1OB3A

Structure of p. falciparum pfpk5
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
286
structure length
277
Chain Sequence
MEKYHGLEKIGEGTYGVVYKAQNNYGETFALKKIRLEKEDEGIPSTTIREISILKELKHSNIVKLYDVIHTKKRLVLVFEHLDQDLKKLLDVCEGGLESVTAKSFLLQLLNGIAYCHDRRVLHRDLKPQNLLINREGELKIADFGLARAFGIVTLWYRAPDVLMGSKKYSTTIDIWSVGCIFAEMVNGTPLFPGVSEADQLMRIFRILGTPNSKNWPNVTELPKYDPNFTVYEPLPWESFLKGLDESGIDLLSKMLKLDPNQRITAKQALEHAYFKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CELL DIVISION CONTROL PROTEIN 2 HOMOLOG
publication title Structures of P. Falciparum Pfpk5 Test the Cdk Regulation Paradigm and Suggest Mechanisms of Small Molecule Inhibition
pubmed doi rcsb
source organism Plasmodium falciparum
molecule tags Transferase
total genus 77
structure length 277
sequence length 286
chains with identical sequence B
ec nomenclature ec 2.7.11.22: Cyclin-dependent kinase.
pdb deposition date 2003-01-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 1ob3A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 1ob3A01
2HW7A 1ZXEA 4FIHA 1L8TA 4EH8A 3SXSA 1AD5A 3TJCA 2X9FA 2Y4PA 1MQBA 3MDYA 1BYGA 2QR8A 1YXUA 5D9HA 4RQVA 2XNEA 3DXPA 5IEYA 2WTCA 2Y8OA 4G5JA 3E3PA 3EQFA 3E92A 3H4JA 3MS9A 4D9TA 4RLLA 2WKMA 3GC0A 2BCJA 5DE2A 2R2PA 2WOTA 4G5PA 3C1XA 3KN5A 5AUWA 2PE0A 4TWPA 3TI1A 3KK8A 4UMRA 3UJGA 1Q99A 4XOYA 4P5ZA 1FMKA 2NP8A 1WBWA 2Y6MA 3EFKA 3QHRA 3SQQA 1UWJA 4JDJA 4ACHA 3NUPA 3KCFA 4E3CA 4K11A 3G90X 4F7LA 5AR3A 2J50A 3O96A 5CLPA 4OBPA 3LVPA 4GS6A 5FDXA 1SMHA 4PDPA 3ZLSA 4Z9LA 3HMPA 2RIOA 4UBAA 4L44A 2HZ4A 3E7OA 4HYUA 4IWOA 3UMWA 4G6LA 4RVKA 2YDJA 4IVDA 3PRIA 2CLQA 2PVKA 4GKIA 5IA3A 3VUMA 4U41A 4X2GA 3E63A 5F4NA 3BLRA 4YTIA 2A0CX 5I0BA 2VN9A 3FI3A 3HV4A 3OCBA 3T3UA 5IQHA 4IB1A 5AP4A 2BDJA 2JAVA 4FK6A 3ZSHA 4W9WA 3ZLWA 2B7AA 2WQNA 2A19B 4AE6A 5E8WA 3ZO2A 4C35A 1XH6A 4L01A 4HYIA 3TTJA 3ZLXA 5KMKA 4DG0E 1J7IA 4OTGA 3ZM9A 4CFXA 4G3CA 4TNDA 5JFWA 2JKOA 2WTVA 1VJYA 4U6RA 5BNJA 3RAKA 4OAUC 5FD2A 1KE7A 4CFWA 2WMRA 2XNGA 4JI9A 4QTCA 4TXCA 3HX4A 5C26A 4BZDA 4O7WA 4J8MA 4EUUA 4MNFA 4O7TA 1ZMWA 4QMWA 1Y91A 5HE3A 4CQEA 5IQBA 5HORA 3FJQE 3V6SA 1FGIA 3B2TA 3PWYA 5DIAA 4MTAA 4K18A 3QD0A 4E4LA 4CLIA 4RJ7A 3VQHA 4U9AA 3RALA 5CAQA 2GNIA 2CGXA 3R8MA 2VRXA 4YJPA 2O65A 2W96B 2XIKA 4BKYA 4X2NA 3R7IA 3MIAA 1JVPP 1S9IA 3F9NA 3OBJA 5KCVA 3TIZA 1FQ1B 4FKIA 2BROA 5CF6A 5IUHA 3FKOA 4FEUA 4IAZA 4M69A 4CV8A 2YIXA 3H0ZA 4FSMA 2W0JA 3LCDA 4NUSA 4OT6A 4CSVA 4F9YA 3F88A 5A4EA 5AA9A 4L52A 4V0GA 1KUTA 4CZUA 3M2WA 2UZNA 3ZONA 4AN9A 5KUPA 3D9VA 3GVUA 4NW6A 3WBLA 1XH9A 4B99A 3PXKA 3LCKA 2PZ5A 3DU8A 4A4XA 4YJNA 4BI1A 3LFDA 3VW6A 3NUAA 5M08A 1J1BA 2C47A 2VWUA 2P3GX 5EM6A 2XBJA 4BDHA 3CSVA 3E8NA 4FKUA 4G3FA 4O96A 2GU8A 2JIVA 3EKKA 3OTUA 2PPQA 4RX9A 4QMXA 4ANBA 3OUKA 2IW6A 4JJRA 5CF5A 2PMNX 2H34A 2J4ZA 3D7ZA 4ACGA 2WQOA 1M2PA 1ZZLA 4AW5A 4DH3A 5GIOE 2JKQA 2QOHA 3IQ7A 1ZYLA 5AP6A 1Q41A 2C6OA 3O51A 2X7GA 5M09A 4CYIA 2PVFA 4FOBA 4Q5HA 2JDVA 3PVGA 4OBQA 5ICPA 3R7VA 3AT3A 5JGAA 5CVFA 4ALVA 1PMEA 2PMOX 3PIYA 4HCVA 4YNEA 5CF4A 1W82A 2OFUA 2ZV9A 3GU6A 2UZDA 3MH1A 3QC4A 4FTJA 4ZAUA 4M68A 4BZOA 2JC6A 3ZM4A 5EQEA 3NPCA 4FICA 4NKAA 2RGPA 3E5AA 5JMSA 2XK9A 3R7GA 4FOCA 1PJKA 1REKA 1PXKA 4PTCA 3R73A 2VO3A 1UVRA 3C9WA 4EONA 3FXZA 4AZWA 2GHLA 1SNXA 3RM6A 4QRCA 4FTMA 2FYSA 4YC6A 4U5JA 4TYGA 3W2QA 3TNQB 4CTCA 2WTWA 3LFQA 3F2NA 4GCJA 2YLEA 2PUUA 4BCNA 4PV0A 3QF9A 1U54B 5A4QA 1KE8A 4IZYA 4CNHA 3TDWA 1PKGA 3CCNA 2BZJA 2QU6A 3D0EA 3MY1A 1CTPE 2EWAA 4PUZA 1GZKA 2QG5A 5AM6A 2FVDA 1O6LA 3RMFA 1BX6A 2HY0A 4BCPA 4G31A 4KIKA 4E6DA 2PU8A 4GIIA 1ZRZA 4FYOA 4BBEA 4EC9A 5HX8A 3UO5A 2ITYA 3F3VA 2CGVA 3QCQA 2WTIA 4TWNA 4BCFA 2XM9A 1IEPA 3MA6A 5A6OA 1LPUA 2I1MA 4DEDA 5ACKA 3HRBA 3F3TA 1WVYA 4J95A 5AP5A 3FZOA 3ZEWA 5HIEA 5IEXA 4PNIA 3BPRA 4WNOA 4F1TA 2VO7A 3DS6A 2GQRA 4K0YA 3F3UA 3NYOA 4OW8A 4QYFA 1J91A 3DAEA 5IF1A 4D5HA 3QA0A 3GENA 4J71A 4UALA 4DGGA 2OJGA 5H8BA 2CCIA 4M13A 3VHEA 3F2AA 4A9UA 3TKUA 5CSHA 2OF4A 3MY5A 3BIZA 2W5BA 4ZLYA 3W2SA 4ITHA 4MNEB 3BGZA 2XK3A 4I21A 4EK3A 4DFLA 3I81A 3KF4A 4KB8A 3UOKA 4BFMA 4QP6A 3BYOA 1YWRA 4E4XA 4MYGA 3GFEA 2C5VA 1XO2B 4IDTA 3W55A 3BZ3A 5AR4A 3PY0A 2R64A 3TKHA 3LCSA 5CANA 4R1VA 4EOLA 3KRJA 5CAUA 1NVRA 5C1QB 2C5XA 2YAKA 2GHGA 2J51A 4IB3A 5FWKK 4ANLA 5KBQA 1IRKA 2ITPA 3NUNA 2YAAA 5KX8A 5JGDA 3CQUA 3BYMA 4QMLA 3TZMA 4GG7A 5EFQA 3EHAA 4D2TA 2B1PA 3KXNA 3QZIA 3R1NA 4NZWB 4KKHA 2F2UA 2J5FA 4BI2A 2WQEA 4JDIA 3F66A 4QTEA 2ZDUA 3V3VA 4JRNA 3EOCA 3II5A 3PJ8A 4BCKA 4IWQA 2ERKA 4WOVA 4EK4A 3NIZA 4FKTA 2B53A 1TVOA 3FQSA 2ZB0A 3PIZA 4ITJA 4K6ZA 4EUTA 4GH2A 4XRJA 1OITA 2ZJWA 2OJJA 4HPTE 5EM8A 4BCJA 5JFSA 2W4KA 3AT2A 5C8MA 1H1PA 4DH8A 1KSWA 2C6KA 3QUEA 4IHPA 2J2IB 4IC7A 3RNIA 3OZ6A 4I0SA 3SA0A 3KQ7A 1OL2A 4RA4A 3ZOSA 3A60A 3K54A 3CLYA 3QCSA 4J1RA 4RFYA 4XH6A 3UYTA 5C8NA 4Y5HA 2W1EA 2O3PA 4ZLZA 3FZTA 4BDDA 1R3CA 2ETMA 4FV8A 4G2FA 4ANOA 3WIGA 3P08A 4DE4A 4FSQA 4K1BA 4RFZA 3VC4A 3KU2A 4O21A 3IG7A 4BF2A 4EHGA 3DLZA 2WTKC 2WIPA 4X21A 3MVLA 4YHJA 3RP9A 3ZC5A 1Y57A 3LFSA 4IMYA 2I0YA 3AD5A 4S30A 1W98A 2QQ7A 3NUSA 3QKKA 3H3CA 3NX8A 3PIXA 4C3RA 1UNHA 2BALA 3AC4A 4JXFA 4D4SA 3QRKA 4LGDA 1REJA 5E1EA 4YO4A 2WHBA 3QCYA 3U9NA 4BTMA 5FM3A 3ORZA 3DAKA 3N4TA 2BHEA 1BKXA 3DNDA 5CSVA 2X8EA 2W4JA 3DZQA 1R1WA 2WMBA 1UV5A 1VYZA 4RLKA 2IZRA 2WIHA 3DBEA 4XP3A 4C37A 4NH1A 2R3FA 2V22A 3OCTA 4P5QA 3WE4A 3L9MA 3P86A 3V8SA 3E93A 3I60A 4FIFA 1Z9XA 2CJMA 3QL8A 1SYKA 1V1KA 4L3JA 3DFAA 4XLIA 2OZOA 3V04A 4JRVA 2W1GA 5ETCA 4BDFA 5DNRA 3MIYA 3I4BA 1M17A 1KE9A 1ZYJA 5D10A 3UZTA 4OAVB 5IQEA 4XNEA 4PDOA 3GNIB 5CU6A 2JFMA 4UMPA 3UGCA 4BICA 4U97A 1APME 5ANGA 4FV9A 3T3VA 3AMBA 2C1BA 4Y95A 3SRVA 2ZMCA 2YM3A 2P0CA 5EDPA 3PA5A 3R8VA 3FMEA 4MEDA 2IN6A 2R3QA 3DZOA 4J8NA 4DCAA 1YDSE 3FC1X 4KIQA 3VUIA 4F0IA 4EK5A 1YXVA 1A48A 1OIQA 2GNFA 4GVAA 3BU3A 4OLIA 4OR5A 5KBRA 2ETRA 4S32A 4FMQA 3C4CA 2C0OA 1DM2A 4IFGA 4GT5A 3RK9A 4BDCA 4DFBA 4NTTA 2C5YA 2ZV7A 4HYSA 3FL4A 4QQ5A 4O0TA 2W5AA 4QP9A 4V01A 2PVMA 3SDJA 1EH4A 2XKDA 3P7AA 3MH2A 3QTUA 5HVYA 3W16A 3DKCA 4GK4A 2XIZA 3TV4A 3A7JA 4FI1A 4IZ5A 4U8ZA 4O0WA 3EFWA 1LUFA 3DOGA 4FK3A 4JR7A 2X8DA 3GXLA 2O64A 5IMEA 2CNUA 2VTLA 1MRUA 1XHAA 4R5YA 5FBNC 4DITA 2H96A 2GNHA 4FZFB 1M2RA 3DK3A 4RMZA 4U3ZA 2XKFA 3LJ1A 4TY1A 2RF9A 4PMMA 4W8DA 4ZLOA 3UNJA 3UOLA 1XH8A 4IX5A 4I94A 4PTEA 2JD5A 2XEZA 4MBLA 3PVWA 5DLSA 2AYPA 3FSFA 3LJ2A 3PZEA 3R63A 4E93A 2CNQA 2JKMA 2V5QA 4DAWA 2QLUA 4D0XA 3OVVA 5BVOA 4RJ4A 4O81A 4KKEA 5GJDA 1BI8A 2QVSE 3EN4A 4MVFA 4D4VA 5GNKA 5BMSA 4KWPA 5E90A 3NUUA 3FLNC 4PP7A 3UG1A 3VS0A 4F7NA 3HP2A 5IKWA 2VAGA 4A9SA 2NNWB 1PXPA 3RNYA 2YFXA 5HCYA 3SVVA 4HZSA 2WTJA 4M7IA 3EN9A 4L68A 5CI7A 3DV3A 3P9JA 4JX7A 3FXWA 3ZBXA 3QBNA 4WT6A 2Z7RA 3PE2A 3UVQA 4ZTMA 4DH1A 3EZRA 3BHHA 2LGCA 2O0UA 4PMPA 4C4GA 4KKGA 2WD1A 3MJ1A 4FEQA 1KOBA 2XCHA 2OK1A 4KBAA 5JEBA 1VEBA 3UG2A 3D14A 2B9IA 1IG1A 4GT3A 3LCOA 2F2CB 4BDKA 4EOJA 4F9BA 3HA8A 4MWIA 4CEGA 2V55A 1NW1A 4LL0A 4GUBA 4R6VA 3U8WA 4R78A 3TT0A 3AT4A 3CPCA 4ASXA 1GJOA 4EKLA 4OBOA 2BFXA 5AV3A 4M3QA 4I6FA 4YJQA 4DGLC 2DWBA 5HESA 4RT7A 3RHXA 5J5TA 3TTIA 4C4HA 4FTAA 3EZVA 2X1NA 3MVMA 3IS5A 5KZIA 4V05A 1Q4LA 5DG5A 3RWPA 4HCUA 3W18A 4YNOA 3ZUTA 4BKZA 4QOXA 3U6HA 3LFNA 2IZUA 2BILB 4FTLA 2B9JA 2UZWE 3P78A 3FMMA 1CKJA 4I3ZA 4RX8A 3OMVA 3G33A 2CMWA 4LG4A 3DA6A 1H27A 3I0OA 4ARKA 1YW2A 4GL9A 3KRXA 4ANNA 4JBPA 5CVHA 1E9HA 3WZDA 4LUEA 2XP2A 3NR9A 4YZBA 2JFLA 3DLSA 4F6WA 3O8UA 3ZXZA 1IAJA 3A7FA 4EEVA 3JR1A 5AP7A 5EDQA 1H0VA 3QLGA 5HG8A 3KN6A 1WBPA 3PWDA 4FT5A 2QC6A 4FV4A 4JIKA 4KBKA 2ITVA 4I5HA 4QT1A 3MGYA 4O0YA 1PXNA 4PMTA 2B0QA 3D5XA 4M66A 5E91A 2XKCA 3R7YA 3VN9A 4BYJA 5HG9A 5CEKA 2PSQA 4I5MA 2GQGA 4AF3A 2RFEA 3ALOA 3BV3A 3F3ZA 4LOPA 2X39A 5T68A 3BBTB 3KC3A 4FIEA 4I4FA 2VTHA 3DKGA 3NAYA 4K2RA 4LQMA 2CDZA 2BTSA 2OZAA 4C7TA 3L9LA 3QX2A 3C5IA 2EXCX 3Q9WA 3F2RA 3DDPA 4ZSJA 2BDWA 1T45A 3FL5A 3A2CA 4AN2A 2J7TA 4WSYA 4EYMA 4DGMA 3WF7A 3EQGA 1RE8A 1JKLA 1OL7A 1W83A 1ZAOA 4CVAA 3MESA 4YJTA 4ASEA 4PDYA 2PUNA 1GIJA 3IPHA 2PMLX 3NSZA 4IANA 4NWMA 4XRLA 4CD0A 4YU2A 4Z7GA 3BEGA 3UDBA 3PJ2A 3A61A 2BRHA 2HXLA 2XYUA 2ZYBA 3DJ7A 3PE1A 2E9NA 2QOCA 4K8AA 4QTBA 4WRSA 5LCKA 2F57A 2UV2A 4UXLA 2F7XE 4GYGA 4EYJA 3HVCA 5AR7A 4E26A 3MFSA 1JSUA 3RTPA 2XBAA 5EM7A 4CMUA 3A8WA 4BI0A 3GB2A 3VRZA 2C6EA 4OTWA 4JQ8A 3CQEA 4ACMA 1OL5A 2J0JA 3SHEA 3GCUA 4UYAA 2YIWA 3FC2A 3QWKA 4QPMA 4FZAB 1OECA 4PP9A 5E8YA 4HYHA 5L8JA 4AS0A 5H3QA 1XKKA 3W1FA 4WKQA 3MSSA 2WTKB 3QC9A 3R01A 3R71A 4BDIA 4OGRA 4ANQA 1YXXA 4OTRA 5CSPA 4XG4A 2QOFA 4O2ZA 5DEWA 2C3JA 4O2PA 4CQGA 5HNIX 1BUHA 3ZFYA 2ITUA 3U87A 3MY0A 3BHVA 2ACXA 2QI8A 4O0UA 5AP1A 4I41A 5CU3A 3HL7A 4TYHA 1O6KA 5H9BA 3PPJA 4TL0A 2BTRA 4OTPA 4G9RA 4RVTA 4ZY4A 3TDVA 1UA2A 2BIKB 4F08A 1BL6A 4C4FA 3DFCB 1UU9A 3AMYA 4TT7A 3LM0A 4UY9A 2R4BA 4BGHA 4YZNA 5CEQA 4YURA 3S95A 2NRYA 1ZYCA 3BHYA 4JNWA 4CYJA 1H08A 3TXOA 4FVRA 2VGOA 2XIRA 2SRCA 3LQ5A 4AAAA 2HCKA 3ZFMA 4YPSA 3V8WA 4Y72A 4ANSA 2R3KA 3BX5A 4F1MA 2J9MA 1YWNA 3PY1A 4BTJA 4QQJA 2QONA 1R0EA 2C6LA 2UZLA 2XEYA 5K4JA 4GG5A 5EK7A 4IDVA 4U3YA 4BDGA 3OW3A 1W84A 5AAFA 3ODZX 5JSMA 1W0XC 3OOGA 2ITTA 5GHVA 4X7QA 3BQRA 2FUMA 3W2RA 3QCXA 1Q8WA 4IVBA 4O38A 4DEEA 4FKQA 1GZOA 3CKWA 5CSWA 5LMAA 1GY3A 4B8LA 5C4KA 5CU2A 2QO2A 3R04A 4L7SA 3UIBA 2A2AA 2ETKA 4U80A 1WZYA 5DBXA 2XNBA 3V5LA 5JN2A 4GT4A 3EQPA 3S2PA 3SG9A 1PMUA 4QO9A 5D11A 4C62A 5F1ZA 4E5BA 3UOJA 1XBAA 2OXYA 2QO7A 1WVWA 2WU7A 2YEXA 4KIOA 5FEEA 2WMXA 5HVKA 3FDNA 3QU0A 3BWJA 4LI5A 4RIXA 4ZSAA 4AN3A 2B55A 4QYHA 4FYNA 4EOSA 3A7HA 4IADA 3SC1A 2XJ1A 2H9VA 3OWPA 2R7IA 4IAAA 3VBQA 4D2SA 4AOTA 4EJNA 5F94A 4DT8A 1F0QA 3FLQA 2EXMA 4AP7A 4E20A 3MB7A 4JL9A 2F4JA 1ZY4A 3RHKA 3QD4A 3C4XA 1Q8ZA 4DH5A 1CKIA 2E9OA 2OH4A 2OJIA 2Z60A 3DJ5A 2UW3A 3QQJA 4B9DA 2I7QA 1SVEA 1UNLA 3AD4A 3CJGA 5L3AA 4XYFA 3GCVA 4YP8A 4N6ZA 4DGOA 3L9NA 3R8PA 4WNKA 3QUPA 5ANOA 3OY3A 3QTSA 3C0IA 3QHWA 3LKMA 2WXVA 3VUHA 3ALNA 4ZSLA 2AUHA 2QR7A 4FV7A 4RIOA 3SOCA 2OIQA 1ZZ2A 4F9WA 3PRFA 5JK3A 3KREA 2RFSA 3A7IA 3GFWA 5CEOA 5LMKA 3WF8A 4X2FA 1B6CB 4TTHB 2JBPA 2W1ZA 3VS1A 3K2LA 4FUXA 2I40A 1A06A 3D5VA 2W1FA 3QQUA 4K9YA 4C59A 3QFVA 3GC7A 4USDA 3Q4UA 3CBLA 4GJ3A 5HIBA 5L2WA 3LXKA 3KEXA 4KD1A 3EQBA 3KY2A 3ULIA 5GZ8A 4BRXA 5CU4A 5IA4A 4EOPA 1YXTA 4O86A 1G3NA 1YXSA 4O82A 2ONLC 2Z7SA 5LWNA 4L9IA 3R2BA 3NNUA 2PZRA 2C30A 2XYNA 4RJ3A 4DEAA 3EN6A 2YERA 4DFXE 4WRGA 2W17A 4FKLA 3ACJA 3RAWA 1OKVA 1PMNA 3OCSA 4QYYA 1RDQE 2OIBA 5C9CA 3FV8A 4UEUA 3DQXA 4PX6A 3TUCA 1JKTA 1Y8GA 2VWYA 3AQVA 3QUDA 4XG8A 5AIRA 3DTWA 1Q61A 4PL3A 3DXNA 1H1WA 5LXMA 5L6PA 4BR3A 2BRBA 4DLIA 4BY9E 4E5AX 2UUEA 5AWMA 5AUXA 4WD5A 2NRUA 4FEXA 1OPKA 4BWKA 4JOAA 1KV1A 2CKEA 1SNUA 5HTBA 2LAVA 3I79A 3LW0A 4S2ZA 3UODA 4E4NA 2XNMA 4ZZMA 5AR5A 4BCHA 5A4LA 1WBNA 2FA2A 2WMUA 4ZMFA 2PL0A 2C3LA 4YTCA 3EQIA 5HBHA 3GC9A 3ORTA 3FY0A 4RIYB 4ZXTA 4Y46A 1UKIA 1BMKA 3R9DA 3U4WA 4MD9E 3O2MA 2WEIA 4U45A 5CS6A 5FTQA 4BCMA 1WCCA 2UW4A 4FSWA 4HNIA 1FVVA 4OTQA 3D2IA 4DLJA 5FDPA 4ACDA 4JQ7A 4Z7HA 4FV6A 5ETFA 4R7BA 4CG8A 2R7BA 4RC4A 4FKSA 4L3LA 2J90A 3RBWA 2BPMA 4HCTA 4O91A 5BVWA 4G3DA 3BRBA 4Z3VA 3IECA 3KK9A 1JLUE 2XB7A 4AT3A 3LMHA 3KL8A 5CY3A 4ZY5A 3F82A 4M14A 5A14A 1FOTA 4RA5A 4V04A 3OS3A 4QNAA 3UOHA 4CKJA 3MH3A 4EQMA 5ANIA 4UV0A 2PE1A 5AV1A 3P23A 4BL1A 2FGIA 4FG9A 4QMOA 3SXFA 4QP7A 2Q83A 3HYHA 1YHSA 2HZIA 1Q8TA 4CZYB 1TQMA 4JAIA 4EOOA 4I6QA 3OUNB 2ZMDA 2VWWA 4AOIA 4XG7A 2J0LA 2HAKA 3COMA 1TQPA 4M69B 1ZY5A 4A06A 4WSQA 4G6OA 4L3PA 3S4QA 2ZV8A 3VW8A 5D7AA 3GUBA 2BZKB 3UYSA 5BVDA 4FE2A 1JKKA 1PMVA 3H9RA 1UKHA 4QPAA 3S00A 3MA3A 2YIRA 4R3PA 4U43A 3PP1A 3TZ9A 4W9XA 4C3PA 3VF9A 2IO6A 3F3WA 3KFAA 3CS9A 3CTQA 5KO1A 3OWLA 3VUKA 3FQEA 3PG1A 1PYXA 3ZTXA 2OI4X 1YKRA 4I1ZA 4CZTA 4HVHA 3ACKA 4WUAA 3IOKA 1X8BA 1ZWSA 2XUUA 3NEWA 5FP6A 4C4JA 3OP5A 3LFBA 1HCLA 3QGWA 4IQ6A 4M0YA 4BCIA 4YR8A 2VTSA 3PP0A 5FTOA 2WFYA 3G5DA 3KVXA 1K2PA 1WBOA 3E87A 3OEFX 3DDQA 4M0ZA 2X7FA 3DY7A 1XBBA 3FI4A 5CT7A 3HLLA 5M53A 3BBWA 3IO7A 3OT3A 4ENXA 2VTQA 3Q4ZA 2BRGA 2Q0NA 5AFVA 2FSLX 2RL5A 3BU5A 2WEVA 3E62A 3ORPA 4FV1A 3V5WA 3MYGA 3VBXA 4EOMA 2HIWA 5CYIA 2YCRA 4PDSA 4NM3A 4X3FC 2YABA 5E9EA 1SZMA 4JQEA 4DBXA 5DHJA 4AZVA 4TRLA 2O8YA 3TUDA 4F63A 2W9ZB 3G2FA 5AUUA 3CY2A 3BCEA 5IU2A 4FTNA 1RJBA 4O27B 4Q5EA 5TO8A 2WZJA 3EWHA 3ERKA 3MFUA 1GNGA 5HO6A 2JDRA 3W2PA 3U51A 2VTIA 2RG6A 4GV1A 4W4WA 4PL4A 5EKNA 3W8QA 2P33A 2C3KA 5HCZA 1NXKA 3UPXA 4D55A 5K9IA 4UWCA 3LJ0A 3HMNA 4TKSA 2V62A 4L8MA 4D5KA 4DEIA 4GKHA 4I22A 1YHWA 5IA0A 1U54A 2CLXA 1GIIA 1NVQA 1VZOA 3FZSA 3KXHA 4Z16A 4APCA 3EQDA 2Y7JA 2UZBA 3KRRA 3BU6A 3R2YA 4FGBA 1Q5KA 3PSDA 1XR1A 4QP3A 5FEDA 4KNBA 4Y5QA 1Q8YA 3NUXA 1DS5A 3CP9A 2UVYA 3L8SA 5I9VA 3ZDUA 2OXXA 3HRFA 4FT7A 3Q9YA 3RI1A 2P4IA 4IW0A 2BAKA 5ANJA 4AACA 4YSJA 3BE9A 4KSQA 3ZZEA 3RPOA 4FG8A 4AFEA 4F4PA 3P7CA 1ZARA 2EU9A 2VWZA 3KF7A 2Z2WA 3AD6A 3IONA 2HENA 5CASA 2G2IA 2Z7LA 5KMLA 4S33A 2PUPA 4NYEA 1H1SA 4GSBA 3GU4A 4DFZE 1PF8A 3HDNA 2X7OA 2GFSA 3GU5A 1M7NA 5AUTA 5CENA 4EZ3A 4USEA 5AUZA 2YLFA 5TOZA 4UB7A 4C02A 3FYJX 5FRIA 2PVHA 4M12A 5EKOA 5EOBA 4QTAA 1PKDA 3FHRA 4E7WA 3BV2A 4ZTRA 4MNEA 5JH6A 3ZLYA 4CKIA 3NRMA 4ZSGA 4FNYA 1G8SA 4YLKA 4X6QC 5KZ0A 2GS6A 4JS8A 5FGKA 1F5QA 4AFJA 3LPBA 5ETAA 2B52A 2Y0AA 2W99B 3I6WA 4L53A 3QQGA 4QMQA 3HV3A 3NZ0A 4FTCA 5CSXA 2VTOA 3LHJA 4TZRA 3VUGA 5B7VA 3ORKA 4I0TA 2ERZE 5CXZA 3NVMB 3CQWA 1OVEA 4J97A 3QX4A 5IPJA 4YZCA 5M4CA 2VX1A 2YCQA 3QD2B 3RPRA 2CKOA 1J1CA 3WZKA 4EBWA 2YJSA 5E8VA 4LV8A 3D83A 4NTSA 4YSMA 5CEIA 4O84A 4N6YA 3DTCA 4EHEA 5DR6A 5AV0A 2IJMA 2I6LA 2OO8X 5K0XA 3KXMA 3FE3A 3OTVA 4RRVA 4I4EA 2OWBA 3SGCA 4DN5A 3TUBA 1P14A 3KMMA 5M4UA 3ORXA 2G1TA 5C27A 4MHAA 5D1JA 3ZH8A 4JX3A 4TYIA 1OBDA 3LM5A 5I5ZA 3FXXA 4BDJA 4NSTA 4IBMA 5IA5A 3QTRA 1ND4A 4HOKA 4R3RA 2W7XA 4S34A 3HAVA 4H39A 3LQ3A 3RINA 2Y6OA 2RFNA 4BBFA 3HMMA 2Z8CA 4GFOA 5BVKA 3OOMA 2R3LA 1JPAA 4OT5A 4RC2A 4ZZOA 3UQFA 4IH8A 2XVDA 2OFVA 3CGFA 5E8ZA 4FR4A 4XLVA 3W32A 5E7RA 4F9CA 2PZYA 3Q6UA 3PVUA 1ZMUA 2H6DA 1JAMA 3QXPA 4ERWA 4C2VA 2PVJA 2BR1A 1WVXA 4J52A 4E4MA 2PMIA 3U6IA 3E7VA 5I9WA 3Q5ZA 4J53A 3MPAA 2WMQA 5LQFA 3Q32A 5JKGA 3E8DA 3AOXA 1MUOA 2HZ0A 5E92A 1H00A 3VRYA 3D15A 3IW6A 3N4VA 1FVRA 5C4LA 4AW0A 2VD5A 2F9GA 4Q9ZA 3HV5A 2OU7A 4NCTC 3QZHA 4HGSA 4E8AA 1BI7A 4UMUA 3KRLA 5BYZA 4BTKA 4O0SA 3G51A 3QKLA 4JBQA 3LFFA 4X2JA 4XV3A 3RCDA 2QOBA 4NT4A 4Z55A 5KNJA 1XQZA 2OICA 4FL1A 4ITIA 3RZFA 3DKOA 4WNMA 3KKVA 4NFNA 4KRCA 4C4IA 1F3MC 3R00A 2UZVA 4A7CA 2JGZA 2YISA 4I0RA 3KRWA 4H3PA 3AC2A 3AGMA 3PTGA 5J79A 4K77A 2CKPA 3PJ3A 2XK4A 4XG6A 4XEYA 1OI9A 3E88A 3D5UA 2QKRA 4I92A 3R8ZA 2FH9A 4FKRA 3ENMA 1B39A 2OBJA 4F1OA 5HE2A 2VNWA 3VNTA 1VYWA 4TPTA 3FLWA 4EH6A 4IE9A 2GS2A 2YM7A 3IDPA 3NGAA 3QYWA 1FPUA 4FIGA 4EWQA 2AC5A 5HE1A 3DXQA 3Q52A 4RWLA 2G15A 4ASZA 5J1WA 2UW7A 2VTPA 3LLTA 3ZRKA 4E6QA 5IH4A 1FINA 4WG5A 4GVJA 4C33A 4FNWA 2EUFB 4NM0A 4RPVA 3T9IA 3TG1A 3H9FA 5CQUA 4LMNA 3QKMA 3QTZA 4UMTA 1E1VA 4MBJA 4RVLA 4II5A 3POOA 4ZS0A 2R3OA 3GT8A 2YM8A 4FKWA 5IA2A 3Q4CA 4YJRA 4BBMA 4FL2A 4P2KA 2GS7A 3F7ZA 4ONAA 3IW8A 3GOPA 5IH5A 4YZMA 3BI6A 1FGKA 2BRMA 3NYNA 3QLFA 5DPVA 2EB2A 3FYKX 4RIWB 5HHWA 4ERKA 3F7WA 4ZEGA 3G9NA 5AJQA 1R39A 1JOWB 2X6EA 3RCJA 3V5QA 4CCBA 1P4OA 4QP4A 5M4FA 4O7SA 3PG3A 4IM3A 5M07A 1PRYA 3DBFA 3ZS5A 5FXQA 2AC3A 4XG3A 5ANEA 4E1ZA 4F65A 5AEPA 4O7VA 2B4SB 1U46A 4LM5A 4MX9A 5EYCA 5CEPA 1M52A 4F09A 2OW3A 4GEOA 3ANRA 5HKMA 4HJOA 2CN8A 2DYLA 3ZFXA 3ZRLA 3ZEPA 3BQCA 4GFMA 5IH6A 3PJCA 5BYYA 4MQ2A 4DHFA 5CNOA 4LGHA 4MQ1A 4PNKA 3PLAE 1YI6A 4JT3A 3UBDA 4DFUA 2WB8A 2I0VA 5DT4A 2A4LA 2X8IA 3FKLA 4X3FB 1Y8YA 4CFNA 5CX9A 4FTIA 4EQCA 5HLNA 2HYYA 2XIXA 4O0XA 3RAIA 2QURA 4FIJA 3BHTA 3VJOA 3QQHA 3DK7A 3OD6X 2PHKA 3R7EA 2XRUA 3IW4A 5IISA 3QRIA 3QTXA 4PWNA 3R7UA 5D7VA 2GCDA 4CMOA 3LAUA 1OKYA 3Q5IA 4DC2A 3CY3A 2V0DA 5D41A 3S3IA 3F69A 4M67A 2ESMA 3OT8A 3FMNA 2VWIA 4MXYA 3UNKA 4GJ2A 4GU6A 1SVHA 5A9UA 4DBNA 4XG2A 3VS6A 1QPEA 1H28A 2UW9A 3WIKA 2Z7QA 4DH7A 4TYEA 4EOKA 1J7LA 2CCHA 2OSCA 3NWWA 2BKKA 4YC8A 4AT4A 3Q2JA 1RW8A 3BKBA 4O1OA 3T9TA 5GIPE 5EW3A 4AA4A 3SOAA 5AX9A 5J7BA 3LOKA 4CGAA 4RC3A 4CXAA 4DF3A 4QQCA 3C13A 4BKJA 1H01A 3L9PA 4QMVA 4G3GA 1GZ8A 1DAYA 3EN5A 4QMUA 3EQHA 4I24A 3MI9A 3TIYA 4QMMA 2IPXA 2VX3A 5LJJA 4NKSA 3V5TA 3ATTA 4U79A 5E4HA 3QTIA 4LRJA 5HU3A 5CAOA 2XKEA 2IZTA 3C4WA 5CI6A 5BVEA 4BGQA 4IX4A 5GINE 3VHKA 2VZ6A 4IC8A 3LXPA 3Q53A 3UC3A 1JNKA 3G15A 2YN8A 4H3QA 2Y9QA 4KA3A 3GI3A 1BLXA 1QL6A 4NU1A 2PVLA 4ZTHA 1JBPE 3TCPA 3BWFA 2WOUA 4MXZA 5JT2A 4MXCA 4F7JA 5J8IA 2R5TA 2F7EE 2GDOA 2E9VA 3E3BX 3IW5A 1UWHA 2XK6A 2IW8A 3RVGA 1PXIA 3EKNA 4L43A 2IWIA 5ACBC 4C3FA 3EH9A 3BE2A 4O83A 4C58A 4EOQA 4IXPA 3NS9A 3T8OA 2PZIA 2PTKA 5DYJA 3JYAA 4H3BA 1I44A 4AX8A 3AC5A 3I5ZA 5GZAA 1WBVA 3LFCA 1IA9A 5AAEA 3PA4A 4XUFA 3HMOA 3THBA 4KBCA 3V8TA 4I5CA 1IR3A 3E8EA 5FG8A 3ANQA 3KULB 4X6RA 4QPSA 5BUJA 2X2MA 3N51A 5EM5A 3C5UA 3U9CA 4FTOA 4B4LA 4WUNA 4LV5A 4EQUA 4QYEA 5EYKA 5FEQA 3BLQA 2CHLA 2XNNA 3NW5A 3SLSA 2R0IA 3WZJA 3NCGA 4E6CA 1HCKA 2IZSA 2VWBA 1M2QA 4W8EA 3GQIA 2VX0A 4D58A 3OEZA 1Y6BA 1OIUA 4FODA 4RWKA 3DK6A 5JZNA 4D2WA 3EYHA 3RPVA 1YDRE 3CR0A 2VTMA 3FHIA 3LFAA 3D7TB 4Q9SA 4LYNA 5TKDA 3R9OA 2X2LA 4XV2A 4YZ9A 3TJDA 1HOWA 1NT2A 2X2KA 4ZMEA 2QG7A 3NAXA 3SX9A 3C4EA 2VV9A 3IGOA 1YI4A 2W4OA 2PVNA 1Z57A 3C51A 3RPSA 3UMXA 4C61A 4RX7A 5CF8A 2QLQA 3DBQA 1LEWA 4HGTA 3REPA 2RFDA 3SW4A 4AZFA 5L2TA 2X81A 1QPJA 1H24A 1J3HA 4FUYA 4GFGA 1OKZA 1PXOA 1ZYDA 4QMYA 3MV5A 4MD8E 4GK3A 3ZUUA 4CFUA 2QCSA 3VAPA 3PFQA 3MTLA 5KHWA 5F95A 4AA0A 4AOJA 3FLZA 4DEHA 5AUYA 3R22A 3K3JA 2PVYA 3EQRA 3LLAA 5HBEA 1OL6A 1YQJA 4AG8A 2XK8A 1ZOHA 2HELA 3FAAA 4PTGA 5AV2A 3O8TA 4TYHB 4XP0A 2JDSA 3JY0A 3VBYA 1QMZA 4AT5A 3MWUA 4C2WA 4EH9A 4MXAA 4FVPA 4IVAA 3N9XA 3G6GA 3H10A 3RGFA 4EH2A 2QOLA 2CPKE 1CDKA 2ZAZA 5L2SA 3COIA 4YUQA 4ENYA 1AQ1A 5HICA 5J87A 2OH0E 2CNVA 3EIDA 4XJ0A 2BZHB 1U4DA 4ANMA 4EH7A 2W06A 2QOKA 2RSVA 3WOWA 2P55A 3JXWA 4NFMA 3PA3A 4AUAA 4BGGA 2WMVA 5AX3A 2BRNA 5DA3A 4C36A 4QMNA 2GQSA 3PY3A 3PSCA 1OB3A 3ZSGA 3CD8A 3V01A 2QHMA 4BDEA 2ITWA 5I9ZA 1NA7A 3QRTA 3GCPA 3GEQA 4EBVA 4NJDA 2OKRA 4O0RA 2G2HA 2YITA 3NYVA 2R3IA 3TL8A 1O9UA 4PRJA 5AR8A 3UE4A 4J98A 3DKFA 3RAHA 4IAFA 5A54A 1I09A 1JQHA 5FBOA 4W4VA 2I0HA 5B0XA 3PXZA 4IEBA 3QRJA 4BWPA 3AC8A 2KULA 4ORKA 3JS2A 3RK7A 3SD0A 3PXQA 3BYUA 3TNWA 4JBVA 3TV6A 4FBXA 2CGUA 4DYMA 3COKA 3QAME 3QRUA 5E8UA 3ZXTA 4FSRA 2GPHA 3ATSA 4A9TA 1OPLA 1H0WA 4DT9A 4DCEA 4LOQA 3WILA 2ZM3A 5AV4A 4XOZA 2IVVA 5HLWA 5H8GA 2PVRA 5AR2A 4BIEA 2IW9A 3VF8A 3FZPA 2PZPA 1KV2A 2B9FA 5IMXA 3FMLA 3HKOA 2BIYA 1UU3A 3BYSA 3R28A 1JWHA 4YZDA 5C01A 1PXJA 3WYYA 5AP3A 3FPMA 1ERKA 4M97A 4UWYA 3P1AA 3PYYA 5IUIA 3TNHA 3ZRMA 1RQQA 1ZOEA 3I1AA 4H1MA 4JG8A 3VWAA 5AM7A 3QQLA 4YTHA 3Q9ZA 4NIFA 2OIDA 3Q60A 4OUCA 4F0GA 5AA8A 2G2FA 2BVAA 3D4QA 4RZWA 4FZ7A 3W2OA 5CVGA 4WIHA 3ZCLA 2YM4A 3R8UA 3S0OA 5LWMA 2WMWA 2WGJA 3LXNA 5AAGA 4WBOA 3F5UA 5TF9A 4EWHA 4ZIMA 4UWBA 2O63A 2XNPA 4JG7A 3FMDA 4XX9A 4YC3A 2XF0A 3IGGA 4FZ6A 3SV0A 2PULA 2WU6A 3HNGA 1AGWA 3H30A 5A4TA 2XK7A 3KGAA 3IKAA 3VVHA 4CV9A 5M56A 4EK6A 1OM1A 2QNJA 4L42A 3EL8A 3WF6A 4BZNA 4UMQA 3NW6A 5I9YA 3PXYA 3O71A 4Y83A 3V6RA 3MJ2A 4FF8A 4JBOA 5EQYA 2ZDTA 4I5PA 1XH4A 2VU3A 5HG5A 2XRWA 2UZUE 3Q96A 1V0OA 4C57A 1OUYA 4MH7A 3I7BA 1VR2A 2JITA 4Y85A 2YJRA 4YJSA 5LVNA 1W7HA 4NM7A 3Q3BA 5HTIA 5I9XA 2IVSA 3CGOA 2XNOA 2VUWA 4IX3A 5HCXA 5DR9A 5BX0A 1OKWA 2UW8A 4RZVA 1H1QA 4AW1A 5J9ZA 5KMMA 3FMKA 3NUYA 4F6UA 2PE2A 1SVGA 3OC1A 4XBUA 4LUDA 4IVCA 5L2IA 2VTJA 3LIJA 1YRPA 2ZM4A 3FMJA 3JY9A 2EVAA 4DTBA 3DT1A 4G3EA 5DH3A 4AQCA 3FBVA 3OXZA 2ITXA 2EXEA 4H36A 4ASDA 5IG1A 1OBGA 1U59A 5ITAA 5BMMA 5IEVA 3R7OA 4FSYA 2GTMA 3ORNA 5AUVA 3W2CA 4MAOA 4AGWA 3AC3A 3HECA 1GAGA 4HPUE 3DB8A 5M55A 3IOPA 3OY1A 4IM2A 4MCVA 4E6AA 2CGWA 4C0TA 5HNBA 4AWIA 5CAVA 5JFXA 4WA9A 5A46A 2JAMA 2OGVA 4RIYA 5T3QA 3SG8A 2OF2A 4MWHA 2OLCA 4EZ7A 2IVTA 4RSSA 3DNEA 4AZEA 4RGJA 5K5XA 3MTFA 2E9UA 1KOAA 2QU5A 3AG9A 3TEIA 5LVMA 2F49A 3OCGA 3BGPA 5GJFA 4EI4A 1LR4A 4DA5A 1YDTE 4L6QA 3QTWA 3ZZWA 4KINA 3O17A 4WNPA 5ETIA 2HY81 4D2RA 2WMAA 4ZJVA 3U54A 4APPA 4B7TA 4CCUA 3ID6C 3Q6WA 4TWOA 3R21A 3ZYAA 3G6HA 5TR6A 2C68A 3DAJA 3WE8A 2PWLA 1UU8A 4PL5A 3TN8A 2R3PA 5EHYA 4V0GB 3AMAA 4I6HA 3CEKA 2YWVA 4DG3E 3OF0A 3M1SA 3TNIA 5B2KA 5BUEA 3UZRA 4D2VA 4BIDA 4D1XA 4RVMA 3GP0A 4P90A 2X4ZA 2EB3A 1P2AA 1SM2A 4FVQA 4D1ZA 4I93A 5JRQA 5IDNA 1K9AA 4MBIA 1ZOGA 2NPQA 3S1HA 2W5HA 2OJ9A 4FG7A 1QPDA 1Q3WA 5KMJA 2JDOA 1MP8A 4E73A 5M44A 3C4FA 3EYGA 1E1XA 3CPBA 4JG6A 4QMTA 4W4YA 4WBBB 4ZTNA 5ANDA 3OW4A 4DFNA 3UPZA 2IG7A 3B2WA 3EQCA 4ZY6A 4R7IA 3ODYX 4BN1A 3ORMA 2VO0A 5DVRA 3ZU7A 1W8CA 2HWPA 3ETAA 3VS4A 5HGIA 1FMOE 3L8XA 3FLYA 4FL3A 3B8RA 5I3OA 4AGUA 4RX5A 3Q2MA 3PPZA 4I20A 5HVJA 4YPDA 3TKIA 5DGZA 4ZS4A 3JPVA 3H0YA 3HRCA 5F9EA 4IB5A 4ZJJA 3HZTA 4N70A 5H8EA 4IAIA 3W8LA 2FSOX 3R1YA 3HDMA 4IB0A 4AU8A 4C38A 1XBCA 4F99A 3F5XA 5CEMA 3NW7A 2R3HA 1IA8A 5B2LA 3RZBA 4YBJA 4EH5A 1U5RA 4AW2A 3GC8A 1XJDA 2GSFA 4MK0A 5FTGA 4FTKA 1L3RE 5BPYA 3KXXA 5J1VA 4O22A 4A07A 4ALWA 4JDKA 4CRLA 5FM2A 1YOMA 3VUTA 2HXQA 3WARA 3BGQA 2NO3A 3IDCA 2GTNA 3OBGA 3CD3A 4FT3A 4D4YA 4DGNA 4F7SA 2XZSA 2JLDA 3I7CA 2ZOQA 2WQBA 4CT1A 3OHTA 2YCFA 5KKRC 5FUTA 4BC6A 2J0KA 3O7LD 2GHMA 4KIKB 3H9OA 3C4ZA 5JRSA 1MRVA 1K3AA 4G6NA 4I6BA 4Y8DA 3SKCA 2J0IA 3CE3A 5HX6A 2C4GA 3PXRA 2QOQA 5JQ5A 5DWRA 1KE6A 4FSNA 4FEVA 4F70A 3TZ8A 1XH5A 2XS0A 4ZSEA 3R8LA 4YTFA 1H26A 3JUHA 1DAWA 1T46A 4KSPA 3TZ7A 4WO5A 1WMKA 4ID7A 2PY3A 4P4CA 5LVLA 4C8BA 5HIDA 5DMZA 2CN5A 1GZNA 4UX9A 4FV2A 2R9SA 2Y4IC 4G16A 3MPTA 3LCTA 4QP2A 1KWPA 4FT9A 4NW5A 2R3JA 4JVGA 2CSNA 3R02A 3LE6A 4FSUA 3QALE 4HVIA 3MH0A 2J6MA 5TE0A 4M8TA 4YGAA 3DBCA 5EOLA 5J5SA 3C0GA 4HGEA 3WI6A 4EHZA 2GNLA 1TQIA 3NNVA 2UZEA 3C0HA 2BUJA 5C03A 3NMUF 2QD9A 2C6DA 3QQKA 4ACCA 5I4NA 3U55A 1UNGA 4OTIA 5DT0A 5HLPA 4PPBA 1WBTA 1XWSA 2BDFA 2P2HA 5ANKA 4D28A 3TV7A 4D9UA 3F6XA 1V0PA 4DFYA 4A9RA 3F5PA 3R6XA 4FA2A 5L8LA 1IAHA 2WTDA 4CT2A 4BHNA 4H1JA 5M51A 5HBJA 3RWQA 4RJ8A 3KXGA 3TWJA 1OZ1A 2Z02A 4EH4A 3I6UA 5IQGA 4Q2AA 3A4OX 4PY1A 5IQCA 3R1SA 1WBSA 4N4SA 5CQWA 3HEGA 3HV6A 2HWOA 3EFLA 2HW6A 3GOKA 3BYVA 4D4RA 5LVOA 3FMHA 5EH0A 5DRDA 3NVKI 1Q97A 5FQDC 4FKVA 3R9NA 2ITQA 3DGKA 3MVHA 4RG0A 3BHUA 4ZOGA 3EJ1A 3IW7A 4FIIA 3QQFA 3LMIA 4DG2E 5HEZA 2ONLA 4J99A 3UIMA 4QTDA 2XCKA 3ET7A 4O0VA 3OXTA 3UO6A 5IQFA 5HZNA 4AE9A 5AADA 2BZIB 4WG4A 4GW8A 3C7QA 4AGCA 2XMYA 3O7LB 5HQ0A 4H05A 3ROYA 1KE5A 1V0BA 2J5EA 4FTUA 3ROCA 4LOOA 4OTDA 3ZBFA 2J0MB 1H25A 4JIAA 5AMNA 5JQ8A 1G8AA 2YA9A 5FP5A 4W4XA 4O7RA 3FKNA 4YLJA 5E8TA 2W1DA 3Q04A 4O7ZA 2GNGA 4X3JA 3HV7A 4I23A 3DB6A 1M7QA 4X0MA 1Q24A 1JSTA 3MPMA 5GZ9A 4FTRA 4ZTSA 1G5SA 4JR3A 3KVWA 3RJCA 4ALUA 4O7LA 2WNTA 3D2KA 4GMYA 1JKSA 3G0EA 4OTFA 4YHFA 4IFCA 1U5QA 3O0GA 5D12A 2YWPA 3UIUA 4G34A 1B38A 3UNZA 1YHVA 4R8QA 4FKOA 1MRYA 2H8HA 5EI6A 2W1CA 3EMGA 3ORIA 4WHZA 4BVUA 2R3MA 5CZIA 4U42A 1QPCA 4EHVA 5DT3A 4FT0A 3VULA 3R30A 3VQUA 4GK2A 2RKUA 5CAPA 4CFMA 4D1SA 4EZ5A 3FI2A 3Q4TA 5BQ0A 1CM8A 2YHVA 5J9LA 1PHKA 2R3RA 3HUBA 2OXDA 3KXZA 3VJNA 4QQTA 5KHXA 4GU9A 2WMTA 4B8MA 5K3YA 4ZZNA 5DEYA 1PY5A 1GOLA 5HE0A 4GRBA 4IAKA 3M42A 2HZNA 2BKZA 2VTNA 3SRVB 4G1WA 4MF0A 4R7HA 1YOJA 1LP4A 2X6DA 4KUJA 2ITOA 2YDIA 3C50A 2WELA 3GU7A 4HZRA 5L8KA 3A4PA 4FNZA 5JZJA 3CIKA 3UP2A 3O8PA 1LEZA 2QOOA 4UN0C 4XP2A 3LQ8A 4BIBA 5JGBA 2C5NA 5EDRA 3HA6A 2C5OA 3UIXA 3QD3A 4KRDA 3RKBA 2C6TA 1DI8A 4KS7A 2A27A 2BAQA 4QP1A 4KS8A 4FEWA 3BELA 3NYXA 5HU9A 1OMWA 2BMCA 2YIYA 1O6YA 1H1RA 5HOAA 4IJPA 3WF9A 3ZUVA 4FV5A 2VTAA 5IQAA 4FC0A 4TYJA 4U7ZA 4XMOA 2YM5A 4RIWA 5G1XA 5JFVA 1URWA 3SAYA 1R78A 4YHTA 4N0SA 2JIIA 4D2PA 3WZUA 4L00A 4ZP5A 1J7UA 1DI9A 4L46A 1UU7A 5LVPA 1OL1A 3QTQA 3LFEA 3VS3A 4CTBA 3QA8A 2Q0BA 3PDTA 1H4LA 4UZDA 5DOSA 5EW8A 1OIYA 5CTPA 2ZB1A 3FZRA 3A7GA 3SXRA 3NIEA 2DS1A 3UC4A 4F6SA 1Q8UA 3UTOA 2QODA 2JDTA 2YACA 2DQ7X 3CJFA 2BHHA 4FKPA 3MBLA 3N4UA 3GQLA 5G6VA 4R5SA 5EHLA 4R77A 3PVBA 3ZDIA 4CG9A 2V7OA 4F64A 4B6LA 4G9CA 4GYIA 5LMKC 3BEAA 2YDKA 3BLHA 4RWIA 1TKIA 3W33A 2UW0A 4MXOA 2B54A 1ZMVA 5A3XA 4X3FA 4Y73A 2HOGA 1ATPE 4AZSA 4D0WA 2PUIA 5J7HA 4DTAA 2VO6A 3L1SA 2REIA 2XJ2A 4QNYA 4NK9A 3EB0A 3P5KA 3HGKA 3KB7A 3NDMA 3R9HA 1M14A 1ZYSA 4PPAA 4G17A 5FXSA 5KKRB 3ZO1A 4L67A 4RWJA 5TT7A 3AGLA 4XS2A 4DTKA 5I3RA 2FB8A 5EG3A 1NY3A 3FSKA 4FV0A 4FTTA 3QWJA 5EW9A 4CMTA 3UQCA 4QP8A 3RK5A 2C0TA 3GU8A 1A9UA 5H2UA 3UZPA 2CKQA 1STCE 5EI8A 4XV1A 2P2IA 3VS5A 4BB4A 2W1HA 3EFJA 3G0FA 3A99A 5L2QA 3KMWA 4IM0A 5HTCA 4NL0A 5EQPA 3CC6A 1YVJA 3QZFA 3K5UA 4A9YA 4U44A 5LCJA 3E64A 2ITNA 4BCGA 4DINA 5CXHA 1Q62A 3I0QA 4LFIA 5GJGA 4USFA 3MW1A 3M11A 2Y4IB 1PXMA 4UYNA 2RG5A 2O5KA 1R0PA 3FY2A 3HUCA 4PPCA 2JKKA 5DFPA 2FO0A 5CALA 3UQGA 1Q3DA 4IX6A 3IK3A 4L7FA 3NNXA 4BYIA 4QMSA 4E5WA 3IDBA 4EL9A 4HVSA 2UW6A 3CTJA 5LARA 1Z5MA 2DUVA 4BCQA 5AP0A 1PXLA 4F0FA 5M57A 3W10A 4RJ6A 4BDAA 3P4KA 1GIHA 5A6NA 5KMIA 2ZVAA 3PJ1A 4TW9A 5IQIA 2FSMX 5AIKA 3VO3A 4FSTA 4HVDA 5KMNA 3HAMA 4EH3A 5BYLA 3FEGA 2VWVA 3QYZA 4RBLA 4BHZA 4EK8A 5EHOA 4BWXA 2QOIA 1H07A 3ITZA 2C3IB 4MXXA 2ITZA 2KTYA 4BTFA 3A8XA 3GBZA 3PPKA 4TNBA 5L6WL 3GGFA 3DJ6A 4NJ3A 3LZBA 2WAJA 4XV9A 4NM5A 4CRSA 4FGRA 4CFVA 4KABA 3TNPC 2VTRA 4HVGA 1JSVA 3DPKA 2R3GA 4IJ9A 2OZAB 1ZLTA 1YWVA 4YBKA 3E8CA 3PZHA 3I5NA 4TN6A 5HD4A 3GCSA 5K0KA 3FQHA 2W9FB 5KE0A 1Y6AA 1WAKA 4YO6A 5I9UA 5A4CA 2PK9A 2QO9A 3KULA 3DQWA 5KMOA 4RJ5A 5L6OA 4O7YA 4IACA 1URCA 4HNFA 5E8XA 3V5PA 3WZEA 3R1QA 3WF5A 5CU0A 4QYGA 3P7BA 1CSNA 4IIRA 3QXOA 3FI8A 3AXWA 2JIUA 2UW5A 3GCQA 4O6EA 4KIPA 4F9AA 5C8KA 5EYDA 4C34A 3LMGA 4O1PA 3FZ1A 4U81A 5DRBA 2GFCA 4M15A 4FSZA 3QZGA 4MKCA 4H58A 3D5WA 1CMKE 2XM8A 4B0GA 3OG7A 3D7TA 3VIDA 3OXIA 3JVSA 4ZTQA 3K5VA 4O7NA 3F5GA 3NCZA 4J96A 5EYMA 3LXLA 4JDHA 2YIQA 4QD6A 3ENHA 4YMJA 4GIHA 3O23A 3QGYA 4JAJA 2QKWB 3DCVA 3OROA 4LGGA 3UVRA 3VBWA 3VS7A 3ZHPC 3SW7A 2QHNA 1OUKA 5K5NA 2UVZA 4U0IA 3WYXA 2C0IA 2XH5A 2E9PA 3KCKA 5DI1A 2V7AA 5CT0A 2OJFE 4EORA 4FX3A 4IAYA 4EOIA 3VS2A 3EN7A 3NLBA 2X4FA 2A1AB 4YJUA 5BUIA 3NNWA 1BL7A 3R83A 4EKKA 3OWJA 4U40A 4R3CA 4FZDB 3TM0A 1YI3A 4LMUA 2XJ0A 2PYWA 5CNNA 2E2BA 3TACA 2YZLA 3O50A 5DN3A 2C6IA 4AXAA 4A4LA 4NCTA 4L45A 3ELJA 3DBDA 4P7EA 5IUGA 1MQ4A 3KA0A 1OIRA 5HNGA 2C1AA 2C6MA 5AP2A 3UO4A 1PYEA 2YCSA 4ZJIA 4UXQA 5IQDA 2YZAA 4IWDA 5M06A 5J95A 2R3NA 3ZO3A 1FBNA 2GMXA 5HO8A 3MN3A 5M4IA 4JLCA 5E8SA 2O2UA 2C69A 4PMSA 4WG3A 5FLFA 5J9YA 3D94A 2WMSA 4HW7A 2R0UA 4FNXA 1H8FA 3CXWA 3OWKA 5IDPA 5T6KA 3L8VA 3ORLA 2JBOA 2VGPA 4TWCA 2F7ZE 2VTTA 3B8QA 1IASA 3MFRA 3PSBA 2G01A 4LRKA 4X2KA 4EC8A 4QMPA 1OPJA 3JVRA 3UP7A 3VBVA 4ZTLA 4AZTA 3CTHA 5FXRA 3MFTA 4XHKB 5HD7A 4IZAA 2B9HA 2WPAA 3HMIA 4FKGA 3POZA 4O6LA 4S31A 4YLLA 4FV3A 3RM7A 3V5JA 3A62A 1YOLA 3HP5A 3PLSA 4OTHA 5HO7A 2IVUA 3R0TA 2WO6A 3L8PA 2GNJA 3U6JA 3UVPA 3Q9XA 1NVSA 2VNYA 4M84A 5BVNA 4QMZA 2W1IA 3PUPA 3ZO4A 5LOHA 4BDBA 3G9LX 5HG7A 5IZFA 4LRMA 3VBTA 4DEBA 4RFMA 1S9JA 1WFCA 2BFYA 4HGLA 1P5EA 2UZOA 3FUPA 4MD7E 2HK5A 4A4OA 3MVJA 3ULZA 4LL5A 2I0EA 2W05A 4MF1A 3KMUA 4PF4A 3F61A 4RIXB 4XBRA 4YJOA 1P4FA 5HI2A 3ZC6A 3ZMMA 5CWZA 4AGDA 1QCFA 2FSTX 2ZM1A 4IWPA 3FWQA 4DEGA 5K4IA 4GUEA 5BVFA 3PXFA 5DR2A 4K33A 5LMBA 5E1SA 3VUDA 2UZTA 1PW2A 4EJ7A 2WQMA 4FTQA 1FVTA 2XA4A 2X9EA 4CFFA 2X0GA 2XIYA 3K3IA 5F20A 4CLJA 4N57A 3AC1A 2ZV2A 4YJVA 2BAJA 5EI2A 2OG8A 4FKJA 4CKRA 5IA1A 4C4EA 4ZK5A 4PQNA 5CZHA 1CKPA 4KAOA 4RQKA 3P0MA 1OGUA 3MB6A 3OFMA 4BCOA 4NEUA 4IZ7A 4XG9A 3COHA 3RPYA 3V51A 3EL7A 2G9XA 2VWXA 5B2MA 2UVXA 4UZHA 3U4UA 3ZSIA 3R9RA 2JEDA 4NIFB 4XCUA 4AA5A 2YM6A 3P79A 3FPQA 4R1YA 3CKXA 4J7BA 5L4QA 3FLSA 1XH7A
chains in the Genus database with same CATH superfamily
2HW7A 1ZXEA 4FIHA 1L8TA 4EH8A 3SXSA 1AD5A 3TJCA 2X9FA 2Y4PA 1MQBA 3MDYA 1BYGA 2QR8A 1YXUA 5D9HA 4RQVA 2XNEA 3DXPA 5IEYA 2WTCA 2Y8OA 4G5JA 3E3PA 3EQFA 3E92A 3H4JA 3MS9A 4D9TA 4RLLA 2WKMA 3GC0A 2BCJA 5DE2A 2R2PA 2WOTA 4G5PA 3C1XA 3KN5A 5AUWA 2PE0A 4TWPA 3TI1A 3KK8A 4UMRA 3UJGA 1Q99A 4XOYA 4P5ZA 1FMKA 2NP8A 1WBWA 2Y6MA 3EFKA 3QHRA 3SQQA 1UWJA 4JDJA 4ACHA 3NUPA 3KCFA 4E3CA 4K11A 3G90X 4F7LA 5AR3A 2J50A 3O96A 5CLPA 4OBPA 3LVPA 4GS6A 5FDXA 1SMHA 4PDPA 3ZLSA 4Z9LA 3HMPA 2RIOA 4UBAA 4L44A 2HZ4A 3E7OA 4HYUA 4IWOA 3UMWA 4G6LA 4RVKA 2YDJA 4IVDA 3PRIA 2X0OA 2CLQA 2PVKA 4GKIA 5IA3A 3VUMA 4U41A 4X2GA 3E63A 1G8KA 5F4NA 3BLRA 4YTIA 2A0CX 5I0BA 2VN9A 3FI3A 3HV4A 3OCBA 3T3UA 5IQHA 4IB1A 5AP4A 2BDJA 2JAVA 4FK6A 3ZSHA 4W9WA 3ZLWA 2B7AA 2WQNA 2A19B 4AE6A 5E8WA 3ZO2A 4C35A 1XH6A 4L01A 4HYIA 3TTJA 3ZLXA 5KMKA 4DG0E 1J7IA 4OTGA 3KIOC 3ZM9A 4CFXA 4G3CA 4TNDA 5JFWA 2JKOA 2WTVA 1VJYA 4U6RA 5BNJA 3RAKA 4OAUC 5FD2A 1KE7A 4CFWA 2WMRA 2XNGA 2AEGA 4JI9A 4QTCA 4TXCA 3HX4A 5C26A 4BZDA 4O7WA 4J8MA 4EUUA 4MNFA 4O7TA 1ZMWA 4QMWA 1Y91A 5HE3A 4CQEA 5IQBA 5HORA 3FJQE 3V6SA 1FGIA 3B2TA 3PWYA 5DIAA 4MTAA 4K18A 3QD0A 4E4LA 4CLIA 4RJ7A 3VQHA 4U9AA 3RALA 5CAQA 2GNIA 2CGXA 3R8MA 2VRXA 4YJPA 2O65A 2W96B 2XIKA 4BKYA 4X2NA 3R7IA 3MIAA 1JVPP 1S9IA 3F9NA 3OBJA 5KCVA 3TIZA 1FQ1B 4FKIA 2BROA 5CF6A 5IUHA 3FKOA 4FEUA 4IAZA 4M69A 4CV8A 2YIXA 3H0ZA 4FSMA 2W0JA 3LCDA 4NUSA 4OT6A 4CSVA 4F9YA 3F88A 5A4EA 5AA9A 4L52A 4V0GA 1KUTA 4CZUA 3M2WA 2UZNA 3ZONA 4AN9A 5KUPA 3D9VA 3GVUA 4NW6A 3WBLA 1XH9A 4B99A 3PXKA 3LCKA 2PZ5A 3DU8A 4A4XA 4YJNA 3TMOA 4BI1A 3LFDA 3VW6A 3NUAA 5M08A 1J1BA 2C47A 2VWUA 2P3GX 5EM6A 4AXDA 2XBJA 4BDHA 3CSVA 3E8NA 4FKUA 4G3FA 4O96A 2GU8A 2JIVA 3EKKA 3OTUA 2PPQA 4RX9A 4QMXA 4ANBA 3OUKA 2IW6A 4JJRA 5CF5A 2PMNX 4AQKA 2H34A 2J4ZA 3D7ZA 4ACGA 2WQOA 1M2PA 1ZZLA 4AW5A 4DH3A 5GIOE 2JKQA 2QOHA 3IQ7A 1ZYLA 5AP6A 1Q41A 2C6OA 3O51A 2X7GA 5M09A 4CYIA 2PVFA 4FOBA 4Q5HA 2JDVA 3PVGA 4OBQA 5ICPA 3R7VA 3AT3A 5JGAA 5CVFA 4ALVA 1PMEA 2PMOX 3PIYA 4HCVA 4YNEA 5CF4A 1W82A 2OFUA 2ZV9A 3GU6A 2UZDA 3MH1A 3QC4A 4FTJA 4ZAUA 4M68A 4BZOA 2JC6A 3ZM4A 5EQEA 3NPCA 4FICA 4NKAA 2RGPA 3E5AA 5JMSA 2XK9A 3R7GA 4FOCA 1PJKA 1REKA 1PXKA 4PTCA 3R73A 2VO3A 1UVRA 3C9WA 4EONA 3FXZA 4AZWA 2GHLA 1SNXA 3RM6A 4QRCA 4FTMA 2FYSA 4YC6A 4U5JA 4TYGA 3W2QA 3TNQB 4CTCA 2WTWA 3LFQA 3F2NA 4GCJA 2YLEA 2PUUA 4BCNA 4PV0A 3QF9A 1U54B 5A4QA 1KE8A 4IZYA 4CNHA 3TDWA 1PKGA 3CCNA 2BZJA 2QU6A 3D0EA 3MY1A 1CTPE 2EWAA 4PUZA 1GZKA 2QG5A 5AM6A 2FVDA 1O6LA 3RMFA 1BX6A 2HY0A 4BCPA 2XALA 4G31A 4KIKA 4E6DA 2PU8A 4GIIA 1ZRZA 4FYOA 4BBEA 4EC9A 5HX8A 3UO5A 2ITYA 3F3VA 2CGVA 3QCQA 2WTIA 4TWNA 4BCFA 2XM9A 1IEPA 3MA6A 5A6OA 1LPUA 2I1MA 4DEDA 5ACKA 3HRBA 3F3TA 1WVYA 4J95A 5AP5A 3FZOA 3ZEWA 5HIEA 5IEXA 4PNIA 3BPRA 4WNOA 4F1TA 2VO7A 3DS6A 2GQRA 4K0YA 3F3UA 3NYOA 4OW8A 4QYFA 1J91A 3DAEA 5IF1A 4D5HA 1TFFA 3QA0A 3GENA 4J71A 4UALA 4DGGA 2OJGA 5H8BA 2CCIA 4M13A 3VHEA 3F2AA 4A9UA 3TKUA 5CSHA 2OF4A 3MY5A 3BIZA 2W5BA 4ZLYA 3W2SA 4ITHA 4MNEB 3BGZA 2XK3A 4I21A 4EK3A 4DFLA 3I81A 3KF4A 4KB8A 3UOKA 4BFMA 4QP6A 3BYOA 1YWRA 4E4XA 4MYGA 3GFEA 2C5VA 1XO2B 4IDTA 3W55A 3BZ3A 5AR4A 3PY0A 2R64A 3TKHA 3LCSA 5CANA 4R1VA 4O4CA 4EOLA 3KRJA 5CAUA 1NVRA 5C1QB 2C5XA 2YAKA 2GHGA 2J51A 4IB3A 5FWKK 4ANLA 5KBQA 1IRKA 2ITPA 3NUNA 2YAAA 5KX8A 5JGDA 3CQUA 3BYMA 4QMLA 3TZMA 4GG7A 5EFQA 3EHAA 4D2TA 2B1PA 3KXNA 3QZIA 3R1NA 4NZWB 4KKHA 2F2UA 2J5FA 4BI2A 2WQEA 4JDIA 3F66A 4QTEA 2ZDUA 3V3VA 4JRNA 3EOCA 3II5A 3PJ8A 4BCKA 4IWQA 2ERKA 4WOVA 4EK4A 3NIZA 4FKTA 2B53A 1TVOA 3FQSA 2ZB0A 3PIZA 4ITJA 4K6ZA 4EUTA 4GH2A 4XRJA 1OITA 2ZJWA 2OJJA 4HPTE 5EM8A 4BCJA 5JFSA 2W4KA 3AT2A 5C8MA 1H1PA 4DH8A 1KSWA 2C6KA 3QUEA 4IHPA 2J2IB 4IC7A 3RNIA 3OZ6A 4I0SA 3SA0A 3KQ7A 1OL2A 4RA4A 3ZOSA 3A60A 3K54A 3CLYA 3QCSA 4J1RA 4RFYA 4XH6A 3UYTA 5C8NA 4Y5HA 2W1EA 2O3PA 4ZLZA 3FZTA 4BDDA 1R3CA 2ETMA 4FV8A 4G2FA 4ANOA 3WIGA 3P08A 4DE4A 4FSQA 4K1BA 4RFZA 3VC4A 3KU2A 4O21A 3IG7A 4BF2A 4EHGA 3DLZA 2WTKC 2WIPA 4X21A 3MVLA 4YHJA 3RP9A 3ZC5A 1Y57A 3LFSA 4IMYA 2I0YA 3AD5A 4S30A 1W98A 2QQ7A 3NUSA 3QKKA 3H3CA 3NX8A 3PIXA 4C3RA 1UNHA 2BALA 3AC4A 4JXFA 4D4SA 3QRKA 4LGDA 1REJA 5E1EA 4YO4A 2WHBA 3QCYA 3U9NA 4BTMA 5FM3A 3ORZA 3DAKA 3N4TA 2BHEA 1BKXA 3DNDA 5CSVA 2X8EA 2W4JA 3DZQA 1R1WA 2WMBA 1UV5A 1VYZA 4RLKA 2IZRA 4DHJA 2WIHA 3DBEA 4XP3A 4C37A 4NH1A 2R3FA 2V22A 3OCTA 4P5QA 3WE4A 3L9MA 3P86A 3V8SA 3E93A 3I60A 4FIFA 1Z9XA 2CJMA 3QL8A 1SYKA 1V1KA 4L3JA 3DFAA 4XLIA 2OZOA 3V04A 4JRVA 2W1GA 5ETCA 4BDFA 5DNRA 3MIYA 3I4BA 1M17A 1KE9A 1ZYJA 5D10A 3UZTA 4OAVB 5IQEA 4XNEA 4PDOA 3GNIB 5CU6A 3UDSA 2JFMA 4UMPA 3UGCA 4BICA 4U97A 1APME 5ANGA 4FV9A 3T3VA 3AMBA 2C1BA 4Y95A 3SRVA 2ZMCA 2YM3A 2P0CA 5EDPA 3PA5A 3R8VA 3FMEA 4MEDA 2IN6A 2R3QA 3DZOA 4J8NA 4DCAA 1YDSE 3FC1X 4KIQA 3VUIA 4F0IA 4EK5A 1YXVA 1A48A 1OIQA 2GNFA 4GVAA 3BU3A 4OLIA 4OR5A 5KBRA 4BJJA 2ETRA 4S32A 4FMQA 3C4CA 2C0OA 1DM2A 4IFGA 4GT5A 3RK9A 4BDCA 4DFBA 4NTTA 2C5YA 2ZV7A 4HYSA 3FL4A 4QQ5A 4O0TA 2W5AA 4QP9A 4V01A 2PVMA 3SDJA 1EH4A 2XKDA 3P7AA 3MH2A 3QTUA 5HVYA 3W16A 3DKCA 4GK4A 2XIZA 3TV4A 3A7JA 4FI1A 4IZ5A 4U8ZA 4O0WA 3EFWA 1LUFA 3DOGA 4FK3A 4JR7A 2X8DA 3GXLA 2O64A 5IMEA 2CNUA 2VTLA 1MRUA 1XHAA 4R5YA 5FBNC 4DITA 2H96A 2GNHA 4FZFB 1M2RA 3DK3A 4RMZA 4U3ZA 2XKFA 3LJ1A 4TY1A 2RF9A 4PMMA 4W8DA 4ZLOA 3UNJA 3UOLA 1XH8A 4IX5A 4I94A 4PTEA 2JD5A 2XEZA 4MBLA 3PVWA 5DLSA 2AYPA 3FSFA 3LJ2A 3PZEA 3R63A 4E93A 2CNQA 2JKMA 2V5QA 4DAWA 2QLUA 4D0XA 3OVVA 5BVOA 4RJ4A 4O81A 4KKEA 5GJDA 1BI8A 2QVSE 3EN4A 4MVFA 4D4VA 5GNKA 5BMSA 5BV3A 4KWPA 5E90A 3NUUA 3FLNC 4PP7A 3UG1A 3VS0A 4F7NA 3HP2A 5IKWA 2VAGA 4A9SA 2NNWB 1PXPA 3RNYA 2YFXA 5HCYA 3SVVA 4HZSA 2WTJA 4M7IA 3EN9A 4L68A 5CI7A 3DV3A 3P9JA 4JX7A 3FXWA 3ZBXA 3QBNA 4WT6A 2Z7RA 3PE2A 3UVQA 4ZTMA 4DH1A 3PUFC 3EZRA 3BHHA 2LGCA 2O0UA 4PMPA 4C4GA 4KKGA 2WD1A 3MJ1A 4FEQA 4DDIA 1KOBA 2XCHA 2OK1A 4KBAA 5JEBA 1VEBA 3UG2A 3D14A 2B9IA 1IG1A 4GT3A 3LCOA 2F2CB 4BDKA 4EOJA 4F9BA 3HA8A 4MWIA 4CEGA 2V55A 1NW1A 4LL0A 4GUBA 4R6VA 3U8WA 4R78A 3TT0A 3AT4A 3CPCA 4ASXA 1GJOA 4EKLA 4OBOA 2BFXA 5AV3A 4M3QA 4I6FA 4YJQA 4DGLC 2DWBA 5HESA 4RT7A 3RHXA 5J5TA 1OGYA 3TTIA 4C4HA 4FTAA 3EZVA 2X1NA 3MVMA 3IS5A 5KZIA 4V05A 1Q4LA 5DG5A 3RWPA 4HCUA 3W18A 4YNOA 3ZUTA 4BKZA 4QOXA 3U6HA 3LFNA 2IZUA 2BILB 4FTLA 2B9JA 2UZWE 3P78A 3FMMA 1CKJA 4I3ZA 4RX8A 3OMVA 3G33A 1W2CA 2CMWA 4LG4A 3DA6A 1H27A 3I0OA 4ARKA 1YW2A 4GL9A 3KRXA 4ANNA 4JBPA 5CVHA 1E9HA 3WZDA 4LUEA 2XP2A 3NR9A 4YZBA 2JFLA 3DLSA 4F6WA 3O8UA 3ZXZA 1IAJA 3A7FA 4EEVA 3JR1A 5AP7A 5EDQA 1H0VA 3QLGA 5HG8A 3KN6A 1WBPA 3PWDA 4FT5A 2QC6A 4FV4A 4JIKA 4KBKA 2ITVA 4I5HA 4QT1A 3MGYA 4O0YA 1PXNA 4PMTA 2B0QA 3D5XA 4M66A 5E91A 2XKCA 3R7YA 3VN9A 4BYJA 5HG9A 5CEKA 2PSQA 4I5MA 2GQGA 4AF3A 2RFEA 3ALOA 3BV3A 3F3ZA 4LOPA 2X39A 5T68A 3BBTB 3KC3A 4FIEA 4I4FA 2VTHA 3DKGA 3NAYA 4K2RA 4LQMA 2CDZA 2BTSA 2OZAA 4C7TA 3L9LA 3QX2A 3C5IA 2EXCX 3Q9WA 3F2RA 3DDPA 4ZSJA 2BDWA 1T45A 3FL5A 3A2CA 4AN2A 2J7TA 4WSYA 4EYMA 4DGMA 3WF7A 3EQGA 1RE8A 1JKLA 1OL7A 1W83A 1ZAOA 4CVAA 3MESA 4YJTA 4ASEA 4PDYA 2PUNA 1GIJA 3IPHA 2PMLX 3NSZA 4IANA 4NWMA 4XRLA 4CD0A 4YU2A 4Z7GA 3BEGA 3UDBA 3PJ2A 3A61A 2BRHA 2HXLA 2XYUA 2ZYBA 3DJ7A 3PE1A 2E9NA 2QOCA 4K8AA 4QTBA 4WRSA 5LCKA 2F57A 2UV2A 4UXLA 2F7XE 4GYGA 4EYJA 3HVCA 2AQXA 5AR7A 4E26A 3MFSA 1JSUA 3RTPA 2XBAA 5EM7A 4CMUA 3A8WA 4BI0A 3GB2A 3VRZA 2C6EA 2ZFYA 4OTWA 4JQ8A 3CQEA 4ACMA 1OL5A 2J0JA 3SHEA 3GCUA 4UYAA 2YIWA 3FC2A 3QWKA 4QPMA 4FZAB 1OECA 4PP9A 5E8YA 4HYHA 5L8JA 4AS0A 5H3QA 1XKKA 3W1FA 4WKQA 3MSSA 2WTKB 3QC9A 3R01A 3R71A 4BDIA 4OGRA 4ANQA 1YXXA 4OTRA 5CSPA 4XG4A 2XARA 2QOFA 4O2ZA 5DEWA 2C3JA 4O2PA 3UDZA 4CQGA 5HNIX 1BUHA 3ZFYA 2ITUA 3U87A 3MY0A 3BHVA 2ACXA 2QI8A 4O0UA 5AP1A 4I41A 5CU3A 3HL7A 4TYHA 1O6KA 5H9BA 3PPJA 4TL0A 2BTRA 4OTPA 4G9RA 4RVTA 4ZY4A 3TDVA 1UA2A 2BIKB 4F08A 3VONA 1BL6A 4C4FA 3DFCB 1UU9A 3AMYA 4TT7A 3LM0A 4UY9A 2R4BA 4BGHA 4YZNA 5CEQA 4YURA 3S95A 2NRYA 1ZYCA 3BHYA 4JNWA 4CYJA 1H08A 3TXOA 4FVRA 2VGOA 2XIRA 2SRCA 3LQ5A 4AAAA 2HCKA 3ZFMA 4YPSA 3V8WA 4Y72A 4ANSA 2R3KA 3BX5A 4F1MA 2J9MA 1YWNA 3PY1A 4BTJA 4QQJA 2QONA 1R0EA 2C6LA 2UZLA 2XEYA 5K4JA 4GG5A 5EK7A 3BL9A 4IDVA 4U3YA 4BDGA 3OW3A 1W84A 5AAFA 3ODZX 5JSMA 1W0XC 3OOGA 2ITTA 5GHVA 4X7QA 3BQRA 2FUMA 3W2RA 3QCXA 1Q8WA 4IVBA 4O38A 4DEEA 4FKQA 1GZOA 3CKWA 5CSWA 5LMAA 1GY3A 4B8LA 5C4KA 5CU2A 2QO2A 3R04A 4L7SA 3UIBA 2A2AA 2ETKA 4U80A 1WZYA 5DBXA 2XNBA 3V5LA 5JN2A 4I6LA 4GT4A 4AAYA 3EQPA 3S2PA 3SG9A 1PMUA 4QO9A 5D11A 4C62A 5F1ZA 4E5BA 3UOJA 1XBAA 2OXYA 2QO7A 1WVWA 2WU7A 2YEXA 4KIOA 5FEEA 2WMXA 5HVKA 3FDNA 3QU0A 3BWJA 4LI5A 4RIXA 4ZSAA 4AN3A 2B55A 4QYHA 4FYNA 4EOSA 3A7HA 4IADA 3SC1A 2XJ1A 2H9VA 3OWPA 2R7IA 4IAAA 3VBQA 4D2SA 4AOTA 4EJNA 5F94A 4DT8A 1F0QA 3FLQA 2EXMA 4AP7A 4E20A 3MB7A 4JL9A 2F4JA 1ZY4A 3RHKA 3QD4A 3C4XA 1Q8ZA 4DH5A 1CKIA 2E9OA 2OH4A 2OJIA 2Z60A 3DJ5A 2UW3A 3QQJA 4B9DA 2I7QA 1SVEA 1UNLA 3AD4A 3CJGA 5L3AA 1XMMA 4XYFA 3GCVA 4YP8A 4N6ZA 4DGOA 3L9NA 3R8PA 4WNKA 3QUPA 5ANOA 3OY3A 3QTSA 3C0IA 3QHWA 3LKMA 2WXVA 3VUHA 3ALNA 4ZSLA 2AUHA 2QR7A 4FV7A 4RIOA 3SOCA 2OIQA 1ZZ2A 4F9WA 3PRFA 5JK3A 3KREA 2RFSA 3A7IA 3GFWA 5CEOA 5LMKA 3WF8A 4X2FA 1B6CB 4TTHB 2JBPA 2W1ZA 3VS1A 3K2LA 4FUXA 2I40A 1A06A 3D5VA 2W1FA 3QQUA 4K9YA 4C59A 3QFVA 3GC7A 4USDA 4QEBA 3Q4UA 3CBLA 4GJ3A 5HIBA 5L2WA 3LXKA 3KEXA 4KD1A 3EQBA 3KY2A 3ULIA 5GZ8A 4BRXA 4AXFA 5CU4A 5IA4A 4EOPA 1YXTA 4O86A 1G3NA 1YXSA 4O82A 2ONLC 2Z7SA 5LWNA 4L9IA 3R2BA 3NNUA 2PZRA 2C30A 2XYNA 4RJ3A 4DEAA 3EN6A 4F78A 2YERA 4DFXE 4WRGA 2W17A 4FKLA 3ACJA 3RAWA 1OKVA 1PMNA 3OCSA 4QYYA 1RDQE 2OIBA 5C9CA 3FV8A 4UEUA 3DQXA 4PX6A 3TUCA 1JKTA 1Y8GA 2VWYA 3AQVA 3QUDA 4XG8A 5AIRA 4O4FA 3DTWA 1Q61A 4PL3A 3DXNA 1H1WA 5LXMA 5L6PA 4BR3A 2BRBA 4DLIA 4BY9E 4E5AX 3UDTA 2UUEA 5AWMA 5AUXA 4WD5A 2NRUA 4FEXA 1OPKA 4BWKA 4JOAA 1KV1A 2CKEA 1SNUA 5HTBA 2LAVA 3I79A 3LW0A 4S2ZA 3UODA 4E4NA 2XNMA 4ZZMA 5AR5A 4BCHA 5A4LA 1WBNA 2FA2A 2WMUA 4ZMFA 2PL0A 2C3LA 4YTCA 3ML1A 3EQIA 5HBHA 3GC9A 3ORTA 3FY0A 4RIYB 4ZXTA 4Y46A 1UKIA 1BMKA 3R9DA 3U4WA 4MD9E 3O2MA 2WEIA 4U45A 5CS6A 5FTQA 4BCMA 1WCCA 2UW4A 4FSWA 4HNIA 1FVVA 4OTQA 3D2IA 4DLJA 5FDPA 4ACDA 4JQ7A 4Z7HA 4FV6A 5ETFA 4R7BA 4CG8A 2R7BA 4RC4A 4FKSA 4L3LA 2J90A 3RBWA 2BPMA 4HCTA 4O91A 5BVWA 4G3DA 3BRBA 4Z3VA 3IECA 3KK9A 1JLUE 2IEWA 2XB7A 4AT3A 3LMHA 3KL8A 5CY3A 4ZY5A 3F82A 4M14A 5A14A 1FOTA 4RA5A 4V04A 3OS3A 4QNAA 3UOHA 4CKJA 3MH3A 4EQMA 5ANIA 4UV0A 2PE1A 5AV1A 3P23A 4O4DA 2FGIA 4FG9A 4QMOA 4BL1A 3SXFA 4QP7A 2Q83A 3HYHA 1YHSA 2HZIA 1Q8TA 4CZYB 1TQMA 4JAIA 4EOOA 4I6QA 3OUNB 3W0NA 2ZMDA 2VWWA 4AOIA 4XG7A 2J0LA 2HAKA 3COMA 1TQPA 4M69B 1ZY5A 4A06A 4WSQA 4G6OA 4L3PA 3S4QA 2ZV8A 3VW8A 5D7AA 3GUBA 2BZKB 3UYSA 5BVDA 4FE2A 1JKKA 1PMVA 3H9RA 1UKHA 4QPAA 3S00A 3MA3A 2YIRA 4R3PA 4U43A 3PP1A 3TZ9A 4W9XA 4C3PA 3VF9A 2IO6A 3F3WA 3KFAA 3CS9A 3CTQA 5KO1A 3OWLA 3VUKA 3FQEA 3PG1A 1PYXA 3ZTXA 2OI4X 1YKRA 4I1ZA 4CZTA 4HVHA 3ACKA 4WUAA 3IOKA 1X8BA 1ZWSA 2XUUA 3NEWA 5FP6A 4C4JA 3OP5A 3LFBA 1HCLA 3QGWA 4IQ6A 4M0YA 4BCIA 4YR8A 2VTSA 3PP0A 5FTOA 2WFYA 3G5DA 3KVXA 1K2PA 1WBOA 3E87A 3OEFX 3DDQA 4M0ZA 2X7FA 3DY7A 1XBBA 3FI4A 5CT7A 3HLLA 5M53A 3BBWA 3IO7A 3OT3A 4ENXA 2VTQA 3Q4ZA 2BRGA 2Q0NA 5AFVA 2FSLX 2RL5A 3BU5A 2WEVA 3E62A 3ORPA 4FV1A 3V5WA 3MYGA 3VBXA 4EOMA 2HIWA 5CYIA 2YCRA 4PDSA 4NM3A 4X3FC 2YABA 5E9EA 1SZMA 4JQEA 4DBXA 5DHJA 4AZVA 4TRLA 2O8YA 3TUDA 4F63A 2W9ZB 3G2FA 5AUUA 3CY2A 3BCEA 5IU2A 4FTNA 1RJBA 4O27B 4Q5EA 5TO8A 2WZJA 3EWHA 3ERKA 3MFUA 1GNGA 5HO6A 2JDRA 3W2PA 3U51A 2VTIA 2RG6A 4GV1A 4W4WA 4PL4A 5EKNA 3W8QA 2P33A 2C3KA 5HCZA 1NXKA 3UPXA 4D55A 5K9IA 4UWCA 3LJ0A 3HMNA 4TKSA 2V62A 4L8MA 4D5KA 4DEIA 4GKHA 3W0SA 4I22A 1YHWA 5IA0A 1U54A 2CLXA 1GIIA 1NVQA 1VZOA 3FZSA 3KXHA 4Z16A 4APCA 3EQDA 2Y7JA 2UZBA 3KRRA 3BU6A 3R2YA 4FGBA 1Q5KA 3PSDA 1XR1A 4QP3A 5FEDA 4KNBA 4Y5QA 4DDGA 1Q8YA 3NUXA 1DS5A 3CP9A 2UVYA 3L8SA 5I9VA 3ZDUA 2OXXA 3HRFA 4FT7A 3Q9YA 3RI1A 2P4IA 4IW0A 2BAKA 5ANJA 4AACA 4YSJA 3BE9A 4KSQA 3ZZEA 3RPOA 4FG8A 4AFEA 4F4PA 3P7CA 1ZARA 2EU9A 2VWZA 3KF7A 2Z2WA 3AD6A 3IONA 2HENA 5CASA 2G2IA 2Z7LA 5KMLA 4S33A 2PUPA 4NYEA 1H1SA 4GSBA 3GU4A 4DFZE 1PF8A 3HDNA 2X7OA 2GFSA 3GU5A 1M7NA 5AUTA 5CENA 4EZ3A 4USEA 5AUZA 2YLFA 5TOZA 4UB7A 4C02A 3FYJX 5FRIA 2PVHA 4M12A 5EKOA 5EOBA 4QTAA 1PKDA 3FHRA 4E7WA 3BV2A 4ZTRA 4MNEA 5JH6A 3ZLYA 4CKIA 3NRMA 4ZSGA 4FNYA 1G8SA 4YLKA 4X6QC 5KZ0A 2GS6A 4JS8A 5FGKA 1F5QA 4AFJA 3LPBA 5ETAA 2B52A 2Y0AA 2W99B 3I6WA 4L53A 3QQGA 3W0MA 4QMQA 3HV3A 3NZ0A 4FTCA 5CSXA 2VTOA 3LHJA 4TZRA 3VUGA 5B7VA 3ORKA 4I0TA 2ERZE 5CXZA 3NVMB 3CQWA 1OVEA 4J97A 3QX4A 5IPJA 4YZCA 5M4CA 2VX1A 2YCQA 3QD2B 3RPRA 2CKOA 1J1CA 3WZKA 4EBWA 2YJSA 5E8VA 4LV8A 3D83A 4NTSA 4YSMA 5CEIA 4O84A 4N6YA 3DTCA 4EHEA 5DR6A 5AV0A 2IJMA 2I6LA 2OO8X 5K0XA 3KXMA 3FE3A 3OTVA 4RRVA 4I4EA 2OWBA 3SGCA 4DN5A 3TUBA 1P14A 3KMMA 5M4UA 3ORXA 2G1TA 5C27A 4MHAA 5D1JA 3ZH8A 4JX3A 4TYIA 1OBDA 3LM5A 5I5ZA 3FXXA 4BDJA 4NSTA 4IBMA 5IA5A 3QTRA 1ND4A 4HOKA 4R3RA 2W7XA 4S34A 3HAVA 4H39A 3LQ3A 3RINA 2Y6OA 2RFNA 4BBFA 3HMMA 2Z8CA 4GFOA 5BVKA 3OOMA 2R3LA 1JPAA 4OT5A 4RC2A 4ZZOA 3UQFA 4IH8A 2XVDA 2OFVA 3CGFA 5E8ZA 4FR4A 4XLVA 3W32A 5E7RA 4F9CA 2PZYA 3Q6UA 3PVUA 1ZMUA 2H6DA 1JAMA 3QXPA 4ERWA 4C2VA 2PVJA 2BR1A 1WVXA 4J52A 4E4MA 2PMIA 3U6IA 3E7VA 5I9WA 3Q5ZA 4J53A 3MPAA 2WMQA 5LQFA 3Q32A 5JKGA 3E8DA 3AOXA 1MUOA 2HZ0A 5E92A 1H00A 3VRYA 3D15A 3IW6A 3N4VA 1FVRA 5C4LA 4AW0A 2VD5A 2F9GA 4Q9ZA 3HV5A 2OU7A 4NCTC 3QZHA 4HGSA 4E8AA 1BI7A 4UMUA 4O4BB 3KRLA 5BYZA 4BTKA 4O0SA 3G51A 3QKLA 4JBQA 3LFFA 4X2JA 4XV3A 3RCDA 2QOBA 4NT4A 4Z55A 5KNJA 1XQZA 2OICA 4FL1A 4ITIA 3RZFA 3DKOA 4WNMA 3KKVA 4NFNA 4KRCA 4C4IA 3PFYA 1F3MC 3R00A 2UZVA 4A7CA 2JGZA 2YISA 4I0RA 3KRWA 4H3PA 3AC2A 3AGMA 3PTGA 5J79A 4K77A 2CKPA 3PJ3A 2XK4A