1OB3A

Structure of p. falciparum pfpk5
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
286
structure length
277
Chain Sequence
b'MEKYHGLEKIGEGTYGVVYKAQNNYGETFALKKIRLEKEDEGIPSTTIREISILKELKHSNIVKLYDVIHTKKRLVLVFEHLDQDLKKLLDVCEGGLESVTAKSFLLQLLNGIAYCHDRRVLHRDLKPQNLLINREGELKIADFGLARAFGIVTLWYRAPDVLMGSKKYSTTIDIWSVGCIFAEMVNGTPLFPGVSEADQLMRIFRILGTPNSKNWPNVTELPKYDPNFTVYEPLPWESFLKGLDESGIDLLSKMLKLDPNQRITAKQALEHAYFKE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CELL DIVISION CONTROL PROTEIN 2 HOMOLOG
publication title Structures of P. Falciparum Pfpk5 Test the Cdk Regulation Paradigm and Suggest Mechanisms of Small Molecule Inhibition
pubmed doi rcsb
source organism Plasmodium falciparum
molecule tags Transferase
total genus 77
structure length 277
sequence length 286
chains with identical sequence B
ec nomenclature ec 2.7.11.22: Cyclin-dependent kinase.
pdb deposition date 2003-01-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 1ob3A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 1ob3A01
2XIKA 5C26A 3CGOA 5LVPA 2J50A 3MS9A 3R30A 3VS5A 4ZMEA 3RP9A 1XH6A 4YNOA 3PJ8A 4EYMA 5CEKA 5IISA 4CFFA 3GEQA 3RHKA 5KMKA 2YM7A 2ETKA 3AMBA 4Y5HA 2WMAA 3TEIA 3LMHA 4BL1A 2OJ9A 2R0UA 4GRBA 1SVEA 4IVDA 4GSBA 1V0OA 1ZZ2A 2YDIA 2VTQA 3QRUA 5HE1A 1R78A 5CF4A 2EWAA 4I23A 4FV1A 4ZTRA 4FI1A 2JC6A 3E3PA 5FD2A 3T3UA 3QZGA 4C4JA 3ZRLA 3HA6A 2P2HA 3NUAA 3OHTA 2XRWA 3MJ1A 2PL0A 3FJQE 1UNGA 4OTIA 1Q97A 4EQUA 4IFCA 4FTRA 4L00A 2O5KA 1JNKA 3TL8A 4UMPA 3QUEA 3UMWA 4RIXB 3MA3A 3TXOA 4H1JA 4RIXA 1SZMA 4NZWB 5AP3A 4DG3E 4E93A 4AS0A 2WMSA 2BAKA 2C1BA 2VGOA 5CT0A 2X2LA 3QTSA 2WQBA 2R0IA 4J52A 2OH0E 3UOHA 4AP7A 4ENXA 2WTVA 4FGBA 2JDVA 3DB8A 4J1RA 2OFUA 4PTCA 4GG7A 2B9HA 3Q2JA 1O6LA 4HVGA 1KV1A 3O2MA 4AQCA 4DGLC 5LMKA 2YDKA 4FSTA 3ZXZA 4F6WA 2C0IA 4PNKA 5AUZA 4FEXA 3OG7A 3CPCA 2VTHA 2ZV7A 3KVWA 1XHAA 3U51A 4ZK5A 4ZSEA 1HOWA 1NVQA 4S31A 3IW4A 4IX3A 3RM7A 1UKHA 4FTKA 4BI2A 5AV2A 3ORMA 4XCUA 1BKXA 3QA8A 3Q4CA 1RW8A 4DFNA 3R1QA 2R3FA 3R7UA 4ZIMA 4R1VA 4XG2A 1GOLA 4H3PA 3V8TA 2F4JA 2IVSA 1OIRA 4H1MA 3UVQA 2ERKA 5FWKK 2J4ZA 4GU6A 3KCKA 5DH3A 5CENA 3LM0A 3TNPC 3R8ZA 2XBJA 4YP8A 2XNPA 4BDHA 4HJOA 4KIQA 5L2SA 3VUMA 4IAKA 2FSLX 5EM7A 5J7BA 3U55A 3Q32A 4RQVA 5AIRA 1XKKA 2QOHA 2VWUA 1FGIA 4KB8A 2VX3A 3TN8A 4D55A 4O6EA 5BQ0A 2VTOA 4MXYA 3EKNA 4UWBA 3TDWA 2WTWA 4RT7A 3SX9A 3RALA 3WF8A 4E1ZA 3B2TA 2OJFE 2X6DA 4KRDA 3R7VA 4F64A 3TNWA 3LFDA 4E4NA 3MESA 4AE6A 4BCNA 4CCUA 4H3BA 2F7EE 2VTLA 1WCCA 4M13A 2W06A 4EJ7A 1U5QA 5J1WA 4FT0A 4Z7HA 5AR5A 3GB2A 4GFMA 1XQZA 4K6ZA 2ITWA 4IBMA 4C4FA 3DXPA 1H1WA 4O7VA 4RFMA 3TJDA 1XH5A 5AR8A 3DJ6A 3E5AA 3ZHPC 1WVYA 4O0UA 3THBA 2WTIA 4DEBA 4EH4A 4C57A 3C13A 3MIAA 2IPXA 4FKQA 4D5HA 3VUKA 1KE6A 2HELA 2X39A 3OWJA 4IMYA 4EK6A 2W4KA 2HW7A 3JYAA 4HPUE 4JBQA 1LPUA 3FXXA 4I92A 4D2RA 5H8EA 2CLQA 3C50A 3NNUA 4Y5QA 5IKWA 4JG6A 1H27A 4MHAA 5LVNA 3U6JA 1ND4A 2F9GA 4CG8A 1RE8A 3BPRA 4ZY6A 4QYHA 3U9NA 3ID6C 3R8PA 3N4TA 1M14A 2QOLA 4QYFA 5L8JA 3IQ7A 5A46A 5KBQA 2OH4A 2XM9A 3RPVA 2GHGA 4LUDA 4P90A 4GJ3A 2R3RA 1BL7A 3DA6A 3R7EA 4F09A 1H1RA 4TYHA 3KY2A 4NM0A 5HBEA 3ZLSA 4A4XA 1OECA 3QL8A 5CWZA 4PMPA 5J79A 3IW5A 2VO0A 4AOTA 5BPYA 2P3GX 4ZZNA 3OWPA 4I6BA 3RAIA 2F49A 1YW2A 3V8SA 3FWQA 3TZ8A 2J2IB 3KK9A 5K5NA 2OIBA 2VO3A 2VTTA 1YWNA 3PE1A 4GV1A 4I6QA 4J8NA 4NCTA 5DR9A 5BNJA 5KNJA 3O0GA 5HE0A 4PTGA 2ZJWA 5JEBA 3QLFA 4E3CA 4DEEA 4DG2E 5FRIA 3SD0A 2W5AA 4AZEA 1ZXEA 4IWDA 2BHEA 2GTNA 1JSUA 3H0ZA 3E87A 3QA0A 4TT7A 2BAJA 5AUXA 4C4GA 1IAHA 2OG8A 4WHZA 4A07A 3FC1X 3DB6A 4AFJA 1PMUA 3ORZA 5AV0A 1BMKA 4FKPA 2G2IA 3GP0A 4J99A 4EQMA 5KHWA 4CKRA 4M66A 3PXZA 2VO7A 2PHKA 2Z7LA 3PY3A 3FXZA 5CZIA 5CS6A 5DIAA 3VQHA 1PYEA 5M53A 1T45A 4NU1A 4ALVA 5HTIA 3EIDA 4JLCA 2QODA 5BUEA 3EL8A 4TKSA 4RMZA 3F5PA 4BIDA 2P55A 3MV5A 2W1FA 2BFYA 1BI8A 3IDPA 4YJSA 1SVHA 1Y57A 5EM5A 3PJCA 5A4CA 1ZARA 4IAFA 3UC4A 3LCKA 3VULA 3V5JA 4UALA 4A4OA 2X7OA 3FZ1A 3F69A 3AOXA 2V0DA 4KAOA 3IW7A 2C1AA 2O64A 1PKGA 3GQIA 5EQPA 3QCYA 3Q04A 3PVUA 4R7HA 1M2RA 2OGVA 2QR7A 4IWOA 4LRJA 1B38A 2XVDA 4PV0A 4QYEA 4W9XA 3VS4A 4DGOA 5HZNA 2VO6A 3OEFX 3GNIB 3BYVA 2WZJA 2WMUA 2B7AA 2A0CX 4O6LA 2YIYA 3QQGA 3VF8A 1OIQA 4LQMA 1LUFA 4O2PA 1H8FA 4AZSA 2JLDA 3KCFA 4O0TA 3UZPA 4GT5A 3E7VA 3ULIA 3VAPA 4ALUA 3DS6A 3V5LA 5CEQA 3RZBA 3W8LA 1FQ1B 4BTKA 4DEGA 3PY0A 2XK3A 2BUJA 2PMIA 1K9AA 2OZAB 2DUVA 3BU5A 3OCGA 3P7AA 1CKJA 2BZJA 2OZAA 4HGLA 4QP3A 4ERWA 3HLLA 2GTMA 4U5JA 4EHEA 2C0OA 3JS2A 5GZ9A 2B53A 1PXPA 5EYKA 1JKSA 3Q9YA 3PFQA 2GCDA 4RJ4A 4O84A 3FMHA 3OTUA 4ONAA 4A9YA 3AMYA 3RAWA 2WTKC 4JQEA 3RNYA 3FYJX 2X8EA 3H9FA 4FSYA 3S1HA 4BCJA 4EL9A 1JKKA 4Z55A 5LJJA 4FTLA 5A3XA 4ZMFA 2JKKA 4I6FA 1NY3A 1K2PA 2G01A 2JIIA 4CV9A 5CAOA 5AV4A 4D2VA 1H0WA 3KKVA 2VGPA 3ANRA 3QKMA 3ZRMA 3D0EA 2PU8A 1YDTE 3ANQA 1WAKA 1PHKA 3NSZA 3PWYA 4AACA 3O17A 4F7NA 5JH6A 1A48A 2RFSA 3H9OA 2QG7A 4MKCA 3R9NA 3CD3A 5E8WA 4DT8A 3NUPA 2YFXA 4WIHA 4OAUC 4FYNA 1NXKA 4FV6A 4XLVA 5AEPA 3R7GA 5AJQA 5JZNA 3BHYA 4XX9A 4ARKA 5KKRC 3WARA 2QO7A 2YCFA 3G0FA 4RGJA 4EOKA 3WF7A 3HMNA 4I21A 3QQHA 4ACDA 2J51A 3IW6A 4M67A 2ZMDA 4KKEA 3JVRA 5J9YA 3EN9A 2HOGA 3QZHA 4IVAA 2OIDA 2PVFA 3CPBA 2QOFA 3F82A 3MFRA 4G3DA 3OXIA 1W8CA 4B9DA 2WPAA 2BR1A 1E1XA 3MB6A 4G2FA 3WF9A 4EH8A 4I5MA 3K5VA 3Q9XA 4WA9A 1Q8UA 3ORLA 4EK4A 4IC8A 4PMMA 2PZYA 4OTPA 3A7IA 3AC5A 3BBTB 2ONLC 4D9UA 2NRYA 3EL7A 3R0TA 2BHHA 3F7ZA 3GUBA 2I40A 2R3JA 2YWVA 1E9HA 2PMOX 4TNBA 3A4OX 4V05A 3R28A 3FL5A 4BHNA 2B9IA 4E5AX 2B52A 4W4XA 3E64A 5M4IA 4GW8A 3PPKA 2XMYA 4MD7E 3HX4A 4F6SA 2E9VA 2WNTA 3SVVA 3GXLA 3BHHA 3QD4A 4M0ZA 4YZBA 4YC3A 4JRVA 3QGWA 4UYAA 4YJUA 5FBOA 3NEWA 4QP1A 4PQNA 1YKRA 2GFCA 2Z02A 4IB1A 4O96A 5HG9A 4GIHA 3D2IA 3KXZA 3LJ2A 4YLJA 2BCJA 4AW0A 5J95A 4MF0A 2BRNA 4IACA 4I5HA 5M4CA 1G3NA 5HICA 3UYTA 5FG8A 2JDOA 2XKEA 3PP0A 2GNLA 1Q3WA 4FSNA 3F3WA 5DMZA 3UIUA 5E7RA 2BRHA 3HMOA 4LG4A 5DVRA 2QLUA 3UODA 3JVSA 3CQEA 3RWQA 1YHVA 4UB7A 3LXLA 4C4HA 4BDFA 2OW3A 4YJPA 4YZ9A 2HY0A 5DFPA 5CVFA 4DFLA 2ITVA 2ZV8A 4W8DA 1KE7A 2DWBA 4QP8A 4CNHA 1ZAOA 1R1WA 2X6EA 3ZLYA 3E8CA 3ZTXA 4ANMA 3S95A 4F9CA 2PVJA 2W9FB 3FMNA 3RK7A 4JXFA 5M44A 3EKKA 2YCQA 3S3IA 4D2PA 3BCEA 1P14A 2OWBA 2X2MA 3C4FA 4W8EA 4XP0A 2VNYA 4DYMA 3RBWA 2Z2WA 5TT7A 3ZSGA 5M08A 1SVGA 3GGFA 4O0VA 4L7FA 3UG2A 4LV5A 4FIIA 4L53A 4FTAA 5AAEA 3LIJA 4EK8A 5JKGA 1XH4A 4QPAA 2R3IA 4MBJA 4C34A 1JKLA 3TDVA 1JWHA 2J5EA 4CT1A 2UZOA 3FSKA 4MD9E 1BLXA 3R04A 2Z7RA 4C33A 4K9YA 4MQ1A 3HNGA 4FSMA 3MH1A 4AW1A 5FTGA 1YI3A 4ORKA 3W1FA 4QMSA 2IZUA 3POOA 3EQHA 4G17A 5AR2A 4DH7A 4PWNA 4QMVA 3DU8A 3ZO1A 2FSOX 2O2UA 3UYSA 2V7OA 3CBLA 4QP9A 4FG9A 5LARA 3QF9A 3DBDA 1FOTA 4C4IA 3MH0A 4USFA 2HZNA 4RVMA 3F61A 3VIDA 3OBJA 2C3JA 2OSCA 3DNDA 4C37A 2EXMA 2WKMA 4ITHA 4IFGA 4TYEA 4FZ6A 4PPCA 5AM6A 1JPAA 2BIYA 4WO5A 4EOMA 4BGQA 2IG7A 3FQSA 4GFGA 3Q3BA 4C59A 4IDVA 4EUUA 3BWJA 5J8IA 4QMNA 1Z5MA 2QG5A 4MX9A 5M57A 3KN5A 2HWPA 3A2CA 5AP2A 4LRKA 4HVIA 5F95A 3FE3A 4EHVA 4YJOA 3BQRA 4CZUA 3PTGA 4OTGA 5CI7A 5ANIA 3ATSA 4LV8A 5KZIA 5L8KA 2G15A 4WRSA 4F0FA 3IKAA 4J71A 4FSZA 4M84A 4C38A 4FTNA 3GU6A 3MIYA 5JGBA 3VBVA 4WKQA 1I44A 4ZZMA 2ITXA 4QPSA 2I1MA 2WFYA 3MWUA 4QO9A 2Q0NA 3BGZA 5EI6A 4GFOA 1UU8A 5E92A 5EQYA 5D7AA 3W18A 4JRNA 4WG5A 5EW9A 2AC3A 4F63A 4DLJA 5AP4A 3FSFA 2C6EA 5K3YA 4E26A 2J0KA 3SQQA 1KUTA 4BB4A 4GK2A 3UIXA 3QXOA 3HMMA 3ZC6A 5C4LA 1YVJA 1FVVA 1GNGA 4R5YA 3PG1A 3PSBA 3ZBFA 4ASDA 1MQ4A 3D83A 3WYYA 5KMOA 3OCSA 2C6DA 1XO2B 3GCSA 1FMOE 5IU2A 3U6HA 2ESMA 3O96A 2BZIB 1A06A 2RFEA 1OL7A 2Z8CA 2I0YA 2EVAA 4JDHA 4IWPA 4MF1A 4PDYA 2VWVA 3RTPA 3S2PA 2PWLA 4D4YA 4FT9A 5BVDA 3OROA 2UW0A 2PE1A 3VRYA 1WBPA 5EI2A 3GCPA 3KREA 3LCDA 4F70A 3CKWA 3I5ZA 3KXHA 3VW6A 3MA6A 4H36A 5DRDA 3Q96A 4D1SA 5L6WL 2VWBA 3IGOA 4FUXA 4C7TA 4EWHA 5IEXA 1YXSA 3TV4A 1ZMUA 4D2SA 3PIXA 3EN6A 5CSXA 4IANA 3ZS5A 4IVBA 4KKHA 4FIEA 2P2IA 3AT2A 1GIHA 5CX9A 1UA2A 4FSQA 1Q5KA 3POZA 3F3ZA 5DT3A 3M1SA 3FMLA 4XG9A 2PYWA 4FVQA 1X8BA 4S2ZA 2RIOA 3O23A 2JIUA 4RJ6A 1URCA 4GMYA 5AWMA 5HVYA 1Q8ZA 4PPAA 3OEZA 5DR2A 2WXVA 3P4KA 2C68A 4M7IA 4O1PA 1PW2A 1OKZA 3F2NA 4IW0A 3NUNA 1FVRA 2QVSE 4RFYA 5IF1A 3KB7A 2C3KA 2J0LA 5BYLA 2O0UA 1GAGA 3A62A 5I5ZA 1XR1A 2OIQA 2OXXA 1PXMA 2X4ZA 3R7IA 4KUJA 3CJGA 4O0SA 3CE3A 3HRBA 1Q8TA 1GJOA 4BDIA 2YIQA 5IA3A 4IADA 1XWSA 2VTJA 2W1GA 5GZ8A 2JKMA 4X2FA 2CDZA 4EWQA 2XIRA 3A61A 3EZRA 4EEVA 2BPMA 1OIYA 3KEXA 3SRVB 1URWA 1P4FA 4I3ZA 3KMMA 3WZJA 4E8AA 2JDSA 2BKZA 4QQJA 4XV3A 4CT2A 5CXZA 4XV1A 1W7HA 1ZRZA 3HRCA 4EONA 3M11A 3S4QA 3TT0A 2Z60A 4HGEA 4B0GA 4FKRA 2OI4X 2R7IA 3T9IA 2ITOA 3D5UA 2XRUA 2KULA 3BBWA 4S34A 4X2GA 5T6KA 3NUXA 4N70A 4Z16A 1VYWA 3FMJA 4AWIA 4HZRA 2YM6A 4UWCA 4Y46A 4PTEA 4YLLA 4UN0C 4YHJA 3SG9A 1M7NA 1P5EA 3EFKA 3I6UA 3HP5A 4LGHA 4N6YA 3NW5A 4G3CA 3RHXA 4IB5A 1K3AA 3BV2A 2Y4PA 4F0IA 4NFMA 3FLNC 4FEQA 4BZDA 1XH8A 1ZYCA 5F1ZA 4ZJIA 1NVRA 4IH8A 3LE6A 3UNJA 3QHRA 3CSVA 3R9RA 4YTCA 5TE0A 1J3HA 3FQHA 4MTAA 4YU2A 4MWHA 3DJ5A 2P0CA 3D5WA 1I09A 2XNMA 2PSQA 4QD6A 2BRMA 2EU9A 3GENA 4S30A 3MB7A 4MBIA 4F1TA 3FEGA 3F3TA 3Q5IA 3VUHA 2QO9A 4ZTMA 3NDMA 3LCOA 1UU7A 1QPJA 3LLAA 4PL3A 5DGZA 5FBNC 3C7QA 3C9WA 3I0OA 2ITUA 4L46A 4RBLA 5HD4A 5IUIA 5ICPA 5F9EA 3ULZA 2W9ZB 3H9RA 2DS1A 4BCMA 5GZAA 2YM5A 3PUPA 4LOPA 2R3NA 3E8EA 4FVRA 2JKOA 2IW6A 2YN8A 3NWWA 4RIYB 2GQRA 4BDKA 4YSMA 3QQUA 4RIYA 2RG5A 5HI2A 5HKMA 3ITZA 2GHMA 3HUBA 2PUIA 4KA3A 1W82A 3FI2A 4FUYA 3HEGA 4DEIA 5C9CA 1U59A 4E4MA 3NCGA 2YJSA 5IH5A 5KZ0A 4ANOA 2R4BA 3C0GA 4KINA 4PL5A 2VTSA 2WOTA 4C8BA 3ZDIA 3Q6WA 3VUTA 1ZYJA 3KULB 4YBKA 3L1SA 4JAJA 3KULA 3AGLA 3QD0A 4DTBA 4DC2A 4O2ZA 3VBXA 3MVLA 4UWYA 4B4LA 4XMOA 2IZSA 5M55A 1CMKE 2BDFA 2C5VA 4M68A 3ZRKA 3ZYAA 4AU8A 5DLSA 4Y95A 3KRRA 4RX8A 4FTIA 4RVKA 4NH1A 2OU7A 3GU7A 3NAXA 3QCQA 1TQIA 4DFZE 3PSDA 3DXQA 4KBAA 2WU7A 4IVCA 3PZEA 4O21A 5GIPE 1PY5A 5CT7A 4OTRA 4FEUA 2C30A 2HW6A 1PMNA 1WBSA 3DLZA 2XYNA 3OW4A 5EYCA 3HV5A 4U6RA 3CCNA 4PRJA 3B2WA 3R1NA 5EW8A 2Y4IB 3SLSA 4F9YA 4GEOA 4X2NA 1ZLTA 4CKJA 2CNUA 4JIKA 1OL2A 3TNIA 4OTHA 1J7LA 4JT3A 3MPAA 5JFSA 3QTWA 3VUDA 1RJBA 3QC9A 4GK3A 1IA8A 3DXNA 3N9XA 1H01A 4I22A 3L9PA 3NNXA 2PPQA 2PUPA 4AGUA 4AGWA 3SAYA 4E20A 4F7LA 3QRKA 4IX4A 4FT3A 2UZVA 2ZV2A 5J9LA 3AC3A 4ZSJA 3OT3A 1JBPE 4FODA 2FB8A 4N4SA 3G9LX 4FL3A 3R1SA 3NMUF 3PXYA 5I3RA 5EG3A 4QTCA 3UPXA 4BBMA 4O7TA 4YZMA 5HNGA 5GIOE 4MXCA 4QT1A 4B99A 4TYJA 3U8WA 3I81A 1BYGA 3OF0A 5HIBA 2C3IB 2UVZA 3PXFA 4FYOA 5DEYA 5EDQA 5HEZA 2XK6A 3FHRA 3OY1A 2O3PA 4FKVA 4V01A 2VTMA 5KMLA 4RJ3A 4FSRA 4C2VA 3ZUUA 3TUBA 2IZTA 2OF2A 3FZSA 3RMFA 2W1DA 4DG0E 2OF4A 5I9YA 1STCE 4Q9SA 5GJDA 2ACXA 3FMDA 4FR4A 3DQWA 4FIGA 3FI3A 4WNMA 4ZEGA 3UJGA 4EK3A 3FL4A 3U54A 1AD5A 3F5UA 5HHWA 3DPKA 4OT6A 4GU9A 4ZLZA 3TWJA 2YIXA 4LOOA 4U42A 3PJ1A 4DITA 1MRYA 1ZY5A 5CU3A 4BFMA 4TTHB 3UGCA 4RFZA 2CCHA 4UZHA 1G8SA 5HORA 3L9NA 3PVGA 3EOCA 3QXPA 4DH1A 3HAMA 2FUMA 2WU6A 4EORA 4FG8A 3ENHA 3QQLA 5HCYA 3MDYA 5CAUA 2JGZA 4CLIA 4FG7A 4GYIA 5LOHA 4KBKA 3BHUA 1AQ1A 2CGWA 3NR9A 1T46A 5DBXA 1CM8A 4I4FA 3EQDA 2XIXA 4FIFA 4TYIA 2ITYA 4QYGA 3KN6A 2OBJA 2XNOA 2ITNA 3DKFA 5IQEA 3NVKI 3MVMA 2W96B 2C5XA 3MH2A 4IZ5A 2A2AA 4Q5HA 4AF3A 3VBTA 1ZZLA 5DR6A 5A4LA 4L68A 1FBNA 1R3CA 4C0TA 4MXAA 4N0SA 3FLYA 3E92A 3BYOA 2BKKA 1XH9A 3EN4A 3QCSA 4HCUA 4FKTA 1VJYA 4KIOA 3CR0A 4BIEA 1S9JA 2P33A 3BGPA 2HENA 3CY3A 3PXKA 4G1WA 3OMVA 2UW5A 3D9VA 5DT0A 4MNFA 2X9EA 1FMKA 3CGFA 1O9UA 3A7HA 4JAIA 4RZVA 3BLQA 3NIEA 1B6CB 4TYHB 4E7WA 4KRCA 5ACKA 2W5BA 4FZDB 4C35A 3C51A 4EOOA 4NYEA 4G9RA 2WOUA 2GNHA 3F5XA 3KU2A 3MY5A 4RWKA 1YI6A 2Z7QA 3QUPA 4AZWA 3T9TA 4K0YA 3BHVA 1APME 3UIBA 1E1VA 3VJNA 3MTFA 2OJIA 1Q41A 4IXPA 3T8OA 2VWYA 1JVPP 5KE0A 4CQEA 2PZIA 3CLYA 4TYGA 4CD0A 1YWRA 1Q24A 4YC8A 4MEDA 3P7BA 4B7TA 5M51A 3EFLA 3HP2A 3ODYX 2XEYA 4AN2A 1M17A 2OO8X 3NUYA 4H05A 5CNOA 2W1HA 3WF5A 4JBOA 2VZ6A 3QUDA 2XJ0A 4O86A 3EQBA 1WVWA 3BYUA 3UP7A 4BR3A 2UW6A 2Y4IC 4GT4A 4G6OA 2Q83A 3DKCA 1PXNA 3M42A 5HVJA 1L8TA 4O82A 5EHYA 5E91A 4BDDA 4HYSA 5HU3A 3QTIA 3U4UA 3TM0A 2VD5A 2QOKA 1VEBA 3LFNA 3PRIA 4G6LA 4RWJA 5DT4A 5EKOA 4NW5A 1YHSA 3EJ1A 4WRGA 1IR3A 2QU5A 3OCBA 4F65A 2F2CB 3MY1A 4LMUA 4MXOA 5LMKC 2BDWA 5EOBA 1KE9A 4CZTA 3ZFMA 3M2WA 2WIPA 3H10A 2EXEA 3WZUA 5M06A 4L45A 4DBXA 2W99B 4PMSA 2UZLA 5A6NA 2C6KA 3CQUA 1LR4A 2IZRA 2A27A 4RZWA 5J5SA 3LPBA 4J96A 2ZYBA 2GMXA 5FDXA 3WE8A 2UW9A 5I9UA 4U3ZA 4XLIA 3G90X 2B55A 3R2YA 4CMUA 4A9UA 5IH4A 1OL5A 1A9UA 1MRVA 3FPMA 3HA8A 4NT4A 4BICA 4P5QA 3AG9A 4F1OA 5HX6A 2VNWA 3LFCA 3GOKA 4ERKA 4USEA 3NW7A 1IAJA 4XG7A 4ASZA 2YIWA 4BI1A 3VNTA 2RFDA 5M07A 3JUHA 3UNKA 3F66A 4KWPA 4AZFA 3MJ2A 4FKJA 1EH4A 2X1NA 1TQPA 4IDTA 5CSPA 4G9CA 4QTAA 2R3KA 5F20A 5TR6A 4BCQA 5CALA 4YJTA 3HRFA 3FC2A 2CN5A 2XZSA 1WFCA 5AP5A 4YGAA 4C3PA 3LCTA 2VTIA 4AW2A 1PMEA 5C27A 5FM2A 4FKIA 4QMUA 2G1TA 5E1SA 2WTCA 3E93A 2YLFA 4YJQA 5HLNA 4XRJA 5JZJA 4DH3A 4GJ2A 4KIKB 4KIKA 1J1CA 4BWXA 1QPDA 4EH3A 4Z7GA 3UIMA 5FLFA 5EM6A 3TACA 3ZZEA 4D9TA 5DN3A 4AFEA 1W84A 1ZMWA 2CKOA 3NX8A 1J7IA 5B2KA 4KSPA 1G8AA 1H1PA 2X2KA 4YBJA 3HKOA 4ZTQA 3REPA 4NJ3A 3HV3A 3BQCA 4ID7A 4RJ5A 4JI9A 3EB0A 1Q8YA 1YQJA 3VQUA 2HXLA 4S32A 1YWVA 3ALNA 3LFFA 4KNBA 3FAAA 3SOAA 1QPEA 3Q4UA 4NTTA 5TOZA 1H1QA 1TQMA 2NP8A 4KBCA 2RSVA 3PWDA 1Y6BA 3ENMA 4C58A 3FKLA 2ITPA 2PVYA 5L3AA 5HE2A 4E4XA 4R7BA 4JQ8A 4W4WA 4A9RA 4I0TA 2PVNA 3LMIA 4X3FA 1CKPA 4R3RA 5JT2A 3AD6A 4PDSA 1U5RA 1OPJA 5CEMA 5CEOA 4MH7A 3MN3A 4QYYA 3UMXA 3UZTA 2R9SA 4F6UA 1FINA 4FKOA 5HTBA 4O1OA 3EYGA 1PRYA 1KSWA 3WBLA 4YJRA 4HCTA 5IEYA 3OCTA 2HXQA 2VX0A 2JEDA 5IUHA 3KGAA 3H3CA 4BCIA 4W4YA 1SYKA 2BAQA 3FI4A 4AT3A 5CASA 4XRLA 3RI1A 3WI6A 4LUEA 5HO8A 5ETAA 5CI6A 2B4SB 3WILA 4U7ZA 4NCTC 4FC0A 1JLUE 3LMGA 4YHTA 1YDRE 4RC2A 3BWFA 3ZZWA 2OJJA 3R8VA 3NLBA 4ZTSA 3IS5A 2C5YA 5ANGA 3UOLA 3W2OA 5DWRA 1OGUA 3MY0A 4GL9A 4NFNA 3TNHA 3NYVA 4EUTA 1WBWA 3BX5A 3DTCA 4EBVA 5LXMA 4IHPA 5DA3A 3ZH8A 1W0XC 2C6LA 3MFSA 4TWOA 3QX2A 2B9FA 3KFAA 5H3QA 5BVNA 3QZFA 4AX8A 4GKIA 1O6KA 2GS2A 2FGIA 3QCXA 1CSNA 4HCVA 2HZIA 1PXLA 2QKRA 4E5BA 3IOKA 1PXKA 3O8PA 2X7GA 5AR4A 3WZEA 4AT4A 5B0XA 5GINE 2C0TA 4GG5A 4YPSA 3RPRA 3O8UA 1WVXA 3BE2A 3GCUA 4R8QA 5I9VA 4C36A 2V55A 2PVLA 2ETRA 2WEIA 4KSQA 5E8UA 5IA4A 1F3MC 4FF8A 3C0IA 3I5NA 3FMKA 4ACCA 2ITQA 2YAAA 3QBNA 4FTUA 4IWQA 3W8QA 5IQHA 3MW1A 3CTJA 2PUNA 5HG5A 5A4EA 5KO1A 4I1ZA 3CP9A 4EZ3A 3OVVA 3HGKA 4JG7A 5ITAA 2IWIA 4I20A 4RA4A 5H9BA 4G3GA 3Q4ZA 2GU8A 2WMTA 4QQCA 4YNEA 5BVOA 3W2CA 3F5GA 4OTFA 3ZO2A 3F2RA 3MPTA 3AD5A 3FQEA 3QU0A 4U80A 4RQKA 4UEUA 4K11A 1J7UA 3N4VA 4DGGA 4MD8E 5FEDA 3S00A 5L2WA 3DKGA 3GCQA 5IPJA 3TTIA 5LVOA 4UMTA 5CANA 4UX9A 3E7OA 3HVCA 2YLEA 4TWPA 2F2UA 3DY7A 5ANOA 1UNLA 3MFTA 1O6YA 3COKA 3ZLXA 4HPTE 1Y6AA 1OI9A 2OFVA 2UW4A 4XJ0A 3V5WA 3I7CA 5IEVA 4IQ6A 2I0HA 5JQ8A 4EBWA 4YSJA 2RF9A 1REJA 4BCGA 1XBCA 1BI7A 3PXRA 2J6MA 2V22A 4MWIA 5FM3A 3MFUA 4F9WA 2QQ7A 3FY2A 3HUCA 4WBOA 4BTMA 3UQCA 3CQWA 5AR3A 1WZYA 3BEGA 3Q6UA 4IAZA 5G6VA 3RZFA 4CMTA 3KF4A 3HMPA 3P08A 3AQVA 2VX1A 1MUOA 2Y0AA 4HNFA 4OBPA 2WAJA 4NSTA 3PA4A 4QMZA 5LWMA 2WO6A 1Q99A 4V04A 2JBPA 2I0VA 3P79A 4AXAA 3EZVA 5AP6A 5BYYA 5KUPA 3COMA 3O50A 1CDKA 4ZSGA 4NM5A 1U54B 3QLGA 2XJ2A 4XS2A 1U54A 2E9OA 2UV2A 4BCKA 4DCAA 4O7WA 4CG9A 3R6XA 1OIUA 4ANNA 4KKGA 4P2KA 4KS7A 2X8IA 2VRXA 4JIAA 5H8BA 2VN9A 4PP9A 4BBEA 2CKPA 3LFEA 4PPBA 5DG5A 5HCZA 4IM0A 1Q61A 2ITZA 4ZSLA 5CXHA 5HNBA 2BRGA 2C69A 3MBLA 3R7YA 5BX0A 4APPA 5EQEA 1YI4A 3HECA 1FGKA 4BKZA 4D5KA 1JAMA 2XJ1A 4QMXA 5HX8A 2IJMA 3QHWA 4U43A 2B0QA 4ASEA 3CXWA 4RVTA 3HV6A 4HGTA 4PP7A 5A4TA 3NVMB 4LGGA 1YXTA 4NKAA 4XH6A 5AADA 4DFXE 4RVLA 1WMKA 3PY1A 4I94A 3T3VA 1MP8A 4NL0A 2PE0A 2QOBA 2H9VA 4FV0A 4HZSA 5ANDA 3DLSA 2XKFA 4D2WA 4NM7A 4CFUA 3UG1A 4ZSAA 1H00A 2ERZE 3WIGA 4DAWA 1OITA 4LI5A 1GIJA 1HCKA 5LWNA 1KV2A 3BELA 4BCHA 2C6TA 5D9HA 2BZKB 2CGUA 2JBOA 3PZHA 3R9OA 4CRSA 3O71A 5CEPA 3Q53A 5JRSA 3L9MA 4Y85A 2F57A 3FKNA 4DA5A 3GFEA 4A06A 4E73A 3OW3A 3OOMA 2PZ5A 3FMEA 4FTMA 5HO7A 3GBZA 3A4PA 4O91A 4GYGA 5AP7A 2BMCA 3EQGA 3ATTA 4CLJA 5KMIA 4WNKA 5IA1A 1IA9A 4XP2A 5HIEA 3CS9A 1OPLA 3AC2A 3ORIA 5CF8A 3I60A 3ZCLA 2CN8A 3VW8A 4GUEA 2QONA 3KRJA 3LFBA 3TIYA 4UZDA 3MH3A 3DCVA 4JL9A 4ANQA 1WBNA 2NRUA 1H0VA 3IK3A 4IIRA 2XS0A 3W2PA 3OZ6A 3BE9A 1GZ8A 4EQCA 4MNEB 3PYYA 4QMTA 4WD5A 4XV2A 4MNEA 3SC1A 3E8NA 4CZYB 3FUPA 2J5FA 1JSTA 2XIYA 5IQAA 3ZSIA 3C4XA 4YTIA 5AFVA 4WUNA 3OT8A 3TZMA 1ZYDA 3PDTA 2YA9A 1DS5A 3NYXA 2HCKA 4A7CA 1Z9XA 4I4EA 1RQQA 2JKQA 2J7TA 2YM3A 3QRTA 3DBQA 4A4LA 4AA0A 4ASXA 4NEUA 3D2KA 3DNEA 3KMUA 4JDKA 4ACMA 3LJ0A 5I0BA 3DK6A 1V0PA 4HYHA 4OLIA 4CFNA 3PIZA 3UO6A 4AUAA 5HQ0A 4FV3A 2W7XA 2B54A 4D1XA 5AA9A 3BYSA 2OK1A 3I0QA 1YOJA 1ZYSA 4CCBA 4PY1A 5H2UA 4PX6A 3QTRA 2GFSA 3IECA 4F7SA 3VJOA 4LGDA 2X8DA 3KA0A 5FP5A 5CF5A 5M09A 5IQGA 4X21A 4EOJA 1DM2A 2ZAZA 4ZP5A 1Q8WA 5DYJA 2YHVA 3FHIA 5FGKA 3AC1A 2ZOQA 4CTCA 5EI8A 3VC4A 2RG6A 4XOZA 3BV3A 2WMQA 2XK9A 4IEBA 2AYPA 4M12A 1S9IA 3RGFA 5JK3A 4DTAA 2JAVA 5HO6A 5ANJA 3Q52A 4CMOA 3WOWA 2RGPA 2YCSA 3DDPA 3BIZA 4II5A 4QP6A 2WMBA 4WBBB 3FZTA 2XEZA 3S0OA 4ACGA 1J91A 1XBBA 3A99A 1Y8YA 2PZRA 2E9NA 5F94A 4F99A 4ZS4A 4AA5A 4MXZA 5C8KA 3CKXA 4FMQA 1V0BA 3N51A 3GFWA 5K0KA 4ZJJA 4FK3A 4TWNA 3ZDUA 4BC6A 4D1ZA 5C8NA 1LEZA 4XG8A 1PXOA 2GSFA 1PYXA 1BL6A 3W2SA 3NS9A 4FZFB 3VS6A 4NWMA 4E6DA 3C1XA 3F88A 3ORPA 3ACJA 3ALOA 3VN9A 1NW1A 2WQNA 3HDNA 2G2FA 4XP3A 3GU5A 4WT6A 3QWJA 2PZPA 4X2JA 3R1YA 3CTQA 5KBRA 3KVXA 5BUIA 2J9MA 4EK5A 3COIA 3EFJA 2R2PA 3SDJA 1ZOEA 3JY0A 4O7ZA 3P7CA 3TKIA 5AAGA 2OJGA 1MRUA 2UZUE 4F9BA 3FDNA 4IAYA 1MQBA 4XBRA 3DK7A 3KF7A 3CEKA 5IDNA 4EOPA 4J8MA 5JRQA 4YO6A 4CEGA 3AMAA 4UXQA 4QP7A 3COHA 1TVOA 2HAKA 2UZWE 2YCRA 2QCSA 2UW8A 2BALA 3LLTA 3QAME 4NIFB 4EH6A 3A7GA 4NIFA 4BDGA 5E4HA 4G3EA 5E8YA 1M2PA 3JPVA 3QQJA 4CFVA 2J0IA 3PRFA 4EJNA 5AIKA 2GS7A 3BU3A 4FV2A 4PDOA 4RRVA 3G6HA 4B8LA 3FPQA 4YZNA 3EN5A 5J7HA 2RKUA 1DI8A 3GC9A 2QOOA 5AP1A 4ZTNA 2YISA 1PF8A 2GS6A 2PVMA 2WHBA 4AAAA 3OOGA 2YERA 4NUSA 3Q5ZA 2PMLX 2ZVAA 4LRMA 3R9HA 2WTJA 4GUBA 4AGDA 4O38A 4A9TA 3VS7A 2HZ4A 3MPMA 4X3JA 5IQDA 1AGWA 2CKQA 2X0GA 1ZMVA 3FZOA 4FNWA 4CYIA 4U0IA 5JFWA 5IQIA 2KTYA 3RINA 2G2HA 3WF6A 3IG7A 2R7BA 1DI9A 3LXPA 1H24A 3I79A 3BU6A 4NW6A 4Q2AA 5CU2A 5L2IA 3OTVA 4RLLA 4BDJA 2PK9A 3ORXA 4BKJA 5ETCA 4O83A 1OZ1A 4XBUA 4XEYA 4AZVA 5CU6A 2CCIA 4IAAA 4QTBA 3ROCA 3RK5A 2QOIA 3LQ3A 5EKNA 4UMQA 4YZDA 4U41A 1GZNA 2WMWA 2CMWA 3AT3A 3AC8A 5I9ZA 2RL5A 1RDQE 4FT7A 1M2QA 2Y6MA 1H25A 2WEVA 5CVGA 4F08A 2PVRA 4QTEA 5E8TA 5CQUA 4L44A 2GNJA 3NPCA 2YAKA 4FTQA 5D10A 4BZNA 1YOMA 2JDTA 2VU3A 3TV6A 1H26A 3FY0A 5A6OA 1GIIA 2YZLA 3RPOA 5FTOA 3LXNA 4W4VA 3PPJA 5BVFA 2IVUA 2VTRA 3C4ZA 4JS8A 3VWAA 3QRJA 5D41A 3SXFA 4K8AA 2R5TA 3HZTA 3FLQA 5L8LA 3LOKA 4LL5A 4QPMA 2EXCX 4U81A 4EC8A 2QU6A 3KXNA 3SA0A 2CNVA 5B2MA 3TTJA 5LCKA 4TZRA 4HVHA 3AGMA 4U8ZA 4FGRA 4RG0A 3IDBA 4KABA 2LAVA 3NCZA 4IX6A 5CAVA 2PULA 3RCJA 5EFQA 1QL6A 4FV4A 4Q5EA 4M15A 2UVYA 4H39A 3G15A 4R7IA 2V62A 2WD1A 4QMYA 5L2QA 3VS2A 3QTQA 5I3OA 3R63A 2E9UA 2XCHA 5D12A 2GNFA 4BGGA 4LFIA 2Y9QA 4HOKA 4GS6A 2R3PA 5IQCA 2W4JA 4YPDA 5ANEA 4D28A 1YRPA 3KXMA 4FKUA 3EQCA 3AD4A 4J98A 3U6IA 2REIA 4JBPA 5CYIA 1Y91A 3VVHA 5AV1A 3LW0A 4ZOGA 5CU0A 3RPYA 3SKCA 4XYFA 2ZDTA 4Z9LA 4AGCA 5HBJA 4DH8A 5I9XA 3FMMA 5LQFA 3O7LB 1H28A 3R00A 3ZEWA 4IJ9A 4P7EA 4CV8A 3PPZA 4IZYA 3UQFA 3F7WA 4OAVB 3HAVA 4TL0A 1IG1A 2VWZA 4OR5A 4YMJA 2XB7A 4TNDA 3AT4A 3L8VA 2HK5A 3I7BA 4JX3A 4RPVA 3KXXA 5FXSA 1XH7A 4PMTA 2ZM4A 3KRXA 1GZOA 3PSCA 3O8TA 3ORNA 2UW3A 4XG6A 5ETFA 3H4JA 2BILB 1Y8GA 1Q3DA 3GT8A 4TN6A 4G31A 2R64A 4OTQA 3SHEA 2ZDUA 1U4DA 2YZAA 4EHZA 5J5TA 3K2LA 4O0YA 2HZ0A 1G5SA 3ETAA 4ZJVA 4FEWA 3DOGA 2P4IA 3II5A 4UBAA 2WTKB 4IM3A 2VV9A 2VTNA 1SNXA 2Z7SA 4I0SA 3V5TA 3ZU7A 4FT5A 4HW7A 3ZUVA 1CTPE 3F3VA 5CLPA 1VZOA 5EDRA 2EB3A 3MGYA 4WUAA 2JAMA 2VTAA 3JR1A 3C0HA 4BTFA 1BX6A 2GNGA 4FNZA 5BVWA 3NRMA 4DINA 3KMWA 4J7BA 4M97A 3QX4A 4BTJA 4F4PA 4ZLOA 2F7ZE 3ZONA 4C2WA 2JD5A 5C8MA 4FZAB 5T68A 2CSNA 4C4EA 4BYJA 4FTTA 1LEWA 4XOYA 3CY2A 3EHAA 4ZTLA 3PVWA 5D1JA 5HCXA 4DF3A 4CGAA 2OZOA 1YXXA 2BTSA 1Q4LA 1R0EA 4M3QA 3UZRA 3CC6A 4A9SA 2WIHA 2VWWA 1UNHA 3IO7A 4FV9A 4G6NA 5KKRB 4KD1A 2I7QA 2QD9A 3QQKA 1ATPE 5AV3A 5HGIA 2XKCA 3AC4A 4LYNA 3PA3A 4MVFA 5JN2A 2YEXA 3PJ3A 5EH0A 1Z57A 4YC6A 5AA8A 2QR8A 3FZPA 3QYZA 1F0QA 1SMHA 5M4FA 4QMWA 4L52A 4BN1A 5CSHA 1VR2A 3NYNA 3VS3A 5JGAA 1QPCA 2R3MA 4D58A 5GJGA 3C5UA 2CPKE 2QO2A 3VUIA 5K5XA 3WZKA 2NO3A 2JIVA 3VBQA 2YM4A 4I5CA 2W17A 3VBWA 1WBTA 4J97A 4MYGA 3PJ2A 1UVRA 4L9IA 3DBEA 2J90A 2HY81 5DRBA 5AUWA 4J53A 5FXRA 4DFUA 4FBXA 2ONLA 3GU4A 2YITA 2PVKA 4LOQA 1U46A 2BIKB 3GCVA 3QALE 5T3QA 3V6SA 4RX5A 3GC8A 5KMMA 4FE2A 2C5OA 5EHLA 4WG4A 5IA0A 3KXGA 1DAWA 3LZBA 4FZ7A 5C03A 3W10A 3LVPA 4ANLA 3K3IA 4O7LA 4ITJA 2JFLA 3UVRA 4R5SA 3GU8A 5L4QA 1UV5A 4R77A 3BLHA 4MCVA 4AA4A 4IC7A 3G5DA 1ZYLA 2C5NA 2UZTA 3DKOA 4MBLA 5FEQA 4UY9A 3V51A 3H30A 3V01A 3UPZA 3P5KA 1ERKA 2BZHB 4CFXA 1BUHA 3LFSA 5HOAA 4QMMA 4U44A 5BMSA 3UO4A 3OWKA 4MK0A 4TRLA 5HG7A 2W4OA 3WYXA 5HNIX 3SW7A 3W33A 4HNIA 5LMBA 3A8XA 3VO3A 2VWIA 4AZTA 2PVHA 1PMVA 4WG3A 3QTZA 3TKUA 3VHEA 3VF9A 4OW8A 3UDBA 4APCA 3W2QA 5HLWA 3SGCA 4D0XA 2ZMCA 4RX7A 3GVUA 4G16A 4U9AA 3ODZX 5CEIA 3R71A 1OPKA 1SNUA 3QGYA 4EH7A 4FIHA 3GC7A 4OTDA 2CJMA 2CHLA 2ITTA 2NPQA 2XF0A 4E5WA 4C61A 5B7VA 2R3QA 4YJVA 2UZEA 4YHFA 5E9EA 4FL2A 4OBQA 4DEHA 4TXCA 3ORKA 4DCEA 3TCPA 3OUNB 4GT3A 4O0RA 2XNNA 3D4QA 5AX3A 3ZFXA 4C3FA 3ZSHA 3ACKA 3MTLA 3VHKA 4USDA 4IX5A 1OKYA 2QLQA 2R3OA 5TKDA 4M69B 1B39A 2Y6OA 4ZS0A 4L3JA 4M69A 2EUFB 3LFAA 5IA2A 4F0GA 3LCSA 3GOPA 3P9JA 2LGCA 4M0YA 3F3UA 3SW4A 1KE8A 4JR7A 4YJNA 1IRKA 5K0XA 4JJRA 1KOAA 4W9WA 1YXUA 4YTHA 5DI1A 3D5VA 1KWPA 2XKDA 1NVSA 3NNWA 4M8TA 5L6OA 1JOWB 3ZUTA 4QP4A 5JFXA 3RKBA 3R01A 4L3LA 4R78A 5GHVA 2FA2A 2XCKA 2GDOA 3QTUA 4R1YA 2ZM3A 3FYKX 3LHJA 3DT1A 4FIJA 4CRLA 4DEDA 5C1QB 4I0RA 4HVSA 1WBVA 3HMIA 4QMOA 2QHMA 4QNAA 3IONA 5LCJA 1OKWA 3DFCB 2QURA 1DAYA 5D11A 4ZY5A 5JFVA 4O7SA 4QNYA 3I4BA 3UTOA 4O7YA 3IDCA 5ACBC 5IH6A 5E1EA 5A4QA 5TO8A 2H34A 2Y7JA 3ELJA 3GC0A 4C3RA 4EH5A 2IVTA 4O27B 5L6PA 4U97A 3HDMA 3GI3A 4NTSA 2YABA 2UZBA 2WMVA 3OD6X 4TW9A 1H4LA 2DQ7X 2BTRA 3MVHA 4HYIA 4X3FB 2DYLA 2PE2A 3C4CA 4AN3A 4BWPA 4BZOA 4OUCA 4OGRA 4CTBA 1OUKA 3ZLWA 4LM5A 4IB0A 4RWIA 5BYZA 3SOCA 3ZFYA 3ZXTA 5CTPA 4BWKA 4UYNA 3DZQA 1KE5A 3ZOSA 1PJKA 5KMJA 3TZ7A 4R3CA 4XG4A 2WELA 4XNEA 4O7NA 5FUTA 3BEAA 2PUUA 3TV7A 3A60A 4OT5A 4EOQA 1YXVA 4EH2A 3R83A 3TNQB 1OL6A 3L9LA 4FTOA 3MVJA 3C4WA 2OXDA 1R0PA 2O65A 1W98A 3HL7A 3QQFA 5DEWA 1YDSE 4MQ2A 3UOJA 5JQ5A 2QOCA 4DFYA 2X81A 2VAGA 4CKIA 3KQ7A 2BROA 4GCJA 5EOLA 4YO4A 5CQWA 4QTDA 4QQ5A 3UNZA 4DFBA 2OKRA 2RFNA 3I1AA 3R7OA 2AUHA 1GZKA 3PP1A 3ZM9A 4DGNA 3R8MA 5AP0A 4M14A 3DAKA 3LJ1A 4OBOA 2EB2A 2G9XA 4AN9A 3Q4TA 4MAOA 3H0YA 4X7QA 1VYZA 4G3FA 5FXQA 3VUGA 4PNIA 4DHFA 5E8ZA 3R2BA 2R3LA 3UC3A 5CF6A 5AUUA 2YWPA 2XA4A 4L67A 4L8MA 4E4LA 5HTCA 5IG1A 4CYJA 4NJDA 5EYMA 4UMUA 3U9CA 3BI6A 1R39A 2WMXA 4BDCA 5HVKA 1XJDA 3Q9WA 5A54A 5HG8A 3BGQA 4HGSA 2C47A 3CJFA 4TWCA 3HV7A 4G5PA 3UVPA 2IVVA 3N4UA 3KC3A 4L6QA 1LP4A 4DE4A 5DOSA 1UWJA 3G33A 2WMRA 4S33A 5TF9A 4EC9A 2H8HA 2JFMA 4IZ7A 3ZC5A 4EYJA 3TUCA 4ZY4A 3QD3A 1OM1A 3UP2A 5JSMA 1NA7A 3EN7A 3SXSA 3VRZA 2BRBA 5E8XA 4ZXTA 3UBDA 5AX9A 3UO5A 2F7XE 2VTPA 2IO6A 4I93A 4FOBA 3HV4A 4X6QC 4ZTHA 4L43A 3D94A 4NK9A 1OUYA 4UXLA 4DN5A 3TIZA 3QD2B 4DT9A 4WNOA 5CSWA 5M4UA 4EI4A 2AC5A 4HVDA 1OL1A 2YIRA 2WTDA 3GQLA 4N6ZA 2E2BA 3B8QA 3DGKA 3EQRA 4O0XA 5CSVA 4C02A 4D0WA 4Z3VA 3I6WA 2WQOA 3RJCA 4BGHA 2CGXA 4EKKA 3DAJA 1FVTA 2VWXA 3EQIA 5DPVA 5IA5A 3DQXA 3EMGA 4BDAA 1YHWA 3U4WA 4FVPA 2OXYA 4RIOA 2W1CA 1OVEA 3EWHA 4K18A 2XK8A 4AE9A 4EH9A 3TUDA 2PTKA 5C4KA 2SRCA 3W16A 4FA2A 2WQMA 5LVMA 5E8SA 4WSYA 3ZMMA 2W5HA 4TPTA 3OUKA 4H58A 5EM8A 2JITA 4ENYA 2BFXA 4FV7A 3RAHA 4BCFA 4QMQA 4FX3A 5BMMA 2VUWA 3PLSA 4U79A 4EHGA 3WE4A 2YDJA 3FI8A 2XBAA 3ERKA 2XP2A 4LMNA 5CNNA 4O7RA 4BDBA 5BVEA 5HIDA 4DH5A 4UMRA 4JVGA 3LQ8A 4WSQA 4EKLA 3EYHA 4BCOA 2QI8A 3D7ZA 4F9AA 2YACA 2XNEA 2X7FA 3IGGA 3OXZA 2UZDA 5AR7A 5EW3A 5BVKA 3KK8A 2W1ZA 3R21A 3JY9A 4AOIA 1CKIA 2YM8A 5HLPA 3LXKA 4QP2A 5KX8A 2R3GA 3OXTA 5K9IA 3VS0A 4J95A 1P2AA 2I6LA 4BDEA 3IW8A 2FSTX 3EQFA 3EH9A 3L8XA 3FLWA 5H8GA 4BKYA 3P78A 2WGJA 4ZAUA 2W05A 4CXAA 5CVHA 4TY1A 3IPHA 4L7SA 4FKWA 5AAFA 4GKHA 4PDPA 4PF4A 4FK6A 4RC4A 5KCVA 1YOLA 3OWLA 4IZAA 3RM6A 4U40A 1IEPA 3V8WA 3VBYA 2IW9A 3RNIA 4JR3A 3K5UA 3E88A 4X3FC 3C4EA 2GHLA 3LAUA 2A1AB 3NUSA 4EOIA 4FSWA 1SM2A 2QHNA 3LQ5A 3O7LD 3OBGA 4FNYA 4GVAA 4NM3A 4E6AA 4AOJA 5CY3A 4RWLA 2QKWB 5E90A 2W0JA 4G34A 5IQFA 1ZWSA 4GVJA 5HESA 4KS8A 2O8YA 3DAEA 2CNQA 4X6RA 2CGVA 2FVDA 4CVAA 1QCFA 4Y83A 3OP5A 5IQBA 1H08A 3HYHA 3DJ7A 4FV5A 5IUGA 4NKSA 4GH2A 3L8SA 3E3BX 4FKGA 4ANSA 4B6LA 5FDPA 5I9WA 4FL1A 3QYWA 3OFMA 4Y8DA 5E8VA 4ACHA 5AMNA 3G2FA 4L3PA 3OS3A 4I6HA 4ZZOA 4ZLYA 4BI0A 4BIBA 2B9JA 5FTQA 5ANKA 2FH9A 3RPSA 3U87A 3G6GA 1ZOGA 2JDRA 1OBDA 2ETMA 2FYSA 3L8PA 4LL0A 4RX9A 5FP6A 3LFQA 2W1EA 3R02A 4JBVA 4QMLA 3UE4A 4BYIA 3R22A 1HCLA 3RAKA 4DEAA 3LM5A 5A14A 3NW6A 5I4NA 2HYYA 3NNVA 3BRBA 3PG3A 3NUUA 4YLKA 1Q62A 1V1KA 3QZIA 5AUYA 1JSVA 4C62A 3FV8A 4F1MA 2UZNA 2C6MA 1OBGA 3OC1A 5AUVA 1NT2A 3F6XA 3D7TB 3FLSA 4QRCA 4K77A 3D7TA 3ZEPA 4DGMA 1PXJA 3MSSA 3UQGA 3KRWA 2E9PA 4CQGA 5FQDC 1M7QA 3R9DA 3E8DA 3TJCA 3W55A 2XH5A 2A19B 3F2AA 5EK7A 5C01A 4IB3A 3AXWA 4XUFA 3O51A 5G1XA 2YJRA 5HU9A 3QKLA 4FKLA 4FEVA 3E62A 4IJPA 4FKSA 2GPHA 1M52A 4FNXA 2WB8A 5EDPA 2PMNX 5IDPA 5J9ZA 3NZ0A 4ITIA 5HE3A 2XNGA 1IASA 1UWHA 2ZB1A 3PLAE 3KRLA 3ZBXA 2NNWB 4YUQA 5K4JA 4PUZA 4MXXA 5HD7A 4JOAA 2FSMX 2XYUA 2H96A 3PXQA 3V5PA 1P4OA 4BHZA 5LVLA 3CIKA 1PXIA 4IAIA 3SXRA 5EYDA 3FLZA 3PA5A 4XG3A 2ZV9A 3G9NA 3ORTA 3PE2A 4RA5A 5CU4A 4YURA 3BHTA 3WZDA 4DBNA 4Q9ZA 2XM8A 3MYGA 3WIKA 3D14A 3CTHA 4KIPA 5DNRA 2HWOA 3TKHA 3ZM4A 3BZ3A 2QNJA 4JX7A 2OICA 2X9FA 3MI9A 2UVXA 1UU9A 1TKIA 4V0GB 1WBOA 4Y73A 4V0GA 5L2TA 3LKMA 4D4RA 1J1BA 3JXWA 1JQHA 2BVAA 3Q2MA 5CZHA 4ALWA 3QKKA 4FICA 4JQ7A 4N57A 3DZOA 2B1PA 4BY9E 3G51A 3NYOA 3D5XA 4YTFA 4X0MA 4EZ7A 4CFWA 2V5QA 2J0JA 4E6QA 1UKIA 2XIZA 3DTWA 4GIIA 4BVUA 5K4IA 4I5PA 1L3RE 2ZB0A 2BDJA 4K1BA 3PVBA 5BUJA 2GQGA 4I24A 4AT5A 1XBAA 4D4VA 4PL4A 4IE9A 4QMPA 4XHKB 1GY3A 3A7FA 4I41A 4L01A 3RWPA 3SRVA 3RVGA 2XUUA 4OTWA 2IN6A 4DLIA 3P0MA 3DBCA 4AW5A 4O81A 3DV3A 2WQEA 3K54A 4G5JA 5M56A 1REKA 2PY3A 2QOQA 5GNKA 3R8UA 1QMZA 3R73A 3W32A 4P4CA 4JG8A 4CFMA 4EZ5A 2FO0A 5FEEA 5IMEA 4K2RA 3G0EA 2C6IA 1UU3A 4RIWB 4D2TA 1OMWA 4EOLA 5J87A 4RIWA 3NGAA 3QRIA 4H3QA 2C6OA 3KL8A 3A7JA 2XNBA 4RLKA 5KHXA 5J1VA 2XK7A 4P5ZA 3DK3A 2H6DA 3DBFA 3K3JA 4JDIA 1FPUA 3F9NA 3QWKA 3P1AA 2Q0BA 4YZCA 1PKDA 5LMAA 3VS1A 3V6RA 4F7JA 1ZY4A 1H1SA 3IOPA 2I0EA 4XV9A 1W83A 2V7AA 4R6VA 5F4NA 3OY3A 4UV0A 5DHJA 3B8RA 2GNIA 5CAPA 4O0WA 2R3HA 3R8LA 5ETIA 4E6CA 5GJFA 3FBVA 5AM7A 5JMSA 4RJ7A 3CD8A 4BF2A 3DFAA 2Y8OA 4HYUA 5B2LA 1ZOHA 2C4GA 2UUEA 3A8WA 5IMXA 2UW7A 3TI1A 3FZRA 3P23A 1JKTA 3P86A 3ROYA 5HBHA 4BCPA 4DTKA 2XK4A 3Q60A 2J0MB 3BLRA 4RSSA 4B8MA 4BRXA 4EOSA 4QOXA 4JDJA 2CKEA 4IM2A 4WNPA 4CSVA 5JGDA 3Q9ZA 3EFWA 1KOBA 3QTXA 4FSUA 5A9UA 2OLCA 3BYMA 1OKVA 4BBFA 3UOKA 2A4LA 4FOCA 4WOVA 4RC3A 3V04A 2ZM1A 3D15A 4U45A 4R3PA 4O22A 3DDQA 4JNWA 3ZO3A 3ZO4A 5AUTA 5CAQA 3PIYA 2W1IA 4K33A 3TZ9A 4FTJA 4L42A 2X4FA 2IW8A 3E63A 3RK9A 2C3LA 3TG1A 3SV0A 1F5QA 3V3VA 3RCDA 3FXWA 3BKBA 2CLXA 3EQPA 3ET7A 5DE2A 4U3YA 3SG8A 3W2RA 3NAYA 4D4SA 1OB3A 2HIWA 4FV8A 4AG8A 2QC6A 5EHOA 5IZFA 3QC4A 4X2KA 4QQTA 4ANBA 3NIZA 3QFVA 4RJ8A 4Y72A 2GQSA 4YR8A 3FKOA 2O63A 1H07A 3V5QA 5KMNA 3C5IA 5D7VA 4FTCA 4GK4A
chains in the Genus database with same CATH superfamily
2XIKA 5C26A 4DDGA 3CGOA 5LVPA 2J50A 3MS9A 3R30A 3VS5A 4ZMEA 3RP9A 1XH6A 4YNOA 3PJ8A 4EYMA 5CEKA 5IISA 4CFFA 3GEQA 3RHKA 5KMKA 2YM7A 2ETKA 3AMBA 4Y5HA 2WMAA 3TEIA 2AQXA 3LMHA 4BL1A 2OJ9A 2R0UA 4GRBA 1SVEA 4IVDA 4GSBA 1V0OA 1ZZ2A 2YDIA 2VTQA 3QRUA 5HE1A 1R78A 5CF4A 2EWAA 4I23A 4FV1A 4ZTRA 4FI1A 2JC6A 3E3PA 5FD2A 3T3UA 3QZGA 4C4JA 3ZRLA 3HA6A 2P2HA 3NUAA 3OHTA 2XRWA 3MJ1A 2PL0A 3FJQE 1UNGA 4OTIA 1Q97A 4EQUA 4IFCA 4FTRA 4L00A 2O5KA 1JNKA 3TL8A 4UMPA 3QUEA 3UMWA 4RIXB 3MA3A 3TXOA 4H1JA 4RIXA 1SZMA 4NZWB 5AP3A 4DG3E 4E93A 4AS0A 2WMSA 2BAKA 2C1BA 2VGOA 5CT0A 4BJJB 2X2LA 3QTSA 2WQBA 2R0IA 4J52A 2OH0E 3UOHA 4BJJA 4AP7A 4ENXA 2WTVA 4FGBA 2JDVA 3DB8A 4J1RA 2OFUA 4PTCA 4GG7A 2B9HA 3Q2JA 4LV7A 1O6LA 4HVGA 1KV1A 3O2MA 4AQCA 4DGLC 5LMKA 2YDKA 4FSTA 3ZXZA 4F6WA 2C0IA 4PNKA 5AUZA 4FEXA 3OG7A 3CPCA 2VTHA 2ZV7A 2X0OA 3KVWA 1XHAA 3U51A 4ZK5A 4ZSEA 1HOWA 1NVQA 4S31A 3IW4A 4IX3A 3RM7A 1UKHA 4FTKA 4BI2A 5AV2A 3ORMA 4XCUA 1BKXA 3QA8A 3Q4CA 1RW8A 4DFNA 3R1QA 2R3FA 3R7UA 4ZIMA 4R1VA 4XG2A 1GOLA 4H3PA 3V8TA 2F4JA 2IVSA 1OIRA 4H1MA 3UVQA 2ERKA 5FWKK 2J4ZA 4GU6A 3KCKA 5DH3A 5CENA 3LM0A 3TNPC 3R8ZA 2XBJA 4YP8A 2XNPA 4BDHA 4HJOA 4KIQA 5L2SA 3VUMA 4IAKA 2FSLX 5EM7A 5J7BA 3U55A 3Q32A 4RQVA 5AIRA 1XKKA 2QOHA 2VWUA 1FGIA 4KB8A 2VX3A 3TN8A 4D55A 4O6EA 5BQ0A 2VTOA 4MXYA 3EKNA 4UWBA 3TDWA 2WTWA 4RT7A 3SX9A 3RALA 3WF8A 4E1ZA 3B2TA 2OJFE 2X6DA 4KRDA 3R7VA 4F64A 3PFYA 3TNWA 3LFDA 4E4NA 3MESA 4AE6A 4BCNA 4CCUA 4H3BA 2F7EE 2VTLA 1WCCA 4M13A 2W06A 4EJ7A 1U5QA 5J1WA 4FT0A 4Z7HA 5AR5A 3GB2A 4GFMA 1XQZA 4K6ZA 2ITWA 4IBMA 4C4FA 3DXPA 1H1WA 4O7VA 4RFMA 3TJDA 1XH5A 5AR8A 3DJ6A 3E5AA 3ZHPC 3W0MA 1WVYA 4O0UA 3THBA 2WTIA 4DEBA 4EH4A 4C57A 1VLRA 3C13A 3MIAA 2IPXA 4FKQA 4D5HA 3VUKA 1KE6A 2HELA 2X39A 3OWJA 4IMYA 4EK6A 2W4KA 2HW7A 3JYAA 4HPUE 4JBQA 1LPUA 3FXXA 4I92A 4D2RA 5H8EA 2CLQA 3C50A 3NNUA 4O4FA 4Y5QA 5IKWA 4JG6A 1H27A 4MHAA 5LVNA 3U6JA 1ND4A 2F9GA 4CG8A 1RE8A 3BPRA 4ZY6A 4QYHA 3U9NA 3ID6C 3R8PA 3N4TA 1M14A 2QOLA 4QYFA 5L8JA 3IQ7A 5A46A 5KBQA 2OH4A 2XM9A 3RPVA 2GHGA 4LUDA 4P90A 4GJ3A 2R3RA 1BL7A 3DA6A 3R7EA 4F09A 1H1RA 4TYHA 3KY2A 4NM0A 5HBEA 3ZLSA 4A4XA 1OECA 3QL8A 5CWZA 4PMPA 5J79A 3IW5A 2VO0A 4AOTA 5BPYA 2P3GX 4ZZNA 3OWPA 4I6BA 3TMOA 3RAIA 2F49A 1YW2A 3V8SA 3FWQA 3TZ8A 4AXCA 2J2IB 3KK9A 5K5NA 2OIBA 2VO3A 2VTTA 1YWNA 3PE1A 4GV1A 4I6QA 4J8NA 4NCTA 5DR9A 5BNJA 5KNJA 3O0GA 5HE0A 4PTGA 2ZJWA 5JEBA 3QLFA 4E3CA 4DEEA 4DG2E 5FRIA 3SD0A 2W5AA 4AZEA 1ZXEA 4IWDA 2BHEA 2GTNA 1JSUA 3H0ZA 3E87A 3QA0A 4TT7A 2BAJA 5AUXA 4C4GA 1IAHA 2OG8A 4WHZA 4A07A 3FC1X 3DB6A 4AFJA 1PMUA 3ORZA 5AV0A 1BMKA 4FKPA 2G2IA 3GP0A 4J99A 4EQMA 5KHWA 4CKRA 4M66A 3PXZA 2VO7A 2PHKA 2Z7LA 3PY3A 3FXZA 5CZIA 5CS6A 5DIAA 3VQHA 1PYEA 5M53A 1T45A 4NU1A 4ALVA 5HTIA 3EIDA 4JLCA 2QODA 5BUEA 3EL8A 4TKSA 4RMZA 3F5PA 4BIDA 2P55A 3MV5A 2W1FA 2BFYA 1BI8A 3IDPA 4YJSA 1SVHA 1Y57A 5EM5A 3PJCA 5A4CA 1ZARA 4IAFA 3UC4A 3LCKA 3VULA 3V5JA 4UALA 4A4OA 2X7OA 3FZ1A 3F69A 3AOXA 2V0DA 4KAOA 3IW7A 2C1AA 2O64A 1PKGA 3GQIA 5EQPA 3QCYA 3Q04A 3PVUA 4R7HA 1M2RA 2OGVA 2A98A 2QR7A 4IWOA 1B38A 2XVDA 4LRJA 4PV0A 4QYEA 3VS4A 4DGOA 5HZNA 2VO6A 3OEFX 3GNIB 3BYVA 2WZJA 2WMUA 2B7AA 2A0CX 4O6LA 2YIYA 3QQGA 3VF8A 1OIQA 4LQMA 1LUFA 4O2PA 1H8FA 4AZSA 2JLDA 3KCFA 4O0TA 3UZPA 4GT5A 3E7VA 3ULIA 3VAPA 4ALUA 3DS6A 3V5LA 5CEQA 3RZBA 3W8LA 1FQ1B 4BTKA 4DEGA 3PY0A 2XK3A 2BUJA 2PMIA 1K9AA 2OZAB 2DUVA 3BU5A 3OCGA 3P7AA 1CKJA 2BZJA 2OZAA 4HGLA 4QP3A 4ERWA 3HLLA 2GTMA 4U5JA 4EHEA 2C0OA 3JS2A 5GZ9A 2B53A 1PXPA 5EYKA 1JKSA 3Q9YA 3PFQA 2GCDA 4RJ4A 4O84A 3FMHA 3OTUA 4ONAA 4A9YA 3AMYA 3RAWA 2WTKC 4JQEA 3RNYA 3FYJX 2X8EA 3H9FA 4FSYA 3S1HA 4BCJA 4EL9A 1JKKA 4Z55A 5LJJA 4FTLA 5A3XA 4ZMFA 2JKKA 4I6FA 1NY3A 1K2PA 2G01A 2JIIA 4CV9A 5CAOA 5AV4A 4D2VA 1H0WA 3KKVA 2VGPA 3ANRA 3QKMA 3ZRMA 3D0EA 2PU8A 1YDTE 3ANQA 1WAKA 1PHKA 3NSZA 3PWYA 4AACA 3O17A 4F7NA 5JH6A 1A48A 2RFSA 3H9OA 2QG7A 3KIOC 4MKCA 3R9NA 3CD3A 5E8WA 4DT8A 3NUPA 2YFXA 4WIHA 4OAUC 4FYNA 1NXKA 4FV6A 4XLVA 5AEPA 3R7GA 5AJQA 5JZNA 3BHYA 4XX9A 4ARKA 5KKRC 3WARA 2QO7A 2YCFA 3G0FA 4RGJA 4EOKA 3WF7A 3HMNA 4I21A 3QQHA 4ACDA 2J51A 3IW6A 4M67A 2ZMDA 4KKEA 3JVRA 5J9YA 3EN9A 2HOGA 3QZHA 4IVAA 2OIDA 2PVFA 3CPBA 2QOFA 3F82A 3MFRA 4G3DA 3OXIA 1W8CA 4B9DA 2WPAA 2BR1A 1E1XA 3MB6A 4G2FA 3WF9A 4EH8A 4I5MA 3K5VA 3Q9XA 4WA9A 1Q8UA 3ORLA 4EK4A 4IC8A 4PMMA 2PZYA 4OTPA 3A7IA 3AC5A 3BBTB 2ONLC 4D9UA 2NRYA 3EL7A 3R0TA 2BHHA 3F7ZA 3GUBA 2I40A 2R3JA 2YWVA 1E9HA 2PMOX 4TNBA 3A4OX 4V05A 3R28A 3FL5A 4BHNA 2B9IA 4E5AX 2B52A 4W4XA 3E64A 5M4IA 4GW8A 3PPKA 2XMYA 4MD7E 4DHZA 3HX4A 4F6SA 2E9VA 2WNTA 3SVVA 3GXLA 3BHHA 3QD4A 4M0ZA 4YZBA 4YC3A 4JRVA 3QGWA 4UYAA 4YJUA 1TFFA 5FBOA 3NEWA 4QP1A 4PQNA 1YKRA 2GFCA 2Z02A 4IB1A 4O96A 5HG9A 4GIHA 3D2IA 3KXZA 3LJ2A 4YLJA 2BCJA 4AW0A 5J95A 4MF0A 2BRNA 4IACA 3BL9A 4I5HA 5M4CA 1G3NA 5HICA 3UYTA 5FG8A 2JDOA 2XKEA 3PP0A 2GNLA 1Q3WA 4FSNA 3F3WA 5DMZA 3UIUA 5E7RA 2BRHA 3HMOA 4LG4A 5DVRA 2QLUA 3UODA 3JVSA 3CQEA 3RWQA 1YHVA 4UB7A 3LXLA 4C4HA 4BDFA 2OW3A 4YJPA 4YZ9A 2HY0A 5DFPA 5CVFA 4DFLA 2ITVA 3AKLA 2ZV8A 4W8DA 1KE7A 2DWBA 4QP8A 4CNHA 1ZAOA 1R1WA 2X6EA 3ZLYA 3E8CA 3ZTXA 4ANMA 3S95A 4F9CA 2PVJA 2W9FB 3FMNA 3RK7A 4JXFA 5M44A 3EKKA 2YCQA 3S3IA 4D2PA 3BCEA 1P14A 2OWBA 2X2MA 3C4FA 4W8EA 4XP0A 2VNYA 4DYMA 3RBWA 2Z2WA 5TT7A 3ZSGA 5M08A 1SVGA 3GGFA 4O0VA 4L7FA 3UG2A 4LV5A 4FIIA 4L53A 4FTAA 5AAEA 3LIJA 4EK8A 5JKGA 1XH4A 4QPAA 2R3IA 4MBJA 4C34A 1JKLA 3TDVA 1JWHA 2J5EA 4CT1A 2UZOA 3AKJA 3FSKA 4MD9E 1BLXA 3R04A 2Z7RA 4O4CA 4C33A 4K9YA 4MQ1A 3HNGA 4FSMA 3MH1A 4AW1A 5FTGA 1YI3A 4ORKA 3W1FA 4QMSA 2IZUA 3POOA 3EQHA 4G17A 5AR2A 4DH7A 4PWNA 4QMVA 3DU8A 3ZO1A 2FSOX 2O2UA 3UYSA 2V7OA 3CBLA 4QP9A 4FG9A 4DHIB 5LARA 3QF9A 3DBDA 1FOTA 4C4IA 3MH0A 4USFA 2HZNA 4RVMA 3F61A 3VIDA 3OBJA 2C3JA 2OSCA 3DNDA 4C37A 2EXMA 2WKMA 4ITHA 4IFGA 4TYEA 4FZ6A 4PPCA 5AM6A 1JPAA 2BIYA 4WO5A 4EOMA 4BGQA 2IG7A 3FQSA 4GFGA 3Q3BA 4C59A 4IDVA 4EUUA 3BWJA 5J8IA 4QMNA 1Z5MA 2QG5A 4MX9A 5M57A 3KN5A 1TZDA 2HWPA 3A2CA 5AP2A 4LRKA 4HVIA 5F95A 3FE3A 4EHVA 4YJOA 3BQRA 4CZUA 3PTGA 4OTGA 5CI7A 5ANIA 3ATSA 4LV8A 5KZIA 5L8KA 2G15A 4WRSA 4F0FA 3IKAA 4J71A 4FSZA 4M84A 4C38A 4FTNA 3GU6A 3MIYA 5JGBA 3VBVA 4WKQA 1I44A 4ZZMA 2ITXA 4QPSA 2I1MA 2WFYA 3MWUA 4QO9A 2Q0NA 3BGZA 5EI6A 4GFOA 1UU8A 5E92A 2AEGA 5EQYA 5D7AA 3W18A 4JRNA 4WG5A 5EW9A 2AC3A 4F63A 4DLJA 5AP4A 3FSFA 2C6EA 5K3YA 4E26A 2J0KA 3SQQA 1KUTA 4BB4A 4GK2A 3UIXA 3QXOA 3HMMA 3ZC6A 5C4LA 1YVJA 1FVVA 1GNGA 4R5YA 3PG1A 3PSBA 3ZBFA 4ASDA 1MQ4A 3D83A 3WYYA 5KMOA 3OCSA 2C6DA 3P5JC 1XO2B 3GCSA 1FMOE 5IU2A 3U6HA 2ESMA 3O96A 2BZIB 1A06A 2RFEA 4LDTA 1OL7A 2Z8CA 2I0YA 2EVAA 4JDHA 4IWPA 4MF1A 4PDYA 2VWVA 3RTPA 3S2PA 2PWLA 4D4YA 4FT9A 5BVDA 3OROA 2UW0A 2PE1A 3VRYA 1WBPA 5EI2A 3GCPA 3KREA 3LCDA 4F70A 3CKWA 3I5ZA 3KXHA 3VW6A 3MA6A 4H36A 5DRDA 3Q96A 4D1SA 5L6WL 2VWBA 3IGOA 4FUXA 4C7TA 2XANA 4EWHA 5IEXA 1YXSA 3TV4A 1ZMUA 4D2SA 3PIXA 3EN6A 5CSXA 4IANA 3ZS5A 4IVBA 4KKHA 4FIEA 2P2IA 3AT2A 1GIHA 2NYAA 5CX9A 1UA2A 4FSQA 1Q5KA 3POZA 3F3ZA 5DT3A 3M1SA 3FMLA 4XG9A 2PYWA 4FVQA 1X8BA 4S2ZA 2RIOA 3O23A 2JIUA 4RJ6A 1URCA 4GMYA 5AWMA 5HVYA 1Q8ZA 4PPAA 3OEZA 3TYKA 5DR2A 2WXVA 3P4KA 2C68A 4M7IA 4O1PA 1PW2A 1W2FA 1OKZA 3F2NA 4IW0A 3NUNA 1FVRA 2QVSE 4RFYA 5IF1A 3KB7A 2C3KA 2J0LA 4I6LA 5BYLA 2O0UA 1GAGA 3A62A 5I5ZA 1XR1A 2OIQA 2OXXA 1PXMA 2X4ZA 3R7IA 4KUJA 3CJGA 4O0SA 3CE3A 3HRBA 1Q8TA 1GJOA 4BDIA 2YIQA 5IA3A 4IADA 1XWSA 2VTJA 2W1GA 2IEWA 5GZ8A 2JKMA 3UDZA 4X2FA 2CDZA 4EWQA 2XIRA 3A61A 3EZRA 4EEVA 2BPMA 1OIYA 3KEXA 3SRVB 1URWA 1P4FA 4I3ZA 3KMMA 3WZJA 4E8AA 2JDSA 2BKZA 4QQJA 4XV3A 4CT2A 5CXZA 4XV1A 1W7HA 1ZRZA 3HRCA 4EONA 3M11A 3S4QA 3TT0A 2Z60A 4HGEA 4B0GA 4FKRA 2OI4X 2R7IA 3T9IA 2ITOA 3D5UA 2XRUA 2KULA 3BBWA 4S34A 4X2GA 5T6KA 3NUXA 4N70A 4Z16A 1VYWA 3FMJA 4AWIA 4HZRA 2YM6A 4UWCA 4Y46A 4PTEA 4YLLA 4UN0C 4YHJA 3SG9A 1M7NA 1P5EA 3EFKA 3I6UA 3HP5A 4LGHA 4N6YA 3NW5A 4G3CA 3RHXA 4IB5A 1K3AA 3BV2A 2Y4PA 4F0IA 4NFMA 3FLNC 4FEQA 4BZDA 1XH8A 1ZYCA 5F1ZA 4ZJIA 1NVRA 4IH8A 3LE6A 3UNJA 3QHRA 3CSVA 3R9RA 4YTCA 5TE0A 1J3HA 3FQHA 4MTAA 4YU2A 4MWHA 3DJ5A 2P0CA 3D5WA 1I09A 2XNMA 2PSQA 4QD6A 2BRMA 2EU9A 3GENA 4S30A 3MB7A 4MBIA 4F1TA 3FEGA 3F3TA 3Q5IA 3VUHA 3UDSA 2QO9A 4ZTMA 3NDMA 3LCOA 1UU7A 1QPJA 3LLAA 4PL3A 5DGZA 5FBNC 3C7QA 3C9WA 3I0OA 2ITUA 4L46A 4RBLA 5HD4A 5IUIA 5ICPA 5F9EA 3ULZA 2W9ZB 3H9RA 2DS1A 4BCMA 5GZAA 2YM5A 3PUPA 4LOPA 3O5AA 2R3NA 3E8EA 4FVRA 2JKOA 2IW6A 2YN8A 3NWWA 4RIYB 2GQRA 4BDKA 4YSMA 3QQUA 4RIYA 2RG5A 4MUQA 5HI2A 5HKMA 3ITZA 2GHMA 3HUBA 2PUIA 4KA3A 1W82A 3FI2A 4FUYA 3HEGA 4DEIA 5C9CA 1U59A 4E4MA 3NCGA 2YJSA 5IH5A 5KZ0A 4ANOA 2R4BA 3C0GA 4KINA 4PL5A 2VTSA 2WOTA 4C8BA 3ZDIA 3Q6WA 3VUTA 1ZYJA 3KULB 4YBKA 3L1SA 4JAJA 3KULA 3AGLA 3QD0A 4DTBA 4DC2A 4O2ZA 3VBXA 3MVLA 4UWYA 4B4LA 4XMOA 2IZSA 5M55A 1CMKE 2BDFA 2C5VA 4M68A 3ZRKA 3ZYAA 4AU8A 5DLSA 4Y95A 3KRRA 4RX8A 4FTIA 4RVKA 4NH1A 2OU7A 3GU7A 3NAXA 3QCQA 1TQIA 4DFZE 3PSDA 3DXQA 4KBAA 2WU7A 4IVCA 3PZEA 4O21A 5GIPE 1PY5A 5CT7A 4OTRA 4FEUA 2C30A 2HW6A 1PMNA 1WBSA 3DLZA 2XYNA 3OW4A 5EYCA 3HV5A 4U6RA 3CCNA 4PRJA 3B2WA 3R1NA 5EW8A 2Y4IB 3SLSA 4F9YA 4GEOA 4X2NA 1ZLTA 4CKJA 2CNUA 4JIKA 1OL2A 3TNIA 4OTHA 1J7LA 4JT3A 3MPAA 5JFSA 3QTWA 3VUDA 1RJBA 3QC9A 4GK3A 1IA8A 3DXNA 3N9XA 1H01A 4I22A 3L9PA 3NNXA 2PPQA 2PUPA 4AGUA 4AGWA 3SAYA 4E20A 4F7LA 3QRKA 4IX4A 4FT3A 1G8JA 2UZVA 2ZV2A 5J9LA 3AC3A 4ZSJA 3OT3A 1JBPE 4FODA 2FB8A 4N4SA 3G9LX 4FL3A 3R1SA 3NMUF 3PXYA 5I3RA 5EG3A 4QTCA 3UPXA 4BBMA 4O7TA 4YZMA 5HNGA 5GIOE 4MXCA 4QT1A 4B99A 4TYJA 3U8WA 3I81A 1BYGA 3OF0A 5HIBA 2C3IB 2UVZA 3PXFA 4FYOA 5DEYA 5EDQA 5HEZA 2XK6A 3FHRA 3OY1A 2O3PA 4FKVA 4V01A 2VTMA 5KMLA 4RJ3A 4FSRA 4C2VA 3ZUUA 3TUBA 2IZTA 2OF2A 3FZSA 3RMFA 2W1DA 4DG0E 2OF4A 5I9YA 1STCE 4Q9SA 5GJDA 2ACXA 3FMDA 4FR4A 3DQWA 4FIGA 3FI3A 4WNMA 4ZEGA 3UJGA 4EK3A 3FL4A 3U54A 1AD5A 3F5UA 5HHWA 3DPKA 4OT6A 4GU9A 4ZLZA 3TWJA 2YIXA 4LOOA 4U42A 3PJ1A 4DITA 1MRYA 2XARA 1ZY5A 5CU3A 4BFMA 4TTHB 3UGCA 4RFZA 2CCHA 4UZHA 1G8SA 5BV3A 5HORA 3L9NA 3PVGA 3EOCA 3QXPA 4DH1A 3HAMA 2FUMA 2WU6A 4EORA 4FG8A 3ENHA 3QQLA 5HCYA 3MDYA 5CAUA 2JGZA 4CLIA 4FG7A 4GYIA 5LOHA 4KBKA 3BHUA 1AQ1A 2CGWA 3NR9A 1T46A 5DBXA 1CM8A 4I4FA 3EQDA 2XIXA 4FIFA 4TYIA 2ITYA 4QYGA 3KN6A 2OBJA 2XNOA 2ITNA 3DKFA 5IQEA 3NVKI 3MVMA 2XAMA 2W96B 2C5XA 3MH2A 4IZ5A 3PUFC 2A2AA 4Q5HA 4AF3A 3VBTA 1ZZLA 5DR6A 5A4LA 4L68A 1FBNA 1R3CA 4C0TA 4MXAA 4N0SA 3FLYA 3E92A 3BYOA 2BKKA 1XH9A 3EN4A 3QCSA 4HCUA 4FKTA 1VJYA 4KIOA 3CR0A 4BIEA 1S9JA 2P33A 3BGPA 2HENA 3CY3A 3PXKA 4G1WA 3OMVA 2UW5A 3D9VA 5DT0A 4MNFA 2X9EA 1FMKA 3CGFA 1O9UA 3A7HA 4JAIA 4RZVA 3BLQA 3NIEA 1B6CB 4TYHB 4E7WA 4KRCA 5ACKA 2W5BA 4FZDB 4C35A 3C51A 4EOOA 4NYEA 4G9RA 2WOUA 2GNHA 3F5XA 3KU2A 3MY5A 4RWKA 3W0NA 1YI6A 2Z7QA 4DHJA 3QUPA 4AZWA 3T9TA 4K0YA 3BHVA 1APME 3UIBA 1E1VA 3VJNA 3MTFA 2OJIA 1Q41A 4IXPA 3T8OA 2VWYA 1JVPP 5KE0A 4CQEA 2PZIA 3CLYA 4TYGA 4CD0A 1YWRA 1Q24A 4YC8A 4MEDA 3P7BA 4B7TA 5M51A 3EFLA 3HP2A 3ODYX 2XEYA 4AN2A 1M17A 2OO8X 3NUYA 4H05A 5CNOA 2W1HA 3WF5A 4JBOA 2VZ6A 3QUDA 2XJ0A 4O86A 3EQBA 1WVWA 3BYUA 3UP7A 4BR3A 2UW6A 2Y4IC 4GT4A 4G6OA 2Q83A 3DKCA 1PXNA 3M42A 5HVJA 1L8TA 4O82A 5EHYA 5E91A 4BDDA 4HYSA 5HU3A 3QTIA 3U4UA 3TM0A 2VD5A 2QOKA 1VEBA 3LFNA 3PRIA 4G6LA 4RWJA 5DT4A 5EKOA 4NW5A 1YHSA 3EJ1A 4WRGA 1IR3A 2QU5A 3OCBA 4F65A 2F2CB 3MY1A 4LMUA 4MXOA 5LMKC 2BDWA 5EOBA 1KE9A 4CZTA 3ZFMA 3M2WA 2WIPA 3H10A 2EXEA 3WZUA 5M06A 4L45A 4AQKA 4DBXA 2W99B 4PMSA 2UZLA 5A6NA 2C6KA 3CQUA 1LR4A 2IZRA 2A27A 4RZWA 5J5SA 3LPBA 4J96A 2ZYBA 2GMXA 5FDXA 3WE8A 2UW9A 5I9UA 3W0OA 4U3ZA 4XLIA 3G90X 2B55A 3R2YA 4CMUA 4A9UA 5IH4A 1OL5A 1A9UA 1MRVA 3FPMA 3HA8A 4NT4A 4BICA 4P5QA 3AG9A 4F1OA 5HX6A 2VNWA 3LFCA 3GOKA 4ERKA 4USEA 3NW7A 1IAJA 4XG7A 4ASZA 2YIWA 4BI1A 3VNTA 4QDEA 2RFDA 5M07A 3JUHA 3UNKA 3F66A 4KWPA 4AZFA 3MJ2A 4FKJA 1EH4A 2X1NA 1TQPA 4IDTA 5CSPA 4G9CA 4QTAA 2R3KA 5F20A 5TR6A 4BCQA 5CALA 4YJTA 3HRFA 3FC2A 2CN5A 2XZSA 1WFCA 5AP5A 4YGAA 4C3PA 3LCTA 2VTIA 4AW2A 1PMEA 5C27A 5FM2A 4FKIA 4QMUA 2G1TA 5E1SA 2WTCA 3E93A 2YLFA 4YJQA 5HLNA 4XRJA 5JZJA 4DH3A 4GJ2A 4KIKB 4KIKA 1J1CA 4BWXA 1QPDA 4EH3A 4Z7GA 3UIMA 5FLFA 5EM6A 3TACA 3ZZEA 4D9TA 5DN3A 4AFEA 1W84A 1ZMWA 2CKOA 3NX8A 1J7IA 5B2KA 4KSPA 1G8AA 1H1PA 2X2KA 4YBJA 3HKOA 4ZTQA 3REPA 4NJ3A 3HV3A 3BQCA 4ID7A 4RJ5A 4JI9A 3EB0A 1Q8YA 1YQJA 3VQUA 2HXLA 4S32A 1YWVA 3ALNA 3LFFA 4KNBA 3FAAA 3SOAA 1QPEA 3Q4UA 4NTTA 5TOZA 1H1QA 1TQMA 2NP8A 4KBCA 2RSVA 3PWDA 1Y6BA 3ENMA 4C58A 2X0QA 3FKLA 2ITPA 2PVYA 2ZFYA 5L3AA 5HE2A 4E4XA 4R7BA 4JQ8A 4W4WA 4A9RA 4I0TA 2PVNA 3AKKA 3LMIA 4X3FA 1CKPA 4R3RA 5JT2A 3AD6A 4PDSA 1U5RA 1OPJA 5CEMA 2X0PA 5CEOA 4MH7A 3MN3A 4QYYA 3UMXA 3UZTA 2R9SA 4F6UA 1FINA 4FKOA 5HTBA 4O1OA 3EYGA 1PRYA 1KSWA 4F78A 3WBLA 4YJRA 4HCTA 5IEYA 3OCTA 2HXQA 2VX0A 2JEDA 5IUHA 3KGAA 3H3CA 4BCIA 4W4YA 1SYKA 2BAQA 3FI4A 4AT3A 5CASA 4XRLA 3RI1A 3WI6A 4LUEA 5HO8A 5ETAA 5CI6A 2B4SB 3WILA 4U7ZA 4NCTC 4FC0A 1JLUE 3LMGA 4YHTA 1YDRE 4RC2A 3BWFA 3ZZWA 2OJJA 3R8VA 3NLBA 4ZTSA 3IS5A 2C5YA 5ANGA 3UOLA 3W2OA 5DWRA 1OGUA 3MY0A 4GL9A 4NFNA 3TNHA 3NYVA 4EUTA 1WBWA 3BX5A 3UDTA 3DTCA 4EBVA 5LXMA 4IHPA 5DA3A 3ZH8A 1W0XC 2C6LA 3MFSA 4TWOA 3QX2A 2B9FA 3KFAA 5H3QA 5BVNA 3QZFA 4AX8A 3VONA 4GKIA 1O6KA 2GS2A 2FGIA 3QCXA 1CSNA 4HCVA 2HZIA 1PXLA 2QKRA 4E5BA 3IOKA 1PXKA 3O8PA 2X7GA 5AR4A 3WZEA 4AT4A 5B0XA 5GINE 2C0TA 4GG5A 4YPSA 3RPRA 3O8UA 1WVXA 3BE2A 3GCUA 4R8QA 5I9VA 4C36A 2V55A 2PVLA 2ETRA 2WEIA 4KSQA 5E8UA 5IA4A 1F3MC 4FF8A 3C0IA 3I5NA 3FMKA 4ACCA 2ITQA 2YAAA 3QBNA 4FTUA 4IWQA 3W8QA 5IQHA 3MW1A 3CTJA 2PUNA 4FRFA 5HG5A 5A4EA 5KO1A 4I1ZA 3CP9A 4EZ3A 3OVVA 3HGKA 4JG7A 5ITAA 2IWIA 4I20A 4RA4A 5H9BA 4G3GA 3Q4ZA 2GU8A 2WMTA 4QQCA 4YNEA 5BVOA 3W2CA 3F5GA 4OTFA 3ZO2A 3F2RA 3MPTA 3AD5A 3FQEA