3A7GA 2ZMDA 4F9WA 2WQEA 3UYSA 1WFCA 5HIDA 3P0MA 3BE2A 2PE2A 1YWRA 3TNPC 4FV3A 4EONA 4FUXA 4LGHA 4OTFA 3VBYA 1H8FA 4MD7E 4P7EA 2QC6A 3F5XA 4G2FA 1OL7A 3K5UA 3QQKA 3WF9A 2C6OA 4D4VA 4FSZA 1J1CA 2OZAA 4Y73A 2G2IA 4FTLA 4BTMA 4JDIA 3MA6A 4PF4A 3AKJA 3W0NA 3VBTA 3G0EA 3S3IA 4H1MA 3TTIA 3PPZA 3PTGA 3RCDA 5JK3A 2XK9A 3FBVA 4LRKA 5AV4A 4N57A 5FXQA 2XARA 3W2QA 3B2WA 4DEIA 3VAPA 3S95A 1H1QA 4ERWA 4XV2A 4IAZA 2W4KA 4XG7A 2WMAA 4IJPA 3DGKA 4XBRA 4EK4A 1HOWA 2VWIA 2OXXA 4JR7A 3OF0A 4O4FA 3HMMA 1ZMUA 1MRYA 2UUEA 3LPBA 3R9OA 4IZAA 4GT5A 4CT2A 4FKGA 4E5AX 4IQ6A 4O0XA 4UMPA 4O91A 4FV9A 3PLAE 3HUCA 3KRWA 3QD0A 1CDKA 4AZWA 4MBIA 3ZLWA 3DPKA 5CAQA 1YOLA 3VF8A 3L9MA 5CNOA 2VTPA 5JFXA 3TV6A 3R8UA 3QC9A 5FTOA 4EWHA 3UMWA 4N6ZA 2R3LA 4YZCA 2SRCA 3CQUA 1E1VA 5M09A 1OPLA 3COIA 2F2CB 4P5ZA 4Y5HA 3FZPA 2CN5A 3DU8A 5EOBA 3HMOA 4AN9A 5KMLA 5M57A 3FQSA 4CG9A 4EOKA 2C0IA 3Q4UA 3RAKA 4PUZA 4BKJA 4FZ6A 2R3IA 2XRWA 4V0GB 2YJSA 4I5PA 2YDJA 4FVQA 4S32A 4EHZA 4QMOA 2QNJA 3ZM9A 4FTUA 4E6QA 5JZJA 4KSPA 4DH3A 2XB7A 3NW6A 1SM2A 4FGBA 4RA5A 2HWOA 3UIXA 4E20A 1IAJA 3ZSIA 4KKEA 2JDOA 3PP0A 2B1PA 3IW6A 3UG2A 4CMTA 5EHYA 4DGNA 4QQCA 5AM7A 4C33A 3RPSA 2XUUA 4PP7A 2BRHA 2R3NA 2X4FA 3HLLA 4Z7HA 4FNXA 4N0SA 2XAMA 3R8MA 3O8TA 4XX9A 3LFDA 3ORNA 4APPA 3O7LD 3VN9A 4D5HA 4KUJA 2GQGA 3DCVA 4WRSA 5CI6A 3QWKA 3TEIA 3PY3A 2I7QA 1Q62A 4WD5A 3FSKA 4IWOA 3ZXTA 1H1SA 2X2LA 3GFEA 3FY2A 4GFMA 3R04A 4OBQA 4YC3A 2FSTX 2B4SB 3BI6A 4G6LA 3CJFA 4GK2A 3DKFA 2HXLA 3P1AA 4J8MA 4EOOA 4O81A 3V3VA 3WZKA 3EMGA 5GINE 1YVJA 5HNGA 2X0QA 2GTNA 4CZUA 4KIKB 1OL2A 1ZXEA 4JJRA 3CPCA 4JOAA 5EQPA 3V51A 2J0MB 3UC3A 2XALA 4CYIA 2BFXA 4FL2A 2W4JA 4TZRA 1PW2A 4OUCA 4V01A 4YJQA 3A8WA 4I94A 3SXRA 4ID7A 1YI3A 3CPBA 2ITYA 3NIEA 4I4EA 4MCVA 4YLLA 2O5KA 2VGPA 4OW8A 2PU8A 5FEEA 3PYYA 1OZ1A 4MEDA 4L01A 3CS9A 4XG9A 4Y72A 5IUGA 1ZY5A 2WTCA 5AR7A 5J1WA 4Q9ZA 3PG1A 4WHZA 1FGIA 5EYMA 4IVBA 3Q4CA 2R3HA 3A61A 1CKPA 1GIIA 4HZRA 1JKKA 1RE8A 5ETIA 3ZLSA 2YWVA 5B2KA 2HW6A 3GCSA 4BGHA 4QMWA 1IA9A 3H9RA 4L68A 3DQWA 3FMNA 1CMKE 4QTAA 4FC0A 2C6MA 1P14A 3QUDA 4W8DA 4YZMA 4ANQA 5IU2A 4EJ7A 4JQ8A 3LAUA 4Y83A 4BC6A 2P4IA 4NYEA 2C5YA 3ETAA 4W4WA 4ASEA 4MF0A 5DEWA 4DEEA 5EM6A 1NVSA 2WNTA 5EKOA 2I40A 2OJJA 1OKVA 3BGZA 3P5KA 2BKZA 3F2AA 4X6QC 3MY1A 3GC8A 4H39A 4YJTA 5HTCA 4M15A 5BUIA 1ZYLA 4N6YA 4I4FA 2ZB1A 4ANSA 4CCBA 3D7ZA 5BQ0A 5CU2A 5KZ0A 4F78A 4LUEA 1XKKA 1KE7A 1PXNA 2VTMA 3EQGA 3MPTA 3Q5IA 3C0GA 4IM0A 3FWQA 2V55A