4IDTA

Crystal structure of nik with 11-bromo-5,6,7,8-tetrahydropyrimido[4',5':3,4]cyclohepta[1,2-b]indol-2-amine (t28)
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
343
structure length
334
Chain Sequence
VEEYLVHALQGSVSSGQAHSLTSLAKTWAARGSRSREPSPKTEDNEGVLLTEKLKPVDYEYREEVHWATHQLRLGRGSFGEVHRMEDKQTGFQCAVKKVRLEVFRAEELMACAGLTSPRIVPLYGAVREGPWVNIFMELLEGGSLGQLVKEQGCLPEDRALYYLGQALEGLEYLHSRRILHGDVKADNVLLSSDGSHAALCDFGHAVCLQTGDYIPGTETHMAPEVVLGRSCDAKVDVWSSCCMMLHMLNGCHPWTQFFRGPLCLKIASEPPPVREIPPSCAPLTAQAIQEGLRKEPIHRVSAAELGGKVNRALQQVGGLKSPWRGEYKEPRHP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase/transferase inhibitor
molecule keywords Mitogen-activated protein kinase kinase kinase 14
publication title Inhibiting NF-KB-inducing kinase (NIK): Discovery, structure-based design, synthesis, structure activity relationship, and co-crystal structures
pubmed doi rcsb
source organism Homo sapiens
total genus 107
structure length 334
sequence length 343
chains with identical sequence B
ec nomenclature ec 2.7.11.25: Mitogen-activated protein kinase kinase kinase.
pdb deposition date 2012-12-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4idtA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4idtA01
2JAVA 3MW1A 1O6LA 2OU7A 1H26A 2VTAA 3IQ7A 4ZJIA 2AYPA 2BRGA 4EYJA 4L7SA 4U3ZA 4FKTA 1H1WA 3ZUVA 1OPKA 3UQCA 3PJ2A 2ONLC 3L1SA 4WBBB 2GQRA 2ITQA 4Y73A 3O23A 5CXHA 2BIKB 2PMNX 3A62A 5IZFA 4CT2A 5IG1A 4PPCA 4DEDA 4U6RA 3LMHA 3JR1A 3W2SA 2WTWA 1FOTA 4MBIA 3TIZA 4XOZA 4GS6A 4X2FA 2OJ9A 5A4QA 3WILA 2OW3A 3A99A 4IX3A 2PUPA 2I0VA 2B1PA 1E1VA 3SDJA 5DIAA 4EQCA 2UZDA 4NL0A 3TL8A 2PVMA 5LOHA 3RPRA 1W82A 5D10A 4PDPA 4R3RA 5E8XA 5EK7A 5A54A 3SKCA 5LQFA 3MGYA 4CV9A 3WF5A 4CD0A 4CKIA 4FOCA 2V7AA 3A7GA 2XCHA 2XM9A 3FYKX 3Q3BA 4WKQA 5AP1A 3SVVA 1AD5A 2CGXA 3EN6A 4ACCA 5LMAA 5K9IA 2RFEA 3DT1A 4AQCA 2B4SB 3JXWA 5IH6A 4D2WA 3U6IA 1KOAA 3R8VA 4FKOA 1GZ8A 3KRJA 3BLQA 3R8MA 3EFLA 3HEGA 4CV8A 4Q5EA 3EWHA 1URWA 4AXAA 2XNNA 4NFMA 2IWIA 4AZVA 2UW8A 4RFZA 2JEDA 4UWBA 2YN8A 5EYCA 4IB3A 3R7EA 4DEIA 4FK6A 2Z02A 4DT8A 2HZIA 4FTAA 5HLPA 1IG1A 1S9IA 3UG1A 3ZTXA 2W5AA 3CXWA 1K2PA 5FP6A 4E20A 4D1XA 3SOAA 4L3JA 2B9FA 5A6NA 4I21A 1VR2A 3QGWA 2HYYA 1YHSA 3UJGA 3PY3A 3DA6A 3EN9A 5KKRC 4C4EA 3R8UA 3BV3A 3O8TA 1MQ4A 1OKYA 4XJ0A 3UIXA 2O64A 4BDEA 2ZV8A 1SYKA 3FL4A 4AGCA 5BUIA 4I41A 2ZB1A 5A4TA 1OIYA 1KE6A 1Z5MA 2I1MA 4FTUA 3SD0A 4CQEA 3TG1A 1XH4A 2PY3A 1R3CA 2QLUA 2GDOA 3OY1A 2ETMA 2J2IB 2C6TA 4K0YA 4BHNA 1ZWSA 4RLKA 4BI1A 4RIYB 2W1EA 1Q8YA 2Y4IC 4QQ5A 3QALE 4FV5A 4O22A 3VS5A 5KMIA 4L3LA 5AP4A 4TYIA 3UO4A 4CMOA 3UQFA 5LJJA 4J99A 4D28A 5AV1A 5HBEA 4FMQA 4BDIA 4E93A 3SA0A 4E4LA 2GS7A 5FLFA 3HMNA 3ZS5A 3PDTA 4CRSA 4FTOA 4ZTRA 1J1CA 3OCSA 3PY0A 5HKMA 4RVLA 2QC6A 4M15A 4QP3A 4X2JA 2FGIA 2JIIA 3BKBA 2HZ4A 2X4FA 4YMJA 4JT3A 1P5EA 3F82A 4G3FA 4JAIA 4UXLA 4NTSA 2VO3A 4QP8A 4K2RA 4YZBA 3K5VA 5CU3A 4BKYA 4DFXE 3P08A 4U3YA 5IQFA 1ERKA 4FX3A 4GK2A 1YWRA 4P90A 2YABA 4L46A 5LMBA 5CF6A 3OZ6A 3U54A 2IVVA 3O17A 3UYTA 3OWJA 3QLFA 3JUHA 5TO8A 4Q9ZA 4Z16A 1IAJA 1WBVA 2XK3A 3ZSHA 3AD5A 4DFZE 3FWQA 5DMZA 2IVUA 5ICPA 4KBCA 4QD6A 4FT3A 4R78A 2J6MA 3IPHA 4QMXA 3OG7A 2ZV9A 3KRXA 5KX8A 2O3PA 5L2TA 3QRIA 5HG8A 3R8ZA 4X6QC 4LM5A 5CZIA 5G6VA 4BIDA 1ZARA 2BR1A 4HNIA 4O0RA 4V01A 2W17A 3A61A 5CEIA 4QTCA 2G2FA 3I5ZA 4MXCA 4USEA 3GU8A 2QU5A 4J7BA 1AGWA 2XKDA 3ZFMA 3ZXZA 5J9YA 1OKWA 4L42A 3QZGA 1CDKA 4J95A 2X9EA 4EZ3A 4GK3A 3PVBA 2KULA 4DEEA 3AGLA 4JLCA 4M7IA 5JEBA 4FOBA 4AE9A 5KMMA 3NUAA 4MXAA 3VUGA 1QCFA 2YJSA 3E8NA 2JDVA 4QMYA 4RMZA 3CBLA 5AWMA 4RC2A 1URCA 3TZ9A 5BMSA 3GC9A 2QD9A 2YJRA 4IACA 2Q0BA 3WARA 3AC4A 4K33A 2X2KA 2BAJA 4P2KA 4JBQA 4JG6A 1QPJA 2UW3A 3DZOA 5LARA 1ZMUA 2ZM3A 2DQ7X 4J98A 4WT6A 4R1VA 3P4KA 3QU0A 3PTGA 4EK8A 5LVLA 4CFUA 3HDNA 3QWKA 2BMCA 2VTNA 3PY1A 1WBSA 2H8HA 1PYEA 2VZ6A 4I93A 3EQRA 2OKRA 3ZDUA 1APME 1WBOA 1JKTA 5I9YA 3PSCA 1VYWA 2Q0NA 4D5HA 4WG3A 1FMKA 1NT2A 3MV5A 3AC8A 2OGVA 3OCGA 2YIWA 3FMMA 2X8DA 4YTHA 3EZRA 3W2CA 3C0IA 4FYNA 3PJ8A 3W2OA 2UW4A 3GB2A 3NUPA 3HUCA 4U81A 4IADA 2UVXA 4BDDA 4RLLA 4D2SA 3KXMA 5F94A 4E5AX 3WF8A 4XG2A 2RF9A 4FEUA 3VVHA 4LMUA 2UVYA 1JVPP 1PW2A 4JQ8A 4Y72A 4XP2A 3QTIA 3PSBA 4BDBA 4HCTA 3ZH8A 1OPLA 3D5UA 3HV6A 3GEQA 4WOVA 4YJTA 3BQRA 3EB0A 3QKLA 3QUPA 3ACKA 4QPSA 3IDBA 3BHVA 1ATPE 3GQIA 2YLEA 2C4GA 2ZDUA 2ZJWA 3O7LD 3T3UA 3COKA 3GI3A 3ORMA 1OGUA 4C34A 5IA1A 1UVRA 5CENA 3H4JA 4MXXA 5AR2A 4GU9A 4YTFA 4EOSA 2XNMA 2I6LA 4IZYA 3AD6A 5GJDA 4EH5A 4H39A 4D4SA 4FIEA 5DHJA 3VS7A 3VUTA 4U97A 3ID6C 2R3FA 4UMRA 1BL7A 3PXKA 1Q41A 4IM2A 5AJQA 2LAVA 2F49A 4FT9A 3V5WA 4DITA 3FZRA 3SV0A 3TI1A 4MBLA 3ZEPA 4RIYA 4D1ZA 4FUXA 2ITXA 2OZAB 2YEXA 3R71A 4XP3A 5H8GA 3E3BX 3RMFA 2WO6A 3AGMA 4UWYA 3HMMA 4BGGA 3HV4A 4FVQA 4A9RA 5IUHA 1WBWA 4E8AA 3FE3A 5B2KA 2VX3A 3E64A 2W05A 4LL5A 5AP6A 4IMYA 3SX9A 4PWNA 3UODA 3R8PA 3IW5A 4O21A 5JQ5A 3OUNB 4C38A 5CAQA 3MVMA 2OIDA 2HZNA 2YIQA 4EONA 5H8BA 3W33A 2YLFA 2XEYA 5CNOA 3VIDA 4A07A 3FZPA 5I5ZA 3NGAA 5FP5A 5L6OA 3FI8A 4YLKA 4PDSA 4RGJA 1PF8A 3K3JA 3LFFA 2WQOA 4KAOA 3QA0A 4GV1A 3CD8A 5HE2A 3TT0A 4FIGA 4A4XA 3VBYA 1H1SA 5HOAA 4O84A 2RKUA 4D0XA 5IMEA 3UVRA 1R0PA 3QRJA 4FSZA 2DWBA 1H24A 3LFCA 4B4LA 4L9IA 2WEIA 4X6RA 2QOQA 3A60A 5L2WA 4GG5A 4DBNA 3Q6UA 3QHRA 5HE1A 4K8AA 4ANOA 4FKRA 4BTFA 3LXNA 3ORNA 4MK0A 3MVHA 4KS7A 2QURA 2JLDA 3OY3A 4ACDA 2HAKA 3KMWA 2C30A 5L2SA 4FV3A 2BDFA 4AOIA 4H1JA 4TXCA 5CAPA 1R1WA 3F9NA 4I6HA 3UMXA 1T45A 3DK7A 1BI7A 5J79A 1KWPA 5LWMA 4RQVA 5AADA 5HZNA 4XG3A 4XV1A 4R5YA 3DBFA 2P55A 3C4WA 4MH7A 3FSFA 5BVNA 3FY2A 4LGDA 1HOWA 4FG7A 2X2LA 2BZHB 3GQLA 4G17A 3CPBA 4R1YA 3MIYA 5HLNA 4AZEA 3HVCA 4LGHA 4I20A 4EK5A 4O2ZA 2B52A 3GFEA 3B8QA 2I0HA 4FV0A 4N6ZA 4QNYA 3TNIA 4UYAA 3VRYA 4KUJA 2UW9A 4U79A 3TWJA 2VRXA 2WQMA 2ZAZA 4F7LA 1V0PA 1A06A 1QPEA 4ZY6A 4MD8E 3NNXA 4EH6A 2G2IA 4C4FA 2YCRA 3HGKA 1OL7A 3D15A 3Q9YA 3TKUA 4KA3A 5EM8A 1WAKA 3LJ2A 3QQHA 1MRUA 4BB4A 4JQ7A 3TZ7A 2X8EA 4H3QA 5AM6A 2X1NA 3GBZA 1E1XA 3CLYA 3R9OA 3ULIA 2W4KA 4OTHA 3WYXA 4ZS4A 3BU6A 1ZAOA 2VWWA 2GQSA 2NRYA 4RX9A 2R2PA 5BMMA 4EC9A 5IQBA 5HTCA 2GNGA 3HMOA 3OXTA 5AP2A 2UW5A 4W4XA 5CAOA 1YW2A 3RAKA 1IA9A 3ZRKA 4YO6A 3ZFYA 3QRUA 4X3FC 3D7TA 3I1AA 5BVEA 4F9WA 1JPAA 2X0GA 4NU1A 3FLYA 3LXKA 5EKNA 3EQDA 3R2BA 3MYGA 4F1MA 4HJOA 5FDPA 4D1SA 3DTWA 3LMIA 3SRVA 4ZLZA 4MX9A 3H0ZA 1ZY5A 5C4KA 4J52A 2EXMA 5CSWA 2B9HA 1P2AA 4RJ3A 4G34A 4CFFA 4BZOA 3II5A 4ZJJA 2H9VA 3RHKA 2QCSA 3LVPA 4K1BA 2FB8A 3M42A 4AZSA 1Y8YA 3LCOA 5CXZA 5HX6A 3QXPA 2R5TA 3ZUUA 3FI4A 4NM7A 4FVPA 2VAGA 4EBVA 1H8FA 2CKEA 3C5UA 2ZDTA 4EKKA 4M67A 1UU9A 1WVWA 1SVGA 4I0RA 5DE2A 3BIZA 3V6SA 4F7SA 4RPVA 2C6DA 5IA4A 3VW8A 2HW7A 3JPVA 4O7WA 5KMJA 5EQPA 2V0DA 4ZTMA 5IQCA 4H58A 3MJ1A 4MQ1A 1H01A 3KREA 3VULA 3KGAA 4MXYA 1IAHA 3EJ1A 3VHKA 4RC3A 2OZAA 3KXGA 1MQBA 4LI5A 1JKSA 5FXQA 3TNWA 4H05A 1SZMA 4CLIA 1G8AA 2HK5A 4J96A 5AEPA 4BYIA 4BIEA 4MYGA 3UOHA 3F5PA 4I0SA 2JIUA 2LGCA 4L53A 2C6MA 2VTTA 4F6WA 4YC3A 4QYYA 4AT5A 3BI6A 4GG7A 3AOXA 4XYFA 5KE0A 3UIUA 5JH6A 1U46A 3PXRA 4ACMA 3WE8A 3OP5A 4WA9A 4KSPA 3HYHA 4DT9A 1PMNA 1S9JA 3B8RA 2Y4PA 2CN5A 3IW8A 4IJPA 2XA4A 3OFMA 3CPCA 3DBDA 4RG0A 3RCDA 4BCPA 3HA8A 3AT4A 5M08A 2J9MA 2A19B 4BDFA 4PPAA 2B0QA 4RX8A 4W8EA 4S33A 3FQSA 3U9CA 5HIBA 3SXFA 2BCJA 2ZMDA 3AMAA 3LFSA 2PMOX 3COHA 4AA5A 2G1TA 2QVSE 4IFCA 4G6LA 2VX0A 4IVCA 4TZRA 4DEAA 4AAAA 1GIIA 3GU4A 4OR5A 4YZDA 4OLIA 3OD6X 3EHAA 4UMPA 2V55A 1OBDA 4FUYA 4C4JA 4RIXB 2HWPA 1YVJA 5C27A 4O0WA 3D7ZA 4FBXA 4GFOA 3U6JA 4YBKA 5CU6A 2PTKA 3MFUA 5BUEA 4FODA 4UZDA 4DBXA 2J0LA 4A9SA 4CLJA 2GHMA 1SMHA 2BZKB 4HOKA 2ITWA 2RIOA 3HLLA 3WF6A 1KE7A 3V5TA 5LWNA 1O6KA 3JY9A 4GVJA 4BRXA 3ZSGA 3R0TA 4YURA 1J3HA 3FAAA 5EHYA 2SRCA 3DTCA 3DFCB 3VQUA 3O96A 4IAAA 4EWHA 5AA8A 4JBVA 4WIHA 5HCZA 3EQGA 3HA6A 2JFLA 4R7HA 4BDKA 3HKOA 4F1TA 3G2FA 4E4XA 1B39A 4JX3A 5EW9A 2C68A 5BVDA 1PXPA 4L67A 3CTJA 3L8PA 3DQWA 4E6DA 4Y8DA 3ZC6A 4BICA 1LR4A 3CY2A 4P7EA 4EK6A 1ND4A 1Q5KA 3R7VA 1K3AA 3ZC5A 3QD3A 4LRKA 3I6UA 3PJ1A 4H3PA 3VHEA 1FPUA 3Q4CA 1J91A 4FI1A 4FA2A 5ANEA 3VF9A 5T68A 2E2BA 4WUNA 4GJ3A 2E9PA 4FL2A 4D2TA 1YHWA 2GSFA 2C0TA 2PMLX 5CF5A 3PPKA 3D2IA 3PIYA 5ETAA 4FICA 2Z7LA 4PMSA 1ZOHA 5A4LA 2R3HA 1ZOGA 4HVSA 4YU2A 3Q5IA 4EBWA 3EZVA 1W0XC 2XM8A 4BCKA 2JBPA 3ENHA 3H0YA 2WTKB 3I0QA 4NH1A 3KULA 5CT0A 4MKCA 5JGDA 4IAYA 3LJ0A 4EOJA 2XKFA 5CASA 4CFWA 3SQQA 3PXFA 3EFWA 4ASXA 4S30A 1U5RA 4MEDA 2O5KA 5AR7A 5LXMA 5HO6A 4Q2AA 3P23A 3RALA 4QMSA 4FSTA 1WCCA 4R7BA 1KSWA 3U6HA 1JSTA 2GU8A 4M66A 2GNHA 4HZSA 5HIDA 4FL3A 2ITNA 5EW3A 2P0CA 4C02A 4KNBA 1Q3DA 2HXQA 2PWLA 4GJ2A 4IWQA 4L3PA 4V05A 3V3VA 3IECA 4D5KA 2R9SA 4CSVA 4EUUA 1XJDA 3QYWA 3BU3A 3H9FA 2CGVA 3KVWA 3LXLA 2DYLA 2ITVA 3O2MA 3QZIA 4TY1A 4QP9A 2C0IA 5ANKA 3R1NA 3FXZA 2YERA 5IEVA 3OW4A 3BGZA 2YAKA 3GENA 4IZ5A 4DEGA 3OT8A 3NSZA 5JFSA 4U5JA 1REJA 2CPKE 3C4CA 3F88A 3I81A 3NAYA 3NW5A 4RJ7A 3R8LA 2J51A 3BELA 3COMA 3QFVA 4QTAA 5ANIA 2V5QA 1BUHA 3ET7A 4AN3A 3JYAA 4OGRA 4DH5A 1GJOA 3SOCA 1Q4LA 5BVWA 2CMWA 4WUAA 2XK8A 4PY1A 3QL8A 2IW6A 2QOKA 4PTGA 5FEEA 3TUDA 3RWPA 4UB7A 1NXKA 3UVQA 5F20A 1MUOA 4ID7A 5JGBA 3P78A 2BZJA 3KMMA 3QTZA 4XG8A 3MFSA 3ZLWA 5JMSA 3CQEA 3GT8A 1K9AA 4NTTA 4S2ZA 1NVSA 2GS6A 3KXXA 2OXYA 3W55A 3PZEA 2OICA 2BTRA 4FSYA 3BE2A 4EOMA 3FDNA 4RBLA 2CKPA 4FL1A 4QMOA 4FF8A 4I22A 4PPBA 2GFCA 2PSQA 3LHJA 5JSMA 4EQUA 4B8MA 4USFA 4EH4A 2VTOA 3TNQB 3QXOA 2ITPA 2O0UA 5CEPA 4FKPA 3BV2A 2C3KA 5JRSA 5C01A 4GFMA 5JK3A 3RNIA 4YO4A 3UYSA 5E92A 2IVTA 3ROCA 5J7HA 4AW5A 3QQFA 2PE0A 3POZA 1NVQA 3Q2JA 5EDQA 2HW6A 1OIUA 2V22A 3NNUA 4RIXA 5J8IA 5C03A 3VUDA 2C5XA 2A4LA 2JC6A 2XIRA 3EKNA 3KRRA 5CVGA 4C0TA 5EI6A 5KHWA 4EHEA 2ZV2A 4J8MA 4FKJA 3AC5A 3VRZA 1TQPA 5DVRA 4EZ7A 2XJ2A 2ZM1A 3PLAE 2C6EA 5EI2A 4HGTA 2AUHA 4MCVA 4X2KA 5AV0A 3SGCA 3FC1X 3OVVA 1W83A 3RGFA 3F2RA 4IVDA 3OT3A 4KIQA 4CCBA 4EJ7A 1W98A 5JFVA 5ACBC 2W99B 4ALUA 3ATTA 5GIOE 3GU5A 2UV2A 5AX9A 3JS2A 3PXQA 2R3IA 4MXOA 4RJ4A 5DRDA 4XP0A 1U4DA 5CU2A 2HWOA 2PZPA 4WG4A 1Q99A 3B2WA 4HYIA 5GZAA 2IO6A 5M53A 3LPBA 1Y6AA 2BPMA 5DWRA 3E62A 1SM2A 3ORLA 5DN3A 4EHVA 5IKWA 2XNEA 5J9LA 2XK7A 3FLSA 4QQJA 1UU7A 4AT4A 4BDHA 2W1HA 3L9LA 3LFEA 1YXSA 3NYOA 3FXWA 4R8QA 5FG8A 5GZ8A 2HIWA 1XBAA 2BVAA 2PL0A 2YDKA 2BRNA 2YDJA 4ALVA 4O0VA 1W7HA 3DNEA 4K11A 4HYHA 3VS4A 1CTPE 3T9IA 4IM3A 2QKRA 4RJ6A 4BZDA 2B7AA 2OFVA 4Y46A 3FHIA 4J53A 4BKJA 3K2LA 1Q24A 4BF2A 3R01A 1PMUA 3KXNA 3FZSA 1RDQE 5JQ8A 1H25A 5E7RA 5E8ZA 4AZWA 4B6LA 1DM2A 3W32A 5DYJA 4KWPA 4Z9LA 1H0VA 3DGKA 3MVLA 3PPZA 4D4YA 5AUWA 2WGJA 4MQ2A 3GOKA 4Y5QA 3U8WA 4CGAA 3S3IA 5HE0A 5HESA 4RX7A 3GNIB 4OBQA 4PTEA 1GNGA 5I4NA 4YJVA 4DINA 2XYNA 4CXAA 3ORXA 4FZDB 4F70A 3DXQA 4QYFA 3DK6A 3P7CA 3NUXA 2C3JA 4FIFA 4ASZA 2IZUA 5E1SA 3ZBFA 5A4CA 3OWLA 5HNGA 4Z7HA 4TL0A 3D83A 4FTMA 2X9FA 3RP9A 3TV7A 3UZTA 2W9FB 2PUIA 3UP7A 5J1VA 5HD7A 4JRNA 4QNAA 1OIQA 5L8JA 2ITOA 3GC7A 2QHNA 2WMRA 5AIRA 3ZSIA 4F1OA 3QQJA 4Y83A 2VO7A 4F99A 3UNZA 2BTSA 3ORPA 4AW1A 3C4XA 2X7GA 4XNEA 2XBAA 4N4SA 3DCVA 2F9GA 1QPDA 2R3OA 5E8TA 3MH1A 4O7VA 3DDPA 3DJ7A 2W0JA 1H4LA 4TKSA 2R3PA 4YZ9A 4DLJA 1W84A 4RVKA 4DH3A 3AMBA 4PDOA 1OL6A 1MP8A 2H96A 3EQFA 3ODYX 4QT1A 2C47A 2GNJA 2XUUA 5FEQA 4EEVA 5AUTA 3RPOA 3MH2A 4JDHA 4F09A 2I7QA 4PMTA 2RFNA 3L8SA 1YI4A 4IAIA 4FNYA 5HORA 3ZDIA 1BI8A 4L68A 1TKIA 5D41A 1ZRZA 2XIYA 4FEXA 3QCQA 4IWDA 2OBJA 1PXJA 5K0KA 4RIOA 5E91A 3RJCA 3V8SA 2YFXA 4QPAA 5KO1A 5A6OA 1JSUA 4KB8A 4IH8A 4EH9A 5CSVA 5C4LA 1G8SA 4O82A 1OUYA 2J50A 3DLSA 3VS6A 4FSUA 3GXLA 5DLSA 3MPMA 4WBOA 2XRWA 5DGZA 1ZZLA 4GKHA 4IVBA 4Y95A 2PZRA 4KKEA 1Q8UA 3HNGA 1JNKA 2W5BA 2R0UA 3FC2A 4W9WA 3QQKA 4X21A 2Y9QA 3QTRA 1VZOA 2BKZA 3EKKA 4TYJA 4O83A 3OROA 1YI6A 4TPTA 3FUPA 3PRFA 5AR3A 3V04A 4HGLA 4A9YA 3D2KA 3O50A 5HCYA 2F4JA 2H34A 1ZZ2A 2PK9A 4YJRA 4GRBA 2XCKA 5FXRA 3TDVA 3HX4A 2XNOA 3ZLSA 4G9RA 1CKJA 4LOQA 1VJYA 5FM2A 4RJ8A 3RK5A 3P5KA 3DKFA 5KKRB 1YXUA 3WZDA 3FLNC 3ZRMA 2BIYA 3Q32A 4ZY5A 4G31A 4XLVA 2RSVA 3NMUF 4YZNA 4N0SA 5ANGA 4ZLOA 1F3MC 2BFXA 5IA5A 4CYIA 4A06A 4D55A 2VWYA 3R7GA 2CNUA 4BCMA 4FTNA 5EH0A 5EFQA 4ZSLA 2Z60A 4E1ZA 4EOLA 4O7YA 2Y4IB 3HMPA 4O0TA 2YIRA 3BU5A 3HL7A 4NJDA 3G5DA 3G90X 4YBJA 4BVUA 2PHKA 4CYJA 5E4HA 2ZV7A 4JR3A 1YDTE 4PX6A 3UG2A 4S31A 3GCQA 2PPQA 2PVLA 3RAIA 3RTPA 1RW8A 5CANA 4PL3A 1ZYCA 5HI2A 3UDBA 3VBTA 1IRKA 3BYOA 2OWBA 4EOKA 2CJMA 3QRKA 4EK4A 4GIHA 4O7SA 2RG6A 2JAMA 4IAZA 5IDPA 5L4QA 4R5SA 5JGAA 4F9CA 3OTUA 1WVYA 3FZTA 3A7IA 4DF3A 3Q4TA 2IG7A 1V0OA 5HVYA 2RGPA 5DEYA 4EKLA 1Y91A 4QMTA 5J5SA 4BN1A 2UUEA 3Q5ZA 3ZO1A 5J1WA 4YJUA 4EZ5A 2VX1A 3OC1A 4QMVA 1JOWB 4FV8A 3M2WA 3PSDA 3VS3A 3F69A 1FGKA 2WIHA 3FQEA 3MY0A 4MXZA 4WD5A 4AX8A 5J5TA 2QO2A 1L8TA 3LFNA 4H36A 4C62A 5IA3A 1OI9A 2GQGA 3ZO4A 1H28A 3DNDA 3IS5A 2WQBA 5TOZA 1PXKA 3VS1A 4L45A 5I3OA 4ZSJA 3OOMA 3NCGA 5LVPA 4BDCA 1TVOA 4RIWA 3P7BA 2WTDA 4X3JA 5BYZA 4BCHA 3ULZA 2RL5A 4M8TA 1O9UA 2C6KA 2X4ZA 4E7WA 4Q9SA 4UY9A 1XR1A 3D7TB 4QTEA 2FSTX 4EUTA 2QU6A 4APCA 3PIZA 5DOSA 3WF9A 1MRVA 2GTMA 3R7OA 4D2VA 3H30A 1U59A 4OTIA 4UBAA 3SRVB 3KK8A 4O0SA 4LL0A 3IOKA 2W5HA 1Q97A 2QLQA 3PWYA 3A2CA 4KINA 2CKOA 5I3RA 1M7NA 1T46A 4WNOA 3MY1A 5K3YA 4LRMA 4DAWA 5BNJA 5FUTA 4GIIA 3UPZA 5D9HA 5DPVA 1J7IA 5CI7A 2ONLA 2W1IA 3LIJA 5EM6A 1PRYA 4I6FA 2IZTA 2W1GA 2XZSA 4YC6A 5A3XA 4YJOA 4C4HA 2WIPA 3KMUA 4O0UA 1IEPA 4FKSA 3FMDA 4O0XA 4F9AA 3VBVA 4O0YA 5GINE 5LVMA 3LLTA 4BBMA 5HNIX 3LQ3A 5ANDA 3R21A 4AGUA 1M2PA 3BYSA 3I4BA 4OBOA 3UC4A 5HLWA 3L9NA 1PJKA 3FLZA 5E90A 4E5BA 3OUKA 3O8PA 1WBPA 4BIBA 3MY5A 5CSHA 4CMUA 5KNJA 4KD1A 4HCVA 4L7FA 2EVAA 3LFAA 2NP8A 4QRCA 2ZM4A 5EDRA 4ZXTA 4GT3A 3W2RA 4EH2A 2R7IA 3CKXA 3KN6A 5HHWA 2WTJA 2DUVA 4PRJA 5EHLA 3RZFA 1XH8A 4YNEA 3U87A 4BGHA 3TV6A 1YRPA 3ORZA 4ZEGA 4C35A 3E7VA 4TYEA 4EOPA 1UNLA 3ALNA 3F6XA 3POOA 4RFMA 2XNBA 3QA8A 4KRCA 4EWQA 4FV2A 1OMWA 3OXZA 4DTKA 2WHBA 4HGSA 4B99A 3R00A 3FJQE 4BBEA 4FSNA 2W1CA 1IA8A 2Z2WA 4GT4A 2B53A 1HCKA 4XUFA 4F6UA 3DKCA 1QPCA 1BL6A 3U55A 3L9PA 3FMLA 5I9XA 2XK9A 4FGRA 2WNTA 4W4YA 4R7IA 3RPYA 4ALWA 5FDXA 2REIA 4UALA 2XYUA 2YHVA 4YC8A 5JT2A 4AACA 4I94A 1DI8A 4AW0A 2WQNA 1H1QA 4E5WA 2YCSA 3C1XA 3QTUA 2W4OA 3E87A 4YGAA 5I9ZA 3LMGA 4DEBA 2XNGA 2GTNA 3ZYAA 4ANLA 5IH4A 1M7QA 1BKXA 3F61A 4TYGA 4ZTQA 2EB2A 4PL5A 3G9LX 1LUFA 1Q61A 3MH3A 5CVFA 4IVAA 3R9RA 4Z3VA 4BCIA 4IWPA 4C7TA 3DXNA 3RK7A 1XH7A 2XIZA 4G2FA 4FIJA 3DPKA 4HYUA 1GZKA 4RWJA 4RA5A 3LAUA 2PZ5A 4ZIMA 4O6LA 2WD1A 2QOBA 3F2NA 3KKVA 1U5QA 2WPAA 3P79A 2XH5A 3VWAA 4ZAUA 1V1KA 1YOJA 2HOGA 2BROA 3F7WA 3FZ1A 4BI2A 4B0GA 4D2PA 3DBEA 4UEUA 4DGOA 2OK1A 2P33A 4IHPA 2YM8A 1STCE 2G2HA 4PP9A 2ZVAA 1BYGA 4G3CA 4XV9A 4MNEA 4K77A 1Y8GA 3BLRA 5AV2A 5D11A 1SVEA 3RM7A 4RSSA 4CG8A 4GCJA 2I0YA 3BHTA 2WMTA 3KU2A 3GCPA 5HNBA 3QF9A 3H9OA 4FKLA 5CTPA 2YIYA 3NIZA 3WZKA 3V01A 2W96B 4JIKA 3W16A 4CCUA 3VS0A 3GC8A 5J9ZA 1PYXA 4XV2A 4IBMA 2OFUA 5I9UA 3R7IA 3VUHA 4U0IA 4WRSA 4CVAA 4FYOA 3KULB 5JZNA 3UOLA 2WOTA 2A1AB 3PIXA 4GMYA 3TM0A 3FI2A 4CKJA 3EIDA 3FPMA 2YCQA 4PUZA 4LOPA 3ZMMA 3ZEWA 5E9EA 4W9XA 3C7QA 5CF4A 3VC4A 1IR3A 3F66A 3TTIA 4HVDA 5A4EA 4JBOA 4XG9A 3KVXA 1P4OA 5CQUA 5EOBA 3HV5A 5BVKA 3ORIA 3KXHA 4NYEA 4M0YA 3PG3A 3CS9A 4YZMA 2C5VA 5B7VA 5C8KA 3N4VA 2ITZA 3ETAA 3EL7A 3MTLA 4JDKA 4RVMA 4WSQA 5IISA 4FE2A 1M14A 1UKIA 2YM5A 3EL8A 1EH4A 4ACGA 1JKLA 3S1HA 3F3ZA 2R3NA 3EYGA 4WO5A 3R9DA 5M06A 2OO8X 2W9ZB 3FEGA 3LOKA 4LRJA 4L52A 3D4QA 4FSRA 2IW9A 4E6QA 4F6SA 4NWMA 4AG8A 3HDMA 4NCTC 3NVKI 3RKBA 3TN8A 4C37A 2AC5A 2R4BA 4YPDA 5I0BA 2C1AA 2IZRA 4IZ7A 3WYYA 5JZJA 3A7JA 3V5JA 3CJGA 4NZWB 4R6VA 2XS0A 4D4RA 4BZNA 4FTCA 1TQMA 4IIRA 4ASDA 2IN6A 3EN7A 4HPUE 5HBJA 4LV8A 1FGIA 4I92A 1DAYA 1OIRA 4ONAA 1IASA 2CKQA 2YM6A 5AUVA 2W1FA 3QBNA 1J7UA 2HXLA 4HPTE 4GFGA 5FWKK 3O71A 3WF7A 4QQCA 1B38A 1FVVA 3NUSA 3THBA 4C59A 5KHXA 1UU8A 4O38A 4X0MA 3COIA 3FMKA 4S34A 4ERKA 3CJFA 3C0GA 2Z8CA 4XMOA 4M13A 3ZFXA 3VAPA 4FVRA 5B0XA 2PE1A 1MRYA 2UZWE 3N51A 3C5IA 3C4ZA 2FVDA 3GGFA 2CNVA 3SG9A 1FVRA 5EHOA 3DB8A 4X3FB 4N70A 3GOPA 2WZJA 1G3NA 4TTHB 4NW5A 5D1JA 4KRDA 4YJSA 4F0IA 3PA5A 4BCOA 3MFRA 3UMWA 4GUBA 1VEBA 3NAXA 3DLZA 5BYYA 3BBTB 2CSNA 3Q60A 5IQGA 1Y6BA 2BRMA 3DXPA 3QD4A 4L00A 3E8EA 2GHLA 4ZLYA 4M68A 4IW0A 5E8SA 3F3TA 2QOOA 3NW6A 4TNBA 3BCEA 4A4LA 5HEZA 1UWJA 3TZMA 2WXVA 3WOWA 5GZ9A 4TWNA 4DHFA 3LQ8A 1PMEA 5GJFA 2PVFA 4C3FA 2JKOA 4QP1A 3W8LA 5M57A 4YR8A 4GH2A 3RAHA 4XLIA 2YA9A 5EOLA 5DR6A 5M51A 3MS9A 3PVUA 4XV3A 2VWIA 2YIXA 3OMVA 4U42A 4GYGA 3HV3A 2ETRA 3PA4A 2WTKC 4PF4A 4TWPA 3AD4A 4BWPA 1WVXA 5IPJA 3CQUA 3TIYA 1OUKA 4F9BA 2F2UA 3A4OX 3LLAA 4O2PA 3G9NA 5AUXA 1SVHA 4R3CA 5FQDC 4ORKA 1H08A 4ASEA 3NWWA 5CU0A 3NUUA 3LCKA 4FSWA 3KN5A 1SNXA 2I40A 1B6CB 1J1BA 3ORKA 4YPSA 3WZUA 2ETKA 4JAJA 1TQIA 3R1QA 1YI3A 2PMIA 2YZAA 4DTBA 4DH7A 4XCUA 3M11A 4CZUA 3OF0A 2YDIA 4IFGA 4FGBA 3TUBA 2HENA 2J0JA 1FQ1B 1WZYA 4L43A 3FXXA 4CFNA 4DC2A 4DYMA 5BVOA 2P3GX 1XKKA 3EQPA 3KA0A 4M0ZA 3FYJX 4LUDA 4JS8A 4AN9A 4KSQA 3C0HA 1UNGA 4QPMA 4R77A 3CE3A 3ALOA 1AQ1A 2Y8OA 4ZMEA 4W4VA 5AAEA 5KZIA 4JX7A 2JIVA 2QO7A 4Z55A 5D7VA 3MWUA 2VO0A 2B54A 1OKVA 3S2PA 4G6NA 2E9VA 4IQ6A 1KV1A 3VN9A 1P14A 1X8BA 3T8OA 3G15A 4FSQA 5LCJA 3N4TA 5IQHA 4E6AA 4DG2E 5IU2A 1KE8A 3E8DA 4FT5A 2BUJA 3DBCA 3PYYA 2EXCX 4JRVA 4FIHA 3ENMA 3PP0A 3MB6A 5HVJA 5DT4A 3U4WA 3FMEA 3K3IA 5BVFA 3I60A 4DGGA 4J8NA 1OL1A 1GOLA 2VTJA 5FBOA 5ETIA 3QAME 4OTWA 2VNYA 3I5NA 5AUZA 5ETFA 1JLUE 2VTMA 2CNQA 4NM3A 4CFXA 4QMMA 4XBRA 3NZ0A 5EG3A 3I0OA 3NS9A 4FTTA 2R64A 2WMVA 5AP5A 4D58A 2UZVA 5LVOA 4F64A 2EB3A 3A4PA 1ZYLA 3FMNA 4QMNA 5IEYA 5FTOA 3ZLXA 3G51A 4EOIA 3VUKA 1GIHA 4RZWA 2P2IA 2QONA 3CEKA 3CY3A 3EYHA 4U44A 4ZZMA 2G15A 3QLGA 3D94A 4XHKB 4DCEA 3QTWA 2VGPA 2XKEA 4ZY4A 4NW6A 1PHKA 4ANSA 5EYMA 1Q8WA 3ERKA 3BHUA 3EMGA 4V0GA 2F7EE 5CWZA 4BWKA 2QOFA 4MVFA 4TWCA 3BQCA 4QYGA 1XH6A 2XIKA 3RM6A 2J0IA 4M12A 1PMVA 3R73A 4WRGA 5BQ0A 1NW1A 2UZNA 3AG9A 3EN4A 5D7AA 3ZM9A 5EQYA 5CI6A 5TE0A 4DFNA 1J7LA 4FG9A 4L8MA 2FH9A 1H00A 4ZTHA 4AU8A 4G6OA 5FM3A 3RVGA 3C4EA 2FA2A 4BL1A 3PVGA 1LP4A 2JDSA 5CZHA 4JL9A 1FVTA 5IDNA 2JKQA 4NEUA 2PULA 4X3FA 2O8YA 3C50A 5FTQA 3QD0A 1Q62A 4GL9A 3T9TA 4AWIA 2J0MB 3OXIA 4E26A 2GHGA 3Q6WA 2PVNA 3DDQA 3ODZX 3BGPA 2YM3A 2JDTA 2UZOA 1ZYSA 3OW3A 3AQVA 4C3RA 5AUYA 4KIPA 4FK3A 4BCFA 1UWHA 4ZSGA 2OLCA 3TUCA 3CSVA 1CKIA 4DLIA 2NO3A 4BYJA 3CR0A 3LCDA 4TWOA 1LPUA 3F2AA 3FY0A 1OM1A 1LEWA 5HG9A 2IW8A 2OIQA 3KL8A 4N6YA 4M97A 3UZPA 4FKWA 4FTLA 3E5AA 5KMOA 3ELJA 3VJOA 5T3QA 2PUUA 4E73A 5IF1A 3F3UA 1OL5A 3QTSA 4BCNA 4ZTNA 2B9IA 3IW7A 4TYHB 3FI3A 3R2YA 4JNWA 4NCTA 4A9UA 4O1OA 2QR7A 2AC3A 3CKWA 3PXZA 3EQIA 5K4JA 1JWHA 5M07A 1XBCA 2X81A 3FV8A 3EQCA 3KY2A 4I5HA 4YZCA 5ITAA 2HY0A 3S95A 5A46A 4IC7A 5HE3A 4YTIA 5DR9A 4JDIA 3ZOSA 2BKKA 4ANBA 2C6LA 3UPXA 2C0OA 3W8QA 1CSNA 3AC1A 4KKGA 4A7CA 4AN2A 5CEOA 5KBQA 3A8XA 4BKZA 3DV3A 3UNKA 4EH3A 4HNFA 3OBGA 4O7LA 2W1DA 4I3ZA 3OWPA 4JXFA 4L6QA 3BYVA 2B9JA 4OTFA 5K5XA 4O7TA 2ACXA 2XIXA 4ARKA 3NW7A 3FPQA 5HX8A 3OBJA 4YHFA 4ZSAA 2QHMA 4BC6A 4QMUA 3ZBXA 3UBDA 3ZM4A 3OEFX 3ATSA 4X2GA 2XMYA 3QC9A 4GKIA 1Z9XA 5A9UA 3ZU7A 1SNUA 2YZLA 2P2HA 3LQ5A 3IW4A 2R7BA 3BYUA 3DZQA 3E88A 4FC0A 2VNWA 2VUWA 2PVJA 2WTVA 3IOPA 3KFAA 3VNTA 3JVSA 2XRUA 4RIWB 4EHGA 5CEMA 4YHTA 1NVRA 1YOLA 4QTBA 4DE4A 4HZRA 1H1RA 4RRVA 4GSBA 3AC2A 5CNNA 4CMTA 3QCYA 4Y85A 3UTOA 4CEGA 4IX5A 2R3JA 3BX5A 3NX8A 4FNXA 2KTYA 2QO9A 2JITA 5CU4A 1YQJA 1PKDA 5E1EA 5HQ0A 5M4UA 5BX0A 4I6QA 1H07A 4FTJA 4F08A 4K9YA 4V04A 4C4IA 1PY5A 2ZYBA 2J90A 4RWKA 4FKGA 4OTPA 3MIAA 3GUBA 3QGYA 3W2PA 2C69A 3MDYA 3CTHA 4XG7A 5JFWA 4M84A 3KC3A 3QQGA 2QOLA 5JRQA 5CEQA 3RZBA 2QG7A 4DGLC 2WMWA 3QZFA 2UZEA 2VWZA 3GP0A 2VTLA 4IWOA 4BCJA 2BZIB 4C33A 4Z7GA 4QMQA 4DA5A 4RT7A 5L6PA 5KCVA 2QI8A 2R3QA 3DJ5A 5IQDA 3UO6A 3ROYA 4EORA 4YLJA 3RWQA 2PZIA 5AA9A 5AV3A 5HD4A 5M44A 4ZS0A 5KBRA 2CCHA 3QUEA 5LVNA 3LW0A 2DS1A 3CD3A 4QMZA 3FHRA 3NUYA 3WZEA 5AR5A 2WU7A 3D0EA 3FQHA 2QOIA 4YHJA 4E4MA 2BAKA 3D5VA 2R0IA 4KIKB 3G6GA 2R3GA 1UA2A 3HP5A 4FT7A 4B7TA 4M3QA 2EWAA 2Z7RA 4BHZA 2YM7A 2EU9A 2R3RA 5HO8A 4CT1A 4ENYA 5F1ZA 5CSPA 2JDOA 5CVHA 3R9NA 1WMKA 4RZVA 4FV7A 5M55A 1LEZA 4DTAA 2G9XA 2HCKA 4BTMA 4ITHA 2PVHA 2J5FA 4KABA 1XHAA 1R0EA 4UZHA 2R3MA 3S0OA 2CHLA 3OCTA 3KK9A 4XBUA 3TZ8A 4FKUA 2QR8A 4FKQA 4F7NA 4KS8A 4PMPA 5KMKA 4F0GA 5K5NA 3MJ2A 5AMNA 4NFNA 3O7LB 2XVDA 4O7ZA 2YWVA 4O81A 4AGDA 5CT7A 5GIPE 2I0EA 5HGIA 2C1BA 4NKSA 3NUNA 4EK3A 3MH0A 4RFYA 4LQMA 4M69A 4OW8A 2IVSA 3HUBA 3DAEA 2F7XE 2W4JA 3FMJA 3PJCA 4BFMA 2BDJA 3D9VA 4YLLA 2J7TA 2Y7JA 5KUPA 3RPVA 4JG8A 1U54B 5B2MA 5T6KA 4C3PA 2E9OA 3JVRA 4BR3A 2VU3A 4AZTA 4E3CA 3Q9WA 5H9BA 4I4FA 5K4IA 4D2RA 3VUIA 5J7BA 1GAGA 2VTQA 2RFDA 4OTRA 5DT0A 3RBWA 4CRLA 4EC8A 4NKAA 4AP7A 1OZ1A 1V0BA 2EUFB 3DKGA 3QKMA 4XRJA 3KQ7A 3L8XA 5EQEA 2VGOA 2CGWA 5K0XA 3HECA 2PZYA 4YUQA 3L9MA 3EOCA 1VYZA 1O6YA 3UO5A 2W1ZA 1OITA 2FUMA 4IM0A 2C6OA 4DN5A 4ANMA 2GNIA 3QTXA 3HRFA 4A9TA 4QO9A 4JIAA 4TYHA 4YJQA 2PU8A 4LV5A 4YSJA 4RWLA 3V8TA 5EM7A 4O6EA 3QX2A 2FSMX 3R9HA 3OWKA 2YISA 2WMAA 4KIOA 3MTFA 3UQGA 4I5MA 4OTDA 4CZYB 4D9UA 2FO0A 5AR8A 5ANJA 3QCXA 1OB3A 1YDSE 2RFSA 3DKOA 3G0EA 4E6CA 3HAVA 4IEBA 3U51A 3IG7A 3U9NA 4AF3A 3UZRA 5B2LA 2X7OA 2Y6OA 4MNEB 5HTBA 3FLQA 2X6DA 4LOOA 3H10A 5E8WA 2HZ0A 4GT5A 3LM0A 1NA7A 4FV4A 2PYWA 2WMXA 4QYHA 5DG5A 5AUUA 5IH5A 3V5QA 5AAGA 2VTSA 2XK6A 5L6WL 3LZBA 4EYMA 4C2VA 4RX5A 4XEYA 3FBVA 3Q04A 5LCKA 4ZMFA 5CYIA 1H1PA 4YP8A 4RQKA 1GY3A 1I44A 2V62A 4DFLA 3ANRA 1R78A 1RJBA 1KOBA 1H27A 1OECA 1OKZA 5IQEA 3M1SA 2IPXA 3G33A 1ZLTA 3MVJA 2WOUA 4IDTA 4JG7A 4BI0A 3SW7A 2YITA 3ANQA 5CF8A 3DJ6A 4AA4A 1WBTA 1YWNA 2FSOX 1FMOE 2G01A 3E8CA 5IEXA 1YKRA 4G9CA 5BUJA 5EI8A 3NR9A 4WHZA 5HU3A 3EQBA 2VWXA 3SAYA 4FEVA 2HY81 3EH9A 4S32A 1HCLA 1BX6A 1QMZA 3K5UA 3R1SA 4G3EA 4FEQA 2XB7A 3E7OA 5CLPA 1YXTA 3ZO2A 5AP0A 3B2TA 3NVMB 1REKA 2JKKA 2XNPA 5A14A 4XOYA 3QUDA 2BAQA 3ZLYA 4EOOA 1CMKE 1ZMWA 2OH4A 2VWUA 4YJNA 5LMKC 5FGKA 4NM5A 3WIGA 2O63A 3DAKA 4QMWA 4AUAA 3GC0A 5GJGA 5HVKA 1PXLA 3BEGA 5IQIA 3Q9ZA 4U80A 2VO6A 2GS2A 1M2RA 4QTDA 2GNFA 3RINA 2OIBA 3LCSA 3RCJA 4FNZA 3E93A 5CAVA 3QRTA 2Y6MA 4XRLA 4MBJA 4UMQA 3V51A 3LKMA 1PXNA 4GYIA 4UMTA 3CC6A 1Q8TA 4IAKA 3VO3A 3QTQA 2A27A 3VBQA 4DH8A 1ZXEA 4MWHA 4I24A 4USDA 5H2UA 4I4EA 4JR7A 2B55A 1UNHA 3D14A 3QKKA 4OT5A 1PXIA 4FTKA 3N9XA 4K6ZA 4FZFB 4F9YA 5AV4A 3MSSA 3LFQA 4UXQA 3E63A 3F3WA 3UOKA 3BLHA 2YWPA 3MPAA 4KIKA 2WMBA 3CTQA 3P0MA 2OI4X 3HMIA 3NPCA 4FV6A 3PA3A 5BYLA 1OL2A 2WTIA 1CM8A 4MF0A 5H8EA 3RPSA 3ZXTA 4F4PA 3Q96A 3IONA 1Q3WA 4P5QA 1YOMA 4NSTA 3LE6A 2F7ZE 5FXSA 1Y57A 4NUSA 4FSMA 5HO7A 2YM4A 3IO7A 2GFSA 3NDMA 4FTIA 4FT0A 3LFBA 2CCIA 3OEZA 4G5PA 4LGGA 5IQAA 3CIKA 1A48A 4IB0A 1YDRE 1W8CA 5E8UA 4Y5HA 3FL5A 4BCQA 3AMYA 5IUGA 2EXEA 3FZOA 1ZY4A 3EQHA 1H0WA 4FG8A 1BLXA 4MAOA 4ITJA 4ZOGA 4AOTA 3ORTA 4EL9A 3UVPA 4EH7A 5H3QA 5E8YA 3SLSA 4FZAB 4DGMA 4AS0A 4EHZA 4TT7A 3V5PA 4PNKA 1F5QA 3ZONA 2OXXA 3BEAA 2OF4A 3BZ3A 3OHTA 4IC8A 1RQQA 4IX4A 1WFCA 3CGOA 4LMNA 4M14A 4TNDA 5DBXA 2BILB 2VWBA 4GU6A 4G3GA 1U54A 1JQHA 3AC3A 4WNMA 2X8IA 3KB7A 4I1ZA 3IK3A 1OBGA 5M56A 1WBNA 1KE5A 2OJJA 2QQ7A 3KEXA 4C36A 4F0FA 4UYNA 2Z7QA 4HVIA 4ZZOA 1P4FA 4C58A 4DG3E 1R39A 2A2AA 2BHHA 2WB8A 4IB5A 1F0QA 2E9NA 4FIIA 4HGEA 4WSYA 2IZSA 5DRBA 3LJ1A 2CLQA 3VF8A 4U8ZA 3BWFA 5KMLA 4GK4A 4O27B 4IANA 2H6DA 4U7ZA 3IDPA 3GCUA 4KBAA 2ERKA 4MHAA 3TJDA 2GMXA 4HCUA 5DNRA 1JBPE 3G0FA 3HZTA 5DR2A 2JGZA 2VTRA 3DK3A 3PE1A 5TF9A 3V5LA 2CLXA 3EN5A 5DT3A 1I09A 3BHYA 1YHVA 5C1QB 4CFVA 2YACA 3PUPA 5EKOA 3V8WA 5F9EA 4FEWA 3VBWA 4QP2A 4OT6A 4HVHA 4JDJA 4GUEA 3NYVA 1GIJA 3QX4A 2CGUA 1KUTA 4PP7A 3HRBA 4TW9A 5I9WA 2BHEA 3ACJA 5DH3A 2FYSA 1ZYDA 3ZZWA 3N4UA 2OJFE 3ZHPC 3QCSA 4YNOA 3MA6A 3QWJA 4AOJA 2CN8A 3W2QA 3LM5A 4OTGA 5CEKA 3UP2A 4F65A 5FBNC 4EQMA 3HV7A 3RHXA 3R63A 3R7UA 3HP2A 4EOQA 4F7JA 1XBBA 5AM7A 1DAWA 2O2UA 3BBWA 3Q4UA 4JJRA 3NCZA 5DEWA 4ENXA 4XG4A 2OF2A 4J1RA 1G5SA 5G1XA 3O8UA 1A9UA 5AR4A 2QOHA 4O7RA 2GNLA 4MNFA 4OTQA 3EFJA 3PXYA 3ZCLA 4JI9A 4RVTA 3TJCA 5IA0A 2XK4A 2UVZA 1L3RE 5AIKA 4C8BA 2JKMA 4D0WA 5F4NA 2E9UA 3ZO3A 4X2NA 3F7ZA 3A7FA 3C13A 4BGQA 3PPJA 4JQEA 5EDPA 4UX9A 5KMNA 3WI6A 3ZRLA 3P9JA 5J95A 3BWJA 2Q83A 3VW6A 4QOXA 5C8MA 5J87A 3DFAA 4E4NA 4ITIA 4ERWA 2ERZE 4WNPA 2C5NA 2XEZA 5E8VA 3E92A 2WEVA 3AT2A 3CP9A 3MB7A 4LYNA 4OBPA 4U43A 5ETCA 4O7NA 1XH5A 2ITYA 2OJGA 1JAMA 3GVUA 4RA4A 4BTJA 3OOGA 3NLBA 3PP1A 4CTBA 1FINA 4QYEA 4V0GB 4UWCA 3NEWA 2JFMA 1YWVA 5FEDA 4FV9A 5JN2A 4DH1A 4XG6A 2IJMA 4NM0A 5M4FA 2W7XA 3PG1A 3R83A 4C4GA 4OAVB 1JSVA 5CALA 3W18A 2C6IA 3MFTA 1DI9A 3TDWA 4AFJA 2WFYA 3H3CA 4O91A 4G5JA 2A0CX 3A8WA 4DFUA 5M09A 4NJ3A 4C57A 4XX9A 3SC1A 4WG5A 3CCNA 3GCSA 3R6XA 4IAFA 2CDZA 4G16A 1XH9A 3IW6A 4MWIA 5D12A 2QOCA 5CS6A 1FBNA 5TKDA 4UMUA 5HIEA 1M2QA 2WTCA 4P5ZA 2VD5A 4C2WA 4UN0C 2OJIA 2PVYA 3WE4A 2BRHA 3HRCA 4NIFB 3UOJA 4X7QA 4QQTA 1OPJA 2JD5A 3QZHA 3RK9A 3Q9XA 3VJNA 4APPA 2ITUA 3KF7A 3QD2B 4JOAA 3H9RA 2UZLA 5C8NA 5LMKA 4WNKA 4RC4A 4DCAA 4DGNA 4TRLA 5IUIA 2WELA 1YXXA 2QKWB 3UE4A 4ZTLA 4ACHA 2PE2A 4QP7A 5DA3A 4YSMA 4AA0A 4ZZNA 2ZB0A 4FZ7A 4II5A 4J71A 4U40A 3MPTA 4AZFA 2FSLX 4A4OA 4IDVA 2Z7SA 2ZOQA 5F95A 4IE9A 3L8VA 4BDAA 1M52A 3R7YA 3WZJA 1Z57A 2QNJA 5IMXA 2F2CB 3DY7A 3FKOA 2R3LA 3AT3A 3MN3A 3S4QA 3TTJA 1KE9A 2OH0E 2V7OA 4OAUC 3ITZA 2UW0A 5BPYA 3UC3A 4BDGA 5IA2A 5JKGA 3V6RA 3LXPA 3SHEA 4AE6A 2UZUE 3DBQA 3NIEA 3GU6A 4IJ9A 3E3PA 4BBFA 2J4ZA 3VQHA 3F5UA 5TT7A 3KRWA 4W4WA 3W10A 3PLSA 3IGOA 4EH8A 4QP6A 4ZP5A 4H1MA 3LFDA 5EYKA 4CFMA 4FTQA 5AX3A 5L8LA 3T3VA 1OVEA 2UW6A 3RI1A 4QP4A 2NNWB 5AFVA 3QYZA 3IGGA 3QC4A 3U4UA 3MA3A 4KBKA 2BRBA 2W06A 3R02A 4HVGA 2C5OA 2VWVA 3MESA 3BGQA 5DI1A 5HICA 3OS3A 3BE9A 2R3KA 3FSKA 3GCVA 3I7BA 4DEHA 3TKHA 5FRIA 4YTCA 3KF4A 4FR4A 2WMQA 2XKCA 3QHWA 2WQEA 1JKKA 3R1YA 2VN9A 4W8DA 3SW4A 3TV4A 3RNYA 5GNKA 2BALA 3JY0A 1Q8ZA 4G1WA 4U41A 3DU8A 3O51A 3IKAA 3RAWA 4AFEA 3S00A 3TACA 1XWSA 4DFYA 3DOGA 3OCBA 4C61A 4PDYA 5FTGA 3DAJA 3W1FA 2JBOA 5AP7A 3HAMA 5DFPA 4PNIA 2J5EA 3C51A 4TN6A 4IZAA 2C3LA 3KCFA 3I7CA 5I9VA 2X39A 3D5WA 3LCTA 1UU3A 4PL4A 4CKRA 4N57A 1RE8A 2PVRA 2VTHA 5EYDA 5HBHA 3ZUTA 4HYSA 4LG4A 2NPQA 5L2QA 5JFXA 1YXVA 2C5YA 1UV5A 4FTRA 2PVKA 4PV0A 3CQWA 3BRBA 5EW8A 3PWDA 2WKMA 3K54A 3KRLA 4OUCA 4P4CA 2X7FA 3PVWA 4QMPA 4GVAA 2VTPA 4YJPA 4NT4A 2WAJA 3FKLA 2C3IB 1CKPA 5L3AA 2OSCA 5GHVA 5ANOA 2X2MA 3REPA 1ZYJA 2WU6A 1NY3A 4GEOA 3NNVA 3PFQA 3C4FA 4BDJA 2XJ0A 4MD7E 4HW7A 5KZ0A 2BDWA 4ANNA 3SG8A 4O86A 4O96A 4JBPA 1E9HA 5M4CA 3KXZA 4BTKA 4PTCA 5M4IA 2F57A 4H3BA 4L01A 3NNWA 3P7AA 3MBLA 3VUMA 2ZMCA 4PQNA 4CG9A 4U45A 5HCXA 4XH6A 4CQGA 5HU9A 5C26A 4IXPA 3IDCA 2VV9A 3DB6A 3R28A 1QL6A 2QG5A 2Y0AA 1GZOA 1PXMA 3F5XA 5CSXA 1PKGA 3NYXA 4CZTA 2UW7A 2NRUA 2GCDA 2WMSA 3Q4ZA 2OZOA 2JDRA 5CX9A 3F5GA 4AW2A 2OXDA 3SXRA 3EFKA 2P4IA 3C9WA 3FMHA 2XBJA 4I5CA 5L2IA 5AAFA 2XJ1A 4LUEA 4RWIA 4U9AA 4FV1A 2ESMA 4KKHA 3TEIA 3VS2A 4K18A 3I6WA 2ITTA 4R3PA 3MI9A 1UKHA 2O65A 2YCFA 3WBLA 3NYNA 5L8KA 2BFYA 4ZK5A 4G3DA 3DS6A 4FKVA 4M69B 3GFWA 5HTIA 3Q2MA 2RG5A 3QQUA 1ZMVA 3PRIA 5C9CA 3PE2A 5ACKA 4QMLA 4B9DA 1XO2B 5CY3A 4AT3A 2UZBA 3A7HA 4IX6A 3GU7A 3Q53A 3Q52A 4MF1A 1M17A 2VTIA 2X6EA 5HG5A 4BWXA 4FNWA 1ZOEA 3I79A 4RJ5A 2HELA 4UV0A 4NIFA 5EM5A 5CQWA 3TCPA 3UIMA 3R22A 3R30A 3D5XA 4BY9E 3TXOA 5TR6A 5HG7A 3BHHA 3QQLA 4B8LA 1GZNA 4EJNA 1DS5A 5AP3A 3TNPC 2OG8A 4AGWA 2GPHA 4JVGA 3G6HA 3ZZEA 2XP2A 3FKNA 3NRMA 4O1PA 4ZTSA 3UGCA 4BCGA 3PZHA 3KCKA 4CTCA 3TKIA 4I6BA 2PUNA 3P86A 3FLWA 3WIKA 1KV2A 4CNHA 4EI4A 3F3VA 2WMUA 4MD9E 2YAAA 4L44A 2XF0A 3SXSA 3CGFA 4Q5HA 4FKIA 4LFIA 3UNJA 4GW8A 4DG0E 3DQXA 4F63A 4DFBA 4PMMA 3O0GA 2UZTA 4ZJVA 4D9TA 1XQZA 2J0KA 4MTAA 3R04A 4D4VA 3AXWA 3VBXA 4ANQA 4I0TA 1PXOA 3BYMA 3PJ3A 3UIBA 3TNHA 2QODA 3BPRA 1BMKA 4XS2A 4I5PA 4NK9A 5FD2A 4I23A 4ZSEA 4IB1A 4FZ6A 3OTVA 4J97A 5CAUA 3P1AA
chains in the Genus database with same CATH superfamily
2JAVA 3MW1A 1O6LA 2OU7A 1H26A 2VTAA 3IQ7A 4ZJIA 3W0NA 2AYPA 2BRGA 4EYJA 4L7SA 4U3ZA 4FKTA 1H1WA 3ZUVA 1OPKA 3UQCA 3PJ2A 2ONLC 3L1SA 4WBBB 2GQRA 2ITQA 4Y73A 3O23A 5CXHA 2BIKB 2PMNX 3A62A 5IZFA 4CT2A 5IG1A 4PPCA 4DEDA 4U6RA 3LMHA 3JR1A 3W2SA 2WTWA 1FOTA 4MBIA 3TIZA 4XOZA 4GS6A 4X2FA 2OJ9A 5A4QA 3WILA 2OW3A 3A99A 4IX3A 2PUPA 2I0VA 2B1PA 3W0OA 1E1VA 3SDJA 5DIAA 4EQCA 2UZDA 4NL0A 3TL8A 2PVMA 5LOHA 3RPRA 1W82A 5D10A 4PDPA 4R3RA 5E8XA 5EK7A 5A54A 3SKCA 5LQFA 3MGYA 4CV9A 3WF5A 4CD0A 4CKIA 4FOCA 2V7AA 3A7GA 2XCHA 2XM9A 3FYKX 3Q3BA 4WKQA 5AP1A 3SVVA 1AD5A 2CGXA 3EN6A 4ACCA 5LMAA 5K9IA 2RFEA 3DT1A 4AQCA 2B4SB 3JXWA 5IH6A 4D2WA 3U6IA 4BJJA 1KOAA 3R8VA 4FKOA 1GZ8A 3KRJA 3BLQA 3R8MA 3EFLA 3HEGA 4CV8A 4Q5EA 3EWHA 1URWA 4AXAA 2XNNA 4NFMA 2IWIA 4AZVA 2UW8A 4RFZA 2JEDA 4UWBA 2YN8A 5EYCA 4IB3A 3R7EA 4DEIA 4FK6A 2Z02A 4DT8A 2HZIA 4FTAA 5HLPA 1IG1A 1S9IA 3UG1A 3ZTXA 2W5AA 3CXWA 1K2PA 5FP6A 4E20A 4D1XA 3SOAA 4L3JA 2B9FA 5A6NA 5BV3A 4I21A 1VR2A 3QGWA 2HYYA 1YHSA 3UJGA 3PY3A 3DA6A 3EN9A 5KKRC 4C4EA 3R8UA 3BV3A 3O8TA 1MQ4A 1OKYA 4XJ0A 3UIXA 2O64A 4BDEA 2ZV8A 1SYKA 3FL4A 4AGCA 5BUIA 4I41A 2ZB1A 5A4TA 1OIYA 1KE6A 1Z5MA 2I1MA 4FTUA 3SD0A 4CQEA 3TG1A 1XH4A 2PY3A 1R3CA 2QLUA 2GDOA 3OY1A 2ETMA 2J2IB 2C6TA 4K0YA 4BHNA 1ZWSA 4RLKA 4BI1A 4RIYB 2W1EA 1Q8YA 2Y4IC 4QQ5A 3QALE 4FV5A 4O22A 3VS5A 5KMIA 4L3LA 5AP4A 4TYIA 3UO4A 4CMOA 3UQFA 5LJJA 4J99A 4D28A 5AV1A 5HBEA 4FMQA 4BDIA 4E93A 3SA0A 4E4LA 2GS7A 5FLFA 3HMNA 3ZS5A 3PDTA 4CRSA 4FTOA 4ZTRA 1J1CA 3OCSA 3PY0A 5HKMA 4RVLA 2QC6A 4M15A 4QP3A 4X2JA 2FGIA 2JIIA 3BKBA 2HZ4A 2X4FA 4YMJA 4JT3A 1P5EA 3F82A 4G3FA 4JAIA 4UXLA 4NTSA 2VO3A 4QP8A 4K2RA 4YZBA 3K5VA 5CU3A 4BKYA 4DFXE 3P08A 4U3YA 5IQFA 1ERKA 4FX3A 4GK2A 1YWRA 4P90A 2YABA 4L46A 5LMBA 5CF6A 3OZ6A 3U54A 2IVVA 3O17A 3UYTA 3OWJA 3QLFA 3JUHA 5TO8A 4Q9ZA 4Z16A 1IAJA 1WBVA 2XK3A 3ZSHA 3AD5A 4DFZE 3FWQA 5DMZA 2IVUA 5ICPA 4KBCA 4QD6A 4FT3A 4R78A 2J6MA 3IPHA 4QMXA 3OG7A 2ZV9A 3KRXA 5KX8A 2O3PA 5L2TA 3QRIA 5HG8A 4O4BB 3R8ZA 4X6QC 4LM5A 5CZIA 5G6VA 4BIDA 1ZARA 2BR1A 4HNIA 4O0RA 4V01A 2W17A 4DHJA 3A61A 4AAYA 5CEIA 4QTCA 2G2FA 3I5ZA 4MXCA 4USEA 3GU8A 2QU5A 4J7BA 1AGWA 2XKDA 3ZFMA 3ZXZA 5J9YA 1OKWA 4L42A 3QZGA 1CDKA 4J95A 2X9EA 4EZ3A 4GK3A 3PVBA 2KULA 4DEEA 3AGLA 4JLCA 4M7IA 5JEBA 4FOBA 4AE9A 5KMMA 3NUAA 4MXAA 3VUGA 1QCFA 2YJSA 3E8NA 2JDVA 4QMYA 4RMZA 3CBLA 5AWMA 4RC2A 1URCA 3TZ9A 5BMSA 3GC9A 2QD9A 2YJRA 4IACA 2Q0BA 3WARA 3AC4A 4K33A 2X2KA 2BAJA 4P2KA 4JBQA 4JG6A 1QPJA 2UW3A 3DZOA 5LARA 1ZMUA 2ZM3A 2DQ7X 4J98A 4WT6A 4R1VA 3P4KA 3QU0A 3PTGA 4EK8A 5LVLA 4CFUA 3HDNA 3QWKA 2BMCA 2VTNA 3PY1A 1WBSA 2H8HA 1PYEA 2VZ6A 4I93A 3EQRA 2OKRA 3ZDUA 1APME 1WBOA 1JKTA 5I9YA 4DDGA 3PSCA 1VYWA 2Q0NA 4D5HA 4WG3A 1FMKA 1NT2A 3MV5A 3AC8A 2OGVA 3OCGA 2YIWA 3FMMA 2X8DA 4YTHA 3EZRA 3W2CA 3C0IA 4FYNA 3PJ8A 3W2OA 2UW4A 3GB2A 3NUPA 3HUCA 4U81A 4IADA 2UVXA 4BDDA 4RLLA 4D2SA 3KXMA 5F94A 4E5AX 3WF8A 4XG2A 2RF9A 4FEUA 3VVHA 4LMUA 2UVYA 1JVPP 1PW2A 4JQ8A 4Y72A 4XP2A 3QTIA 3PSBA 4BDBA 4HCTA 3ZH8A 1OPLA 3D5UA 3HV6A 3GEQA 4WOVA 4YJTA 3BQRA 3EB0A 3QKLA 3QUPA 3ACKA 4QPSA 3IDBA 3BHVA 1ATPE 3GQIA 2YLEA 2C4GA 2ZDUA 2ZJWA 3O7LD 3T3UA 3COKA 3GI3A 3ORMA 1OGUA 4C34A 5IA1A 1UVRA 5CENA 3H4JA 4MXXA 5AR2A 4GU9A 4YTFA 4EOSA 2XNMA 2I6LA 4IZYA 3AD6A 5GJDA 4EH5A 4H39A 4D4SA 4FIEA 5DHJA 3VS7A 3VUTA 4U97A 3ID6C 2R3FA 4UMRA 1BL7A 3PXKA 1Q41A 4IM2A 5AJQA 2LAVA 2F49A 4FT9A 3V5WA 4DITA 3FZRA 3SV0A 3TI1A 4MBLA 3ZEPA 4RIYA 4D1ZA 4FUXA 2ITXA 2OZAB 2YEXA 3R71A 4XP3A 5H8GA 3E3BX 3RMFA 2WO6A 3AGMA 4UWYA 3HMMA 4BGGA 3HV4A 4FVQA 4A9RA 5IUHA 1WBWA 4E8AA 3FE3A 5B2KA 2VX3A 3E64A 2W05A 4LL5A 5AP6A 4IMYA 3SX9A 4PWNA 3UODA 3KIOC 3R8PA 3IW5A 4O21A 5JQ5A 3OUNB 4C38A 5CAQA 3MVMA 2OIDA 2HZNA 2YIQA 2AQXA 4EONA 5H8BA 3W33A 2YLFA 2XEYA 5CNOA 3VIDA 4A07A 3FZPA 5I5ZA 3NGAA 5FP5A 5L6OA 3FI8A 4YLKA 4PDSA 4RGJA 1PF8A 3K3JA 3LFFA 2WQOA 4KAOA 3QA0A 4GV1A 3CD8A 5HE2A 3TT0A 4FIGA 4A4XA 3VBYA 1H1SA 5HOAA 4O84A 2RKUA 4D0XA 5IMEA 3UVRA 1R0PA 3QRJA 4FSZA 2DWBA 1H24A 3LFCA 4B4LA 4L9IA 2WEIA 4X6RA 2QOQA 3A60A 5L2WA 4GG5A 4DBNA 3Q6UA 3QHRA 5HE1A 4K8AA 4ANOA 4FKRA 4BTFA 3LXNA 3ORNA 4MK0A 3MVHA 4KS7A 2QURA 2JLDA 3OY3A 4ACDA 2HAKA 3KMWA 2C30A 5L2SA 4FJVA 4FV3A 2BDFA 4AOIA 4H1JA 4TXCA 5CAPA 1R1WA 3F9NA 4I6HA 3UMXA 1T45A 3DK7A 1BI7A 5J79A 1KWPA 5LWMA 4RQVA 4AXDA 5AADA 5HZNA 4XG3A 4XV1A 4R5YA 3DBFA 2P55A 3C4WA 4MH7A 3FSFA 5BVNA 3FY2A 4LGDA 1HOWA 4FG7A 2X2LA 2BZHB 3GQLA 4G17A 3CPBA 4R1YA 3MIYA 5HLNA 4AZEA 3HVCA 4LGHA 4I20A 4EK5A 4O2ZA 2B52A 3GFEA 3B8QA 2I0HA 4FV0A 4N6ZA 4QNYA 3TNIA 4UYAA 3VRYA 4KUJA 2UW9A 4U79A 3TWJA 2VRXA 2WQMA 2ZAZA 3UDZA 4F7LA 1V0PA 1A06A 1QPEA 4ZY6A 4MD8E 3NNXA 4EH6A 2G2IA 4C4FA 2YCRA 3HGKA 1OL7A 3D15A 3Q9YA 3TKUA 4KA3A 5EM8A 1WAKA 3LJ2A 3QQHA 1MRUA 4BB4A 4JQ7A 3TZ7A 2X8EA 4H3QA 5AM6A 2X1NA 3GBZA 1E1XA 3CLYA 3R9OA 3ULIA 2W4KA 4OTHA 3WYXA 4ZS4A 3BU6A 1ZAOA 2VWWA 2GQSA 2NRYA 4RX9A 2R2PA 5BMMA 4EC9A 5IQBA 5HTCA 2GNGA 3HMOA 3OXTA 5AP2A 2UW5A 4W4XA 5CAOA 1YW2A 3RAKA 1IA9A 3ZRKA 4YO6A 3ZFYA 3QRUA 4X3FC 3D7TA 3I1AA 5BVEA 4F9WA 2NYAA 1JPAA 2X0GA 4NU1A 3FLYA 3LXKA 5EKNA 3EQDA 3R2BA 3MYGA 4F1MA 4HJOA 5FDPA 4D1SA 3DTWA 3LMIA 3SRVA 4ZLZA 4MX9A 3H0ZA 1ZY5A 5C4KA 4J52A 2EXMA 5CSWA 2B9HA 1P2AA 4RJ3A 4G34A 4CFFA 4BZOA 3II5A 4ZJJA 2H9VA 3RHKA 2QCSA 3LVPA 4K1BA 2FB8A 3M42A 4AZSA 1Y8YA 3LCOA 5CXZA 5HX6A 3QXPA 2R5TA 3ZUUA 3FI4A 4NM7A 4FVPA 2VAGA 4EBVA 1H8FA 2CKEA 3C5UA 2ZDTA 4EKKA 2X0OA 4M67A 1UU9A 1WVWA 1SVGA 4I0RA 5DE2A 3BIZA 3V6SA 4F7SA 4RPVA 2C6DA 5IA4A 3VW8A 2HW7A 3JPVA 4O7WA 5KMJA 5EQPA 2V0DA 4ZTMA 3VONA 5IQCA 4H58A 3MJ1A 4MQ1A 1H01A 3KREA 3VULA 3KGAA 4MXYA 1IAHA 3EJ1A 3VHKA 4RC3A 2OZAA 3KXGA 1MQBA 4LI5A 1JKSA 5FXQA 3TNWA 4H05A 1SZMA 4CLIA 1G8AA 2HK5A 4J96A 5AEPA 4BYIA 4BIEA 4MYGA 3UOHA 3F5PA 1TZDA 4I0SA 2JIUA 2LGCA 4L53A 2C6MA 2VTTA 4F6WA 4YC3A 4QYYA 4AT5A 3BI6A 4GG7A 3AOXA 4XYFA 5KE0A 3UIUA 5JH6A 1U46A 3PXRA 4ACMA 3WE8A 3OP5A 4WA9A 4KSPA 1W2DA 3HYHA 4DT9A 1PMNA 1S9JA 3B8RA 2Y4PA 2CN5A 1VLRA 3IW8A 4IJPA 2XA4A 3OFMA 3CPCA 3DBDA 4RG0A 3RCDA 4BCPA 3HA8A 3AT4A 5M08A 2J9MA 2A19B 4BDFA 4PPAA 2B0QA 4RX8A 4W8EA 4S33A 3FQSA 3U9CA 5HIBA 3SXFA 2BCJA 2ZMDA 3AMAA 3LFSA 2PMOX 3COHA 4AA5A 2G1TA 2QVSE 3NFFB 4IFCA 4G6LA 2VX0A 4IVCA 4TZRA 4DEAA 4AAAA 1GIIA 3GU4A 4OR5A 4YZDA 3AKJA 4OLIA 3OD6X 3EHAA 4UMPA 2V55A 1OBDA 4FUYA 4C4JA 4RIXB 2HWPA 1YVJA 5C27A 4O0WA 3D7ZA 4FBXA 4GFOA 3U6JA 4YBKA 5CU6A 2PTKA 3MFUA 5BUEA 4FODA 4UZDA 4DBXA 2J0LA 3NFGB 4A9SA 4CLJA 4AXEA 2GHMA 1SMHA 2BZKB 4HOKA 2ITWA 2RIOA 3HLLA 3WF6A 1KE7A 3V5TA 5LWNA 1O6KA 3JY9A 4GVJA 4BRXA 3ZSGA 3R0TA 4YURA 1J3HA 3FAAA 5EHYA 2SRCA 3DTCA 3DFCB 3VQUA 3O96A 4IAAA 4EWHA 5AA8A 4JBVA 4WIHA 5HCZA 3EQGA 3HA6A 2JFLA 4R7HA 4BDKA 3HKOA 4F1TA 3G2FA 4E4XA 1B39A 4JX3A 5EW9A 2C68A 5BVDA 1PXPA 4L67A 3CTJA 3L8PA 3DQWA 4E6DA 4Y8DA 1G8KA 3ZC6A 4BICA 1LR4A 3CY2A 4P7EA 4EK6A 1ND4A 1Q5KA 3R7VA 1K3AA 3ZC5A 3QD3A 4LRKA 3I6UA 3PJ1A 4H3PA 3VHEA 1FPUA 3Q4CA 1J91A 4FI1A 4FA2A 5ANEA 3VF9A 5T68A 2E2BA 4WUNA 4GJ3A 2E9PA 4FL2A 4D2TA 1YHWA 2GSFA 2C0TA 2PMLX 5CF5A 3PPKA 3D2IA 4BJJB 3PIYA 5ETAA 4FICA 2Z7LA 4PMSA 1ZOHA 5A4LA 2R3HA 1ZOGA 4HVSA 4YU2A 3Q5IA 4EBWA 3EZVA 1W0XC 2XM8A 4BCKA 2JBPA 3ENHA 3H0YA 2WTKB 3I0QA 4LDTA 4NH1A 3KULA 5CT0A 2XALA 4MKCA 5JGDA 4IAYA 3LJ0A 4EOJA 2XKFA 5CASA 4CFWA 3SQQA 3PXFA 3EFWA 4ASXA 4S30A 1U5RA 4MEDA 2O5KA 5AR7A 5LXMA 5HO6A 4Q2AA 3P23A 3RALA 4QMSA 4FSTA 1WCCA 4R7BA 1KSWA 3U6HA 1JSTA 2GU8A 4M66A 2GNHA 4HZSA 5HIDA 4FL3A 2ITNA 5EW3A 2P0CA 4C02A 4KNBA 1Q3DA 2HXQA 2PWLA 4GJ2A 4IWQA 4L3PA 4V05A 3V3VA 3IECA 4D5KA 2R9SA 4CSVA 4EUUA 1XJDA 3QYWA 3BU3A 3H9FA 2CGVA 3KVWA 3LXLA 2DYLA 2ITVA 3O2MA 3QZIA 4TY1A 4QP9A 2C0IA 5ANKA 3R1NA 3FXZA 2YERA 5IEVA 3OW4A 3BGZA 4I6LA 2YAKA 3GENA 4IZ5A 4DEGA 3OT8A 3NSZA 5JFSA 4DHZA 4U5JA 1REJA 2CPKE 3C4CA 3F88A 3I81A 3NAYA 3NW5A 4RJ7A 3R8LA 2J51A 3BELA 3COMA 3QFVA 4QTAA 5ANIA 2V5QA 1BUHA 3ET7A 4AN3A 3JYAA 4OGRA 4DH5A 1GJOA 3SOCA 1Q4LA 5BVWA 2CMWA 4WUAA 2XK8A 4PY1A 3QL8A 2IW6A 2QOKA 4PTGA 5FEEA 3TUDA 3RWPA 4UB7A 1NXKA 3UVQA 5F20A 1MUOA 4ID7A 1G8JA 5JGBA 3P78A 2BZJA 3KMMA 3QTZA 4XG8A 3MFSA 3ZLWA 5JMSA 3CQEA 3GT8A 1K9AA 4NTTA 4S2ZA 1NVSA 2GS6A 3KXXA 2OXYA 3W55A 3PZEA 2OICA 2BTRA 4FSYA 3BE2A 4EOMA 3FDNA 4RBLA 2CKPA 4FL1A 4QMOA 4FF8A 4I22A 4PPBA 2GFCA 2PSQA 3LHJA 5JSMA 4EQUA 4B8MA 4USFA 4EH4A 2VTOA 3TNQB 3P5JC 3QXOA 2ITPA 2O0UA 5CEPA 4FKPA 3BV2A 2C3KA 5JRSA 5C01A 4GFMA 5JK3A 3RNIA 4YO4A 3UYSA 5E92A 2IVTA 3ROCA 5J7HA 4AW5A 2IF8A 4LV7A 3QQFA 2PE0A 3POZA 1NVQA 3Q2JA 5EDQA 2HW6A 1OIUA 2V22A 3NNUA 4RIXA 5J8IA 5C03A 3VUDA 2C5XA 2A4LA 2JC6A 2XIRA 3EKNA 3KRRA 5CVGA 4C0TA 5EI6A 5KHWA 4EHEA 2ZV2A 4J8MA 4FKJA 3AC5A 3VRZA 1TQPA 5DVRA 4EZ7A 2XJ2A 2ZM1A 3PLAE 2C6EA 5EI2A 4HGTA 2AUHA 4MCVA 4X2KA 5AV0A 3SGCA 3FC1X 3OVVA 1W2FA 1W83A 3RGFA 3F2RA 4IVDA 3OT3A 4KIQA 4CCBA 4EJ7A 1W98A 5JFVA 5ACBC 2W99B 4ALUA 3ATTA 5GIOE 3GU5A 2UV2A 5AX9A 3JS2A 3PXQA 2R3IA 4MXOA 4RJ4A 5DRDA 4XP0A 1U4DA 5CU2A 2HWOA 2PZPA 4WG4A 1Q99A 3B2WA 4HYIA 5GZAA 2IO6A 5M53A 3LPBA 1Y6AA 2BPMA 5DWRA 3E62A 1SM2A 3ORLA 5DN3A 4EHVA 5IKWA 2XNEA 5J9LA 2XK7A 3FLSA 4QQJA 1UU7A 4AT4A 4BDHA 2W1HA 3L9LA 3LFEA 1YXSA 3NYOA 3FXWA 4R8QA 5FG8A 5GZ8A 2HIWA 1XBAA 2BVAA 2PL0A 2YDKA 2BRNA 2YDJA 4ALVA 4O0VA 1W7HA 3DNEA 4K11A 4HYHA 3VS4A 1CTPE 3T9IA 4IM3A 2QKRA 4RJ6A 4BZDA 2B7AA 2OFVA 4Y46A 3FHIA 4J53A 4BKJA 3K2LA 1Q24A 4BF2A 3R01A 1PMUA 3KXNA 3FZSA 1RDQE 5JQ8A 1H25A 5E7RA 5E8ZA 4AZWA 4B6LA 1DM2A 3W32A 5DYJA 4KWPA 4Z9LA 1H0VA 3DGKA 3MVLA 3PPZA 4D4YA 5AUWA 2WGJA 4MQ2A 3GOKA 4Y5QA 3U8WA 4CGAA 3UDTA 3S3IA 5HE0A 5HESA 4RX7A 3GNIB 4OBQA 4PTEA 1GNGA 5I4NA 2XAMA 4YJVA 4DINA 2XYNA 4CXAA 3ORXA 4FZDB 4F70A 3DXQA 4QYFA 3DK6A 3P7CA 3NUXA 2C3JA 4FIFA 4ASZA 2IZUA 5E1SA 3ZBFA 5A4CA 3OWLA 5HNGA 4Z7HA 4TL0A 3D83A 4FTMA 2X9FA 3RP9A 3TV7A 3UZTA 2W9FB 2PUIA 3UP7A 5J1VA 5HD7A 4JRNA 4QNAA 1OIQA 5L8JA 2ITOA 3GC7A 2QHNA 2WMRA 5AIRA 3ZSIA 4F1OA 3QQJA 4Y83A 2VO7A 4F99A 3UNZA 2BTSA 3ORPA 4AW1A 3C4XA 2X7GA 4XNEA 2XBAA 4N4SA 3DCVA 2F9GA 1QPDA 2R3OA 5E8TA 3MH1A 4O7VA 3DDPA 3DJ7A 2W0JA 1H4LA 4TKSA 2R3PA 4YZ9A 4DLJA 1W84A 4RVKA 4DH3A 3AMBA 4PDOA 1OL6A 1MP8A 2H96A 3EQFA 3ODYX 4QT1A 2C47A 2GNJA 2XUUA 5FEQA 4EEVA 5AUTA 3RPOA 3MH2A 4JDHA 4F09A 2I7QA 4PMTA 2RFNA 3L8SA 1YI4A 4IAIA 4FNYA 5HORA 3ZDIA 1BI8A 4L68A 1TKIA 5D41A 1ZRZA 2XIYA 4FEXA 3QCQA 4IWDA 2OBJA 1PXJA 5K0KA 4RIOA 5E91A 3RJCA 3V8SA 2YFXA 4QPAA 5KO1A 5A6OA 1JSUA 4KB8A 4IH8A 4EH9A 5CSVA 5C4LA 1G8SA 4O82A 1OUYA 2J50A 3DLSA 3VS6A 4FSUA 3GXLA 5DLSA 3MPMA 4WBOA 2XRWA 5DGZA 1ZZLA 4GKHA 4IVBA 4Y95A 2PZRA 4KKEA 1Q8UA 3HNGA 1JNKA 2W5BA 2R0UA 3FC2A 4W9WA 3QQKA 4X21A 2Y9QA 3QTRA 1VZOA 2BKZA 3EKKA 4TYJA 4O83A 3OROA 1YI6A 4TPTA 3FUPA 3PRFA 5AR3A 3V04A 4HGLA 4A9YA 3D2KA 3O50A 5HCYA 2F4JA 2H34A 1ZZ2A 2PK9A 4YJRA 4GRBA 2XCKA 5FXRA 3TDVA 3HX4A 2XNOA 3ZLSA 4G9RA 1CKJA 4LOQA 1VJYA 5FM2A 4RJ8A 3RK5A 3P5KA 3DKFA 5KKRB 1YXUA 3WZDA 3FLNC 3ZRMA 1ST4A 2BIYA 3Q32A 4ZY5A 4G31A 4XLVA 2RSVA 3NMUF 4YZNA 4N0SA 5ANGA 4ZLOA 1F3MC 2BFXA 5IA5A 4CYIA 4A06A 4D55A 2VWYA 3R7GA 2CNUA 4BCMA 4FTNA 5EH0A 5EFQA 4ZSLA 2Z60A 4E1ZA 4EOLA 4O7YA 2Y4IB 3HMPA 4O0TA 2YIRA 3BU5A 3HL7A 4NJDA 3G5DA 3G90X 4YBJA 4BVUA 2PHKA 4CYJA 4JMQA 5E4HA 2ZV7A 4JR3A 1YDTE 4PX6A 3UG2A 4S31A 3GCQA 2PPQA 2PVLA 3RAIA 3RTPA 1RW8A 5CANA 4PL3A 1ZYCA 5HI2A 3UDBA 3VBTA 1IRKA 3BYOA 2OWBA 4EOKA 2CJMA 3QRKA 4EK4A 4GIHA 4O7SA 2RG6A 2JAMA 4IAZA 5IDPA 5L4QA 4R5SA 5JGAA 4F9CA 3OTUA 1WVYA 3FZTA 3A7IA 4DF3A 3Q4TA 2ZFYA 2IG7A 1V0OA 5HVYA 2RGPA 5DEYA 4EKLA 1Y91A 4QMTA 5J5SA 4BN1A 2UUEA 3Q5ZA 3ZO1A 5J1WA 4YJUA 4EZ5A 2VX1A 3OC1A 4QMVA 1JOWB 4FV8A 3M2WA 3PSDA 3VS3A 3F69A 1FGKA 2WIHA 3FQEA 3MY0A 4MXZA 4WD5A 4AX8A 5J5TA 2QO2A 1L8TA 3LFNA 4H36A 4C62A 5IA3A 1OI9A 2GQGA 3ZO4A 3W0MA 1H28A 3DNDA 3IS5A 2WQBA 5TOZA 1PXKA 3VS1A 4L45A 5I3OA 4ZSJA 3OOMA 3NCGA 5LVPA 4BDCA 1TVOA 4RIWA 3P7BA 3TMOA 2WTDA 4X3JA 5BYZA 4BCHA 3ULZA 2RL5A 4M8TA 1O9UA 2C6KA 2X4ZA 4E7WA 4Q9SA 4UY9A 1XR1A 3D7TB 4QTEA 2FSTX 4EUTA 2QU6A 3AKKA 4APCA 3PIZA 5DOSA 3WF9A 1MRVA 2GTMA 3R7OA 4D2VA 3H30A 1U59A 4OTIA 4UBAA 3SRVB 3KK8A 4O0SA 4LL0A 3IOKA 2W5HA 1Q97A 2QLQA 3PWYA 3A2CA 4KINA 1W2CA 2CKOA 5I3RA 1M7NA 1T46A 4WNOA 3MY1A 5K3YA 4LRMA 4DAWA 5BNJA 5FUTA 4GIIA 3UPZA 5D9HA 5DPVA 1J7IA 5CI7A 2ONLA 2W1IA 3LIJA 5EM6A 1PRYA 4I6FA 2IZTA 2W1GA 2XZSA 4YC6A 5A3XA 4YJOA 4C4HA 2WIPA 3KMUA 4O0UA 1IEPA 4FKSA 3FMDA 4O0XA 4F9AA 3VBVA 4O0YA 5GINE 5LVMA 3LLTA 4BBMA 5HNIX 3LQ3A 5ANDA 3R21A 4AGUA 1M2PA 3BYSA 3I4BA 4OBOA 3UC4A 5HLWA 3L9NA 1PJKA 3FLZA 5E90A 4E5BA 3OUKA 3O8PA 1WBPA 4BIBA 3MY5A 5CSHA 4CMUA 5KNJA 4KD1A 4HCVA 4L7FA 2EVAA 3LFAA 2NP8A 4QRCA 2ZM4A 5EDRA 4ZXTA 4GT3A 3W2RA 4EH2A 4DHIB 2R7IA 3CKXA 3KN6A 5HHWA 2WTJA 2DUVA 4PRJA 5EHLA 3RZFA 1XH8A 4YNEA 3U87A 4BGHA 3TV6A 1YRPA 3ORZA 4ZEGA 4C35A 3E7VA 4TYEA 4EOPA 4O4DA 1UNLA 3ALNA 3F6XA 3POOA 4RFMA 2XNBA 3QA8A 4KRCA 4EWQA 4FV2A 1OMWA 3OXZA 4DTKA 2WHBA 4HGSA 4B99A 3R00A 3FJQE 4BBEA 4FSNA 2W1CA 1IA8A 2Z2WA 4GT4A 2B53A 1HCKA 4XUFA 4F6UA 3DKCA 2AEGA 1QPCA 1BL6A 3U55A 3L9PA 3FMLA 5I9XA 2XK9A 3AKLA 4FGRA 2WNTA 4W4YA 4R7IA 3RPYA 4ALWA 5FDXA 2REIA 4UALA 2XYUA 2YHVA 4YC8A 5JT2A 4AACA 4I94A 1DI8A 4AW0A 2WQNA 1H1QA 4E5WA 2YCSA 3C1XA 3QTUA 2W4OA 3E87A 4YGAA 5I9ZA 3LMGA 4DEBA 2XNGA 2GTNA 3ZYAA 4ANLA 5IH4A 1M7QA 1BKXA 3F61A 4TYGA 4ZTQA 2EB2A 4PL5A 3G9LX 1LUFA 1Q61A 3MH3A 5CVFA 4IVAA 3R9RA 4Z3VA 4BCIA 4IWPA 4C7TA 3DXNA 3RK7A 1XH7A 2XIZA 4G2FA 4FIJA 3DPKA 4HYUA 1GZKA 4RWJA 4RA5A 3LAUA 2PZ5A 4ZIMA 4O6LA 2WD1A 2QOBA 3F2NA 3KKVA 1U5QA 2WPAA 3P79A 2XH5A 3VWAA 4ZAUA 1V1KA 1YOJA 2HOGA 2BROA 3F7WA 3FZ1A 4BI2A 4B0GA 4D2PA 3DBEA 4UEUA 4DGOA 2OK1A 2P33A 4IHPA 2YM8A 1STCE 2G2HA 4PP9A 2ZVAA 1BYGA 4G3CA 4XV9A 4MNEA 4K77A 1Y8GA 3BLRA 5AV2A 5D11A 1SVEA 3RM7A 4RSSA 4CG8A 4GCJA 4AXFA 2I0YA 3BHTA 2WMTA 3KU2A 3GCPA 2X0PA 5HNBA 3QF9A 3H9OA 4FKLA 5CTPA 2YIYA