1OB3A

Structure of p. falciparum pfpk5
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
286
structure length
277
Chain Sequence
MEKYHGLEKIGEGTYGVVYKAQNNYGETFALKKIRLEKEDEGIPSTTIREISILKELKHSNIVKLYDVIHTKKRLVLVFEHLDQDLKKLLDVCEGGLESVTAKSFLLQLLNGIAYCHDRRVLHRDLKPQNLLINREGELKIADFGLARAFGIVTLWYRAPDVLMGSKKYSTTIDIWSVGCIFAEMVNGTPLFPGVSEADQLMRIFRILGTPNSKNWPNVTELPKYDPNFTVYEPLPWESFLKGLDESGIDLLSKMLKLDPNQRITAKQALEHAYFKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords CELL DIVISION CONTROL PROTEIN 2 HOMOLOG
publication title Structures of P. Falciparum Pfpk5 Test the Cdk Regulation Paradigm and Suggest Mechanisms of Small Molecule Inhibition
pubmed doi rcsb
source organism Plasmodium falciparum
total genus 77
structure length 277
sequence length 286
chains with identical sequence B
ec nomenclature ec 2.7.11.22: Cyclin-dependent kinase.
pdb deposition date 2003-01-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 1ob3A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 1ob3A01
3AT4A 2JAVA 3CTHA 5IMEA 3OXIA 4O1PA 4TY1A 4CCBA 4U42A 1CKJA 3RALA 3DB6A 3KRRA 3ZRLA 3DV3A 3L9MA 2J90A 5BVKA 3EIDA 5F4NA 5EH0A 3QU0A 2YWVA 1H26A 3OW3A 2XRWA 2FYSA 4GYIA 3RM6A 2BAKA 5FDPA 4RA4A 1PMUA 4UYNA 2A1AB 4U43A 1OB3A 3H9RA 2Y7JA 3ZFXA 3ZZEA 4IHPA 4TTHB 2YM3A 3EZVA 1PYEA 3PY1A 3QA8A 5CU0A 4DBNA 4EQUA 1URCA 4R3CA 2W06A 5J8IA 5IQEA 2WHBA 5K3YA 1FMOE 4MNEB 4YJTA 4R6VA 4FG9A 5HX6A 5M4IA 3TKHA 5CVGA 4LYNA 4PPBA 2YIQA 4FOCA 4O86A 3QTZA 3ITZA 3OFMA 4M66A 3I81A 4M0ZA 4FE2A 3DK3A 3WZKA 1H1SA 4OLIA 5AV3A 4RQVA 3P7CA 5EW9A 2C3KA 3FMKA 2C6DA 3DTCA 2OICA 1XH9A 1Y8GA 2Y4IC 3PIZA 3QQGA 4PDYA 2PE1A 4MNFA 3EJ1A 5D10A 2XKCA 5CYIA 4F64A 3LMHA 4EK3A 2VWWA 2P55A 2C0TA 4WSQA 1WCCA 4FV3A 2PPQA 3OMVA 4S2ZA 3RAKA 5L4QA 1YOLA 5L6OA 1K3AA 2ERZE 4KS7A 3KRWA 4U80A 1H0VA 1AQ1A 3R1QA 4G9CA 5EFQA 2BFXA 2JDSA 2OO8X 2R7IA 2E9VA 4IIRA 4IEBA 4W4YA 2XYNA 3BE2A 4NTSA 5H2UA 1H28A 3C7QA 2UZUE 3PWDA 3RPYA 2BDFA 2LAVA 3UNJA 3BEAA 1J1CA 2Y6MA 3FZTA 2UW6A 4AT4A 4CKRA 1YXXA 5CZIA 4HGEA 5AP0A 1I44A 4CYIA 3KF4A 3ORKA 3PG1A 2GFSA 2B53A 3GEQA 4ZXTA 2OJFE 3OCGA 4O27B 4CLJA 2WMVA 2CMWA 4PMMA 2BROA 3W32A 3D14A 5TT7A 4B8MA 3C5UA 1RDQE 3ENHA 4FZ7A 3LFNA 3I6UA 5T3QA 4FKUA 3QC9A 2ONLC 4XUFA 3WZDA 3COMA 5HX8A 4PDSA 5JGBA 4EONA 4M13A 5M44A 2XF0A 2Y8OA 3BLRA 2XVDA 5DR9A 3MTLA 3DS6A 3PG3A 2F2UA 4XG8A 4DTBA 5I5ZA 3PIXA 2R0UA 4EQCA 3C9WA 3EQHA 4C61A 3QRUA 4FUXA 4XG6A 5DT3A 2G2IA 4WNMA 5ANKA 4OUCA 4HNIA 1UWJA 4XYFA 3IQ7A 4NWMA 4FZFB 3PJ1A 2O3PA 2HELA 3W33A 3ZLWA 4DC2A 4AZVA 3MY1A 3HV5A 4CV8A 2PL0A 2V5QA 1QPEA 2WEVA 5IA2A 1NVRA 2WFYA 1ZXEA 4O0XA 5FXQA 2CLXA 4KIOA 4PPCA 2C5VA 3QXPA 2W1HA 3LVPA 1OM1A 4BDKA 4QQTA 5HBJA 3TUBA 4EH4A 3HAVA 5C8MA 1XH7A 1SVHA 5GJDA 5HBEA 4O7WA 2SRCA 2F4JA 3KMMA 4JNWA 3QTXA 4JXFA 4IM2A 3I5NA 3POZA 4QT1A 5ANDA 3IW4A 5A6OA 2WOTA 5AAEA 1E9HA 4QTDA 3ZDUA 4ZTMA 4HYSA 5I9ZA 3RBWA 3MS9A 4F1TA 3EYGA 4D2SA 5LWNA 3S0OA 2OXXA 3F6XA 2UW9A 1ZLTA 2F2CB 3KVXA 3RAIA 3BPRA 4TYIA 3LPBA 4F08A 5L2TA 5EM5A 1H24A 3SHEA 4BCPA 3E8NA 5L2WA 5I3RA 2CHLA 4RC3A 4CZUA 5E8SA 2YJRA 2J51A 4L9IA 3P1AA 3ID6C 3DK7A 4IX5A 3PXRA 3CKWA 5A3XA 3W2QA 5A54A 4GEOA 1UWHA 2PVLA 3RJCA 4BCOA 2EB2A 4G5JA 4MYGA 4D1ZA 4ZSEA 2RG6A 3C51A 3FZRA 2BAJA 4MBIA 5JQ8A 3K3IA 3TNHA 4GT3A 2G15A 4R5YA 2VTLA 5BVDA 4XP0A 5C9CA 2YLFA 5M51A 4PMTA 5L3AA 4KA3A 4O38A 4R1VA 3DXNA 5HEZA 1J91A 4BCHA 4MVFA 3HMNA 4ZTNA 3BRBA 3MVLA 4M12A 5AR4A 3L9PA 4C57A 4DBXA 3CQWA 4O7VA 4YTFA 1CM8A 2ZOQA 3AD4A 3RP9A 5CEIA 2W1EA 3QQFA 2W1FA 4PL5A 1H08A 4RVKA 4RX9A 4D2VA 5LJJA 4PPAA 2YFXA 5HD7A 3BWJA 5CAVA 4ZMFA 3VO3A 1XJDA 3ZUUA 4CKIA 3BQRA 4AZEA 3QTIA 2W96B 4FZ6A 4UALA 3R9NA 2CCIA 3MFTA 4I6HA 3Q60A 4J95A 4KKEA 4WT6A 3T3VA 5BPYA 4E5AX 1Q3DA 3S3IA 2FGIA 3O0GA 4XOZA 3RHXA 3HRCA 3G15A 4MWIA 4KKHA 3ZYAA 2B7AA 3NVMB 1H4LA 3FQSA 3NUPA 3VS3A 1OIQA 4RIWA 5HO7A 3EYHA 3E7VA 5TF9A 5IDPA 3E92A 2QNJA 3NYNA 3UODA 4G16A 1OPLA 2J9MA 2UW0A 3MH3A 5CF4A 5CT0A 2ACXA 2CJMA 3ZUVA 3THBA 4F1MA 1GAGA 1UU8A 4E93A 4EOSA 1MRUA 1ZMUA 3PJ8A 4FSWA 3VUMA 4Z7GA 2NNWB 3ZSIA 3NYVA 4MX9A 5CLPA 2BIKB 5G6VA 2X7OA 3QD4A 4FTKA 4EH7A 3BV2A 4TNDA 3FSKA 1YDRE 5B2MA 4FT7A 1T45A 4O0YA 4O6LA 4UWYA 5IF1A 3I7BA 3F5UA 1PRYA 4YMJA 4J8MA 2OU7A 1Y6BA 5I3OA 1XH5A 2GNLA 3RTPA 4O96A 4GVJA 3CIKA 3VUDA 4OTRA 2YLEA 3R8VA 5HIEA 2JBPA 2YM6A 3C13A 3LFBA 4R1YA 1K9AA 4ORKA 4QO9A 4FVQA 3NUNA 5ANEA 4A07A 4AGDA 4ID7A 4L7SA 5CSHA 3F3ZA 4K18A 3W55A 3DU8A 4ERWA 3C0IA 4Z3VA 4QMXA 2UW8A 4FIEA 2VWVA 2A2AA 1QL6A 4TRLA 4EH5A 2ITUA 4TWOA 5J7BA 2ZAZA 3JPVA 3DXPA 4NM0A 2QO2A 3NWWA 4IAFA 3Q9YA 4BDHA 3NMUF 3WZEA 5TOZA 5ANJA 3QF9A 5DIAA 5DYJA 4GYGA 4O2PA 2YCSA 3UQGA 2BILB 2QHMA 3DNDA 2BRBA 5EYDA 4D0WA 3CQEA 3W2CA 3PDTA 4TWCA 5KZ0A 4BCKA 4FKJA 4AFEA 3FMHA 1PXOA 2XKEA 3MV5A 3P78A 4IW0A 5BQ0A 2BR1A 2E2BA 2OKRA 3EN9A 2PUNA 3R71A 3SDJA 2VTOA 3QD2B 4ZY5A 5LMKA 4IB3A 4JQ7A 3UJGA 3B8QA 1YOMA 3LXNA 3DDQA 2QI8A 4D28A 2UVZA 2ITYA 3PYYA 3RGFA 2PVNA 2X9FA 4A7CA 5AAGA 3ORXA 3PXYA 4U3ZA 3GFEA 4FTMA 3ZRKA 2JFMA 1RQQA 5GZ9A 4FTJA 4FTQA 3F69A 4G3DA 2J0LA 3R04A 1Q8YA 2X7GA 5CEQA 4JG6A 1M7NA 5ANOA 4AFJA 3SRVA 4YZDA 1GOLA 4EWQA 5HE0A 1OKZA 2IW6A 3DKGA 3LMGA 5EHOA 4YJSA 5HGIA 4AAAA 1G8SA 1P5EA 3OCBA 4D9UA 1WVWA 3NUXA 3U8WA 3E3BX 4XP2A 5KMNA 4CRSA 3LAUA 3HV7A 3O17A 4RSSA 1DM2A 4FTLA 3ZRMA 4AE9A 5AV1A 3DQWA 1FPUA 1HOWA 3QCSA 4A9YA 2C5OA 3IW5A 3H30A 1OUYA 4R7BA 4OR5A 1MQ4A 3RNYA 1YRPA 2UZEA 3R6XA 2R4BA 1OL6A 3FL5A 3UP7A 4GS6A 4CTBA 3R7GA 4NUSA 4NFMA 4AS0A 2PHKA 2UZDA 3EQIA 4O22A 4YLLA 4I6QA 4YO4A 4A4LA 1JKSA 4V01A 3ZEWA 2BDWA 3MFUA 1OBDA 4UBAA 4AGUA 4UV0A 3BYVA 4L44A 2V22A 3TIYA 3ZO2A 2XM8A 3GT8A 5CALA 2QC6A 3DKOA 3IONA 3Q4CA 3GENA 1V0PA 3I60A 2PUPA 3V5JA 1JSUA 2PVJA 3IOPA 3ZTXA 4G3CA 1GZOA 3QX2A 4O0TA 4LI5A 4AOJA 3F3UA 3JYAA 5AV0A 3RK7A 3G0EA 4OTPA 5J79A 4EH8A 1M14A 1YVJA 2XYUA 4GG7A 3LJ0A 3VRYA 2CKQA 4J98A 2HENA 3TNWA 4F7JA 2UW4A 5AR7A 2V0DA 4OTQA 5AM6A 2R3QA 2BTSA 3IO7A 3LHJA 2WMBA 5H8GA 5CQWA 2YAAA 3OHTA 3A62A 2GSFA 2P0CA 2XCKA 4XBRA 2QURA 3FPQA 2XKDA 5CANA 4GKIA 3GOKA 5DRDA 4X2FA 3MPAA 3OTVA 4FYNA 2WNTA 3H9FA 3GBZA 3UG2A 4ZTRA 3MIYA 4JQEA 4EHEA 5D41A 4EHZA 2YWPA 3W16A 2JKOA 5IQDA 4UMRA 5TE0A 2P2IA 3RWPA 4XV3A 3R2BA 4ZEGA 3R9RA 2VWXA 1ZYDA 4ZSJA 4OTDA 2FH9A 3D83A 2J4ZA 2JDOA 3E87A 5EI6A 5EKOA 4USEA 5IEXA 3BELA 4C59A 3F2AA 4O1OA 5E1EA 2AUHA 1H0WA 4KINA 3ZS5A 3HECA 3OBGA 4FKGA 4BDFA 3SA0A 5EDRA 2CGVA 2PE0A 2XIZA 4E5BA 3BYMA 4TYEA 5EW8A 5JRQA 3JS2A 3BLHA 4DLIA 3EHAA 5ACBC 3FMEA 1CKPA 4YO6A 4H39A 4TYJA 2OJ9A 2W1DA 3QCQA 3OP5A 3KN6A 1ZARA 4U0IA 3S2PA 1MQBA 3C50A 1U46A 4BICA 4GVAA 4BY9E 3TDWA 5D7VA 1WBOA 2OBJA 1M52A 2H34A 3LCTA 3TUDA 2GHGA 4U6RA 5KMLA 4B4LA 4AW0A 3F7WA 4ZZOA 2QLQA 3OZ6A 4KB8A 2VTMA 4JX7A 1WZYA 2XK4A 3CP9A 3O8UA 2BRNA 3KCFA 5D11A 5L6PA 3S1HA 2X81A 3D5WA 2J50A 4JRVA 4TW9A 1UKIA 4ANSA 1RW8A 1G3NA 2HZ0A 3MJ1A 4L3JA 3FMNA 3KXMA 4PP9A 5H8EA 1XWSA 5IISA 1JKLA 2JLDA 4FL1A 4Y46A 5IQCA 4NM7A 4NW5A 2Z02A 2NP8A 4I5HA 4Z16A 1QPJA 2QG5A 3NDMA 3HMMA 3P7BA 1ZOGA 4DAWA 5HU3A 3PSBA 3VN9A 3HZTA 2WEIA 4I0TA 4M15A 4B99A 4QMNA 2EU9A 3L8VA 4LQMA 4DCAA 3GU4A 1ZZLA 4HYIA 3N4TA 4USDA 4EH9A 2J2IB 5ETFA 3R22A 4L01A 4D1XA 4IZAA 4XCUA 5BYYA 2ZM4A 3NW7A 4AZWA 2IJMA 4BFMA 4CD0A 5BUJA 4CG9A 1ZZ2A 5ETIA 5JFWA 3NZ0A 3PVWA 5DEWA 4JR7A 4AT3A 4MBJA 3TM0A 2J0JA 3M11A 4IWDA 1F5QA 4XX9A 4FEXA 2W7XA 5AADA 1QPDA 2W1GA 1YXTA 3IDCA 1H07A 1YXUA 4AOTA 5IU2A 3TL8A 3TTJA 1YXVA 1ZAOA 5AJQA 5IEVA 5D9HA 5KMIA 2HYYA 2WGJA 4IJPA 4AF3A 5AP2A 4CVAA 5CAOA 1RE8A 2QOBA 3PSCA 5CI7A 3RM7A 3TN8A 3QXOA 3LLTA 4MNEA 5JFVA 3JR1A 3ZDIA 3LFQA 3HDMA 4LGHA 3FI2A 3UOLA 4CFUA 5D7AA 3NNUA 5M55A 3WILA 5EQPA 2PMOX 5CEPA 3QTRA 3UTOA 4BHZA 4QMLA 5LMKC 4N57A 2ZVAA 3H3CA 3JY0A 4PNIA 4QMTA 3VAPA 4D1SA 3R8PA 5K4JA 3F66A 1L3RE 2CPKE 4QMSA 2QOHA 3IW8A 4FYOA 4WNPA 5BMMA 4DFYA 3GCVA 5DOSA 5HTIA 4UMQA 4E1ZA 4EZ3A 4DCEA 2VTRA 4I0RA 5EQEA 4WO5A 2VD5A 5KMMA 5E92A 3H9OA 3PZEA 4G1WA 4FG8A 4BYJA 3HUCA 4HZRA 1O9UA 4JAJA 4NH1A 3F2NA 4IZYA 2A27A 4EBWA 4OBOA 4XJ0A 1WFCA 5F9EA 3FEGA 4I6BA 1VZOA 4K77A 5AAFA 4S32A 3D15A 5T6KA 4GUBA 4HVDA 4FEUA 3VRZA 5EI8A 5DA3A 4DGGA 4C38A 2YM5A 3NUSA 5HZNA 5HG7A 4G9RA 4FSTA 2BTRA 2WB8A 2WTKB 3A2CA 3HV4A 3QQHA 2BPMA 3FY0A 4GV1A 4L52A 4NCTA 4YLJA 3T8OA 3VWAA 3MY0A 5C8NA 5KUPA 3FLZA 4AQCA 2YIWA 2YA9A 3MB6A 2VGOA 4FV8A 4RJ7A 1ZYLA 4AN3A 3QA0A 4I5MA 4FVPA 2G2HA 5IPJA 2XIKA 4RWJA 3EN6A 1J7LA 2EXEA 3AT3A 5HG5A 1B6CB 2HXLA 3I4BA 1JSTA 2JIVA 2ZMDA 4L00A 3RNIA 1ZYSA 2VZ6A 2WU6A 4GJ3A 3BWFA 1HCKA 4JBOA 1HCLA 3SOAA 4E6DA 4XRJA 4O0WA 1JBPE 3GC7A 3R7YA 4A9RA 2X2KA 3SG9A 5LVOA 2WTIA 2IZTA 3DJ7A 3TTIA 5LCJA 3PRFA 4ANLA 1M2RA 3NS9A 2GDOA 2YABA 2Z2WA 4P5QA 2CN5A 4E4NA 4KSPA 3KRXA 4XV9A 3LXLA 2XJ2A 3FZ1A 4IFGA 2C6EA 3MH2A 4PTCA 3W8LA 4H36A 2BZHB 2QQ7A 4J1RA 1NA7A 4HVIA 5EHLA 4DYMA 4FEVA 4E6QA 4G34A 3FHRA 4N0SA 3RZBA 2VWYA 3AMYA 4QYEA 4PDPA 5HO8A 3W1FA 4QMOA 4UXLA 2FO0A 3U87A 3AD5A 4PMPA 1YDSE 3NVKI 3VS6A 4BCMA 4O7LA 4L7FA 4OTIA 3LFSA 1DAWA 2P3GX 4IAYA 2CNQA 3VHKA 3VNTA 3ZSGA 4LM5A 3KRLA 2G01A 3CGOA 4I24A 4O0UA 3VBYA 2ZV9A 2XNMA 4AA0A 2W05A 2RG5A 3PZHA 4U81A 3AMBA 5IQIA 2Y9QA 3MH1A 5EG3A 3E8CA 4IAAA 2OIDA 5CU3A 3AMAA 4FI1A 5AUTA 4YZCA 5AFVA 1ZYCA 2B52A 2QO9A 4FKLA 5FXRA 5CVFA 5IA3A 4GMYA 3R7OA 3QBNA 3QZHA 5JQ5A 1LPUA 4BZDA 3PXKA 4C2WA 4EH2A 4JOAA 3AG9A 2QOFA 3F3WA 4H1MA 4CMUA 3A8XA 4D4SA 4RWKA 5I9YA 2BRHA 3FC1X 1SM2A 2OFUA 4LG4A 2XP2A 1YW2A 3CJGA 2X7FA 4FSUA 4QYFA 4XG4A 4MF1A 3R0TA 4BWXA 1IA9A 4C0TA 4YC6A 1BYGA 2PUIA 4BIDA 4I94A 5CWZA 2X6EA 2R9SA 4IVBA 4A9SA 4CV9A 2KULA 4AT5A 4IB0A 4QYHA 4C4GA 3EQDA 3MY5A 4U5JA 4AW5A 2HOGA 4DEAA 3R7IA 3F82A 1KSWA 4U97A 4PTGA 4YJVA 4EOQA 4OTWA 3L8XA 3OUKA 3W2RA 3OEFX 2E9NA 1SMHA 4IAZA 4EOLA 4LOPA 2C6TA 5C4LA 4IAIA 4RFMA 4W4XA 5HICA 4RLKA 4DH3A 2IVTA 2OSCA 2W5AA 3HYHA 3UMWA 1IR3A 1XH6A 4GFMA 3RCDA 3KXGA 5DWRA 3GCPA 3LCKA 5E7RA 3II5A 3KFAA 4MWHA 4V05A 5FQDC 3R7UA 3C4EA 4ITJA 2YHVA 3QYWA 3IKAA 3V5WA 3VS5A 2EUFB 2VTNA 2RL5A 2WKMA 3LFDA 4GG5A 3QGYA 1I09A 1Q24A 4FEWA 1J3HA 3ZC5A 4DEBA 1DI8A 3D7ZA 2VWIA 1XH8A 3JVRA 4XS2A 4AX8A 1M17A 2YN8A 1Z9XA 3CD8A 1MRVA 2X2MA 2VTJA 3DBDA 1L8TA 3IECA 4KS8A 4ZJIA 2JDTA 4CFNA 2PYWA 3NNVA 4O84A 2VV9A 5B0XA 4YBJA 4AZTA 3WYYA 1F3MC 1Y57A 5AUVA 3SW4A 3SXRA 4EH6A 3KU2A 5AUXA 2W99B 1ZWSA 3D5XA 4KIQA 4C4JA 4D2PA 4DEDA 3WYXA 4ACMA 4NSTA 4UX9A 4JG8A 4GJ2A 4KIKA 2R3HA 5J5TA 3EQRA 4TYGA 4ZS0A 5DT0A 1Z57A 3OXTA 2YDJA 1IEPA 2VU3A 3IGGA 4HPTE 4YR8A 4QP1A 4ACCA 3OF0A 5EKNA 3EWHA 3MIAA 2BCJA 1PF8A 5E9EA 4QNYA 3FMLA 3U54A 2X39A 3ZUTA 5GJGA 1QPCA 4QRCA 2HY0A 3MVJA 3U6HA 4C8BA 4TYHB 1PMNA 3A61A 1SVGA 1OBGA 3PVGA 3BE9A 3WARA 4LOQA 5CASA 1PMEA 3EB0A 3PJ2A 2PZ5A 5D12A 1O6YA 1KWPA 3GNIB 4KRCA 4EI4A 4XRLA 5H3QA 4BZOA 4FT3A 3V5QA 5T68A 1Q8ZA 3EQPA 1KOBA 1SNXA 1FGKA 2ITZA 3D2IA 3TUCA 3PVBA 1R39A 4CFWA 4I22A 4P90A 3NCGA 4A4OA 4L8MA 1M2QA 3DK6A 3POOA 4AOIA 2RGPA 2IZRA 2XIRA 4FV4A 2ZYBA 4FIHA 2GNGA 2R3PA 2P33A 5M56A 5E91A 4DFUA 3L9LA 3FLSA 2WQOA 3BHYA 3DNEA 2VUWA 2JFLA 2UV2A 3FQHA 3Q4TA 3UVPA 4ALWA 4F6SA 5EM6A 1GZKA 2A0CX 4TWNA 5EYMA 4EC9A 5IUGA 3MH0A 2J0MB 3VBXA 3F5PA 4Y83A 2OZOA 1OGUA 3F3TA 3VIDA 3A8WA 4MXOA 5AV4A 3DB8A 3F5XA 2WPAA 2QR7A 2YCQA 5L8JA 2CLQA 1Q62A 4P4CA 4PRJA 3QGWA 3O23A 4NCTC 5KE0A 4Z9LA 3MESA 2BKKA 2W4JA 4AP7A 1W82A 1YQJA 4BIEA 4R8QA 3KK9A 5K4IA 2ZV7A 4ZSGA 2GQRA 3KN5A 2O8YA 4N6YA 3OWJA 4HVGA 3MI9A 3E64A 5E8UA 3D5VA 3PP1A 5AUZA 5FWKK 3MSSA 5FTOA 4G6NA 4JBVA 4FSZA 5E8ZA 5TKDA 2C6MA 4OT5A 3NLBA 3LMIA 2IZSA 1Q8TA 3O50A 2OIBA 4XG9A 2C1AA 3KB7A 3PTGA 3P9JA 4R5SA 2XBJA 2C6LA 3ENMA 3EKKA 3NAYA 2WTVA 5IUIA 5HVKA 2PULA 2XZSA 4FNWA 4J8NA 4M97A 3C0HA 3EN5A 3Q53A 3ZLXA 2AC3A 4WKQA 3I7CA 3UP2A 3QKMA 3RWQA 3TWJA 5F95A 3I6WA 1WAKA 4IB1A 2VAGA 4L68A 2GHLA 4QMZA 3UVRA 4ZLZA 3KA0A 3C5IA 2YCRA 4FODA 4F99A 3PRIA 4YBKA 1OL7A 4NL0A 1CSNA 2GNHA 2YIYA 4C3PA 3VVHA 4HNFA 4YC8A 3Q6UA 3O8PA 4PMSA 5IMXA 1TVOA 3G9LX 4DFXE 5KO1A 2HZNA 3RK9A 3TNQB 5HLPA 1YHWA 4TNBA 2ERKA 4TPTA 4W8DA 3FKLA 5ICPA 2EB3A 4X21A 4ANBA 4ZSAA 1KE9A 4YZNA 3L8SA 2NRUA 3R01A 4FSMA 5KHWA 1UU7A 3KMWA 1FVRA 3VUHA 3DT1A 3KKVA 2GS6A 3HMPA 5E8TA 4AN9A 2BZKB 5DH3A 2WAJA 3QTUA 4L42A 3KL8A 4YPSA 4BCQA 4FVRA 2XNEA 4OGRA 4MQ2A 2XNNA 2WELA 5AP4A 5AP1A 2IZUA 5E8XA 4JLCA 3HA6A 4BCFA 3LQ5A 2R3MA 1NVSA 5CENA 4L45A 1U54B 3PXQA 3R00A 3KK8A 4MQ1A 4Y85A 4M68A 5JEBA 3SXFA 3EN7A 4S30A 1CTPE 2I0HA 3OEZA 4NYEA 4MD7E 3L1SA 1YI6A 4IXPA 4QTEA 1UNHA 2XNBA 4FSRA 5HE3A 5L2SA 4ASEA 2V7OA 3RK5A 4BN1A 5JT2A 1TQIA 1OIYA 2WQMA 4IM0A 4RJ3A 1P2AA 1PXNA 4FIIA 5IA5A 1GIJA 2OF2A 2Z7SA 3B2WA 3E63A 4EYMA 4RIXA 4DFZE 1JWHA 5ITAA 3QUPA 3S4QA 2J6MA 3HNGA 3TJCA 3FZPA 1IRKA 4NT4A 4JAIA 3SV0A 1YWRA 4DE4A 4M69A 4H3BA 3MJ2A 4HJOA 3KC3A 3NCZA 4HYHA 4KIKB 3BLQA 3R8ZA 3UO6A 3FYJX 4E4XA 4MAOA 3PVUA 2C47A 2C5NA 4ITHA 5CF5A 1ZOHA 4XG2A 4C4FA 1KV2A 4IFCA 4E6AA 3EFWA 4KRDA 4RQKA 2A4LA 2WZJA 1XQZA 4FIJA 4AA4A 3BZ3A 2REIA 2XRUA 5GIPE 2XNPA 5BYZA 4BZNA 5K5NA 4IBMA 4C36A 5CAQA 5KMOA 4FT0A 3H4JA 2QONA 2I1MA 5FGKA 3GUBA 4EQMA 4K2RA 4EOJA 3ERKA 4O91A 3BV3A 4FKIA 3BCEA 4J53A 2VRXA 3V3VA 3W18A 4BTFA 3OCSA 3WF5A 3O71A 3PE1A 4F7NA 5L2IA 4FGRA 5B2KA 3FI3A 3DBEA 2B9HA 2CSNA 1M2PA 2H6DA 2HXQA 3G9NA 1IG1A 1YHVA 3A7GA 3W10A 2J5FA 4FT9A 4EK5A 5IQBA 2RFSA 3AC5A 3MGYA 2R3KA 3DBFA 5JZNA 3LLAA 2HW7A 5AP3A 2QKRA 3NRMA 2PVMA 4BTJA 3PY3A 2QD9A 3TNIA 2G9XA 3DA6A 4QTCA 3BIZA 4ASZA 4D0XA 4CKJA 3PJCA 4DG3E 3R8MA 4EORA 5A4LA 5LVNA 2WMTA 2E9PA 2J0KA 4O7NA 3HGKA 3EH9A 4BIBA 3NW6A 3KXXA 4I6FA 3I5ZA 2J5EA 3FXXA 1T46A 3MWUA 3FJQE 1Y91A 4TT7A 4JG7A 5AWMA 4ZY6A 5LWMA 5E8VA 3ATTA 4RX8A 1TKIA 2RF9A 4ACDA 5M07A 4RVLA 5A4EA 4IVDA 2GCDA 2HZIA 3P23A 3AC4A 1PXLA 3A7JA 4RIOA 3OY3A 2XBAA 3OG7A 3PA3A 4C33A 1W98A 2GU8A 2PMNX 3GXLA 3WOWA 3DGKA 1FINA 4HVSA 3GB2A 2CCHA 4O6EA 1Q61A 3U55A 5CU2A 1GNGA 3OVVA 3QWKA 3HAMA 3BHUA 4ANNA 3R83A 3LCOA 4IVCA 3NX8A 3WI6A 4C2VA 5HNIX 2KTYA 4ZTHA 4BB4A 2QU6A 4RX7A 2R3RA 2JDRA 4UEUA 4ANQA 1Q5KA 5DEYA 1JLUE 5EDPA 2ITOA 4EKKA 2EVAA 3ETAA 4M14A 4ZTQA 2XK7A 4BKJA 4ZY4A 4YZBA 4D4YA 2QR8A 3VUGA 4QPAA 4YP8A 5KBRA 3DAKA 3FXZA 3KXNA 2OG8A 1PKDA 4MD9E 4WA9A 3UQCA 4NW6A 4NM5A 5IH5A 3CGFA 4J71A 4Q9ZA 3V5LA 4DN5A 4JDJA 3RZFA 4FMQA 2UUEA 2XB7A 3DXQA 1P4OA 3MPTA 3HUBA 2WTWA 5JKGA 3GU6A 1CMKE 4C34A 4C3RA 5FDXA 4FV9A 5GZAA 3UO5A 4O2ZA 4CT2A 4WNOA 4TZRA 4OAVB 2VO6A 4NIFA 3OUNB 4I92A 4KKGA 4DH1A 4DGLC 3KXHA 4W4WA 3Q96A 5IUHA 1LUFA 2HWOA 3LJ1A 5J5SA 3JY9A 4GSBA 4DH8A 4K8AA 2XH5A 5F20A 3UYSA 3ZXTA 4KNBA 2OGVA 2VN9A 3GGFA 4GT5A 3W2OA 3ZO3A 2C1BA 3GU7A 3Q4ZA 5DGZA 3CTQA 2CKPA 3UC3A 4AGWA 4APPA 2DUVA 4EOIA 5BUIA 2I0YA 2R3IA 3DZOA 4BCIA 1S9IA 5C03A 4WBBB 3P86A 4ANOA 4LOOA 4DH5A 2QCSA 4W9WA 2PVRA 4DA5A 1XH4A 4G3GA 3ULZA 3VBQA 5KHXA 2F57A 4E3CA 5JZJA 3MPMA 3EL7A 3W2PA 4LRMA 4GK2A 2C3JA 4FTRA 4MKCA 5AR2A 3WIKA 4Z55A 3Q5ZA 3GCSA 4O0RA 5E4HA 4AZSA 5HTCA 4X0MA 2JKKA 4RT7A 5AP5A 2BHEA 4HGLA 3FMMA 4MXCA 2XK3A 2FA2A 1NVQA 5EOBA 3REPA 3BHHA 1SYKA 5AUWA 4AU8A 1DAYA 1OPJA 2X6DA 3FMJA 5DPVA 2Z7RA 3K2LA 4YURA 2FVDA 3NNXA 3COKA 2GS2A 4I20A 5EI2A 4C4HA 3QUDA 3NR9A 4II5A 4LL0A 2EXCX 5J9ZA 4EHVA 1PJKA 2DS1A 2RFEA 2G1TA 4RIXB 3WZUA 4IMYA 4YC3A 2WD1A 5L6WL 3WE8A 4BRXA 1GJOA 4EZ7A 4WG4A 3PWYA 4AGCA 5GIOE 2WMSA 3K5VA 1WBPA 2WO6A 3VHEA 1W7HA 4F0FA 4M69B 5DMZA 5AIRA 1UNGA 3D4QA 3VBWA 5CXZA 4YLKA 2QG7A 2ETMA 2CDZA 5FM3A 3R7EA 5BYLA 4OTGA 4O7SA 3OROA 4ZLYA 4IX4A 3GFWA 2YJSA 4IWPA 4RG0A 3FPMA 4WUAA 3FLYA 2B4SB 3FKOA 4UN0C 4R7HA 5LCKA 5IEYA 3LFCA 2XMYA 4HOKA 3KULB 3WIGA 4LGGA 3PUPA 5BVFA 3IS5A 5CT7A 3CR0A 3DKFA 4D2WA 2CNUA 3HDNA 3QX4A 3ZH8A 4MBLA 5LXMA 2W1CA 5DHJA 2ZV2A 4LUDA 4M7IA 5I9VA 3NPCA 4LMNA 2NPQA 3P7AA 2XA4A 2XS0A 5AMNA 2W4OA 4QYGA 4ZOGA 4GT4A 2YZAA 3HV6A 2VTHA 2P4IA 2PVFA 3BYOA 4IACA 5JGDA 3ZOSA 3M2WA 1PKGA 3LW0A 2VTQA 5LVLA 3QLGA 4FIFA 4KWPA 3MB7A 1ND4A 1YXSA 4RIYA 4YTHA 4ZIMA 2WTCA 2W17A 4E7WA 1JVPP 4L53A 5GZ8A 2ZM1A 5HBHA 3E88A 3VS0A 1FMKA 4FL3A 1IAJA 2OWBA 5CSXA 1H1QA 1XO2B 2JC6A 4BKYA 1Q3WA 5HTBA 4ERKA 4NU1A 2YIRA 3T3UA 4FL2A 4OW8A 4XH6A 3FV8A 3GQIA 4E26A 3CY2A 3DAEA 3Q9WA 4IZ7A 3CQUA 4I4EA 4P7EA 3BU3A 5CU4A 4G5PA 2XJ1A 4WG3A 2IVUA 5D1JA 5DE2A 5CEKA 1XBCA 3DZQA 3B8RA 2UZLA 4B9DA 2C4GA 2XK6A 4P2KA 3VJNA 1MRYA 1W84A 3UBDA 4EC8A 3TJDA 4MXYA 3G51A 3F2RA 2CGXA 5J1WA 2WU7A 4C62A 3VBVA 1YWVA 3A60A 4EHGA 3DAJA 4YSJA 2PTKA 5M57A 5DN3A 4BGGA 5GHVA 3OT3A 3EKNA 1H1RA 4HYUA 3FI4A 1J1BA 4IJ9A 3R7VA 4JQ8A 2OW3A 4MTAA 3IG7A 3FKNA 4EL9A 3Q9ZA 3QZFA 4QTBA 3D9VA 4D5HA 4OT6A 1BL7A 5AX9A 1FVVA 2LGCA 4IDTA 2QO7A 3AD6A 2F7XE 3QRKA 3DDPA 5M53A 4G2FA 3PLSA 2W5BA 5CF8A 4X2JA 4YSMA 1ZYJA 4EJNA 4PL4A 4QTAA 5EK7A 5FXSA 4CLIA 3LFAA 4YHFA 1TQPA 2C5YA 3QC4A 3EFLA 1H01A 1R3CA 3R8UA 3ROYA 2FSMX 4KBCA 3BHTA 5IA4A 4F6UA 3RHKA 4CFVA 4NTTA 3IDBA 3I1AA 2PUUA 5ETCA 3RKBA 2DYLA 1IASA 5EOLA 3UNKA 4CSVA 4CRLA 4BDBA 3RPSA 3CBLA 4UZHA 3DPKA 4AN2A 4AUAA 5B7VA 5I9XA 4JX3A 4NIFB 5HIBA 4UXQA 5FLFA 4A06A 4YZ9A 4DT9A 4GU9A 4QP2A 4I1ZA 4FKOA 4K1BA 4CYJA 4RZWA 2QOCA 3EQGA 3LQ8A 4X2GA 5ANIA 1IAHA 4L46A 3FLWA 4TYHA 3DJ5A 5LVPA 4FGBA 4E4LA 5BNJA 4W4VA 4I4FA 4ZZMA 4I5PA 3GI3A 3WBLA 3EMGA 3F61A 1VEBA 1Z5MA 2B9FA 2B9IA 3QHRA 4WRSA 2E9UA 2OH0E 3KCKA 5DLSA 5BVEA 4LMUA 1XR1A 3TZMA 5KX8A 3AT2A 3JUHA 4F0GA 5LVMA 4I0SA 3D94A 1W83A 5DT4A 2OJIA 3KQ7A 4FX3A 5HKMA 1Q8WA 3TKUA 3PA4A 4YHJA 5AA8A 4XHKB 3VS2A 2UZOA 4MHAA 4E5WA 3BGQA 4LL5A 4C3FA 3AGMA 3TDVA 4E73A 1PMVA 3GU5A 4GL9A 2PVYA 4WHZA 3GP0A 3U4UA 2VTTA 4CT1A 5DI1A 4YJRA 3CE3A 4F6WA 4S33A 4C35A 3B2TA 2PMIA 3QD0A 1WVXA 2XIYA 3G0FA 4GUEA 1JSVA 2R64A 1PXPA 2UW3A 3COHA 4XOYA 4XBUA 4NK9A 4YGAA 3UIMA 4BI2A 4DGOA 4EEVA 5FTGA 4BI1A 5KNJA 3FLQA 2C5XA 2O64A 4MD8E 2RKUA 5FEQA 3SAYA 4BF2A 4TL0A 3MW1A 3OWLA 4RC2A 1VR2A 4FICA 1B39A 4ACGA 4DEHA 4EZ5A 2UVYA 1AD5A 3QALE 4DH7A 2WTKC 4Q9SA 3U51A 5DG5A 3RAHA 3FDNA 3FXWA 4MEDA 5AEPA 2FB8A 2OH4A 4ALUA 4PY1A 4KUJA 4G31A 1KE5A 3AQVA 3FL4A 4KSQA 2CGWA 2AC5A 2YERA 3OTUA 2R7BA 3AC2A 3QQJA 4OBQA 3WF7A 4QP9A 4OAUC 4U79A 1O6LA 3FY2A 2O2UA 1BI8A 4RJ6A 2BFYA 3C4WA 4RRVA 4U9AA 3DLZA 5CI6A 5AR5A 4OBPA 5FP5A 4JBPA 5HG8A 5I0BA 2RIOA 2RFDA 3BU6A 4GFGA 3PXFA 5HVYA 3U4WA 3S00A 3G33A 3JVSA 4W8EA 3ELJA 1X8BA 1XHAA 3RI1A 2WMRA 2X1NA 4IVAA 2BKZA 4RIYB 5AP6A 1U4DA 3ZHPC 1A48A 4IDVA 4IM3A 4FG7A 4EK4A 2YACA 5HE1A 4FR4A 2Q0NA 2XM9A 4QMVA 1OVEA 1ZY4A 4MXAA 1V0OA 2OFVA 3ORLA 4FV0A 5TR6A 3ACJA 5FTQA 3DQXA 3QCYA 4JT3A 2C0IA 3BYUA 1YKRA 3BBWA 3FSFA 4U40A 3R9HA 4F9BA 3SC1A 1H27A 3HLLA 5E1SA 4QQJA 4HVHA 4JIAA 2R2PA 5M4FA 1Y6AA 2ITPA 2VTPA 1FGIA 3R30A 4AW1A 4F63A 3MVHA 4MK0A 3CTJA 4YJNA 4UZDA 4RBLA 3F7ZA 2Q0BA 3OOGA 2DQ7X 4GCJA 5J9LA 2Q83A 1WVYA 2IG7A 3ATSA 3TACA 2FSLX 3QYZA 4YTIA 3TNPC 5HCZA 2W4KA 3OWKA 4PWNA 3MA3A 4EUUA 4WOVA 4YUQA 2O0UA 1KUTA 4QD6A 2YM7A 2WMXA 2PZIA 1S9JA 3G2FA 1WBNA 4ARKA 5CSPA 1O6KA 1U54A 5KBQA 4HPUE 4IWOA 4V04A 1UU3A 4MF0A 1E1XA 1Q41A 4BBMA 4CMOA 4HW7A 4EJ7A 2VTSA 3BGPA 4YHTA 2QODA 1YHSA 3FHIA 4M3QA 3PP0A 2YCFA 3ULIA 3HV3A 3R1SA 1OKWA 4DINA 3QQUA 3UVQA 2BVAA 3Q5IA 4LRKA 3G6HA 3QKKA 2BIYA 4DG2E 1WBTA 3GC9A 5KZIA 3FE3A 4BTKA 3K3JA 3E7OA 2GPHA 3F3VA 2X8DA 3EFKA 3ODYX 4FV2A 4G17A 4JDIA 4P5ZA 4BDDA 4XG3A 5IH6A 5JFSA 3HMOA 4M0YA 4FKPA 4RJ8A 3UZTA 2BHHA 4PL3A 3F9NA 3ZEPA 4AACA 1GIIA 3DJ6A 1VYZA 4EYJA 3VF9A 3UOJA 4IQ6A 3QTSA 2C0OA 5KKRB 3TV7A 3H0YA 4AW2A 3UC4A 5JH6A 3KEXA 3ZCLA 5BVWA 2RSVA 3V01A 3L8PA 2YAKA 3CY3A 4PUZA 2I0EA 4X3JA 2Z7LA 4HCTA 1FOTA 5EDQA 5HORA 2J7TA 4DT8A 5CF6A 4L6QA 3ZSHA 1KE7A 2RFNA 4RMZA 4Q5EA 4JL9A 4AZFA 4BDEA 4PDOA 2ZM3A 3EN4A 4BC6A 2YM8A 1ATPE 4K0YA 4RLLA 2VNYA 4XEYA 4G3EA 3CKXA 4G6OA 4V0GB 5J7HA 4GIHA 3PJ3A 4J52A 1LP4A 4X3FA 3ZO1A 1LEWA 3E3PA 1WMKA 3IW6A 4B6LA 5M4CA 5CY3A 4FNXA 4UMTA 4ENXA 3TT0A 2IVSA 5GNKA 4D9TA 3F88A 4I93A 4Z7HA 4YJUA 3DLSA 4FK6A 1R1WA 3KREA 4IANA 2I6LA 2YISA 2W9FB 1OIUA 3BX5A 4CTCA 5JRSA 2OIQA 1W0XC 4CZTA 4H3PA 4IZ5A 2JKQA 3A4PA 3R9OA 5HOAA 4BR3A 4RWLA 3UPZA 2JDVA 1Q99A 3ODZX 1OECA 2C69A 4PP7A 5KKRC 2C6IA 4FV5A 5HHWA 1UU9A 2ETKA 2WQNA 3UNZA 2JD5A 1U5RA 1YOJA 4FBXA 3UE4A 5BX0A 3W8QA 3KF7A 4WIHA 5I9WA 5LOHA 4RGJA 4I21A 2HIWA 3C4FA 4X7QA 3SD0A 2R3LA 3EOCA 2B55A 3TZ8A 1SVEA 1XKKA 5LARA 2C6KA 2XK9A 4NZWB 3N4VA 1Y8YA 2PZYA 3EQBA 4UB7A 3P4KA 4B8LA 1K2PA 4F4PA 2XK8A 5CVHA 4EWHA 4KD1A 4QMWA 2IN6A 2VTAA 2BUJA 5CU6A 2ITNA 4X6RA 4IX6A 4QMQA 3R1YA 5CNOA 4BYIA 2XNGA 4I5CA 3AC3A 5HCYA 2NO3A 4FV7A 3RAWA 3WF9A 1VJYA 2ZJWA 5HO6A 3VULA 1OKYA 3G6GA 2HW6A 5CXHA 4EOOA 3BYSA 4F09A 1LEZA 2EXMA 2GNFA 2F49A 5FBOA 3UIBA 1V1KA 4ONAA 4CFMA 4EBVA 3UZPA 2WTDA 2V55A 2R3NA 3Q9XA 5K0KA 1UKHA 3RVGA 2W9ZB 3EQCA 5AUYA 4C58A 3D2KA 3V8WA 3FWQA 3A7HA 3C1XA 4DEGA 4E6CA 3M42A 3ORNA 3QAME 2CKEA 4FOBA 3BEGA 3GU8A 4PF4A 4D2TA 4GH2A 4F7SA 1ZY5A 1JOWB 3QRJA 3P79A 3VQHA 2XNOA 2PZPA 3T9IA 3IK3A 1E1VA 1Q4LA 4K11A 3PE2A 2VTIA 5AIKA 5A4QA 4FTUA 3LXKA 5HLNA 3Q52A 4IC7A 3UQFA 5DR2A 2QU5A 4L43A 1AGWA 3RINA 5ANGA 3I0OA 4ZJVA 3TXOA 4FT5A 1REKA 5CS6A 4RX5A 2GS7A 3N4UA 3C0GA 1W8CA 4L3LA 3FMDA 4IADA 5CTPA 2Z8CA 3TV4A 3R1NA 1KOAA 4C4EA 4CNHA 5C8KA 4DGNA 4FUYA 1PXJA 4A9TA 4ZLOA 2QOOA 3ANRA 4GW8A 4ZSLA 4KABA 1PY5A 4K9YA 3A7FA 4ZK5A 4YNOA 3HP2A 4O0SA 5FD2A 1NW1A 1PXMA 3DBQA 5JN2A 5IKWA 4Y95A 3ZFMA 1OZ1A 3PPKA 5IH4A 4BCGA 5HNBA 4RVMA 2VWZA 3HRFA 3OBJA 1H1WA 3OT8A 3R63A 3PPZA 4ZTLA 3TI1A 2VWUA 3MBLA 5HCXA 3S95A 3D7TB 3O7LB 3RCJA 4LV5A 5HU9A 2BMCA 3CD3A 1UV5A 1SNUA 4M8TA 3ZM9A 3SOCA 4UMUA 3ZMMA 3CPCA 3D5UA 5A14A 3CCNA 4R3RA 2B54A 4FV6A 3O2MA 4F7LA 1STCE 5HI2A 4F1OA 3NSZA 2YZLA 2P2HA 4LUEA 5A46A 5IQFA 4QMPA 4Y5QA 2PVHA 3LFFA 3UPXA 4BDIA 3VUTA 4O7ZA 4J7BA 3RPOA 4EKLA 5J87A 1UNLA 3WE4A 1A9UA 1R0PA 4N6ZA 3TIZA 4S31A 4JVGA 3VS7A 2VO7A 2OZAA 4QQCA 4F9AA 2R5TA 2GQGA 4PTEA 5H9BA 2V7AA 2XEYA 5DFPA 3PSDA 4BCNA 3PXZA 3SXSA 5JFXA 3NAXA 1XBAA 2ZB1A 4R77A 2XEZA 3VC4A 5A6NA 5CAPA 5M08A 3V5TA 3V6SA 3I0QA 3IOKA 5AX3A 5IQGA 5KMJA 4G3FA 3PIYA 4U7ZA 4FV1A 5C1QB 3KULA 2JIUA 4C7TA 2HY81 4U3YA 5E90A 2QOLA 4UWCA 3KGAA 5F1ZA 2JITA 4APCA 2HK5A 2YDIA 2BRGA 4KBAA 3A4OX 3DOGA 5KMKA 5H8BA 4O7RA 3OCTA 3ZM4A 2GMXA 4I41A 3AC1A 1MUOA 3HP5A 4X3FB 5HVJA 3V5PA 4GU6A 4UMPA 2WMQA 5FRIA 4RVTA 3ZC6A 3LCSA 4FA2A 3PY0A 3QZGA 3PLAE 3V04A 3LKMA 1PXIA 3G5DA 4PX6A 1ERKA 3C4XA 4F9CA 2QKWB 4FNYA 1REJA 4ITIA 4RJ4A 5EYCA 3CPBA 1WBWA 3E5AA 4ZJJA 4IE9A 5CSVA 2R3FA 2HAKA 4YZMA 2XCHA 5G1XA 1ZMVA 3GC0A 3HL7A 2IW8A 2ITVA 3NYOA 5LMAA 4C4IA 4BBFA 2PU8A 1YDTE 1MP8A 2FSTX 3SGCA 2PZRA 3MFRA 4QOXA 4GK3A 2C30A 3P5KA 1B38A 4F70A 1YI3A 1JPAA 3GVUA 5TO8A 3M1SA 2BRMA 4N70A 4FSYA 3UYTA 5HNGA 3HVCA 4USFA 2Y0AA 2OF4A 3FYKX 1BI7A 1NXKA 2UW7A 4C02A 2WXVA 3LCDA 4FKVA 3VW6A 3MVMA 4QPMA 3GCUA 4QP3A 3UDBA 3QTQA 5HIDA 4RFZA 1IA8A 4F9WA 4D58A 4X3FC 3UMXA 3VS4A 1QMZA 2UZVA 1XBBA 2CGUA 3KXZA 1OPKA 5C01A 5FP6A 1F0QA 1G5SA 1R78A 5FUTA 3LOKA 3QCXA 2VX3A 1UA2A 4ZAUA 4IWQA 4XV1A 3V51A 4WRGA 3SKCA 2WOUA 1R0EA 2F7EE 1PHKA 4MH7A 3MDYA 2JIIA 2VGPA 5E8YA 5HQ0A 3TV6A 3AC8A 2WIHA 2J0IA 3MYGA 3CXWA 2JAMA 4RC4A 4FC0A 2JKMA 3V6RA 3ZONA 4DTAA 5IQAA 2UZNA 4O83A 4BDAA 2PWLA 3QLFA 4Y73A 4HGTA 3C4ZA 4D55A 1J7IA 5AM7A 4HGSA 4GRBA 5AV2A 3U9CA 4KIPA 4QNAA 4NEUA 3HX4A 2B1PA 4QP8A 3LQ3A 5GINE 4BWPA 3ZLYA 4A4XA 3HKOA 3VF8A 3VS1A 5FBNC 3NEWA 4RJ5A 3R28A 3NGAA 1GZNA 3LZBA 1DI9A 3PFQA 2UZTA 5AR3A 3OOMA 3RMFA 2OXYA 4EK6A 2QOQA 4FTIA 2X8IA 2YITA 4F65A 2YDKA 4K6ZA 2ZB0A 3VQUA 4H05A 4RWIA 4BDJA 1KE8A 3ORPA 3SX9A 1FQ1B 4RA5A 2YM4A 5M09A 4ZMEA 1EH4A 4U44A 3N51A 2C6OA 4FNZA 4O0VA 3FZSA 4AXAA 3ORIA 2ZMCA 3VUKA 2ZV8A 2ITQA 4R78A 2QHNA 2PK9A 1OKVA 2WMAA 5DR6A 3BI6A 2WMWA 2V62A 4BGHA 3HMIA 3UGCA 3KMUA 2UZWE 1OITA 4RZVA 4BTMA 2YIXA 2H8HA 3LFEA 3OC1A 4S34A 2PSQA 4TKSA 4ALVA 5KCVA 4E8AA 3HRBA 1OL5A 1H00A 3MTFA 3TZ7A 4WNKA 5CEOA 4JDHA 5CSWA 4IAKA 4WBOA 3VJOA 2FUMA 2Z7QA 4D4RA 5B2LA 1J7UA 1OI9A 3BKBA 2UZBA 3O51A 3WF8A 3ZBXA 4FKRA 4R7IA 2GNJA 3NNWA 5BMSA 4RIWB 2R3JA 3QQLA 4FTAA 3NUYA 2OZAB 3PA5A 2X0GA 3FLNC 3BQCA 4R3PA 5EYKA 4ASDA 5M06A 3GC8A 2DWBA 5HG9A 2CN8A 3NUAA 4O21A 3NIEA 4H58A 1LR4A 4MXXA 2OXDA 3ORTA 4EOKA 2IWIA 3UIXA 3GCQA 4QMYA 2BAQA 4RPVA 2OJGA 3ZU7A 4DFBA 3OXZA 1A06A 1U59A 4IC8A 4QQ5A 4U45A 1Q8UA 4I3ZA 5L8KA 3DFCB 5IZFA 5EQYA 5A4TA 4JIKA 4CMTA 4ZP5A 4BHNA 4L67A 4GKHA 4TWPA 3SQQA 3ACKA 1GZ8A 1GIHA 3GQLA 2GTNA 4MCVA 3HA8A 1BUHA 2VX1A 3TKIA 4E4MA 3JXWA 3TCPA 4BL1A 3R9DA 4DGMA 4NKAA 3D0EA 2X4ZA 4Y8DA 2ITXA 4D4VA 4DG0E 4FKWA 3W2SA 4CEGA 3NYXA 4MXZA 1JNKA 3ZXZA 4XLVA 3QHWA 5GJFA 3UOHA 5J9YA 3FC2A 1URWA 3NW5A 4JBQA 4FTNA 1V0BA 5CNNA 4JRNA 4X2KA 4CQEA 4ZS4A 3HEGA 4J97A 1OMWA 2ITTA 4WD5A 5CX9A 3ZLSA 4XLIA 2GNIA 3E8EA 4PNKA 3AOXA 4K33A 3OWPA 2VO3A 3OD6X 4CG8A 3T9TA 1H1PA 3U9NA 2WMUA 3LIJA 3COIA 5CZHA 1YWNA 2VO0A 3BBTB 4XP3A 5C26A 5L2QA 2IO6A 3QD3A 5AP7A 2X4FA 2B0QA 3UZRA 1PYXA 2I0VA 4JR3A 3UO4A 2Z60A 4NKSA 2X2LA 5E8WA 4L3PA 4YJQA 4FSNA 2BZJA 3I79A 4QMMA 3FUPA 5EHYA 4F9YA 4U8ZA 3AXWA 2QVSE 2R3OA 3OY1A 2BDJA 4NM3A 2JEDA 3LE6A 2PMLX 4UY9A 2WQEA 3IPHA 4FTCA 4DEIA 5C4KA 2I40A 2EWAA 5JSMA 2PY3A 4FIGA 5A4CA 1NT2A 3F5GA 4QPSA 4EK8A 4CGAA 4H3QA 3R73A 5JK3A 3NIZA 1U5QA 4NJDA 1KV1A 2HZ4A 2QOIA 3OS3A 4FKTA 3FZOA 3UIUA 2NRYA 4YTCA 3LM0A 4CQGA 1UVRA 2ESMA 2AYPA 4YPDA 3PPJA 4OTHA 3QZIA 3SRVB 4O7YA 5IQHA 3CLYA 5K5XA 2CNVA 2ZDTA 2O65A 3NUUA 4HCUA 5AR8A 4X2NA 4DLJA 3ORZA 2UVXA 4EOMA 5EM8A 3QRTA 5JGAA 5J1VA 5CAUA 3QQKA 4LV8A 2I7QA 4GIIA 3L9NA 3KVWA 4JS8A 4YJOA 5F94A 4D2RA 4DHFA 5K0XA 4Q5HA 3BHVA 3FAAA 3SW7A 3MFSA 3QWJA 4Y72A 1ZOEA 4DF3A 2GHMA 4F0IA 3EL8A 4I23A 4YJPA 3ZFYA 1DS5A 2H96A 2H9VA 3AGLA 3FBVA 5K9IA 4BGQA 3UOKA 5M4UA 5FM2A 5CEMA 1BLXA 2W1ZA 4O7TA 3GOPA 4A9UA 3E93A 5FEEA 2ONLA 3E8DA 4FEQA 1SZMA 4BDGA 4O81A 2Y4PA 2UW5A 1APME 4N4SA 4LRJA 4QMUA 4JJRA 1CDKA 4ACHA 4WG5A 2B9JA 4ANMA 2GQSA 4QP6A 5DBXA 3SVVA 1P14A 1WBVA 3R2YA 3LXPA 4IB5A 4JI9A 1VYWA 3TG1A 3CS9A 4NFNA 4QP4A 3LJ2A 4BDCA 2C3IB 2IVVA 1G8AA 2ZDUA 3CC6A 4FSQA 4IH8A 4V0GA 3WZJA 1Q97A 4B0GA 5AUUA 5EW3A 4XG7A 4DFNA 5ETAA 1OL1A 1P4FA 3KRJA 3MA6A 1ZRZA 3IDPA 1JKKA 2HWPA 2W1IA 3O7LD 3U6JA 5CQUA 4BVUA 4BI0A 2ETRA 5I4NA 3LM5A 3E62A 3H10A 2CKOA 1QCFA 5JMSA 3Q2JA 4CCUA 2YEXA 4O82A 3CSVA 5IA0A 5J95A 2OK1A 3RPVA 5FG8A 4NJ3A 4XMOA 2C3LA 2R3GA 5AA9A 3QTWA 1JKTA 2QLUA 4Q2AA 4Y5HA 3V8TA 3U6IA 4IX3A 4LFIA 3FI8A 3BGZA 3Q32A 4J96A 5LMBA 2JBOA 4ASXA 4PQNA 4W9XA 3A7IA 3V8SA 3QRIA 2O5KA 4AE6A 2PVKA 5IG1A 2GTMA 2XKFA 3CEKA 3ZZWA 4RFYA 3EFJA 5A9UA 3UG1A 5HESA 3Q2MA 4DTKA 4DITA 3R8LA 2OI4X 5HD4A 3K54A 2BALA 2R0IA 4BBEA 1H8FA 3DFAA 3QFVA 4EOPA 1M7QA 2X8EA 3DBCA 3KY2A 2C68A 2ITWA 4XNEA 2G2FA 4YNEA 1OIRA 2IW9A 4J99A 3ET7A 4U41A 3R21A 3Q6WA 3CJFA 1PXKA 1OL2A 3QKLA 5BUEA 4OTFA 1WBSA 1JAMA 3ORMA 3ANQA 3C4CA 2FSOX 1BX6A 4GFOA 4QYYA 3ROCA 1H25A 3BU5A 2GFCA 2BZIB 3EZRA 1FVTA 4UWBA 3Q04A 3QL8A 4LGDA 2OJJA 4FZAB 3P0MA 5EM7A 4WSYA 3ALNA 2F7ZE 2XJ0A 4TXCA 2OLCA 3IW7A 2W5HA 2A19B 2VWBA 2WQBA 3TEIA 4X6QC 1CKIA 3FQEA 3K5UA 2W0JA 4ZZNA 3SG8A 2E9OA 4EUTA 4FZDB 5DVRA 3VUIA 4BKZA 3G90X 4FF8A 4FKSA 4FTOA 3O96A 4TN6A 4CFXA 2O63A 4CZYB 2JGZA 3OW4A 5IA1A 2VX0A 4AA5A 3VBTA 1YI4A 2HCKA 5C27A 3DKCA 4C37A 4E20A 5DNRA 3VW8A 3EQFA 4G6LA 4UYAA 5ACKA 4DEEA 4ZTSA 5BVOA 4M67A 3O8TA 4FK3A 2F9GA 3DTWA 2QOKA 4KBKA 3MN3A 3Q4UA 4ENYA 3Q3BA 1BL6A 4CXAA 5LQFA 4D5KA 2WTJA 2IPXA 2PE2A 4B7TA 3A99A 3DY7A 3RPRA 4EH3A 2XUUA 2VNWA 4FKQA 3P08A 4M84A 1JQHA 1BKXA 4HCVA 3N9XA 4PV0A 3TZ9A 4WUNA 3ALOA 3QUEA 4FTTA 3SLSA 2X9EA 3DCVA 4DFLA 5L8LA 4KAOA 1RJBA 3H0ZA 5HLWA 2Y6OA 4GK4A 3D7TA 5I9UA 4BWKA 1OUKA 1TQMA 1NY3A 2Y4IB 4QP7A 4AWIA 4YU2A 5IDNA 1KE6A 3R02A 4HZSA 3ZBFA 4CFFA 4BCJA 1BMKA 1PW2A 3IGOA 4JDKA 4XV2A 3WF6A 4H1JA 5HE2A 5DRBA 4AG8A 5FEDA 2XIXA 1GY3A 1ZMWA 3ZO4A 5BVNA 2WIPA 1FBNA
chains in the Genus database with same CATH superfamily
3AT4A 2JAVA 3CTHA 5IMEA 3OXIA 4O1PA 4TY1A 4CCBA 4U42A 1CKJA 3RALA 3DB6A 3KRRA 3ZRLA 3DV3A 3L9MA 2J90A 5BVKA 3EIDA 5F4NA 5EH0A 3QU0A 2YWVA 1H26A 3OW3A 2XRWA 2FYSA 4GYIA 3RM6A 2BAKA 5FDPA 4RA4A 1PMUA 4UYNA 2A1AB 4U43A 1OB3A 3H9RA 2Y7JA 3ZFXA 3ZZEA 4IHPA 4TTHB 2YM3A 3EZVA 1PYEA 3PY1A 3QA8A 5CU0A 4DBNA 4EQUA 1URCA 4R3CA 2W06A 5J8IA 5IQEA 2WHBA 5K3YA 1FMOE 4MNEB 4YJTA 4R6VA 4FG9A 5HX6A 5M4IA 3TKHA 5CVGA 4LYNA 4PPBA 2YIQA 4FOCA 4O86A 3QTZA 3ITZA 3OFMA 4M66A 3I81A 4M0ZA 4FE2A 3DK3A 3WZKA 1H1SA 4OLIA 5AV3A 4RQVA 3P7CA 5EW9A 2C3KA 3FMKA 2C6DA 3DTCA 2OICA 1XH9A 1Y8GA 2Y4IC 3PIZA 3QQGA 1VLRA 2PE1A 4PDYA 4MNFA 3EJ1A 5D10A 2XKCA 5CYIA 4F64A 3LMHA 4EK3A 2VWWA 2P55A 2C0TA 4WSQA 1WCCA 4FV3A 2PPQA 3OMVA 4S2ZA 3RAKA 5L4QA 1YOLA 5L6OA 1K3AA 2ERZE 4KS7A 3KRWA 4U80A 1H0VA 1AQ1A 3R1QA 4G9CA 5EFQA 2BFXA 2JDSA 2OO8X 2R7IA 2E9VA 4IIRA 4IEBA 4W4YA 3VONA 2XYNA 3BE2A 4NTSA 5H2UA 1H28A 3C7QA 2UZUE 3PWDA 3RPYA 2BDFA 2LAVA 3UNJA 3BEAA 1J1CA 2Y6MA 3FZTA 2UW6A 4AT4A 4CKRA 1YXXA 5CZIA 4HGEA 5AP0A 1I44A 4CYIA 3KF4A 3ORKA 3PG1A 2GFSA 2B53A 3GEQA 4ZXTA 2OJFE 3OCGA 4O27B 4CLJA 2WMVA 2CMWA 4PMMA 2BROA 3W32A 3D14A 5TT7A 4B8MA 3C5UA 1RDQE 3ENHA 4FZ7A 3LFNA 3I6UA 5T3QA 4FKUA 3QC9A 2ONLC 4XUFA 3WZDA 3COMA 5HX8A 4PDSA 5JGBA 4EONA 4M13A 5M44A 2XF0A 2Y8OA 3BLRA 2XVDA 5DR9A 3MTLA 3DS6A 3PG3A 2F2UA 4XG8A 4DTBA 5I5ZA 3PIXA 2R0UA 4EQCA 3C9WA 3EQHA 4C61A 3QRUA 4FUXA 4XG6A 5DT3A 2G2IA 4WNMA 5ANKA 4OUCA 4HNIA 1UWJA 4XYFA 3IQ7A 4NWMA 4FZFB 3PJ1A 2O3PA 2HELA 3W33A 3ZLWA 4DC2A 4AZVA 3MY1A 3HV5A 4CV8A 2PL0A 2V5QA 1QPEA 2WEVA 4O4BB 5IA2A 1NVRA 2WFYA 1ZXEA 4O0XA 5FXQA 2CLXA 4KIOA 4PPCA 2C5VA 3QXPA 2W1HA 3LVPA 1OM1A 4BDKA 4QQTA 5HBJA 3TUBA 4EH4A 3HAVA 5C8MA 1XH7A 1SVHA 5GJDA 5HBEA 4O7WA 2SRCA 2F4JA 3KMMA 4JNWA 3QTXA 4JXFA 4IM2A 3I5NA 3POZA 4QT1A 5ANDA 3IW4A 5A6OA 2WOTA 5AAEA 1E9HA 4QTDA 3ZDUA 2XANA 4ZTMA 4HYSA 5I9ZA 3RBWA 3MS9A 4F1TA 3EYGA 4D2SA 5LWNA 3S0OA 2OXXA 3F6XA 2UW9A 1ZLTA 2F2CB 3KVXA 3RAIA 3BPRA 4TYIA 3LPBA 4F08A 5L2TA 5EM5A 1H24A 3SHEA 4BCPA 3E8NA 5L2WA 5I3RA 2CHLA 4RC3A 4CZUA 5E8SA 2YJRA 2J51A 4L9IA 3P1AA 3ID6C 3DK7A 4IX5A 3PXRA 3CKWA 5A3XA 3W2QA 5A54A 4GEOA 1UWHA 2PVLA 3RJCA 4BCOA 2EB2A 4G5JA 4MYGA 4D1ZA 4ZSEA 2RG6A 3C51A 3FZRA 2BAJA 4MBIA 5JQ8A 3K3IA 3TNHA 4GT3A 2G15A 4R5YA 2VTLA 5BVDA 4XP0A 5C9CA 2YLFA 5M51A 4PMTA 5L3AA 4KA3A 4O38A 4R1VA 3DXNA 5HEZA 1J91A 4BCHA 4MVFA 3HMNA 4ZTNA 3BRBA 3MVLA 4M12A 5AR4A 3L9PA 4C57A 2NYAA 4DBXA 3CQWA 4O7VA 4YTFA 1CM8A 2ZOQA 3AD4A 3RP9A 5CEIA 3W0OA 2W1EA 3QQFA 2W1FA 4PL5A 1H08A 4RVKA 4RX9A 4D2VA 5LJJA 4PPAA 2YFXA 5HD7A 3BWJA 5CAVA 4ZMFA 3VO3A 1XJDA 3ZUUA 4CKIA 3BQRA 4AZEA 4QEBA 3QTIA 2W96B 4FZ6A 4UALA 3R9NA 2CCIA 3MFTA 4I6HA 3Q60A 4J95A 4KKEA 4WT6A 3T3VA 5BPYA 4E5AX 1Q3DA 3S3IA 2FGIA 3O0GA 4XOZA 3RHXA 3HRCA 3G15A 4MWIA 4KKHA 3ZYAA 2B7AA 3NVMB 1H4LA 3FQSA 3NUPA 3VS3A 1OIQA 4RIWA 5HO7A 3EYHA 3E7VA 5TF9A 5IDPA 3E92A 2QNJA 3NYNA 3UODA 4G16A 1OPLA 2J9MA 2UW0A 3MH3A 2XALA 5CF4A 5CT0A 2ACXA 2CJMA 3ZUVA 3THBA 4F1MA 1GAGA 1UU8A 4E93A 4EOSA 1MRUA 1ZMUA 3PJ8A 4FSWA 3VUMA 4Z7GA 2NNWB 3ZSIA 3NYVA 4MX9A 5CLPA 2BIKB 5G6VA 2X7OA 3QD4A 4FTKA 4EH7A 3BV2A 4TNDA 3FSKA 1YDRE 5B2MA 4FT7A 1T45A 4O0YA 4O6LA 4UWYA 5IF1A 3I7BA 3F5UA 1PRYA 4YMJA 4J8MA 2OU7A 1Y6BA 5I3OA 4O4EA 1XH5A 2GNLA 3RTPA 4O96A 4GVJA 3CIKA 3VUDA 4OTRA 2YLEA 3R8VA 5HIEA 2JBPA 2YM6A 3C13A 3LFBA 4R1YA 1K9AA 4ORKA 4QO9A 4FVQA 3NUNA 5ANEA 4A07A 4AGDA 4ID7A 4L7SA 5CSHA 3F3ZA 4K18A 3W55A 3DU8A 4ERWA 3C0IA 4Z3VA 4QMXA 2UW8A 4FIEA 2VWVA 2A2AA 1QL6A 4TRLA 4EH5A 2ITUA 4TWOA 5J7BA 2ZAZA 3JPVA 3DXPA 4NM0A 2QO2A 3NWWA 4IAFA 3Q9YA 4BDHA 3NMUF 3WZEA 5TOZA 5ANJA 3QF9A 5DIAA 5DYJA 4GYGA 4O2PA 2YCSA 3UQGA 2BILB 2QHMA 3DNDA 3BL9A 2BRBA 5EYDA 4D0WA 3CQEA 3W2CA 3PDTA 4TWCA 5KZ0A 4BCKA 4FKJA 4AFEA 3FMHA 1PXOA 2XKEA 3MV5A 3P78A 4IW0A 5BQ0A 2BR1A 2E2BA 2OKRA 3EN9A 2PUNA 3R71A 3SDJA 2VTOA 3QD2B 4ZY5A 5LMKA 4IB3A 4JQ7A 3UJGA 3B8QA 1YOMA 3LXNA 3DDQA 2QI8A 4D28A 2UVZA 2ITYA 3PYYA 3RGFA 2PVNA 2X9FA 4A7CA 5AAGA 3ORXA 3PXYA 4U3ZA 3GFEA 4FTMA 3ZRKA 2JFMA 4FJVA 1RQQA 5GZ9A 4FTJA 4FTQA 3F69A 4G3DA 2J0LA 3R04A 1Q8YA 2X7GA 5CEQA 4JG6A 1M7NA 5ANOA 4AFJA 3SRVA 4YZDA 1GOLA 4EWQA 5HE0A 1OKZA 2IW6A 3DKGA 3LMGA 5EHOA 4YJSA 5HGIA 4AAAA 1G8SA 1P5EA 3OCBA 4D9UA 1WVWA 3NUXA 3U8WA 3E3BX 4XP2A 5KMNA 4CRSA 3LAUA 3HV7A 3O17A 4RSSA 1DM2A 4FTLA 3ZRMA 4AE9A 5AV1A 3DQWA 1FPUA 1HOWA 3QCSA 4A9YA 2C5OA 3IW5A 3H30A 1OUYA 4R7BA 4OR5A 1MQ4A 3RNYA 1YRPA 2UZEA 3R6XA 2R4BA 1OL6A 3FL5A 3UP7A 4GS6A 4CTBA 3R7GA 4NUSA 4NFMA 4AS0A 2PHKA 2UZDA 3EQIA 4O22A 4YLLA 4I6QA 4YO4A 4A4LA 1JKSA 4V01A 3ZEWA 2BDWA 3MFUA 1OBDA 3TMOA 4UBAA 4AGUA 4UV0A 3BYVA 4L44A 2V22A 3TIYA 3ZO2A 2XM8A 3GT8A 5CALA 2QC6A 3DKOA 3IONA 3Q4CA 3GENA 1V0PA 3I60A 2PUPA 3V5JA 1JSUA 2PVJA 3IOPA 3ZTXA 4G3CA 1GZOA 3QX2A 4O0TA 4LI5A 4AOJA 3F3UA 3JYAA 5AV0A 3RK7A 3G0EA 4OTPA 5J79A 4EH8A 1M14A 1YVJA 2XYUA 4GG7A 3LJ0A 3VRYA 2CKQA 4J98A 2HENA 3TNWA 4F7JA 2UW4A 5AR7A 2V0DA 4OTQA 5AM6A 2R3QA 2BTSA 3IO7A 3LHJA 2WMBA 5H8GA 5CQWA 2YAAA 1ST0A 3OHTA 3A62A 2GSFA 2P0CA 2XCKA 4XBRA 2QURA 3FPQA 2XKDA 5CANA 4GKIA 3GOKA 5DRDA 4X2FA 3MPAA 3OTVA 4FYNA 2WNTA 3H9FA 3GBZA 3UG2A 4ZTRA 3MIYA 4JQEA 4EHEA 5D41A 4EHZA 2YWPA 3W16A 2JKOA 5IQDA 4UMRA 5TE0A 2P2IA 3RWPA 4XV3A 3R2BA 4ZEGA 3R9RA 2VWXA 1ZYDA 4ZSJA 4OTDA 2FH9A 3D83A 2J4ZA 2JDOA 3E87A 5EI6A 5EKOA 4USEA 5IEXA 3BELA 4C59A 3F2AA 4O1OA 5E1EA 2AUHA 1H0WA 4KINA 3ZS5A 3HECA 3OBGA 4FKGA 4BDFA 3SA0A 5EDRA 2CGVA 2PE0A 2XIZA 4E5BA 3BYMA 4TYEA 4DHJA 5EW8A 5JRQA 3JS2A 3BLHA 4QDEA 4DLIA 3EHAA 5ACBC 3FMEA 1CKPA 4YO6A 4H39A 4TYJA 2OJ9A 2W1DA 3QCQA 3OP5A 3KN6A 1ZARA 4U0IA 3S2PA 1MQBA 3C50A 1U46A 4BICA 3W0RA 4GVAA 4BY9E 3TDWA 5D7VA 1WBOA 2OBJA 1M52A 2H34A 3LCTA 3TUDA 2GHGA 4U6RA 5KMLA 4B4LA 4AW0A 3F7WA 4ZZOA 2QLQA 3OZ6A 4KB8A 2VTMA 4JX7A 1WZYA 2XK4A 3CP9A 3O8UA 2BRNA 3KCFA 5D11A 5L6PA 3S1HA 2X81A 3D5WA 2J50A 4JRVA 4TW9A 1UKIA 4ANSA 1RW8A 1G3NA 2HZ0A 3MJ1A 4L3JA 3FMNA 3KXMA 4PP9A 5H8EA 1XWSA 5IISA 1JKLA 2JLDA 4FL1A 4Y46A 5IQCA 4NM7A 4NW5A 2Z02A 2NP8A 4I5HA 4Z16A 1QPJA 2QG5A 3NDMA 3HMMA 3P7BA 1ZOGA 4DAWA 5HU3A 3W0PA 4QDVA 3PSBA 3VN9A 3HZTA 2WEIA 4I0TA 4M15A 4B99A 4QMNA 2EU9A 3L8VA 4LQMA 4DCAA 3GU4A 1ZZLA 4HYIA 3N4TA 4USDA 4EH9A 2J2IB 5ETFA 3R22A 4L01A 4D1XA 4IZAA 2AEGA 4XCUA 5BYYA 2ZM4A 3NW7A 4AZWA 2IJMA 4BFMA 4CD0A 5BUJA 4CG9A 1ZZ2A 5ETIA 5JFWA 3NZ0A 3PVWA 5DEWA 4JR7A 4AT3A 4MBJA 3TM0A 2J0JA 3M11A 4IWDA 1F5QA 4XX9A 4FEXA 2W7XA 5AADA 1QPDA 2W1GA 1YXTA 3IDCA 4MUQA 1H07A 1YXUA 4AOTA 5IU2A 3TL8A 3TTJA 1YXVA 1ZAOA 5AJQA 5IEVA 5D9HA 5KMIA 2HYYA 2WGJA 4IJPA 3ML1A 4AF3A 5AP2A 4CVAA 5CAOA 1RE8A 2QOBA 3PSCA 5CI7A 3RM7A 3TN8A 3QXOA 3LLTA 4MNEA 5JFVA 3JR1A 4LV7A 3ZDIA 3LFQA 3HDMA 4LGHA 3FI2A 3UOLA 4CFUA 4AXCA 5D7AA 3NNUA 5M55A 3WILA 5EQPA 2PMOX 5CEPA 3QTRA 3UTOA 4BHZA 4QMLA 5LMKC 4N57A 2ZVAA 3H3CA 3JY0A 4PNIA 4QMTA 3VAPA 4D1SA 3R8PA 5K4JA 3F66A 1L3RE 2CPKE 4QMSA 2AQXA 2QOHA 3IW8A 4FYOA 4WNPA 5BMMA 4DFYA 3GCVA 5DOSA 5HTIA 4UMQA 1XMLA 4E1ZA 4EZ3A 4DCEA 2VTRA 4I0RA 5EQEA 4WO5A 2VD5A 5KMMA 5E92A 3PUFC 3H9OA 3PZEA 4G1WA 4FG8A 4BYJA 3HUCA 4HZRA 1O9UA 4JAJA 4NH1A 3F2NA 4IZYA 2A27A 4EBWA 4OBOA 4XJ0A 1WFCA 5F9EA 3FEGA 4I6BA 1VZOA 4K77A 5AAFA 4S32A 3D15A 5T6KA 4GUBA 4HVDA 4FEUA 3VRZA 5EI8A 5DA3A 4DGGA 4C38A 2YM5A 3NUSA 5HZNA 5HG7A 4G9RA 4FSTA 2BTRA 2WB8A 2WTKB 3A2CA 3HV4A 3QQHA 2BPMA 3FY0A 4GV1A 4L52A 4NCTA 4YLJA 3T8OA 3VWAA 3MY0A 5C8NA 5KUPA 3FLZA 4AQCA 2YIWA 2YA9A 3MB6A 2VGOA 4FV8A 4RJ7A 1ZYLA 4AN3A 3QA0A 4I5MA 4FVPA 2G2HA 5IPJA 2XIKA 4RWJA 3EN6A 1J7LA 2EXEA 3AT3A 5HG5A 1B6CB 2HXLA 3I4BA 1JSTA 1ST4A 2JIVA 2ZMDA 4L00A 3RNIA 1ZYSA 2VZ6A 2WU6A 4GJ3A 3BWFA 1HCKA 4JBOA 1HCLA 3SOAA 2XAMA 4E6DA 4XRJA 4O0WA 1JBPE 3GC7A 3R7YA 4A9RA 2X2KA 3SG9A 5LVOA 2WTIA 2IZTA 3DJ7A 3TTIA 5LCJA 3PRFA 4ANLA 1M2RA 3NS9A 2GDOA 2YABA 2Z2WA 4P5QA 2CN5A 4E4NA 4KSPA 3KRXA 4XV9A 3LXLA 2XJ2A 3FZ1A 4IFGA 2C6EA 3MH2A 4PTCA 3W8LA 4H36A 2BZHB 2QQ7A 4J1RA 1NA7A 4HVIA 5EHLA 4DYMA 4FEVA 4E6QA 4G34A 3FHRA 4N0SA 3RZBA 2VWYA 3AMYA 4QYEA 4PDPA 5HO8A 3W1FA 4QMOA 4UXLA 2FO0A 3U87A 3AD5A 4PMPA 1YDSE 3NVKI 3VS6A 4BCMA 4O7LA 4L7FA 4OTIA 3LFSA 1DAWA 2P3GX 1G8KA 4IAYA 2CNQA 3VHKA 3VNTA 3ZSGA 4LM5A 3KRLA 2G01A 3CGOA 4I24A 4O0UA 3VBYA 3W0MA 2ZV9A 2XNMA 4AA0A 2W05A 2RG5A 3PZHA 4U81A 3AMBA 5IQIA 2Y9QA 3MH1A 5EG3A 3E8CA 4IAAA 2OIDA 4DHIB 5CU3A 3AMAA 4FI1A 5AUTA 4YZCA 5AFVA 1ZYCA 2B52A 2QO9A 4FKLA 5FXRA 5CVFA 5IA3A 4GMYA 3R7OA 3QBNA 3QZHA 4O4CA 5JQ5A 1LPUA 4BZDA 3PXKA 4C2WA 4EH2A 4JOAA 3AG9A 2QOFA 3F3WA 4H1MA 4CMUA 3A8XA 4D4SA 4RWKA 5I9YA 2BRHA 3FC1X 1SM2A 2OFUA 4LG4A 2XP2A 1YW2A 3CJGA 2X7FA 4FSUA 4QYFA 4XG4A 3AKKA 4MF1A 3R0TA 4BWXA 1IA9A 4C0TA 4YC6A 1BYGA 2PUIA 4BIDA 4I94A 5CWZA 2X6EA 2R9SA 4IVBA 4A9SA 4CV9A 2KULA 4AT5A 4IB0A 4QYHA 4C4GA 3EQDA 3MY5A 4U5JA 4AW5A 2HOGA 4DEAA 3NFGB 3R7IA 3F82A 1KSWA 4U97A 4PTGA 4YJVA 4EOQA 4OTWA 3L8XA 3OUKA 3W2RA 3OEFX 2E9NA 1SMHA 4IAZA 4EOLA 4LOPA 2XARA 2C6TA 5C4LA 4IAIA 4RFMA 4W4XA 5HICA 4RLKA 4DH3A 2IVTA 2OSCA 2W5AA 3HYHA 3UMWA 1IR3A 1XH6A 4GFMA 3RCDA 3KXGA 5DWRA 3GCPA 3LCKA 5E7RA 3II5A 3KFAA 4MWHA 1W2FA 4V05A 5FQDC 3R7UA 3C4EA 4ITJA 2YHVA 3QYWA 3IKAA 3V5WA 3VS5A 2EUFB 2VTNA 2RL5A 4FRFA 2WKMA 3LFDA 4GG5A 3QGYA 1I09A 1Q24A 4FEWA 1J3HA 3ZC5A 4DEBA 1DI8A 3D7ZA 2VWIA 1XH8A 3JVRA 4XS2A 4AX8A 1M17A 2YN8A 1Z9XA 3CD8A 1MRVA 2X2MA 2VTJA 3DBDA 1L8TA 3IECA 4KS8A 4ZJIA 2JDTA 4CFNA 2PYWA 3NNVA 4O84A 2VV9A 5B0XA 4YBJA 4AZTA 3WYYA 1F3MC 1Y57A 5AUVA 3SW4A 3SXRA 4EH6A 3KU2A 5AUXA 3TYKA 2W99B 1ZWSA 3D5XA 4KIQA 4C4JA 4D2PA 4DEDA 3WYXA 4ACMA 4NSTA 4UX9A 4JG8A 4GJ2A 4KIKA 2R3HA 5J5TA 3EQRA 4TYGA 4ZS0A 5DT0A 1Z57A 3OXTA 2YDJA 1IEPA 2VU3A 3IGGA 4HPTE 4YR8A 4QP1A 4ACCA 3OF0A 5EKNA 3EWHA 3MIAA 2BCJA 1PF8A 5E9EA 4QNYA 3FMLA 3U54A 2X39A 3ZUTA 5GJGA 1QPCA 4QRCA 2HY0A 3MVJA 3U6HA 4C8BA 4TYHB 1PMNA 3A61A 1SVGA 1OBGA 3PVGA 3BE9A 3WARA 4LOQA 5CASA 1PMEA 3EB0A 3PJ2A 2PZ5A 5D12A 1O6YA 1KWPA 3KIOC 3GNIB 4KRCA 4EI4A 4XRLA 5H3QA 4BZOA 4FT3A 3V5QA 5T68A 1Q8ZA 3EQPA 1KOBA 1SNXA 1FGKA 2ITZA 3D2IA 3TUCA 3PVBA 1R39A 4CFWA 4I22A 4P90A 3NCGA 4A4OA 4L8MA 1M2QA 3DK6A 3POOA 4AOIA 2RGPA 2IZRA 2XIRA 4FV4A 2ZYBA 4FIHA 2GNGA 2R3PA 3W0NA 2P33A 5M56A 5E91A 4DFUA 3L9LA 3FLSA 3AKLA 2WQOA 3BHYA 3DNEA 2VUWA 2JFLA 2UV2A 3FQHA 3Q4TA 3UVPA 4ALWA 4F6SA 4I6LA 5EM6A 1GZKA 2A0CX 4TWNA 5EYMA 4EC9A 5IUGA 3MH0A 2J0MB 3VBXA 3F5PA 4Y83A 2OZOA 1OGUA 3F3TA 3VIDA 3A8WA 4MXOA 5AV4A 3DB8A 3F5XA 2WPAA 2QR7A 2YCQA 5L8JA 2CLQA 1Q62A 4P4CA 4PRJA 3QGWA 3O23A 4NCTC 5KE0A 4JMQA 4Z9LA 3MESA 2BKKA 2W4JA 4AP7A 1W82A 1YQJA 4BIEA 4R8QA 3KK9A 5K4IA 2ZV7A 4ZSGA 2GQRA 3KN5A 2O8YA 4N6YA 3OWJA 4HVGA 3MI9A 3E64A 5E8UA 3D5VA 3PP1A 5AUZA 5FWKK 3MSSA 5FTOA 4G6NA 4JBVA 4FSZA 5E8ZA 5TKDA 2C6MA 4OT5A 3NLBA 3LMIA 2IZSA 1Q8TA 3O50A 2OIBA 4XG9A 2C1AA 3KB7A 3PTGA 3P9JA 4R5SA 2XBJA 2C6LA 3ENMA 3EKKA 3NAYA 2WTVA 5IUIA 5HVKA 2PULA 2XZSA 4FNWA 4J8NA 4M97A 3C0HA 3EN5A 3Q53A 3ZLXA 2AC3A 4WKQA 3I7CA 3UP2A 3QKMA 3RWQA 3TWJA 5F95A 3I6WA 1WAKA 4IB1A 2VAGA 4L68A 2GHLA 4QMZA 3UVRA 4ZLZA 3KA0A 3C5IA 2YCRA 4FODA 4F99A 3PRIA 4YBKA 1OL7A 4NL0A 1CSNA 2GNHA 2YIYA 4C3PA 3VVHA 4HNFA 2ZFYA 4YC8A 3Q6UA 3O8PA 4PMSA 5IMXA 1TVOA 3G9LX 4DFXE 5KO1A 2HZNA 3RK9A 3TNQB 5HLPA 1YHWA 4TNBA 2ERKA 4TPTA 4W8DA 3FKLA 5ICPA 2EB3A 4X21A 4ANBA 4ZSAA 1KE9A 4YZNA 3L8SA 2NRUA 3R01A 4FSMA 5KHWA 1UU7A 3KMWA 1FVRA 3VUHA 3DT1A 3KKVA 2GS6A 3HMPA 5E8TA 4AN9A 2BZKB 5DH3A 2WAJA 3QTUA 4L42A 3KL8A 4YPSA 2IEWA 4FVRA 4BCQA 2XNEA 4OGRA 4MQ2A 2XNNA 2WELA 5AP4A 5AP1A 2IZUA 5E8XA 4JLCA 3HA6A 4BCFA 3LQ5A 2R3MA 1NVSA 5CENA 4L45A 1U54B 3PXQA 3R00A 3KK8A 4MQ1A 4Y85A 4M68A 5JEBA 3SXFA 3EN7A 4S30A 1CTPE 2I0HA 3OEZA 4NYEA 4MD7E 3L1SA 1YI6A 4IXPA 4QTEA 1UNHA 2XNBA 4FSRA 5HE3A 5L2SA 4ASEA 2V7OA 3RK5A 4BN1A 5JT2A 1TQIA 1OIYA 2WQMA 4IM0A 4RJ3A 1P2AA 1PXNA 4FIIA 5IA5A 1GIJA 2OF2A 2Z7SA 3B2WA 3E63A 4EYMA 4RIXA 4DFZE 1JWHA 5ITAA 3QUPA 3S4QA 2J6MA 3HNGA 3TJCA 3FZPA 1IRKA 4NT4A 4JAIA 3SV0A 1YWRA 4DE4A 4M69A 4H3BA 3MJ2A 4HJOA 3KC3A 3NCZA 4HYHA 4KIKB 3BLQA 3R8ZA 3UO6A 3FYJX 4E4XA 4MAOA 3PVUA 2C47A 2C5NA 4ITHA 5CF5A 1ZOHA 4XG2A 4C4FA 1KV2A 4IFCA 4E6AA 3EFWA 4KRDA 4RQKA 2A4LA 2WZJA 1XQZA 4FIJA 4AA4A 3BZ3A 2REIA 2XRUA 5GIPE 2XNPA 5BYZA 4BZNA 5K5NA 4IBMA 4C36A 5CAQA 5KMOA 4FT0A 3H4JA 2QONA 2I1MA 5FGKA 3GUBA 4EQMA 4K2RA 4EOJA 3ERKA 4O91A 3BV3A 4FKIA 3BCEA 4J53A 2VRXA 3V3VA 3W18A 4BTFA 3OCSA 3WF5A 3O71A 3PE1A 4F7NA 5L2IA 4FGRA 1TZDA 3FI3A 3DBEA 2B9HA 2CSNA 1M2PA 2H6DA 2HXQA 3G9NA 5B2KA 4O4DA 1IG1A 1YHVA 3A7GA 3W10A 2J5FA 4FT9A 4EK5A 5IQBA 2RFSA 3AC5A 3MGYA 2R3KA 3DBFA 5JZNA 3LLAA 2HW7A 5AP3A 2QKRA 3NRMA 2PVMA 4BTJA 3PY3A 2QD9A 3TNIA 2G9XA 3DA6A 4QTCA 3BIZA 4ASZA 4D0XA 4CKJA 3PJCA 4DG3E 3R8MA 4EORA 5A4LA 5LVNA 2WMTA 2E9PA 2J0KA 4O7NA 3HGKA 3EH9A 4BIBA 3NW6A 3KXXA 4I6FA 3I5ZA 2J5EA 3FXXA 1T46A 3MWUA 3FJQE 1Y91A 4TT7A 4JG7A 5AWMA 4ZY6A 5LWMA 5E8VA 3ATTA 4RX8A 1TKIA 2RF9A 4ACDA 5M07A 4RVLA 5A4EA 4IVDA 2GCDA 2HZIA 3P23A 3AC4A 1PXLA 3A7JA 4RIOA 3OY3A 2XBAA 3OG7A 3PA3A 3AKJA 4C33A 1W98A 2GU8A 2PMNX 3GXLA 3WOWA 3DGKA 1FINA 4HVSA 3GB2A 2CCHA 4O6EA 1Q61A 3U55A 5CU2A 1GNGA 3OVVA 3QWKA 3HAMA 3BHUA 4ANNA 3R83A 3LCOA 4IVCA 3NX8A 3WI6A 4C2VA 5HNIX 2KTYA 4ZTHA 4BB4A 2QU6A 4RX7A 2R3RA 2JDRA 4UEUA 4ANQA 1Q5KA 5DEYA 1JLUE 5EDPA 2ITOA 4EKKA 2EVAA 3ETAA 4M14A 4ZTQA 2XK7A 4BKJA 4ZY4A 4YZBA 4D4YA 2QR8A 3VUGA 4QPAA 4YP8A 5KBRA 3DAKA 3FXZA 3KXNA 2OG8A 1PKDA 4MD9E 4WA9A 3UQCA 4NW6A 4NM5A 5IH5A 3CGFA 4J71A 4Q9ZA 3V5LA 4DN5A 4JDJA 3RZFA 4FMQA 2UUEA 2XB7A 3DXQA 1P4OA 3MPTA 3HUBA 2WTWA 5JKGA 3GU6A 1CMKE 4C34A 4C3RA 5FDXA 4FV9A 5GZAA 3UO5A 4O2ZA 4BJJB 4CT2A 4WNOA 4TZRA 4OAVB 2VO6A 4NIFA 3OUNB 4I92A 4KKGA 4DH1A 4DGLC 3KXHA 4W4WA 3Q96A 5IUHA 1LUFA 2HWOA 3LJ1A 5J5SA 3JY9A 4GSBA 4DH8A 4K8AA 2XH5A 5F20A 3UYSA 3ZXTA 4KNBA