4PY1A

Crystal structure of tyk2 in complex with compound 15, 6-((2,5-dimethoxyphenyl)thio)-3-(1-methyl-1h-pyrazol-4-yl)-[1,2,4]triazolo[4,3-b]pyridazine
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
290
structure length
289
Chain Sequence
PTVFHKRYLKKIRDLGEGHFGKVSLYCYDPTNDGTGEMVAVKALKADAGPQHRSGWKQEIDILRTLYHEHIIKYKGCCEDAGAASLQLVMEYVPLGSLRDYLPRHSIGLAQLLLFAQQICEGMAYLHSQHYIHRDLAARNVLLDNDRLVKIGDFGLAKAVPEGHEYRVREDGDSPVFWYAPECLKEYKFYYASDVWSFGVTLYELLTHCDSSQSPPTKFLELIGIAQGQMTVLRLTELLERGERLPRPDKCPAEVYHLMKNCWETEASFRPTFENLIPILKTVHEKYQG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords Non-receptor tyrosine-protein kinase TYK2
publication title Kinase domain inhibition of leucine rich repeat kinase 2 (LRRK2) using a [1,2,4]triazolo[4,3-b]pyridazine scaffold.
pubmed doi rcsb
source organism Homo sapiens
total genus 93
structure length 289
sequence length 290
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2014-03-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4py1A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4py1A01
3EMGA 4FTNA 4BCOA 4EH2A 5ETIA 3QQGA 4AZVA 1NVSA 2IVSA 4JDKA 3QZFA 3NUNA 3RMFA 2VD5A 3BHUA 3RPRA 4CFUA 2OBJA 2VGOA 4FKJA 4EBVA 2CNVA 4PPBA 5C8KA 3FKNA 5J7HA 5CSPA 2VWWA 2W5BA 3VS0A 4PRJA 3S00A 3GBZA 3G51A 4HNFA 1UNHA 2I0EA 3PVBA 5CAPA 4N0SA 5CYIA 4BIDA 5I3OA 4EH7A 3OCGA 4ARKA 3EQBA 2UZDA 2RF9A 5AP7A 1ZOEA 2X2KA 3PIYA 1Q8WA 2PMOX 4OT5A 1I44A 2GS2A 3I79A 3L8SA 4EZ3A 3DY7A 3P7AA 2R3QA 1WAKA 4FIFA 3D2IA 3QAME 5T6KA 3VS5A 5CVGA 2GQGA 2J0LA 3MPMA 2CN5A 4Z7HA 3B8RA 4WO5A 3BV2A 3MS9A 3WZDA 5KUPA 3HKOA 3HZTA 4DTKA 3TV7A 5HE3A 3BRBA 3QCSA 5H8GA 2XB7A 4K0YA 3MESA 4O0RA 4RPVA 2DS1A 2XNNA 3C0IA 1U59A 3LFBA 3TV6A 1IG1A 3TDWA 5HD4A 1CKIA 2Z7SA 3OFMA 1AQ1A 5DEWA 4OTIA 3KFAA 5FQDC 2C6EA 2GPHA 5DRDA 5AR4A 4BZOA 1IASA 4PMSA 3VUDA 3D5UA 1XH7A 2CCIA 4CRSA 2BRGA 1GZKA 4FNWA 4QNAA 3BU6A 2WQBA 3LAUA 3OTUA 4FNZA 3VBYA 1H24A 4O0VA 5ETFA 2ZYBA 3R01A 3EL7A 3LQ3A 5K0XA 4BIBA 1H0VA 1O6KA 4GVAA 2FSLX 4TW9A 1ATPE 3A61A 2WMWA 4OUCA 4YHTA 2XUUA 1NW1A 3P86A 3A4PA 4L6QA 4LL0A 3RBWA 2WZJA 4GVJA 2H9VA 1FGKA 4QP1A 4A4XA 4CKIA 4CLJA 3UOLA 2WOTA 3PZEA 5EYMA 1BYGA 5CSHA 4F7JA 3T9TA 3H10A 5ETAA 1AD5A 5HIBA 3DV3A 1KOAA 4FTRA 2CNQA 3JUHA 3ZLWA 4C02A 2BPMA 2RL5A 4R8QA 3ZLSA 3QTWA 4IAIA 3TCPA 4CFWA 2VTRA 1M14A 3N4UA 5AR8A 1OB3A 1OECA 3E64A 4V0GB 3ACJA 1WBWA 2Y4PA 4TL0A 2W4OA 3HV4A 2VO7A 2W1IA 2UV2A 3FZTA 4JJRA 4DFUA 4ZAUA 3FMEA 4WHZA 4FI1A 4FSUA 2UVZA 3NYXA 3W32A 3NW7A 4M8TA 4UMTA 4ALVA 3PPJA 3MPTA 5GJGA 2C1AA 3FY0A 4UMUA 4YJTA 4E4NA 4JBPA 4QYFA 4IDVA 2B9FA 3Q5IA 2BRHA 2P0CA 3EKKA 4P4CA 2YERA 4O7YA 3V8TA 5HNIX 3GGFA 3RPSA 2EB2A 4C61A 2PVNA 3GEQA 2VTJA 4KRDA 2UW3A 4BDGA 4F7SA 1WVXA 5CU0A 2P33A 3LZBA 4FIJA 3DXPA 4IACA 4U40A 4O38A 3R7IA 4DEIA 4NTSA 3BYSA 4RIOA 2BRMA 4O27B 4L00A 2DWBA 3JXWA 4MX9A 4FT0A 3DLZA 3HNGA 3OCBA 5H8EA 3DOGA 4X3FA 5ACBC 5KZ0A 4AA0A 4RVTA 2VGPA 4FVQA 5CU6A 5IQFA 4ONAA 4FSZA 2ITTA 4K6ZA 3HMOA 3FV8A 4H3BA 3UG2A 3TACA 1ZOGA 2X4FA 4AZWA 4O0YA 4ZMFA 3FY2A 4R3CA 2IWIA 3NUAA 4DITA 4EOSA 3SGCA 4EK3A 3PXFA 4IC7A 3W8LA 5CASA 4YURA 4QD6A 3W16A 4ZZOA 3PDTA 2R3MA 3GQLA 2BKZA 2GNGA 2GSFA 3HMMA 2BHHA 3MI9A 4FICA 1PXLA 4OTDA 5CSXA 2EB3A 4BKZA 4IFCA 4CG8A 5CNOA 4FEVA 3U9NA 2WMSA 3SX9A 2QOIA 4FBXA 3RPOA 2ZOQA 4NFNA 3R9DA 4E7WA 5EHOA 3FXZA 4ZMEA 3LLTA 2GNHA 3PA4A 2AYPA 2X8IA 3GT8A 5KX8A 5KKRB 1PJKA 3LOKA 3PTGA 5IH4A 2C5VA 3O8PA 3FMLA 3PSBA 4O0TA 4Y5HA 3PFQA 3SQQA 4YP8A 2R7BA 5JZJA 3VUHA 3R71A 3VQHA 4L7FA 4QYGA 5KHWA 4CYIA 3LMGA 3K5UA 3W55A 4MCVA 1LUFA 3R22A 1JSVA 3R7VA 1R3CA 4ZTQA 1A06A 3SG9A 3HV3A 4NCTC 4YPDA 1IA8A 3UC4A 5M53A 2HZNA 4UXLA 3A8WA 3DXQA 4EH4A 3C0HA 4IB5A 4I92A 4AP7A 3Q9ZA 4WT6A 3CGFA 4AZEA 1Q5KA 4RA5A 3ZO2A 4A4LA 3LPBA 4QP3A 5LVPA 4L53A 1PXKA 5EYKA 4K18A 4WUAA 3QUPA 2GMXA 4QMVA 3UG1A 4YSMA 4NK9A 4EYJA 3JR1A 4FSWA 1ZMUA 4YC8A 3KULB 3QA0A 2FUMA 3REPA 2OI4X 4WOVA 2VTHA 5GJDA 2E9OA 5J9ZA 4UY9A 3LJ1A 5JK3A 4IWDA 1QPDA 3U6JA 3BKBA 2GFSA 2AC3A 1TQPA 4EOQA 3SD0A 3R02A 3ZO4A 1ND4A 3F5GA 3O7LD 1OPKA 2BZKB 4CFFA 4ANOA 3VW6A 2HXQA 4FYOA 4QMMA 4R3PA 3NNWA 3EQIA 2UW4A 3SC1A 4IH8A 2IW9A 4QNYA 4DT8A 3HV5A 4WD5A 4BZDA 3FI8A 5HHWA 4RX8A 4G3EA 4G3CA 2CKEA 1ZY5A 3RVGA 4IADA 1UWHA 4LM5A 4M97A 4BTMA 5IEVA 1P14A 2EXMA 3TKIA 5EW3A 3QQKA 3R73A 4IAFA 3G9NA 4UEUA 4O7WA 2PVKA 4TWPA 5GJFA 4GT4A 2RFSA 4IB0A 4EHVA 4ZXTA 4W4WA 3HLLA 5M44A 1UU7A 2OJGA 3CPCA 2KTYA 1U54A 4MF0A 3TNWA 1NVQA 2LGCA 5FM2A 4ZY6A 5HVJA 3VWAA 4HPTE 3NIZA 3SV0A 5DH3A 3VUKA 4BF2A 4CRLA 4Z7GA 4JXFA 3ZC6A 1ZARA 3F61A 2X1NA 3VF8A 4UMRA 3HA8A 1B6CB 4DH7A 5I9ZA 1TQIA 4YJSA 2FB8A 5CY3A 4F4PA 5BVEA 3Q6UA 3D2KA 4FG8A 5M08A 4BDKA 3P79A 5LWNA 1LEWA 2GHMA 3QTUA 3QTIA 5HNBA 4NUSA 4AN9A 1ERKA 2W1GA 3KGAA 5IF1A 2JBOA 4E4MA 5M4IA 2QC6A 3ZHPC 5C26A 2H8HA 3FLQA 3TN8A 5JGBA 3NS9A 4ZSLA 3UVPA 3GENA 2G2HA 3IS5A 3QC4A 5DNRA 2O5KA 2WMUA 4O7RA 2XP2A 4EOJA 3DBEA 3QU0A 5EW8A 4IWOA 4QP2A 3MA6A 2HWOA 4PV0A 3GOPA 3KC3A 4U81A 5FG8A 2UW5A 4AGDA 3O71A 4QMLA 1F5QA 4NIFB 4YHFA 3VNTA 3RM6A 2JDVA 2YAAA 4K1BA 4LL5A 4XG7A 5LARA 2CCHA 3KF7A 5TE0A 3FI4A 3VIDA 5HORA 2OSCA 5IA1A 3CGOA 2WIHA 3UIXA 4BWXA 2X6DA 4KSQA 2A4LA 4QYEA 1H08A 3DZOA 4BDCA 2CKQA 3H3CA 1KE8A 3Q4TA 2VAGA 3QYWA 2JDRA 4RIXA 4AN2A 4KB8A 2WQMA 1PYEA 4GJ2A 1O6YA 4ERKA 2X2MA 4DEHA 2VWXA 5CEPA 3KXMA 5DBXA 3CEKA 5JRQA 2GQRA 4YZMA 2CHLA 2CMWA 1STCE 3O23A 4JIAA 3QTRA 4TYHB 3QWJA 5E8TA 3HDMA 3OG7A 3SXRA 3ALNA 1YOLA 2OIDA 4FK3A 4IX3A 5FLFA 2BDFA 4MK0A 4XUFA 2QG5A 3R28A 5KZIA 1KUTA 4YJNA 4S32A 3E63A 5D41A 4L3LA 4JQ8A 3ZZEA 3MY5A 3FDNA 2W05A 1PXJA 3DB8A 4YJQA 4C3FA 1J7IA 4ACDA 2QOHA 4NCTA 3QWKA 4Y5QA 3E92A 3POZA 1DAWA 4GUEA 4H3QA 3MJ2A 1YKRA 5A6NA 3EN7A 4MQ1A 4XG4A 3OWKA 4HVSA 2ZV9A 3OT8A 4WBBB 5FUTA 3MIYA 3UPXA 1GIIA 4FV5A 2A2AA 5DR9A 1YI6A 2VNWA 5D7VA 2QO7A 1F3MC 4E5AX 4QQJA 3R8MA 3NUUA 3ORPA 3QC9A 5HZNA 3ZMMA 3AQVA 4KKHA 5HNGA 2VWVA 4CSVA 4FE2A 4NKSA 2UZBA 4EHZA 2C1BA 4K11A 3I60A 4IWQA 4KINA 4XNEA 2XK9A 2Y0AA 4U3YA 1H1WA 4UMQA 5F95A 5FGKA 3VBTA 1SYKA 4GV1A 2PU8A 3TIYA 2ZM3A 5B7VA 3KN6A 3E8CA 2WMAA 1CDKA 4KABA 2BR1A 3WI6A 4U97A 5GNKA 3BE9A 4FTKA 3P4KA 3UNZA 2XK8A 4U44A 3UNKA 3BHYA 3FYKX 5JFVA 4AZFA 2NP8A 2WKMA 4G31A 3FMJA 2P3GX 4C3RA 3FL5A 4QMWA 3MYGA 4JLCA 5HICA 5I9XA 3IK3A 5HG5A 4FVPA 1HCLA 2YWPA 3GC8A 4RFZA 1H07A 1OPJA 1YXXA 2P55A 3CC6A 3TUCA 4J97A 2JDSA 3E87A 3CJFA 5FBNC 4C38A 3W18A 5H9BA 4E3CA 4DBXA 2LAVA 2XBAA 3EQDA 4B9DA 1PXMA 4IZYA 4JR7A 1U5QA 2QOCA 3NR9A 1UU9A 4OBPA 3R21A 4KSPA 2FA2A 2YWVA 1BL6A 5FEEA 3RNIA 3Q2JA 3L1SA 2HAKA 2GTMA 2GNFA 5KMIA 4R1YA 3C4XA 4RFMA 5EW9A 3UVRA 2JKOA 4QT1A 5LVNA 3JVRA 4AOTA 4KS8A 2QLUA 3OTVA 1QMZA 4PMPA 5CEMA 3Q4UA 5FBOA 4RJ3A 4ZY5A 2WGJA 1URCA 1NT2A 1W0XC 2UUEA 4F99A 4QP7A 4I5PA 5BX0A 1IAJA 3DKCA 4XV2A 3KU2A 3QCYA 4Q5HA 3BX5A 1ZLTA 3IDPA 4RJ4A 3GU6A 5DPVA 3LXPA 2E2BA 4YLKA 4QOXA 4RC3A 2WTCA 5EDPA 4AW2A 3UO5A 5CT0A 3DZQA 3ZO3A 4F9AA 3LXLA 2PK9A 4MWHA 5IZFA 4DCAA 2YIXA 4S33A 1J7LA 4HVDA 1FQ1B 3LVPA 4ZLZA 2R64A 2E9NA 4GU9A 3L9LA 5FTOA 2XNBA 2IZSA 3B2WA 2FVDA 4I94A 4FKQA 4HCUA 3FWQA 2YCFA 2C3IB 3FLSA 4U43A 3ZEPA 4IJ9A 4D28A 2V7AA 4O6EA 2W5AA 3FZPA 3ZXTA 2CGUA 4L43A 3OY1A 5J5SA 5DG5A 4X6QC 4BFMA 4O7ZA 4QP6A 4IM3A 4RJ5A 4IVCA 4ZK5A 3LMHA 2JFMA 2YIQA 4G3GA 3UJGA 1ZYLA 1E1XA 4X3FB 2X4ZA 2R3PA 2Z7RA 4PY1A 2Z8CA 1MRYA 3LCTA 3MGYA 5HD7A 1JWHA 3CE3A 2ITOA 2PZRA 5HLWA 3IOKA 4AT5A 5B2LA 3LXNA 3CCNA 3E5AA 5K3YA 3EQRA 2XRWA 2YCSA 5A4TA 4G1WA 3FXXA 4GH2A 4UB7A 3HV7A 3MH2A 3VHEA 2GCDA 3DJ5A 4QMUA 5AADA 1OVEA 3LFEA 4A7CA 3ATTA 3FC2A 3RAIA 3FI2A 4UMPA 4O2ZA 5KE0A 4I0SA 5CF8A 3PXQA 1H01A 5HX6A 3DJ7A 3NUXA 4D4VA 2H6DA 1NXKA 4L45A 3GU5A 5DWRA 4U3ZA 4FKUA 4YC6A 2QG7A 3NVMB 2I40A 2VN9A 3BLHA 4FVRA 3OEFX 2XIXA 3W2SA 3UO6A 2C68A 3RGFA 4Q2AA 3NAYA 1H28A 4FODA 4DFXE 1H1RA 2VRXA 4YNOA 4F0FA 1BI7A 4JT3A 2G01A 2VWIA 3A8XA 3AOXA 4CCUA 4ACMA 5CZHA 1K3AA 2WEVA 3TG1A 4KKEA 2FSMX 2QOLA 2XM8A 2WTDA 2ITWA 3FQEA 2YEXA 4YJOA 1OI9A 2PE2A 2W1ZA 2XK7A 3WILA 4N70A 5A54A 3RHXA 4O22A 1O6LA 4XJ0A 5LWMA 4GKIA 4FKPA 4BHZA 3DJ6A 3PJ1A 5D1JA 4EUTA 3ORKA 4HGSA 3O96A 5ITAA 2PVLA 2Y9QA 3JY9A 4A07A 2XF0A 5TR6A 4DEBA 4AT3A 3ENMA 3GVUA 3BELA 4X2GA 5CAOA 5L2SA 2PUPA 4Z55A 2C5NA 3WZEA 2QURA 3GFEA 2IO6A 4BC6A 3B8QA 2YZLA 4FSTA 3VUTA 3HRFA 3TNQB 3FPMA 3PJ3A 4D1SA 4KWPA 1RW8A 3KMUA 4Y46A 3EJ1A 3KRJA 4Y73A 4EOKA 5I4NA 1J1BA 4FKTA 3CPBA 1PW2A 5CQUA 4BCMA 1XR1A 2Y6OA 3MH0A 3OBJA 4FKIA 4U79A 2GNJA 4YR8A 1W7HA 3L8XA 1UWJA 4FKOA 4IQ6A 2XKFA 4USDA 3VHKA 3D94A 3WF5A 4RJ7A 3UYTA 2OG8A 4XCUA 4LGHA 4L8MA 3PPZA 4IANA 4M3QA 2VWZA 3OVVA 2QNJA 3OXIA 5M51A 2ZMCA 5C1QB 3QFVA 3IGOA 2PTKA 4AX8A 3F69A 4FEXA 1VYWA 2VU3A 4FV7A 1W8CA 5AV4A 4E73A 4O7SA 1JSUA 4X21A 4GCJA 2VTAA 5JKGA 5AV3A 3BZ3A 1TKIA 4C58A 4QTDA 3WARA 4QP8A 3U55A 3R8PA 1U54B 2VTLA 3NWWA 3I0QA 4HCVA 4JS8A 4JRNA 4JNWA 4D55A 5CXZA 1WBTA 2IVUA 2WTVA 3FC1X 5L6WL 2QO9A 2QKRA 3D7TA 4IM0A 4TZRA 4GFOA 3OCSA 4WSQA 4E26A 1Q8TA 5L2TA 4U7ZA 2OIBA 4OGRA 4BCKA 3U8WA 4HVGA 3PPKA 4E20A 4MXZA 4LV8A 5DA3A 5CEIA 3THBA 4OBQA 2QU5A 3PG1A 3UYSA 5DEYA 3T9IA 5KMNA 5E9EA 3F7ZA 2OJJA 1CSNA 2OF4A 2WFYA 5EG3A 1FVRA 3Q53A 4PMMA 4BCFA 4MAOA 3ZO1A 5CF6A 2GU8A 3FLNC 5HBEA 3SAYA 4D4RA 5BPYA 4N57A 5FEQA 3AC8A 5HEZA 2WO6A 2HCKA 3QF9A 5ANOA 3TUDA 2I0VA 1PXNA 2VX1A 3P08A 4ZJIA 1S9IA 2BCJA 5E8VA 2FYSA 3Q6WA 4PL3A 3BQRA 2YFXA 3QTQA 4XYFA 3FHRA 5EI8A 4FC0A 5AR3A 2R3IA 4GKHA 3VS3A 2OJIA 2B55A 1W84A 3L9NA 4Q9SA 2EXCX 4IB1A 3SXSA 4ENYA 2BILB 3W2CA 3ZLXA 4U0IA 3UO4A 2UZEA 2UZLA 4WIHA 4ORKA 3ROYA 4BCQA 2F49A 4RIXB 3MDYA 5IEXA 4F0IA 2BFXA 3DDPA 5CX9A 3KY2A 5LXMA 4JL9A 5A46A 5DFPA 4MXYA 4BGHA 1OKWA 4RIWA 4C35A 5AA8A 1VR2A 4M13A 5HG9A 4J98A 3C0GA 2XNGA 3UP7A 3C4WA 4ASZA 3RWQA 1Q8UA 3LQ8A 3PVGA 5EOBA 2ETMA 3IG7A 4U80A 4K33A 3VBQA 3NIEA 4USFA 3KXXA 3FHIA 4JDHA 1SZMA 2UW0A 3PP0A 3RINA 5ANDA 4EKKA 3PXZA 2F9GA 2GNLA 4RRVA 4D9UA 3FI3A 4FIIA 4H1JA 4FEWA 3TWJA 1P2AA 1V1KA 4CV9A 4GEOA 3DTWA 3NUSA 4EC9A 3QZGA 4W9XA 2UZTA 4DFNA 4WBOA 5HBJA 3DBQA 3IONA 3H0YA 2A19B 2RIOA 3KN5A 4FIGA 4IZ5A 4JAJA 4C2VA 4F7LA 5AA9A 4QTCA 2PULA 5AMNA 4XG9A 3LCDA 2B4SB 4LUDA 1JPAA 2V0DA 4CEGA 3QQLA 5KMJA 2VZ6A 3PG3A 1Q97A 2J5EA 2VX0A 3F5PA 3P7CA 3E8EA 4H58A 4MEDA 4P90A 5F4NA 4L7SA 5CVHA 4V04A 5CI6A 5BYYA 4NM5A 1SVEA 4J1RA 5E7RA 2O64A 3C13A 2RFDA 4O6LA 4EQUA 3W1FA 3Q9YA 4BDEA 4L44A 3I5NA 1JAMA 2OIQA 5EOLA 5AWMA 5JQ8A 2VWBA 4FEQA 4NM0A 3QRIA 5EDQA 3WOWA 4DYMA 4F65A 1XH8A 2R7IA 2W1DA 4LFIA 3R9RA 2VTSA 5E8ZA 4A9SA 2Z2WA 4ANNA 4E5BA 4C4EA 3PP1A 4EKLA 4DA5A 4G9CA 2BUJA 3DNEA 4ZS0A 5LMAA 4C8BA 1MQBA 5IQBA 4IX4A 3OUNB 1YWRA 4Y83A 1FBNA 2PUIA 1W98A 4FSRA 4IIRA 4WA9A 2G2IA 4JBOA 4F09A 2W4JA 3ORXA 1TVOA 2XNEA 4FTMA 3UODA 2VNYA 2XNOA 3ODYX 5CNNA 3D9VA 4AFJA 3BYOA 3E93A 1YRPA 4LOOA 2R3GA 2IW6A 3MWUA 3AC5A 4S31A 4MTAA 4YMJA 2RG5A 1M17A 4G34A 3QTZA 1KV2A 4O0WA 3W2RA 5C4KA 4ZZMA 4BN1A 5HBHA 5AEPA 4J95A 3RZBA 4O0XA 4RWIA 4P5ZA 4HYUA 4KBAA 3EWHA 3KRLA 4FTJA 2WQNA 4AA5A 5AAEA 2W9ZB 3FZRA 3IGGA 3ORNA 2DUVA 2R3HA 3C4ZA 4ZSAA 2Z7LA 4HJOA 4CXAA 4RWJA 4XLIA 1KE9A 2V62A 2PUUA 3FUPA 1YDTE 5C03A 4QMOA 1J3HA 5LCKA 2J7TA 5D11A 3WF6A 3CTQA 5CEQA 3H9OA 4HNIA 4GFGA 5A4EA 4D2WA 3ACKA 3P0MA 2OICA 3CTJA 3DAKA 2PVRA 4GRBA 4BICA 2W17A 4J99A 3RNYA 3KQ7A 4LOPA 4FIEA 4U41A 3TJDA 4YTCA 2CNUA 4JIKA 3Q9XA 5BVWA 2R2PA 5T3QA 2RG6A 3QLGA 3GCSA 4LGDA 5A4LA 4YJUA 3R30A 3BWFA 2BZHB 4DBNA 2QHMA 5L2IA 4XP0A 5CXHA 4CTBA 4BDFA 4UBAA 1Q99A 3HDNA 2EVAA 2YITA 2JBPA 5HOAA 5F1ZA 4C59A 2C6IA 4Z16A 1PKGA 1OGUA 1ZAOA 3KK9A 3OW3A 3PVWA 3QA8A 2OFUA 3KXHA 3SOCA 5M09A 4V01A 2OU7A 4EOLA 2FGIA 3UZPA 4EH5A 2WMBA 4MH7A 4FKWA 3F5XA 1GZNA 3KXGA 4Q9ZA 4DEGA 3W2OA 2IZUA 3D0EA 3LFCA 3VN9A 4BCPA 3F66A 1IAHA 2O0UA 3BCEA 2W1EA 4XH6A 5BUIA 5HQ0A 3I5ZA 2R3RA 2V7OA 4GIIA 3VS7A 2A0CX 3BHTA 5HG8A 3VF9A 3ZFYA 2VTPA 5CU4A 5E1SA 3ZUUA 4NU1A 4O1PA 2ZV8A 4BHNA 2J4ZA 5A9UA 1V0OA 3C1XA 4PP9A 4QO9A 5HLPA 5E8SA 2W06A 5L6PA 4DT9A 3L8PA 4FTIA 3GC7A 4QMZA 1TQMA 4KIKA 4FG7A 3LM0A 4XHKB 3DBFA 4FKVA 1OUKA 4I4FA 5EYDA 5BVKA 3COIA 4TWCA 5C8NA 2FH9A 2ZM1A 4NW6A 2G2FA 4I5HA 4YZDA 1ZOHA 4NH1A 5AAFA 4R5SA 4BWKA 4MBIA 3KL8A 3B2TA 1YXVA 3F6XA 4LUEA 2R3KA 3PXKA 4BVUA 3CY3A 3VAPA 3UOKA 4BTFA 3U4UA 4E4XA 3FQHA 4F0GA 3PSCA 3TIZA 1YXSA 2JAMA 2ERZE 3QRJA 3FSFA 4CLIA 4YLJA 2BIKB 2PVJA 2OXXA 4FV3A 3VBWA 4UXQA 2JLDA 3PY0A 4YTIA 3ZU7A 3LMIA 4HZSA 3HYHA 3EH9A 4XG3A 4J96A 3AC1A 2YM5A 2ZDUA 3DKOA 2VV9A 3IO7A 3DB6A 3EN6A 4WNPA 1PF8A 2J50A 4EBWA 3N4TA 4ZSGA 1Q41A 3G6GA 1ZMWA 5AR7A 3IPHA 2UZWE 4QYHA 3LCSA 1LR4A 2X39A 2UW6A 2ONLC 4WKQA 3G6HA 4BWPA 4HVIA 3I1AA 3U9CA 5EM7A 4O81A 3EQCA 4AWIA 3DS6A 3GU8A 3LHJA 3SW4A 1U4DA 4APCA 4ASEA 3R7UA 2WPAA 2GFCA 3EKNA 4IX6A 3U4WA 4M0YA 4RLLA 3HVCA 3AD5A 3JY0A 1H1QA 1WVWA 5TKDA 2WOUA 3MPAA 2XVDA 3D5WA 4FMQA 4MD7E 4ZJVA 1R78A 4OLIA 4XS2A 4C2WA 3ZH8A 4WRGA 5M55A 3U6IA 4C0TA 4R1VA 2XZSA 5FWKK 5J79A 2F4JA 2BKKA 5FRIA 4GFMA 5I9VA 2B1PA 3FZSA 2WAJA 4BIEA 4YZCA 3G2FA 3OF0A 3VBXA 3BHHA 1PMVA 2PVFA 3AMAA 4J7BA 1FMOE 2ZB1A 3D7TB 1OITA 4PDOA 4WG4A 4YC3A 1OBDA 2WMVA 4OTWA 4AE9A 4JRVA 5JZNA 4JI9A 2OKRA 4D2PA 3S0OA 4BDAA 1YHVA 3R2BA 2NRYA 3ZUTA 5CU3A 1OL6A 4XG6A 4U5JA 1QL6A 2HZIA 4G6OA 5AJQA 4MVFA 3UOJA 3LFSA 2W9FB 4KKGA 4ANLA 2PPQA 3ORTA 2BTSA 3HMPA 3EZRA 4DLJA 3PSDA 4IAKA 1W82A 4M66A 3PYYA 3AT4A 3TKHA 4A9RA 3R00A 3A60A 5FXRA 3I6WA 5KHXA 3L9PA 5JH6A 2W96B 3DTCA 3PJ8A 3UTOA 4YZBA 1JNKA 5IQIA 3BEGA 4HPUE 3H0ZA 4MHAA 4FZAB 4XEYA 3TEIA 2QR7A 2BVAA 3EN4A 4I0RA 2JKKA 4F1TA 5AV1A 1Y8YA 4FT9A 4EWQA 4F6UA 5CZIA 3QKKA 3AC4A 1XWSA 2GHGA 4FTCA 3BPRA 2XA4A 2WU6A 4IHPA 3QQFA 2NRUA 4LRKA 4I23A 1UKHA 3E62A 2J0IA 2JIVA 3NRMA 2PZ5A 5AP3A 3DK7A 4JX3A 2J2IB 4M0ZA 1SNXA 1OL1A 3WF8A 3K3JA 4C33A 5JMSA 4O91A 4DC2A 5DOSA 2UZOA 2XK4A 3PXYA 4XG8A 3TKUA 4FTLA 4JR3A 2QODA 4O0UA 2IVVA 3UNJA 5AAGA 4EOOA 3Q3BA 4C4IA 1JSTA 2RKUA 2J0MB 5G6VA 5HI2A 3KRRA 2CLQA 3TNPC 1R39A 4CMUA 4ZP5A 5KNJA 3FEGA 3C5IA 3R1NA 3OXTA 3ZYAA 2PVHA 4EH3A 3V51A 4FK6A 4YJRA 4RIWB 3V5TA 3QZIA 1UV5A 4EI4A 1XQZA 5DHJA 1WBVA 2P4IA 5CANA 3K2LA 5L6OA 4QRCA 4EJNA 4D4YA 1V0PA 2JIUA 3A7GA 3KF4A 2CJMA 3ZFXA 3V5PA 4RLKA 4D2TA 3ORIA 3S3IA 3PIZA 5TO8A 5EM6A 5JT2A 1OUYA 4R7IA 3LIJA 4IBMA 2C6LA 1Y6BA 3ID6C 4J52A 2VTNA 4NZWB 4TNBA 5C4LA 1DM2A 3OZ6A 4Z9LA 1JOWB 1H8FA 5AV0A 2NPQA 3WF9A 2WMTA 1E9HA 2OF2A 3OOGA 3VVHA 1J7UA 5IQHA 3ORMA 3C4CA 1FGIA 2XKDA 4KUJA 2HELA 4BR3A 3KREA 3EB0A 4BDHA 3F2NA 3D5XA 5KMKA 4PDSA 2UW8A 3CKWA 2B54A 3EQGA 2JITA 3KKVA 3LJ2A 3G15A 3TV4A 3W33A 4KBCA 4AW0A 5LOHA 1BL7A 1SVGA 2GDOA 2J0JA 3HA6A 3MVMA 5CWZA 3P7BA 4FGBA 1JKKA 4KBKA 4NJ3A 2C6TA 4E6CA 3AGLA 4PPAA 4DGNA 4IFGA 1ZWSA 2C47A 4GUBA 3VUGA 3OOMA 2SRCA 4O83A 3DDQA 4YGAA 3CP9A 3GCPA 4RZWA 3ZBFA 3UQFA 3QHWA 5GZ9A 3UC3A 2FSTX 4W4YA 4YO4A 2OGVA 3K3IA 2OZAA 4QP4A 3S2PA 2W4KA 2QLQA 5A4CA 1YI4A 4L3PA 3C4EA 5FTGA 2CKPA 2VTMA 4HGEA 5M4CA 4B99A 4CT1A 4EYMA 1L3RE 3KB7A 2QOOA 3BLQA 3C5UA 3DFAA 4FL3A 4CT2A 1PKDA 3DQXA 4J8NA 3TL8A 3P5KA 1YQJA 2QOKA 3LFDA 3C7QA 4QMPA 4LRMA 4RVKA 2WTKC 2V55A 2JAVA 2VWYA 3OT3A 4MQ2A 1XKKA 2JDOA 4TNDA 3R0TA 5IA3A 4C62A 3C51A 3R1QA 3SRVA 3VULA 2WTJA 4DTBA 3QHRA 4M68A 2XJ0A 5KKRC 2YABA 3TUBA 3DKGA 2WMXA 4ZIMA 4TT7A 3ZZWA 2H34A 4I3ZA 3NCZA 2WD1A 4BTJA 4JBVA 4C34A 2HIWA 3GC0A 4PF4A 2YIWA 4TYGA 3DNDA 2DQ7X 2YM6A 3IQ7A 4RX9A 3PWYA 3S1HA 4AQCA 3TZ7A 1REKA 3OMVA 3R9HA 2W1CA 4JDIA 5HIDA 3EFWA 5LVLA 3RAWA 3VO3A 4BBMA 4DN5A 5KMMA 5TF9A 4O84A 3PIXA 3QGYA 2W1FA 1PMEA 1XHAA 1YDRE 2C6OA 4YSJA 3CD8A 5M4FA 4TYIA 3V5LA 1KV1A 4FTOA 1CKPA 5I9YA 4I21A 3I4BA 3QKMA 5KO1A 3PY1A 4D5KA 5AR5A 4FUYA 3EZVA 4ZTMA 2VX3A 4ACHA 3V8SA 2WB8A 3MH3A 4XRJA 2C6KA 4AZTA 3LLAA 4I20A 5M56A 2R9SA 1Q8ZA 2QOFA 4ZSEA 2Y7JA 3RPVA 3TZMA 4ANSA 4L68A 3H30A 3KCFA 4ALWA 5H8BA 4L3JA 4M14A 3NZ0A 5J87A 4YUQA 2C5XA 3SOAA 2J51A 1H1SA 3AG9A 4YBJA 2XJ1A 3D14A 3RAKA 4DEDA 4I6FA 5EKOA 5LCJA 3FMMA 1CMKE 2C6DA 4QMTA 4BBEA 2UZUE 1H25A 3O7LB 3QZHA 4RWKA 4EZ5A 1ZMVA 3PY3A 1R0EA 2PVMA 1Q3WA 4ZJJA 4A9UA 5A4QA 2B0QA 5E4HA 4FOBA 4JG6A 3GCUA 4FV6A 4HOKA 4EK8A 3BBWA 4OT6A 1PMUA 2UZNA 5CEKA 5AX9A 4PL5A 5HLNA 3RI1A 2HYYA 5IUHA 3ZSGA 4BGGA 2XK3A 5LVOA 5CI7A 5CLPA 5DI1A 4BKJA 4FZDB 3EQPA 1B38A 1QPJA 2ZV7A 4FNXA 4G17A 4QPMA 4F70A 5AFVA 2YM7A 5IG1A 1OIRA 4P7EA 3FQSA 4KIKB 4CV8A 3EQHA 1UA2A 3NPCA 4DLIA 2BTRA 2XIZA 5CVFA 4YTFA 2YAKA 4UWYA 3LXKA 3SVVA 5CAVA 3MVLA 2PMNX 2ZVAA 4RIYA 3HAVA 3MN3A 4O0SA 2IVTA 3MFTA 4IC8A 3RK7A 5IQAA 3NGAA 3QXPA 5IA0A 3VS2A 4LOQA 4ASXA 2QQ7A 5EH0A 5EYCA 4MXXA 3F7WA 4QMNA 4L42A 4X2FA 2W5HA 5A14A 4YZNA 3KCKA 3MVJA 5L3AA 5IUIA 5AUWA 2ESMA 4BZNA 4CG9A 3WIKA 4Y8DA 2P2IA 3FYJX 3QD3A 4PNIA 3RAHA 3BGPA 2EU9A 3KMWA 3HUBA 3EQFA 4I5CA 1WCCA 3OW4A 4G2FA 4OAUC 4DFZE 2C69A 5JN2A 4S2ZA 1APME 3LJ0A 4EK6A 3TTJA 2PWLA 2WTIA 3BYUA 5KCVA 5AUVA 5JGDA 4PPCA 3DFCB 3V01A 2PL0A 2PUNA 4PTGA 4H05A 2XRUA 2ITYA 3NYVA 3CXWA 3JS2A 5AP5A 5HO6A 3RP9A 2B9JA 3MIAA 5EQEA 1JVPP 3RALA 5HTIA 4QMQA 2CKOA 2YIYA 4F6WA 2OH4A 5DYJA 5K5XA 3ZRMA 2FO0A 5EM5A 4ZY4A 2HOGA 3AC2A 3QALE 3EL8A 4G6LA 1SM2A 3CY2A 3R1SA 4ID7A 4MNEA 4WNMA 5LVMA 4X2JA 1FOTA 1JKSA 4QMXA 5AIKA 3CSVA 2F2UA 2GS6A 4K77A 3VC4A 4BI1A 4EC8A 5BQ0A 5EKNA 4IB3A 1IA9A 3WZJA 5CF4A 3U87A 3NNUA 3EN9A 3TTIA 5LQFA 4DGOA 1H0WA 4HCTA 2YZAA 3JPVA 3FLZA 4X2NA 3HGKA 4GL9A 1RQQA 4D58A 4PMTA 5ANKA 4ZTLA 1P5EA 1IEPA 5HE0A 2Q0BA 3HRCA 2QVSE 3R04A 5DE2A 4M67A 5HG7A 2ZAZA 4FG9A 4W4XA 5JRSA 3POOA 4YO6A 3CBLA 3GU7A 2X9FA 4R6VA 4E6AA 3VUMA 1DAYA 2BAKA 4ITJA 2CGWA 2BRNA 5ETCA 2XMYA 4DGGA 5LMBA 2PMLX 3GB2A 5HX8A 4LG4A 4YHJA 5K4JA 4GYIA 2QCSA 2YM8A 4IDTA 4C57A 4TXCA 5FDXA 4F9BA 5AM6A 4ZTRA 4UN0C 4YPSA 1OIYA 5AP6A 4IW0A 4QMSA 4RC2A 4E6QA 4DG2E 5I9WA 4DTAA 4WG5A 2OXYA 2HY0A 4IAYA 1Q62A 1BMKA 1RDQE 2BALA 1L8TA 5M57A 2VWUA 4E1ZA 5B2MA 2REIA 4C4FA 4RC4A 3RTPA 4KIOA 1S9JA 1XH6A 4BDJA 3WBLA 1ZZ2A 3BGZA 5AP0A 4FZFB 4XRLA 2Y8OA 5IQEA 2ZDTA 3GXLA 4IAAA 4U42A 1YXUA 4RSSA 2OZOA 3FL4A 4OTGA 3MB6A 3DKFA 3N4VA 2F57A 1QPEA 4OBOA 1M7QA 1U46A 3M11A 3A7FA 4TTHB 2A1AB 1EH4A 3W8QA 3R63A 2KULA 3ZRKA 5L8LA 3PE2A 3A62A 4RWLA 5AIRA 4TRLA 3R7YA 2X2LA 4I6HA 1REJA 4M12A 4ITIA 5E92A 4FIHA 5FDPA 3QXOA 2UW7A 2J5FA 3FLWA 2H96A 5I3RA 2BRBA 4H1MA 4GG7A 4LQMA 3NW6A 4A4OA 2XIRA 5EK7A 4EZ7A 3F2RA 3UIBA 4BYJA 5FP6A 4DH8A 2JKQA 2ITXA 4U6RA 4FTTA 1WBOA 3NDMA 4CMOA 2F7XE 4R7HA 4I6BA 3WYYA 2I1MA 4XBRA 5DT3A 5AM7A 3EIDA 3GP0A 3FZOA 3ZEWA 2JFLA 4AU8A 4D0WA 3UOHA 4FYNA 5J1VA 5JFSA 3JYAA 4ASDA 4HGLA 3ZTXA 4DG3E 3AT3A 2YDJA 4FT3A 4AOJA 4H3PA 3VS4A 3E3PA 1YVJA 2J9MA 3VJNA 2RFNA 4IX5A 4FUXA 5J95A 3O2MA 4FL1A 3DBDA 1ZYSA 3FSKA 5HESA 4IXPA 4LV5A 5M4UA 4ZTHA 4B8MA 4DCEA 4G6NA 2YN8A 2ITQA 2VTOA 3E7OA 3QBNA 5HTBA 4ACCA 1XH4A 2C5YA 2HWPA 2HK5A 2ITZA 2BHEA 2RSVA 4BY9E 3QX2A 4QTBA 3SHEA 4CCBA 5CENA 4FV1A 5BMSA 5AP2A 2R3OA 4RA4A 4X3FC 3VBVA 4BTKA 3O51A 3PE1A 4L9IA 2VTTA 4M69A 2OJFE 4E4LA 4F9CA 5TOZA 1YWVA 4EOIA 3NW5A 3QL8A 3HX4A 3R8VA 3ULIA 4RGJA 4BGQA 3GC9A 3P1AA 3AXWA 2OZAB 3JVSA 5BNJA 1H27A 4ZTNA 1HOWA 3HV6A 3S95A 1UKIA 3R8LA 4RT7A 2YDIA 4AUAA 4JX7A 3O8UA 2I0HA 4FT5A 4TYHA 4GK3A 3KXNA 3NYOA 1IR3A 1Y57A 2WQOA 4N6ZA 3H4JA 1HCKA 2XEYA 3R9NA 3FMKA 3G9LX 1ZYDA 3BLRA 2OO8X 2JEDA 4MD8E 5BYZA 4M15A 3COKA 4DFLA 4YU2A 1CM8A 5HVKA 5IA2A 3AD4A 4I24A 4IMYA 3SRVB 3ZUVA 2O65A 2BAQA 2BZJA 2WELA 4JVGA 4KA3A 4FKLA 5AR2A 4D4SA 4EORA 1FVTA 4W9WA 5IH6A 3DK6A 3WZUA 3R83A 1V0BA 4KNBA 4JAIA 4YZ9A 2GQSA 2ETKA 2QI8A 3R8ZA 2C0OA 4FT7A 5AUXA 4F1MA 2VO0A 3UDBA 3F82A 1H26A 5IDNA 2OWBA 3PJ2A 3LFAA 4MD9E 5E8YA 4E93A 5DMZA 3IW4A 4Z3VA 4F64A 2XIYA 5C9CA 1YDSE 1O9UA 3E7VA 3IW8A 4BCIA 4WUNA 2XCHA 3A7JA 3CS9A 3TZ9A 3NVKI 3MFUA 3OWJA 5IU2A 4AW5A 4ALUA 3R7GA 1GIHA 5KMLA 5AUUA 4CZTA 4WNOA 1YWNA 2IG7A 1OPLA 2F7ZE 3ANRA 3RCDA 3VQUA 1MP8A 4UWCA 4XBUA 5EFQA 3NMUF 4NJDA 4AN3A 4BL1A 3WE8A 5K9IA 4DH1A 3UQCA 3VJOA 3BU3A 2JGZA 1YOMA 5HCXA 3Q32A 1JBPE 5F9EA 4O7TA 2HW6A 4HZRA 5KBRA 4O82A 5BYLA 1ZY4A 2BDJA 3TM0A 4BI0A 4PUZA 2NO3A 4BKYA 2VO6A 3HECA 3ROCA 5BVOA 3OBGA 5J7BA 4IVAA 4GK2A 4EH8A 3UZTA 2Y4IC 4TPTA 3OCTA 5HU9A 3ZM9A 3CJGA 4B0GA 3T8OA 3GCQA 4FTQA 1WMKA 4AA4A 1T46A 1JKTA 5HO8A 4EUUA 4F08A 5JFWA 2B53A 3EYHA 2UVYA 3AGMA 2JIIA 2EXEA 4B4LA 4HYIA 4FTUA 4TYJA 3HP2A 2ITPA 2HXLA 5JGAA 4CZYB 2UZVA 3QRTA 4GT5A 4GU6A 5DGZA 4APPA 4CQEA 3KRWA 4NFMA 1CKJA 1J91A 1VEBA 2ZM4A 3DCVA 4I5MA 1GY3A 2C5OA 4JBQA 4XG2A 4F9WA 2YLEA 2YACA 3AMBA 3MTFA 4CYJA 4UX9A 1AGWA 2J0KA 1GOLA 1G8SA 4QTEA 4BCGA 2YHVA 4I0TA 3Q04A 5CSVA 5DIAA 3ZS5A 3OY3A 5CF5A 4AW1A 4C7TA 1GIJA 4XV1A 2RFEA 3MTLA 5D12A 5CU2A 3T3UA 5JSMA 3H9FA 5J9LA 4PDPA 5LMKC 4AAAA 3CQEA 1KE5A 1Q24A 2BDWA 3OEZA 3SKCA 1OIQA 3DU8A 3O17A 5J8IA 4RIYB 3IDCA 3EYGA 4MXAA 3GFWA 1KOBA 4EQCA 1H1PA 3CD3A 4FGRA 3WE4A 3FZ1A 4R7BA 3C50A 5LJJA 1K2PA 3OD6X 3VS1A 3PA5A 2CN8A 4TKSA 5C8MA 5ICPA 4BDBA 2X0GA 2ZB0A 3UZRA 4LMUA 2O8YA 1OL7A 3PVUA 3LE6A 3DLSA 4O7NA 4FSYA 3FJQE 4G16A 4IM2A 3UMWA 2C3LA 3GCVA 3OXZA 3R7EA 4D1ZA 3QQUA 5CEOA 4PX6A 4A9YA 4P2KA 3HUCA 5CTPA 3U54A 4JQ7A 4GMYA 2YJSA 5HO7A 2W99B 4N6YA 3OROA 1MQ4A 3COHA 3R7OA 2WQEA 4M84A 4FSNA 3TI1A 3D5VA 3V5QA 2ITUA 3ELJA 3FKLA 2C3KA 4NW5A 1PHKA 2CSNA 5BVFA 4CGAA 4DINA 2AC5A 3IECA 4Q5EA 2DYLA 3IDBA 5IEYA 4KS7A 3M2WA 4DE4A 3HP5A 2WTKB 3E3BX 1NY3A 1IRKA 5BUEA 3UP2A 3MB7A 4WRSA 4IZ7A 4BYIA 4D1XA 3KA0A 5IDPA 2BZIB 1KE7A 4KIPA 4UALA 4EK4A 4MNEB 2VTIA 3E8DA 4XP3A 5D9HA 5T68A 4C3PA 5AV2A 5DT4A 1PXPA 1UU8A 4P5QA 1Z57A 4K9YA 4M7IA 5E8WA 4DEAA 3A7IA 3SG8A 4GW8A 4QQ5A 1URWA 5FD2A 1Q3DA 2R5TA 3GI3A 3LM5A 3I7CA 4XV9A 3RKBA 3QQJA 4F9YA 4IVBA 1H00A 5FEDA 4D9TA 3GU4A 3UIMA 5EDRA 4ZS4A 5L4QA 3NNXA 1YHSA 3SW7A 4RVMA 4AGUA 4PNKA 3NAXA 2J90A 3ANQA 2C30A 3FMDA 4D0XA 4ITHA 2PZYA 1B39A 4Y85A 4YJPA 3VRYA 5E8XA 3EOCA 3K54A 3N51A 4S34A 4R5YA 2FSOX 2Z7QA 3OC1A 4JQEA 1JQHA 2CGVA 3T3VA 4CKJA 1YHWA 3BYMA 5AUTA 3LFFA 4G5JA 2PVYA 5AX3A 1OKVA 4CD0A 3QD2B 2BAJA 2X7FA 4FNYA 3FPQA 5IA4A 5EQPA 2WMRA 2X7OA 2PE1A 3G0FA 5L8KA 2PYWA 1NVRA 2CPKE 3MFRA 4DAWA 3NUYA 3RM7A 1WBPA 2X7GA 2XKCA 3NNVA 4LYNA 2YDKA 3IW6A 4QTAA 4NYEA 4I22A 3QD0A 4I1ZA 4EHGA 2G1TA 4EOMA 4NM7A 3WF7A 5IMXA 4XOZA 3MV5A 3BEAA 3LKMA 1RE8A 3I0OA 3R6XA 3ORLA 4EL9A 4EK5A 3FXWA 4DH3A 4EOPA 4IWPA 3A99A 3F5UA 4F63A 3G5DA 4FEUA 3WIGA 3V5WA 3SLSA 3PRFA 4LI5A 4RQVA 2C6MA 3F2AA 2O2UA 4YBKA 4BRXA 2VTQA 1NA7A 3AT2A 4CVAA 5IKWA 2PHKA 3MY0A 4E5WA 5GINE 1Q8YA 3IKAA 4FSQA 5CAQA 2YCQA 3FE3A 3QYZA 3DPKA 1VYZA 3MSSA 5FP5A 5J9YA 2QOQA 5LMKA 1Z9XA 3AD6A 2Z02A 4ACGA 5DLSA 3FAAA 4FV9A 4USEA 5IH5A 3SDJA 5CQWA 3DAEA 3MW1A 2XH5A 3TNHA 4EQMA 3HAMA 2YJRA 4V05A 4L67A 1UU3A 2PMIA 3BQCA 4L46A 2I6LA 4DEEA 2X9EA 4ZEGA 4JDJA 1G3NA 2BMCA 5JEBA 4II5A 2R0UA 3FKOA 1GJOA 4J71A 4C4HA 5F20A 4CKRA 4A06A 4J8MA 4OTQA 4D2SA 5IUGA 3EN5A 1OL5A 4FKRA 5J5TA 3P78A 3VRZA 1A9UA 4AXAA 3L9MA 4O1OA 2CGXA 4X2KA 4BDDA 3ATSA 2PE0A 1X8BA 2A27A 3NSZA 5TT7A 2E9VA 2F7EE 3LQ5A 4EWHA 3BBTB 3ERKA 3BI6A 5ANGA 3NCGA 4K2RA 4UV0A 1BLXA 1Y6AA 4IZAA 4OTRA 4HVHA 4I41A 3ZOSA 1ZZLA 2B52A 5K5NA 4QP9A 2P2HA 3QRKA 4UZHA 1XJDA 2X81A 3A4OX 1ZXEA 3OHTA 3QUEA 4M69B 4WSYA 2WIPA 5M06A 4EONA 1Z5MA 3PLSA 4C36A 5D7AA 3PWDA 5H3QA 4NL0A 4YLLA 1H4LA 3RJCA 2BFYA 3F9NA 3MH1A 3KVXA 4L01A 4CTCA 2XJ2A 2YM4A 3UPZA 5E90A 2R0IA 5FXQA 4NSTA 3FBVA 1KE6A 2ONLA 1VJYA 4AS0A 5HCZA 4KRCA 1XH5A 3UVQA 4DH5A 1M7NA 5AP1A 2ETRA 3R2YA 4H36A 2WNTA 4RJ8A 4E8AA 3F3WA 5IQGA 3BE2A 5DR6A 3M42A 4AACA 2XBJA 4X6RA 4D2RA 2ZV2A 4DHFA 4F7NA 1OZ1A 3RWPA 1FMKA 3M1SA 4G3FA 1OMWA 4FZ6A 3PLAE 2PZPA 4HW7A 1Y8GA 2NNWB 4OW8A 2OXDA 3DK3A 3TJCA 2JC6A 2Q0NA 3A7HA 4GK4A 5BVNA 3QD4A 2GTNA 4J53A 3MY1A 2ZJWA 4MF1A 3CQUA 4HGTA 4ZSJA 1QPCA 2QHNA 4U45A 3ITZA 2E9UA 4MYGA 4FTAA 5HTCA 2Z60A 5AUZA 3K5VA 4O7VA 4XP2A 1KWPA 4TWOA 2GNIA 4QMYA 3VW8A 5IISA 4BCJA 2G9XA 3EFLA 2IW8A 4ZZNA 5A6OA 2XNPA 4X7QA 2QR8A 4R78A 3OS3A 2HENA 1A48A 5H2UA 3V6RA 4HYSA 3QGWA 2V22A 3HEGA 3RCJA 3ZONA 1GZ8A 2EWAA 3OWPA 3COMA 5DVRA 2X8EA 2YIRA 1OKYA 2OH0E 1CTPE 3DA6A 3KMMA 3FMNA 4TWNA 5GIPE 1JLUE 3PXRA 4RX5A 4R3RA 4PQNA 2WTWA 3OWLA 4F1OA 3TT0A 3U6HA 5CT7A 4W4VA 2OW3A 2HY81 4BCHA 5IQDA 3QRUA 2WXVA 4BBFA 3D83A 1YW2A 1ZYCA 4B8LA 3OUKA 5DT0A 2R3JA 4ZLYA 1BI8A 2OJ9A 4ANQA 2XCKA 3D15A 1XO2B 4JG7A 5I9UA 3TXOA 4GJ3A 3MFSA 4QQCA 3CQWA 2WHBA 4DFBA 1SVHA 2QKWB 1OL2A 2HZ4A 1UNLA 4HYHA 4B6LA 3O50A 4PWNA 3N9XA 3R9OA 2I0YA 4ERWA 1OKZA 3ZSHA 3MA3A 3ENHA 2GS7A 4X3JA 1YOJA 4NTTA 5FM3A 3DXNA 3RK5A 4AFEA 2IPXA 3VUIA 3I81A 2QD9A 4RFYA 3Q5ZA 3G0EA 4UZDA 2XKEA 4I4EA 3F3UA 2BIYA 3P9JA 2QO2A 4G9RA 4FOCA 5C27A 2XEZA 3QQHA 1GZOA 5E1EA 2IZRA 3LCOA 2RGPA 2GHLA 4PDYA 3ODZX 5ACKA 3LFNA 3TNIA 3Q2MA 4AGCA 3WZKA 3PZHA 4V0GA 3UQGA 3F3TA 4QPSA 1R0PA 5BUJA 2UW9A 2R4BA 3RHKA 5EI2A 4RQKA 3V5JA 3ZDUA 3PA3A 3Q60A 4FR4A 4CFNA 3ZFMA 3ZXZA 2IZTA 3EFJA 2HW7A 3KEXA 3F88A 4H39A 2XS0A 4RVLA 5E8UA 4ANMA 4I6QA 2X6EA 1PMNA 3BHVA 4D5HA 1DI8A 3ORZA 5GHVA 2BROA 2CDZA 4EHEA 2JKMA 5L2WA 3FMHA 3BWJA 4C37A 1M52A 3QCXA 4AGWA 4X0MA 2C4GA 4EH6A 3I6UA 4Y95A 5C01A 4FL2A 5EHYA 3MVHA 4FV4A 4FZ7A 2F2CB 3NUPA 3O0GA 4FA2A 4PP7A 5HE1A 3II5A 4GG5A 4K8AA 5E91A 2W1HA 4OTPA 1XBAA 4IVDA 4TY1A 4E6DA 2O63A 4L52A 5L8JA 2OLCA 5HGIA 3NX8A 1XBBA 4KD1A 2B7AA 4U8ZA 4A9TA 4EEVA 1PYXA 4RZVA 4FX3A 4G5PA 4MXOA 1XBCA 2XYUA 4LGGA 2YISA 1Y91A 4OTFA 2R3FA 4YTHA 5EHLA 4C4GA 2QOBA 3E88A 5JQ5A 4EJ7A 3V6SA 3L8VA 3VS6A 4UYNA 2JD5A 4EH9A 2OK1A 3HMNA 4RMZA 4AZSA 5I0BA 3QUDA 4PTCA 2YA9A 2V5QA 5M07A 2YCRA 2PSQA 4ZTSA 4FV8A 2B9HA 3ZC5A 4XLVA 1U5RA 5HCYA 3EHAA 4W8EA 2XM9A 3C9WA 3G90X 4RX7A 3BYVA 4BDIA 3NYNA 2E9PA 4ZOGA 2ACXA 2IN6A 4YJVA 4Y72A 4DF3A 4FSMA 1YI3A 3QX4A 3O8TA 4QPAA 3UGCA 2R3NA 2R3LA 5AP4A 1T45A 1KSWA 3S4QA 4BCNA 1VZOA 2W0JA 4KAOA 2X8DA 1P4FA 5FXSA 2J6MA 3NLBA 5B2KA 3WYXA 1PXOA 3UE4A 4RG0A 4AF3A 4W8DA 3DBCA 4OR5A 4KIQA 5AUYA 2G15A 2W7XA 4BB4A 4RBLA 5HIEA 1PRYA 4G3DA 4FKSA 4IE9A 4AOIA 1BKXA 3F3ZA 3SXFA 5DRBA 3ZDIA 2ZMDA 3D7ZA 4UYAA 2XYNA 4QYYA 3HRBA 3F3VA 1MUOA 2YLFA 3GQIA 1PXIA 1LEZA 3DAJA 5K0KA 3R8UA 4AE6A 4TN6A 4NWMA 4DGMA 4MKCA 3ALOA 2ERKA 3RZFA 4MBJA 4NKAA 4U9AA 5HE2A 4OAVB 2YM3A 5DR2A 4XMOA 5IMEA 1DI9A 2CLXA 3C4FA 2Y4IB 3PRIA 4MNFA 3W10A 4BI2A 3CLYA 4I93A 1WVYA 4C4JA 3KULA 3AMYA 4XOYA 3A2CA 4CFMA 2I7QA 3BIZA 2JDTA 2PY3A 5CAUA 5ANEA 3G33A 3BV3A 1M2RA 5FTQA 3U51A 5D10A 1ZRZA 4IEBA 4XV3A 2XIKA 3ZM4A 5J1WA 4LRJA 1GNGA 1XH9A 2Y6MA 4MBLA 1WBSA 3E8NA 2OFVA 4GIHA 5F94A 4GSBA 5CS6A 1R1WA 4DGLC 5IQCA 3W2PA 3D4QA 1M2QA 5G1XA 3HL7A 4IAZA 3DT1A 3LFQA 4NT4A 2XK6A 3GNIB 3IOPA 3SA0A 2WMQA 5A3XA 3UMXA 5EQYA 4ZLOA 2PZIA 5IPJA 1SNUA 1G5SA 1SMHA 2VO3A 2VUWA 1J1CA 2C3JA 3KVWA 3LCKA 3MBLA 1Q61A 4NEUA 4O2PA 5HKMA 5BMMA 4IJPA 4DFYA 2AUHA 4OTHA 1Q4LA 1P4OA 3Q96A 4GT3A 5KMOA 3MJ1A 3DQWA 3QTXA 5BVDA 5HU3A 4FV0A 3CTHA 2B9IA 3DGKA 3ZRLA 3GOKA 3LW0A 4O7LA 3TDVA 1OM1A 4AT4A 1BUHA 4CFXA 4JOAA 4O21A 2QONA 4UWBA 1MRUA 3IW5A 5L2QA 3FLYA 3CKXA 3KK8A 1E1VA 1WZYA 1I09A 3ULZA 4CFVA 3QLFA 4D2VA 5JFXA 1GAGA 3KXZA 4CZUA 5IA5A 3PJCA 4MXCA 4DG0E 2EUFB 3RK9A 3Q52A 3QTSA 1WFCA 3ZCLA 3V8WA 4O96A 1FINA 1DS5A 4NM3A 5CALA 1BX6A 5GZ8A 3P23A 3GUBA 1ZYJA 4S30A 4R77A 3I7BA 3BGQA 4MWIA 1JKLA 1G8AA 3CR0A 4JG8A 5B0XA 4O86A 5EI6A 3AC3A 4FF8A 2HZ0A 3Q4ZA 4GS6A 4RJ6A 4CQGA 4CNHA 1M2PA 5GIOE 2IJMA 3V04A 5HVYA 3ET7A 1F0QA 5KBQA 1FVVA 3W2QA 5K4IA 1OBGA 4XX9A 1MRVA 1RJBA 1OIUA 1UNGA 3H9RA 2ITVA 3PUPA 4NIFA 5ANJA 2O3PA 1K9AA 1LP4A 4TYEA 3ETAA 4N4SA 1LPUA 3R1YA 1QCFA 4PL4A 4F6SA 1W83A 2WU7A 3BU5A 3IW7A 3QCQA 4FV2A 4WG3A 3ZLYA 2XNMA 3ZBXA 5ANIA 3UIUA 4AG8A 4ANBA 4CMTA 3EFKA 5EM8A 2C0TA 4YNEA 5DN3A 4PTEA 4WNKA 1UVRA 3KRXA 3UBDA 3Q9WA 3QKLA 2C0IA 1WBNA 4GYGA 2ITNA 3OP5A 4FKGA 3V3VA 2WEIA 1PY5A 3Q4CA 5I5ZA 3RPYA 4ENXA 3TZ8A 3HMIA 3ZSIA 2QU6A 5CSWA 5GZAA 1FPUA 3NEWA 2Q83A 4B7TA 4LMNA 3CIKA 1YXTA 2UVXA 4QQTA
chains in the Genus database with same CATH superfamily
3EMGA 4FTNA 4BCOA 4EH2A 5ETIA 3QQGA 4AZVA 1NVSA 2IVSA 4JDKA 3QZFA 3NUNA 3RMFA 2VD5A 3BHUA 3RPRA 4CFUA 2OBJA 2VGOA 4FKJA 4EBVA 2CNVA 4PPBA 5C8KA 3FKNA 5J7HA 5CSPA 2VWWA 2W5BA 3VS0A 4PRJA 3S00A 3GBZA 3G51A 4HNFA 1UNHA 2I0EA 3PVBA 5CAPA 4N0SA 5CYIA 4BIDA 5I3OA 4EH7A 3OCGA 4ARKA 4I6LA 3EQBA 2UZDA 2RF9A 5AP7A 1ZOEA 4JMQA 2X2KA 3PIYA 1Q8WA 2PMOX 4OT5A 1I44A 2GS2A 3I79A 3L8SA 4EZ3A 3DY7A 3P7AA 2R3QA 1WAKA 4FIFA 3D2IA 3QAME 5T6KA 3VS5A 5CVGA 2GQGA 2J0LA 3MPMA 2CN5A 4Z7HA 3B8RA 4WO5A 3BV2A 3MS9A 3WZDA 5KUPA 3HKOA 3HZTA 4DTKA 3TV7A 5HE3A 3BRBA 3QCSA 5H8GA 2XB7A 4K0YA 3MESA 4O0RA 4RPVA 3TMOA 2DS1A 2XNNA 3C0IA 1U59A 3LFBA 3TV6A 1IG1A 3TDWA 5HD4A 1CKIA 2Z7SA 3OFMA 1AQ1A 5DEWA 4OTIA 3KFAA 5FQDC 2C6EA 2GPHA 5DRDA 5AR4A 4BZOA 1IASA 4PMSA 3VUDA 3D5UA 1XH7A 2CCIA 4CRSA 2BRGA 1GZKA 4FNWA 4QNAA 3BU6A 2WQBA 3LAUA 3OTUA 4FNZA 3VBYA 1H24A 4O0VA 5ETFA 2ZYBA 3R01A 3EL7A 3LQ3A 5K0XA 4BIBA 1H0VA 1O6KA 4GVAA 2FSLX 4TW9A 1ATPE 3A61A 2WMWA 4OUCA 4YHTA 2XUUA 1NW1A 3P86A 3A4PA 4L6QA 4LL0A 3RBWA 2WZJA 4GVJA 2H9VA 1FGKA 4QP1A 4A4XA 4CKIA 4CLJA 3UOLA 2WOTA 3PZEA 5EYMA 1BYGA 5CSHA 4F7JA 3T9TA 3H10A 5ETAA 1AD5A 5HIBA 3DV3A 1KOAA 4FTRA 2CNQA 3JUHA 3ZLWA 4C02A 2BPMA 2RL5A 4R8QA 3ZLSA 3QTWA 4IAIA 3TCPA 4CFWA 2VTRA 1M14A 3N4UA 5AR8A 1OB3A 1OECA 3E64A 4V0GB 3ACJA 1WBWA 2Y4PA 4TL0A 3UDSA 2W4OA 3HV4A 2VO7A 2W1IA 2UV2A 3FZTA 4JJRA 4DFUA 4ZAUA 3FMEA 4WHZA 4FI1A 4FSUA 2UVZA 3NYXA 3W32A 3NW7A 4M8TA 4UMTA 4ALVA 3PPJA 3MPTA 5GJGA 3O5AA 2C1AA 3FY0A 4UMUA 4YJTA 4E4NA 4JBPA 4QYFA 4IDVA 2B9FA 3Q5IA 2BRHA 2P0CA 3EKKA 4P4CA 2YERA 4O7YA 3V8TA 5HNIX 3GGFA 3RPSA 2EB2A 4C61A 2PVNA 3GEQA 2VTJA 4KRDA 2UW3A 4BDGA 4F7SA 1WVXA 5CU0A 2P33A 3LZBA 4FIJA 3DXPA 4IACA 4U40A 4O38A 3R7IA 4DEIA 4NTSA 3BYSA 4RIOA 2BRMA 1VLRA 4O27B 4L00A 2DWBA 3JXWA 4MX9A 4FT0A 3DLZA 3HNGA 3OCBA 5H8EA 3DOGA 4X3FA 5ACBC 5KZ0A 4AA0A 4RVTA 2VGPA 4FVQA 5CU6A 5IQFA 4ONAA 4FSZA 2ITTA 4K6ZA 3HMOA 3FV8A 4H3BA 3UG2A 3TACA 1ZOGA 2X4FA 4AZWA 4O0YA 4ZMFA 3FY2A 2X0PA 4R3CA 2IWIA 3NUAA 4DITA 4EOSA 3SGCA 4EK3A 3PXFA 4IC7A 3W8LA 5CASA 4YURA 4QD6A 3W16A 4ZZOA 3PDTA 2R3MA 3GQLA 2BKZA 2GNGA 2GSFA 3HMMA 2BHHA 3MI9A 4FICA 1PXLA 4OTDA 5CSXA 2EB3A 1W2CA 4BKZA 4IFCA 4CG8A 5CNOA 4FEVA 3U9NA 2WMSA 3SX9A 2QOIA 4FBXA 3RPOA 2ZOQA 4NFNA 3R9DA 3PFYA 4E7WA 5EHOA 3FXZA 4ZMEA 3LLTA 2GNHA 3PA4A 2AYPA 2X8IA 3GT8A 5KX8A 5KKRB 1PJKA 3LOKA 3PTGA 5IH4A 2C5VA 3O8PA 3FMLA 3PSBA 4O0TA 4Y5HA 3PFQA 3SQQA 4YP8A 2R7BA 5JZJA 3VUHA 3R71A 3VQHA 4L7FA 4QYGA 5KHWA 4CYIA 3LMGA 3K5UA 3W55A 4MCVA 1LUFA 3R22A 1JSVA 3R7VA 1R3CA 4ZTQA 1A06A 3SG9A 3HV3A 4NCTC 4YPDA 1IA8A 3UC4A 5M53A 2HZNA 4UXLA 3A8WA 3DXQA 4AQKA 4EH4A 3C0HA 4IB5A 4I92A 4AP7A 3Q9ZA 4WT6A 3CGFA 4AZEA 1Q5KA 4RA5A 3ZO2A 4A4LA 3LPBA 4QP3A 5LVPA 4L53A 1PXKA 5EYKA 4K18A 4WUAA 3QUPA 2GMXA 4QMVA 3UG1A 4YSMA 4NK9A 4EYJA 3JR1A 4FSWA 1ZMUA 4YC8A 3KULB 3QA0A 2FUMA 1TFFA 3REPA 2OI4X 4WOVA 2VTHA 5GJDA 2E9OA 5J9ZA 4UY9A 3LJ1A 5JK3A 4IWDA 1QPDA 3U6JA 3BKBA 2GFSA 2AC3A 1TQPA 4EOQA 3SD0A 3R02A 3ZO4A 1ND4A 3F5GA 3O7LD 1OPKA 2BZKB 4CFFA 4ANOA 3VW6A 2HXQA 4FYOA 4QMMA 4R3PA 3NNWA 3EQIA 2UW4A 3SC1A 4IH8A 2IW9A 4QNYA 4DT8A 3HV5A 4WD5A 4BZDA 3FI8A 5HHWA 4RX8A 4G3EA 4G3CA 2CKEA 1ZY5A 3RVGA 4IADA 1UWHA 4LM5A 4M97A 4BTMA 5IEVA 1P14A 2EXMA 3TKIA 4DHIB 5EW3A 3QQKA 3R73A 4IAFA 3G9NA 4UEUA 4O7WA 2PVKA 4TWPA 5GJFA 4GT4A 2RFSA 4IB0A 4EHVA 4AXCA 4ZXTA 4W4WA 3HLLA 5M44A 1UU7A 2OJGA 3CPCA 2KTYA 1U54A 4MF0A 3TNWA 1NVQA 2LGCA 5FM2A 4ZY6A 5HVJA 3VWAA 4HPTE 3NIZA 3SV0A 5DH3A 3VUKA 4BF2A 4CRLA 4Z7GA 4JXFA 3ZC6A 1ZARA 3F61A 2X1NA 3VF8A 4UMRA 3HA8A 1B6CB 4DH7A 5I9ZA 1TQIA 4YJSA 2FB8A 5CY3A 4F4PA 4QEBA 5BVEA 3Q6UA 3D2KA 4FG8A 5M08A 4BDKA 3P79A 5LWNA 1LEWA 2GHMA 3QTUA 3QTIA 5HNBA 4NUSA 4AN9A 1ERKA 2W1GA 3KGAA 5IF1A 2JBOA 4E4MA 5M4IA 2QC6A 3ZHPC 5C26A 2H8HA 3FLQA 3TN8A 5JGBA 3NS9A 4ZSLA 3UVPA 3GENA 2G2HA 3IS5A 3QC4A 5DNRA 2O5KA 2WMUA 4O7RA 2XP2A 4EOJA 3DBEA 3QU0A 5EW8A 4IWOA 4QP2A 3MA6A 2HWOA 4PV0A 3GOPA 3KC3A 4U81A 5FG8A 2UW5A 4AGDA 3O71A 4QMLA 1F5QA 4NIFB 4YHFA 3VNTA 3RM6A 2JDVA 2YAAA 4K1BA 4LL5A 4XG7A 5LARA 2A98A 2CCHA 3KF7A 3FI4A 5TE0A 3VIDA 5HORA 2OSCA 5IA1A 3CGOA 2WIHA 3UIXA 4BWXA 2X6DA 4KSQA 2A4LA 4QYEA 1H08A 3DZOA 2IF8A 4BDCA 2CKQA 3H3CA 1KE8A 3Q4TA 2VAGA 3QYWA 2JDRA 4RIXA 4AN2A 4KB8A 2WQMA 1PYEA 4GJ2A 1O6YA 4ERKA 2X2MA 4DEHA 2VWXA 5CEPA 3KXMA 5DBXA 3CEKA 5JRQA 2GQRA 4YZMA 2CHLA 2CMWA 1STCE 3O23A 4JIAA 3QTRA 4TYHB 3QWJA 5E8TA 3HDMA 3OG7A 3SXRA 3ALNA 1YOLA 2OIDA 4FK3A 4IX3A 5FLFA 2BDFA 4MK0A 4XUFA 2QG5A 3R28A 5KZIA 1KUTA 4YJNA 4S32A 3E63A 5D41A 4L3LA 4JQ8A 3ZZEA 3MY5A 3FDNA 2W05A 1PXJA 3DB8A 4YJQA 4C3FA 1J7IA 3NFGB 4ACDA 2QOHA 4NCTA 3QWKA 4Y5QA 3E92A 3POZA 1DAWA 4GUEA 4H3QA 3MJ2A 1YKRA 5A6NA 3EN7A 4MQ1A 4XG4A 3OWKA 4HVSA 2ZV9A 3OT8A 3P5JC 4WBBB 5FUTA 3MIYA 3UPXA 1GIIA 4FV5A 2A2AA 5DR9A 1YI6A 2VNWA 5D7VA 2QO7A 1F3MC 4E5AX 4QQJA 3R8MA 3NUUA 3ORPA 3QC9A 5HZNA 3ZMMA 3AQVA 4KKHA 5HNGA 2VWVA 4CSVA 4FE2A 4NKSA 2UZBA 4EHZA 2C1BA 4K11A 3I60A 4IWQA 4KINA 4XNEA 2XK9A 2Y0AA 4U3YA 1H1WA 4UMQA 5F95A 5FGKA 3VBTA 1SYKA 4GV1A 2PU8A 3TIYA 2ZM3A 5B7VA 3KN6A 3E8CA 2WMAA 1CDKA 4KABA 2BR1A 3WI6A 4U97A 5GNKA 3BE9A 4FTKA 3P4KA 3UNZA 2XK8A 4U44A 3UNKA 3BHYA 3FYKX 5JFVA 4AZFA 2NP8A 2WKMA 4G31A 3FMJA 2P3GX 4C3RA 3FL5A 4QMWA 3MYGA 4JLCA 5HICA 5I9XA 3IK3A 5HG5A 4FVPA 1HCLA 2YWPA 3GC8A 4RFZA 1H07A 1OPJA 1YXXA 2P55A 3CC6A 3TUCA 4J97A 2JDSA 3E87A 3CJFA 5FBNC 4C38A 3W18A 5H9BA 4E3CA 4DBXA 2LAVA 2XBAA 3EQDA 4B9DA 1PXMA 4IZYA 4JR7A 1U5QA 2QOCA 3NR9A 1UU9A 4OBPA 3R21A 4KSPA 2FA2A 2YWVA 1BL6A 5FEEA 3RNIA 3Q2JA 3L1SA 2HAKA 2GTMA 2GNFA 5KMIA 4R1YA 3C4XA 4RFMA 5EW9A 3UVRA 2JKOA 4QT1A 5LVNA 3JVRA 4AOTA 4KS8A 2QLUA 3OTVA 1QMZA 4PMPA 5CEMA 3Q4UA 5FBOA 4RJ3A 4ZY5A 2WGJA 1URCA 1NT2A 1W0XC 2UUEA 4F99A 4QP7A 1G8KA 4I5PA 5BX0A 2AQXA 1IAJA 3DKCA 4XV2A 3KU2A 3QCYA 4O4CA 4Q5HA 3BX5A 1ZLTA 3IDPA 4RJ4A 3GU6A 5DPVA 3LXPA 2E2BA 4YLKA 4QOXA 4RC3A 2WTCA 5EDPA 4AW2A 3UO5A 3NFFB 5CT0A 3DZQA 3ZO3A 4F9AA 3LXLA 2PK9A 4MWHA 5IZFA 4DCAA 2YIXA 4S33A 1J7LA 4HVDA 1FQ1B 3LVPA 4ZLZA 2R64A 2E9NA 4GU9A 3L9LA 5FTOA 2XNBA 2IZSA 3B2WA 2FVDA 4I94A 4FKQA 4HCUA 3FWQA 2YCFA 2C3IB 3FLSA 4U43A 3ZEPA 4IJ9A 4D28A 2V7AA 4O6EA 2W5AA 3AKKA 3FZPA 3ZXTA 2CGUA 4L43A 3OY1A 5J5SA 5DG5A 4X6QC 4BFMA 4O7ZA 4QP6A 4IM3A 4RJ5A 4IVCA 4ZK5A 3LMHA 2JFMA 2YIQA 4G3GA 3UJGA 1ZYLA 1E1XA 4X3FB 2X4ZA 2R3PA 2Z7RA 4PY1A 2Z8CA 1MRYA 3LCTA 3MGYA 5HD7A 1JWHA 3CE3A 2ITOA 2PZRA 5HLWA 3IOKA 4AT5A 5B2LA 3LXNA 3CCNA 3E5AA 5K3YA 3EQRA 2XRWA 2YCSA 5A4TA 4G1WA 3FXXA 4GH2A 4UB7A 3HV7A 3MH2A 3VHEA 2GCDA 3DJ5A 4QMUA 5AADA 1OVEA 3LFEA 4A7CA 3ATTA 3FC2A 3RAIA 3FI2A 4UMPA 4O2ZA 5KE0A 4I0SA 5CF8A 3PXQA 1H01A 5HX6A 3DJ7A 3NUXA 4D4VA 2H6DA 1NXKA 4L45A 3GU5A 5DWRA 4U3ZA 4FKUA 4YC6A 2QG7A 3NVMB 2I40A 2VN9A 3BLHA 4FVRA 3OEFX 2XIXA 3W2SA 3UO6A 2C68A 3RGFA 4Q2AA 3NAYA 1H28A 4FODA 4DFXE 1H1RA 2VRXA 4YNOA 4F0FA 1BI7A 4JT3A 2G01A 2VWIA 3A8XA 3AOXA 4CCUA 4ACMA 5CZHA 1K3AA 2WEVA 3TG1A 4KKEA 2FSMX 2QOLA 2XM8A 2WTDA 2ITWA 3FQEA 2YEXA 4YJOA 1OI9A 2PE2A 2W1ZA 2XK7A 3WILA 4N70A 5A54A 3RHXA 4O22A 1O6LA 4XJ0A 5LWMA 4GKIA 4FKPA 4BHZA 3DJ6A 3PJ1A 5D1JA 1XMMA 4EUTA 3ORKA 4HGSA 3O96A 5ITAA 2PVLA 2Y9QA 3JY9A 4A07A 2XF0A 5TR6A 4DEBA 4AT3A 3ENMA 3GVUA 3BELA 4X2GA 5CAOA 5L2SA 2ZFYA 2PUPA 4Z55A 2C5NA 3WZEA 2QURA 3GFEA 2IO6A 4BC6A 3B8QA 2YZLA 1W2FA 4FSTA 3VUTA 3HRFA 3TNQB 3FPMA 3PJ3A 4D1SA 4KWPA 1RW8A 3KMUA 4Y46A 3EJ1A 3KRJA 4Y73A 4EOKA 5I4NA 1J1BA 4FKTA 3CPBA 1PW2A 5CQUA 4BCMA 1XR1A 2Y6OA 3MH0A 3OBJA 4FKIA 4U79A 2GNJA 4YR8A 1W7HA 3L8XA 1UWJA 4FKOA 4IQ6A 2XKFA 4USDA 3VHKA 3D94A 1OGYA 3WF5A 4DDGA 4RJ7A 3UYTA 2OG8A 4XCUA 4LGHA 4L8MA 3PPZA 4IANA 4M3QA 2VWZA 3OVVA 2QNJA 3OXIA 5M51A 2ZMCA 5C1QB 3QFVA 3IGOA 2PTKA 4AX8A 3F69A 4FEXA 1VYWA 2VU3A 4FV7A 1W8CA 5AV4A 4E73A 3BL7A 4O7SA 1JSUA 4X21A 4GCJA 2VTAA 5JKGA 5AV3A 3BZ3A 1TKIA 4C58A 4QTDA 3WARA 4QP8A 3U55A 3R8PA 1U54B 2VTLA 3NWWA 3I0QA 4HCVA 4JS8A 4JRNA 4JNWA 4D55A 5CXZA 1WBTA 2IVUA 2WTVA 3FC1X 5L6WL 2QO9A 2QKRA 3D7TA 4IM0A 4TZRA 4GFOA 3OCSA 4WSQA 4E26A 4FRFA 1Q8TA 5L2TA 4U7ZA 2OIBA 4OGRA 4BCKA 4AXDA 3U8WA 4HVGA 3PPKA 4E20A 4MXZA 4LV8A 5DA3A 5CEIA 3THBA 4OBQA 2QU5A 3PG1A 3UYSA 5DEYA 3T9IA 5KMNA 5E9EA 3F7ZA 2OJJA 1CSNA 2OF4A 2WFYA 5EG3A 1FVRA 3Q53A 4PMMA 4BCFA 4MAOA 3ZO1A 5CF6A 2GU8A 3FLNC 5HBEA 3SAYA 4D4RA 5BPYA 4N57A 5FEQA 3AC8A 5HEZA 2WO6A 2HCKA 3QF9A 5ANOA 3TUDA 2I0VA 1PXNA 2VX1A 3P08A 4ZJIA 1S9IA 2BCJA 5E8VA 2FYSA 3Q6WA 4PL3A 3BQRA 2YFXA 3QTQA 4XYFA 3FHRA 5EI8A 4FC0A 5AR3A 2R3IA 4GKHA 3VS3A 2OJIA 2B55A 1W84A 3L9NA 4Q9SA 2EXCX 4IB1A 3SXSA 4ENYA 2BILB 3W2CA 3ZLXA 4U0IA 3UO4A 2UZEA 2UZLA 4WIHA 4ORKA 3ROYA 4BCQA 2F49A 4RIXB 3MDYA 5IEXA 4F0IA 2BFXA 3DDPA 5CX9A 3KY2A 5LXMA 4JL9A 5A46A 5DFPA 4MXYA 4BGHA 1OKWA 4RIWA 4C35A 5AA8A 1VR2A 4M13A 5HG9A 4J98A 3C0GA 2XNGA 3UP7A 3C4WA 4ASZA 3RWQA 1Q8UA 3LQ8A 3PVGA 5EOBA 2ETMA 3IG7A 4U80A 4K33A 3VBQA 3NIEA 4USFA 3KXXA 3FHIA 4JDHA 1SZMA 2UW0A 3PP0A 3RINA 5ANDA 4EKKA 3PXZA 2F9GA 2GNLA 4RRVA 4D9UA 3FI3A 4FIIA 4H1JA 4FEWA 3TWJA 1P2AA 1V1KA 4CV9A 4GEOA 3DTWA 3NUSA 4EC9A 3QZGA 4W9XA 2UZTA 4DFNA 4WBOA 5HBJA 3DBQA 3IONA 3H0YA 2A19B 2RIOA 3KN5A 4FIGA 4IZ5A 4JAJA 4C2VA 4F7LA 5AA9A 4QTCA 2PULA 5AMNA 4XG9A 3LCDA 2B4SB 4LUDA 1JPAA 2V0DA 4CEGA 3QQLA 5KMJA 2VZ6A 3PG3A 1Q97A 2J5EA 2VX0A 3F5PA 3P7CA 3E8EA 4H58A 4MEDA 4P90A 5F4NA 4L7SA 5CVHA 4V04A 5CI6A 5BYYA 4NM5A 1SVEA 4J1RA 5E7RA 2O64A 3C13A 2RFDA 4O6LA 4EQUA 3W1FA 3Q9YA 4BDEA 4L44A 3I5NA 1JAMA 2OIQA 5EOLA 5AWMA 5JQ8A 2VWBA 4FEQA 4NM0A 3QRIA 5EDQA 3WOWA 4DYMA 4F65A 1XH8A 2R7IA 2W1DA 4LFIA 3R9RA 2VTSA 5E8ZA 4A9SA 2Z2WA 4ANNA 4E5BA 4C4EA 3PP1A 4EKLA 4DA5A 4G9CA 2BUJA 3DNEA 4ZS0A 5LMAA 4C8BA 1MQBA 5IQBA 4IX4A 3OUNB 1YWRA 4Y83A 1FBNA 2PUIA 1W98A 4FSRA 4IIRA 4WA9A 2G2IA 4JBOA 4F09A 2W4JA 3ORXA 1TVOA 2XNEA 4FTMA 3UODA 2VNYA 2XNOA 3PUFC 3ODYX 5CNNA 3D9VA 4AFJA 3BYOA 3E93A 3W0OA 4F78A 1YRPA 4LOOA 2R3GA 2IW6A 3MWUA 3AC5A 4S31A 4MTAA 4YMJA 2RG5A 1M17A 4G34A 3QTZA 1KV2A 4O0WA 3W2RA 5C4KA 4ZZMA 4BN1A 5HBHA 5AEPA 4J95A 3RZBA 4O0XA 4AXEA 4RWIA 4P5ZA 4HYUA 4KBAA 2XANA 3EWHA 3KRLA 4FTJA 2WQNA 4AA5A 5AAEA 2W9ZB 3FZRA 3IGGA 3ORNA 3AKJA 2DUVA 2R3HA 3C4ZA 4ZSAA 2Z7LA 4HJOA 4CXAA 3ML1A 4RWJA 4XLIA 1KE9A 2V62A 2PUUA 3FUPA 1YDTE 5C03A 4QMOA 1J3HA 5LCKA 2J7TA 5D11A 3WF6A 3CTQA 5CEQA 3H9OA 4HNIA 4GFGA 5A4EA 4D2WA 3ACKA 3P0MA 2OICA 3CTJA 3DAKA 2PVRA 4GRBA 4BICA 2W17A 4J99A 3RNYA 3KQ7A 4LOPA 4FIEA 4U41A 3TJDA 4YTCA 2CNUA 1G8JA 4JIKA 3Q9XA 5BVWA 2R2PA 5T3QA 2RG6A 3QLGA 3GCSA 4LGDA 5A4LA 4YJUA 3R30A 3BWFA 2BZHB 4DBNA 2QHMA 5L2IA 4XP0A 5CXHA 3KIOC 4CTBA 4BDFA 4UBAA 1Q99A 3W0NA 3HDNA 2EVAA 2YITA 2JBPA 5HOAA 5F1ZA 4C59A 2C6IA 4Z16A 1PKGA 1OGUA 1ZAOA 3KK9A 3OW3A 3PVWA 3QA8A 2OFUA 3KXHA 3SOCA 5M09A 4V01A 2OU7A 4EOLA 2FGIA 3UZPA 4EH5A 2WMBA 4MH7A 4FKWA 3F5XA 1GZNA 3KXGA 4Q9ZA 4DEGA 3W2OA 4DHJA 3W0QA 2IZUA 3D0EA 3LFCA 3VN9A 4BCPA 3F66A 1IAHA 2O0UA 3BCEA 2W1EA 4XH6A 5BUIA 5HQ0A 3I5ZA 2R3RA 2V7OA 4GIIA 3VS7A 2A0CX 3BHTA 5HG8A 3VF9A 3ZFYA 2VTPA 5CU4A 5E1SA 3ZUUA 4NU1A 4O1PA 2ZV8A 4BHNA 2J4ZA 5A9UA 1V0OA 3C1XA 4PP9A 4QO9A 5HLPA 5E8SA 2W06A 5L6PA 4DT9A 3L8PA 4FTIA 3GC7A 4QMZA 1TQMA 4KIKA 4FG7A 3LM0A 4XHKB 3DBFA 4FKVA 1OUKA 4I4FA 5EYDA 5BVKA 3COIA 4TWCA 5C8NA 2FH9A 2ZM1A 4NW6A 2G2FA 4I5HA 4YZDA 1ZOHA 4NH1A 5AAFA 4R5SA 4BWKA 4MBIA 3KL8A 3B2TA 1YXVA 3F6XA 4LUEA 2R3KA 3PXKA 4BVUA 3CY3A 3VAPA 3UOKA 4BTFA 3U4UA 4E4XA 3FQHA 4F0GA 3PSCA 3TIZA 1YXSA 2JAMA 2ERZE 3QRJA 3FSFA 4CLIA 4YLJA 2BIKB 2PVJA 2OXXA 4FV3A 3VBWA 4UXQA 2JLDA 3PY0A 4YTIA 3ZU7A 3LMIA 4HZSA 3HYHA 3EH9A 4XG3A 4J96A 3AC1A 2YM5A 2ZDUA 3DKOA 2VV9A 3IO7A 3DB6A 3EN6A 4WNPA 1PF8A 2J50A 4EBWA 3N4TA 4ZSGA 1Q41A 3G6GA 1ZMWA 5AR7A 3IPHA 2UZWE 4QYHA 3LCSA 1LR4A 2X39A 2UW6A 2ONLC 4WKQA 3G6HA 4BWPA 4HVIA 3W0MA 3I1AA 3U9CA 5EM7A 4O81A 3EQCA 4AWIA 3DS6A 3GU8A 3LHJA 3SW4A 1U4DA 4APCA 4ASEA 3R7UA 2WPAA 2GFCA 3EKNA 4IX6A 3U4WA 4M0YA 4RLLA 3HVCA 3AD5A 3JY0A 1H1QA 1WVWA 5TKDA 2WOUA 3MPAA 2XVDA 3D5WA 4FMQA 4MD7E 4ZJVA 1R78A 4OLIA 4XS2A 4C2WA 3ZH8A 4WRGA 5M55A 3U6IA 4C0TA 4R1VA 2XZSA 5FWKK 5J79A 2F4JA 2BKKA 5FRIA 4GFMA 5I9VA 4LDTA 2B1PA 3FZSA 2WAJA 4BIEA 4YZCA 3G2FA 3OF0A 3VBXA 3BHHA 1PMVA 2PVFA 3AMAA 4J7BA 1FMOE 2ZB1A 3D7TB 1OITA 4PDOA 4WG4A 4YC3A 1OBDA 2WMVA 4OTWA 4AE9A 4JRVA 5JZNA 4JI9A 2OKRA 4D2PA 3S0OA 4BDAA 1YHVA 3R2BA 2NRYA 3ZUTA 5CU3A 1OL6A 4XG6A 4U5JA 1QL6A 2HZIA 4G6OA 5AJQA 4MVFA 3UOJA 3LFSA 2W9FB 4KKGA 4ANLA 2PPQA 3ORTA 2BTSA 3HMPA 3EZRA 4DLJA 3PSDA 4IAKA 1W82A 4M66A 3PYYA 3AT4A 3TKHA 4A9RA 3R00A 3A60A 5FXRA 3I6WA 5KHXA 3L9PA 5JH6A 2W96B 3DTCA 3PJ8A 3UTOA 4YZBA 1JNKA 5IQIA 3BEGA 4HPUE 3H0ZA 4MHAA 4FZAB 4XEYA 3TEIA 2QR7A 2BVAA 3EN4A 4I0RA 2JKKA 4F1TA 5AV1A 1Y8YA 4FT9A 4EWQA 4F6UA 5CZIA 3QKKA 3AC4A 1XWSA 2GHGA 4FTCA 3BPRA 2XA4A 2WU6A 4IHPA 3QQFA 2NRUA 4LRKA 4I23A 1UKHA 3E62A 2J0IA 2JIVA 3NRMA 2PZ5A 5AP3A 3DK7A 4JX3A 2J2IB 4M0ZA 3TYKA 1SNXA 1OL1A 3WF8A 3K3JA 4C33A 5JMSA 4O91A 4DC2A 5DOSA 2UZOA 2XK4A 3PXYA 4XG8A 3TKUA 4FTLA 4JR3A 2QODA 4O0UA 2IVVA 3UNJA 5AAGA 4EOOA 3Q3BA 2IEWA 4C4IA 1JSTA 2RKUA 2J0MB 5G6VA 5HI2A 3KRRA 2CLQA 3TNPC 1R39A 4CMUA 4ZP5A 5KNJA 3FEGA 3C5IA 3R1NA 3OXTA 3ZYAA 2PVHA 4EH3A 3V51A 4FK6A 4YJRA 4RIWB 3V5TA 3QZIA 1UV5A 4EI4A 1XQZA 5DHJA 1WBVA 2P4IA 5CANA 3K2LA 5L6OA 4QRCA 4EJNA 4D4YA 1V0PA 2JIUA 3A7GA 3KF4A 2CJMA 4LV7A 3ZFXA 3V5PA 4RLKA 4D2TA 3ORIA 3S3IA 3PIZA 5TO8A 5EM6A 5JT2A 1OUYA 4R7IA 3LIJA 4IBMA 2C6LA 1Y6BA 3ID6C 4QDEA 4J52A 2VTNA 4NZWB 3W0SA 4TNBA 5C4LA 1DM2A 3OZ6A 1W2DA 4Z9LA 1JOWB 1H8FA 5AV0A 2NPQA 3WF9A 2WMTA 1E9HA 2OF2A 3OOGA 3VVHA 1J7UA 5IQHA 3ORMA 3C4CA 1FGIA 2XKDA 4KUJA 2HELA 4BR3A 3KREA 3EB0A 4BDHA 3F2NA 3D5XA 5KMKA 4PDSA 2UW8A 3CKWA 2B54A 3EQGA 2JITA 3KKVA 3LJ2A 3G15A 3TV4A 3W33A 4KBCA 4AW0A 5LOHA 1BL7A 1SVGA 2GDOA 2J0JA 3HA6A 3MVMA 5CWZA 3P7BA 4FGBA 1JKKA 4KBKA 4NJ3A 2C6TA 4E6CA 3AGLA 4PPAA 4DGNA 4IFGA 1ZWSA