3LCDA

Inhibitor bound to a dfg-in structure of the kinase domain of csf-1r
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
297
structure length
290
Chain Sequence
GNSYTFIDPTQLPYNEKWEFPRNNLQFGKTLGAGAFGKVVEATAFGLGKEDAVLKVAVKMLKSTAHADEKEALMSELKIMSHLGQHENIVNLLGACTHGGPVLVITEYCCYGDLLNFLRRKAEADLDPLELRDLLHFSSQVAQGMAFLASKNCIHRDVAARNVLLTNGHVAKIGDFGLARDIMSNYIVKGNARLPVKWMAPESIFDCVYTVQSDVWSYGILLWEIFSLGLNPYPGILVNSKFYKLVKDGYQMAQPAFAPKNIYSIMQACWALEPTHRPTFQQICSFLQEQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Macrophage colony-stimulating factor 1 receptor
publication title Structure-based drug design enables conversion of a DFG-in binding CSF-1R kinase inhibitor to a DFG-out binding mode
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 93
structure length 290
sequence length 297
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2010-01-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3lcdA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3lcdA01
2R9SA 3KCFA 3W2SA 5DBXA 5CF5A 2VU3A 3UZPA 4MWIA 4FEXA 4DE4A 2W1IA 2C68A 3W2QA 5ANOA 5KMMA 3CEKA 2WEVA 2VWZA 3AXWA 3EN5A 5DRBA 1UU7A 1W84A 3UQCA 1U54B 1U54A 3BPRA 5H2UA 3OT3A 2C4GA 3FC2A 3RAKA 3E92A 2QOCA 4GU6A 4H3BA 4DITA 4XV9A 4AX8A 3HA6A 2R4BA 5AP2A 3VUIA 5I5ZA 4JIAA 2FSMX 4HCTA 4RLKA 1WAKA 4K8AA 4KD1A 4W8DA 3V04A 3CD3A 1Q8YA 2B54A 5M4UA 4ZSAA 1T45A 5K0KA 5IG1A 4HCUA 2CNVA 3LW0A 5J5SA 5E91A 2XJ0A 2A2AA 4X2GA 4W4XA 4BL1A 4FSQA 5J1WA 2C6LA 2JKOA 5IQBA 4AGDA 4BDDA 2DWBA 3FKNA 2OJGA 2CN5A 3CKXA 3DKOA 4HVGA 2J0MB 5K0XA 2GQSA 3OUNB 2YDIA 3LCSA 1BX6A 3CY2A 3D5UA 4QYHA 3HEGA 3QBNA 4IACA 3BHUA 4DG3E 2J7TA 4AOJA 1REJA 5JQ5A 1SZMA 1UU8A 2WMAA 3TN8A 1YHVA 3RMFA 4AZEA 3R7IA 3DTCA 2JDVA 3DCVA 3DZQA 3AMBA 3F88A 5AMNA 3FEGA 2Q0BA 5DR9A 5F4NA 5IISA 3DS6A 4MQ1A 2C3KA 1MRYA 2VGOA 2Z2WA 3UZTA 1BI8A 3BE2A 3TNQB 4AP7A 2UW4A 2YCRA 4QT1A 4V0GB 5E8WA 4PL5A 4V0GA 3LQ3A 4IAYA 4UMPA 2XNOA 3R8ZA 2BRBA 3AMYA 3KVXA 3LFQA 3WF7A 2LAVA 5A9UA 1ERKA 1CMKE 3BBTB 3FV8A 1SVGA 3K5UA 4G3DA 4EK3A 1TQMA 3IKAA 4O21A 1K2PA 5AR8A 1UWHA 3QD3A 3GBZA 4FBXA 4ZEGA 5A14A 4FK6A 4QTCA 4C4GA 4GH2A 3KXXA 1OIUA 4J1RA 2NPQA 3NNVA 4DT8A 3FLSA 4UYAA 4E20A 5M51A 5GJGA 5HIBA 2QOKA 5E8VA 4BCPA 2UVYA 3O50A 3PYYA 4LV5A 1IAHA 3DJ6A 3HVCA 4XG9A 5HE1A 3CJGA 1ZYJA 4P5QA 3EFJA 5EI6A 1OUYA 4AUAA 3FQHA 5ETCA 4Q2AA 2C47A 5LCKA 4BDFA 4E93A 5LCJA 4FTCA 1CKJA 3LJ0A 3PA5A 4QMQA 4LI5A 1J3HA 4EOQA 1B6CB 4LRJA 4MTAA 3BZ3A 3L9NA 3RAIA 4TXCA 4BGGA 5KCVA 1LEZA 4FMQA 3R2BA 1O9UA 4QMSA 5DEWA 3QZHA 1J1BA 2X2LA 3U55A 2OG8A 3KVWA 3FMMA 2P4IA 3MPMA 4IVBA 4HPUE 4CXAA 4DGNA 2BAJA 4BZNA 3ACKA 3O8UA 3PE2A 2W0JA 1E1XA 3D7TA 5E1SA 5AR5A 1WBOA 3MH1A 2PUUA 2W1FA 4EBVA 4U80A 2UZTA 3OVVA 1J7LA 3O0GA 5AV2A 3I5ZA 1OL6A 1RQQA 2J0JA 2Z8CA 3OBGA 4KIPA 4LQMA 5T6KA 4L44A 4UALA 4J71A 4BCGA 3WZEA 4G6LA 1JNKA 1XH5A 4HYUA 3SV0A 5AV3A 4YMJA 1WVWA 1K9AA 3S1HA 2BKKA 1DAYA 4E5AX 4IX4A 1BL7A 2QU5A 4G5PA 4O0TA 4C3PA 4LOOA 4IH8A 4NJDA 2UW5A 2O3PA 2UW7A 4A06A 4DN5A 4ERWA 3FI8A 2HIWA 2R3MA 3ZO1A 3ZLYA 3Q60A 3R1QA 3NLBA 4ZOGA 1JKTA 3TNWA 4BVUA 4XJ0A 1RDQE 2RG6A 4EYJA 3LXPA 4QMMA 2JDTA 2Z7SA 4FK3A 4MKCA 3ELJA 2KULA 4BDJA 2YIWA 5BYZA 4F7LA 4HJOA 4O7VA 1BI7A 4IZ7A 2W05A 5CQUA 3V5PA 1M2QA 2VTIA 4M12A 2GTMA 2Y7JA 4FG9A 2QOIA 4F1TA 4FSZA 5C8KA 1M14A 3MPTA 4H3PA 3D4QA 4XCUA 4CCUA 1J7IA 4KS7A 3SC1A 3QX4A 4FNYA 3FMNA 4W9WA 3GC7A 3SXRA 2PZPA 3KRJA 3OBJA 3A7GA 5D10A 5EM6A 5GNKA 1I44A 5AAEA 2ACXA 2C6EA 5LMBA 3BLHA 4IBMA 4Y72A 4BICA 1XWSA 4OT6A 5CLPA 2I6LA 1IAJA 3SOCA 1YOMA 2AC3A 4E4MA 5CXZA 2WFYA 4PDOA 4FV6A 3GC0A 4HVSA 2VN9A 3JS2A 4G1WA 4EC9A 2WKMA 3ZO2A 2R3LA 3G0EA 4WUNA 1IEPA 2BR1A 2UVZA 4KWPA 4ZTLA 4QTEA 5KMKA 2UV2A 1OVEA 3NS9A 3WE4A 3DT1A 3BU6A 4IM2A 3ROYA 4QD6A 5I3OA 3SA0A 2JBPA 4A9SA 2WQBA 3DB6A 5CNOA 4QRCA 3WE8A 4BCMA 3QYWA 4RJ7A 4ZSGA 3RK9A 1OL2A 5LJJA 3ZHPC 5AP7A 2CMWA 2OF2A 3COHA 3KFAA 2X8IA 5CTPA 3LXKA 5CYIA 4ARKA 4DFBA 3IW7A 3BLRA 3HDNA 1GJOA 3I1AA 4I1ZA 4C59A 5FWKK 5HG7A 3UPXA 4C4IA 3QRKA 4AN9A 3TUCA 2BDFA 4HGTA 5JEBA 4TWNA 5A3XA 3PXYA 4R7HA 4NH1A 4QTDA 2EWAA 4Y83A 4CZTA 2BZKB 3DJ5A 3V8WA 4EK5A 2CKEA 4KA3A 3GU7A 4K33A 3EQIA 4PTGA 4AE9A 4IEBA 5EH0A 3A62A 1OKWA 2YABA 1FPUA 4EJ7A 2OJ9A 3MY1A 4IVCA 2ZV9A 3FLYA 2QHNA 2VWUA 3M2WA 4AZSA 1O6YA 2WMUA 4CNHA 5HLPA 3ZM9A 3ALNA 1XR1A 5JFSA 3D2IA 1SVHA 3DOGA 4Z16A 2ETKA 4XBUA 5AR3A 1KV1A 4U9AA 4P4CA 3QCYA 4RA5A 3F7WA 4CTCA 2GMXA 3IS5A 2F7ZE 4YJQA 3HMMA 3VS4A 2QOFA 3RKBA 3ANQA 4GYIA 1NT2A 2HOGA 3FWQA 5DNRA 2XS0A 3HMOA 2NRUA 4IX3A 4FV8A 2QU6A 5DR2A 3NIZA 4I6QA 5HIDA 2VTTA 4RIWA 5FP5A 4BBMA 4JNWA 4R78A 4CRLA 5GINE 4B99A 3QCSA 5KE0A 4OAUC 2WZJA 4L43A 4FEWA 4JIKA 2X8EA 4KINA 5GJFA 5EM7A 3OP5A 3ZXZA 2F7EE 5AUYA 4QPMA 4LRMA 3G15A 1VR2A 2PVJA 2YIRA 4XP2A 3OCGA 3DU8A 3UIBA 4FGRA 2E9NA 2XNBA 1XBCA 3DV3A 4AN2A 4NKSA 4AZVA 4WUAA 3OC1A 4IANA 4FTLA 5K3YA 3A4PA 4QMPA 4KABA 2PMIA 4EI4A 5JZNA 3GUBA 4ORKA 2WQMA 1WBTA 3H30A 3ZC6A 4AW5A 2R3GA 2UUEA 4EZ5A 2PVRA 2Q83A 3QQUA 3OG7A 4FV1A 3FSKA 4MBJA 4CTBA 3MBLA 5CI7A 5EW8A 1P5EA 3ZBXA 3NYOA 3UMWA 4A4OA 4FA2A 1W82A 3TUBA 5C27A 3K5VA 4S30A 3F5GA 3OCBA 2J5FA 4IDTA 5DA3A 1QPJA 2PVHA 2V0DA 2QQ7A 4R5SA 5EW3A 4APCA 3P1AA 3FYJX 4EH8A 3HV4A 3P79A 2GDOA 4KKEA 2CSNA 2C30A 4XUFA 3C51A 4CZUA 5JFVA 2G1TA 4FIGA 4FV0A 3LOKA 4MNEB 4HZSA 2Y0AA 3EMGA 3V5LA 4G5JA 4ANBA 4UMUA 3GFEA 2GS7A 5TOZA 5GZAA 1Q4LA 2OZAA 1OKVA 5IMXA 2BTRA 2QR8A 3GQIA 5FXRA 3DPKA 3I81A 1NW1A 3DNEA 4Y5HA 3R8UA 5AAGA 1UA2A 3DTWA 4ENXA 4Q9ZA 4TWOA 5LXMA 3LLAA 2O2UA 2OSCA 4FV3A 3CR0A 4ITHA 2XIRA 5A4CA 4C4FA 3MFTA 4LM5A 4BB4A 3DKFA 3V8SA 1YOJA 2XA4A 3OCTA 2X4FA 1A06A 3G33A 5EYKA 1R0EA 2WOUA 2R64A 4CMUA 4JBPA 3BHHA 2XYUA 3UO4A 3DBFA 4EKKA 4Z7GA 5CAUA 2CKPA 5M56A 2WGJA 5LMKA 4D1ZA 2ITWA 3L8PA 5IA2A 3UBDA 5IH6A 4RVKA 3VS2A 4WBBB 5EOLA 4YTHA 2GCDA 5HX6A 4FICA 2IPXA 3AQVA 2W1CA 3VULA 2XRWA 2ETRA 3PXQA 4GCJA 4JJRA 4QPAA 3F9NA 4PRJA 3V5QA 1L3RE 4ZXTA 2NNWB 2H34A 3FUPA 3TNIA 4C33A 1KE8A 3KN6A 3NPCA 3HDMA 1H24A 3VS0A 3CQWA 1JKLA 3RZFA 2OI4X 5M09A 1OGUA 3T9IA 5JMSA 4RSSA 3PTGA 4DG0E 3GCUA 2ITXA 4J8MA 5CSVA 3CS9A 3I0QA 5E8ZA 5HO8A 2GHMA 4IC7A 4PP7A 4EOSA 2ZMDA 4E5BA 1APME 1ZMVA 2CCHA 5BVNA 1KUTA 1OKYA 3H9RA 5JRSA 1SNXA 3MY5A 3L9PA 4D0XA 4AZFA 4LGDA 3ITZA 2OBJA 2PTKA 3RJCA 4UX9A 3DZOA 4FSTA 4LGHA 3BI6A 1A48A 2AYPA 3NNUA 3PY0A 4O38A 4FT3A 4FOBA 4XV3A 3CTHA 1TVOA 5JGDA 4D4RA 2YDKA 3MH3A 4UN0C 1UWJA 4KBCA 5HKMA 4O2PA 4OAVB 4U0IA 3FXXA 1NY3A 3ORTA 4JAJA 2GPHA 2GNGA 5HZNA 2Z7RA 3R7VA 1OMWA 4FKJA 4FTKA 4F9WA 3RWPA 2Z7LA 4FKLA 3F6XA 5CU2A 3F66A 2JFLA 4PF4A 3FPQA 5C4KA 4D9UA 1KOAA 4RJ8A 5KBQA 5BUEA 3QTXA 2R3HA 4W4WA 4F64A 3AC1A 4FG7A 3LQ8A 3MI9A 2QCSA 5CAQA 3KU2A 4N4SA 1K3AA 3SAYA 2W1DA 2XVDA 5CEKA 2WB8A 2FB8A 3EFKA 3PJ1A 3VHEA 4BCKA 5L2TA 1HCKA 1QCFA 2Z02A 3ORPA 3C0GA 3NEWA 3OMVA 4GL9A 4O91A 4QMVA 2PL0A 4YBKA 5J7HA 3PIYA 2QC6A 4GW8A 4WNKA 3ATSA 4KUJA 3DKCA 3DAKA 4GV1A 3DNDA 4Z7HA 2ZB1A 1BUHA 2FUMA 3AMAA 4QTBA 4CRSA 1GIJA 1X8BA 3D94A 4D4YA 1XH4A 4L3PA 5L6PA 3OXIA 4OTWA 2XCKA 5AM6A 3QUPA 4B7TA 4CMTA 4FTNA 3IDPA 2GU8A 1V1KA 3EQDA 2IWIA 3H4JA 3SG9A 4I92A 1YI4A 2X0GA 3OHTA 3UJGA 3LFEA 4M7IA 4F0GA 1OPLA 1LR4A 5EFQA 4FSRA 4BDCA 4ZAUA 2WQNA 3GCSA 4ALWA 3G6GA 4FV5A 3NCZA 3R2YA 3QGWA 3NUPA 3TKHA 3VJNA 4MD9E 2PZ5A 2WXVA 4C8BA 2NO3A 3AD6A 2V22A 5EKNA 2OZOA 4MXZA 2R3IA 1ZOHA 2BVAA 4DEGA 3QQHA 4C36A 3HUBA 3OT8A 2DUVA 4GK4A 3GQLA 4I6HA 4PPBA 3B2TA 2UZVA 4L00A 4F63A 4CV8A 5HGIA 1XJDA 5HVYA 4BKJA 3UOKA 3FL5A 3RWQA 4EOLA 2VTPA 3QZFA 3POZA 1VYZA 4IAAA 3AD4A 5HG5A 3BWFA 2OFUA 3ROCA 2R7IA 4HZRA 2CNUA 4F9BA 4DEIA 2V7OA 1ZARA 3KC3A 4O7YA 2BDJA 4JG6A 3R9RA 2R3QA 2BRHA 2IZSA 3AT4A 3FBVA 4L3JA 4Q9SA 2C6IA 3CC6A 5A46A 2I0VA 4BTFA 2EXCX 4YLJA 1LP4A 4FVQA 4EHVA 5DOSA 3ORKA 3OY1A 4E8AA 3LHJA 3FLZA 3MFUA 3V5TA 1IG1A 3ZFXA 5IUIA 1E1VA 4USDA 2XK9A 3KRRA 4C3RA 5K9IA 4H3QA 4W4YA 3HGKA 3BU3A 3ETAA 3GU8A 5AP3A 5EDQA 4MK0A 3EIDA 3EOCA 4GIHA 2WMXA 4IWQA 4K9YA 4W4VA 4F6UA 5CAVA 3SVVA 4XYFA 3DA6A 5IH5A 2BHHA 3QQJA 3FXWA 4CQGA 4DGLC 1OBDA 4IJ9A 3TJCA 4N0SA 4WD5A 3ZUTA 5LMAA 4E26A 4USFA 1JSUA 5KX8A 1P2AA 2FGIA 4P5ZA 4XHKB 3UODA 4XG6A 3VBXA 5IU2A 4ZMEA 3JY9A 4FEUA 3HV6A 4C58A 2C5OA 2YCSA 3CLYA 3PZHA 2QO2A 1S9JA 2JDOA 4YP8A 3R83A 5AX3A 3UVRA 4F7JA 5L2WA 3CE3A 3QC4A 5TT7A 4C37A 3LIJA 3PSBA 1LPUA 1PW2A 1GY3A 3AC8A 3MESA 3Q9WA 3UOLA 5LVOA 3LPBA 5ETAA 3PPZA 3R1NA 3PP1A 2XJ2A 5CNNA 3MWUA 4IWPA 3VS1A 2ZOQA 5H9BA 2HZ4A 4ACMA 4AW0A 3H0YA 2Y8OA 3FMEA 4D4VA 5I3RA 4J53A 2B9HA 4RQVA 1PF8A 3MA3A 2C3LA 4IWDA 2B1PA 2OXDA 4QP1A 3DFCB 3TIZA 3UIMA 5FUTA 3JVRA 3HMNA 3VF8A 4O0VA 5D41A 3PWYA 3LJ2A 4XG3A 4YJVA 4ASZA 4F9AA 5LQFA 4F0FA 4C3FA 3G0FA 3LFAA 4YJSA 3U54A 2XMYA 3HYHA 3IOPA 3G5DA 3LLTA 3CKWA 4H36A 4KKGA 3Q5ZA 4X3FB 4B4LA 4FIHA 4OUCA 4X3FA 4C34A 4CEGA 3D15A 4NJ3A 5IQEA 3UC4A 3MJ1A 4G2FA 4JDJA 2XCHA 4EH5A 4A07A 5IUGA 2E9OA 3FMLA 1AGWA 1BMKA 1PXMA 4D0WA 3BU5A 4FSYA 1PJKA 4S2ZA 2FSOX 3LCDA 5BMSA 4I21A 1H28A 4XP0A 4I0RA 2PE1A 4CFFA 1H25A 3C4ZA 2H96A 4AAAA 4E5WA 4CG8A 2RFSA 5L8KA 1W98A 3DFAA 2LGCA 4H05A 1IRKA 4FSMA 3C0IA 3BGZA 1XO2B 1U4DA 2C69A 3NGAA 3T9TA 2BRGA 5DIAA 5AWMA 4EORA 4JBOA 3EL8A 3VRZA 4BTMA 2ONLC 3TM0A 1OZ1A 4XLIA 2YM6A 3VUDA 4MYGA 2HW7A 4D2RA 3VQHA 2V5QA 4JQEA 1U46A 3MJ2A 5ANGA 4PMPA 1F5QA 2ITUA 4HOKA 4S34A 1H26A 4WG4A 4BKYA 5LVLA 4EKLA 3I7CA 3V5JA 3E93A 1Y8GA 1M17A 4RBLA 2CNQA 2QOHA 4I3ZA 4BN1A 4I0TA 4AFEA 3TKUA 3KXZA 5FTQA 4ANOA 4DEDA 4QMZA 5H8EA 2EXMA 3GU5A 4RIXA 3O8TA 4L52A 3VVHA 4FT0A 4J97A 5IZFA 3HP2A 5L3AA 3QC9A 4M14A 2GQRA 4KSQA 4FV2A 2UZOA 4FV4A 2CGWA 5CVHA 3ZRMA 3R21A 4NW5A 4FOCA 1Q5KA 2J4ZA 4I41A 3VO3A 4G6NA 4BCHA 1OPJA 3F7ZA 4WBOA 3TEIA 3A61A 4RX5A 4AFJA 3RM7A 2QOBA 5KUPA 3UO6A 4AOTA 4QQJA 3ZLXA 3W2RA 3MV5A 1XQZA 5FRIA 5HBHA 1B38A 2XNPA 2XKDA 5CWZA 3VS6A 2BZIB 3QCXA 4FZDB 3OUKA 3LCOA 4O0RA 3TT0A 2QOLA 4PMSA 3PZEA 1S9IA 3FSFA 5TF9A 3PWDA 3P0MA 4DCEA 4FIEA 1DS5A 5JK3A 3ERKA 3L8SA 4TY1A 3ZS5A 3FPMA 2VWIA 2W1GA 2ZVAA 1MP8A 4AT3A 2XNMA 3EH9A 3AC3A 2FYSA 4KNBA 5FDPA 4YHFA 4EWQA 1A9UA 5CANA 1YXUA 3MFRA 3NR9A 3TNPC 3QA8A 2IW9A 3L1SA 5C03A 3LCKA 4PNKA 4ANNA 3C1XA 5L6OA 2WIHA 3R01A 2CLXA 4XV1A 3RAHA 2OIDA 4CFVA 3W33A 1JSVA 3RCJA 5D11A 3EKKA 3CQEA 1DI8A 4AA0A 5DFPA 3IO7A 3OXZA 2XB7A 4LOPA 1E9HA 3RP9A 1WMKA 4YNOA 2OWBA 4X21A 4X2JA 5F94A 4DTKA 3FZSA 5IEXA 5EM8A 3P7CA 2VTSA 2VTQA 4JDHA 1P4OA 4RC3A 4BHNA 4EOJA 3OF0A 3ZSIA 3WF9A 2IVTA 3IW5A 4GVJA 4M69B 1P4FA 4ZY6A 3C5IA 2YLFA 1PMUA 3UE4A 4PDPA 4KIQA 4I4EA 4XH6A 3ZFMA 4FEVA 2Y4IB 2NP8A 1ZAOA 3FZTA 3L9LA 2FSLX 1FGIA 4CV9A 3IGOA 2OIQA 3THBA 3RPSA 4X2KA 2QHMA 2B4SB 4BI2A 3VUHA 1DI9A 4O83A 3V6RA 2C6KA 4JS8A 4I94A 5FQDC 4CKJA 2W7XA 3HV7A 3EQFA 4A7CA 2F2UA 1LUFA 3D83A 3R73A 2VTRA 3QTIA 3SLSA 3EL7A 4BCFA 1I09A 2C6TA 4I4FA 4XG7A 3GENA 2C3JA 3DK3A 1FVRA 5HCXA 3WOWA 1OM1A 3KY2A 3R8LA 4BCOA 3LAUA 4U5JA 2HY81 4YJUA 1KOBA 3MS9A 3VUKA 2YISA 3DBEA 2JBOA 4DHFA 3UPZA 2Z60A 5FDXA 5EQPA 1ZOEA 1QL6A 2F49A 5FEDA 1JKSA 3IOKA 3NW7A 5CF6A 1BKXA 2GNJA 3R8MA 4ID7A 5EI8A 3MTLA 3ULIA 5BQ0A 4DBXA 3HECA 1YXVA 4PL4A 2XBAA 3OTUA 5I9UA 3R9NA 1IASA 4BHZA 5HCZA 1SYKA 2WAJA 4EL9A 4OTQA 3KEXA 4IXPA 5AR2A 4NM5A 4NFNA 2UZNA 1H1QA 4C2VA 2RKUA 3E64A 2JIIA 4XG4A 4DEEA 2XNEA 3QUDA 4M3QA 2QVSE 4I5CA 4TWCA 2XNGA 5HEZA 4TNBA 3CPCA 5JQ8A 3D7ZA 2C0IA 2B52A 3OWPA 4FTUA 2BRNA 1ZZ2A 3QUEA 5CXHA 4B8MA 3KRLA 5LMKC 5EDPA 2WQOA 3Q4TA 5HO7A 3F69A 4IZAA 3R28A 5T68A 2H6DA 1ZYSA 5DT4A 2O0UA 2B9JA 2R3JA 4W9XA 2OO8X 4MH7A 2ZDUA 5CEQA 4W8EA 3QZGA 4O7ZA 4PTEA 1WBPA 5B7VA 3KF7A 4E6AA 4OGRA 2AUHA 3LVPA 4USEA 4FEQA 4CZYB 1DAWA 4QMXA 3NUYA 1M7QA 4QP7A 2PUPA 3EN7A 3CY3A 4D1XA 5GIOE 3E8CA 2FSTX 4IVAA 1G5SA 3FC1X 4E6QA 3TIYA 4YTFA 3R7UA 5LVMA 4QPSA 4RWLA 5IA4A 4S31A 5ICPA 2W1ZA 5DRDA 5E1EA 4J99A 2IVUA 4BDHA 4CFNA 3U4WA 3OROA 4FV7A 3FY0A 4D1SA 4M84A 4A9RA 4BRXA 1HOWA 5K4JA 3C4FA 4KBAA 1STCE 3W8LA 2ZV2A 4BWKA 4BDKA 4FR4A 4L68A 3ZO3A 4Y46A 1J7UA 3SD0A 4O6LA 4K77A 3GCQA 3ORZA 2YZAA 2UW6A 3HL7A 2VUWA 3P7AA 4HVIA 4R77A 4RZVA 3RHKA 3E62A 1PXNA 1QMZA 3QCQA 3R9HA 4IX6A 4ITIA 4IQ6A 4MVFA 4UV0A 4YURA 2RGPA 2XK8A 4QMLA 4GG7A 1OIYA 4GFMA 2YIQA 3GT8A 4C7TA 4HNIA 2BROA 4QYEA 1YWVA 5F20A 3Q9ZA 4FIFA 1TQPA 3K2LA 3DLZA 3Q2MA 4ZZMA 3BYSA 5GZ9A 2PMNX 1UVRA 2FVDA 4C38A 5HLWA 1ATPE 1CDKA 2X2KA 4TZRA 4ZJIA 5BVDA 3PUPA 3MIYA 1ZWSA 5C01A 3NUXA 3UYTA 1UV5A 2VTHA 4MBLA 1M7NA 4RX7A 5CEOA 4CYJA 4EJNA 2AC5A 3O7LD 4N70A 4XS2A 2VTMA 5CX9A 4WNPA 1Q8WA 1XH6A 2OFVA 2XIZA 4DH7A 3ENHA 2HAKA 2GSFA 3C9WA 3KXMA 1SNUA 2X9FA 4H1JA 4RIOA 4M68A 3VW6A 4BCIA 4PNIA 4F1MA 1OBGA 2WTVA 3IPHA 4U7ZA 2F4JA 4YHTA 3QTUA 4ZIMA 3QD4A 4KIKB 4NU1A 4J96A 3EQHA 1R78A 1PXOA 4EQUA 2P0CA 2CLQA 3K54A 2ONLA 5CI6A 5FXSA 4E7WA 5ANDA 5CF8A 3DB8A 1ZRZA 2WTJA 2YM8A 4ACCA 3ZEWA 2IJMA 4NSTA 3V5WA 4ZJVA 3ET7A 3KK8A 5G1XA 4FNWA 2RSVA 2WMRA 1RW8A 1H1SA 3Q6UA 4NW6A 3NW6A 4FNZA 4YSJA 1U5RA 3O71A 4PQNA 5E90A 4HVHA 3UQFA 4IM0A 4TYIA 4GKHA 1SMHA 3BRBA 2XKCA 2PE2A 4EK6A 4XV2A 1XBAA 2FH9A 1GIHA 4U45A 3NVKI 3ID6C 4RZWA 5HO6A 5BYYA 4BBEA 4NKAA 4X6QC 3CGFA 3MB6A 4LL0A 3FHRA 3A4OX 2A1AB 4PV0A 3M1SA 1ZYDA 4UXLA 4C61A 3VC4A 4O1OA 4D2TA 4O84A 3AGLA 3VNTA 3H10A 2OJFE 5EG3A 4TYEA 4X7QA 3WBLA 3HV3A 4X3JA 4FZFB 3A7JA 4QP2A 3ZSHA 2ZDTA 4BGQA 2GNLA 3NZ0A 4TPTA 2YLEA 3C4WA 5AP5A 5B2MA 4GMYA 4F7NA 4QQTA 4GVAA 4PPCA 5LWMA 2BCJA 2X6EA 2ZJWA 1BLXA 2UZUE 1PKGA 2WQEA 3ALOA 3MTFA 3RBWA 4ONAA 3FI3A 5ANIA 4X6RA 3FLNC 4DEBA 3RPVA 4QP8A 2QOOA 4AXAA 3ZU7A 4AW1A 2W5BA 3R6XA 1H1PA 1M52A 4JR3A 3TNHA 4AOIA 4E1ZA 3ZZWA 4C02A 2BRMA 4ZLYA 5AIRA 4CGAA 5HTCA 4QMTA 3DGKA 2E2BA 1MQ4A 4JT3A 2XUUA 4ZJJA 5AAFA 4YJOA 3DY7A 4CFUA 1H1WA 5M4IA 3I7BA 3B8RA 3ZRLA 5ANEA 2X7OA 3PJ2A 2VNYA 4M0YA 4QP9A 5KO1A 5CALA 4PDSA 1Y6BA 2JIUA 3NSZA 4RIYB 3ODYX 4LFIA 3TV4A 4BIBA 4C4EA 3E5AA 3RGFA 3DBQA 3ZLSA 3QTRA 5EHLA 3RK7A 2X4ZA 3PLAE 5AA8A 4DFXE 4YJPA 5DR6A 4D9TA 5FD2A 4YC3A 5CQWA 2GQGA 2F2CB 4YZBA 3KGAA 2V62A 3GP0A 2CKOA 3TZ8A 1MUOA 2UZEA 2UZDA 3JR1A 2EU9A 2B53A 4YPDA 3MSSA 3C4XA 1YXSA 2RL5A 4JI9A 3MFSA 2WTKB 4R1YA 3PXRA 1Q8UA 2P55A 3KQ7A 2PVKA 2YCQA 4ZP5A 5EYMA 2RFDA 4F08A 4K0YA 2YIYA 4DFUA 4UMRA 4U3ZA 4BR3A 4FL2A 3UGCA 2PE0A 2UVXA 4YZ9A 5KHWA 2UW8A 4NL0A 1H4LA 4ZTMA 3NNXA 2VGPA 2PHKA 5EW9A 4O27B 2R0IA 4LOQA 3TKIA 3OW4A 4MNEA 5BYLA 4JOAA 4EHZA 3QWJA 4TYHB 1ZXEA 4DFLA 4ZZNA 3S0OA 2VX0A 1PYEA 3PVUA 2BAKA 4MD7E 4CYIA 2BFYA 1BYGA 4QOXA 4NM3A 4TRLA 5CT0A 4DT9A 1Y8YA 3G9LX 2CHLA 3E63A 3UOHA 4X3FC 1H1RA 1OKZA 5E92A 5M44A 3LFCA 4FSUA 5DGZA 5EKOA 3QX2A 2EUFB 5AUVA 3SRVB 3FLWA 3COMA 2E9UA 3V51A 2CGXA 4JRNA 2W4JA 5AEPA 2ETMA 4IHPA 4GJ2A 3EJ1A 4GSBA 3HP5A 3KMWA 3HUCA 3UVPA 2ITYA 3G9NA 2YWVA 4EOKA 4QNAA 4ANSA 1R1WA 4B8LA 3DBCA 4C2WA 2XIKA 2QI8A 1GZNA 1OIQA 2ZAZA 4RFMA 4YNEA 4IAKA 4ZSEA 3H9OA 3R9DA 4D2WA 5IQFA 4RWJA 3VQUA 4II5A 3RM6A 3E8EA 4EUTA 3ATTA 3F5XA 3RI1A 3W16A 1TKIA 4FTMA 3BHYA 2GS2A 3O8PA 4FIJA 4AU8A 1OL7A 4ALUA 2W9ZB 3GCVA 2PVFA 1JVPP 4WOVA 4RRVA 2YDJA 2HZ0A 3VBWA 2J2IB 4A4XA 2ITPA 3SW4A 4NM7A 5J87A 2VRXA 2RF9A 2JD5A 2VTNA 3CQUA 5EK7A 4BTJA 2W4OA 4IZ5A 1Q62A 1W7HA 3QAME 3ZOSA 1Q3DA 3E87A 1OL5A 2BPMA 2QODA 3EN6A 3DDPA 1JWHA 3EZRA 4RLLA 3AOXA 3P9JA 3IW4A 4LUDA 5AV4A 5CASA 4XBRA 4EK4A 5HNIX 5FP6A 5JFXA 4YZCA 2VO0A 5HE0A 2BZJA 3V01A 3GFWA 3TUDA 2PUIA 5GIPE 2FO0A 2HWPA 2WTDA 4U79A 4GUBA 5LVPA 2HZNA 5CY3A 2PMLX 3SKCA 3QYZA 5A4QA 3C0HA 4ACHA 4FSNA 4JVGA 3NCGA 4YZDA 4Y73A 3Q5IA 4CKRA 1V0OA 2R3PA 1YHSA 3CSVA 3O17A 3PXZA 2XEZA 4FTQA 2QKRA 3BYMA 4ZTQA 5DEYA 4NIFB 4AG8A 3DQWA 2X6DA 4NIFA 4L9IA 4UB7A 5CS6A 2HY0A 4ANMA 5BVFA 5BVOA 1AD5A 3N51A 3F3WA 4JG7A 4BDBA 1H27A 5AP4A 4PP9A 5EDRA 4GK3A 5K5XA 5FM2A 3I4BA 4BZOA 4YR8A 1PRYA 4O0WA 4UWBA 4DG2E 3BWJA 4DA5A 3POOA 2J50A 5M07A 3I6WA 4ASEA 2YA9A 3L8XA 4I5PA 1YKRA 1YDSE 5L6WL 3VN9A 5IQIA 4I5MA 3E7VA 1JBPE 1YXTA 1F3MC 2R0UA 4IADA 5AUXA 4R8QA 1JPAA 2VAGA 3D5WA 1Q24A 3QGYA 3U6HA 4FE2A 3FKLA 1EH4A 3ZH8A 2H8HA 3EZVA 3PSCA 4FX3A 4TYJA 4H39A 5JFWA 5KMIA 2YITA 4UXQA 3ORMA 3F3ZA 4FIIA 3SOAA 5A54A 3V6SA 4P2KA 2Y4IC 3R1SA 4O0UA 3NYNA 4BDAA 4R7IA 3R8PA 1PKDA 4ENYA 2IO6A 5I9YA 2ESMA 1OECA 3LKMA 1NVQA 3EQPA 5HQ0A 4R7BA 2F57A 4G17A 3N9XA 3KRWA 3P7BA 3QTWA 2QLQA 3HAVA 5DMZA 5J1VA 3ZTXA 2YCFA 4O82A 3TZ9A 3VS7A 3Q9YA 4JAIA 4JQ7A 3MVLA 3TJDA 4E6CA 5AJQA 5CZHA 3OXTA 5DWRA 4F65A 1YW2A 4FKUA 3QA0A 4EHEA 3BIZA 5E8YA 2XK3A 2ZB0A 4IB3A 4IX5A 1YOLA 1O6KA 3C13A 4GU9A 4M13A 3ZBFA 3QTSA 3FQSA 4JDKA 2R3RA 3KULB 5IF1A 2O64A 2ZMCA 4I22A 4RX8A 4HYSA 4BDIA 4UEUA 4MXYA 2E9VA 4RT7A 3FMDA 2R5TA 3CP9A 5CEPA 2J5EA 4ZK5A 4CCBA 5JKGA 4FI1A 1URCA 3GC8A 4DFNA 3AT2A 3KF4A 1ZLTA 3NRMA 3UNZA 4D5HA 3DKGA 1QPEA 5ANJA 5HX8A 2B0QA 3QRIA 5J7BA 4AQCA 4E6DA 4OTIA 1MRUA 1CM8A 3RINA 5C4LA 1PMEA 3BE9A 3QKMA 5FBOA 4EOIA 3EB0A 2QG7A 3UNKA 3Q52A 2XF0A 4RWKA 3COIA 3BEAA 3R8VA 3IW8A 3EYGA 3PRIA 5IQHA 3ZFYA 4PMMA 3IGGA 4J52A 3NYXA 3W10A 3NAXA 1DM2A 5EYCA 1ZOGA 1ZY4A 2WMTA 1GZKA 4A4LA 2V55A 3QTQA 4GEOA 3HZTA 5JZJA 2XP2A 2A27A 5M57A 4H58A 1FMOE 2Y6OA 3F5PA 4BGHA 1G8AA 2GTNA 3L8VA 3DJ7A 3F3VA 3ZRKA 2J0IA 3RPOA 4RVLA 4O22A 3LXLA 4JG8A 1RJBA 3D5VA 4FTIA 4GK2A 5ANKA 3ZXTA 4I23A 5CSPA 5L4QA 3E3BX 1UNLA 2W1HA 4DAWA 4LGGA 3DK7A 5T3QA 2J0LA 4O7WA 3F3TA 4E4NA 4NTSA 1JLUE 5BUJA 3LMIA 5BNJA 2IZTA 4QP3A 3S4QA 5AUTA 4NT4A 4IB5A 2IW6A 1FVVA 3WILA 3W2PA 3QU0A 2YAKA 4U43A 4DINA 4QYFA 3O7LB 4B6LA 2ERKA 4DBNA 3NDMA 4GFOA 4BCQA 3U9CA 2P2IA 1PMNA 3MH2A 3OFMA 3QHWA 4NM0A 2XM8A 1H00A 2RFNA 2Y9QA 3JXWA 4P90A 3WF5A 4RJ5A 4D55A 2J9MA 4B9DA 4RJ4A 2VWVA 4WKQA 3OD6X 3AGMA 4M67A 1IA8A 1H0VA 2G2IA 3F2RA 1Y6AA 4MEDA 5KMJA 2VV9A 3BV2A 2REIA 3ORXA 3O23A 3MB7A 1SVEA 3MDYA 1YI6A 4DH3A 4DTAA 5AA9A 3KXHA 4G34A 2I0HA 4I5HA 5EHOA 4E73A 5CU0A 4JBQA 4KIOA 3MYGA 4WSYA 5IKWA 3MVJA 4G3GA 2QD9A 1CKPA 1OL1A 4GS6A 4ZTNA 2BIYA 3ZM4A 3QLFA 5J9LA 2J6MA 2WO6A 4QMUA 4F0IA 2XIXA 5E8XA 4YLLA 5LOHA 3FZ1A 3U51A 5HG8A 2ZM4A 3O96A 3KB7A 1WCCA 2BMCA 5EQYA 5ITAA 4NTTA 1REKA 3PE1A 3UIUA 4IM3A 5J9YA 4ERKA 3VUTA 2PULA 3A2CA 4L7FA 2EVAA 3BGPA 2BFXA 4FTTA 3NUAA 5JGBA 2E9PA 4R6VA 5IDPA 5LARA 1IA9A 2IVSA 4OTGA 3DXNA 4MXXA 4MF1A 5I9XA 3NMUF 3R63A 1AQ1A 1KV2A 2XYNA 4OT5A 2W5AA 3TV6A 1OUKA 1HCLA 4RJ6A 5F1ZA 4YTIA 3ZONA 1Q8ZA 2YZLA 4UZDA 5HG9A 2JAMA 4J95A 4X2NA 3LXNA 4TT7A 2X2MA 5E8UA 3TTJA 1JOWB 3VUMA 4EHGA 3ZLWA 3GOKA 4CQEA 2G15A 2IN6A 4ZS4A 4Y95A 1VEBA 3BELA 4F6SA 4EEVA 3HMIA 4FKGA 4MHAA 2X81A 4HGEA 4YJRA 3C50A 3EHAA 2JKMA 3LFBA 5CAOA 1ND4A 2GNIA 3AD5A 4FG8A 4WT6A 4CVAA 4CG9A 4D2PA 4S32A 3Q9XA 4IVDA 3HKOA 3G51A 4BY9E 4BKZA 5AFVA 3AT3A 2ZM3A 2J51A 2OJIA 4JR7A 3FDNA 3UP2A 4ZLZA 5AR4A 4OTRA 2VWWA 5KZIA 5HI2A 3IDBA 3NIEA 4WSQA 4J98A 5AP6A 3LMHA 1ZZLA 3R30A 2PPQA 4FYOA 3QRUA 5AR7A 2G9XA 3TDWA 1PXLA 3U8WA 5CVGA 3FJQE 4U41A 4ALVA 2C5XA 4F4PA 1UNHA 2HK5A 2XM9A 4RX9A 2HWOA 4QQCA 4HW7A 3N4UA 4DF3A 4GFGA 1UKHA 1WBSA 2QO9A 4FL3A 3ORNA 5FEQA 3LM5A 4HCVA 4HGSA 3GXLA 3QWKA 4I20A 4AF3A 4C4JA 2YIXA 4ZTHA 1W83A 3OZ6A 4TYGA 5CU4A 3F3UA 3TV7A 3ZUUA 1UU3A 5AP0A 4E4XA 4RVTA 3KCKA 4J7BA 3PFQA 2BALA 2XK4A 3ENMA 4QMOA 3T3UA 3LFSA 4QO9A 4QNYA 2YM3A 4FT7A 3EQBA 2OH0E 2VTJA 4GT3A 4C35A 5HIEA 1WBWA 2PVLA 2XRUA 1YRPA 2B9IA 3FLQA 3NYVA 3QQLA 4M69A 5EHYA 5B2LA 2YM5A 4O0XA 5F9EA 4KRDA 3O2MA 4R1VA 1H01A 1PXJA 4YZNA 3OOMA 3BYUA 3GEQA 3A8WA 3VIDA 5BUIA 5JN2A 4PTCA 4EZ3A 4D2SA 3IK3A 5EM5A 4HYHA 4OBOA 2ITQA 1RE8A 3Q4CA 2WTKC 5IDNA 3SDJA 3UTOA 3E8DA 3LMGA 4EOMA 4NZWB 5JH6A 4WRGA 4KAOA 2DQ7X 1G3NA 3R9OA 3TI1A 3PDTA 4LRKA 3MVHA 3UDBA 2YJSA 3GVUA 5FEEA 4PY1A 4FZAB 3LZBA 1WBNA 4KSPA 2PVYA 5HORA 2SRCA 4UBAA 1U59A 4JQ8A 4OBQA 3R00A 4DGOA 2V7AA 1GIIA 3JY0A 5GHVA 5CU3A 4O1PA 4YPSA 2YWPA 4EOOA 4KS8A 4YTCA 2JKKA 2UW3A 3UG1A 3D5XA 3PJ3A 2QR7A 4ZZOA 3BQCA 4PPAA 1XH9A 1XH8A 1R3CA 4C4HA 3LFNA 4Q5HA 5C26A 2A4LA 2F9GA 2PWLA 4ASDA 4AWIA 3U6IA 5BVEA 2VWXA 4RA4A 4BCNA 4APPA 3PP0A 3TZ7A 2PZYA 1JQHA 3EQRA 3FMJA 4FTJA 2OXXA 1ZYCA 3PRFA 3AC4A 2OH4A 4R5YA 3RZBA 1ZMWA 5CVFA 2JDSA 3ZCLA 1TQIA 2R7BA 3VRYA 1SM2A 3O51A 2CGUA 5M4CA 1GZ8A 3VWAA 5HD7A 3FQEA 4AGWA 3RALA 1Q99A 2PY3A 4FKWA 4X2FA 2G01A 3EWHA 1J91A 2VX3A 2HW6A 2PYWA 5E4HA 4DEAA 3GNIB 4OTFA 4BF2A 2OU7A 3QD0A 2WHBA 4EYMA 3KMMA 5KMNA 2W1EA 3I6UA 5C1QB 1FGKA 3NNWA 4FUYA 1WBVA 1KE5A 4GT4A 4HNFA 3H0ZA 3KL8A 4AZTA 1MQBA 2DYLA 4BI1A 5HTIA 2RIOA 5E8SA 3PG3A 3SHEA 3W1FA 2OK1A 5A4LA 5J9ZA 5LWNA 2BIKB 5DLSA 4O7SA 3Q2JA 4CFXA 4FKIA 3OWLA 1WZYA 4FKTA 3ZO4A 3FXZA 2GHLA 4WG5A 4WNOA 5FXQA 5J8IA 3GU4A 3HNGA 4ANQA 3QXOA 1U5QA 4PMTA 2HZIA 5H8GA 3FZOA 4FYNA 4IB1A 2ZM1A 4F9CA 3UZRA 3MIAA 3TL8A 4QYGA 3WYXA 2RG5A 5A4TA 3GU6A 4I6BA 3GCPA 5LVNA 4WA9A 4V04A 3CBLA 5E7RA 1YXXA 2WD1A 3GC9A 1R0PA 3HV5A 3MN3A 3L9MA 4WNMA 4CLJA 1J1CA 2P2HA 4DH8A 3ZDUA 3D7TB 1YDTE 4IDVA 5DT3A 4IIRA 4Z55A 3TACA 2CGVA 3SXSA 3Q4ZA 2WPAA 3PJ8A 3P08A 1H07A 4G3CA 4NUSA 4RJ3A 4RGJA 5D12A 5HLNA 2XK6A 5C9CA 2IZRA 3RTPA 4MF0A 1KSWA 1Z9XA 5HVJA 1PYXA 1QPDA 4FGBA 4P7EA 4UWYA 2R3FA 4WO5A 2QKWB 3BHTA 3LJ1A 4PL3A 2QNJA 3EKNA 3OCSA 2OKRA 4FKSA 3VUGA 3C5UA 4DFZE 4FT9A 4BYIA 4L7SA 4AACA 1NVSA 3E3PA 4IC8A 3A7FA 2ITOA 4MQ2A 3T8OA 4KB8A 2X7FA 1O6LA 2YM7A 3NW5A 5CENA 4NEUA 2HCKA 2X7GA 1PXPA 4RMZA 1R39A 4C0TA 1WVXA 3AC2A 4AT5A 1URWA 3FYKX 5IQCA 3NUSA 4JDIA 4NCTC 4ZY5A 2YJRA 5M55A 4BBFA 3JUHA 3VBTA 3D2KA 3BKBA 4ZTSA 3PPKA 5DPVA 5IMEA 5DT0A 5ACKA 3A60A 1H08A 4L6QA 3ORIA 5D7VA 5IUHA 2W5HA 3VJOA 4I93A 4KIKA 1YQJA 2PVMA 5M4FA 2FA2A 1IR3A 2WMWA 4OTHA 3RVGA 3WIKA 3UC3A 2YEXA 4KKHA 5KZ0A 3SG8A 3ZYAA 2X39A 4ACGA 3PVWA 3EFLA 3P4KA 3R02A 2QG5A 4C57A 3PVBA 4XOYA 4NYEA 2DS1A 2X8DA 4TKSA 4XG8A 1UKIA 3ZUVA 4F70A 3G2FA 1PHKA 2O65A 3CTJA 3KXGA 3Q3BA 4OBPA 3A99A 5IA0A 1YVJA 2CJMA 4Y85A 4YC6A 3QQKA 5AADA 4FVRA 2YM4A 1Z5MA 4YLKA 3Q32A 3NUNA 4LL5A 5K5NA 4A9UA 4RC2A 5K4IA 1PY5A 5DI1A 3VBYA 3PXFA 3N4TA 5J79A 4QMWA 3H9FA 2OGVA 2W99B 3NWWA 5CT7A 5E8TA 3IG7A 2HXQA 3PY3A 2UZLA 2G2HA 4J8NA 3WARA 2EB2A 5I0BA 5IQGA 3WF6A 1VYWA 3FKOA 4QP6A 5I9VA 4EQCA 2YERA 3C4CA 4RG0A 3C7QA 5JT2A 5HD4A 2JIVA 3BEGA 3RCDA 4D4SA 4E3CA 3CPBA 1P14A 3F2AA 5AUWA 5AM7A 5HNBA 4MXOA 3I60A 3SX9A 4XMOA 3D14A 1W0XC 3FHIA 3FZRA 1Q41A 3PY1A 4RFYA 3RNIA 1Q61A 3E88A 3EN9A 4K1BA 2EXEA 4CT1A 2BTSA 5KKRB 4FTAA 3RHXA 5IA1A 1JSTA 2XKEA 2ITNA 1KE9A 2VO6A 3AG9A 3W18A 5FTOA 5DE2A 1WFCA 5D9HA 4PWNA 4FSWA 2P3GX 4FVPA 2PK9A 3UYSA 3BYVA 4AGCA 4G3EA 4LUEA 4UMQA 3S3IA 4FKQA 2UW9A 5AV0A 2JEDA 2ZV8A 4RQKA 4BC6A 4HYIA 5AX9A 3TTIA 3EQCA 3R7OA 5A6NA 4DCAA 2YAAA 2WEIA 4RIYA 3PA4A 1ZY5A 2C0TA 4JBVA 5J95A 4MX9A 4IW0A 3WZKA 4CT2A 4EH3A 3MVMA 4N6ZA 3MA6A 4U8ZA 2Y4PA 5CSXA 5IPJA 4G3FA 4IB0A 2OLCA 4DLJA 5D1JA 3QQGA 4K2RA 4KRCA 3W2CA 4RIWB 3UIXA 5HHWA 2OXYA 3VAPA 3BHVA 3FY2A 4ZSLA 1YWNA 4XG2A 3A7IA 3KREA 4UMTA 5IQAA 4IMYA 5FLFA 4OTPA 4IAFA 4WG3A 2PSQA 4TWPA 4O7TA 4DEHA 3HX4A 2WOTA 3OWKA 2QONA 5FTGA 3UP7A 2BDWA 5DHJA 3Q96A 5GJDA 2JC6A 2WU6A 3QRJA 4YBJA 3W32A 5AIKA 2GFCA 2I0YA 5B0XA 3BGQA 1LEWA 3HRCA 4IFCA 2GHGA 3W2OA 2OW3A 4UY9A 5CAPA 3D9VA 5BMMA 3W55A 5HOAA 2C5VA 4TW9A 3VW8A 5E9EA 4K6ZA 2Q0NA 4TYHA 2IVVA 1CSNA 5CZIA 1Q97A 2XIYA 2XEYA 2UZWE 4L45A 3W8QA 2J0KA 5C8MA 4GKIA 5M53A 5BVKA 4GG5A 2QOQA 2I0EA 2ZYBA 2CPKE 3P86A 3QXPA 3R1YA 2UW0A 4R3PA 4QTAA 5GZ8A 5JGAA 4M8TA 2CN8A 4FTRA 3SRVA 3QTZA 2R2PA 3D0EA 2O5KA 3G90X 4UZHA 3CD8A 4IFGA 3RPYA 3PJCA 5FG8A 3GI3A 2OJJA 4UYNA 1UNGA 4MBIA 1CKIA 3I79A 4BI0A 2JFMA 3E8NA 2A0CX 2WMSA 2WTCA 5HE3A 3MGYA 4F6WA 4G9CA 3ACJA 4FODA 1ZYLA 4BFMA 2QURA 4FC0A 2OZAB 3MW1A 3R7YA 3FMKA 3WYYA 3WZDA 5KNJA 4WHZA 3EQGA 4O96A 3R04A 4JRVA 4O2ZA 4R3RA 1FQ1B 4OR5A 4DGGA 2WMBA 3HMPA 5L8LA 1M2RA 4OLIA 2PUNA 3OOGA 3ZEPA 3V8TA 4RWIA 2GNFA 3PSDA 4K11A 3DAJA 3BV3A 4M15A 3EYHA 3FAAA 4L01A 2YFXA 1KE7A 3QQFA 4U44A 5IEYA 5CU6A 3DXPA 3ODZX 1YI3A 4FKOA 3JPVA 5L2QA 2XKFA 4DFYA 4O0YA 4AZWA 3S00A 4O6EA 4IJPA 2R3NA 2GFSA 4EZ7A 4Z3VA 4C62A 5TO8A 2HXLA 3G6HA 4FT5A 4A9TA 4BTKA 4Y8DA 3FI2A 3FL4A 4L8MA 3KK9A 5JSMA 4ZS0A 1XH7A 3VS3A 4BIEA 1PMVA 5AUZA 3E7OA 3EN4A 4L67A 1V0BA 3LFDA 4YUQA 1L8TA 3EFWA 2JLDA 3MPAA 3R7EA 3T3VA 3K3IA 4DH1A 3IDCA 4ACDA 5CEMA 1GZOA 4XRLA 3QL8A 4XX9A 5KMLA 5AV1A 3BX5A 5DG5A 2CKQA 5G6VA 4I0SA 4EWHA 4LMNA 4YU2A 3OWJA 1JKKA 2R3OA 3R7GA 4FKRA 3ULZA 4UWCA 4K18A 2YHVA 4O86A 2ERZE 1YWRA 1Y57A 4I6FA 4X0MA 5ACBC 3HAMA 4ZMFA 2B9FA 2JAVA 2VWYA 4QP4A 2J90A 4EK8A 3U87A 1F0QA 4IAIA 4U3YA 3R71A 3DAEA 4IWOA 5DVRA 4LYNA 1B39A 4JL9A 4RPVA 3AC5A 1T46A 3RNYA 4GUEA 2R3KA 3S2PA 4F1OA 4BWXA 5ETIA 1PXKA 1GNGA 3CCNA 3DQXA 1YHWA 3CGOA 3QD2B 4FNXA 3N4VA 4MD8E 4NCTA 1Y91A 5CF4A 1KWPA 5IQDA 1OPKA 1Q3WA 5HTBA 4AGUA 3MY0A 3UO5A 3NAYA 2BUJA 4GT5A 3WZUA 4FTOA 3QHRA 2F7XE 3KXNA 4LV8A 3WF8A 3QKKA 5EOBA 4BZDA 1H8FA 1Q8TA 2O8YA 3V3VA 3IQ7A 2I1MA 4ZLOA 4RVMA 5HBEA 2UZBA 3PG1A 1YDRE 1JAMA 4BYJA 2C0OA 3CJFA 5L2SA 4G16A 4GJ3A 4O0SA 3DBDA 3PA3A 2IW8A 3DXQA 3GGFA 2RFEA 2HELA 4XP3A 4RC4A 1V0PA 5BVWA 5CEIA 3OY3A 3NUUA 1QPCA 2C1AA 3LM0A 4QQ5A 2XK7A 3SXFA 4JX3A 1FINA 3U4UA 4ZY4A 3UOJA 4MXAA 2PVNA 2JGZA 5TR6A 4YO4A 3QF9A 3ANRA 3ZMMA 4DTBA 2C6OA 3QLGA 5AP1A 3KULA 4EH7A 1KE6A 2QO7A 5HNGA 1VZOA 4MAOA 4MCVA 3KN5A 3QFVA 3QALE 3LQ5A 2VO3A 3F61A 4F9YA 2BKZA 2C5YA 3OEFX 5HICA 3Q04A 3B8QA 4NK9A 4L53A 3VS5A 3PVGA 2A19B 5I4NA 4XLVA 3NVMB 4YZMA 3JYAA 4Y5QA 2OICA 5JRQA 4V01A 3LE6A 3TG1A 4IZYA 5L8JA 3OW3A 2W17A 2BAQA 5HVKA 3FMHA 3ORLA 2HENA 2YACA 1NVRA 2Z7QA 3PPJA 4BDEA 5EQEA 3P78A 4ITJA 1UU9A 2XJ1A 4U97A 2NRYA 3WZJA 3R0TA 2KTYA 3Q53A 4YSMA 4A9YA 5AUUA 5CSWA 2B7AA 3U6JA 1GAGA 4CFWA 4S33A 5M06A 4M0ZA 3COKA 1MRVA 2VX1A 4ANLA 2VTOA 4M66A 4OW8A 4XRJA 4YGAA 1FVTA 2XH5A 4DC2A 3CTQA 2PZIA 5HCYA 3UNJA 4EC8A 3PIXA 5HE2A 1H0WA 1G8SA 4JLCA 5TKDA 4F99A 1OITA 4IAZA 1FOTA 4I24A 4EH6A 5IEVA 4PX6A 3U9NA 2VO7A 4YJNA 4CLIA 5IA5A 3ZDIA 1WVYA 1CTPE 5H3QA 3TXOA 3QZIA 4B0GA 3DK6A 3FE3A 1XHAA 3ZSGA 2VTAA 5BX0A 5J5TA 3BYOA 3LCTA 4QMYA 3IECA 4ASXA 5HBJA 2VD5A 5HU3A 3H3CA 4TL0A 2PZRA 2VWBA 4XNEA 5H8BA 3IW6A 4FV9A 5EYDA 4AS0A 4D58A 3A8XA 1OIRA 3SQQA 3BLQA 4BWPA 2BZHB 3M42A 1FBNA 4QYYA 5BPYA 2ITVA 4FKVA 5CSHA 3HA8A 3I5NA 4CMOA 4XEYA 4YJTA 2O63A 2WTWA 5ETFA 4TTHB 4AW2A 5HESA 4RFZA 2WIPA 4GRBA 4EUUA 5A6OA 3Q4UA 3VBVA 4DYMA 4ZSJA 4F09A 1XBBA 3HRFA 4AA4A 3VBQA 4DLIA 2JDRA 3QKLA 2WELA 4EH4A 3GOPA 2C6DA 3CXWA 4EONA 4DGMA 4EH2A 4LMUA 3REPA 2Y6MA 3HRBA 2VTLA 3KRXA 4IE9A 4U40A 4FZ7A 5B2KA 2QLUA 4LG4A 1XKKA 4L46A 1FMKA 3HLLA 2C3IB 4AA5A 3F5UA 5DH3A 4AT4A 4DH5A 4E4LA 4PUZA 3R22A 4ZTRA 2IG7A 4TNDA 3UG2A 3JVSA 5IH4A 3B2WA 4FL1A 3S95A 2VZ6A 2G2FA 2WNTA 1BL6A 5DYJA 2W06A 4Z9LA 2C1BA 4U6RA 2CDZA 2X9EA 3TZMA 3OEZA 2XBJA 4YO6A 4O7LA 4U42A 2X1NA 3ZC5A 4BCJA 4BDGA 3IONA 1NA7A 2OIBA 3OTVA 4HGLA 2OF4A 4R3CA 2I40A 2B55A 2CCIA 4XOZA 3FZPA 4U81A 3SGCA 3PLSA 4GIIA 4D28A 3BBWA 2HYYA 2WTIA 2ZV7A 4CFMA 2BILB 5FM3A 4JX7A 5EI2A 3NX8A 4N57A 3RPRA 3WIGA 3P23A 4EQMA 4O7NA 1W8CA 5HU9A 4YC8A 4L42A 4V05A 4O81A 2W4KA 4CKIA 4EBWA 2JKQA 2JITA 4Q5EA 5FBNC 2WMQA 5TE0A 4TN6A 3TDVA 4NFMA 4NWMA 4WIHA 2W9FB 4G6OA 3ZZEA 4EOPA 3KKVA 3CIKA 3I0OA 4D5KA 3BCEA 2YN8A 4EH9A 4BIDA 3PIZA 4OTDA 3RK5A 2C6MA 2EB3A 3Q6WA 3II5A 4MWHA 4GYGA 2GNHA 3KA0A 3MH0A 4QMNA 3WI6A 4FKPA 5I9WA 2WMVA 3UVQA 3P5KA 4MNFA 5D7AA 4D2VA 3RAWA 1GOLA 1PXIA 5KBRA 4JXFA 4L3LA 5KHXA 2H9VA 3DDQA 5KKRC 4M97A 4RIXB 1OB3A 2VNWA 1ZMUA 5IA3A 3DLSA 3A7HA 3GB2A 3TWJA 2XNNA 4G9RA 5M08A 2WU7A 4WRSA 2PMOX 4FZ6A 2IZUA 4MXCA 2C5NA 4CSVA 1VJYA 3OS3A 2W96B 3M11A 5A4EA 3C4EA 3FI4A 4AE6A 4AN3A 3KMUA 5C8NA 2I7QA 3PXKA 5DN3A 1M2PA 3K3JA 2PU8A 5F95A 4FUXA 1OI9A 2BHEA 4G31A 3VF9A 3TCPA 4HPTE 3UMXA 4F7SA 4YHJA 5L2IA 3SW7A 4PDYA 2GS6A 5I9ZA 4O7RA 3F82A 2XZSA 4FF8A 4N6YA 2P33A 5FGKA 3F2NA 3UQGA 3QRTA 3VHKA 1Z57A 4KBKA 4HVDA 5KMOA 2ITZA 3LFFA 4H1MA 4CD0A 1NXKA 3BQRA 2ITTA
chains in the Genus database with same CATH superfamily
2R9SA 3KCFA 3W2SA 5DBXA 5CF5A 2VU3A 3UZPA 4MWIA 4FEXA 4DE4A 3W0QA 2W1IA 2C68A 3W2QA 5ANOA 5KMMA 3CEKA 2WEVA 2VWZA 3AXWA 3EN5A 5DRBA 1UU7A 1W84A 3UQCA 1U54B 1U54A 3BPRA 5H2UA 3OT3A 2C4GA 3FC2A 3RAKA 3E92A 2QOCA 4GU6A 4H3BA 4DITA 4XV9A 4AX8A 3HA6A 2R4BA 5AP2A 3VUIA 5I5ZA 4JIAA 2FSMX 4HCTA 4RLKA 1WAKA 4K8AA 4KD1A 4W8DA 3V04A 3CD3A 1Q8YA 2B54A 5M4UA 4ZSAA 1T45A 5K0KA 5IG1A 4HCUA 2CNVA 3LW0A 5J5SA 5E91A 2XJ0A 2A2AA 4X2GA 4W4XA 4BL1A 4FSQA 5J1WA 2C6LA 2JKOA 5IQBA 4AGDA 4BDDA 2AEGA 2DWBA 3FKNA 2OJGA 2CN5A 3CKXA 3DKOA 4HVGA 2J0MB 5K0XA 2GQSA 3OUNB 2YDIA 3LCSA 1BX6A 3CY2A 3D5UA 4QYHA 3HEGA 3QBNA 4IACA 3BHUA 4DG3E 2J7TA 4AOJA 1REJA 5JQ5A 1SZMA 1UU8A 2WMAA 3TN8A 1YHVA 3RMFA 4AZEA 3R7IA 3DTCA 2JDVA 3DCVA 3DZQA 3AMBA 3F88A 5AMNA 3FEGA 2Q0BA 5DR9A 5F4NA 5IISA 3DS6A 4MQ1A 2C3KA 1MRYA 2VGOA 2Z2WA 3UZTA 1BI8A 3BE2A 3TNQB 4AP7A 2UW4A 2YCRA 4QT1A 4V0GB 5E8WA 4PL5A 4V0GA 3LQ3A 4IAYA 4UMPA 2XNOA 3R8ZA 2BRBA 3AMYA 3KVXA 3LFQA 3WF7A 2LAVA 5A9UA 1ERKA 1CMKE 3BBTB 3FV8A 1SVGA 3K5UA 4G3DA 4EK3A 1TQMA 3IKAA 4O21A 1K2PA 5AR8A 1UWHA 3QD3A 3GBZA 4FBXA 4ZEGA 5A14A 4FK6A 4QTCA 4C4GA 4GH2A 3KXXA 1OIUA 4J1RA 2NPQA 3NNVA 4DT8A 3FLSA 4UYAA 4E20A 5M51A 5GJGA 5HIBA 2QOKA 5E8VA 4BCPA 2UVYA 3O50A 3PYYA 4LV5A 1IAHA 3DJ6A 3HVCA 4XG9A 5HE1A 3CJGA 1ZYJA 4P5QA 3EFJA 5EI6A 1OUYA 4AUAA 3FQHA 5ETCA 4Q2AA 2C47A 5LCKA 4BDFA 4E93A 5LCJA 4FTCA 1CKJA 3LJ0A 3PA5A 3NFGB 4QMQA 4LI5A 1J3HA 4EOQA 1B6CB 4LRJA 4MTAA 3BZ3A 3L9NA 3RAIA 4TXCA 4BGGA 5KCVA 1LEZA 4FMQA 3R2BA 1O9UA 4QMSA 5DEWA 3QZHA 1J1BA 2X2LA 3U55A 2OG8A 3KVWA 3FMMA 2P4IA 3MPMA 4IVBA 4HPUE 4CXAA 4DGNA 2BAJA 4BZNA 3ACKA 3O8UA 3PE2A 2W0JA 1E1XA 3D7TA 5E1SA 5AR5A 1WBOA 3MH1A 2PUUA 2W1FA 4EBVA 4U80A 2UZTA 3OVVA 1J7LA 3O0GA 5AV2A 3I5ZA 1OL6A 1RQQA 2J0JA 2Z8CA 3OBGA 4KIPA 4LQMA 5T6KA 4L44A 4UALA 4J71A 4BCGA 3WZEA 4G6LA 1JNKA 1XH5A 4HYUA 3SV0A 5AV3A 4YMJA 1WVWA 1K9AA 3S1HA 2BKKA 1DAYA 4E5AX 4IX4A 1BL7A 2QU5A 4G5PA 4O0TA 4C3PA 4LOOA 4IH8A 4NJDA 2UW5A 2O3PA 2UW7A 4A06A 4DN5A 4ERWA 3FI8A 2HIWA 2R3MA 3ZO1A 3ZLYA 3Q60A 3R1QA 3NLBA 4ZOGA 1JKTA 3TNWA 4BVUA 4XJ0A 1RDQE 2RG6A 4EYJA 3LXPA 4QMMA 2JDTA 2Z7SA 4FK3A 4MKCA 3ELJA 2KULA 4BDJA 2YIWA 5BYZA 4F7LA 4HJOA 4O7VA 1BI7A 4IZ7A 2W05A 5CQUA 3V5PA 1M2QA 2VTIA 4M12A 2GTMA 2Y7JA 4FG9A 2QOIA 4F1TA 4FSZA 5C8KA 1M14A 3MPTA 4H3PA 3D4QA 4XCUA 4CCUA 1J7IA 4KS7A 3SC1A 3QX4A 4FNYA 3FMNA 4W9WA 3GC7A 3SXRA 2PZPA 3KRJA 3OBJA 3A7GA 5D10A 5EM6A 5GNKA 1I44A 5AAEA 2ACXA 2C6EA 5LMBA 3BLHA 4IBMA 4Y72A 4BICA 1XWSA 4OT6A 5CLPA 2I6LA 1IAJA 3SOCA 1YOMA 2AC3A 4E4MA 5CXZA 2WFYA 4PDOA 4FV6A 3GC0A 4HVSA 2VN9A 3JS2A 4G1WA 4EC9A 2WKMA 3ZO2A 2R3LA 3G0EA 4WUNA 1IEPA 2BR1A 2UVZA 4KWPA 4ZTLA 4QTEA 5KMKA 2UV2A 1OVEA 3NS9A 3WE4A 3DT1A 3BU6A 4IM2A 3ROYA 4QD6A 5I3OA 3SA0A 2JBPA 4A9SA 2WQBA 3DB6A 5CNOA 4QRCA 3WE8A 4BCMA 3QYWA 4RJ7A 4ZSGA 3RK9A 1OL2A 5LJJA 3ZHPC 5AP7A 2CMWA 2OF2A 3COHA 3KFAA 2X8IA 5CTPA 3LXKA 5CYIA 4ARKA 4DFBA 3IW7A 3BLRA 3HDNA 1GJOA 3I1AA 4I1ZA 4C59A 5FWKK 5HG7A 3UPXA 4C4IA 3QRKA 4AN9A 3TUCA 2BDFA 4HGTA 5JEBA 4TWNA 5A3XA 3PXYA 4R7HA 4NH1A 4QTDA 2EWAA 4Y83A 4CZTA 2BZKB 3DJ5A 3V8WA 4EK5A 4QDEA 2CKEA 4KA3A 3GU7A 4K33A 3EQIA 4PTGA 4AE9A 4IEBA 5EH0A 3A62A 1OKWA 2YABA 1FPUA 4EJ7A 2OJ9A 3MY1A 4IVCA 2ZV9A 3FLYA 2QHNA 2VWUA 3M2WA 4AZSA 1O6YA 2WMUA 4CNHA 5HLPA 3ZM9A 3ALNA 1XR1A 5JFSA 3D2IA 1SVHA 3DOGA 4Z16A 2ETKA 4XBUA 5AR3A 1KV1A 4U9AA 4P4CA 3QCYA 4RA5A 3F7WA 4CTCA 2GMXA 3IS5A 2F7ZE 4YJQA 3HMMA 3VS4A 2QOFA 3RKBA 3ANQA 4GYIA 1NT2A 2HOGA 3FWQA 5DNRA 2XS0A 3HMOA 2NRUA 4IX3A 4FV8A 2QU6A 5DR2A 3NIZA 4I6QA 5HIDA 2VTTA 4RIWA 5FP5A 4BBMA 4JNWA 4R78A 4CRLA 5GINE 4B99A 3QCSA 5KE0A 4OAUC 2WZJA 4L43A 4FEWA 4JIKA 2X8EA 4KINA 5GJFA 5EM7A 3OP5A 3ZXZA 2F7EE 5AUYA 4QPMA 4LRMA 3G15A 1VR2A 2PVJA 2YIRA 4XP2A 3OCGA 3DU8A 3UIBA 4FGRA 2E9NA 2XNBA 1XBCA 3DV3A 4AN2A 4NKSA 4AZVA 4WUAA 3OC1A 4IANA 4FTLA 5K3YA 3A4PA 4QMPA 4KABA 2PMIA 4EI4A 5JZNA 3GUBA 4ORKA 2WQMA 1WBTA 3H30A 3ZC6A 4AW5A 2R3GA 2UUEA 4EZ5A 2PVRA 2Q83A 3QQUA 3OG7A 4FV1A 3FSKA 4MBJA 4CTBA 3MBLA 5CI7A 5EW8A 1P5EA 2X0QA 3NYOA 3UMWA 3ZBXA 4A4OA 1W82A 4FA2A 5C27A 3TUBA 3K5VA 4S30A 3F5GA 3OCBA 2J5FA 4IDTA 5DA3A 1QPJA 2PVHA 2V0DA 2QQ7A 4R5SA 5EW3A 4APCA 1G8JA 3P1AA 3FYJX 4EH8A 3HV4A 3P79A 2GDOA 4KKEA 2CSNA 2C30A 4XUFA 3C51A 4CZUA 5JFVA 2G1TA 4FIGA 4FV0A 3LOKA 4MNEB 4HZSA 2Y0AA 3EMGA 3V5LA 4G5JA 4ANBA 4UMUA 3GFEA 2GS7A 5TOZA 5GZAA 1Q4LA 2OZAA 1OKVA 5IMXA 2BTRA 2QR8A 3GQIA 5FXRA 3DPKA 3I81A 1NW1A 3DNEA 4Y5HA 3R8UA 5AAGA 1UA2A 3DTWA 4ENXA 4Q9ZA 4TWOA 5LXMA 3LLAA 2O2UA 2OSCA 4FV3A 3CR0A 4ITHA 2XIRA 5A4CA 4C4FA 3MFTA 4LM5A 4BB4A 3DKFA 3V8SA 1YOJA 2XA4A 3OCTA 2X4FA 1A06A 3G33A 5EYKA 1R0EA 2WOUA 2R64A 4CMUA 4JBPA 3BHHA 2XYUA 3UO4A 3DBFA 4EKKA 4Z7GA 5CAUA 2CKPA 5M56A 2WGJA 5LMKA 4D1ZA 2ITWA 3L8PA 5IA2A 3UBDA 5IH6A 4RVKA 3VS2A 4WBBB 5EOLA 4YTHA 2GCDA 5HX6A 4FICA 2IPXA 3AQVA 2W1CA 3VULA 2XRWA 2ETRA 3PXQA 4GCJA 4JJRA 4QPAA 3F9NA 4PRJA 3V5QA 4AXEA 1L3RE 4BJJB 4ZXTA 3W0PA 2NNWB 2H34A 3FUPA 3TNIA 2X0OA 4C33A 1KE8A 3KN6A 3NPCA 3HDMA 1H24A 3VS0A 3CQWA 1JKLA 3RZFA 3TMOA 2OI4X 5M09A 1OGUA 3T9IA 5JMSA 4RSSA 3PTGA 4DG0E 3GCUA 2ITXA 4J8MA 5CSVA 3CS9A 3I0QA 5E8ZA 5HO8A 2GHMA 4IC7A 4PP7A 4EOSA 2ZMDA 4E5BA 1APME 1ZMVA 2CCHA 5BVNA 1KUTA 1OKYA 3H9RA 5JRSA 1SNXA 3MY5A 3L9PA 4D0XA 4AZFA 4LGDA 3ITZA 2OBJA 2PTKA 3RJCA 4UX9A 3DZOA 4FSTA 4LGHA 3BI6A 1A48A 2AYPA 3NNUA 3PY0A 4O38A 4FT3A 4FOBA 4XV3A 3CTHA 1TVOA 5JGDA 4D4RA 2YDKA 3MH3A 4UN0C 1UWJA 4KBCA 5HKMA 4O2PA 4OAVB 4U0IA 3FXXA 1NY3A 3ORTA 4JAJA 2GPHA 2GNGA 5HZNA 2Z7RA 3R7VA 1OMWA 4FKJA 4FTKA 4F9WA 3RWPA 2Z7LA 4FKLA 3F6XA 5CU2A 3F66A 2JFLA 4PF4A 3FPQA 5C4KA 4D9UA 1KOAA 4RJ8A 5KBQA 5BUEA 3QTXA 2R3HA 4W4WA 4F64A 3AC1A 4FG7A 3LQ8A 3MI9A 4I6LA 2QCSA 5CAQA 3KU2A 4N4SA 1K3AA 3SAYA 2W1DA 2XVDA 5CEKA 2WB8A 2FB8A 3EFKA 3PJ1A 3VHEA 4BCKA 5L2TA 1HCKA 1QCFA 2Z02A 3ORPA 3C0GA 3NEWA 3OMVA 4GL9A 4O91A 4QMVA 1VLRA 2XANA 2PL0A 4YBKA 5J7HA 3PIYA 2QC6A 4GW8A 4WNKA 3ATSA 4KUJA 3DKCA 4AXCA 3DAKA 4GV1A 3DNDA 4Z7HA 2ZB1A 1BUHA 2FUMA 3AMAA 4QTBA 4CRSA 1GIJA 1X8BA 3D94A 4D4YA 1XH4A 4L3PA 5L6PA 3OXIA 4OTWA 2XCKA 5AM6A 3QUPA 4B7TA 4CMTA 4FTNA 3IDPA 2GU8A 1V1KA 3EQDA 2IWIA 3H4JA 3SG9A 4I92A 1YI4A 2X0GA 3OHTA 3UJGA 3LFEA 4M7IA 4F0GA 1OPLA 1LR4A 5EFQA 4FSRA 4BDCA 4ZAUA 2WQNA 3GCSA 4ALWA 3G6GA 4FV5A 3NCZA 3R2YA 3QGWA 3NUPA 3TKHA 3VJNA 4MD9E 2PZ5A 2WXVA 4C8BA 2NO3A 3AD6A 2V22A 5EKNA 2OZOA 4MXZA 2R3IA 1ZOHA 2BVAA 4DEGA 3QQHA 4C36A 3HUBA 3OT8A 2DUVA 4GK4A 3GQLA 4I6HA 4PPBA 3B2TA 2UZVA 4L00A 4F63A 4CV8A 5HGIA 1XJDA 5HVYA 4BKJA 3UOKA 3FL5A 3RWQA 4EOLA 2VTPA 3QZFA 3POZA 1VYZA 4IAAA 3AD4A 5HG5A 3BWFA 2OFUA 3ROCA 2R7IA 4HZRA 2CNUA 4F9BA 4DEIA 2V7OA 1ZARA 3KC3A 4O7YA 2BDJA 4JG6A 3R9RA 2R3QA 2BRHA 2IZSA 3AT4A 3FBVA 4L3JA 4Q9SA 2C6IA 3CC6A 5A46A 2I0VA 4BTFA 2EXCX 4YLJA 1LP4A 4FVQA 4EHVA 5DOSA 3ORKA 3OY1A 4E8AA 3LHJA 3UDSA 3FLZA 3MFUA 3V5TA 1IG1A 3ZFXA 5IUIA 3VONA 1E1VA 4USDA 2XK9A 3KRRA 4C3RA 5K9IA 4H3QA 4W4YA 3HGKA 3BU3A 3ETAA 3GU8A 5AP3A 5EDQA 4AAYA 4MK0A 3EIDA 3EOCA 4GIHA 2WMXA 4IWQA 4K9YA 4W4VA 4F6UA 5CAVA 3SVVA 4XYFA 3DA6A 5IH5A 2BHHA 3QQJA 3FXWA 4CQGA 4DGLC 1OBDA 4IJ9A 3TJCA 4N0SA 4WD5A 3ZUTA 5LMAA 4E26A 4USFA 1JSUA 5KX8A 1P2AA 2FGIA 4P5ZA 4XHKB 3UODA 4XG6A 3VBXA 5IU2A 4ZMEA 3JY9A 4FEUA 3HV6A 4C58A 2C5OA 2YCSA 3CLYA 3PZHA 2QO2A 1S9JA 2JDOA 4YP8A 3R83A 5AX3A 3UVRA 4F7JA 5L2WA 3CE3A 3QC4A 5TT7A 4C37A 3LIJA 3PSBA 1LPUA 1PW2A 1GY3A 3AC8A 3MESA 3Q9WA 3UOLA 5LVOA 3LPBA 5ETAA 3PPZA 3R1NA 3PP1A 2XJ2A 5CNNA 3MWUA 4IWPA 3VS1A 2ZOQA 5H9BA 2HZ4A 4ACMA 4AW0A 3H0YA 2Y8OA 3FMEA 4D4VA 5I3RA 4J53A 2B9HA 4RQVA 1PF8A 3MA3A 2C3LA 4IWDA 2B1PA 2OXDA 4QP1A 3DFCB 3TIZA 3UIMA 5FUTA 3JVRA 3HMNA 3VF8A 4O0VA 5D41A 3PWYA 3LJ2A 4XG3A 4YJVA 4ASZA 4F9AA 5LQFA 4F0FA 4C3FA 3W0SA 3G0FA 3LFAA 4YJSA 3U54A 2XMYA 3HYHA 3IOPA 3G5DA 3LLTA 3CKWA 4H36A 4KKGA 3Q5ZA 4X3FB 4B4LA 4FIHA 4OUCA 4X3FA 4C34A 4CEGA 3D15A 4NJ3A 5IQEA 3UC4A 3MJ1A 4G2FA 4JDJA 2XCHA 4EH5A 4A07A 5IUGA 2E9OA 3FMLA 1AGWA 1BMKA 1PXMA 4D0WA 3BU5A 4FSYA 1PJKA 4S2ZA 2FSOX 3LCDA 5BMSA 4I21A 1H28A 4XP0A 4I0RA 2PE1A 4CFFA 1H25A 3C4ZA 2H96A 4AAAA 4E5WA 3AKLA 4CG8A 2RFSA 5L8KA 1W98A 3DFAA 2LGCA 4H05A 1IRKA 4FSMA 3C0IA 3BGZA 1XO2B 1U4DA 2C69A 3NGAA 3T9TA 2BRGA 5DIAA 5AWMA 4EORA 4JBOA 3EL8A 3VRZA 4BTMA 2ONLC 3TM0A 1OZ1A 4XLIA 2YM6A 3VUDA 4MYGA 2HW7A 1TFFA 4D2RA 3VQHA 2V5QA 4JQEA 1U46A 3MJ2A 5ANGA 4PMPA 1F5QA 2ITUA 4HOKA 4S34A 1H26A 4WG4A 4BKYA 5LVLA 4EKLA 3I7CA 3V5JA 3E93A 1Y8GA 1M17A 4RBLA 2CNQA 2QOHA 4I3ZA 4BN1A 4I0TA 4AFEA 3TKUA 3KXZA 5FTQA 4ANOA 4DEDA 4QMZA 5H8EA 2EXMA 3GU5A 4RIXA 3O8TA 4L52A 3VVHA 4FT0A 4J97A 5IZFA 3HP2A 5L3AA 3QC9A 4M14A 2GQRA 4KSQA 4FV2A 2UZOA 4FV4A 2CGWA 5CVHA 3ZRMA 3R21A 4NW5A 4FOCA 1Q5KA 2J4ZA 4I41A 4LDTA 3VO3A 4G6NA 4BCHA 1OPJA 3F7ZA 4WBOA 3TEIA 3A61A 4RX5A 4AFJA 3RM7A 2QOBA 5KUPA 3UO6A 4AOTA 4QQJA 3ZLXA 3W2RA 3MV5A 1XQZA 5FRIA 5HBHA 1B38A 2XNPA 2XKDA 5CWZA 3VS6A 2BZIB 3QCXA 4FZDB 3OUKA 3LCOA 4O0RA 3TT0A 2QOLA 4PMSA 3PZEA 1S9IA 3FSFA 5TF9A 3PWDA 3P0MA 4DCEA 4FIEA 1DS5A 5JK3A 3ERKA 3L8SA 4TY1A 3ZS5A 3FPMA 2VWIA 2W1GA 2ZVAA 1MP8A 4AT3A 2XNMA 3EH9A 3AC3A 2FYSA 4KNBA 5FDPA 4YHFA 4EWQA 1A9UA 5CANA 1YXUA 3MFRA 3NR9A 3TNPC 3QA8A 2IW9A 3L1SA 5C03A 3LCKA 4PNKA 4ANNA 3C1XA 5L6OA 2WIHA 3R01A 2CLXA 4XV1A 3RAHA 2OIDA 4CFVA 3W33A 1JSVA 3RCJA 3P5JC 5D11A 3EKKA 3CQEA 1DI8A 4AA0A 5DFPA 3IO7A 3OXZA 2XB7A 4LOPA 1E9HA 3RP9A 1WMKA 4YNOA 2OWBA 4X21A 4X2JA 5F94A 4DTKA 3FZSA 5IEXA 5EM8A 3P7CA 2VTSA 2VTQA 4JDHA 1P4OA 4RC3A 4BHNA 4EOJA 3OF0A 3ZSIA 3WF9A 2IVTA 2IF8A 3IW5A 4GVJA 4M69B 1P4FA 4ZY6A 3C5IA 2YLFA 1PMUA 3UE4A 4PDPA 4KIQA 4I4EA 4XH6A 3ZFMA 4FEVA 2Y4IB 2NP8A 1ZAOA 3FZTA 3L9LA 2FSLX 5BV3A 1FGIA 4CV9A 3IGOA 2OIQA 3THBA 3RPSA 4X2KA 2QHMA 2B4SB 4BI2A 3VUHA 4AQKA 1DI9A 4O83A 3V6RA 2C6KA 4JS8A 4I94A 5FQDC 4CKJA 2W7XA 3HV7A 3EQFA 4A7CA 2F2UA 1LUFA 3D83A 3R73A 2VTRA 3QTIA 3SLSA 3EL7A 4BCFA 1I09A 2C6TA 4I4FA 4XG7A 3GENA 2C3JA 3DK3A 1FVRA 5HCXA 3WOWA 1OM1A 3KY2A 3R8LA 4BCOA 3LAUA 4U5JA 2HY81 4YJUA 1KOBA 3MS9A 3VUKA 2YISA 3DBEA 2JBOA 4DHFA 3UPZA 2Z60A 5FDXA 5EQPA 1ZOEA 1QL6A 1XMLA 2F49A 5FEDA 1JKSA 3IOKA 3NW7A 5CF6A 1BKXA 2GNJA 3R8MA 4ID7A 5EI8A 3MTLA 3ULIA 2XALA 5BQ0A 4DBXA 3HECA 1YXVA 4PL4A 2XBAA 3OTUA 5I9UA 3R9NA 1IASA 4BHZA 5HCZA 1SYKA 2WAJA 4EL9A 4OTQA 3KEXA 4IXPA 5AR2A 4NM5A 4NFNA 2UZNA 1H1QA 4C2VA 2RKUA 3E64A 2JIIA 4XG4A 4DEEA 2XNEA 3QUDA 4M3QA 2QVSE 4I5CA 4TWCA 2XNGA 5HEZA 4TNBA 3CPCA 5JQ8A 3D7ZA 2C0IA 2B52A 3OWPA 4FTUA 2BRNA 1ZZ2A 3QUEA 5CXHA 4B8MA 3KRLA 5LMKC 5EDPA 2WQOA 3Q4TA 5HO7A 3F69A 4IZAA 3R28A 5T68A 2H6DA 1ZYSA 5DT4A 2O0UA 2B9JA 2R3JA 4W9XA 2OO8X 4MH7A 2ZDUA 5CEQA 4W8EA 3QZGA 4O7ZA 4PTEA 1WBPA 5B7VA 3KF7A 4E6AA 4OGRA 2AUHA 3LVPA 4USEA 3AKKA 4FEQA 4CZYB 1DAWA 4QMXA 3NUYA 1M7QA 4QP7A 2PUPA 3EN7A 3CY3A 4D1XA 5GIOE 3E8CA 2FSTX 4IVAA 1G5SA 3FC1X 4E6QA 3TIYA 4YTFA 3R7UA 5LVMA 4QPSA 4RWLA 5IA4A 4S31A 5ICPA 2W1ZA 5DRDA 5E1EA 4J99A 2IVUA 4BDHA 4CFNA 3U4WA 3OROA 4FV7A 3FY0A 4D1SA 4M84A 4A9RA 4BRXA 1HOWA 5K4JA 3C4FA 4KBAA 1STCE 3W8LA 2ZV2A 4BWKA 4BDKA 4FR4A 4L68A 3W0NA 3ZO3A 4Y46A 1J7UA 3SD0A 4O6LA 4K77A 3GCQA 3ORZA 2YZAA 2UW6A 3HL7A 2VUWA 3P7AA 4HVIA 4R77A 4RZVA 3RHKA 3E62A 1PXNA 4O4BB 1QMZA 3QCQA 3R9HA 4IX6A 4ITIA 3BL7A 4IQ6A 4MVFA 4UV0A 4YURA 2RGPA 2XK8A 4QMLA 4GG7A 1OIYA 4GFMA 2YIQA 3GT8A 4C7TA 4HNIA 2BROA 4QYEA 1YWVA 5F20A 3Q9ZA 4FIFA 1TQPA 3K2LA 3DLZA 3Q2MA 4ZZMA 3BYSA 5GZ9A 2PMNX 1UVRA 2FVDA 4C38A 5HLWA 1ATPE 1CDKA 2X2KA 4TZRA 4ZJIA 5BVDA 3PUPA 3MIYA 1ZWSA 5C01A 3NUXA 3UYTA 1UV5A 2VTHA 4MBLA 1M7NA 4RX7A 5CEOA 4CYJA 4EJNA 2AC5A 3O7LD 4N70A 4XS2A 2VTMA 5CX9A 4WNPA 1Q8WA 1XH6A 2OFVA 2XIZA 4DH7A 3ENHA 2HAKA 2GSFA 3C9WA 3KXMA 1SNUA 2X9FA 4H1JA 4RIOA 4M68A 3VW6A 4BCIA 4PNIA 4F1MA 1OBGA 2WTVA 3IPHA 4U7ZA 2F4JA 4YHTA 3QTUA 4ZIMA 3QD4A 4KIKB 4NU1A 4J96A 3EQHA 1R78A 1PXOA 4EQUA 2P0CA 2CLQA 3K54A 2ONLA 5CI6A 5FXSA 4E7WA 5ANDA 5CF8A 3DB8A 1ZRZA 2WTJA 2YM8A 4ACCA 3ZEWA 2IJMA 4NSTA 3V5WA 4ZJVA 3ET7A 3KK8A 5G1XA 4FNWA 2RSVA 2WMRA 1RW8A 1H1SA 3Q6UA 4NW6A 3NW6A 4FNZA 4YSJA 1U5RA 3O71A 4PQNA 5E90A 4HVHA 3UQFA 4IM0A 4TYIA 4GKHA 1SMHA 3BRBA 2XKCA 2PE2A 4EK6A 4XV2A 1XBAA 2FH9A 1GIHA 4U45A 3NVKI 3ID6C 4RZWA 5HO6A 5BYYA 4BBEA 4NKAA 4X6QC 3CGFA 3MB6A 4LL0A 3FHRA 3A4OX 2A1AB 4PV0A 3M1SA 1ZYDA 4UXLA 4C61A 3VC4A 4O1OA 4D2TA 4O84A 3AGLA 3VNTA 3H10A 2OJFE 5EG3A 4TYEA 4X7QA 3WBLA 3HV3A 4X3JA 4FZFB 3A7JA 4QP2A 3ZSHA 2ZDTA 4BGQA 2GNLA 3NZ0A 4TPTA 2YLEA 3C4WA 5AP5A 5B2MA 4GMYA 4F7NA 4QQTA 4GVAA 4PPCA 1XMMA 5LWMA 2BCJA 2X6EA 2ZJWA 3UDZA 1BLXA 2UZUE 1PKGA 2WQEA 3ALOA 3MTFA 3RBWA 4ONAA 3FI3A 5ANIA 4X6RA 3FLNC 4DEBA 3RPVA 4QP8A 2QOOA 4AXAA 3ZU7A 4AW1A 2W5BA 3R6XA 1H1PA 1M52A 4JR3A 3TNHA 4AOIA 4E1ZA 3ZZWA 4C02A 2BRMA 4ZLYA 5AIRA 4CGAA 5HTCA 4QMTA 3DGKA 2E2BA 1MQ4A 4JT3A 2XUUA 4ZJJA 5AAFA 4YJOA 3DY7A 4CFUA 1H1WA 5M4IA 3I7BA 3B8RA 3ZRLA 5ANEA 2X7OA 3PJ2A 2VNYA 4M0YA 4QP9A 5KO1A 5CALA 4PDSA 1Y6BA 2JIUA 3NSZA 4RIYB 3ODYX 4LFIA 3TV4A 4BIBA 4C4EA 3E5AA 3RGFA 3DBQA 3ZLSA 3QTRA 5EHLA 3RK7A 2X4ZA 3PLAE 5AA8A 4DFXE 4YJPA 5DR6A 4D9TA 5FD2A 4YC3A 5CQWA 2GQGA 2F2CB 4YZBA 3KGAA 2V62A 3GP0A 2CKOA 3TZ8A 1MUOA 2UZEA 2UZDA 3JR1A 2EU9A 2B53A 4YPDA 2ZFYA 3MSSA 3C4XA 1YXSA 2RL5A 4JI9A 3MFSA 2WTKB 4R1YA 3PXRA 1Q8UA 2P55A 3KQ7A 2PVKA 2YCQA 4ZP5A 5EYMA 3KIOC 2RFDA 4F08A 4K0YA 2YIYA 4DFUA 4UMRA 4U3ZA 4BR3A 4FL2A 3UGCA 2PE0A 2UVXA 4YZ9A 5KHWA 2UW8A 4NL0A 1H4LA 4ZTMA 3NNXA 2VGPA 2PHKA 5EW9A 4O27B 2R0IA 4LOQA 3TKIA 3OW4A 4MNEA 5BYLA 4JOAA 4EHZA 3QWJA 4TYHB 1ZXEA 4DFLA 4ZZNA 3S0OA 2VX0A 1PYEA 3PVUA 1W2FA 2BAKA 4MD7E 4CYIA 2BFYA 1BYGA 4QOXA 4NM3A 4TRLA 5CT0A 4DT9A 1Y8YA 4QDVA 3G9LX 2CHLA 3E63A 3UOHA 4X3FC 1H1RA 1OKZA 4DHIB 5E92A 5M44A 3LFCA 4FSUA 5DGZA 5EKOA 3QX2A 2EUFB 5AUVA 3SRVB 3FLWA 3COMA 2E9UA 3V51A 2CGXA 4JRNA 2W4JA 5AEPA 2ETMA 4IHPA 4GJ2A 3EJ1A 4GSBA 3HP5A 3KMWA 3HUCA 3UVPA 2ITYA 3G9NA 2YWVA 4EOKA 4QNAA