1Q8ZA

The apoenzyme structure of the yeast sr protein kinase, sky1p
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
363
structure length
354
Chain Sequence
GYHPAFKGEPYKDARYILVRKLGWGHFSTVWLAKDMVNNTHVAMKIVRGDKVYTEAAEDEIKLLQRVNDADNTKEDSMGANHILKLLDHFNHKGPNGVHVVMVFEVLGENLLALIKKYEHRGIPLIYVKQISKQLLLGLDYMHRRCGIIHTDIKPENVLMEIVDSPENLIQIKIADLGNACWYDEHYTNSIQTREYRSPEVLLGAPWGCGADIWSTACLIFELITGDFLFETKDDDHIAQIIELLGELPSYLLRNGKYTRTFFNSLLRNISKLKFWPLEDVLTEKYKFSKDEAKEISDFLSPMLQLDPRKRADAGGLVNHPWLKDTLGMEEIRVPDRELYGSGSDIPGWFEEVR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords SR Protein Kinase
publication title Nucleotide-Induced Conformational Changes in the Saccharomyces cerevisiae SR Protein Kinase, Sky1p, Revealed by X-Ray Crystallography
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 106
structure length 354
sequence length 363
chains with identical sequence B
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2003-08-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 1q8zA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 1q8zA01
4UMRA 4MD8E 2QO2A 3TXOA 3VF9A 4UX9A 2VO6A 3IK3A 2IW8A 3VS3A 3W2CA 2BZKB 4IMYA 3WBLA 4PTGA 4BZDA 4Z7GA 3KK9A 4K1BA 4L43A 5CSXA 3V04A 4RWKA 3PVWA 4CFNA 4W8DA 3RPVA 4Q9ZA 3HAVA 4AOIA 3R8VA 4Z16A 1ZY4A 2CLXA 1M52A 4TWOA 2J0JA 4ANMA 4DEIA 4ZP5A 3QQJA 4XG7A 2XF0A 3SG9A 1OZ1A 2YM6A 5J95A 1M2QA 4ZTSA 5EQYA 5HVYA 2F2UA 3EQPA 1VR2A 3LXNA 3R73A 4IQ6A 5KZ0A 3ZEWA 1E9HA 4S34A 2VWXA 3ID6C 5HG9A 2GNJA 5DR9A 5IQAA 4QNYA 4FUYA 4FTTA 4ZY5A 2QNJA 1YW2A 3ULZA 3OUNB 4RJ8A 2HAKA 3PXFA 4AA0A 2C69A 3W32A 2C30A 3WF9A 4A07A 3BHYA 3FMHA 3FQSA 2EB2A 1AQ1A 3PXZA 3S4QA 5EI8A 4FZ6A 2VGOA 4Y5HA 3AMBA 2AUHA 3GC9A 2YAAA 4FTIA 1MRUA 5J1VA 4N0SA 5FP6A 1P2AA 4R3CA 2BVAA 3DDPA 3NUYA 4IXPA 4XUFA 2BKKA 3K3IA 4I6QA 2IWIA 1M2PA 3ODZX 2C5XA 2C47A 5AUVA 5A9UA 3R2BA 2PZIA 4RLLA 3OFMA 2PY3A 1R1WA 4HYUA 3WIGA 2XZSA 4YJRA 1WBTA 3C0GA 2HZ4A 3SHEA 4AW2A 4CYIA 4UBAA 3A7HA 4M68A 3EH9A 2A2AA 2W1CA 3QTIA 4HCUA 3VS6A 4D2PA 4NW5A 3IW5A 3KREA 4XP2A 1V1KA 2GFSA 4JVGA 3D7TA 4BDGA 3SA0A 3HMMA 4NCTA 2SRCA 3JVRA 5EYKA 5BYZA 4ERKA 1J1BA 5KMLA 4O82A 2QU5A 3R8MA 4D9TA 3PWYA 4R7IA 3BQRA 2WFYA 3W2SA 5IA1A 2UW6A 4WOVA 1OKWA 5IQEA 1KSWA 2CNQA 4CG9A 4WKQA 5AV1A 5ANDA 3CLYA 3E8NA 2CNVA 5HBHA 4OTIA 1J7LA 4IFCA 1ZAOA 3DPKA 4H36A 4Y8DA 5FXSA 3ZDIA 4HVIA 1Q61A 3NNVA 2C0IA 4GYGA 1IASA 4DFZE 4R77A 3KMMA 4XX9A 4GMYA 3OF0A 4P7EA 4ALUA 1NY3A 1Y8YA 2Q0BA 4CRLA 3DLZA 3ORLA 4DEEA 3L8PA 4EORA 3NW5A 1PXLA 2FYSA 2J0IA 3FI2A 4MNFA 4Q5HA 1HCLA 2G1TA 3ZFXA 3DNDA 3VQUA 1ZY5A 1G3NA 3QCSA 4G17A 3LCTA 2HZIA 5T68A 3UZPA 2PU8A 1UKIA 4BCPA 3QHRA 4LV8A 2VNYA 5F1ZA 4LMUA 5HE3A 4DGGA 2OZAB 4TNDA 4EH8A 3UO5A 1XHAA 4EUTA 4AAAA 2ZV2A 1ZOGA 4KAOA 5AAGA 5L6PA 5AV3A 5EQEA 1FPUA 4I20A 4C4HA 4DBXA 3F2AA 4MQ2A 5EYDA 3R9HA 3HX4A 1SVHA 2WTJA 3BIZA 3LFBA 4G3GA 2BTSA 3CJGA 4X3JA 3ZONA 4WSQA 5ETIA 4C4JA 5CEPA 3Q9WA 3LZBA 3V01A 2C6KA 3R8PA 5K5NA 2EUFB 4I4FA 3BYUA 2XK7A 3IW4A 2B7AA 4O0TA 3B2TA 4Q5EA 3EFKA 3FLYA 4LRMA 4FTLA 3ZFMA 5L8KA 4DTKA 3A4PA 5ETCA 4HYSA 5C27A 3LFFA 1JOWB 4WRSA 3V5WA 2PUPA 1BMKA 4BB4A 1P4OA 4FGBA 4MQ1A 5DR6A 3LCDA 4AE9A 2RG5A 5AP0A 4ASEA 2XNOA 4YTFA 4LOPA 4QO9A 4KSQA 2JAVA 5DA3A 4FSNA 4EH4A 2V7OA 3QRIA 4HZSA 4JLCA 4NZWB 3Q53A 4YBKA 4YR8A 3GOPA 4D4SA 5A6OA 4CLJA 3HRBA 2BR1A 3BYOA 3QAME 2YABA 4YJPA 3VWAA 2BZHB 2CSNA 1NXKA 3H0ZA 3KY2A 4RG0A 3EQRA 3W18A 4QD6A 2OK1A 1OKVA 2R3GA 3LFAA 4TYHA 3DJ7A 4HCVA 2IW9A 2VTRA 4X21A 2YACA 4EOPA 2BFXA 3A7IA 4EK4A 5CALA 5LARA 1UNLA 1DAYA 4L01A 5C4KA 3SKCA 4YURA 1FQ1B 4I93A 3QHWA 4HW7A 4KINA 2R3JA 2GU8A 5HQ0A 4AZWA 3EN4A 4F0FA 3A62A 2PZ5A 2GNLA 1Q5KA 3C4XA 4EHZA 3Q32A 4IDTA 3PPKA 2VTQA 4FF8A 1W84A 3R1NA 4XJ0A 3QA0A 4JG7A 4KA3A 3AC3A 4YZMA 2Z02A 2WMSA 3O71A 4IAAA 3TNIA 2PVMA 3WF8A 3GUBA 3FAAA 5TR6A 4QMYA 2IN6A 5DYJA 1KE6A 2Y6MA 3MY0A 4QP8A 4W4WA 4EWQA 2VTAA 2V62A 2QQ7A 3QZHA 3PY3A 4E6CA 3O50A 5HD7A 3TT0A 4FK3A 4MVFA 2XJ1A 2WKMA 4R6VA 4CFFA 1BLXA 3EHAA 3TDVA 2HXQA 2FSMX 3DBFA 3G5DA 3HKOA 5AX9A 2W1IA 3R8ZA 4GFOA 5TT7A 2UVXA 3TJDA 3WOWA 3D14A 4CV9A 3D4QA 3ALNA 4F6WA 5EYMA 2IW6A 4IC8A 2UW8A 4JAJA 5A4TA 3GQLA 3A8XA 4OTHA 4A9TA 2IPXA 3UTOA 2X7OA 2I40A 4TPTA 3C4EA 3WZDA 3DAKA 4C62A 4FNXA 4ZK5A 2R3PA 3BV2A 4WG4A 3SXSA 1G5SA 1WBNA 5A6NA 1ZYDA 3C4ZA 2ITTA 4U42A 4JDHA 2WIHA 3LXKA 4I0SA 3K5UA 3FQEA 3FE3A 4YJSA 1OPLA 3Q5IA 4I6HA 5AUYA 3BQCA 2R3IA 4USEA 3GB2A 3RK9A 3OP5A 2GDOA 5KNJA 1J7UA 4R7BA 2Z7QA 3V8WA 4LQMA 4G6NA 4OTQA 2BILB 4FV8A 1Y57A 2W1HA 1GZNA 5FTOA 4C4IA 4E4LA 5IPJA 3NCZA 3NLBA 4L8MA 3DJ5A 3OMVA 4L68A 4QQJA 3U6IA 4G3CA 3B2WA 4C38A 3FJQE 2I0YA 1ZMVA 4FVRA 3TNPC 3IGOA 1A48A 4QMVA 4XLVA 3D7TB 3JUHA 3NNUA 4S2ZA 4W9WA 1H08A 5JZJA 4RWIA 2G15A 4MF1A 4C33A 3P08A 3PSBA 3E7OA 3UZRA 2DQ7X 4YJVA 4XLIA 1PF8A 2B52A 2PK9A 4PMTA 1W0XC 2BDFA 2UW4A 4LM5A 3OD6X 4GS6A 4NM7A 4NCTC 3QQHA 3GVUA 4G3FA 4CFUA 5DLSA 1OUKA 2BHHA 2E9VA 4IVBA 3PVGA 4LL0A 3IW8A 4D9UA 4F4PA 2B55A 5D7AA 4D2RA 2CKEA 2PMOX 2F49A 3DB6A 4KBKA 3QXOA 4OTGA 1P14A 4KS8A 5E7RA 5AP1A 4GKIA 2OJJA 3R22A 4ZSAA 4XCUA 5KX8A 3EQDA 1XKKA 4D2VA 4JR3A 3C13A 5EHOA 4BI1A 5K4JA 4O7TA 3GCPA 1QPCA 3LW0A 3KRWA 5AIRA 2I1MA 2HIWA 4JS8A 3D5XA 4CFWA 4AXAA 4CG8A 2UW3A 3R8LA 3AQVA 2VWBA 3IS5A 3IOKA 4K11A 3N4TA 4GU6A 4ZJJA 2EWAA 4QOXA 3UO6A 3C1XA 4W4XA 5IMXA 4LI5A 1XQZA 2R3QA 2YN8A 3RTPA 3E88A 2C5VA 2XP2A 4WNKA 3OC1A 4AN9A 4BDKA 3GFWA 4AU8A 2FVDA 4XYFA 2HCKA 2VWUA 5CENA 4I3ZA 4O27B 2IZSA 2RG6A 3MJ1A 4AT3A 4DITA 5JFSA 2QOBA 4EOJA 5C1QB 3DLSA 2H6DA 4UXQA 5GJDA 3ZU7A 2C3LA 2V5QA 4K0YA 4E4XA 4MEDA 3S00A 4YJOA 2HOGA 3PE2A 4ZTRA 4EZ7A 4JOAA 5C8NA 5J1WA 3FDNA 4ZAUA 4UMPA 4X6QC 4ZSGA 4IZYA 1V0PA 3RK7A 2OJIA 3C50A 4O7NA 4FIEA 4F70A 5ETFA 4EK8A 3BV3A 1ZYSA 1OL2A 5AP5A 5BVWA 1OECA 3OTUA 2VWZA 3P5KA 3V5TA 1BX6A 4AUAA 1JNKA 2OI4X 1FVVA 4FIGA 5TF9A 2QI8A 1H26A 1OM1A 3QUEA 4H3PA 2IVUA 4IBMA 3UZTA 3RNYA 3PYYA 1TKIA 4RVMA 4QMMA 4EI4A 5CT7A 4Y72A 4EYJA 5M56A 2WU7A 4QTAA 5AIKA 1Q8YA 4CEGA 2WD1A 5IH4A 1JKTA 1XH6A 3UC4A 1Y91A 4ZEGA 2WEIA 3ZSIA 3VUGA 5CANA 4FV4A 4O0UA 5BVFA 3G9LX 5M4FA 4XOYA 5HNGA 2CDZA 5J9YA 3UVPA 4N57A 3QRUA 3ZRLA 4QTEA 3ATSA 3I6WA 2PVLA 5HI2A 2QKRA 5AP3A 2YIRA 5L2QA 5JRQA 5M06A 3BI6A 1O6YA 3EQFA 3RZBA 4BCHA 1U4DA 4MX9A 1YDRE 4MHAA 3R9DA 4F7LA 3R21A 4EBWA 2XIXA 2YCFA 4J7BA 5TOZA 3II5A 4FKQA 5E8SA 2IZUA 3N51A 4I5MA 2WPAA 4FV0A 4AGCA 4BDJA 3SW7A 2RFNA 3O51A 3O8UA 2XK8A 3TN8A 3BYMA 3V8SA 1SYKA 1CTPE 1FMKA 3GU5A 3SG8A 3KK8A 5L4QA 1GZ8A 3ZLYA 4QYHA 4TW9A 4YJUA 3QLFA 1PXIA 4DHFA 5HD4A 2PZYA 3W10A 3LM0A 4XP3A 3OOGA 4EQMA 2YLFA 5A14A 2EU9A 4RC3A 3FI8A 1WVWA 3D0EA 3PJ2A 4KIQA 5CXHA 2BAJA 5DGZA 2JIIA 3ZZEA 4AZEA 3R83A 4BFMA 4ORKA 1RDQE 3F9NA 5CS6A 3PZHA 4LYNA 4QMLA 4QP4A 5EFQA 3MIYA 4ZY6A 4R78A 4R8QA 3WF7A 1W8CA 2YJRA 3U9NA 4F64A 2UZDA 4RJ6A 4D4RA 4JX7A 1ZOEA 4M3QA 3OZ6A 3EKKA 3AD5A 2CGWA 3L8VA 4H3BA 5AX3A 3FZPA 3WZKA 1E1VA 3DAEA 3DK6A 1OBGA 4O6EA 4B7TA 3W2QA 2PMLX 1H07A 3GEQA 2W1EA 3LMGA 4KIPA 3Q4UA 2GNIA 2UV2A 4N70A 4QT1A 4GT5A 4UALA 2UW0A 2XRWA 1LR4A 2IVTA 3ENHA 4JQ8A 5T3QA 2XK9A 4PMMA 4O38A 4IAZA 1V0OA 4KNBA 4DFLA 4DG2E 4KIOA 5DH3A 1Q8ZA 3CR0A 3DBQA 4FTQA 4YTIA 3UMXA 1QPJA 2WIPA 5BUIA 4AT5A 4YNOA 2DS1A 4FK6A 2O8YA 3TKUA 1URWA 5AR2A 4UYNA 3RNIA 4C57A 3ET7A 2F7EE 2HWPA 2XM9A 4QMNA 5GIPE 5DNRA 5HIDA 4JRVA 5AAFA 1NT2A 4G34A 2HK5A 5J87A 3OT3A 4TYEA 5FXRA 5CQUA 3VAPA 4BGGA 1LEWA 4DC2A 4PTEA 5IMEA 2C0TA 5IUGA 3FSKA 5M51A 2J5EA 5HG8A 3VHEA 3QGWA 1SM2A 3Q9ZA 2IVSA 3OBGA 2C5NA 4PWNA 3C5UA 2W5BA 4AP7A 3TNHA 5CTPA 4W4YA 3FMEA 4BVUA 2HW6A 3BE9A 3RM7A 5J9ZA 4M7IA 3H30A 1BUHA 2XS0A 5CWZA 1H27A 4FV1A 3C4CA 3CKXA 4WIHA 1ZZLA 3PJ1A 4E6AA 3DKOA 3MDYA 3ZO4A 1ZWSA 4XEYA 5HE1A 3H9RA 3OEZA 3ORIA 4FZDB 5EM8A 1KWPA 5HIEA 4ONAA 3QD4A 4GK3A 1FVTA 5L3AA 2PL0A 3BCEA 2NRYA 4BDEA 4L00A 3A60A 1W83A 2XA4A 3AC2A 3ITZA 3LFQA 3P23A 3B8QA 4K8AA 3EQBA 5HCYA 3RM6A 3BRBA 4C36A 1W82A 3RPOA 1PXMA 5IQCA 1YXXA 3DFAA 1PMNA 4C7TA 3DNEA 5GZAA 4RX5A 5DBXA 2OFUA 5IU2A 4HPUE 5DG5A 4KRDA 3EQIA 2UZTA 5F94A 2E9OA 1R3CA 4AWIA 2X9FA 4X7QA 4CVAA 1WVYA 4K9YA 3O2MA 3CY2A 4EKLA 5CU0A 1CMKE 3QQKA 4FSWA 1R0EA 2VD5A 4YU2A 2PHKA 2HELA 2YFXA 3GBZA 3MFUA 2W9FB 3BBWA 5IG1A 3PLAE 3AC5A 4FSYA 1H25A 3QQFA 2GTNA 1Q8TA 1LUFA 2WMAA 5E8WA 3ODYX 3ZUUA 3FMKA 4QTCA 2WMRA 3TUCA 1PKDA 3I1AA 3RAIA 2R4BA 2I0VA 1O9UA 2OXYA 1F0QA 4X3FA 4L3PA 3VO3A 4L7FA 2WTKC 4BWKA 3ORPA 4C4FA 3O8PA 4JG8A 4FT5A 4NFNA 4EEVA 5L2SA 4PNKA 4C2WA 5ANEA 1MUOA 1NA7A 1ZYCA 2W4KA 4MK0A 2OICA 5HZNA 3DU8A 5JZNA 3F2NA 4OTFA 4IIRA 4E4MA 3FQHA 3D94A 4Y46A 2OFVA 2YEXA 4M13A 5DWRA 3ZDUA 1LEZA 1PMUA 2R3RA 3MPTA 4FV6A 3A4OX 3FMMA 4MXXA 3UNZA 4PP7A 3UYTA 1YOMA 4EUUA 5LOHA 3DTCA 5LMBA 3PP1A 2VZ6A 2BALA 4F99A 4F7NA 3IG7A 4HPTE 3W16A 4RIYA 2A4LA 3LQ5A 3RHXA 3RINA 3WIKA 5E8UA 4FV5A 2P2HA 3GC8A 5K0KA 3SV0A 2CGXA 2PTKA 4DF3A 4NKAA 3PPZA 2EXEA 1JSTA 3OT8A 2VWYA 2F7XE 5KHXA 4M66A 4QMPA 4CZUA 4C59A 4O6LA 3QL8A 1UU3A 1YI4A 2ITWA 2O0UA 2X6EA 1H1RA 3IW6A 4U81A 5CU6A 5FBNC 2QR7A 4B4LA 4E5BA 2RSVA 2WELA 3V5JA 3QYZA 2ZYBA 4BCNA 4KBAA 4RSSA 2W96B 4BI0A 4E5AX 3DQWA 3OY3A 2ZV8A 1URCA 2O3PA 4A4OA 3HMPA 2VTPA 4RIXA 5LXMA 1WBOA 2VAGA 4JNWA 5I9WA 2Q83A 5EW8A 3R9RA 2YM7A 3EQCA 5HHWA 2OKRA 2YIQA 4M69A 2BZJA 2VUWA 5BYLA 4S32A 4ANLA 3NAXA 4C4GA 4X2NA 4F0GA 4OAVB 3BU3A 5M44A 3P79A 3IDBA 4CSVA 1XBBA 2B9FA 4IC7A 4QTBA 3RVGA 4A9RA 2PULA 2XVDA 5CSWA 4WO5A 4IH8A 2P3GX 3P7CA 2X7GA 5JMSA 4GT3A 4O0XA 2R64A 3AD6A 3QX4A 2Y4IC 2JDVA 5F95A 5HESA 3W1FA 4NYEA 4A06A 4EK6A 1R39A 4YZCA 5IKWA 2B0QA 2ZOQA 4L7SA 4LRJA 1ERKA 3R63A 5HTCA 5ANOA 4WSYA 3PXKA 1M2RA 3ZM9A 4DBNA 3Q04A 3RAKA 1VZOA 4H3QA 3GC0A 4H05A 5D11A 3JPVA 4IB1A 3FI3A 5FEQA 4ASDA 4DT9A 1YDSE 1PJKA 4TWPA 4AN3A 2ETRA 1R78A 3MFSA 4IEBA 5CSHA 5AP4A 1J1CA 3E3BX 2JC6A 3NZ0A 3NYOA 1OIUA 4YMJA 5CF8A 5GIOE 4BYIA 3CSVA 1FVRA 5M4UA 2C6LA 5CF6A 3CJFA 3DA6A 1CDKA 2WZJA 1UV5A 3QWJA 4EOMA 3PUPA 3BHHA 3KULA 1Q41A 3D2IA 3V6SA 3LJ2A 3SXFA 3VNTA 4DH8A 5ACBC 2R0IA 4ZJVA 3QZGA 1H24A 4GVAA 3F7ZA 4JQEA 4K18A 3ZC5A 2PMNX 3F61A 4ZIMA 2JIVA 5DEYA 4NIFA 4AW1A 4ZZNA 3QUPA 5C8MA 2EVAA 2AC5A 3CKWA 4F6UA 5HG7A 4ZSLA 5GZ9A 1SMHA 3A8WA 4I6FA 4J8MA 4J53A 4FIFA 5FQDC 3LCOA 5T6KA 2VTJA 3VUIA 2CKOA 5E4HA 5KMKA 2QVSE 3KRJA 3MBLA 4C8BA 3VBWA 2PZRA 2RFEA 3P0MA 5ACKA 3UP2A 4EWHA 2R3OA 3OUKA 4ZTNA 3MH0A 4MBJA 3ACJA 4EH9A 3VJOA 1UNGA 5IDPA 1TQIA 4XHKB 1BI7A 1YQJA 4YBJA 4IDVA 3RK5A 4O7WA 4IFGA 4QP9A 4D5HA 3R02A 3QRJA 4RGJA 3V5PA 3O7LB 4D1SA 4G6LA 3EN5A 3PA3A 5IEVA 3NMUF 1W7HA 4EJ7A 4WG5A 2PE0A 5KO1A 5HCXA 1GAGA 3KC3A 1T46A 2J0LA 4Q2AA 4QTDA 4YPSA 1OL7A 3L9LA 1IA9A 3GP0A 3WYYA 3ZMMA 4EHGA 5A4LA 2GS6A 5ANKA 4QYEA 2CMWA 3UG1A 4YLKA 4YHJA 4GL9A 5LVMA 2PE1A 1FMOE 2P0CA 4DGLC 1GIHA 1JSVA 1IAJA 4FV2A 2B53A 4QP1A 1MRVA 1OIRA 3MB7A 2W5AA 4X2JA 3LHJA 3BZ3A 5DT3A 5I3OA 2YLEA 5HE2A 1NW1A 2Y4PA 2FSTX 3F7WA 4IX6A 2YIYA 3TUBA 2CHLA 2OJFE 5AR3A 2GQSA 1I09A 3PA5A 4PMSA 4LUDA 3V6RA 3MPAA 4O22A 1F5QA 3ORNA 4V0GA 2YIXA 3Q96A 4FKWA 3UIUA 4D0XA 5CEIA 3KKVA 4DH7A 4YZDA 3IOPA 2X8IA 3NYXA 3TV6A 4HVSA 2BHEA 2WMTA 2W7XA 5DHJA 2YM3A 2WMXA 4R1VA 4PL4A 2CJMA 2G2FA 4BCJA 3EN7A 1YOLA 1Z5MA 5HNBA 4ZJIA 2X0GA 3SGCA 4ZS0A 4NJDA 3HUBA 4M0YA 3I4BA 3MH2A 4DH5A 2G2IA 3MA3A 4OTRA 1Q97A 2C1AA 3OG7A 3VHKA 3A2CA 5I5ZA 4AOJA 3I6UA 5EK7A 5LWNA 4DLJA 2XK4A 3OS3A 4JDKA 4X3FC 1JKLA 4IZ5A 2VX1A 3KRXA 3OROA 1YVJA 3MVMA 4Z7HA 5E8VA 4YC6A 2BKZA 2DWBA 2GFCA 2HW7A 3GT8A 3LIJA 4FTOA 5D1JA 2HY0A 3QTSA 2JIUA 4BBEA 3Q2JA 2JGZA 1BKXA 1WFCA 2XEZA 4FV9A 4WNPA 4EOOA 4RZVA 2YCSA 4OW8A 3WYXA 2DUVA 3MI9A 3OCGA 4F6SA 2UZNA 3MA6A 2RKUA 3ZTXA 3QLGA 2IZTA 4OT6A 3DXQA 4O0SA 4FNYA 4DAWA 2J0MB 4I0TA 3VS1A 2IZRA 1DI8A 2GCDA 2VO0A 3VBTA 3A7JA 5JQ8A 4NTTA 4O84A 4BR3A 1ZYLA 3DS6A 4I5CA 4XP0A 1NVRA 4MWHA 1GJOA 4FX3A 4WT6A 3T9IA 2XKDA 1WBWA 3UJGA 3EJ1A 3EN9A 2H9VA 4CYJA 2H96A 4TKSA 3C0HA 3FHIA 4WA9A 3R9NA 4B6LA 3JXWA 2WMWA 4GKHA 1CKJA 3ZRMA 4F9AA 4N4SA 4FTKA 3FXXA 4FV3A 4XG6A 3D15A 3MTFA 3JS2A 4M0ZA 5TO8A 3VS4A 3TG1A 4DYMA 1YOJA 4L46A 3PJ3A 1U54B 3KRRA 4IB5A 3OEFX 3R1SA 3UDBA 3DV3A 4FZAB 4K2RA 2BROA 4FT9A 2ZV7A 1Q8WA 1AGWA 3C0IA 4QP3A 3QKKA 5LVLA 4G3DA 2W0JA 3A7FA 4X6RA 5CNOA 4ZZMA 4FI1A 4GIHA 5BUJA 3MPMA 4FTJA 3EKNA 4GV1A 5KMNA 1OUYA 4FBXA 5BUEA 4ZMEA 3I0QA 2GQRA 3G6HA 3FWQA 5FRIA 3MJ2A 5FEDA 4AA5A 3F3VA 4EH3A 5E90A 1XWSA 2X39A 2VX0A 3FZOA 4U97A 3TV4A 3I5ZA 4G5JA 4O1PA 3SOAA 4RVKA 5FDPA 5JK3A 1YHWA 2YWPA 2UZBA 2R5TA 3KN6A 3DKGA 4LUEA 4M12A 5ETAA 5LWMA 3G6GA 3SAYA 4CQEA 3BWJA 5AADA 2CKQA 3IQ7A 2WOTA 2DYLA 5EYCA 4ACCA 4EH2A 5I4NA 3EQHA 5BYYA 1QCFA 3EZVA 4F7JA 1JQHA 4YHTA 5KZIA 2ERZE 1OIYA 3TKHA 2JKMA 3FC1X 1NVSA 4BF2A 2BAQA 4GFGA 3NWWA 3KXHA 4FYNA 4GCJA 4GUEA 4AA4A 3RWQA 5A4CA 1YXVA 4JBPA 4QMQA 3UQFA 4F9CA 3KULB 4DEBA 4RJ7A 4FSRA 4ZTHA 3N4VA 3GCQA 4EONA 4O86A 1ZARA 1A06A 4KRCA 2VTSA 1UU7A 4CXAA 5BVNA 1WBPA 4O2ZA 4F1TA 3FLNC 3DTWA 3HP5A 3UQCA 5H2UA 3ZHPC 4M67A 3G90X 2Z60A 1VYWA 4NWMA 3Q5ZA 3QCYA 4IVAA 4O7SA 3FI4A 3FLSA 4WUNA 3KEXA 4G16A 2CGUA 4PPCA 4KD1A 4ZS4A 2ACXA 5CF5A 3AMAA 3PG3A 4OR5A 3UQGA 4Z9LA 4DFUA 2ITPA 3UPXA 4RRVA 4P2KA 5FGKA 2YERA 5FLFA 4OLIA 3E87A 4C3PA 4D55A 3U6HA 3FPQA 3RP9A 4F9BA 2P55A 2QC6A 4PRJA 3OW3A 4RZWA 3LFCA 4IWQA 3TI1A 5A54A 5AEPA 5I9ZA 2OG8A 5JGAA 3VC4A 2OF4A 4IB0A 5BMMA 2YDIA 3OHTA 5AV4A 2J0KA 3QKLA 2X81A 2YIWA 3Q3BA 4Y83A 3UNJA 3D5VA 5CAVA 3R0TA 2GS7A 2R0UA 3ZSGA 2JDTA 2GNHA 5CVGA 2W05A 4NW6A 3NUSA 4N6ZA 5BVKA 3SX9A 4O1OA 3DBCA 4BCFA 1PYEA 3IECA 3MGYA 4JAIA 2X4FA 3HMOA 4FYOA 1H28A 3OWKA 4MNEA 5EDQA 2PYWA 2W1FA 5FWKK 4CRSA 2YWVA 1KE9A 4J1RA 3ZZWA 1H4LA 2VGPA 2XK6A 3FPMA 4BI2A 4EOQA 3C5IA 2I6LA 4FUXA 4CCBA 1ZMWA 1H1PA 4QPAA 4P4CA 1UU9A 5HU9A 4M97A 3QD0A 4ALVA 1MQBA 5DI1A 4FEQA 3UMWA 5H8BA 1M14A 5DR2A 4OAUC 3FUPA 3QQLA 4MXCA 3KXNA 3MFRA 3VIDA 2JDRA 5JFXA 5BMSA 4FG8A 4I0RA 4PNIA 2F57A 3SW4A 2Y7JA 3KMUA 2Y8OA 4IWOA 2WTCA 5FDXA 4F65A 5JFWA 2OJGA 3CP9A 5FXQA 3BLQA 1REJA 3QTUA 3TWJA 5E1EA 4E73A 2VTNA 4S33A 3DKFA 3KL8A 3PE1A 1JAMA 1YHVA 1QPEA 4BL1A 2OJ9A 4KKHA 4PV0A 4AGDA 4CMOA 4ALWA 3NIEA 1Q3WA 3E3PA 4IAYA 4RJ5A 4TWCA 4CT2A 4AW0A 3OCTA 3I60A 4EKKA 2J51A 2ITXA 2XNGA 3QF9A 4QMSA 4NM0A 3D83A 3GOKA 4ZOGA 4JG6A 3FYJX 3MY1A 4JX3A 4JIKA 3R71A 5H8EA 1DI9A 1PKGA 2WMUA 4EL9A 3ORXA 2R3HA 5JEBA 5CT0A 2CCHA 5EM5A 4BZOA 3E8EA 3R9OA 4C61A 4TN6A 4YLLA 3H9FA 3UO4A 2EB3A 3HV3A 3VUKA 3OBJA 4D4YA 3F3TA 3UG2A 1Y6AA 1W98A 3LFDA 4GW8A 5CVFA 5KMMA 4BY9E 1WBSA 3UC3A 4DT8A 1OL5A 4AE6A 4K77A 4GSBA 1IR3A 3HVCA 4ZSJA 3TZ9A 3MN3A 3LLAA 4FTUA 4I23A 2BAKA 4ACHA 1OBDA 1YWRA 3DGKA 4TYJA 1YXTA 4F7SA 5AAEA 3ATTA 4MXAA 4GG5A 3HEGA 4U7ZA 4LOOA 5HGIA 3R04A 5BVOA 5EQPA 3GU6A 3ZM4A 2C3JA 4LL5A 3M1SA 1XH9A 4BCIA 3HMIA 3DAJA 4IX4A 2J4ZA 4RIWA 4U9AA 4A9UA 2WQNA 2PVYA 1H0WA 4HGSA 5FUTA 2VTTA 3F69A 3F82A 2RL5A 4GK4A 3ROYA 2YCQA 2J9MA 1M17A 5G6VA 4Z3VA 3HAMA 2IJMA 4GIIA 4L52A 5AA9A 5IISA 3LQ8A 3BGZA 5DRBA 4ANBA 3TL8A 5BQ0A 2OH4A 4B8MA 4BCKA 3DCVA 3OXIA 2WQOA 3HV4A 3ETAA 3DBDA 5CYIA 1U59A 3F3WA 3RBWA 3EYHA 4TYHB 3FMDA 2WEVA 1BYGA 4O81A 4WD5A 1OIQA 2X2MA 4MBLA 2QOQA 5FTGA 2JBOA 4JR7A 1WCCA 2ITOA 4ENXA 2ZB0A 4C34A 3I81A 3MVHA 4BDBA 3QC9A 5AP7A 4BZNA 4YLJA 2QOCA 2XM8A 5EG3A 2PMIA 2VTOA 3GCUA 4RMZA 3RALA 4NK9A 4EC8A 4D0WA 5JQ5A 5IF1A 2OWBA 4FMQA 2JKKA 4P90A 2PVKA 2RGPA 3MWUA 3KU2A 4BCQA 3CIKA 4HNFA 2QOKA 4BTMA 1F3MC 4DN5A 4F9YA 5JT2A 3H0YA 2J2IB 4AG8A 1YWVA 5DPVA 5KE0A 3F5PA 4TY1A 4DTAA 1XH5A 4OTWA 3WI6A 1J3HA 4A7CA 1IRKA 3CCNA 3NUAA 1KV2A 5CNNA 4BCMA 5LMKA 2XRUA 4BHZA 4EOIA 3EL7A 3VUDA 3FLQA 3CGOA 3R01A 4QP2A 3E5AA 5CI6A 3EQGA 4EBVA 5I9YA 3BE2A 4XG4A 3T3VA 2X9EA 2WXVA 5KMIA 4XRLA 3U51A 3Q4TA 4FKPA 4NM5A 4CKJA 4Y5QA 2GMXA 4FODA 3ZFYA 5C9CA 5CASA 5JH6A 2VWVA 3QYWA 4BICA 2BZIB 4YC8A 5IA3A 3UOJA 4AX8A 2CGVA 3QCXA 2OF2A 3UE4A 3FXZA 4FL2A 3E62A 3R8UA 4M15A 3PZEA 3TJCA 4D4VA 2WHBA 3EZRA 5I9XA 2HZ0A 3QZFA 4KB8A 5GHVA 5CU3A 3VBVA 1FGKA 3LJ1A 2CNUA 5HIBA 1FINA 1XH8A 2HZNA 1YWNA 5IQGA 3POOA 3ERKA 3COKA 3BGPA 4R5YA 4BTFA 3RKBA 5L2IA 3LE6A 3PJ8A 3ELJA 3LM5A 2XJ2A 4RX8A 3D5UA 3ZUVA 4NM3A 5F9EA 3VS7A 1XH4A 3NSZA 4ACGA 3OWPA 1UVRA 5DVRA 4O21A 2EXCX 3FZSA 5AUUA 4FTAA 4MD9E 3L8XA 4BYJA 4XH6A 4FEXA 2GS2A 3T8OA 4EQUA 2LGCA 4PMPA 2XIKA 5HVJA 4QYYA 4DEGA 2WMBA 3Q4ZA 4KIKA 2CN5A 4RC4A 1PYXA 3HV6A 5CSPA 2O5KA 3QTXA 4HOKA 3IPHA 4UWBA 2B4SB 4XV1A 4EQCA 3L9MA 1PY5A 3LXLA 2QO9A 4L3LA 2WTDA 4EH6A 2HXLA 2HYYA 5L8LA 3UYSA 2UZEA 3NS9A 3Q6UA 4EK5A 5HICA 2OSCA 4HYHA 4E26A 3F5GA 1V0BA 4IWDA 3WZUA 2UUEA 4XOZA 4M14A 4XG2A 4L9IA 3V51A 4FZ7A 3QQUA 3QTZA 2PVJA 5L2TA 3KB7A 1OPKA 2XNBA 1NVQA 3CTQA 3N9XA 1ND4A 4NL0A 3LLTA 5B2KA 4E3CA 1T45A 3FMNA 5D9HA 4FR4A 4AZVA 4E93A 3MFTA 4CD0A 5CZHA 1KE5A 4O7RA 1Z9XA 4APPA 4C02A 3DK3A 1H1WA 3KMWA 4TWNA 3K3JA 3QWKA 4AACA 4IWPA 4GVJA 1DAWA 5H9BA 4E1ZA 5C8KA 4CKRA 4OGRA 5IA5A 4J96A 2R3NA 2E9NA 1HOWA 4NT4A 1GIJA 5DE2A 4IJPA 3BHTA 4G3EA 4GEOA 3MESA 2UZVA 4G9CA 5DT4A 3ZC6A 3E8CA 3TACA 5IZFA 3QQGA 2OZOA 1YKRA 4X2KA 5EDPA 3RWPA 1Q62A 1RW8A 2J6MA 2PVNA 3AT2A 4W9XA 4F09A 3KA0A 5G1XA 4BIBA 1APME 4OTDA 1FBNA 1GNGA 5EKOA 3KGAA 2PVRA 2WTKB 3KVWA 3PXRA 3QALE 5CX9A 1K3AA 3BYVA 3HA6A 2YDJA 5AJQA 3S2PA 2QOIA 4FEWA 4DA5A 4I92A 4CMTA 3V8TA 3KQ7A 4J8NA 1J91A 3IDPA 2WTWA 2Z7RA 3PG1A 3QX2A 1OKYA 2JDSA 2QR8A 4RWLA 3NUUA 4RIOA 2XNPA 2JBPA 2UW9A 2XKEA 4I41A 4PDOA 2WOUA 3H9OA 4GJ2A 4FIJA 1DS5A 3U4WA 2W06A 3WZJA 2ITUA 3TUDA 4LGHA 4ITIA 3KF7A 4JT3A 4Q9SA 3CPBA 3MVLA 3O7LD 5DEWA 3PFQA 4H39A 2OLCA 4CGAA 4FKTA 2QURA 3FKOA 4AGUA 3KFAA 3D5WA 2QOFA 4FIIA 3E93A 4M8TA 5EW3A 3BX5A 3QFVA 5CEQA 4CQGA 1H0VA 4I4EA 5I9UA 3C7QA 5HO8A 3MV5A 5HE0A 1H00A 3RCJA 4UY9A 2PZPA 4UMUA 4CZTA 5J9LA 2OIBA 3V5LA 3BGQA 4TTHB 4OT5A 5AFVA 4I94A 1Y8GA 3JVSA 4FKRA 4EZ5A 4LOQA 5AR8A 3F66A 3R7UA 4O91A 4YNEA 2VWIA 4UEUA 5FTQA 4WHZA 2JFLA 2QD9A 3IKAA 3RAHA 5CI7A 5AM6A 3ZLSA 4W8EA 3TM0A 3VJNA 3WILA 4EJNA 3P1AA 2XKFA 4JJRA 3FLZA 4GH2A 3BHUA 4PX6A 3PY0A 5M57A 2ITQA 3VS0A 5AA8A 1OGUA 3HMNA 4YTHA 2WAJA 3OCBA 4U40A 4FKUA 4PP9A 4IJ9A 5H8GA 3KXXA 2OZAA 4NFMA 2BRHA 4WNOA 5CXZA 4V01A 4NH1A 5HX8A 1PRYA 1KUTA 2A19B 4WG3A 3B8RA 2Y4IB 2BDJA 4IX5A 5M55A 3ZUTA 3R7EA 5BX0A 3FZTA 4DGMA 4YJTA 5GNKA 4HCTA 4ZZOA 2VO7A 2Z7SA 3IW7A 4GT4A 4P5QA 4U3ZA 4DEHA 5AUTA 5LMKC 4IAFA 1K2PA 2A1AB 2OXDA 3TDWA 2ESMA 4TNBA 4HZRA 3S95A 4ACDA 4PY1A 1H8FA 5JKGA 3KVXA 1SZMA 1UNHA 3CBLA 1B6CB 3NNWA 4U44A 3H10A 3CXWA 2XIYA 4RX7A 3QU0A 5ANIA 2FSOX 3DT1A 4EH5A 3OXTA 5AR4A 5AUZA 2QKWB 3RPSA 4D2TA 5K0XA 4IE9A 2YM5A 2QHMA 4J71A 4WRGA 5JGBA 4TZRA 4PPAA 4MAOA 5E91A 2R7BA 3NW7A 2JEDA 5IQDA 2J90A 4IM3A 2Z2WA 4UWYA 3ZO1A 4BDIA 3HV5A 4ASZA 4Y95A 4GYIA 1KE8A 4NSTA 4IX3A 3R2YA 4GFMA 3RI1A 4D58A 3U8WA 4DH1A 4FTMA 3RZFA 5CEOA 5J5SA 2ZAZA 4FT0A 5A4QA 2BFYA 3VBYA 3DXPA 1ZXEA 1IA8A 2O63A 3PSCA 4FSUA 2FB8A 4UMQA 4YO6A 5CVHA 2VO3A 2G9XA 2ITNA 3E64A 4I21A 5EI6A 5L8JA 2C4GA 3QZIA 3DB8A 3GU8A 4CZYB 3I79A 2OH0E 4J97A 3H3CA 4JRNA 4B8LA 3NGAA 1O6LA 2UZLA 3AXWA 2UVYA 4WUAA 4XNEA 3L9PA 2XNMA 4QMTA 3WE8A 2GNFA 2REIA 3A7GA 5HNIX 2X4ZA 4CNHA 5IEXA 2ETMA 5CSVA 2YJSA 4HGEA 2NNWB 3PP0A 4H1JA 5LVPA 4U43A 4EOKA 3NEWA 4JBVA 3ANQA 4BDHA 5E8TA 2UW7A 2ZJWA 2EXMA 2CLQA 3VF8A 5EM7A 4QQCA 4MTAA 3OWJA 4EYMA 3OWLA 4R5SA 5CU2A 3SRVA 3UVRA 3THBA 5LQFA 3F3UA 4CKIA 1YRPA 2B9HA 4BGQA 3W33A 5E8YA 1J7IA 4YTCA 3GU7A 2NRUA 2AC3A 5ICPA 1ZYJA 3UP7A 2FO0A 4RQVA 2WO6A 4EOLA 4O7VA 4FEUA 1KOAA 4RPVA 1XH7A 3D9VA 1PXOA 2O64A 3TZ8A 1ZZ2A 3VW8A 1PXKA 3AOXA 3FZRA 3PIXA 4RLKA 4AQCA 5HBJA 3AT4A 5EHLA 1B39A 3OOMA 5IA0A 4MYGA 3WF5A 4R7HA 4KBCA 1MQ4A 3BYSA 3E7VA 3R7YA 3ZBXA 1TQMA 2OIDA 4QQTA 2I7QA 3MVJA 1K9AA 4M84A 3KCKA 3LOKA 5J5TA 4ANQA 3BEAA 2PE2A 4DGNA 3PDTA 3U6JA 1ZOHA 3EFWA 3ZSHA 3ZXZA 4NEUA 2F4JA 4CCUA 4CT1A 4BDAA 5KKRB 2XYNA 5EHYA 3DBEA 4YO4A 2CCIA 2V7AA 4UXLA 4D1ZA 1PXPA 2C6MA 3W2OA 3DFCB 3O23A 1KOBA 2UZOA 3ZOSA 4HJOA 4X3FB 5KKRC 3CTHA 1UA2A 4CFXA 3F3ZA 2CPKE 3L9NA 5D41A 2BDWA 5JGDA 5AR5A 4XRJA 4JDJA 2FSLX 2BRBA 4QMZA 4NKSA 4O83A 3MY5A 3R30A 3ORKA 4XG8A 4AFJA 2PSQA 3CY3A 2E2BA 4WBBB 2CKPA 3LXPA 2W9ZB 2ETKA 2Y6OA 3MS9A 3FKLA 5EOBA 2ZB1A 2PPQA 4NUSA 4RIYB 2B9IA 4BDFA 3DJ6A 5A3XA 2X6DA 5M53A 2C5OA 5EW9A 4HNIA 3FYKX 4ZSEA 4FNZA 4PDSA 4X2GA 2XMYA 1UWHA 3M42A 3PA4A 2C3IB 5CU4A 4RJ4A 5AWMA 2VV9A 2QOOA 3BLRA 1RE8A 4L53A 2W1GA 3ZBFA 4RFZA 3EYGA 1UKHA 4ANNA 2QCSA 1PMEA 4BIDA 1H1SA 4J52A 5D7VA 4R3RA 2AYPA 1MRYA 4XMOA 4L3JA 1MP8A 4B0GA 4DINA 4BRXA 1OKZA 3HDNA 3A99A 2UZUE 4QMWA 5CAUA 2R7IA 4DH3A 3FEGA 3NNXA 3QTQA 5DOSA 5ANJA 4ZLOA 4J98A 4G5PA 3UOKA 1M7QA 4H1MA 1GY3A 2J7TA 4ANOA 3BEGA 4A9SA 2BTRA 4BKJA 2PUIA 4RIXB 1WVXA 2ITZA 3R6XA 4F0IA 4F1MA 1L3RE 3KF4A 4AZFA 3QD3A 5KCVA 5LCJA 3PVBA 3RPYA 3I7CA 4M69B 4YJQA 3RGFA 4Z55A 2XIRA 1SVEA 4RWJA 5LMAA 1U5QA 3P86A 2W4OA 2G2HA 3HGKA 2GNGA 1ZRZA 4HGLA 3V3VA 3RAWA 3VUHA 4HVDA 3OW4A 4I22A 3K2LA 3HZTA 4I5HA 5CAQA 1H1QA 5IA2A 2C3KA 4O7YA 4FVQA 4DG0E 3BLHA 2Q0NA 1AD5A 3VW6A 4ZLYA 1B38A 1RQQA 4DCEA 3K5VA 3CQWA 4U41A 5AP2A 4CMUA 3O0GA 1XBCA 3POZA 4PQNA 3MB6A 5HEZA 3DZQA 3R1YA 3SDJA 3UOHA 5CF4A 3U54A 4ACMA 2PVHA 2RF9A 3HYHA 4IANA 3P4KA 2CN8A 3UIBA 1REKA 3VS2A 1OB3A 3FY0A 4J99A 2VTLA 4IW0A 4WBOA 2W99B 3R1QA 4FT3A 4UZDA 2ONLA 2WB8A 3LKMA 4FTNA 5BVEA 4UMTA 4PPBA 4BDCA 4LRKA 3VBQA 2QLQA 5DN3A 3SC1A 3Q52A 1TVOA 2C6DA 3BPRA 5HORA 3UIXA 3Q6WA 4YP8A 2ITVA 4FSZA 4USDA 2QODA 1GOLA 2R2PA 3HP2A 5EDRA 3UIMA 5A46A 3FZ1A 4JDIA 2QG7A 4FKVA 4FNWA 4FSMA 2VX3A 4OTPA 5AUWA 3U87A 2JFMA 5LVNA 4FSTA 2IO6A 4DEAA 4RT7A 1QPDA 2BPMA 4FL1A 1XR1A 4I24A 3OY1A 2RFSA 3P9JA 5KMOA 1YI3A 5IA4A 3L1SA 3UNKA 2XBJA 3QCQA 4U45A 4FEVA 4B9DA 3UODA 1S9IA 4I1ZA 3GGFA 2XIZA 4GRBA 4MXOA 4XBUA 4NIFB 3S3IA 3M11A 4XV9A 4TYGA 4RQKA 2X2LA 4IVCA 4S30A 4D1XA 4EOSA 3F88A 1SNXA 5F4NA 3QD2B 2Y9QA 2ZVAA 2WMVA 3MH3A 5CQWA 5FM2A 3TKIA 5HTBA 3FL4A 5FD2A 4U6RA 2KTYA 3AGLA 4L6QA 2X7FA 3NDMA 4O2PA 4CFVA 2GSFA 4U8ZA 3NVKI 2HY81 4F08A 4KWPA 1STCE 3DKCA 4CFMA 4RFMA 3SRVB 3FMJA 3ACKA 4CTBA 5CAPA 3U55A 3TZMA 3KRLA 1G8AA 2QU6A 3G2FA 4HVHA 3VRZA 2X1NA 3JYAA 5JN2A 3VS5A 4NU1A 2J5FA 2H8HA 2VTIA 2YA9A 2WQBA 2KULA 4JL9A 3E8DA 4C37A 2XNNA 3CS9A 4IM0A 4OBQA 5AMNA 2LAVA 4RA4A 3R7VA 2WMQA 3P7BA 3VN9A 1G8SA 4FTRA 3AC1A 3CQEA 3CE3A 4L67A 2XK3A 4ASXA 4QMUA 2V55A 3EB0A 1PXNA 2UW5A 4YSMA 3GENA 3W8LA 4FC0A 3LFNA 4CLIA 4RFYA 1JVPP 4FTCA 5DIAA 3S1HA 3HDMA 3L8SA 3WARA 2OXXA 3HUCA 2R3MA 5GJFA 2XCHA 3NIZA 4AFEA 3M2WA 3QTRA 2GHMA 2WQMA 4G9RA 4NTSA 3AMYA 4MBIA 4V0GB 5EM6A 5M09A 1OITA 4EK3A 5B7VA 4ITHA 5L2WA 3W55A 3CD8A 4ITJA 2IVVA 2QHNA 2HENA 3ZO2A 3G9NA 3CC6A 4QP7A 5KUPA 2ZM1A 2R9SA 3F2RA 2XB7A 2XCKA 4FKIA 4BIEA 2ZM4A 5D10A 2GTMA 4BCGA 2GPHA 2QOLA 4A4XA 4R1YA 3I5NA 3VVHA 3UBDA 4JXFA 1SNUA 5FM3A 3UVQA 2YDKA 3MYGA 1I44A 3QRKA 1H01A 2IG7A 1JPAA 1ZMUA 3GFEA 3Q60A 3Q9YA 3UPZA 3FKNA 5H3QA 3UGCA 3D2KA 2WTIA 4H58A 2A0CX 3HECA 1Q24A 1OPJA 2ZMDA 1VEBA 2FA2A 2ZV9A 4KUJA 2XBAA 3NAYA 2V22A 3DXNA 3NYNA 4FSQA 5LCKA 4FA2A 3Q9XA 3VUMA 5CZIA 2B54A 5AM7A 3DOGA 3VBXA 4TXCA 5IUHA 4GK2A 1U46A 2R3LA 3IDCA 3QRTA 4LV5A 3ZCLA 4DFYA 3EIDA 5C01A 4TL0A 4FZFB 3FMLA 2WQEA 3V5QA 5CY3A 1ATPE 4FE2A 4GUBA 3LFSA 2BMCA 4ZXTA 4QPMA 4R3PA 5EH0A 4MXYA 2ITYA 4PUZA 5ANGA 3WF6A 4II5A 4O0RA 4AZSA 4G31A 5CLPA 3PPJA 3G51A 3LAUA 3PXQA 4YZNA 3ZXTA 4BWPA 1ZLTA 3I0OA 1FOTA 3NYVA 4MD7E 2X2KA 4RBLA 5CEMA 4DE4A 2FGIA 3S0OA 3GCVA 2X8EA 4FOCA 4IHPA 5AV2A 4ERWA 4U79A 4MKCA 2BIYA 3DK7A 4APCA 5BVDA 2C6TA 5BNJA 4EH7A 2YZAA 2F9GA 2FH9A 3D7ZA 1Q8UA 4LGDA 1GZKA 3DY7A 4DGOA 1XJDA 3IONA 3PSDA 4MH7A 4E7WA 5HLPA 2BRGA 2XH5A 5E8ZA 3NR9A 3LQ3A 3DZOA 1QL6A 1KE7A 1A9UA 5K9IA 3MH1A 1OL1A 5ITAA 2XNEA 5I9VA 1IEPA 3Q2MA 3C51A 1LPUA 4BN1A 3VULA 2JD5A 3GU4A 2ZDUA 4BWXA 4EHEA 2GHLA 3PRFA 5HO7A 3PRIA 3RPRA 3VRYA 2W5HA 4N6YA 4QPSA 4RVLA 2ZMCA 4UB7A 5AP6A 5F20A 4BDDA 4F9WA 3VUTA 4ZLZA 3F6XA 2B1PA 1WMKA 3KXGA 3R7OA 2W1ZA 3OTVA 4A9YA 2ONLC 4MCVA 4F63A 2YZLA 2W4JA 4OUCA 3QC4A 2C68A 4U3YA 3T9TA 3GCSA 2BCJA 4U0IA 2JITA 2PWLA 2QO7A 2RIOA 3E92A 4OBOA 4E6QA 3GI3A 1VJYA 3ZS5A 4LFIA 4O96A 3LCKA 4L44A 4U80A 4FGRA 2P2IA 4YZ9A 4X2FA 2WTVA 3DDQA 3FV8A 3NVMB 2C6EA 3ALOA 4QQ5A 4QP6A 3TNWA 3TTJA 4EC9A 3HRCA 3U9CA 4C3RA 4XV3A 3ULIA 5CEKA 4E20A 3ZLXA 4UZHA 2GQGA 1YXSA 1BL7A 2C6IA 2P4IA 3UOLA 3SOCA 4CV8A 3HA8A 4PDYA 4YZBA 4QMXA 3PJCA 4AW5A 3R7IA 4RX9A 2B9JA 3QXPA 1XBAA 2VWWA 4EHVA 5IH6A 4B99A 3C9WA 1M7NA 2O65A 3TEIA 5LVOA 2VN9A 3FLWA 5FP5A 3BWFA 1P4FA 1Q3DA 1IG1A 4ZTMA 5E1SA 3SXRA 4ANSA 5CAOA 1YDTE 4E6DA 3PWDA 4IZAA 1OMWA 3BU5A 4BC6A 3O96A 4W4VA 3GNIB 4FOBA 4G1WA 3FBVA 3WE4A 5LJJA 1PMVA 3LPBA 4GG7A 4XBRA 4XG9A 5DFPA 3RJCA 4KKGA 2BIKB 2JKQA 5DT0A 4ENYA 1JKKA 2A27A 2VNWA 2PUNA 3DQXA 5E8XA 4WNMA 2F7ZE 5FEEA 4DFNA 1E1XA 1Z57A 2XKCA 3W2PA 3OCSA 3LVPA 5TKDA 3PTGA 3TV7A 2JLDA 4CTCA 2BRNA 1JLUE 3HV7A 3G33A 5HCZA 4FV7A 3ORMA 4FL3A 4BKYA 2ERKA 3CD3A 5B0XA 3C4WA 2FUMA 3EN6A 4LG4A 4DFXE 4G2FA 2R3FA 4RA5A 3TIZA 2JAMA 5M08A 5FBOA 3BU6A 4MNEB 3P78A 2V0DA 3JR1A 2NPQA 4NJ3A 4UWCA 3ZEPA 3QGYA 5GZ8A 2C5YA 2YCRA 4KS7A 2VTHA 2I0EA 4JI9A 4V04A 4C2VA 2WU6A 4K6ZA 5HOAA 3OVVA 1JSUA 5EOLA 1UU8A 5L6OA 1XO2B 2E9UA 4UV0A 4DFBA 4U5JA 5IQIA 4AT4A 1Y6BA 2C0OA 3TCPA 4E8AA 1JBPE 3COHA 3F5UA 5AV0A 2Z7LA 3AD4A 4ZMFA 3NX8A 2YISA 5J79A 1YI6A 3NUXA 2UZWE 4O7LA 3MTLA 2JDOA 3ANRA 4O0WA 4UN0C 3FC2A 2YHVA 4JQ7A 4V05A 3KN5A 5FG8A 3LFEA 2QONA 3BBTB 4IZ7A 1JKSA 2XUUA 5EI2A 4DTBA 4IADA 3ROCA 5HLWA 3BKBA 3FY2A 5KBRA 4L42A 4FG9A 3G0EA 1Q99A 5C26A 1WAKA 4JBQA 5GINE 4RVTA 4OBPA 1GZOA 1PW2A 5I0BA 3I7BA 3JY9A 3ORTA 4BGHA 3LMIA 4QRCA 3O17A 4FKOA 1RJBA 3NPCA 4P5ZA 3VQHA 5A4EA 5DMZA 4FT7A 2QG5A 2JKOA 3FSFA 4YGAA 1Q4LA 2XJ0A 3A61A 3R28A 2OO8X 4O0VA 2YM8A 4HYIA 3TIYA 4DLIA 3G15A 3CTJA 5IQBA 3ENMA 4G6OA 2ZDTA 3C4FA 5E9EA 3QKMA 5J8IA 3NRMA 4E4NA 3KXZA 3MW1A 1IAHA 5HX6A 3SVVA 4FKLA 1UWJA 2QLUA 2YAKA 3NW6A 4FG7A 4HGTA 3TTIA 1LP4A 3EL8A 4A4LA 4D2SA 5IEYA 1VYZA 2OIQA 3EMGA 3HL7A 5JRSA 5HG5A 2QOHA 3ZH8A 4AS0A 4RJ3A 5KHWA 3CPCA 3T3UA 4TRLA 5HKMA 3EWHA 4ZTQA 3JY0A 4BKZA 4FIHA 3EFJA 4RIWB 5L6WL 2J50A 4O7ZA 4BCOA 2WNTA 5K4IA 4JBOA 1L8TA 1CKIA 2G01A 2I0HA 5AUXA 3GXLA 4ARKA 4QNAA 3P7AA 1P5EA 3K54A 4MWIA 2BRMA 4QMOA 1EH4A 5D12A 5HU3A 3W2RA 3Q4CA 4D2WA 4HVGA 2C1BA 5I3RA 5IH5A 3OXZA 3W8QA 1OI9A 5DRDA 1PHKA 1GIIA 1WZYA 4AOTA 4O0YA 5J7HA 4L45A 3QA8A 2O2UA 3HLLA 4Y73A 5E92A 4YSJA 1R0PA 4GU9A 5HBEA 3NUPA 2XYUA 4DEDA 3NCGA 3CQUA 3PXYA 4ID7A 3COMA 2VRXA 2OGVA 4IAIA 2PVFA 4QYFA 4BHNA 4DG3E 3BHVA 5IQHA 2X8DA 3N4UA 4AZTA 4BBMA 5IQFA 5M4CA 5C03A 3RMFA 4C0TA 2GHGA 3CGFA 1HCKA 4IM2A 1OVEA 4FKSA 4BTKA 5KMJA 4I6BA 3QBNA 3O8TA 5JFVA 4MXZA 4QYGA 4IB3A 4S31A 3H4JA 5GJGA 3SD0A 1BI8A 2RFDA 3GQIA 3U4UA 3TZ7A 4PF4A 3PIYA 4FICA 4BTJA 4UYAA 4YC3A 5JSMA 4ZTLA 4DCAA 2NP8A 1FGIA 4XG3A 1YHSA 4YHFA 2VU3A 2F2CB 4Y85A 5TE0A 3AC4A 3PIZA 5HTIA 3AGMA 1SVGA 3BELA 4RC2A 4YUQA 1JWHA 3FL5A 2NO3A 5IUIA 1OL6A 4TT7A 1BL6A 3KXMA 3REPA 1TQPA 4BBFA 3PY1A 2Y0AA 3LCSA 3COIA 1KV1A 3AG9A 4LGGA 3IO7A 5B2LA 4C58A 5K5XA 4AGWA 3FHRA 3ZO3A 2ZM3A 4AN2A 4XV2A 3RHKA 3ZLWA 2XEYA 1X8BA 3GC7A 4KKEA 2WGJA 3FXWA 5EKNA 5HVKA 1CKPA 2C6OA 4PL5A 4F1OA 1U54A 5B2MA 4IVDA 4FVPA 4PDPA 2R3KA 3PLSA 4J95A 2VTMA 3QUDA 4I5PA 4IACA 3KCFA 5HO6A 1CSNA 5BPYA 4X0MA 2H34A 4LMNA 2W1DA 4KABA 3ZYAA 3AT3A 2HWOA 2UVZA 3F5XA 2OBJA 4FKGA 3SQQA 3WZEA 3ZRKA 4D28A 1CM8A 3HNGA 2P33A 4GJ3A 3AC8A 3LJ0A 5IDNA 4KSPA 5M4IA 3HRFA 5C4LA 1O6KA 1S9JA 3RCDA 4AF3A 3NUNA 4PL3A 4PTCA 1U5RA 1DM2A 3MSSA 3E63A 3R7GA 5AR7A 1WBVA 4TYIA 1PXJA 3ORZA 3IGGA 2OU7A 4IAKA 4KIKB 4C35A 4YJNA 4USFA 4XS2A 2W17A 2BUJA 3PVUA 4K33A 3SLSA 4C3FA 4ZY4A 4YPDA 5J7BA 4JIAA 2YM4A 3G0FA 5K3YA 5M07A 4C4EA 4E5WA 2Z8CA 3QTWA 1YXUA 3CEKA 2YITA 4FKJA 3TNQB 2OW3A 3EFLA 5KBQA 2E9PA 4MF0A 3MIAA 4D5KA 4EZ3A 2PUUA 3EOCA 5HLNA 1QMZA 3LMHA 3R00A
chains in the Genus database with same CATH superfamily
4UMRA 4MD8E 2QO2A 3TXOA 3VF9A 4UX9A 2VO6A 3IK3A 2IW8A 3BL7A 3VS3A 3W2CA 2BZKB 4IMYA 3WBLA 4PTGA 4BZDA 4Z7GA 3KK9A 4K1BA 4L43A 5CSXA 3V04A 4RWKA 3PVWA 4CFNA 4W8DA 3RPVA 4Q9ZA 3HAVA 4AOIA 3R8VA 4Z16A 1ZY4A 2CLXA 1M52A 4TWOA 2J0JA 4ANMA 4DEIA 4ZP5A 3QQJA 4XG7A 2XF0A 3SG9A 1OZ1A 2YM6A 5J95A 1M2QA 4ZTSA 5EQYA 5HVYA 2F2UA 3EQPA 1VR2A 3LXNA 3R73A 4IQ6A 5KZ0A 3ZEWA 1E9HA 4S34A 2VWXA 3ID6C 5HG9A 2GNJA 5DR9A 5IQAA 4QNYA 4FUYA 4FTTA 4ZY5A 2QNJA 1YW2A 3ULZA 3OUNB 4RJ8A 2HAKA 3PXFA 3TMOA 4AA0A 2C69A 3W32A 2C30A 3WF9A 4A07A 3BHYA 3FMHA 3FQSA 2EB2A 1AQ1A 3PXZA 3S4QA 5EI8A 4FZ6A 2VGOA 4Y5HA 3AMBA 2AUHA 3GC9A 2YAAA 4FTIA 1MRUA 5J1VA 4N0SA 5FP6A 1P2AA 4R3CA 2BVAA 3DDPA 3NUYA 4IXPA 4XUFA 2BKKA 3K3IA 4I6QA 2IWIA 1M2PA 3ODZX 2C5XA 2C47A 5AUVA 5A9UA 3R2BA 2PZIA 4RLLA 3OFMA 2PY3A 1R1WA 4HYUA 3WIGA 2XZSA 4YJRA 1WBTA 3C0GA 2HZ4A 3SHEA 4AW2A 4CYIA 4UBAA 3A7HA 4M68A 3EH9A 2A2AA 2W1CA 3QTIA 4HCUA 3VS6A 4D2PA 4NW5A 3IW5A 3KREA 4XP2A 1V1KA 2GFSA 4JVGA 3D7TA 4BDGA 3SA0A 3HMMA 4NCTA 2SRCA 3JVRA 5EYKA 5BYZA 4ERKA 1J1BA 5KMLA 4O82A 2QU5A 3R8MA 4D9TA 3PWYA 4R7IA 3BQRA 2WFYA 3W2SA 5IA1A 2UW6A 4WOVA 1OKWA 5IQEA 1KSWA 2CNQA 4CG9A 4WKQA 5AV1A 5ANDA 3CLYA 3E8NA 2CNVA 5HBHA 4OTIA 1J7LA 4IFCA 1ZAOA 3DPKA 4H36A 4Y8DA 5FXSA 3ZDIA 4HVIA 1Q61A 3NNVA 2C0IA 4GYGA 1IASA 4DFZE 4R77A 3KMMA 4XX9A 4GMYA 3OF0A 4P7EA 4ALUA 1NY3A 1Y8YA 2Q0BA 4CRLA 3DLZA 3ORLA 4DEEA 3L8PA 4EORA 3NW5A 1PXLA 2FYSA 2J0IA 3FI2A 4MNFA 4Q5HA 1HCLA 2G1TA 3ZFXA 3DNDA 3VQUA 1ZY5A 1VLRA 1G3NA 3QCSA 4G17A 3LCTA 2HZIA 5T68A 3UZPA 2PU8A 1UKIA 4BCPA 3QHRA 4LV8A 2VNYA 5F1ZA 4LMUA 5HE3A 4DGGA 2OZAB 4TNDA 4EH8A 3UO5A 1XHAA 4EUTA 4AAAA 2ZV2A 1ZOGA 4KAOA 5AAGA 5L6PA 5AV3A 5EQEA 1FPUA 4I20A 4C4HA 4DBXA 3F2AA 4MQ2A 5EYDA 3R9HA 3HX4A 1SVHA 2WTJA 3BIZA 3LFBA 4G3GA 2BTSA 3CJGA 4X3JA 3ZONA 4WSQA 5ETIA 4C4JA 5CEPA 3Q9WA 3LZBA 3V01A 2C6KA 3R8PA 5K5NA 2EUFB 4I4FA 3BYUA 2XK7A 3IW4A 2B7AA 4O0TA 3B2TA 5BV3A 4Q5EA 3EFKA 3FLYA 4LRMA 4FTLA 3ZFMA 5L8KA 4DTKA 3A4PA 5ETCA 4HYSA 5C27A 3LFFA 1JOWB 4WRSA 3V5WA 2PUPA 1BMKA 4BB4A 1G8JA 1P4OA 4MUQA 1XMMA 4FGBA 4MQ1A 5DR6A 3LCDA 4AE9A 3W0SA 2RG5A 5AP0A 4ASEA 2XNOA 4YTFA 4LOPA 4QO9A 4KSQA 2JAVA 5DA3A 4FSNA 4EH4A 2V7OA 3QRIA 4HZSA 4JLCA 4NZWB 3Q53A 4YBKA 4YR8A 3GOPA 4D4SA 5A6OA 4CLJA 3HRBA 2BR1A 3BYOA 3QAME 2YABA 4YJPA 3VWAA 2BZHB 2CSNA 1NXKA 3H0ZA 3KY2A 4RG0A 3EQRA 3W18A 4QD6A 2OK1A 1OKVA 2R3GA 3LFAA 4TYHA 3DJ7A 4HCVA 2IW9A 2VTRA 4X21A 2YACA 4EOPA 2BFXA 3A7IA 4EK4A 5CALA 5LARA 1UNLA 1DAYA 4L01A 5C4KA 3SKCA 4YURA 1FQ1B 4I93A 3QHWA 4HW7A 4KINA 2R3JA 2GU8A 5HQ0A 4AZWA 3EN4A 4F0FA 3A62A 2PZ5A 2GNLA 1Q5KA 3C4XA 4EHZA 3Q32A 4FJVA 4IDTA 3PPKA 2VTQA 4DHIB 4FF8A 1W84A 3R1NA 4XJ0A 3QA0A 4JG7A 4KA3A 3AC3A 4YZMA 2Z02A 2WMSA 3O71A 4IAAA 3TNIA 2PVMA 3WF8A 3GUBA 3FAAA 5TR6A 4QMYA 2IN6A 5DYJA 1KE6A 2Y6MA 3MY0A 4QP8A 4W4WA 4EWQA 2VTAA 2V62A 2QQ7A 3QZHA 3PY3A 4E6CA 3O50A 5HD7A 3TT0A 4FK3A 4MVFA 2XJ1A 2WKMA 4R6VA 4CFFA 1BLXA 3EHAA 3TDVA 2HXQA 2FSMX 3DBFA 3G5DA 3HKOA 5AX9A 2W1IA 3R8ZA 4GFOA 5TT7A 2UVXA 3TJDA 3WOWA 3D14A 4CV9A 3D4QA 3ALNA 4F6WA 5EYMA 2IW6A 4IC8A 2UW8A 4JAJA 5A4TA 3GQLA 3A8XA 4OTHA 4A9TA 2IPXA 3UTOA 2X7OA 4AXEA 2I40A 4TPTA 3C4EA 3WZDA 3DAKA 4C62A 4FNXA 4ZK5A 2R3PA 3BV2A 4WG4A 3SXSA 1G5SA 1WBNA 5A6NA 1ZYDA 3C4ZA 2ITTA 4U42A 4JDHA 2WIHA 3LXKA 4I0SA 3K5UA 3FQEA 3FE3A 4YJSA 1OPLA 3Q5IA 4I6HA 5AUYA 1TFFA 3BQCA 2R3IA 4USEA 3GB2A 3RK9A 3OP5A 2GDOA 5KNJA 1J7UA 4R7BA 2Z7QA 3V8WA 4LQMA 4G6NA 4OTQA 2BILB 4FV8A 1Y57A 2W1HA 1GZNA 5FTOA 4C4IA 4E4LA 5IPJA 3NCZA 3NLBA 4L8MA 3DJ5A 3OMVA 4L68A 4QQJA 3U6IA 4G3CA 3B2WA 4C38A 3FJQE 2I0YA 1ZMVA 4FVRA 3TNPC 3IGOA 1A48A 4QMVA 4XLVA 3D7TB 3JUHA 3NNUA 4S2ZA 4W9WA 1H08A 1OGYA 5JZJA 4RWIA 2G15A 4MF1A 4C33A 3P08A 3PSBA 3E7OA 3UZRA 2DQ7X 4YJVA 4XLIA 1PF8A 2B52A 2PK9A 4PMTA 1W0XC 2BDFA 2UW4A 4LM5A 3OD6X 4GS6A 4NM7A 4NCTC 3QQHA 3GVUA 4G3FA 4CFUA 5DLSA 1OUKA 2BHHA 2E9VA 4IVBA 3PVGA 4LL0A 3IW8A 4D9UA 4F4PA 2B55A 5D7AA 4D2RA 2CKEA 2PMOX 2F49A 3DB6A 4KBKA 3QXOA 4OTGA 1P14A 4KS8A 5E7RA 5AP1A 4GKIA 2OJJA 3R22A 4ZSAA 4XCUA 5KX8A 3EQDA 1XKKA 4D2VA 4JR3A 3C13A 5EHOA 4BI1A 5K4JA 4O7TA 3GCPA 1QPCA 3LW0A 3KRWA 5AIRA 2I1MA 2HIWA 4JS8A 3D5XA 3KIOC 4CFWA 2XANA 4AXAA 4CG8A 2UW3A 3R8LA 3AQVA 2VWBA 3IS5A 3IOKA 4K11A 3N4TA 4GU6A 4ZJJA 2EWAA 4QOXA 3UO6A 3C1XA 4W4XA 5IMXA 4LI5A 1XQZA 2R3QA 2YN8A 4AXDA 3RTPA 3E88A 2C5VA 2XP2A 4WNKA 3OC1A 4AN9A 4BDKA 3GFWA 4AU8A 2FVDA 4XYFA 2HCKA 2VWUA 5CENA 2IEWA 4I3ZA 4O27B 2IZSA 2RG6A 3MJ1A 4AT3A 4DITA 5JFSA 2QOBA 4EOJA 5C1QB 3DLSA 2H6DA 4UXQA 5GJDA 3ZU7A 2C3LA 2V5QA 4K0YA 4E4XA 4MEDA 3S00A 4YJOA 4QEBA 2HOGA 3PE2A 4ZTRA 4EZ7A 4JOAA 5C8NA 5J1WA 3FDNA 4ZAUA 4UMPA 4X6QC 4ZSGA 4IZYA 1V0PA 3RK7A 2OJIA 3C50A 4O7NA 4FIEA 4F70A 5ETFA 4EK8A 3BV3A 1ZYSA 1OL2A 5AP5A 5BVWA 1OECA 3OTUA 2VWZA 3P5KA 3V5TA 1BX6A 4AUAA 1JNKA 2OI4X 1FVVA 4FIGA 5TF9A 2QI8A 1H26A 1OM1A 3QUEA 4H3PA 2IVUA 4IBMA 3UZTA 3RNYA 3PYYA 1TKIA 4RVMA 4QMMA 4EI4A 5CT7A 4Y72A 4EYJA 5M56A 2WU7A 4QTAA 5AIKA 1Q8YA 4CEGA 2WD1A 5IH4A 1JKTA 1XH6A 3UC4A 1Y91A 4ZEGA 4BJJA 2WEIA 3ZSIA 3VUGA 5CANA 4FV4A 4O0UA 5BVFA 3G9LX 5M4FA 4XOYA 5HNGA 2CDZA 5J9YA 3W0MA 3UVPA 4N57A 3QRUA 3ZRLA 4QTEA 3ATSA 3I6WA 2PVLA 5HI2A 2QKRA 5AP3A 2YIRA 5L2QA 5JRQA 1ST4A 3BI6A 5M06A 1O6YA 3EQFA 3RZBA 4BCHA 1U4DA 4MX9A 1YDRE 4MHAA 3R9DA 4F7LA 3R21A 4EBWA 2XIXA 2YCFA 4J7BA 5TOZA 3II5A 4FKQA 5E8SA 2IZUA 3N51A 4I5MA 2WPAA 4FV0A 4AGCA 4BDJA 3SW7A 2RFNA 3O51A 3O8UA 2XK8A 3TN8A 3BYMA 3V8SA 1SYKA 1CTPE 1FMKA 3GU5A 3SG8A 3KK8A 5L4QA 1GZ8A 3ZLYA 4QYHA 4TW9A 4YJUA 3QLFA 1PXIA 4DHFA 5HD4A 2PZYA 3W10A 3LM0A 4XP3A 3OOGA 4EQMA 2YLFA 5A14A 2EU9A 4RC3A 3FI8A 1WVWA 3D0EA 3PJ2A 4KIQA 5CXHA 2BAJA 5DGZA 2JIIA 3ZZEA 4AZEA 3R83A 4BFMA 4ORKA 1RDQE 3F9NA 5CS6A 3PZHA 4LYNA 4QMLA 4QP4A 5EFQA 3MIYA 4ZY6A 4R78A 4R8QA 3WF7A 1W8CA 2YJRA 3U9NA 4F64A 2UZDA 4RJ6A 4D4RA 4JX7A 1ZOEA 4M3QA 3OZ6A 3EKKA 3AD5A 2CGWA 3L8VA 4H3BA 5AX3A 3FZPA 3WZKA 1E1VA 3DAEA 3DK6A 1OBGA 4I6LA 4O6EA 4B7TA 3W2QA 3AKJA 2PMLX 1H07A 3GEQA 2W1EA 3LMGA 4KIPA 3Q4UA 2GNIA 2UV2A 4N70A 4QT1A 4GT5A 4UALA 2UW0A 2XRWA 1LR4A 2IVTA 3ENHA 4JQ8A 5T3QA 2XK9A 4PMMA 4O38A 4IAZA 1V0OA 4KNBA 4DFLA 4DG2E 4KIOA 5DH3A 1Q8ZA 3CR0A 3DBQA 4FTQA 4YTIA 3UMXA 1QPJA 2WIPA 5BUIA 3AKKA 4AT5A 4YNOA 2DS1A 4FK6A 2O8YA 3TKUA 1URWA 5AR2A 4UYNA 3RNIA 4C57A 3ET7A 2F7EE 2HWPA 2XM9A 4QMNA 5GIPE 5DNRA 5HIDA 4JRVA 5AAFA 1NT2A 4G34A 2HK5A 5J87A 3OT3A 4TYEA 5FXRA 5CQUA 3VAPA 4BGGA 1LEWA 4DC2A 4PTEA 5IMEA 2C0TA 5IUGA 3FSKA 5M51A 2J5EA 5HG8A 3VHEA 3QGWA 1SM2A 3Q9ZA 2IVSA 3OBGA 2C5NA 4PWNA 3C5UA 2W5BA 4AP7A 3TNHA 5CTPA 4W4YA 3FMEA 4BVUA 2HW6A 3BE9A 3RM7A 5J9ZA 4M7IA 3H30A 1BUHA 2XS0A 5CWZA 1H27A 4FV1A 3C4CA 3CKXA 4WIHA 1ZZLA 3PJ1A 4E6AA 3DKOA 3MDYA 3ZO4A 1ZWSA 4XEYA 5HE1A 3H9RA 3OEZA 3ORIA 4FZDB 5EM8A 1KWPA 5HIEA 4ONAA 3QD4A 4GK3A 1FVTA 5L3AA 2PL0A 3BCEA 2NRYA 4BDEA 4L00A 3UDSA 3A60A 1W83A 2XA4A 3AC2A 3ITZA 3LFQA 3P23A 3B8QA 4K8AA 3EQBA 4O4EA 5HCYA 3BRBA 3RM6A 1W82A 3RPOA 1PXMA 5IQCA 1YXXA 3DFAA 1PMNA 4C7TA 3DNEA 5GZAA 4RX5A 5DBXA 2OFUA 5IU2A 4HPUE 5DG5A 4KRDA 3EQIA 2UZTA 5F94A 2E9OA 1R3CA 4AWIA 2X9FA 4X7QA 4CVAA 1WVYA 4K9YA 3O2MA 3CY2A 4EKLA 5CU0A 1CMKE 3UDTA 3QQKA 4FSWA 1R0EA 2VD5A 4YU2A 2PHKA 2HELA 2YFXA 3GBZA 3MFUA 2W9FB 3BBWA 5IG1A 3PLAE 3AC5A 4FSYA 1H25A 3QQFA 2GTNA 1Q8TA 1LUFA 2WMAA 5E8WA 3ODYX 3ZUUA 3FMKA 4QTCA 2WMRA 3TUCA 1PKDA 3I1AA 3RAIA 2R4BA 2I0VA 1O9UA 2OXYA 1F0QA 4X3FA 4L3PA 3VO3A 4L7FA 2WTKC 4BWKA 3ORPA 4C4FA 3O8PA 4JG8A 4FT5A 4NFNA 4EEVA 5L2SA 4PNKA 4C2WA 5ANEA 1MUOA 1NA7A 1ZYCA 2W4KA 4MK0A 2OICA 5HZNA 3DU8A 5JZNA 3F2NA 4OTFA 4IIRA 4E4MA 3FQHA 3D94A 4Y46A 2OFVA 2YEXA 4M13A 5DWRA 3ZDUA 1LEZA 1PMUA 2R3RA 3MPTA 4FV6A 3A4OX 3FMMA 4MXXA 3UNZA 4PP7A 3UYTA 1YOMA 4EUUA 5LOHA 3DTCA 5LMBA 3PP1A 2VZ6A 2BALA 4F99A 4F7NA 3IG7A 4HPTE 3W16A 4RIYA 2A4LA 3LQ5A 3RHXA 3RINA 3WIKA 5E8UA 4FV5A 2P2HA 3GC8A 5K0KA 3SV0A 2CGXA 2PTKA 4DF3A 4NKAA 3PPZA 2EXEA 1JSTA 3OT8A 2VWYA 2F7XE 5KHXA 4M66A 4QMPA 4CZUA 4C59A 4O6LA 3QL8A 1UU3A 1YI4A 2ITWA 2O0UA 2X6EA 1H1RA 3IW6A 4U81A 5CU6A 5FBNC 2QR7A 4O4CA 4B4LA 4E5BA 2RSVA 2WELA 3V5JA 3QYZA 2ZYBA 4BCNA 4KBAA 4RSSA 2W96B 4DHJA 4BI0A 4E5AX 3DQWA 3OY3A 2ZV8A 1URCA 2O3PA 4A4OA 3HMPA 2VTPA 4RIXA 5LXMA 1WBOA 2VAGA 4JNWA 5I9WA 2Q83A 5EW8A 3R9RA 2YM7A 3EQCA 5HHWA 2OKRA 2YIQA 4M69A 2BZJA 2VUWA 5BYLA 4S32A 4ANLA 3NAXA 4C4GA 4X2NA 4F0GA 4OAVB 3BU3A 5M44A 3P79A 3IDBA 4CSVA 1XBBA 2B9FA 4DDGA 4IC7A 4QTBA 3RVGA 4A9RA 2PULA 2XVDA 3W0RA 5CSWA 4WO5A 4IH8A 2P3GX 3P7CA 2X7GA 5JMSA 4GT3A 4O0XA 2R64A 3AD6A 3QX4A 2Y4IC 2JDVA 5F95A 5HESA 3W1FA 4NYEA 4A06A 4EK6A 1R39A 4YZCA 5IKWA 2B0QA 2ZOQA 4L7SA 4LRJA 1ERKA 3R63A 5HTCA 5ANOA 4WSYA 3PXKA 1M2RA 3ZM9A 4DBNA 3Q04A 3RAKA 1VZOA 4H3QA 3GC0A 4H05A 5D11A 3JPVA 4IB1A 3FI3A 5FEQA 4ASDA 4DT9A 1YDSE 1PJKA 4TWPA 4AN3A 2ETRA 1R78A 3MFSA 4IEBA 5CSHA 5AP4A 1J1CA 3E3BX 2JC6A 3NZ0A 3NYOA 1OIUA 4YMJA 5CF8A 5GIOE 4BYIA 3CSVA 1FVRA 5M4UA 2C6LA 5CF6A 3CJFA 3DA6A 1CDKA 2WZJA 1UV5A 3QWJA 4EOMA 3PUPA 3BHHA 3KULA 1Q41A 3D2IA 3V6SA 3LJ2A 3SXFA 3VNTA 4DH8A 5ACBC 2R0IA 4ZJVA 3QZGA 1H24A 4GVAA 3F7ZA 4JQEA 4K18A 3ZC5A 2PMNX 3F61A 4ZIMA 2JIVA 5DEYA 4NIFA 4AW1A 4ZZNA 3QUPA 5C8MA 2EVAA 2AC5A 3CKWA 4F6UA 5HG7A 4ZSLA 5GZ9A 1SMHA 3A8WA 4I6FA 4J8MA 4J53A 4FIFA 5FQDC 3LCOA 5T6KA 2VTJA 3VUIA 2CKOA 5E4HA 5KMKA 2QVSE 3KRJA 3MBLA 4C8BA 3VBWA 2PZRA 2RFEA 3P0MA 5ACKA 3UP2A 4EWHA 2R3OA 3OUKA 4ZTNA 3MH0A 4MBJA 3ACJA 4EH9A 3VJOA 1UNGA 4O4DA 5IDPA 1TQIA 4XHKB 1BI7A 1YQJA 4YBJA 4IDVA 3RK5A 4O7WA 4IFGA 4QP9A 4D5HA 3R02A 3QRJA 4RGJA 3V5PA 3O7LB 4D1SA 4G6LA 3EN5A 3PA3A 5IEVA 3NMUF 1W7HA 4EJ7A 4WG5A 2PE0A 5KO1A 5HCXA 1GAGA 3KC3A 1T46A 2J0LA 4Q2AA 4QTDA 4YPSA 1OL7A 3L9LA 1IA9A 3GP0A 3WYYA 3ZMMA 4EHGA 5A4LA 2GS6A 5ANKA 4QYEA 2CMWA 3UG1A 4YLKA 4YHJA 4GL9A 5LVMA 2PE1A 3W0NA 1FMOE 2P0CA 3PFYA 4DGLC 1GIHA 1JSVA 1IAJA 4FV2A 2B53A 4QP1A 1MRVA 1OIRA 3MB7A 2W5AA 4X2JA 3LHJA 3BZ3A 5DT3A 5I3OA 2YLEA 5HE2A 1NW1A 2Y4PA 2FSTX 3F7WA 4IX6A 2YIYA 3TUBA 2CHLA 2OJFE 5AR3A 2GQSA 1I09A 3PA5A 4PMSA 4LUDA 3V6RA 3MPAA 4O22A 1F5QA 3ORNA 4V0GA 2YIXA 3Q96A 4FKWA 3UIUA 4D0XA 5CEIA 3KKVA 4DH7A 4YZDA 3IOPA 2X8IA 3NYXA 3TV6A 4HVSA 2BHEA 2WMTA 2W7XA 5DHJA 2IF8A 2YM3A 2WMXA 4R1VA 4PL4A 2CJMA 2G2FA 4BCJA 3EN7A 1YOLA 1Z5MA 5HNBA 4ZJIA 2X0GA 3SGCA 4ZS0A 4NJDA 3HUBA 4M0YA 3I4BA 3MH2A 4DH5A 2G2IA 3MA3A 4OTRA 1Q97A 2C1AA 3OG7A 3VHKA 3A2CA 5I5ZA 4AOJA 3I6UA 5EK7A 5LWNA 4DLJA 2XK4A 3OS3A 4JDKA 4X3FC 1JKLA 4IZ5A 2VX1A 3KRXA 3OROA 1YVJA 3MVMA 4Z7HA 5E8VA 4YC6A 2BKZA 2DWBA 2GFCA 2HW7A 3GT8A 3LIJA 4FTOA 5D1JA 2HY0A 2X0QA 3QTSA 2JIUA 4BBEA 3Q2JA 2JGZA 1BKXA 1WFCA 2XEZA 4FV9A 4WNPA 4EOOA 4RZVA 2YCSA 4OW8A 3WYXA 2DUVA 3MI9A 3OCGA 4F6SA 2UZNA 3MA6A 2RKUA 3ZTXA 3QLGA 2IZTA 4OT6A 3DXQA 4O0SA 4FNYA 4DAWA 2J0MB 4I0TA 3VS1A 2IZRA 1DI8A 2GCDA 2VO0A 3VBTA 3A7JA 5JQ8A 4NTTA 4O84A 4BR3A 1ZYLA 3DS6A 4I5CA 4XP0A 1NVRA 4MWHA 1GJOA 4FX3A 4WT6A 3T9IA 2XKDA 1WBWA 3UJGA 3EJ1A 3EN9A 2H9VA 4CYJA 2H96A 4TKSA 3C0HA 3FHIA 4WA9A 3R9NA 4B6LA 3JXWA 2WMWA 4GKHA 1CKJA 3ZRMA 4F9AA 4N4SA 4FTKA 3FXXA 4FV3A 4XG6A 3D15A 3MTFA 3JS2A 4M0ZA 5TO8A 3VS4A 3TG1A 4DYMA 1YOJA 4L46A 3PJ3A 1U54B 3KRRA 4IB5A 3OEFX 3R1SA 3UDBA 3DV3A 4FZAB 4K2RA 2BROA 4FT9A 2ZV7A 1Q8WA 1AGWA 3C0IA 4QP3A 3QKKA 5LVLA 4G3DA 2W0JA 3A7FA 4X6RA 5CNOA 4ZZMA 4FI1A 4GIHA 5BUJA 3MPMA 4FTJA 3EKNA 4GV1A 5KMNA 1OUYA 4FBXA 5BUEA 4ZMEA 3I0QA 2GQRA 3G6HA 3FWQA 5FRIA 3MJ2A 5FEDA 4AA5A 3F3VA 4EH3A 5E90A 1XWSA 2X39A 2VX0A 3FZOA 4U97A 3TV4A 3I5ZA 4G5JA 4O1PA 3SOAA 4RVKA 3AKLA 5FDPA 5JK3A 1YHWA 2YWPA 2UZBA 2R5TA 3KN6A 3DKGA 4LUEA 4M12A 4O4FA 5ETAA 5LWMA 3G6GA 3SAYA 4CQEA 3BWJA 5AADA 2CKQA 3IQ7A 2WOTA 2DYLA 5EYCA 4ACCA 4EH2A 5I4NA 3EQHA 5BYYA 1QCFA 3EZVA 4F7JA 1JQHA 4YHTA 5KZIA 2ERZE 1OIYA 3TKHA 2A98A 2JKMA 3FC1X 1NVSA 4BF2A 2BAQA 4GFGA 3NWWA 3KXHA 4FYNA 4GCJA 4GUEA 4AA4A 3BLAA 3RWQA 5A4CA 1YXVA 4JBPA 4QMQA 3UQFA 4F9CA 3KULB 4DEBA 4RJ7A 4FSRA 4ZTHA 3N4VA 3GCQA 4EONA 4O86A 1ZARA 1A06A 4KRCA 2VTSA 1UU7A 4CXAA 5BVNA 1WBPA 4O2ZA 4F1TA 3FLNC 3DTWA 3HP5A 3UQCA 5H2UA 3ZHPC 4M67A 3G90X 2Z60A 1VYWA 4NWMA 3Q5ZA 3QCYA 4IVAA 4O7SA 3FI4A 3FLSA 4WUNA 3KEXA 4G16A 2CGUA 4PPCA 4KD1A 4ZS4A 2ACXA 5CF5A 3AMAA 3PG3A 4OR5A 3UQGA 4Z9LA 4DFUA 2ITPA 3UPXA 4RRVA 4P2KA 5FGKA 2YERA 5FLFA 4OLIA 3E87A 4C3PA 4D55A 3U6HA 3FPQA 3RP9A 4F9BA 2P55A 2QC6A 4PRJA 3OW3A 4RZWA 3LFCA 4IWQA 3TI1A 5A54A 5AEPA 5I9ZA 2OG8A 5JGAA 3VC4A 2OF4A 4IB0A 5BMMA 2XALA 2YDIA 3OHTA 5AV4A 2J0KA 3QKLA 2X81A 2YIWA 3Q3BA 4Y83A 3UNJA 3D5VA 5CAVA 3R0TA 2GS7A 2R0UA 3ZSGA 2JDTA 2GNHA 5CVGA 2W05A 4NW6A 3NUSA 3UDZA 4N6ZA 5BVKA 3SX9A 4O1OA 3DBCA 4BCFA 1PYEA 3IECA 3MGYA 4JAIA 2X4FA 3HMOA 4FYOA 1H28A 3OWKA 4MNEA 5EDQA 2PYWA 2W1FA 5FWKK 4CRSA 2YWVA 1KE9A 4J1RA 3ZZWA 1H4LA 2VGPA 2XK6A 3FPMA 4BI2A 4EOQA 3C5IA 2I6LA 4FUXA 4CCBA 1ZMWA 1H1PA 4QPAA 4P4CA 1UU9A 5HU9A 4M97A 3QD0A 4ALVA 1MQBA 5DI1A 4FEQA 3UMWA 5H8BA 1M14A 5DR2A 4OAUC 3FUPA 3QQLA 4MXCA 3KXNA 3MFRA 3VIDA 2JDRA 5JFXA 5BMSA 4FG8A 4I0RA 4PNIA 2F57A 3SW4A 2Y7JA 3KMUA 2Y8OA 4IWOA 2WTCA 5FDXA 4F65A 5JFWA 2OJGA 3CP9A 5FXQA 3BLQA 1REJA 3QTUA 3TWJA 5E1EA 4E73A 2VTNA 4S33A 3DKFA 3KL8A 3PE1A 1JAMA 1YHVA 1QPEA 4BL1A 2OJ9A 4KKHA 4PV0A 4AGDA 4CMOA 4ALWA 3NIEA 1Q3WA 3E3PA 4IAYA 4RJ5A 4TWCA 4CT2A 4AW0A 3OCTA 3I60A 4EKKA 2J51A 2ITXA 2XNGA 2XAMA 3QF9A 4QMSA 4NM0A 3D83A 3GOKA 4ZOGA 4JG6A 3FYJX 3MY1A 4JX3A 4JIKA 3R71A 5H8EA 1DI9A 1PKGA 2WMUA 4EL9A 3ORXA 2R3HA 5JEBA 5CT0A 2CCHA 5EM5A 4BZOA 3E8EA 3R9OA 4C61A 4TN6A 4YLLA 3H9FA 3UO4A 2EB3A 3HV3A 4C36A 3VUKA 3OBJA 4D4YA 3F3TA 3UG2A 1Y6AA 1W98A 3LFDA 4GW8A 5CVFA 5KMMA 4BY9E 1WBSA 3UC3A 4DT8A 1OL5A 4AE6A 4K77A 4GSBA 1IR3A 3HVCA 4ZSJA 3TZ9A 3MN3A 3LLAA 4FTUA 4I23A 2BAKA 4ACHA 1OBDA 1YWRA 3DGKA 4TYJA 1YXTA 4F7SA 5AAEA 3ATTA 4MXAA 4GG5A 3HEGA 4U7ZA 4LOOA 5HGIA 3R04A 5BVOA