3LCDA

Inhibitor bound to a dfg-in structure of the kinase domain of csf-1r
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
297
structure length
290
Chain Sequence
GNSYTFIDPTQLPYNEKWEFPRNNLQFGKTLGAGAFGKVVEATAFGLGKEDAVLKVAVKMLKSTAHADEKEALMSELKIMSHLGQHENIVNLLGACTHGGPVLVITEYCCYGDLLNFLRRKAEADLDPLELRDLLHFSSQVAQGMAFLASKNCIHRDVAARNVLLTNGHVAKIGDFGLARDIMSNYIVKGNARLPVKWMAPESIFDCVYTVQSDVWSYGILLWEIFSLGLNPYPGILVNSKFYKLVKDGYQMAQPAFAPKNIYSIMQACWALEPTHRPTFQQICSFLQEQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords Macrophage colony-stimulating factor 1 receptor
publication title Structure-based drug design enables conversion of a DFG-in binding CSF-1R kinase inhibitor to a DFG-out binding mode
pubmed doi rcsb
source organism Homo sapiens
total genus 93
structure length 290
sequence length 297
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2010-01-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3lcdA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3lcdA01
5D10A 5FBNC 2WIHA 2XK4A 3GOKA 4FL2A 4PTEA 1XH4A 5JQ8A 4GU6A 3U51A 4QPSA 3F5XA 2Z60A 5IA0A 5LVPA 3Q2JA 4D2WA 3MH1A 2Y0AA 4I5CA 4N6YA 4QP7A 3ZBXA 4YLJA 2WQEA 2C69A 3G90X 4WG3A 4DGGA 3D14A 5J79A 2XM8A 5DLSA 5HTBA 1IAJA 5IA3A 3WARA 2WMUA 2CKQA 3PSCA 3RWQA 3ZLWA 1APME 1QMZA 4AOTA 3OCGA 1A06A 5I9UA 4DCAA 3GFWA 5J87A 3KRWA 3NWWA 4Y85A 4C4JA 2PHKA 1O6YA 4HPUE 4DHFA 2WFYA 3OBGA 3R1NA 1EH4A 2OJ9A 2BKZA 3F5GA 3WIGA 4L00A 3FL4A 5AUXA 3PG3A 2XM9A 4G6LA 3UIBA 5HO8A 1QPEA 3D7TA 5C9CA 4IXPA 2CGXA 4BGGA 2ZV2A 3OUKA 4FNWA 2ZOQA 5J5TA 1VYZA 4CFFA 3D5XA 4JNWA 5J7BA 1S9JA 3SOCA 4BB4A 3QCQA 3VW6A 4P7EA 2CGUA 5HHWA 5C01A 3ZEPA 4FR4A 2ITVA 4IB5A 4FTOA 1UVRA 2BMCA 4GMYA 3DKCA 3FPQA 5EHOA 4BBFA 4EOOA 3DAKA 2R3IA 3P7CA 5KMOA 3RNYA 3HUCA 4F7JA 4A9SA 4ZTNA 4UMRA 3EKKA 1NVRA 1W98A 4XJ0A 4OAVB 1JKKA 1H07A 1Q62A 1K9AA 3FI3A 4YBKA 3UO4A 4P90A 1GAGA 2QQ7A 2O5KA 4FL1A 1WBVA 3KY2A 2XIKA 2QOQA 4MF0A 3IW4A 3SVVA 1M2QA 3KRXA 4NFMA 4O6EA 2J0JA 2QC6A 3Q9XA 2XZSA 3BV3A 3E8NA 2XMYA 3A7FA 3VUIA 2HAKA 5EYDA 4A9YA 4Z7GA 2ONLA 4EH9A 1CKIA 3FZOA 3HMPA 1J7LA 1H28A 5H9BA 2NRYA 2VWXA 2OH0E 3PPJA 5IH4A 3W2RA 3SG8A 4D28A 4KNBA 3GQIA 3VAPA 1J7IA 1YOJA 3VS1A 4G3FA 4BDAA 4IZ5A 4C4IA 5KMIA 4MXZA 4EUTA 5M4FA 4ZJJA 4F7SA 4YO4A 1SM2A 3A7GA 1R0PA 3MDYA 4NJDA 5FEEA 3V5LA 3Q9ZA 3MA3A 5J1WA 3JVSA 4EC9A 4FEWA 3UOLA 5E7RA 3UTOA 3VS3A 1M7NA 2C6IA 2IWIA 4YSMA 3E7VA 3NYXA 4D2SA 1GZNA 2PVJA 5E8ZA 2ONLC 3UE4A 4AXAA 2C30A 2YM3A 4HJOA 2X0GA 4K1BA 3QX2A 4I23A 3CLYA 4ASEA 4CT2A 3DT1A 3PVBA 2JLDA 3JYAA 4GU9A 3QTRA 4O96A 3TJCA 3VS0A 5LVMA 5M07A 4XLIA 4OAUC 4H1MA 4KUJA 2HZIA 4O0RA 3C13A 1REJA 3FXWA 3AD5A 4ARKA 3U9CA 3IW7A 4UV0A 3ZOSA 1OGUA 4FIIA 5T3QA 3DBDA 4J71A 5C27A 2J50A 3DNEA 3R2BA 4ITJA 2P33A 4IB0A 4QYYA 4C3RA 5KBQA 2EB2A 5AV0A 3ALOA 3IS5A 4Z9LA 4CRSA 3NIEA 4DFNA 2YZLA 2V62A 2VTAA 3GENA 2BTSA 2P55A 4HGTA 4I21A 4JDIA 4LL0A 4RFYA 5CSWA 2YIWA 5EYKA 5I9YA 1Q4LA 4O81A 2C5NA 4ORKA 1OIRA 4L01A 4O2PA 1DI8A 4LYNA 4MQ1A 3PVUA 5AP3A 4ITHA 1VEBA 4EK6A 2W1FA 4DLJA 2REIA 2V55A 2EB3A 3GU4A 3DOGA 4C36A 5L4QA 4I3ZA 3L8VA 5DG5A 5EW9A 1OECA 4IHPA 2RSVA 3I7CA 2UZBA 3ZH8A 1Q61A 3FI4A 3CJGA 3NUPA 4JR3A 1CDKA 4QP8A 1G8AA 5HVJA 3R8LA 3RWPA 3AC8A 3CCNA 4MKCA 4RJ7A 2BHHA 3EQBA 4NTSA 3QTWA 4PNIA 4ASZA 4HVDA 1XO2B 4WT6A 1B38A 2BRHA 5HNGA 3TV6A 4ASDA 5LJJA 1OKWA 3ZFXA 3COKA 4B4LA 4D2PA 4JRNA 5CVGA 2UVZA 1PJKA 2CJMA 2ZB1A 3SD0A 5C26A 4FKOA 2CLXA 3REPA 2RG6A 3FMDA 3BU5A 4U7ZA 1KSWA 2WMVA 4O7NA 2H34A 4BWKA 5L6OA 3QL8A 3R7YA 4BHZA 4WRSA 3A8WA 3NRMA 1Q8ZA 3V6RA 3AQVA 4QPMA 3RJCA 3DTCA 2UZDA 4FSWA 3GBZA 4NM3A 4NZWB 2QU6A 2ETRA 5K5NA 1G8SA 4KKEA 4Q5EA 2YWVA 4RIOA 1I44A 5IDNA 4S34A 2OFUA 3FSFA 2F9GA 4Z3VA 4ZZOA 2QG5A 3DLZA 3KMMA 4N70A 3DXPA 4MF1A 4GW8A 4BIDA 2SRCA 2R3JA 4LUEA 3H9RA 2UW5A 2BDFA 4MNFA 3UNZA 3H4JA 4YU2A 5G1XA 3TUDA 4P5ZA 5H8GA 4C61A 3NMUF 3TKHA 2GNGA 3RCDA 1M52A 4DYMA 3G51A 2X9FA 3M2WA 4RT7A 2WXVA 3ITZA 4DEIA 4K18A 5EM8A 2CCIA 5K0XA 4C37A 5C8NA 5DNRA 3CE3A 4E5BA 3C5UA 2CN8A 2OK1A 2WMBA 3LMIA 3W2PA 4IAAA 5EDRA 3VUTA 4BCKA 4DGLC 2VGPA 2YN8A 2PVMA 4FSNA 3A7IA 2YIXA 2X6EA 5BVWA 3KRLA 3CY3A 3S4QA 4ASXA 4YUQA 3VBXA 4M13A 1JQHA 4G2FA 3ROCA 4CZUA 3D5UA 4F64A 2VNWA 4O0VA 4XG8A 4BDGA 5LMAA 3VUGA 5DEYA 4OT5A 1J1BA 4OTRA 4WIHA 4BY9E 4FV0A 4TXCA 1TKIA 4U3YA 3LJ0A 4TKSA 4WO5A 4CV9A 3TI1A 3EOCA 1E9HA 4KBAA 4YPDA 3PE1A 5AP1A 4TT7A 3SAYA 2NNWB 4WBBB 3V8WA 3SGCA 3SQQA 5EM7A 4ANBA 1QPJA 3Q2MA 2OIQA 1JKLA 3ZYAA 4A9RA 4OTFA 2CDZA 2P2IA 3HGKA 2I40A 4AGDA 3WE8A 5A4TA 3KRRA 4YMJA 5C8MA 5FTQA 4ACDA 1ZRZA 2JAVA 2UW8A 2VWUA 4GJ2A 2VTRA 4FX3A 4JR7A 4UXLA 3NUAA 5HI2A 4BFMA 3AC5A 3QQLA 2WTKC 1PF8A 2XNMA 3QD3A 1URWA 1TQIA 3KVXA 3OXZA 4J98A 5F9EA 3ZO2A 3UOHA 5B2KA 4G3DA 4YJUA 4FTNA 4FV3A 5ANOA 4ERKA 4JJRA 1IEPA 1Q5KA 3PSDA 1YHVA 4ZIMA 4C7TA 4H58A 5I4NA 3TTIA 4AACA 4RVMA 3AMAA 3HLLA 3K3IA 2A4LA 3OCBA 3VQUA 4IACA 5GINE 3CPCA 4O27B 3L8XA 4F4PA 4HGSA 2V0DA 3FC1X 1YWVA 1IR3A 4RQKA 5E8YA 3P0MA 3UMXA 5TT7A 3VUDA 4EH6A 2C5OA 5E91A 2QKWB 2UZWE 3A4OX 4L45A 3IG7A 5CWZA 4IC7A 1YWNA 4HVIA 1J3HA 3LCTA 4LOQA 1E1XA 4FT0A 3K54A 2C6OA 2GHMA 5AAFA 2PVHA 3QLFA 4C35A 1FMKA 4FODA 3QQUA 4KKGA 5EM5A 4EL9A 4O7YA 3QKLA 5BX0A 3LMGA 2QOFA 4E7WA 4HZSA 1H1QA 4F0IA 4XG7A 4DG2E 3AGLA 5CSVA 4GYIA 5BPYA 3TNPC 1JBPE 1JVPP 4WG4A 3TZ9A 4ZZNA 3POZA 4ZS4A 4ZLYA 2GHGA 1PHKA 3KF7A 4XP2A 5IEXA 5EHYA 3F66A 3ZXTA 4F7NA 3R30A 4ZTHA 3NW7A 4CMUA 2PK9A 4XEYA 3RPSA 5EYCA 3ANQA 4O0WA 2WMQA 3F3ZA 5HTIA 3UPZA 3IW5A 2IVSA 3N51A 3QD2B 3C9WA 4W9XA 5FG8A 3RPVA 5E9EA 4D4RA 3ZSHA 2HY0A 3MH2A 3H3CA 4BZOA 4RIWB 2ZDTA 2C3JA 3GVUA 5GIOE 3HUBA 4HYSA 4EOMA 5CXHA 5BVNA 3COIA 4NM0A 3ORIA 4NW5A 3I0OA 3NUYA 1H01A 4ZXTA 3DKGA 3V8TA 1SVGA 3O8UA 4S33A 1O6LA 5HX8A 3IDBA 4JQ7A 5G6VA 5AV4A 1LP4A 5CI7A 3UO5A 5J9ZA 3O17A 2ITXA 3NIZA 4EOLA 4C58A 2XNNA 2PZPA 3CTHA 2UZOA 2LGCA 3EHAA 3QKKA 4WUNA 4BHNA 5KCVA 3S1HA 1LUFA 5CU4A 3VRZA 2X7GA 3F3UA 5F1ZA 3DBCA 2JIUA 3BQCA 5H3QA 3TT0A 4A9TA 4C34A 4QMZA 3GI3A 5CU0A 3VF8A 4DEEA 1KWPA 3PJ2A 3VW8A 4EQCA 4AFEA 4ZSAA 5AAGA 3QRKA 2HWPA 5CF5A 1WBOA 5M44A 3WI6A 3ORTA 2XEYA 3GU8A 4HVSA 4FTQA 3RPYA 3ACJA 3TUCA 3I6UA 4NU1A 1Q99A 3AT4A 1TQPA 3Q32A 3TXOA 2JDSA 2GNFA 4QD6A 5DOSA 5IU2A 3MFRA 4FV9A 4XMOA 3TIZA 4E26A 2PULA 4O7RA 3RM7A 3OWLA 3VVHA 4N6ZA 2GS6A 3NSZA 2PUIA 5AADA 3ZLSA 3QBNA 1PW2A 5AUVA 2J7TA 3DBFA 3MS9A 4YC6A 4RLKA 2PZIA 3R00A 2VGOA 3NS9A 3Q6WA 4ZTSA 3IPHA 5HZNA 3CTJA 5DR6A 4F7LA 3UOKA 3OWPA 3VN9A 4ACMA 5JGAA 5L2WA 1OPJA 3D7ZA 2YEXA 2OICA 1KE8A 3QFVA 5KE0A 3NGAA 2VRXA 2FB8A 3HNGA 5CF8A 3TTJA 5BNJA 4B6LA 2YA9A 1ZWSA 4I6HA 4IAZA 2CNUA 5FLFA 4O7LA 3EL8A 4UB7A 3CQUA 4AUAA 1SNUA 1OKVA 1PXIA 2C1AA 3EN9A 3PY3A 5BUEA 2FUMA 2O65A 1FVVA 3JY0A 5AJQA 2PVYA 1IASA 4FTUA 2YM6A 2X8DA 5HLPA 4JG6A 2OJJA 3QTIA 2YAKA 1L3RE 2X1NA 3NX8A 4LRMA 5JEBA 1BI7A 3SA0A 2B0QA 2F7ZE 2E9UA 4KRDA 4E6CA 4GUEA 1UWHA 2OO8X 4MNEA 4DTKA 4KS8A 3PLAE 2C6LA 3ZRMA 3OG7A 2JBPA 3AMBA 1OL5A 5JFXA 3CKWA 1OL2A 2UVYA 2FSMX 2FA2A 2W17A 1W83A 4RWJA 1GIJA 4E20A 1OL1A 3WBLA 4EH7A 3EKNA 4TWOA 4K33A 2HOGA 4UZDA 4AZWA 2IZRA 5J8IA 3BV2A 2HZNA 2J6MA 4GJ3A 3FYKX 3HX4A 4M0YA 2J51A 5LMKA 2Z8CA 4U81A 4XV3A 4P5QA 2WMAA 1OPKA 2VWWA 3F9NA 1P4FA 4FKUA 4IAFA 4H39A 3N4UA 4DF3A 5DI1A 4DTAA 1UU8A 5IQBA 2I0EA 2OZAA 1ZMVA 4O7VA 3CS9A 2HXLA 4M69A 1PYEA 3JY9A 3ZO1A 1PXOA 3OWJA 4RX7A 5EDPA 2Y4IB 3NLBA 1PKDA 2NPQA 4ZLOA 3MA6A 1NW1A 2WIPA 4OTQA 4FEVA 5CZHA 2RKUA 4FSZA 4PPCA 4AOJA 4C4HA 4QYGA 2ITQA 4U40A 4ANMA 4ZY6A 3EJ1A 5JQ5A 2O3PA 3KXNA 1MQ4A 4IWOA 4D2RA 3KULB 3RAKA 3DQWA 2ACXA 4Q5HA 3W2QA 4CKIA 1OPLA 3MJ2A 5CNNA 1W8CA 2WTDA 4PWNA 5LMKC 3BYOA 3PDTA 4USFA 5JN2A 4AT5A 4RLLA 3R7EA 3PY1A 4PDYA 3FXXA 4LV8A 4F9WA 5LARA 2ETMA 4IAKA 1QPDA 3GCVA 4FKIA 2VTNA 2F4JA 2X9EA 3CKXA 1XH6A 2WQMA 4R7IA 2CGWA 2X81A 4TTHB 5CAVA 5LMBA 4ALVA 3GB2A 3HMMA 4FMQA 3I0QA 1ZOHA 4ZTRA 3EYHA 3CR0A 3GXLA 4QMNA 5LQFA 2W99B 3EFKA 4RZWA 5HLWA 4R77A 3O96A 3DDPA 1UA2A 5D11A 4EK5A 2PY3A 1T45A 2WU7A 4FTMA 3KRJA 2QR8A 4N0SA 1GIIA 1OIYA 2EVAA 5BYZA 3OP5A 1F0QA 2EUFB 2BZJA 3KC3A 4BTKA 3RHKA 1XH9A 2IVUA 2WMTA 4HW7A 3LFEA 4PUZA 3Q9WA 3RCJA 1XR1A 3SOAA 4BDCA 4J7BA 2XS0A 3BYSA 2BIYA 2GNJA 2PE1A 4FVPA 5M08A 3EYGA 5AM7A 3F2NA 4D4SA 4PTCA 1ZXEA 5AUTA 1PKGA 1R78A 2I6LA 3FZPA 4EYJA 5BUJA 2WGJA 3AC4A 5C4KA 4GVAA 3D2IA 3FUPA 2XKEA 2R3HA 3LFSA 2XNBA 3Q3BA 5AP7A 3KKVA 5AP0A 1WFCA 5TR6A 3EMGA 3A7JA 2JDVA 2W06A 2QOCA 3H30A 4O1OA 4RBLA 1ZZ2A 3R7VA 5FGKA 3WF7A 3WIKA 3ZMMA 1Q3DA 4CNHA 3BU3A 4ANOA 5A4EA 2GQSA 4BCOA 4EKLA 2WQNA 3LZBA 1PYXA 4JVGA 4FKQA 4OW8A 4YSJA 4CG9A 3FMNA 1Y8GA 1PMEA 2C3KA 5CZIA 3U54A 4I0SA 2FVDA 4I94A 3UVPA 4YJRA 3TUBA 4NIFB 3WE4A 1URCA 5KHWA 5H8BA 5HU3A 2UW6A 2C1BA 3TCPA 4BZDA 2EWAA 5A9UA 5HO6A 4I6QA 2UW0A 3FZ1A 4QTCA 3KA0A 5FEDA 4ERWA 1YRPA 4YNEA 4G6NA 2JITA 3QKMA 2JKQA 2GQRA 3BIZA 3TKIA 5CEKA 3ET7A 3I4BA 3PWDA 5CQWA 3UQGA 3BHUA 3W1FA 3MH3A 4UX9A 3UOJA 3OCTA 3QGYA 3BI6A 4APCA 5AUUA 3OY3A 3PXZA 5J9YA 3PYYA 1SZMA 3C4CA 5LWMA 5DT0A 4FK6A 1YDRE 2C6KA 1FMOE 2XBJA 2QURA 4X21A 4AN3A 1NVQA 4ZJVA 3SV0A 3QZGA 1A9UA 4IWPA 4GRBA 3P86A 4X0MA 5D9HA 3ZC6A 2Y4PA 4U42A 5CQUA 4D2TA 5HE1A 2JBOA 2XKDA 5DR2A 4S31A 4GV1A 4IX6A 2B9IA 3TV4A 3DXQA 5ACKA 4I24A 3W16A 3W2SA 2IW6A 3OT8A 3HRBA 5IUHA 3D94A 3BYUA 4Z16A 4QMLA 5AIKA 2Q0NA 3M42A 1YDSE 3PXFA 4O21A 4U0IA 3P79A 4YHTA 5AWMA 2O0UA 3FMLA 4DGNA 4EOJA 5FXRA 4JG8A 4ZTMA 2C3IB 3D4QA 3OW4A 4RA4A 3U4WA 5AEPA 2R4BA 5GHVA 2Y6OA 2CNQA 3DNDA 1H00A 4MXXA 4FV5A 4E5WA 3PRFA 3N9XA 4A4XA 3R01A 4BDEA 4CZYB 2ITNA 3QQJA 3AGMA 1BYGA 2W1IA 5K4JA 2QLQA 5M09A 1ZY5A 4J99A 1H27A 3W8LA 4BDJA 3KN5A 3FLNC 4RVTA 5D41A 4RGJA 4C2WA 4JS8A 2ZV9A 4IZ7A 1H4LA 4DT9A 5M57A 3RAIA 3DZOA 4QP1A 2XJ2A 4MEDA 2F7XE 3C7QA 3OC1A 3R1YA 3LJ2A 4FZAB 1Y8YA 4IB1A 4I4FA 4XHKB 4UMUA 4MXAA 2R3QA 1Q8TA 3OMVA 2VZ6A 5B2LA 4M8TA 4IWQA 4FE2A 5AP4A 1H26A 2WTVA 4BCNA 3RZBA 1OKZA 2ZM1A 3CD8A 3GU5A 5IDPA 4LOPA 4EK3A 4E4XA 4CQGA 1R0EA 4O2ZA 3TWJA 3NAYA 3LOKA 5LCJA 5EW3A 3TNWA 4QMOA 5LVNA 4FZ6A 3AD6A 3FMKA 2J5EA 4DN5A 2XNPA 3MFSA 4GT5A 2B54A 1OVEA 3BPRA 3UG2A 3HRFA 3OT3A 3V51A 2NO3A 2PZ5A 5IUIA 3QGWA 5A4QA 2QOLA 3D5VA 3GCQA 4MBIA 3NCGA 3UP2A 5LWNA 1XJDA 4LL5A 4O7ZA 1BMKA 3WZUA 4ITIA 3UVRA 1P5EA 3PXQA 3S95A 4D55A 4FTAA 4JBQA 2UZUE 4OLIA 5D12A 5HE0A 4IM2A 3O71A 5KMKA 4L3JA 3RMFA 4CMOA 4F0FA 3AOXA 4HNIA 3CSVA 4FICA 4FV7A 4F1MA 1I09A 1FVRA 3V5QA 3MH0A 4QYHA 2XIRA 4YZCA 4BCHA 4BKZA 2R2PA 2JD5A 5CEPA 1UKHA 1YXSA 2YDIA 3F3TA 2QO2A 2I0HA 2VWYA 4AW0A 3BEGA 3P78A 4FGRA 3NVKI 4YTFA 5AP2A 1ZYLA 2GNLA 4LUDA 4QQJA 3ZS5A 2IPXA 4GH2A 3Q5ZA 4OTPA 3V5TA 5F95A 5IA1A 2FSLX 2R3PA 5HIDA 5J7HA 4L8MA 3NUUA 4JOAA 4B8LA 5BYLA 4G9RA 3MN3A 4ZTLA 3SX9A 5DE2A 3R8UA 1CSNA 4AA5A 3QZHA 3PSBA 4E3CA 4DH1A 4ZMEA 4UALA 3UNJA 2W5HA 3IECA 3RTPA 5BUIA 4B99A 3VUMA 4BDBA 3R1SA 1W84A 4TYGA 1WBSA 4EK8A 3BE9A 3O0GA 3PRIA 5JT2A 4PDPA 5DWRA 5EFQA 5LCKA 5FD2A 5FBOA 1IG1A 3DFCB 4RX5A 1J91A 3BLRA 4B8MA 4EHZA 1GY3A 3VJNA 3VBTA 4QP2A 4EQMA 3FKNA 2EXEA 5FRIA 3GEQA 3OVVA 4D1XA 3W2CA 5A54A 2XK3A 4OTGA 1U54A 3FBVA 2YM5A 3OCSA 1MQBA 4FKPA 4JQ8A 4XRJA 2BZKB 4NM7A 3L9PA 4DBNA 5KMNA 1SNXA 4G3EA 4FIGA 4ZOGA 3BBTB 4EC8A 3KFAA 4AOIA 4CQEA 2OJFE 2GS2A 3PVWA 3I1AA 3QCXA 3AG9A 4C62A 1BKXA 5ANEA 4RIXB 3VC4A 3DS6A 3FLZA 3W33A 4KB8A 4CFMA 2GTNA 3ENMA 3JR1A 5IEYA 3ULIA 1KOAA 3QA0A 3VWAA 5HVYA 3BBWA 2JC6A 2XK6A 3OEZA 2VO0A 4CCUA 4CFVA 3FMEA 3DB8A 3GC0A 3PZEA 2J4ZA 5ANDA 5J5SA 3UZTA 4YPSA 3DTWA 5A6NA 1UKIA 2R3GA 3FMMA 4OGRA 4PDOA 3ZFYA 4F6SA 1MP8A 5HO7A 1JPAA 5AFVA 2JDRA 4O0XA 2PTKA 5KKRB 3ZFMA 2QODA 3BGQA 3Q4TA 3OY1A 5H2UA 3QRIA 4DFLA 2PU8A 2ZAZA 2BRNA 4P4CA 4EWHA 1Q41A 1KOBA 3QC4A 4KIKA 5F20A 4RMZA 4FKSA 4ZZMA 5M4CA 4JX3A 5EW8A 1XHAA 4IFGA 3ZDIA 2C0TA 1AD5A 3ZEWA 2I7QA 1B39A 4EJ7A 3KL8A 3GC7A 2DQ7X 4ZEGA 3S0OA 3Q96A 2C3LA 4UBAA 3KK9A 3UBDA 4B7TA 4W8EA 4FTRA 2OH4A 2OXDA 4RIYA 4FKWA 4YC8A 3FZRA 4C38A 3DY7A 3VHEA 4R5SA 5M53A 4V0GB 2XIXA 4KAOA 3S3IA 3PA4A 3M1SA 4IAYA 2AC5A 2PL0A 3EZVA 1XQZA 4NM5A 4BTMA 2I1MA 3RBWA 2ZMCA 2ZV8A 1GOLA 1ZLTA 3GCSA 3NUNA 4FI1A 5D7VA 5ITAA 2RL5A 4ALUA 3BHHA 3MSSA 4PNKA 4C57A 4DE4A 3U8WA 3LXNA 4XNEA 3KQ7A 4BGHA 2PMIA 3ERKA 3FPMA 4FT7A 3EIDA 3R28A 5ANGA 2B53A 2OIDA 2GFCA 2PE0A 3KXZA 4NEUA 4XX9A 4QTEA 4TYHB 4JDJA 2XK8A 1PXPA 4FGBA 4RJ8A 4D0WA 2VTQA 5CS6A 2YCSA 3VNTA 3I7BA 2OI4X 5HG8A 2OF4A 5EQEA 4OTWA 1YXTA 2R5TA 5AM6A 1GZOA 5HBHA 4MBLA 5FQDC 2GPHA 4WSYA 4FTCA 2VNYA 3BX5A 4UWCA 2XBAA 1Y6BA 3PXRA 2I0VA 2J5FA 3V3VA 3COMA 4BDDA 4O84A 4HZRA 1DAYA 5I0BA 5GIPE 2OXXA 2VTSA 3UC4A 4DLIA 2ITWA 5BMSA 4XBRA 3QRJA 5I9WA 1H1PA 2ESMA 2YLEA 2B9FA 5DGZA 4YP8A 3DU8A 3QHRA 2R7IA 4KBKA 3ZSIA 4EYMA 3NAXA 1JLUE 2BRMA 2YIRA 3C4EA 3P08A 2G01A 4WBOA 5GJDA 3MBLA 4QT1A 1MRUA 1RQQA 3DJ7A 4EORA 3R2YA 5AR2A 2CKPA 4AGWA 2HENA 3VBYA 3S2PA 1VJYA 4XH6A 5BVEA 3PLSA 5BVKA 2WD1A 3FWQA 2IZTA 2RFDA 4JX7A 1YVJA 4JL9A 4AT3A 2WMSA 4YJVA 4F1TA 3CY2A 2ERKA 3E63A 2B9HA 2PSQA 3P5KA 3EFJA 4AGUA 4X3FB 3VHKA 4OT6A 2GNIA 2HW7A 4J52A 3NYVA 4PY1A 3TN8A 4GL9A 1YOMA 3RHXA 2JEDA 4F9AA 4CRLA 4IC8A 4MD9E 2W1GA 2QOOA 4OR5A 3R8ZA 1RDQE 3TDVA 1OUYA 4MK0A 2Q83A 2VX1A 2WTWA 4IZAA 2BR1A 5BVFA 3BGPA 4RJ3A 5EI2A 3FXZA 4IE9A 4FSYA 4CKRA 1OL7A 1L8TA 5CY3A 3KMWA 4V01A 5K3YA 4DBXA 3RK9A 2OJGA 5IQEA 2F2CB 3MGYA 4WNOA 4CGAA 3U4UA 2AC3A 3C4XA 3G6HA 3QWJA 3PJ3A 4QMMA 3DCVA 4RFMA 5CEQA 2Z7QA 3AT2A 3NW6A 4AZEA 3BWFA 5DVRA 4M0ZA 3E8EA 2XIYA 4GT4A 2W4JA 3QXPA 4IDVA 4RG0A 4LGHA 2RFEA 2VO7A 2J90A 3SLSA 4L53A 2F57A 2W05A 4XUFA 3UP7A 2VX3A 5CSHA 4MD7E 4EH2A 4GCJA 4H05A 4AW5A 1OL6A 3DKFA 3UZPA 2BZHB 3T9TA 4EUUA 3MY5A 4D9TA 4F6WA 4A06A 4ACHA 3O7LD 4CZTA 2QOBA 2BILB 1MRVA 4FNZA 4ZSGA 1YXXA 1GIHA 3DA6A 5DRBA 5KZIA 4KWPA 4DH3A 4JAIA 5I9VA 5M56A 1ATPE 2UVXA 3BYMA 3O8TA 4MD8E 3OXIA 2YZAA 4BYJA 3ATTA 3VRYA 3WF5A 2BHEA 3ELJA 1E1VA 3ZDUA 4BYIA 4HGEA 5CU3A 4WRGA 2J9MA 4ACCA 3U55A 4QMWA 3B8RA 4FIHA 4PQNA 2VTIA 4BCIA 3LFCA 4Y95A 4DFXE 3VS4A 5B2MA 1P2AA 2GNHA 3LFFA 3PXKA 3QZIA 4FK3A 5HOAA 4YTIA 4C33A 3SRVB 2FO0A 3KEXA 3NYOA 2E9NA 4GS6A 5DHJA 3G15A 3NW5A 2O8YA 3TZ7A 3LCDA 4ZMFA 5AR5A 2JKMA 1IRKA 4H3QA 1YDTE 2YWPA 3IGOA 1ZOGA 3ZCLA 2GU8A 4TY1A 3VIDA 4XV1A 4D5KA 2QHNA 2UW9A 3HDNA 3QHWA 4PTGA 3SXFA 3II5A 2VD5A 4QMSA 3FAAA 1F3MC 5FTGA 2W1ZA 4YZBA 3THBA 4NL0A 1NXKA 1Q97A 2XEZA 5F4NA 3WZEA 1PXMA 5CNOA 3DK7A 4G6OA 3DJ5A 5DH3A 4EOQA 2PWLA 4F70A 4F9CA 4KKHA 3E88A 2ZMDA 2F7EE 4O1PA 3B8QA 4YLKA 5IQCA 2BAKA 5IQDA 3FY2A 3WYYA 2GDOA 4XOZA 4KABA 4BICA 4X6RA 2B52A 5LOHA 4BCMA 4KIPA 3RKBA 1R1WA 5ANKA 3A62A 1G3NA 1GNGA 3E62A 2C4GA 5ANJA 5ETCA 2G9XA 3VO3A 3VUKA 2WNTA 4QP6A 4FSRA 3P4KA 2ERZE 4I0RA 1H1RA 3HMOA 4R3CA 1FVTA 4XG4A 3WZDA 2ITOA 2Z2WA 3I6WA 2PVRA 2WU6A 3NNXA 4BL1A 4RWIA 1H24A 4ZAUA 2XA4A 5GZ8A 2OZOA 4I92A 4LV5A 1GZ8A 1PXKA 2YACA 4I93A 3ODYX 4YZ9A 3QTQA 5HX6A 1FQ1B 3PPKA 2QD9A 4E4LA 4O82A 1J1CA 3ROYA 3NDMA 4Y5QA 3IW8A 5AR7A 1QL6A 4M15A 4TNBA 1M17A 4LI5A 2O2UA 1Z9XA 2KULA 3UC3A 3NZ0A 3GC8A 2ITZA 3C0HA 3C1XA 1H0VA 4R1YA 4E5AX 3IOPA 4GYGA 3D7TB 1NA7A 3A7HA 3G6GA 1YOLA 3PVGA 4UMTA 3Q4UA 2XRUA 2WAJA 3LPBA 5I3RA 5IQIA 4B9DA 1PMNA 3F7ZA 2YM7A 4G34A 3ANRA 5ANIA 2XNGA 2QONA 3CP9A 4FOBA 4FTLA 3LKMA 2IN6A 4X6QC 4FIJA 2H8HA 3NPCA 2ZB0A 5EKOA 3OWKA 1TQMA 5GZAA 2OBJA 2BRGA 2W9ZB 4L9IA 3RINA 4BGQA 3PIYA 4AFJA 3MPMA 1M7QA 1OBDA 2UZEA 1U4DA 3IW6A 3CPBA 5EH0A 5JRSA 3ZHPC 4U3ZA 1WBPA 3PIZA 3HYHA 2PPQA 3HV4A 4CFNA 2PUNA 3V5WA 2R3FA 5DBXA 4BCPA 2O63A 4LQMA 5IQHA 2W7XA 3QLGA 5HCXA 2UUEA 2DUVA 3VJOA 4I5PA 5GJGA 3WZKA 4CT1A 2XVDA 4MAOA 3P9JA 4Q2AA 2FSTX 5EOLA 2XKFA 4QQTA 1DI9A 1LEZA 2C0IA 5C8KA 3R22A 2ZVAA 3FZSA 4WD5A 4CMTA 4IX5A 3QYZA 4DINA 2EXMA 1XH8A 4X2NA 2A0CX 3HAMA 4Y72A 2ITPA 4ONAA 4UY9A 4AA4A 1GZKA 4DFBA 3O23A 1RW8A 3HVCA 4GK2A 2EU9A 4TL0A 3TDWA 3HA6A 1YI3A 4YJTA 5L6PA 5CEMA 1J7UA 4HVHA 3BHYA 3UIXA 5JH6A 4W4XA 4CFUA 5JZJA 4XLVA 5EOBA 5M4IA 3U6HA 3MV5A 2BVAA 2W0JA 4J1RA 4DH5A 1WVYA 2YITA 2WZJA 4DEHA 5HQ0A 2PVNA 2XRWA 3H0YA 2BZIB 3D5WA 4O0SA 3JS2A 1LEWA 1SYKA 3MB6A 3E5AA 3OW3A 3RALA 5IH6A 5HGIA 4H1JA 3WYXA 2WELA 1ND4A 4UYNA 4CD0A 3FMJA 3NUXA 2X4FA 5KKRC 2OKRA 1Q8YA 5EQYA 4DFUA 2GTMA 2GHLA 4KSQA 4WUAA 1XKKA 3ENHA 3AT3A 4IB3A 5FTOA 4I41A 1CKJA 1GJOA 2GS7A 2UV2A 3H9OA 3V6SA 1FOTA 5HNBA 2G15A 3BEAA 4L3LA 3HV6A 3KVWA 2W1DA 2DS1A 4I5HA 2VU3A 4D5HA 4BDIA 3QALE 3FLQA 1U5QA 4JIAA 5IPJA 4GG7A 3U6IA 4YC3A 2W5AA 3R21A 3C4FA 2YHVA 4PMTA 2R7BA 3W55A 5DPVA 5HBJA 3A8XA 4DH7A 3QA8A 4EZ7A 1RJBA 4RJ5A 3U9NA 4R1VA 2IW8A 4LRJA 3M11A 5JFWA 3ZC5A 4M12A 4WOVA 2OJIA 4DEGA 2XUUA 3LAUA 4Y83A 3OOMA 2E2BA 2QKRA 3R7OA 2DYLA 2YDJA 4FT5A 5E90A 5TO8A 3V8SA 5HD7A 4GFGA 4ZSJA 4YZNA 3ZXZA 2RG5A 4C3PA 4IH8A 5ETIA 4IM3A 4RJ6A 4MXOA 4FIFA 1KE6A 1BX6A 3QTXA 3V04A 5CYIA 4HGLA 4AS0A 3BKBA 5K5XA 4OTIA 4W4WA 3FE3A 5DT3A 4BF2A 4RC2A 3VS5A 3KMUA 2FH9A 4AN2A 1UNHA 3AC1A 3R6XA 4FTKA 2C5XA 5FDXA 5CXZA 3VBQA 4ANNA 1ZOEA 2BUJA 3N4VA 2V5QA 3O51A 2WKMA 4X2JA 3FKLA 3AXWA 5CTPA 3TKUA 2PMLX 1U5RA 3D83A 3Q9YA 4F1OA 3B2WA 3PG1A 4O38A 3DAEA 3CQWA 2XP2A 2YM8A 2YCQA 5AA9A 3R9OA 3EB0A 2B1PA 4GSBA 3NNWA 1UV5A 4WNPA 4LMUA 4LM5A 3RGFA 5AA8A 3KXMA 3LQ5A 4AZTA 3EQRA 4QNAA 4BI0A 3KB7A 5L2QA 5L8LA 3BCEA 3F6XA 4A4LA 4YHJA 2CNVA 4WNKA 1PXNA 3CGFA 4GT3A 2E9OA 5HORA 2W1EA 5AP6A 5A6OA 3O2MA 2VO6A 4Y73A 5DYJA 3LXKA 5HIEA 3T9IA 1AQ1A 2QOKA 3DGKA 3FEGA 3BWJA 3GP0A 3QU0A 3A60A 1M14A 2UW4A 3FZTA 3R71A 5CX9A 3V5JA 2WOUA 3DBQA 3IO7A 3IDCA 2JKOA 3CQEA 3GNIB 5A46A 3ZTXA 5JSMA 3OOGA 2VWVA 3I81A 4UEUA 4NT4A 3P7BA 1OZ1A 1YI4A 4YJQA 5CVHA 4IIRA 1FPUA 3TZMA 2XJ0A 4MTAA 3DJ6A 4C4GA 2Y7JA 2CMWA 2OIBA 3ZM4A 4XP0A 3MVJA 3MYGA 4K2RA 4O7TA 4EKKA 4EQUA 1FGIA 3QUPA 4YJSA 2CKEA 2O64A 4PL5A 3BU6A 3Q5IA 2NRUA 2WTKB 1V0OA 4KIOA 2QNJA 2WEIA 3EFWA 1WBNA 2IZUA 1X8BA 4KD1A 4E93A 5CENA 4EHGA 4FOCA 2P3GX 2WMRA 3ODZX 5ETAA 1T46A 2HWOA 3G0FA 5HTCA 3LFBA 4FYOA 3U87A 5FUTA 5E1SA 5KZ0A 1O9UA 3UYTA 5HE3A 4HCUA 3R83A 4J96A 4BWXA 1STCE 4TWPA 2W4OA 3EN6A 5M4UA 3ALNA 5JRQA 4O0YA 3F3WA 1ZAOA 2XH5A 3F5UA 2V22A 4F6UA 1QPCA 4HNFA 4L52A 4NW6A 3W10A 3DBEA 4FKVA 4W8DA 3FHIA 3Q04A 1SVHA 3DDQA 4OUCA 3OFMA 4F0GA 3ZUUA 2ZJWA 3QC9A 5C4LA 1OUKA 4DEAA 4WG5A 4XG9A 2YERA 4FT3A 3C50A 4QP3A 2UZLA 4RZVA 3QQFA 5KMLA 3TV7A 3OXTA 4U45A 4F99A 1WVWA 4ZTQA 1XBBA 4TN6A 3ZBFA 4YR8A 3FI8A 3ORKA 3RK7A 4JBPA 4DCEA 2ZDUA 3V01A 5K4IA 2ITTA 3ZUVA 3HRCA 2UW7A 3FLWA 4FKGA 5IH5A 4FNYA 5AMNA 2XJ1A 4BIEA 3EWHA 4RFZA 4A4OA 4DC2A 3FYJX 3H9FA 3G33A 1YHSA 2W5BA 3ORLA 5CLPA 4I0TA 1Q8UA 1CM8A 2CKOA 4G5PA 2HW6A 1CTPE 5CF6A 2HXQA 3WZJA 4M7IA 5DA3A 3KREA 3MESA 5AR8A 4MH7A 4C59A 5AP5A 2B4SB 4RIWA 2IW9A 1RE8A 4R7BA 4WHZA 4XV2A 1HOWA 2XF0A 3GT8A 3R9DA 2C6TA 4ALWA 3AD4A 2JIVA 3EQGA 3O7LB 4ZY5A 3L8PA 1WMKA 3DAJA 4M84A 4R3RA 2GCDA 3FC2A 3GU6A 4TPTA 4BKYA 2UZVA 1OITA 3Q4CA 4FTTA 3EFLA 4MX9A 4PMSA 5ICPA 1G5SA 2HELA 4ENYA 3ZO3A 4JBOA 2WEVA 2VWBA 4ZY4A 3GOPA 4O91A 4X2FA 3OROA 4CFWA 3LCOA 3MJ1A 5IMXA 3SDJA 1ZARA 2VAGA 3FV8A 3ZLXA 5I5ZA 3F2RA 1XWSA 2BFYA 2R3NA 5D7AA 3C4WA 2PE2A 1XH5A 4R7HA 3UZRA 4FTJA 4PL4A 1S9IA 3DK3A 4QMPA 2PVFA 4UWYA 3WF6A 3MPTA 4XP3A 5IISA 3UODA 4BBMA 3KXHA 5BVDA 4FEUA 4TNDA 3AMYA 4JDHA 3R7IA 4DFZE 5CVFA 4ANLA 3QF9A 2P4IA 3SW4A 3RZFA 3BLQA 1UNLA 5HE2A 4AG8A 5EDQA 2RFNA 3P1AA 3FKOA 2VV9A 4YGAA 5FXQA 2JAMA 3EN5A 3QD4A 2ITUA 4IEBA 4GIHA 3SHEA 3TNQB 3WILA 2VTHA 4R3PA 2R3RA 3LXPA 3Q6UA 4RC3A 3NNVA 4F65A 1H8FA 3OD6X 4CSVA 1P4OA 3FLSA 3FQHA 4NCTA 3QYWA 4NTTA 1PMVA 3TG1A 3C51A 3LM5A 5IEVA 3UJGA 3W32A 5HVKA 3QUEA 4L7FA 2WOTA 3E93A 3SC1A 3I60A 2HK5A 5I9XA 4U9AA 3QQKA 2XK9A 4JI9A 3EQIA 4F9BA 3FQSA 3HAVA 3BLHA 5T68A 2X7OA 5HLNA 3PJ1A 3CJFA 1JWHA 4FSQA 4XG6A 4O86A 4TYJA 4CLIA 2WTIA 1Y6AA 3FJQE 4V04A 4FC0A 4FKRA 5EI8A 4BWPA 2WTCA 2C5VA 1JKTA 1Q8WA 3VS2A 5IQFA 3MB7A 2PZRA 4IWDA 3OHTA 3QRTA 4UXQA 3ID6C 2QU5A 4U97A 4M68A 1TVOA 4NCTC 4TRLA 4IBMA 1R3CA 5BYYA 1WBTA 4FG7A 3ZLYA 3FDNA 2IJMA 3MWUA 4NK9A 3D15A 4QQ5A 4RX9A 5IMEA 1QCFA 2UW3A 3LFQA 4HCTA 3T8OA 3PIXA 4WA9A 3HV5A 2Q0BA 5TE0A 4L42A 1YXUA 1ZZLA 3OS3A 4FKLA 4IZYA 1ZMUA 4K11A 2J0LA 3BHVA 4E4NA 4BCGA 4FVQA 2QLUA 4EHEA 5JMSA 3E3BX 3GU7A 4LG4A 5FWKK 4FA2A 3C0IA 2A19B 4E8AA 3IOKA 2BCJA 5K0KA 5E4HA 3IKAA 3R7UA 4BZNA 2QR7A 4RWLA 4JG7A 5JKGA 3ZU7A 4R8QA 4GKHA 4MNEB 4H3BA 4I1ZA 4QQCA 3D2KA 3E3PA 5ACBC 2Y6MA 4BN1A 2Z7RA 4HCVA 1PRYA 1U46A 2J0MB 3PWYA 3SXSA 1HCLA 5DMZA 5JGBA 3HMIA 1SVEA 3HZTA 5FP5A 3V5PA 4EWQA 2IVVA 3FQEA 3VBWA 5AUWA 2WO6A 2DWBA 2JDTA 3QXOA 1DAWA 2Z7SA 4GIIA 3KULA 1UNGA 2VTJA 4RPVA 4U80A 3MY0A 4R5YA 4W4YA 1CMKE 4LFIA 5HG5A 5DFPA 3GUBA 3FL5A 4I6BA 5KX8A 2OWBA 2B55A 3G0EA 3PJCA 4K77A 2OZAB 4BCQA 2C6MA 3QTZA 4C2VA 3CC6A 4UYAA 4X2KA 4M69B 5HICA 4JLCA 4EOKA 4YURA 4QOXA 5CEOA 2Y4IC 3KCFA 4K6ZA 4O0TA 2R3MA 3E7OA 4IX3A 2YDKA 3Q53A 4MWIA 5CANA 4BBEA 4I22A 3SW7A 3F88A 1DM2A 2WMWA 5GJFA 3TM0A 4ANQA 2P0CA 3FY0A 4CFXA 1PY5A 3LM0A 1M2RA 1BLXA 3F2AA 3H0ZA 3QUDA 2JKKA 4Y46A 2R0IA 5A4LA 2E9PA 3G9NA 5IZFA 2QI8A 4TZRA 4JBVA 4A07A 4I6FA 4EK4A 4J53A 4DEDA 5FDPA 3FHRA 2WMXA 5JFVA 1WVXA 3A99A 3BQRA 4HOKA 4ZLZA 2H96A 4OBQA 3KK8A 2C68A 4JRVA 3HV7A 4NFNA 1YQJA 2OSCA 2GMXA 1Q24A 4U6RA 2R64A 3TJDA 4BRXA 3IDPA 4YLLA 3LQ8A 2G2FA 3NYNA 5IA5A 3EQDA 2R3KA 3JVRA 3OEFX 2XCHA 4GK3A 4GUBA 4MHAA 5CAQA 2Z7LA 1KUTA 4YTHA 3RAHA 1O6KA 4QRCA 2VTLA 3UYSA 2BFXA 3UIMA 4DEBA 3OF0A 1OIQA 4QYEA 4PMPA 4FV6A 3WF8A 4H3PA 4AE6A 4EEVA 2X2KA 2YCFA 4JXFA 3WF9A 4AN9A 4EZ3A 4PF4A 3FSKA 4U8ZA 5HNIX 4FL3A 4E6AA 4BCJA 2NP8A 2Z02A 4G17A 3H10A 3IQ7A 4MCVA 4O6LA 2W9FB 4Q9SA 4G31A 4EZ5A 5EYMA 4FUXA 3E87A 4LGGA 4Y5HA 4YO6A 4KSPA 4QPAA 5CASA 1CKPA 1KE7A 2OXYA 2B7AA 5A14A 4NIFA 5AIRA 3PA3A 1H08A 4EJNA 5KNJA 5HG7A 1WZYA 5HCYA 4YNOA 4CCBA 2PMOX 4ZP5A 5TF9A 4ZSEA 2GSFA 4ZSLA 3L1SA 2VWIA 3A61A 3MTFA 4QTBA 4I4EA 3PPZA 4EOSA 4M3QA 5JK3A 5KHXA 4FF8A 3F82A 1IAHA 4K8AA 2OLCA 1ZYCA 4BCFA 3D0EA 4BKJA 2HCKA 1JAMA 3ETAA 4QTDA 3PJ8A 3RPOA 1MRYA 3R0TA 4NJ3A 2X2LA 3K5VA 4TWNA 2R3LA 3SG9A 3HA8A 2C5YA 2Y8OA 2JDOA 3QWKA 3QAME 5T6KA 4EI4A 2XIZA 4DG3E 2QOIA 1Z57A 4QO9A 2RFSA 3R9RA 5E1EA 3FI2A 2J0IA 2HYYA 2QO7A 3GQLA 4U44A 2ZYBA 4FTIA 4WKQA 5KMJA 1JSUA 3T3UA 1JNKA 5AR4A 1MUOA 5IG1A 3NEWA 3VS6A 2XKCA 1BUHA 4G16A 3TEIA 5M51A 5CALA 3TIYA 3KXXA 3OTUA 2PYWA 1YW2A 1DS5A 5AX9A 4BTJA 2OFVA 4K9YA 2WQBA 4DAWA 5TKDA 4NH1A 4EONA 1WCCA 4RSSA 2XNEA 2VN9A 1V0PA 4WSQA 4A7CA 3IK3A 3ZRLA 2ZM3A 3EN4A 4L43A 4GK4A 1Y91A 4Z7HA 3FLYA 4XG2A 4X7QA 2JFMA 4ACGA 1H1WA 3DZQA 3W8QA 1YKRA 4JT3A 4XBUA 3F69A 4FSUA 2QHMA 2WTJA 3COHA 5AX3A 4UN0C 4O7SA 2A2AA 3KGAA 4QMXA 3DB6A 5AV2A 4AU8A 3ZZWA 4QYFA 3RI1A 5KUPA 2W1HA 4L6QA 3K5UA 4XCUA 5IF1A 3Q60A 3IGGA 4PPAA 4CTCA 3QCSA 5GZ9A 4PMMA 4QP4A 3ZUTA 4M14A 5CEIA 2BDWA 4PP7A 5BQ0A 3LW0A 5CI6A 1PXJA 2X7FA 3ZO4A 5I9ZA 4FEXA 1H25A 4KS7A 4OBPA 1ZYJA 4KA3A 4NKSA 2BRBA 2H6DA 3UO6A 4RX8A 2PVLA 3DV3A 5F94A 2YIQA 1OKYA 1V1KA 2A1AB 1ZYDA 1WBWA 5DR9A 4J97A 1B6CB 5FP6A 2YJSA 3R63A 2BROA 2F49A 4FZ7A 5AR3A 1IA9A 3LMHA 4FKJA 4IAIA 4PP9A 5JFSA 2V7OA 5HESA 3LQ3A 2BPMA 4IW0A 5M55A 4X3JA 4CXAA 4FZFB 1PMUA 3P23A 4BI2A 3DKOA 3GC9A 4LRKA 3BHTA 5LXMA 3LLAA 4YJNA 3ORXA 1XBAA 5AUYA 2HIWA 5E92A 5C1QB 1UWJA 1OBGA 5HD4A 5EG3A 3C0GA 4WNMA 4S32A 3AC2A 2WQOA 1H0WA 3GCPA 2YLFA 3QQHA 5HIBA 3ACKA 4PPBA 3CXWA 5ETFA 5BMMA 2UZNA 3DXNA 3R1QA 1UU7A 2WHBA 5HEZA 3RVGA 5J9LA 4NWMA 4O22A 5IKWA 4PL3A 4TYEA 5H8EA 4EH4A 2CGVA 3DFAA 4M97A 1VR2A 3RNIA 4FG9A 2P2HA 3G9LX 3HMNA 4L46A 2QO9A 4GFOA 4FT9A 3R8PA 4D0XA 4EH8A 4IVDA 3MY1A 3L9NA 3HP2A 1H1SA 2W96B 3CEKA 3C4ZA 5CU6A 3JUHA 5FXSA 5E8WA 3AC3A 3CIKA 4FSMA 4M67A 4E4MA 3HP5A 5AV1A 4QMVA 3UPXA 3DK6A 4QMUA 3ZSGA 5CAOA 1UU9A 5GNKA 1OI9A 3RM6A 2RIOA 2RF9A 2X8EA 4FUYA 4LGDA 2PZYA 4XYFA 3TNHA 4CV8A 2BKKA 4RJ4A 3RAWA 2IZSA 3VUHA 1YHWA 2JIIA 4D4VA 3HECA 3PXYA 5L6WL 4IQ6A 4XOYA 4ENXA 1BL7A 4MBJA 4KIQA 4DITA 1WAKA 4KINA 3G2FA 1REKA 1W7HA 3HEGA 2YM4A 3GCUA 3QRUA 1FBNA 2IO6A 3TL8A 4CTBA 4BIBA 4C0TA 2XB7A 2QVSE 4TYIA 4USDA 3LIJA 2GQGA 4IVBA 2C6EA 3F7WA 2JFLA 3VQHA 5L8JA 3WOWA 4GG5A 4FEQA 4D1SA 2I0YA 1ZYSA 3ORZA 3W18A 2CCHA 1ZMWA 2X2MA 2QCSA 4E1ZA 4V05A 5FM2A 4RA5A 4AE9A 4FZDB 5HU9A 4RIXA 3QQGA 3P7AA 3UVQA 5DRDA 5L2IA 3SXRA 2HZ0A 2IG7A 1LR4A 2CSNA 2X39A 3I79A 4CKJA 4NUSA 2JGZA 3IONA 4AZVA 3PZHA 4G3CA 4A9UA 4AW1A 2FYSA 2XYUA 3L9LA 4FKTA 1UU3A 3MVHA 4II5A 4RVKA 4MVFA 4D58A 1FINA 2CPKE 4X2GA 4BDKA 5A3XA 1U54B 4FYNA 2PVKA 4MXYA 3EQHA 2VTTA 2BAQA 1YI6A 4UZHA 3MVLA 4YJPA 3TACA 4W4VA 1HCKA 2AYPA 4U79A 4FV2A 5E8SA 1P14A 5JGDA 4CG8A 4AF3A 5L2SA 4PDSA 3ZONA 2VTPA 4GEOA 4HYHA 4IJPA 3MIAA 2XK7A 5KMMA 5EI6A 3ORMA 3RK5A 3E8DA 4D2VA 5CAPA 4O0UA 3VF9A 5E8UA 2G2HA 4BVUA 3EN7A 4RWKA 4D1ZA 3UGCA 4J8NA 4F9YA 5L2TA 2YABA 2ZM4A 4O83A 5EM6A 4JDKA 3MI9A 3DLSA 4P2KA 5CSPA 5E8TA 2BAJA 3R8VA 4CEGA 4L44A 4V0GA 4KBCA 3C5IA 5KBRA 3JPVA 4XRLA 1R39A 2C0OA 4G3GA 4KIKB 3LCKA 3QCYA 1Z5MA 4F08A 4EHVA 5A4CA 4C8BA 3T3VA 2VO3A 3QD0A 2OG8A 4W9WA 5IA2A 3KF4A 1VZOA 5EK7A 4AAAA 2OU7A 5CT0A 3KCKA 3BRBA 4GFMA 4Y8DA 4CLJA 5B0XA 1KV1A 4F09A 3R73A 4DG0E 4QP9A 2OW3A 4JAJA 5DT4A 3R8MA 4D9UA 4GVJA 4JQEA 4GKIA 2EXCX 4ZJIA 2XCKA 2LAVA 4DTBA 2ETKA 4RIYB 3EQPA 4TW9A 3UMWA 4OTDA 4AGCA 3GGFA 4TYHA 2FSOX 1W0XC 3BZ3A 3LFDA 4XG3A 3OUNB 4Z55A 4DT8A 4AW2A 1IA8A 1SMHA 4G9CA 4IDTA 5FM3A 3L9MA 3NVMB 2G2IA 4CYIA 4NYEA 2YCRA 1KV2A 2OF2A 2PUUA 3BE2A 3DQXA 5KO1A 4APPA 1YWRA 4U43A 5E8XA 4AA0A 3ZZEA 5B7VA 4QTAA 5IUGA 1BI8A 2AUHA 2IVTA 4UMQA 4Q9ZA 3G5DA 5J1VA 3HKOA 4YZMA 4IFCA 5IQAA 3BELA 1AGWA 3DPKA 4ANSA 3OTVA 4FV1A 3GFEA 4J95A 3QZFA 4FG8A 4AT4A 5LVOA 3ATSA 2R0UA 3LE6A 1F5QA 2VWZA 3MFUA 4FVRA 3SKCA 4RRVA 3UNKA 3R9HA 4IVCA 3PFQA 4BI1A 4L7SA 4BTFA 2BDJA 1JSVA 2BTRA 3PE2A 3KXGA 4K0YA 5J95A 4USEA 5HKMA 4JIKA 2J2IB 3R02A 3L8SA 4U41A 3UQFA 3EZRA 3F61A 4C02A 4H36A 3A2CA 1W82A 1YXVA 3LHJA 1LPUA 4FV8A 4C4EA 5EKNA 2PUPA 1ERKA 5L3AA 2KTYA 4J8MA 2VX0A 2Y9QA 3Q52A 4DGOA 1K2PA 1JSTA 2E9VA 4QNYA 4X3FA 3UIUA 4NKAA 5HBEA 4AP7A 4AX8A 2CN5A 3LFNA 3EQFA 4FV4A 4D4YA 3BGZA 3LLTA 2R3OA 3HL7A 2YIYA 3I5NA 2X8IA 3LVPA 4ID7A 4YZDA 1BL6A 4XV9A 5AV3A 4QMTA 5I3OA 3N4TA 4DA5A 4I5MA 2V7AA 5DEWA 4R78A 5K9IA 3CBLA 4MXCA 3ULZA 4DGMA 4YTCA 4M66A 4G5JA 4IMYA 4S2ZA 4AZFA 5CT7A 3QX4A 4YHFA 5E8VA 4AWIA 4C3FA 1A48A 1OB3A 5DN3A 3A4PA 2BALA 4IX4A 4IM0A 3B2TA 4RQVA 4AZSA 4U5JA 4YJOA 5CU2A 4IANA 4QMYA 3TZ8A 3FMHA 4E73A 3VS7A 1ZY4A 2G1TA 3RP9A 2QOHA 1OMWA 2R9SA 3EL7A 2VUWA 2QG7A 4IJ9A 4X3FC 3PP0A 4XS2A 5EQPA 3RPRA 4BDFA 5HCZA 3UDBA 4FIEA 3O8PA 3LFAA 4E6DA 2F2UA 2VTMA 2YJRA 4MWHA 5TOZA 2FGIA 3CTQA 3HDMA 3NUSA 5CAUA 3PA5A 3LJ1A 3MTLA 3ZM9A 2X4ZA 4BDHA 4F63A 2VTOA 1Y57A 3K2LA 3ORNA 3E8CA 4OBOA 3S00A 4HYUA 3MVMA 3ZRKA 2J0KA 5C03A 5FEQA 4EH3A 4OTHA 3R9NA 3D9VA 4L67A 4DH8A 2GFSA 3O50A 1VYWA 4N4SA 4IVAA 5CSXA 3R04A 4EOIA 5CF4A 1NVSA 3KU2A 1U59A 4DFYA 4BC6A 3QTSA 2RGPA 3R7GA 4PV0A 1XH7A 2WB8A 4S30A 2OGVA 5AAEA 5AUZA 3I5ZA 3LCSA 3ORPA 3PUPA 3LXLA 4PX6A 4MQ2A 4RC4A 2W1CA 1KE9A 4NSTA 4RVLA 4IADA 3U6JA 1JKSA 2UZTA 3EQCA 2C47A 4MYGA 4R6VA 4EBVA 4G1WA 2ZV7A 3OBJA 3W2OA 2XNOA 1NT2A 4N57A 3SRVA 2PMNX 3EH9A 3K3JA 3NR9A 2H9VA 2WPAA 4LOOA 4YBJA 3PP1A 4ZS0A 3NCZA 1XBCA 2HY81 1KE5A 1Q3WA 4B0GA 2CHLA 1M2PA 2YAAA 3HV3A 3Q4ZA 4FBXA 4L3PA 3F3VA 5EHLA 4QMQA 3VULA 1NY3A 4O7WA 1PXLA 5LVLA 3KN6A 5DIAA 4UMPA 4E6QA 2YFXA 4AQCA 1K3AA 3MFTA 4L68A 1OM1A 2B9JA 5D1JA 3MW1A 4EH5A 3JXWA 2XYNA 3BYVA 3NNUA 3OZ6A 4I20A 1V0BA 4HPTE 2X6DA 1OIUA 5HG9A 5BVOA 4C4FA 4BR3A 3PY0A 3E64A 2A27A 2CLQA 1FGKA 4EOPA 2YISA 3TNIA 4CVAA 5IA4A 5IQGA 3CGOA 5JZNA 4FNXA 2ITYA 4HVGA 2BIKB 3MPAA 3UG1A 4ZK5A 4CYJA 2HZ4A 3F5PA 4EBWA 1JOWB 3UQCA 4FSTA 5L8KA 3CD3A 3MIYA 4TWCA 2W4KA 5M06A 4LMNA 3POOA 3PTGA 2C6DA 4UWBA 4PRJA 4KRCA 3E92A 3VBVA 4HYIA 3QTUA
chains in the Genus database with same CATH superfamily
5D10A 5FBNC 2WIHA 2XK4A 3GOKA 4FL2A 4PTEA 1XH4A 5JQ8A 4GU6A 3U51A 4QPSA 3F5XA 2Z60A 5IA0A 5LVPA 3Q2JA 4D2WA 3MH1A 2Y0AA 4I5CA 2AQXA 4N6YA 4QP7A 3ZBXA 4YLJA 2WQEA 2C69A 3G90X 4WG3A 4DGGA 3D14A 5J79A 2XM8A 5DLSA 5HTBA 1IAJA 5IA3A 3WARA 2WMUA 2CKQA 3PSCA 3RWQA 3ZLWA 1APME 1QMZA 4AOTA 3OCGA 1A06A 5I9UA 4DCAA 3GFWA 5J87A 3KRWA 3NWWA 4Y85A 4C4JA 2PHKA 1O6YA 4HPUE 4DHFA 2WFYA 3OBGA 3R1NA 1EH4A 2OJ9A 2BKZA 3F5GA 3WIGA 4L00A 3FL4A 5AUXA 3PG3A 4FRFA 2XM9A 4G6LA 3UIBA 5HO8A 1QPEA 4AXCA 3D7TA 5C9CA 4IXPA 2CGXA 4BGGA 4QDEA 2ZV2A 3OUKA 4FNWA 2ZOQA 5J5TA 1VYZA 4CFFA 3D5XA 4JNWA 5J7BA 1S9JA 3SOCA 4BB4A 3QCQA 3VW6A 4P7EA 2CGUA 5HHWA 5C01A 3ZEPA 2NYAA 3W0NA 4FR4A 2ITVA 4IB5A 4FTOA 1UVRA 2BMCA 4GMYA 3DKCA 3FPQA 5EHOA 4BBFA 4EOOA 3DAKA 2R3IA 3P7CA 5KMOA 3RNYA 3HUCA 4F7JA 4A9SA 4ZTNA 4UMRA 3EKKA 1NVRA 1W98A 4XJ0A 4OAVB 1JKKA 1H07A 1Q62A 1K9AA 3FI3A 4YBKA 3UO4A 4P90A 1GAGA 2QQ7A 2O5KA 4FL1A 1WBVA 3KY2A 2XIKA 2QOQA 4MF0A 3IW4A 3SVVA 1M2QA 3KRXA 4NFMA 4O6EA 2J0JA 2QC6A 3Q9XA 2XZSA 3BV3A 3E8NA 2XMYA 3A7FA 3VUIA 2HAKA 5EYDA 4A9YA 4Z7GA 2ONLA 4EH9A 1CKIA 3FZOA 3HMPA 1J7LA 1H28A 5H9BA 2NRYA 2VWXA 2OH0E 3PPJA 5IH4A 3W2RA 3SG8A 4D28A 4KNBA 3GQIA 3VAPA 1J7IA 1YOJA 3VS1A 4G3FA 4BDAA 4IZ5A 4C4IA 5KMIA 4MXZA 4EUTA 5M4FA 4ZJJA 4F7SA 4YO4A 1SM2A 3A7GA 1R0PA 3MDYA 4NJDA 5FEEA 3V5LA 3Q9ZA 4QEBA 3MA3A 5J1WA 3JVSA 4EC9A 4FEWA 3UOLA 5E7RA 3UTOA 3VS3A 1M7NA 2C6IA 2IWIA 4YSMA 3E7VA 3NYXA 4D2SA 1GZNA 2PVJA 5E8ZA 2ONLC 3UE4A 4AXAA 2C30A 2YM3A 4HJOA 2X0GA 4K1BA 3QX2A 4I23A 3CLYA 4ASEA 4CT2A 3DT1A 3PVBA 2JLDA 3JYAA 4GU9A 3QTRA 4O96A 3TJCA 3VS0A 5LVMA 5M07A 4XLIA 4OAUC 4H1MA 4KUJA 2HZIA 4O0RA 3C13A 1REJA 3FXWA 3AD5A 4ARKA 3U9CA 3IW7A 4UV0A 3ZOSA 1OGUA 4FIIA 5T3QA 3DBDA 4J71A 5C27A 2J50A 3DNEA 3R2BA 4ITJA 2P33A 4IB0A 4QYYA 4C3RA 5KBQA 2EB2A 5AV0A 3ALOA 3IS5A 4Z9LA 4CRSA 3NIEA 4DFNA 2YZLA 2V62A 2VTAA 3GENA 2BTSA 2P55A 4HGTA 4I21A 4JDIA 4LL0A 4RFYA 5CSWA 2YIWA 5EYKA 5I9YA 1Q4LA 4O81A 2C5NA 4ORKA 1OIRA 4L01A 4O2PA 1DI8A 4LYNA 4MQ1A 3PVUA 5AP3A 4ITHA 1VEBA 4EK6A 2W1FA 4DLJA 2REIA 2V55A 2EB3A 3GU4A 3DOGA 4C36A 5L4QA 4I3ZA 3L8VA 5DG5A 5EW9A 1OECA 4IHPA 2RSVA 3I7CA 2UZBA 3ZH8A 1Q61A 3FI4A 3CJGA 3NUPA 4JR3A 1CDKA 4QP8A 1G8AA 5HVJA 3R8LA 3RWPA 3AC8A 3CCNA 4MKCA 4RJ7A 2BHHA 3EQBA 4NTSA 3QTWA 4PNIA 4ASZA 4HVDA 1XO2B 4WT6A 1B38A 2BRHA 5HNGA 3TV6A 4ASDA 5LJJA 1OKWA 3ZFXA 3COKA 4B4LA 4D2PA 4JRNA 5CVGA 2UVZA 1PJKA 2CJMA 2ZB1A 3SD0A 5C26A 4FKOA 2CLXA 3REPA 2RG6A 3FMDA 3BU5A 4U7ZA 1KSWA 2WMVA 4O7NA 2H34A 4BWKA 5L6OA 3QL8A 3R7YA 4BHZA 4WRSA 3A8WA 3NRMA 1Q8ZA 3V6RA 3AQVA 4O4BB 4QPMA 3RJCA 3DTCA 2UZDA 4FSWA 3GBZA 4NM3A 4NZWB 2QU6A 1XMMA 2ETRA 5K5NA 1G8SA 4KKEA 4Q5EA 2YWVA 4RIOA 1I44A 5IDNA 4S34A 2OFUA 3FSFA 2F9GA 4Z3VA 4ZZOA 2QG5A 3DLZA 3KMMA 4N70A 3DXPA 4MF1A 4GW8A 4BIDA 2SRCA 2R3JA 4LUEA 3H9RA 2UW5A 2BDFA 4MNFA 3UNZA 3H4JA 4YU2A 5G1XA 3TUDA 4P5ZA 5H8GA 4C61A 3NMUF 3TKHA 2GNGA 3RCDA 1M52A 4DYMA 3G51A 2X9FA 3M2WA 4RT7A 2WXVA 3ITZA 4DEIA 4K18A 5EM8A 2CCIA 5K0XA 4C37A 5C8NA 5DNRA 3CE3A 4E5BA 3C5UA 2CN8A 2OK1A 2WMBA 3LMIA 3W2PA 4IAAA 5EDRA 3VUTA 4BCKA 4DGLC 2VGPA 2YN8A 2PVMA 4FSNA 3A7IA 2YIXA 2X6EA 5BVWA 3KRLA 3CY3A 3S4QA 4ASXA 4YUQA 3VBXA 3W0QA 4M13A 1JQHA 4G2FA 3ROCA 4CZUA 3D5UA 4F64A 2VNWA 4O0VA 4XG8A 4BDGA 5LMAA 3VUGA 5DEYA 4OT5A 1J1BA 4OTRA 4WIHA 4BY9E 4FV0A 4TXCA 1TKIA 4U3YA 3LJ0A 4TKSA 4WO5A 4CV9A 3TI1A 3EOCA 1E9HA 4KBAA 4YPDA 3PE1A 5AP1A 1TFFA 4TT7A 3SAYA 2NNWB 4WBBB 3V8WA 3SGCA 3SQQA 5EM7A 4ANBA 1QPJA 3Q2MA 2OIQA 1JKLA 3ZYAA 4A9RA 4OTFA 2CDZA 2P2IA 3HGKA 2I40A 4AGDA 3WE8A 5A4TA 3KRRA 4YMJA 5C8MA 5FTQA 4ACDA 1ZRZA 2JAVA 2UW8A 2VWUA 4GJ2A 2VTRA 4FX3A 4JR7A 4UXLA 3NUAA 5HI2A 4BFMA 3AC5A 3QQLA 2WTKC 1PF8A 2XNMA 3QD3A 1URWA 1TQIA 3KVXA 3OXZA 4J98A 5F9EA 2AEGA 3ZO2A 3UOHA 5B2KA 4G3DA 4YJUA 4FTNA 4FV3A 5ANOA 4ERKA 4JJRA 1IEPA 1Q5KA 3PSDA 1YHVA 4ZIMA 4C7TA 4H58A 5I4NA 3TTIA 4AACA 4RVMA 3AMAA 3HLLA 3K3IA 2A4LA 3OCBA 3VQUA 4IACA 5GINE 3CPCA 4O27B 3L8XA 4F4PA 4HGSA 2V0DA 3FC1X 1YWVA 1IR3A 4RQKA 5E8YA 3P0MA 3UMXA 5TT7A 3VUDA 4EH6A 2C5OA 5E91A 2QKWB 2UZWE 3A4OX 4L45A 3IG7A 5CWZA 4IC7A 1YWNA 4HVIA 1J3HA 3LCTA 4LOQA 1E1XA 4FT0A 3K54A 2C6OA 2GHMA 5AAFA 2PVHA 3QLFA 4C35A 1FMKA 4FODA 3QQUA 4KKGA 5EM5A 4EL9A 4O7YA 3QKLA 5BX0A 3LMGA 2QOFA 4E7WA 4HZSA 1H1QA 4F0IA 4LV7A 4XG7A 4DG2E 3AGLA 5CSVA 4GYIA 5BPYA 3TNPC 1JBPE 1JVPP 4WG4A 3TZ9A 4ZZNA 3POZA 4ZS4A 4ZLYA 2GHGA 1PHKA 3KF7A 4XP2A 5IEXA 5EHYA 3F66A 3ZXTA 4O4CA 4F7NA 3R30A 4ZTHA 3NW7A 4CMUA 2PK9A 4XEYA 3RPSA 5EYCA 3ANQA 4O0WA 2WMQA 3F3ZA 5HTIA 3UPZA 3IW5A 2IVSA 3N51A 3QD2B 3C9WA 4W9XA 5FG8A 3RPVA 5E9EA 4D4RA 3ZSHA 2HY0A 3MH2A 3H3CA 4BZOA 4RIWB 2ZDTA 2C3JA 3GVUA 3NFFB 5GIOE 3HUBA 4HYSA 4EOMA 5CXHA 5BVNA 3COIA 4NM0A 3ORIA 4NW5A 3I0OA 3NUYA 1H01A 4ZXTA 3DKGA 3V8TA 1SVGA 3O8UA 4S33A 1O6LA 5HX8A 3IDBA 4JQ7A 5G6VA 5AV4A 1LP4A 5CI7A 3UO5A 5J9ZA 3O17A 2ITXA 3NIZA 4EOLA 4C58A 2XNNA 2PZPA 3CTHA 2UZOA 2LGCA 3EHAA 3QKKA 4WUNA 4BHNA 5KCVA 3S1HA 1LUFA 5CU4A 3VRZA 2X7GA 3F3UA 5F1ZA 3DBCA 2JIUA 3BQCA 5H3QA 3TT0A 4A9TA 4C34A 4QMZA 3GI3A 5CU0A 3VF8A 4DEEA 1KWPA 3PJ2A 3VW8A 4EQCA 4AFEA 4ZSAA 5AAGA 3QRKA 2HWPA 5CF5A 1WBOA 5M44A 3WI6A 3ORTA 2XEYA 3GU8A 4HVSA 4FTQA 3RPYA 3ACJA 3TUCA 3I6UA 4NU1A 1Q99A 3AT4A 1TQPA 3Q32A 3TXOA 2JDSA 2GNFA 4QD6A 5DOSA 5IU2A 3MFRA 4FV9A 4XMOA 3TIZA 4E26A 2PULA 4O7RA 3RM7A 3OWLA 3VVHA 4N6ZA 2GS6A 3NSZA 2PUIA 5AADA 3ZLSA 3QBNA 1PW2A 5AUVA 2J7TA 3DBFA 3MS9A 4YC6A 4RLKA 2PZIA 3R00A 2VGOA 3NS9A 3Q6WA 4ZTSA 3IPHA 5HZNA 3CTJA 5DR6A 4F7LA 3UOKA 3OWPA 3VN9A 4ACMA 5JGAA 5L2WA 1OPJA 3D7ZA 2YEXA 2OICA 1KE8A 3QFVA 5KE0A 3NGAA 2VRXA 2FB8A 3HNGA 5CF8A 3TTJA 5BNJA 4B6LA 2YA9A 1ZWSA 4I6HA 4IAZA 2CNUA 2XARA 5FLFA 4O7LA 3EL8A 4UB7A 3CQUA 4AUAA 1SNUA 1OKVA 1PXIA 2C1AA 3EN9A 3PY3A 5BUEA 2FUMA 2O65A 1FVVA 3JY0A 5AJQA 2PVYA 4AXEA 1IASA 4FTUA 2YM6A 2X8DA 5HLPA 4JG6A 2OJJA 3QTIA 2YAKA 1L3RE 2X1NA 3NX8A 4LRMA 5JEBA 1BI7A 3SA0A 2B0QA 2ZFYA 2F7ZE 2E9UA 4KRDA 4E6CA 4GUEA 1UWHA 2OO8X 4MNEA 4DTKA 4KS8A 3PLAE 2C6LA 3ZRMA 3OG7A 2JBPA 3AMBA 1OL5A 5JFXA 3CKWA 1OL2A 2UVYA 2FSMX 2FA2A 2W17A 1W83A 4RWJA 1GIJA 4E20A 1OL1A 3WBLA 4EH7A 3EKNA 4TWOA 4K33A 2HOGA 4UZDA 4AZWA 2IZRA 5J8IA 3BV2A 2HZNA 2J6MA 4GJ3A 3FYKX 3HX4A 4M0YA 2J51A 5LMKA 2Z8CA 4U81A 4XV3A 4P5QA 2IF8A 2WMAA 1OPKA 2VWWA 3F9NA 1P4FA 4FKUA 4IAFA 4H39A 3N4UA 4DF3A 5DI1A 4DTAA 1UU8A 5IQBA 2I0EA 2OZAA 1ZMVA 4O7VA 3CS9A 2HXLA 4M69A 1PYEA 3JY9A 3ZO1A 1PXOA 3OWJA 4RX7A 5EDPA 2Y4IB 3NLBA 1PKDA 2NPQA 4ZLOA 3MA6A 1NW1A 2WIPA 4OTQA 4FEVA 5CZHA 2RKUA 4FSZA 4PPCA 4AOJA 4C4HA 4QYGA 2ITQA 4U40A 4ANMA 4ZY6A 3EJ1A 5JQ5A 2O3PA 3KXNA 1MQ4A 4IWOA 4D2RA 3KULB 3RAKA 3DQWA 2ACXA 4Q5HA 3W2QA 4CKIA 1OPLA 3MJ2A 5CNNA 1W8CA 2WTDA 4PWNA 3W0MA 5LMKC 3BYOA 3PDTA 4USFA 5JN2A 4AT5A 4RLLA 3R7EA 3PY1A 4PDYA 3FXXA 4LV8A 4F9WA 5LARA 2XANA 2ETMA 4IAKA 1QPDA 3GCVA 4FKIA 2VTNA 3TMOA 2F4JA 2X9EA 3CKXA 1XH6A 2WQMA 4R7IA 2CGWA 2X81A 4TTHB 5CAVA 5LMBA 4ALVA 3GB2A 3HMMA 4FMQA 3I0QA 1ZOHA 4ZTRA 3EYHA 3CR0A 3GXLA 4QMNA 5LQFA 2W99B 3EFKA 4RZWA 5HLWA 4R77A 3O96A 4LDTA 3DDPA 1UA2A 5D11A 4EK5A 2PY3A 1T45A 2WU7A 4FTMA 3KRJA 2QR8A 4N0SA 1GIIA 1OIYA 2EVAA 5BYZA 3OP5A 1F0QA 2EUFB 2BZJA 3KC3A 4BTKA 3RHKA 1XH9A 2IVUA 2WMTA 4HW7A 3LFEA 4PUZA 3Q9WA 3RCJA 1XR1A 3SOAA 4BDCA 4J7BA 2XS0A 3BYSA 2BIYA 2GNJA 2PE1A 4FJVA 4FVPA 5M08A 3EYGA 5AM7A 3F2NA 4D4SA 4PTCA 1ZXEA 5AUTA 1PKGA 1R78A 2I6LA 3FZPA 4EYJA 5BUJA 2WGJA 3AC4A 5C4KA 4GVAA 3D2IA 3FUPA 2XKEA 2R3HA 3LFSA 2XNBA 3Q3BA 5AP7A 3W0OA 3KKVA 5AP0A 1WFCA 5TR6A 3EMGA 3A7JA 2JDVA 2W06A 2QOCA 3H30A 4O1OA 4RBLA 1ZZ2A 3R7VA 5FGKA 3WF7A 3WIKA 3ZMMA 1Q3DA 4CNHA 3BU3A 4ANOA 5A4EA 2GQSA 4BCOA 4EKLA 2WQNA 3LZBA 1PYXA 4JVGA 4FKQA 4OW8A 4YSJA 4CG9A 3FMNA 1Y8GA 1PMEA 2C3KA 5CZIA 3U54A 4I0SA 2FVDA 4I94A 3UVPA 4YJRA 3TUBA 4NIFB 3WE4A 1URCA 5KHWA 5H8BA 5HU3A 2UW6A 4AAYA 2XALA 2C1BA 3TCPA 4BZDA 2EWAA 5A9UA 5HO6A 4I6QA 2UW0A 3FZ1A 4QTCA 3KA0A 5FEDA 4ERWA 1YRPA 4YNEA 4G6NA 2JITA 3QKMA 2JKQA 2GQRA 3BIZA 3TKIA 5CEKA 3ET7A 3I4BA 3PWDA 5CQWA 3UQGA 3BHUA 3W1FA 3MH3A 4UX9A 3UOJA 3OCTA 3QGYA 3BI6A 4APCA 5AUUA 3OY3A 3PXZA 5J9YA 3PYYA 1SZMA 3C4CA 5LWMA 3O5AA 5DT0A 4FK6A 1YDRE 2C6KA 1FMOE 2XBJA 2QURA 4X21A 4AN3A 1NVQA 4ZJVA 3SV0A 3QZGA 1A9UA 4IWPA 4GRBA 3P86A 4X0MA 5D9HA 3ZC6A 2Y4PA 4U42A 5CQUA 4D2TA 5HE1A 2JBOA 2XKDA 5DR2A 4S31A 4GV1A 4IX6A 2B9IA 3TV4A 3DXQA 5ACKA 4I24A 3W16A 3W2SA 2IW6A 3OT8A 3HRBA 5IUHA 3D94A 3BYUA 4Z16A 4QMLA 5AIKA 2Q0NA 3M42A 1YDSE 3PXFA 4O21A 4U0IA 3P79A 4YHTA 5AWMA 2O0UA 3FMLA 4DGNA 4EOJA 5FXRA 4JG8A 4ZTMA 2C3IB 3D4QA 3OW4A 4RA4A 3U4WA 5AEPA 1ST0A 2R4BA 5GHVA 2Y6OA 2CNQA 3DNDA 1H00A 4MXXA 4FV5A 4E5WA 3PRFA 3N9XA 4A4XA 3R01A 4BDEA 4CZYB 2ITNA 3QQJA 3AGMA 1BYGA 2W1IA 5K4JA 2QLQA 5M09A 1ZY5A 4J99A 1H27A 3W8LA 4BDJA 3KN5A 3FLNC 4RVTA 5D41A 4RGJA 3ML1A 4C2WA 4JS8A 2ZV9A 4IZ7A 1H4LA 4DT9A 5M57A 3RAIA 3DZOA 4QP1A 2XJ2A 4MEDA 2F7XE 3C7QA 3OC1A 3R1YA 3LJ2A 4FZAB 1Y8YA 4IB1A 4I4FA 4XHKB 4UMUA 4MXAA 2R3QA 1Q8TA 3OMVA 2VZ6A 5B2LA 4M8TA 4IWQA 4FE2A 5AP4A 1H26A 2WTVA 4BCNA 3RZBA 1OKZA 2ZM1A 3CD8A 3GU5A 5IDPA 4LOPA 4EK3A 4E4XA 4CQGA 1R0EA 4O2ZA 3TWJA 3NAYA 3LOKA 5LCJA 5EW3A 3TNWA 4QMOA 5LVNA 4FZ6A 3AD6A 3FMKA 2J5EA 4DN5A 2XNPA 3MFSA 4GT5A 2B54A 1OVEA 3BPRA 3UG2A 3HRFA 3OT3A 3V51A 2NO3A 2PZ5A 5IUIA 3QGWA 5A4QA 2QOLA 3D5VA 3GCQA 4MBIA 3NCGA 3UP2A 5LWNA 3UDSA 1XJDA 4LL5A 4O7ZA 1BMKA 3WZUA 4ITIA 3UVRA 1P5EA 3PXQA 3S95A 4D55A 4FTAA 4JBQA 2UZUE 4OLIA 5D12A 5HE0A 4IM2A 3O71A 5KMKA 4L3JA 3RMFA 4CMOA 4F0FA 3AOXA 4HNIA 3CSVA 4FICA 4FV7A 4F1MA 1I09A 1FVRA 3V5QA 3MH0A 4QYHA 2XIRA 4YZCA 4BCHA 4BKZA 2R2PA 2JD5A 5CEPA 1UKHA 1YXSA 2YDIA 3F3TA 2QO2A 2I0HA 2VWYA 4AW0A 3BEGA 3P78A 4FGRA 3NVKI 4YTFA 3AKLA 5AP2A 1ZYLA 2GNLA 4LUDA 4QQJA 3ZS5A 2IPXA 4GH2A 3Q5ZA 4OTPA 3V5TA 5F95A 5IA1A 2FSLX 2R3PA 5HIDA 5J7HA 4L8MA 3NUUA 4JOAA 4B8LA 5BYLA 4G9RA 3MN3A 4ZTLA 3SX9A 5DE2A 3R8UA 3BL7A 1CSNA 4AA5A 3QZHA 3PSBA 4E3CA 4DH1A 4ZMEA 4UALA 3UNJA 2W5HA 3IECA 3RTPA 5BUIA 4B99A 3VUMA 4BDBA 3R1SA 1W84A 4TYGA 1WBSA 4EK8A 3BE9A 3O0GA 3PRIA 5JT2A 4PDPA 5DWRA 5EFQA 5LCKA 5FD2A 5FBOA 1IG1A 3DFCB 4RX5A 1J91A 3BLRA 4B8MA 4EHZA 1GY3A 3VJNA 3VBTA 4QP2A 4EQMA 3FKNA 2EXEA 5FRIA 3GEQA 3OVVA 4D1XA 3W2CA 5A54A 2XK3A 4OTGA 4BJJA 1U54A 3FBVA 2YM5A 3OCSA 1MQBA 4FKPA 4JQ8A 4XRJA 2BZKB 4NM7A 3L9PA 4DBNA 5KMNA 1SNXA 4G3EA 4FIGA 4ZOGA 3BBTB 4EC8A 3KFAA 4AOIA 4CQEA 2OJFE 2GS2A 3PVWA 3I1AA 3QCXA 3AG9A 4C62A 1BKXA 5ANEA 4RIXB 3VC4A 3DS6A 3FLZA 3W33A 4KB8A 4CFMA 2GTNA 3ENMA 3JR1A 5IEYA 3ULIA 1KOAA 3QA0A 3VWAA 5HVYA 3BBWA 2JC6A 2XK6A 3OEZA 2VO0A 4CCUA 4CFVA 3FMEA 3DB8A 3GC0A 3PZEA 2J4ZA 5ANDA 5J5SA 3UZTA 4YPSA 3DTWA 5A6NA 1UKIA 2R3GA 3FMMA 4OGRA 4PDOA 3ZFYA 4F6SA 1MP8A 5HO7A 1JPAA 5AFVA 2JDRA 4O0XA 2PTKA 5KKRB 4DDGA 3ZFMA 2QODA 3BGQA 3Q4TA 3OY1A 5H2UA 3QRIA 4DFLA 2PU8A 2ZAZA 2BRNA 4P4CA 4EWHA 1Q41A 1KOBA 3QC4A 4KIKA 5F20A 4RMZA 4FKSA 4ZZMA 5M4CA 4JX3A 5EW8A 1XHAA 4IFGA 3ZDIA 2C0TA 1AD5A 3ZEWA 2I7QA 1B39A 4EJ7A 3KL8A 3GC7A 2DQ7X 4ZEGA 3S0OA 3Q96A 2C3LA 4UBAA 3KK9A 3UBDA 4B7TA 4W8EA 4FTRA 2OH4A 2OXDA 4RIYA 4FKWA 4YC8A 3FZRA 4C38A 3DY7A 3VHEA 4R5SA 5M53A 4V0GB 2XIXA 4KAOA 3S3IA 3PA4A 3TYKA 3M1SA 4IAYA 2AC5A 2PL0A 3EZVA 1XQZA 4NM5A 4BTMA 2I1MA 3RBWA 2ZMCA 2ZV8A 1GOLA 1ZLTA 3GCSA 3NUNA 4FI1A 5D7VA 5ITAA 2RL5A 4ALUA 3BHHA 3MSSA 4PNKA 4C57A 4DE4A 3U8WA 1TZDA 3LXNA 3KQ7A 4XNEA 4BGHA 4QDVA 2PMIA 3ERKA 3FPMA 4FT7A 3EIDA 3R28A 5ANGA 2B53A 2OIDA 2GFCA 2PE0A 3KXZA 4NEUA 4XX9A 4QTEA 4TYHB 4JDJA 2XK8A 1PXPA 4FGBA 4RJ8A 4D0WA 2VTQA 5CS6A 2YCSA 3VNTA 3I7BA 2OI4X 5HG8A 2OF4A 5EQEA 4OTWA 1YXTA 2R5TA 5AM6A 1GZOA 5HBHA 4MBLA 5FQDC 2GPHA 4WSYA 4FTCA 2VNYA 3BX5A 4UWCA 2XBAA 1Y6BA 3PXRA 2I0VA 2J5FA 3V3VA 3COMA 4BDDA 4O84A 4HZRA 1DAYA 4O4EA 5I0BA 5GIPE 2OXXA 2VTSA 3UC4A 4DLIA 2ITWA 5BMSA 4XBRA 3QRJA 5I9WA 1H1PA 2ESMA 2YLEA 2B9FA 5DGZA 4YP8A 3DU8A 3QHRA 2R7IA 4KBKA 3ZSIA 4EYMA 3NAXA 1JLUE 2BRMA 2YIRA 3C4EA 3P08A 2G01A 4WBOA 5GJDA 3MBLA 4QT1A 1MRUA 1RQQA 3DJ7A 4EORA 3R2YA 5AR2A 2CKPA 4AGWA 2HENA 3VBYA 3S2PA 1VJYA 4XH6A 5BVEA 3PLSA 5BVKA 2X0PA 2WD1A 3FWQA 2IZTA 2RFDA 4JX7A 1YVJA 4JL9A 4AT3A 2WMSA 4YJVA 4F1TA 3CY2A 2ERKA 3E63A 2B9HA 2PSQA 3P5KA 3EFJA 4AGUA 4X3FB 3VHKA 4OT6A 2GNIA 2HW7A 4J52A 3NYVA 4PY1A 3TN8A 4GL9A 1YOMA 3RHXA 2JEDA 4F9AA 4CRLA 4IC8A 4MD9E 2W1GA 2QOOA 4OR5A 3R8ZA 1RDQE 3TDVA 1OUYA 4MK0A 2Q83A 2VX1A 2WTWA 4IZAA 2BR1A 5BVFA 3BGPA 4RJ3A 5EI2A 3FXZA 4IE9A 4FSYA 4F78A 4CKRA 1OL7A 1L8TA 5CY3A 3KMWA 4V01A 5K3YA 4DBXA 3RK9A 2OJGA 5IQEA 2F2CB 3MGYA 4WNOA 4CGAA 3U4UA 2AC3A 3C4XA 3G6HA 3QWJA 3PJ3A 4QMMA 3DCVA 4RFMA 5CEQA 2Z7QA 3AT2A 3NW6A 4AZEA 3BWFA 5DVRA 4M0ZA 3E8EA 2XIYA 4GT4A 2W4JA 3QXPA 4IDVA 4RG0A 4LGHA 2RFEA 2VO7A 2J90A 3SLSA 4L53A 2F57A 2W05A 4XUFA 3UP7A 2VX3A 5CSHA 4MD7E 4EH2A 4GCJA 4H05A 4AW5A 1OL6A 3DKFA 3UZPA 2BZHB 3T9TA 4EUUA 3MY5A 4D9TA 4F6WA 4A06A 4ACHA 3O7LD 4CZTA 2QOBA 2BILB 1MRVA 4FNZA 4ZSGA 1YXXA 1GIHA 3DA6A 5DRBA 5KZIA 4KWPA 4DH3A 4JAIA 5I9VA 5M56A 1ATPE 2UVXA 3BYMA 3O8TA 4MD8E 3OXIA 2YZAA 4BYJA 1VLRA 3VRYA 3WF5A 2BHEA 3ATTA 3ELJA 1E1VA 3ZDUA 4BYIA 4HGEA 5CU3A 4WRGA 2J9MA 4ACCA 3U55A 4QMWA 3B8RA 3P5JC 4FIHA 4PQNA 2VTIA 4BCIA 3LFCA 4Y95A 4DFXE 3VS4A 5B2MA 1P2AA 2GNHA 3LFFA 3PXKA 3QZIA 4FK3A 5HOAA 4YTIA 4C33A 3SRVB 2FO0A 3KEXA 3NYOA 2E9NA 4GS6A 5DHJA 3G15A 3NW5A 2O8YA 3TZ7A 3LCDA 4ZMFA 5AR5A 2JKMA 1IRKA 4H3QA 1YDTE 2YWPA 3IGOA 1ZOGA 3ZCLA 2GU8A 4TY1A 3VIDA 4XV1A 4D5KA 2QHNA 2UW9A 3HDNA 3QHWA 4PTGA 3SXFA 3II5A 2VD5A 4QMSA 3FAAA 1F3MC 5FTGA 2W1ZA 4YZBA 3THBA 4NL0A 1NXKA 1Q97A 2XEZA 5F4NA 3WZEA 1PXMA 5CNOA 3DK7A 4G6OA 3DJ5A 5DH3A 4EOQA 2PWLA 4F70A 4F9CA 4KKHA 3E88A 2ZMDA 4DHIB 2F7EE 4O1PA 3B8QA 4YLKA 5IQCA 2BAKA 5IQDA 3FY2A 3WYYA 2GDOA 4XOZA 4KABA 4BICA 4X6RA 2B52A 5LOHA 4BCMA 3W0PA 4KIPA 3RKBA 1R1WA 5ANKA 3A62A 1G3NA 1GNGA 3E62A 2C4GA 5ANJA 5ETCA 2G9XA 3VO3A 3VUKA 2WNTA 4QP6A 4FSRA 3P4KA 4MUQA 2ERZE