3OOGA

Human camp-dependent protein kinase in complex with a small fragment
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
335
structure length
333
Chain Sequence
KEFLAKAKEDFLKKWESPAQNTAHLDQFERIKTLGTGSFGRVMLVKHKETGNHYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMVMEYVPGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGFAKRVKGRTWLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFATTDWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEEEIRVINEKCGKEFSEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords cAMP-dependent protein kinase catalytic subunit alpha
publication title Fragment based drug design on human PKA
rcsb
source organism Homo sapiens
total genus 106
structure length 333
sequence length 335
ec nomenclature ec 2.7.11.11: cAMP-dependent protein kinase.
pdb deposition date 2010-08-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3oogA01
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3oogA02
1G8AA 2VZ6A 1GNGA 3Q9ZA 4D1XA 5FBOA 1VZOA 3U9NA 2GQSA 4K11A 2GTMA 3Q4ZA 4AN9A 3RK9A 4G5JA 3COHA 3KRLA 3FLQA 4FIGA 4YNOA 4BGGA 2YM6A 3UO4A 3S1HA 5CAQA 5FD2A 4U7ZA 3UIUA 4MKCA 4GCJA 4F7JA 4QYEA 5FEEA 2CNVA 4D1ZA 4ENYA 1V0OA 3OBJA 5E8WA 4A9SA 4GK2A 3MN3A 4PMSA 2EVAA 4TY1A 5J8IA 4EBWA 2UW8A 4JBPA 5FDXA 3QD3A 4EK3A 3Q2MA 2B9FA 5F9EA 1M52A 4BDKA 4L3PA 3R04A 3ZO3A 4ACHA 4EH4A 4G2FA 4I6BA 4DCEA 2YITA 4HCVA 1KOBA 4GFMA 3EQPA 4EBVA 5CY3A 1JOWB 3Q9XA 1PKDA 5JH6A 3SRVB 2XK4A 1PMNA 3GC8A 3HAMA 3I0QA 4FIHA 5I3OA 2XKFA 2BPMA 3EQFA 3RPOA 2VWZA 2YCSA 4RJ8A 3VRYA 4C2VA 4I22A 3QHWA 3FJQE 4F0FA 1JSUA 4L43A 3KEXA 1H24A 2OXYA 1SM2A 5JFXA 5BQ0A 4YZCA 2C1BA 3NUXA 4KD1A 1NXKA 3F2AA 5K0KA 2OH4A 4IIRA 5HIDA 4DEDA 3ORXA 2JDVA 2J9MA 4RBLA 4FV1A 2RG5A 3PG1A 2VWUA 4MX9A 4B99A 3VBWA 3HLLA 4E93A 3NPCA 4E5BA 2JDOA 5FWKK 5A14A 3FSKA 1QPDA 2HWOA 2HIWA 3UOJA 3C1XA 3C0IA 5E8ZA 3MA3A 1L3RE 4DHFA 4HVDA 3FMEA 2PVJA 4FZFB 3OXTA 3NWWA 2QVSE 3D2IA 2HZ4A 4L45A 4NCTA 3W2QA 4CXAA 4XV3A 4C0TA 4WUNA 5HVKA 4CKIA 4IAKA 3C4CA 1YWRA 2X7GA 4DT8A 2O63A 4ZXTA 4BGHA 2WD1A 3QXOA 4X2GA 3DJ7A 5J95A 3ORKA 4GJ2A 5DI1A 3QRUA 4DYMA 1ZOGA 4O84A 3Q4CA 2YZAA 5CQUA 3TXOA 4EOQA 3QGYA 4U97A 3JR1A 1BYGA 2CDZA 2QOFA 3DT1A 2QONA 2ITUA 2EB3A 3LFQA 3W8LA 4CCUA 5HTBA 2IO6A 3LAUA 4FSYA 4KNBA 3ATSA 1PXKA 2ERZE 4QMNA 3QTXA 3TTIA 3GB2A 2BDFA 2R3GA 4ZTSA 2C6MA 2UW9A 4QYGA 3SXFA 3UG2A 4LRMA 4IBMA 4DEGA 1WBOA 4XG7A 4IVAA 1YXTA 4FI1A 3N4TA 3DDQA 2O64A 3FHIA 4JQEA 3D5UA 4Y83A 5K9IA 4GKHA 2BAQA 3P7AA 4YZNA 4BBEA 3OCGA 2Y4PA 3PVUA 1H26A 2B54A 3MVLA 4GFGA 3C5IA 4YNEA 5L8KA 4DGMA 2PUNA 4YUQA 3VS6A 2ZV2A 4L52A 1OL7A 4DH1A 2I7QA 4EYJA 2XP2A 4UALA 3V5TA 4ANNA 2EB2A 4XCUA 5L8JA 5KZ0A 2QO9A 2V62A 3KRXA 4FSQA 2WU6A 5CI6A 3VC4A 3MIAA 5A6NA 4LMUA 4ZY5A 4YZMA 5LWNA 5E7RA 5BUIA 4NT4A 1KWPA 2WTVA 4CRLA 3H4JA 1Q24A 2WIPA 1SVGA 3FZ1A 5ITAA 4L7FA 2BZJA 1O6YA 4RIWA 3CE3A 3KULA 4CFXA 2ETRA 3DA6A 3MFRA 2J0IA 3OWJA 2WZJA 3KU2A 2HW7A 5M55A 5AV0A 2VTLA 4MXOA 5I9YA 3I7CA 4RJ7A 3UO5A 2XBJA 2GHLA 2J50A 1ZARA 3P79A 4QTDA 3BV3A 3LFNA 4O38A 2YISA 3O71A 5B2LA 3R7GA 4CFUA 3FLSA 4FV2A 4U44A 3CD8A 3R00A 4F6UA 4RVKA 4C34A 3BU6A 4E6QA 4RWLA 5AR7A 4C62A 3PWDA 5JK3A 3FE3A 4OAUC 2GCDA 4ZJJA 3MH0A 3W2SA 2V55A 4RC3A 5FQDC 2R5TA 3HUCA 4EOSA 3C7QA 4IVDA 1TVOA 1OPKA 2CGXA 4AF3A 3CQWA 5AAEA 2H34A 2FSMX 4WO5A 5KHWA 4DH5A 3MY1A 4YR8A 5HIBA 3UVPA 5IISA 2GNHA 2OZAB 3CPBA 4QTCA 2OFVA 5A46A 2VO0A 1HCLA 2OXXA 3QZFA 4FR4A 3BWFA 5AA8A 4QT1A 5HLNA 3NW6A 4BDJA 3R6XA 5LCJA 4YTFA 4PTEA 5AAGA 1Q8YA 2Y7JA 4U79A 3UOLA 4FODA 4BI2A 2J7TA 2JIVA 2UZVA 3FMKA 3NYXA 5KX8A 5AIRA 4BDAA 4YSJA 4IDTA 5AMNA 5GJFA 4NKAA 4E20A 1Q8UA 3M11A 2UW7A 1SMHA 5C9CA 1WBTA 3LVPA 1ZYSA 4GEOA 4R7BA 5A4CA 5L8LA 4FEWA 2O8YA 1UU7A 3GFEA 3P9JA 2EWAA 2XYNA 4R5SA 5FLFA 2G9XA 5B2KA 3R9NA 4IE9A 3TACA 4AT4A 5HQ0A 2YDIA 5KMMA 1REKA 2WTCA 5D12A 3C50A 4J8MA 4QMTA 3JVRA 3OBGA 4PL3A 2F2UA 3KVXA 4XP2A 5IH4A 5LVOA 1YI6A 2CLXA 1KV2A 4FT7A 1PRYA 3HMIA 3R83A 4U42A 2UZWE 2ITXA 2PVKA 3DKFA 4XS2A 5M53A 2GFCA 5HNGA 2IVTA 5M4IA 4W4XA 3Q6UA 2CJMA 2YZLA 3K3JA 2VO3A 4KSPA 3A2CA 4NW6A 1WMKA 3V5WA 5CU0A 4HCTA 2X1NA 2X39A 2YIQA 5AM6A 4I6HA 3PDTA 3NZ0A 4FT3A 4XG3A 3FPQA 3HMMA 2V5QA 4C57A 2YCQA 4YBKA 5AA9A 1PYEA 4HVGA 4C33A 4CZUA 1B39A 4PMPA 3UC3A 5HLWA 2PE0A 3NEWA 3DJ5A 5K4IA 4O83A 2SRCA 3BLHA 4ZTQA 4JAIA 3GU6A 3HKOA 1T45A 1KSWA 3F82A 4QO9A 5IKWA 4RFZA 2CKQA 1Y6AA 4F63A 4YJQA 5AP0A 2JLDA 4O81A 2IPXA 3AD4A 4I5CA 4YZBA 1F5QA 5I9WA 4KB8A 1WVXA 5CSPA 5DR2A 3D4QA 3KRJA 1ZWSA 2QR7A 4GYIA 5TF9A 1CDKA 3V5PA 5IQIA 3QQUA 2WMUA 4CT1A 4D0WA 3TTJA 3NLBA 2PVMA 5CVFA 4BDCA 4MNFA 4KKGA 5EQEA 2C3LA 2C68A 2CHLA 4WT6A 4AGWA 3GCUA 4AQCA 2EXEA 4K6ZA 1ATPE 2Z2WA 3QD4A 2J6MA 2XCHA 3A4PA 1NVQA 1IA8A 3MA6A 2J0KA 3MSSA 3QWKA 4HVIA 2YWVA 2BDWA 5D10A 5BX0A 2Y0AA 4AP7A 4Y5HA 3S95A 4F9CA 3EQIA 3CCNA 4LGGA 1PKGA 2O65A 3E3BX 5CEKA 4YPSA 2Z7QA 4FG7A 3Q60A 3ZM4A 4AWIA 2WXVA 3IW7A 4ZSAA 3DFAA 5AFVA 3R8VA 2VTOA 4TN6A 4CEGA 2PVLA 2PVRA 4PNKA 3PXRA 5BVDA 3F3WA 3ORLA 3BV2A 4OT5A 2BRHA 5FXRA 1R3CA 3BYSA 2PVFA 4CCBA 1VYWA 4PV0A 3WE4A 5AR4A 1J1CA 2Q0BA 3UIMA 3OF0A 4GW8A 3BBTB 1Q97A 3VBQA 3QWJA 3PJ2A 3PRIA 5A4EA 4FICA 3BRBA 3VWAA 1B38A 4H05A 2OWBA 2VTTA 2R4BA 3ZUTA 4UBAA 2O5KA 4DITA 3AT3A 2PZIA 4EUUA 3MFUA 3ZO1A 3A99A 2IW9A 4G3DA 3LIJA 4NEUA 4RIYB 3NNUA 4F9AA 4MH7A 2OBJA 2Y4IC 4LOOA 2JAVA 4KBKA 4CTCA 4EOIA 2VNYA 3LFSA 1OUYA 3T9IA 1GIJA 5FTQA 4AN2A 4Q5HA 3KXGA 2C0OA 5J87A 3HUBA 5E8TA 3ZSGA 3BBWA 4KUJA 3BQCA 4S31A 2WQBA 3F9NA 4IWQA 2QURA 4LL0A 4BCNA 1OGUA 5AV2A 2QLQA 4I5HA 5EW8A 3C4XA 3C4ZA 4I5MA 1WBNA 3BYOA 5C1QB 4ZZOA 3PYYA 4UMUA 3AD5A 2Y6MA 4DINA 4E73A 4YO6A 3BGZA 3KVWA 2W9FB 2RGPA 3DDPA 4MD7E 4ZIMA 4UMPA 4FIIA 3JS2A 3NNWA 2XNNA 4MXZA 2F49A 3TI1A 4RX5A 2XM8A 3ORZA 4ENXA 5HCYA 4N6ZA 4KSQA 4JG6A 4BCGA 5A4TA 5ETIA 3DK6A 1Z9XA 3THBA 3QD0A 3G6GA 3WOWA 4LUEA 3A8WA 5JQ8A 3FDNA 3F7WA 4DFNA 3RWQA 1PF8A 4K18A 4V01A 3UNZA 3G51A 4MBLA 4RIWB 3KULB 4D28A 5I4NA 2WEIA 2XJ1A 3AC3A 3ZEPA 4FSTA 2KTYA 3TT0A 3VUTA 2YLEA 3REPA 3UMWA 4WHZA 3BELA 4ZZMA 4D2WA 3NVMB 3U55A 4KBAA 2HZ0A 2Z60A 4YJPA 3CJGA 4NFMA 3E87A 2WMWA 3QTZA 5CNOA 3SVVA 4NW5A 5AJQA 4FTKA 4KIKA 4DEIA 5JGAA 2QKRA 2IW8A 3QLFA 4O7ZA 2VTSA 4L68A 4QNYA 4IJPA 5C8MA 2WGJA 3NGAA 3KQ7A 4IANA 4HZSA 1OL2A 1PY5A 4HGTA 3UVRA 4CG9A 5AP3A 4FT0A 3HAVA 1ZMUA 2QU5A 4FTIA 3FI4A 3FYJX 4FNZA 1R0PA 3R7VA 4CFVA 4ERKA 3I4BA 5IA2A 3DBEA 4YBJA 1VYZA 4XRLA 5HNBA 1Q8ZA 2RL5A 4R7HA 2W1HA 3WZJA 2NPQA 3PPKA 4M14A 4G3EA 4E8AA 3IECA 3CPCA 2QD9A 4BKZA 3PVGA 5E1SA 3GXLA 2W05A 1OVEA 4TKSA 3UJGA 5T3QA 2BZKB 1WBSA 2ZMDA 4M0ZA 2ERKA 3OW3A 4M69B 5DNRA 5HD4A 5LOHA 4M7IA 2X8IA 4I20A 3R9DA 5M4UA 3SG8A 5CENA 1PXMA 3LFAA 4QNAA 4QMUA 3AC4A 4HGLA 2B52A 4UXLA 5M06A 2OH0E 4ORKA 1U5RA 3R30A 5EH0A 1NVRA 3IOPA 3TKHA 2E9NA 2QOCA 4AS0A 4AW5A 1CKIA 3L8SA 2ITOA 4DBXA 3KK8A 4II5A 2X9EA 5KHXA 4ARKA 4B4LA 3E8NA 5M4CA 3VRZA 1Y57A 4G6NA 3ZMMA 1WZYA 4ZSJA 1PXJA 2F7EE 2WTJA 3HRFA 4S30A 4IEBA 1K9AA 5EKNA 4WBOA 3S0OA 3LHJA 4IB1A 4OBOA 4W8DA 5DN3A 3V8WA 2WOTA 3P86A 2ZYBA 3GT8A 3R2YA 4U8ZA 4AT3A 3PSCA 3TNIA 2VTHA 1JKTA 3L9MA 3Q4TA 1YHWA 2JGZA 4O0UA 4A4LA 3FMDA 4BZOA 1V0BA 5CXHA 4APCA 2FVDA 4X0MA 4QPMA 4DEBA 3KY2A 5LJJA 2JC6A 4IB0A 5AR8A 3QGWA 4IDVA 5E9EA 3MH2A 2XJ0A 3HMOA 2B4SB 2RIOA 3OEZA 4FKJA 4OBPA 5AUZA 2XIZA 3V5QA 3RVGA 2XNPA 2ITVA 5H8GA 5LQFA 3OROA 2HY0A 3E92A 3WBLA 2XRWA 4IC7A 2RSVA 3B2WA 3FQEA 3CR0A 3MJ2A 5CX9A 2UZLA 5L6OA 2QG5A 2BRBA 3BIZA 3RBWA 1REJA 3FWQA 3WZUA 4CZYB 3ENMA 4J7BA 4BIBA 4DG2E 3L9NA 4FTCA 5AX3A 2BMCA 4BCJA 1CM8A 4L46A 4PMMA 4MK0A 5DT3A 3PA5A 3PUPA 2WPAA 2XKCA 3EN5A 3FI3A 3MY5A 5CEOA 3KREA 3BHHA 1I09A 3V51A 2G15A 3BX5A 3POOA 3NDMA 3QAME 3PE2A 2AC5A 5CZIA 4FNWA 5EDRA 3ZLSA 3LE6A 4R7IA 4QTAA 5IA5A 3S3IA 4CMUA 2E9PA 3OHTA 3O96A 3BU3A 4LRJA 3AXWA 5KKRC 2XB7A 3AC8A 3K5VA 4OTPA 4YJUA 4BTFA 3MV5A 3PVBA 3O8UA 4L67A 3COMA 3O2MA 4PDOA 5ANEA 4YTIA 1ZMWA 2FSLX 3EQHA 3ZH8A 3Q4UA 5CALA 4I23A 4XUFA 5K5NA 2PMIA 4C7TA 4ITJA 1OPJA 4EH7A 1GY3A 3QQFA 2PUIA 4IZAA 4C8BA 4BBFA 2YA9A 3TUBA 4XG9A 4O1OA 4TYGA 4GJ3A 2W4JA 3RTPA 3QX2A 4EORA 3TG1A 3KXMA 1DI8A 3U87A 4BC6A 4EC9A 2ZDUA 4JDJA 3ITZA 1PMEA 1UU3A 3NIEA 4FL2A 4UWCA 4H39A 3QFVA 1XKKA 4BF2A 3BU5A 3QU0A 4FSRA 4A06A 3BYVA 1YHSA 3N51A 4BBMA 4G9RA 4DFLA 3PLAE 3I6UA 4E6DA 2C5VA 3KXXA 4F0IA 4WNKA 3GBZA 1FPUA 3G0EA 2Z7SA 4LYNA 1M2RA 4QMXA 4BYIA 3ZTXA 3P1AA 4OR5A 5HX8A 2ESMA 4V05A 4BR3A 3TDVA 3WZEA 4ZAUA 4FC0A 1KUTA 1WCCA 4JBOA 3QF9A 2UW4A 3W2OA 3LZBA 4PDPA 3WZKA 3QCXA 2XRUA 4JOAA 4ASEA 4F9YA 1TQIA 3TN8A 2GSFA 4M15A 3TDWA 4IM0A 4RSSA 4RIOA 3QYZA 4ZTHA 1XH9A 4KIOA 3HP2A 2E9UA 1ZXEA 5AV1A 1BI7A 4F6WA 2FH9A 4WNOA 2WQNA 4YU2A 4JLCA 2YIYA 3QTIA 4FV0A 4CKJA 3UQFA 4O0RA 4L42A 4RJ3A 3D5VA 1QPCA 4EHZA 2VV9A 5HG9A 2IZTA 2BTRA 3IPHA 4QD6A 3DAJA 4X2KA 3VNTA 3VULA 2PMLX 3HZTA 4UWBA 3DPKA 3U6IA 3QQGA 5HORA 4FKVA 4BCQA 1YDTE 3AC1A 3GUBA 3OCBA 3OP5A 4JQ8A 4K8AA 2PZRA 3BKBA 3R2BA 4F7LA 4ANQA 3WIKA 2QKWB 5CYIA 5TOZA 2G2FA 3VUMA 3H9OA 4A9UA 2VWYA 3C4EA 5FEDA 1JSTA 3RPRA 4BZNA 5KMKA 1YI3A 2WO6A 3QKMA 4CMTA 4F08A 3Q96A 2WHBA 4FZDB 4LL5A 3QA0A 1WFCA 4K2RA 2IZRA 5T68A 2X9FA 1W82A 1FMKA 5FM2A 4FV5A 4IJ9A 2JKQA 1IASA 4PTCA 2R3MA 1EH4A 2A19B 3CGFA 2XBAA 4X2JA 4J95A 2JDRA 1YRPA 2QHMA 2W4OA 4R1VA 5HO7A 1OITA 2C6OA 2QU6A 5AUWA 3Q5ZA 5G1XA 3LMHA 4J99A 3FXZA 2PY3A 1SYKA 3KC3A 4FT9A 4TYHB 3V6RA 2OIDA 3MYGA 1OKZA 2PSQA 4H3QA 4B7TA 2XZSA 3DTWA 4KAOA 4KIKB 3KMMA 3VW6A 1Z57A 1PXOA 4U45A 4NL0A 5GHVA 4CTBA 5KBRA 5JZJA 1XR1A 4FOCA 3EZRA 4HYHA 5FUTA 2RF9A 5DEWA 3I60A 4H1JA 1H1QA 1M2QA 4YJNA 3AMAA 3HV6A 3IONA 4HGSA 2RKUA 2ITZA 3VS3A 2YAAA 3UNJA 3TL8A 4GT5A 4IMYA 2IVUA 3O8PA 3QXPA 5EYKA 5I9UA 2VAGA 4I4EA 3ZFXA 4AW1A 4AOJA 4A4XA 4PNIA 1MRYA 2GS7A 4JS8A 4FV8A 4ACDA 4IX3A 4QQJA 1JWHA 3DNDA 3GOKA 3C51A 4JDKA 2AUHA 4PY1A 4ALVA 5M56A 4E4MA 4F9BA 2DUVA 3SDJA 4G5PA 4OTIA 2C6DA 2HY81 4G6OA 4RVMA 1ND4A 4LOPA 4G3CA 5IQGA 4QQTA 2X8DA 3OY1A 2CKEA 3MIYA 2VWIA 5L2WA 4AFEA 5HE0A 2J0JA 4XX9A 2CN5A 3LJ2A 4FYOA 3OS3A 3JY9A 3LLTA 3WF7A 4IM2A 4R1YA 2YHVA 3KKVA 3FLNC 5EYCA 3RI1A 3SOCA 3PXYA 2C6LA 5IPJA 2VWWA 5EM8A 2BUJA 3GU8A 4EWQA 3DS6A 1M7NA 3CY3A 2FB8A 4PWNA 4QMPA 3FZPA 3G15A 2C5XA 3ZLYA 4MVFA 5CEMA 5JSMA 4M66A 5KNJA 1L8TA 5BVWA 5BVOA 3R21A 1Y6BA 1CKJA 3E3PA 3FV8A 3IDCA 4HYIA 4AX8A 1YW2A 2REIA 4DAWA 4AG8A 2CNQA 4JG7A 4D4VA 3LKMA 4OT6A 3AGMA 5AR5A 3FC2A 4CFWA 2YDJA 4OTDA 3KXNA 4U43A 1W98A 2XNMA 5ANDA 5CSWA 3W2CA 4JBVA 1H1SA 2OGVA 1PXPA 3O7LB 3WF6A 3TM0A 3QCSA 5HE2A 2X7OA 4IXPA 3K3IA 4FKPA 4M13A 2VD5A 4A07A 2IW6A 2VTRA 2OJ9A 4TNBA 4RWJA 3R1QA 4WNPA 1PXIA 4AUAA 3FEGA 2XKEA 4K77A 2CSNA 5CAVA 2P0CA 4QMZA 3D15A 3OC1A 3P7CA 4ID7A 4EK5A 2FYSA 5EDPA 4RIYA 3SKCA 3OW4A 4NTSA 4AZTA 4E6CA 4EKKA 3KFAA 4W8EA 4RC4A 3ZZWA 4FKIA 1AQ1A 2F2CB 2OIBA 2IG7A 3OOGA 4MXCA 3SC1A 5LWMA 4TYIA 4QMVA 3QA8A 3QC9A 3QRKA 4GRBA 4RT7A 3RK7A 4CV9A 4D2RA 4U40A 2B55A 4RC2A 2QQ7A 3E88A 4G34A 4BCFA 2R3FA 3T8OA 5JKGA 4NM7A 3ERKA 4BHZA 4EI4A 3MW1A 5C4LA 3PIXA 3TV6A 3U8WA 4FG9A 2H8HA 4S33A 3WILA 4LM5A 2JFLA 3FPMA 5LARA 1YWNA 2C5YA 1OKYA 3QALE 1ZAOA 4UWYA 4YLLA 4O7LA 3EFLA 3NYNA 3VBTA 5JFVA 3V6SA 3VAPA 3TNWA 2DQ7X 2R7IA 3F69A 4ZTRA 4JT3A 4YC8A 2BALA 4FKTA 4EH9A 3G2FA 5M51A 2CMWA 3E7OA 4XP0A 5AM7A 2PVHA 4FZAB 4RQKA 3R7YA 2HZIA 2R3LA 3H30A 4I0TA 3S2PA 4EZ3A 5CAUA 3UP2A 5IQCA 4MHAA 5DHJA 4TNDA 4JX3A 5BMMA 3W8QA 2W1IA 2F4JA 2OG8A 4IQ6A 4P5ZA 1PXLA 3QZGA 4QPAA 1XH8A 4TWCA 4YC6A 2JEDA 2EUFB 5HG5A 4USDA 3SXSA 5IMEA 5M09A 5H9BA 1CSNA 2X4FA 4FTNA 2H6DA 2A2AA 4WG4A 2YCRA 3E93A 3PXKA 4CSVA 2CKPA 4DH3A 3HMNA 3OWPA 3W55A 3QTWA 4ITIA 3RHKA 1GOLA 3O17A 2PK9A 3FYKX 3HA6A 3RCJA 4F4PA 3F2NA 4O2PA 2P2HA 2YJRA 5BYZA 3JVSA 3CIKA 2PUPA 3G5DA 5IH5A 2ZV7A 1LPUA 1OZ1A 1WVWA 4F7NA 5FG8A 4D4SA 4CGAA 2XH5A 3AOXA 2YIXA 4KRDA 5G6VA 4F1MA 3O23A 4FEUA 2C0IA 3OFMA 3SA0A 2XS0A 3PJ8A 3F88A 2RG6A 5A54A 5CWZA 3EFKA 4NK9A 3QTQA 5HCXA 2PL0A 3P08A 5DT4A 4HCUA 2HXQA 3LCTA 2JDSA 1R39A 2B1PA 2WMBA 3IW8A 4IACA 5ETFA 3VN9A 5JEBA 5LMKA 3RK5A 4QYFA 4DTBA 4BN1A 2C3JA 4M69A 5AUYA 5AR2A 2XEYA 3JY0A 1O6KA 3GC9A 3R0TA 3AD6A 4JRVA 4RFMA 4XYFA 3ROCA 2Z7RA 1HOWA 3MH1A 3PZEA 3U51A 3R1YA 4CRSA 4XG2A 3R28A 4NSTA 2B9JA 2JKOA 3O7LD 4KINA 3WIGA 2WTKC 2XUUA 3FMJA 3MVMA 1T46A 3OVVA 4BKYA 2ONLA 3UVQA 2WMQA 3OT8A 5LVPA 3R7IA 3W33A 1B6CB 2C3IB 4GT3A 5D11A 4XNEA 3ZDUA 5C8NA 3G90X 4FKQA 4UZDA 4BI0A 2PE2A 3EL7A 3AC2A 5ICPA 5EYDA 2R3KA 1YKRA 4FIFA 3BE9A 1FBNA 4YTCA 1UKIA 4AFJA 5C27A 3GC7A 5ETCA 4C4EA 4EHVA 3LLAA 2UZBA 2JIUA 3ZXTA 2QO7A 5IDNA 4EKLA 4ZY6A 2VN9A 4PDYA 3PLSA 4C2WA 3CY2A 4OGRA 2QNJA 4QQCA 4FE2A 4FEXA 2W1FA 2X2MA 3ORTA 2WOUA 2F9GA 3NUAA 2PZYA 4APPA 1UU8A 4ANLA 4EH6A 2XKDA 3ZYAA 2QLUA 4X2NA 4CNHA 3DQWA 3S00A 1IAHA 2UW3A 3LM5A 4H58A 2I0HA 4LUDA 4RGJA 4GKIA 3GC0A 4F09A 3OT3A 4QTEA 4RQVA 2A4LA 2I1MA 2Z8CA 3GU4A 4NUSA 2GDOA 4O0YA 3ZONA 3F5XA 3NS9A 2VU3A 2VX0A 5ANJA 5JZNA 3H9RA 5LVLA 3F5GA 5TE0A 5D7VA 2WIHA 4G16A 4QMYA 2WTWA 3WZDA 3KXZA 4ZLZA 2W17A 3FMLA 3GCSA 3GCPA 1UA2A 3D94A 4HOKA 4P2KA 3RALA 3Q9WA 3OZ6A 3DNEA 2JD5A 2KULA 2Y4IB 3EQDA 3D9VA 3E8CA 3AT4A 4GH2A 3UIXA 3UPXA 3ZRMA 4I6QA 2NRYA 1OIUA 2W5BA 3COKA 4M8TA 5BUJA 4A4OA 3V5JA 4FNYA 4O0WA 2YDKA 4LGHA 1UNGA 1MRVA 1YWVA 2OF4A 3L8PA 3L8VA 4DG0E 1U4DA 2PYWA 4CKRA 5IZFA 1Z5MA 5EFQA 3CSVA 3P7BA 4PRJA 2FA2A 4TTHB 4GFOA 3I79A 4Q2AA 5DFPA 4DLIA 2HZNA 2RFSA 3IK3A 4BB4A 2P3GX 2ZDTA 3HX4A 2W7XA 1UKHA 3T9TA 4BGQA 5K0XA 2ITQA 3KK9A 3DLSA 3PE1A 4D5KA 2R64A 1XH6A 5IG1A 3VW8A 3UODA 2VTQA 3VHEA 3RNIA 4R78A 4D58A 3NRMA 3IW4A 3EFWA 4MF1A 1MQ4A 2XIYA 4RMZA 2YEXA 4EZ5A 2VGPA 4O0TA 5E8XA 3HV7A 3VUHA 4M97A 2YERA 3BZ3A 1Q5KA 4PF4A 3MPAA 1PXNA 4QMOA 2YLFA 3RAWA 4M12A 4UX9A 1Q62A 3RMFA 2NRUA 2C5NA 1W7HA 1VJYA 3PTGA 4M67A 5HBHA 3ATTA 4CQEA 4C4GA 4I92A 3GEQA 2X6EA 1SNXA 3OXZA 3R8ZA 3W10A 2R0UA 4U3YA 1DAWA 4G3GA 4JIAA 1F0QA 3FLZA 4FZ7A 4DN5A 3HP5A 3E64A 1UNLA 3DOGA 1OMWA 5HOAA 4BDDA 4EH8A 4CVAA 4BCOA 4IZ5A 5M57A 4NYEA 5BVKA 4RG0A 2C3KA 3W32A 2BIKB 4Z7HA 4YMJA 5CANA 1LP4A 3CS9A 4I6FA 2XIXA 1QPJA 3DQXA 3ZCLA 3GGFA 1XBBA 1OUKA 4GIIA 4L44A 2XNOA 2WQOA 1O6LA 2E9OA 3UOHA 3LFEA 4JXFA 4UV0A 4JX7A 3VS1A 3TKIA 4QMMA 3RCDA 3RAHA 4BDIA 2FGIA 2X6DA 3JXWA 5T6KA 5KUPA 2X4ZA 1QPEA 2WELA 5JQ5A 2UV2A 5J1VA 1JNKA 3F5PA 1URWA 5K5XA 4DTAA 4G17A 4XMOA 4I93A 1WAKA 4YJRA 5J9YA 4FTMA 5BVEA 2QR8A 4EYMA 4C38A 4C3FA 4YHFA 5HBJA 4DEAA 4DCAA 5JMSA 3LQ5A 1G8SA 3R8MA 2RFEA 4EQUA 4Z55A 3P23A 3I81A 4J53A 3ZBFA 2CN8A 2W1EA 3UZPA 5CEQA 3GCVA 1RW8A 3IG7A 5C8KA 2UUEA 3MTFA 3UE4A 1M14A 4FL3A 4C58A 4J8NA 5EM5A 4AZFA 2C1AA 3T3VA 4LFIA 4BZDA 2WTIA 4XBRA 3HECA 1SNUA 1XQZA 4O96A 4D55A 2OU7A 3ZS5A 4GVJA 5HICA 3R7OA 1V1KA 1X8BA 3BGQA 4FTRA 4HPTE 1BL7A 3F3UA 4I21A 4MXXA 4WUAA 5A3XA 3U6JA 3F2RA 4M3QA 2VTMA 3OD6X 4TL0A 5A6OA 4DC2A 3OY3A 3AMBA 4EEVA 5DIAA 4CFMA 5CSHA 1FVVA 2QOLA 3I1AA 4TYHA 5DRDA 3LCKA 3GOPA 5E92A 3UYSA 1KE5A 1VEBA 4EH2A 1XBCA 3A61A 3AQVA 5FBNC 3SXRA 3EZVA 2Q0NA 2YACA 3EQBA 1UV5A 4MQ1A 4EH3A 4FL1A 3ORIA 2ZM4A 4J1RA 4QP2A 5BUEA 2WMVA 3CC6A 3LXNA 4MD8E 4DEEA 4YJSA 1OM1A 2GNJA 3ACJA 3BYUA 4AU8A 4XH6A 3EKKA 3Q53A 1TQPA 5JT2A 2J5FA 4NM3A 3C0GA 3DB8A 4PP9A 5GZ8A 2PU8A 1XHAA 4LOQA 1OIRA 4MQ2A 4NZWB 4FK6A 2VWXA 3DAEA 4NCTC 1DI9A 3RP9A 4XV2A 2UZUE 2UZDA 1YVJA 5HVYA 3U6HA 3EYGA 3ULIA 4C4JA 5JGDA 4GL9A 4JR3A 2QOIA 3E63A 3B8QA 4WKQA 1YXSA 4QP6A 3W2PA 3UIBA 3RPSA 5FGKA 3CTQA 4YZDA 3DJ6A 2VTAA 4ZMFA 3IQ7A 4KS7A 2JBPA 5EI2A 3VS7A 5F95A 2XJ2A 4XHKB 4OTWA 4AGCA 4BICA 4ZMEA 1Y91A 4TYJA 5DMZA 2YJSA 4O0VA 3FMNA 1BMKA 3VUKA 4KIQA 4R5YA 3QTSA 2BKZA 3CKWA 5H8EA 1H4LA 3CTJA 5J1WA 2HXLA 4K0YA 4NU1A 4A9RA 3NUNA 3LCOA 5EI8A 3RZFA 3VF8A 2J0MB 4EHGA 1IA9A 3EQCA 1QL6A 2CCHA 3BHTA 5J79A 3SD0A 2BRMA 5KKRB 3P78A 5M44A 5GIOE 2O2UA 2DS1A 3F66A 3PP0A 4JDHA 3QKKA 3DXQA 3P5KA 1YOLA 4D9UA 3MFTA 4GG7A 4QP8A 5CZHA 5CASA 5AR3A 4O86A 4B0GA 3UO6A 4EK4A 3PSDA 3PY1A 4D1SA 5LVMA 4YLKA 5IA1A 5AUUA 4B8MA 4MCVA 2OJGA 4GK4A 2XF0A 5JRSA 4AT5A 3RWPA 4B9DA 4DGNA 1Q8WA 5BVFA 5CAPA 1OKWA 1R78A 3KMWA 1H25A 1OL6A 5J9LA 4ZJIA 2R7BA 3SOAA 3TNQB 4ZSGA 5HE1A 2XNGA 1F3MC 3FUPA 4ZS0A 3KN5A 4H3PA 4BCKA 3AT2A 5EHOA 5IA4A 4PPBA 5CVHA 4YJTA 1BUHA 3A7GA 3GQLA 4DEHA 4HYSA 4FNXA 5GJGA 4WSQA 1JKKA 2W96B 4LQMA 4RA4A 4QTBA 1WVYA 1OI9A 3TIYA 4QRCA 1RDQE 5CNNA 4X7QA 4N6YA 3FKOA 3ANQA 3E8EA 4CMOA 1KE9A 4IWOA 4IWDA 3RINA 2CGWA 3H0YA 3B2TA 3D83A 3UQGA 3HL7A 4FSZA 3DTCA 3I5ZA 4YJOA 4OUCA 1JSVA 1ZZ2A 2B9HA 4N57A 3QLGA 1AGWA 1H8FA 3EYHA 3NUUA 3AMYA 4I1ZA 4Y95A 5AP1A 5E90A 3DZQA 5EK7A 3RM7A 2HELA 5DT0A 4KBCA 3UZTA 3VUIA 5L4QA 1H01A 1VR2A 1NA7A 5TT7A 3HDMA 4AE9A 4EC8A 1LR4A 5DEYA 4WSYA 2J2IB 4RVTA 5A4QA 2ITYA 4G3FA 4GYGA 4ZEGA 3ORNA 2QOBA 3TNPC 2OZOA 2ZMCA 4ERWA 4XOZA 4HVHA 5EDQA 2PVNA 5I9VA 2YM5A 3EH9A 5FTOA 3E5AA 4WRGA 4PL4A 4FV4A 4D2PA 5IEYA 2GNGA 4PPAA 1MP8A 4Y73A 3WF8A 3MESA 3DZOA 4O91A 4B8LA 5GZAA 5L2QA 2B53A 2WNTA 1A48A 4X2FA 5CSXA 3IGGA 3IO7A 3DLZA 3TKUA 1P4OA 3QYWA 4AN3A 3VIDA 4FTOA 2OLCA 4O6EA 3R9HA 3OEFX 4MWHA 5EHLA 2X81A 3O51A 3RAKA 5DE2A 3BPRA 3F3ZA 5EYMA 5I9ZA 4PTGA 5IA0A 3OOMA 5M4FA 4JJRA 3MS9A 4BTKA 2A1AB 5DGZA 2ITNA 4ALUA 3DU8A 3IS5A 3PA3A 3VS0A 1WBVA 3WARA 2WMTA 4FKUA 4Q9ZA 3ID6C 3N4UA 1CTPE 3Q6WA 3FAAA 3ENHA 5KMNA 3EKNA 2F7ZE 1GZNA 2BILB 4JBQA 2VTPA 4BIEA 5FEQA 4O7SA 1LEWA 4RPVA 2XIRA 2XVDA 5BMSA 4GG5A 2XNEA 3ZU7A 1FINA 4IVBA 1P14A 4FGBA 3KRWA 1JLUE 4ANBA 4FF8A 3JUHA 2F57A 2LAVA 2Y9QA 3SG9A 2QOQA 3QTRA 4RVLA 4NH1A 3POZA 2V7AA 4CYIA 2OI4X 1FVRA 4GSBA 3TV4A 2YM3A 4FTLA 5JGBA 5L2TA 4S34A 3UBDA 5EOLA 3L9PA 3O0GA 4KA3A 3QUDA 2YAKA 1J1BA 4ZK5A 4JRNA 2JITA 4D2VA 1YDRE 4QMWA 2X2LA 4IWPA 4QMSA 3MGYA 5IA3A 2X0GA 5IF1A 3TUDA 3R1NA 4FVPA 1AD5A 5AX9A 5JRQA 3DKGA 3R63A 4JIKA 5HTCA 4C36A 5HI2A 4U80A 4UMRA 2WMAA 4J96A 3PRFA 1PMVA 3SX9A 3QZHA 1IEPA 2R3IA 3ZEWA 3I7BA 3FMMA 4IX4A 4BCIA 3DXNA 4L00A 4HZRA 4MTAA 4HNFA 2ZOQA 1GJOA 2FSTX 2XYUA 3LQ8A 3QX4A 5EHYA 3ZUVA 4A7CA 4D5HA 2AYPA 5CSVA 4AE6A 2BAJA 4C61A 2WKMA 4AGDA 4DE4A 4OTQA 2J5EA 4GMYA 4ZTLA 4E5WA 3U9CA 1LUFA 4BY9E 3BEAA 4UYAA 4ASXA 4QYHA 4DT9A 4EOOA 1K2PA 3V01A 4ZS4A 4YP8A 3BLRA 3DY7A 3EIDA 3NR9A 4FKOA 3RHXA 1FOTA 3UC4A 3RNYA 5H8BA 2C5OA 3A7IA 3HMPA 4OW8A 3CP9A 4U41A 4F65A 2ETKA 4Y8DA 1Q4LA 3CEKA 2OKRA 5HCZA 2UVZA 4CLJA 3LCDA 4TWPA 4LRKA 3WYYA 4RX7A 3ZOSA 4BTMA 4WOVA 3ZC6A 1OECA 3A7HA 3ULZA 3KRRA 1MRUA 3MVJA 4MD9E 4W4WA 3FSFA 3PJ1A 2GU8A 1IR3A 1I44A 4I24A 4OTFA 3VS2A 3CKXA 1W84A 4C3PA 3VUGA 2GMXA 3W16A 4O7NA 4FK3A 4WD5A 4XEYA 1TKIA 2IN6A 4Y85A 1XO2B 5EOBA 4DG3E 2HWPA 1ZYJA 3ACKA 3D0EA 5CF5A 5HTIA 5D41A 2BROA 2VX1A 5EW3A 3LJ1A 3UQCA 1OKVA 3U54A 3K2LA 4ZSEA 5DBXA 4EOMA 3QQLA 3NW7A 4IAAA 2Y8OA 4IAYA 5KE0A 3FC1X 2B9IA 3ZRLA 4ZTMA 2IVSA 3HV5A 2UZNA 4S32A 3AGLA 1ZYCA 2XCKA 4TXCA 3FZSA 3NAXA 3VBVA 5BYLA 1M2PA 4FYNA 5HD7A 5DYJA 1HCKA 2XK3A 3LFBA 4DH8A 3GVUA 2W0JA 4RA5A 4CZTA 3CBLA 4BCPA 4F9WA 1OBDA 2DWBA 3ZFMA 3FQSA 4FV9A 4BCMA 5LXMA 3HV4A 4O6LA 1TQMA 3E7VA 3HVCA 3KL8A 2R3RA 1Q3DA 5IUGA 3NUPA 5E8SA 2YWPA 4RZVA 3FI2A 1PMUA 2VNWA 4YHJA 2ZB0A 5FXQA 4X3FC 5L2IA 1RE8A 4V0GB 3VUDA 5HX6A 5GIPE 1Y8GA 3ANRA 4EQCA 4E26A 3Q3BA 5J9ZA 3MPMA 5HLPA 1YOMA 5EQPA 3SGCA 1W0XC 4O0SA 5D1JA 5E8VA 5AWMA 4IH8A 1QMZA 3EHAA 1OL1A 5HZNA 1E1VA 3F61A 5KZIA 2YIRA 3GFWA 5AP7A 4Z16A 2UW5A 4NFNA 2JAMA 2F7XE 3V04A 5IEXA 3LMGA 5LVNA 3QZIA 1URCA 2V7OA 4GUBA 4FSMA 4PL5A 2Y6OA 3PFQA 1YXUA 1ZOEA 3BCEA 2QI8A 3HGKA 1H28A 4FKWA 2C47A 2E2BA 3E62A 5HVJA 5IUIA 3QUEA 1H27A 4PPCA 4FVRA 1Q41A 3DBQA 4W9WA 5CU2A 4O7WA 2V22A 2X2KA 3ZHPC 4Q5EA 4RFYA 4AZVA 5JFWA 1O9UA 3FZRA 4EJNA 5KMLA 1U46A 3HRBA 3NAYA 5CS6A 3M1SA 4YURA 3MI9A 3C0HA 3ZO2A 4F1OA 2CNUA 3FBVA 5DRBA 3QL8A 4P4CA 1Q8TA 3OG7A 4DGOA 1WBPA 3ETAA 3PPZA 3DXPA 4FGRA 3KMUA 4HVSA 5KO1A 3ZBXA 5KMOA 2GHMA 2OIQA 5FRIA 3HDNA 4KS8A 3W1FA 2OICA 3EJ1A 4IADA 5HGIA 1QCFA 4R3RA 4BHNA 4F99A 4O82A 5CF4A 5HU9A 2HK5A 3UOKA 1J7IA 3NUYA 4JR7A 4RIXA 4E7WA 2CKOA 3VS5A 2XMYA 2EU9A 3LM0A 3W18A 3DKCA 2UVYA 1CMKE 2VTJA 4L3LA 4R3PA 5CQWA 4YSMA 5C4KA 1R0EA 1ZY4A 4ZTNA 1LEZA 3FKNA 4FTQA 2YCFA 4TWOA 3D5XA 5HKMA 4TT7A 3IDBA 3MJ1A 2R3HA 5LCKA 4USEA 4YHTA 2G01A 2R3JA 2ZJWA 3VHKA 4IAZA 4JVGA 5E91A 3JPVA 5ANOA 5CLPA 4BWXA 4G9CA 4Z7GA 2YM8A 1GZ8A 5J5TA 4U3ZA 4O7VA 1KOAA 5DOSA 5M07A 1H1RA 3VJOA 3OWLA 4U9AA 4BDFA 3A62A 4D4YA 2W4KA 5GNKA 4N0SA 2FSOX 2QCSA 4WRSA 5AP5A 4F7SA 4O22A 3SW4A 3F3VA 3ZXZA 1DAYA 4F70A 4O21A 3EB0A 3QD2B 4RJ4A 2UW0A 2EXCX 3CJFA 1XH5A 2QODA 4BRXA 3QUPA 5GZ9A 2WTKB 4O1PA 2YABA 2HYYA 4GV1A 3QBNA 3TZMA 4RX8A 4XG8A 3FL5A 4NIFA 3TWJA 2I40A 3VF9A 1FQ1B 2WQEA 3OTVA 1PW2A 1XWSA 3ZO4A 3U4UA 2GNLA 4OTHA 3H3CA 5FP5A 2ZAZA 4IW0A 5IH6A 5CU6A 1SVEA 3NNVA 2W9ZB 4Z9LA 3R9RA 3H10A 1STCE 4JDIA 3ORMA 4FSWA 4NJDA 3SLSA 4E3CA 1IAJA 3R22A 3PIZA 4PX6A 4HYUA 3R1SA 2X7FA 2WU7A 2W5HA 3OTUA 5C01A 5I0BA 2C6IA 3ZUUA 4BIDA 3OMVA 4WIHA 4WG5A 3FL4A 4XLIA 4C4HA 2OO8X 3JYAA 3HA8A 4O27B 4IC8A 2R2PA 3IOKA 3GCQA 4L6QA 3BI6A 4FKLA 4F1TA 4IFCA 3BHVA 2QO2A 5CI7A 3DB6A 5L2SA 2E9VA 4O7TA 4I0RA 4ASZA 4C59A 4LI5A 3UG1A 1U54A 4F6SA 2P33A 1G3NA 4IFGA 4XLVA 3R8PA 1YXXA 4J52A 4BDEA 4KKEA 2C0TA 2P55A 2VTNA 4FV3A 4Y72A 2BFYA 5KBQA 3Q52A 5EI6A 4BYJA 3TNHA 4UMTA 4J97A 5ACBC 4PP7A 4ACMA 2OFUA 2PZPA 4WA9A 3SHEA 3HNGA 1Q3WA 3NW5A 4H3BA 4AGUA 2VO7A 5HG7A 2YM4A 3KCFA 3MTLA 3AC5A 2PZ5A 3L1SA 2EXMA 3P4KA 4KIPA 4WNMA 4E4NA 5KMIA 3R01A 4EHEA 4FVQA 4BDBA 4K33A 4YJVA 5CU4A 4MBIA 3FMHA 3ORPA 4ZSLA 5AUXA 2WFYA 2UW6A 5HIEA 3EQRA 4IAIA 4PQNA 4PUZA 1UWHA 3ELJA 3HEGA 3EWHA 3GQIA 5EG3A 5IQEA 1XH7A 2CLQA 1DM2A 4QMLA 3WE8A 3G6HA 4V04A 2BCJA 4UYNA 4MBJA 3AG9A 3NSZA 3CD3A 5AUTA 1XJDA 2BDJA 3QKLA 3H9FA 4YZ9A 4FKGA 2P2IA 3MVHA 4U0IA 4K1BA 3IKAA 3UGCA 2VRXA 4FG8A 4I0SA 3WF9A 4AA5A 2W99B 4MXYA 4EONA 4D9TA 4FTAA 4QP3A 2IJMA 3P0MA 3MH3A 2IWIA 1ZLTA 3PZHA 3LJ0A 1GAGA 2HAKA 3C13A 4MNEA 4RJ6A 3EN9A 5A4LA 5E4HA 5F1ZA 4BVUA 2R0IA 3E8DA 3F5UA 3ALNA 2VUWA 5BNJA 2BTSA 5DH3A 5CAOA 5CU3A 4AAAA 5EQYA 3C4FA 4CD0A 2GFSA 5AIKA 3ALOA 4JI9A 5HO8A 5BYYA 3K5UA 2VO6A 3R9OA 3B8RA 3CTHA 1XH4A 4RLLA 4X6RA 1OIYA 4PMTA 4CT2A 1S9JA 2I0YA 2PPQA 2QOKA 4CFFA 3OUNB 3R8UA 4DGGA 2I0VA 3F6XA 3M42A 3FXWA 3EL8A 3TJCA 4RLKA 3FZOA 3VQHA 3DGKA 4HJOA 2R3OA 3DAKA 4MXAA 3UDBA 4EJ7A 1KE8A 4ANMA 4DBNA 2C6KA 3CGOA 4KWPA 4G6LA 1OIQA 2YN8A 3NMUF 4D2TA 2OXDA 1W8CA 2CPKE 4TRLA 3ZFYA 4RWKA 2GS2A 3GU5A 3S4QA 4EUTA 2O0UA 3G9LX 3D14A 5M08A 2ETMA 3NYOA 1G5SA 3BQRA 2W5AA 4ITHA 4UXQA 5AEPA 1E1XA 4UMQA 3R73A 3ZRKA 2BVAA 1IRKA 4DF3A 5AP6A 5IQHA 3G9NA 4QP9A 4G31A 5IQFA 3KGAA 4DLJA 3LCSA 3MFSA 4RJ5A 5ANIA 4W4VA 2QHNA 2OJJA 3RPYA 5TKDA 3SAYA 4ASDA 4FV7A 2PULA 4X6QC 4EOLA 1ZOHA 3I5NA 4IHPA 5AP2A 2NP8A 3TIZA 4AOTA 3FZTA 1OBGA 1J7UA 3Q9YA 4FUXA 2BZHB 3MB7A 3FY0A 3OCSA 4BDGA 2BAKA 3ZM9A 3C9WA 5K4JA 4DFBA 2WQMA 3QRTA 4CFNA 4EOPA 3LXLA 4H1MA 5AV3A 1BI8A 3BGPA 3NCGA 5HEZA 4FV6A 4QOXA 4RZWA 5CVGA 2ZB1A 4U6RA 2BHEA 4E5AX 3A7FA 5I5ZA 2A27A 2ZVAA 4FZ6A 5DVRA 3TZ9A 2G2HA 2XA4A 2HCKA 4LV5A 1JPAA 4P90A 2LGCA 4TWNA 2IVVA 5AP4A 2R3PA 3BHUA 3R8LA 4CYJA 4HW7A 4MF0A 4XJ0A 2CGVA 4XV9A 2WMRA 3PY3A 4RIXB 2YIWA 3RZBA 1M7QA 1GIHA 4DFXE 4TW9A 3SW7A 5EKOA 4DA5A 1A06A 3NUSA 3ZLXA 2QOOA 4GUEA 4W4YA 2NNWB 3LFDA 4R6VA 4ZOGA 3EN4A 4XG6A 1Y8YA 4LG4A 4A9YA 5CF8A 4L53A 1ZYLA 1JQHA 5JN2A 5CEIA 3W2RA 3TV7A 4AW0A 5DPVA 4EOKA 2PMNX 1FGIA 3PJ3A 1H0WA 3FLYA 4YO4A 5D7AA 1P2AA 3Q04A 4I5PA 4JL9A 4E1ZA 2XEZA 4MWIA 1E9HA 2BR1A 3VO3A 4ALWA 1BLXA 2RFDA 3UPZA 3A7JA 3DFCB 3RAIA 3DK3A 3CQUA 3FY2A 3UTOA 2DYLA 4TZRA 2GPHA 4UEUA 4H36A 4F0GA 1UVRA 5IDPA 5J5SA 3C5UA 3NX8A 3M2WA 3UNKA 4M84A 4O0XA 5E1EA 2XNBA 4FUYA 2BRGA 1M17A 5A9UA 4MYGA 4ANSA 5E8UA 3MWUA 3H0ZA 4EWHA 2OF2A 4HGEA 4GU9A 5AV4A 2PUUA 1KE7A 3R7UA 4B6LA 3QQKA 4EZ7A 3PWYA 4FEVA 3LPBA 4U81A 4ZLOA 4FSUA 5IQDA 1Q99A 4QQ5A 3VS4A 2J51A 3U4WA 4FSNA 1H1WA 3DBFA 2XK7A 2GQGA 4NIFB 3Q2JA 3D7TA 2Q83A 4X3FA 4GT4A 1FGKA 3RPVA 2VWVA 3C4WA 2R3QA 1UWJA 2W1GA 3PIYA 4FMQA 4MAOA 1NW1A 4LMNA 3R02A 5E8YA 2O3PA 3BEGA 4ACGA 3D2KA 5H3QA 4C4IA 3LW0A 5EW9A 4RWIA 4FTUA 4FTTA 5H2UA 2PMOX 4O7YA 3DBCA 3L8XA 4I94A 5L6WL 5IU2A 4IX5A 3LXPA 3V3VA 1YQJA 4E6AA 3IDPA 2OW3A 4QP1A 1MUOA 3V8SA 1ZRZA 3MDYA 5IEVA 4RX9A 2R3NA 4EH5A 3GNIB 4ZLYA 3DK7A 3MY0A 3MPTA 2GS6A 4I4FA 1A9UA 3LQ3A 4YLJA 4ZY4A 4OLIA 2XIKA 1K3AA 4I41A 3MB6A 3PP1A 2I6LA 3HRCA 1ZZLA 1U54B 4IAFA 4L8MA 3N4VA 2C69A 3RKBA 4UY9A 4Y46A 1S9IA 2WMSA 1H0VA 4NM5A 4EK8A 2JKMA 3QTUA 3FHRA 2B7AA 2QOHA 3SV0A 3VBYA 1J91A 2A0CX 1P5EA 4FKSA 4E4XA 4AOIA 1U59A 2IZUA 3PY0A 4FIEA 2J0LA 5F20A 5FDPA 5CXZA 4XV1A 1WBWA 5GINE 1V0PA 3SQQA 4AA4A 5HG8A 5I9XA 5EM7A 3TZ7A 3BE2A 5ETAA 4DGLC 4EL9A 2GQRA 4L9IA 4BL1A 1OPLA 3HYHA 3V8TA 4U5JA 1UNHA 2JFMA 4O2ZA 4C35A 5L3AA 4EK6A 5DR9A 3PXQA 3L9LA 1YI4A 3LFFA 3PG3A 1FVTA 4EQMA 1DS5A 4DFYA 5BVNA 3EQGA 4V0GA 5C03A 4DFZE 3COIA 4GS6A 5HO6A 3ZDIA 4ONAA 2HENA 5ANKA 3LMIA 1Q61A 4L7SA 4IX6A 4KKHA 4W9XA 5D9HA 4P7EA 4C02A 3R7EA 5HHWA 2I0EA 4FEQA 4QP4A 3G0FA 4X3JA 4UB7A 1JKLA 3OCTA 5HESA 3RGFA 3TJDA 3G33A 3II5A 1ZY5A 4KRCA 2UVXA 2B0QA 3A8XA 3DCVA 4LGDA 4NWMA 3ZZEA 4BDHA 4JAJA 4BCHA 4RRVA 3SRVA 2XM9A 4MNEB 1NT2A 3Q32A 1CKPA 1FMOE 2VWBA 3PVWA 2YM7A 1J3HA 5LMAA 4AACA 2OJFE 5TR6A 3DBDA 5C26A 3KXHA 2J4ZA 4MEDA 4TYEA 2W1CA 5J7HA 1YXVA 2GNFA 5HE3A 3K54A 5HNIX 2UZEA 5F4NA 1H1PA 4M0YA 4BI1A 1PYXA 4FTJA 5B7VA 3PXFA 4EOJA 4FA2A 3QRJA 4QPSA 4Z3VA 3CQEA 3EN6A 3FQHA 5TO8A 4O7RA 4CG8A 4XG4A 4R3CA 4QP7A 5EM6A 3Q5IA 2NO3A 4Q9SA 5B2MA 3TUCA 1GIIA 1JBPE 1BL6A 2GHGA 4X21A 4R77A 5DWRA 5K3YA 2G1TA 2PWLA 3LFCA 4FKRA 3ZSIA 4AZEA 4IZ7A 1MQBA 5CTPA 1NVSA 4GU6A 5DA3A 2VGOA 4J98A 4AW2A 2WEVA 3PPJA 1OB3A 1W83A 2ZM1A 3PSBA 3A60A 2HOGA 4FT5A 5DR6A 4LV8A 5FM3A 4BWKA 5I3RA 4WBBB 2PE1A 5LMKC 1U5QA 4OTRA 4K9YA 1PHKA 3ET7A 3QC4A 5IUHA 1YHVA 2W1DA 3CLYA 3PXZA 4E4LA 5CT0A 2C30A 3VJNA 4AZSA 5DG5A 3FLWA 3HV3A 4WG3A 5BPYA 3GENA 4FX3A 5AUVA 4NTTA 4ZZNA 2FUMA 1ZMVA 1GZOA 2ZM3A 5L6PA 3MBLA 2YFXA 4CQGA 1APME 2ONLC 5F94A 3ZC5A 4I3ZA 4ZJVA 5ACKA 3ZLWA 3F7ZA 3ODZX 3KCKA 5B0XA 4IM3A 2P4IA 2WAJA 1OL5A 2WB8A 4XRJA 5FTGA 2ITPA 2VTIA 3TCPA 2C4GA 3OXIA 2WMXA 5CT7A 4TPTA 4USFA 2G2IA 5AADA 3NNXA 4NJ3A 2V0DA 3KB7A 3LOKA 3QCYA 5AAFA 3WF5A 3EFJA 4IVCA 5GJDA 4HPUE 2FO0A 3RJCA 2W06A 4KABA 4XOYA 1H07A 3CXWA 4L3JA 2ITWA 4OTGA 4CV8A 2JDTA 4ZP5A 4M68A 3IW6A 4OBQA 1JKSA 2C6TA 3EN7A 3NIZA 2BFXA 2H9VA 3OWKA 4BTJA 4N4SA 2CGUA 2QC6A 2WTDA 2VX3A 2OSCA 3TZ8A 3FXXA 3UYTA 3FKLA 1XBAA 3R71A 4A9TA 1NY3A 3GP0A 3EMGA 4BFMA 1J7LA 5KMJA 2BRNA 3GI3A 3BLQA 3QCQA 4F64A 4FBXA 1ERKA 3QQJA 3WI6A 4FOBA 3NYVA 3D5WA 4DFUA 3KF4A 4XBUA 2JKKA 4AXAA 1ZYDA 2ZV9A 3O50A 3VVHA 5JFSA 1YOJA 4IB3A 1SZMA 1KE6A 2PHKA 4YGAA 3A4OX 4IZYA 3NCZA 4QMQA 4PDSA 3O8TA 3BHYA 3F3TA 4DH7A 2IZSA 2CCIA 4OAVB 3OUKA 3NVKI 3QHRA 4DTKA 2JIIA 4GK3A 5CF6A 4YPDA 2AC3A 4S2ZA 1RQQA 4NKSA 3UP7A 5IQBA 1BX6A 3KF7A 4XP3A 2OZAA 4BWPA 4D4RA 3DV3A 2ITTA 2BHHA 4ACCA 5KCVA 2BIYA 4UZHA 5J7BA 4G1WA 3D7TB 5LMBA 2H96A 1KV1A 4C37A 4X3FB 3IW5A 3IGOA 4HNIA 4GVAA 2J90A 1IG1A 3GU7A 3T3UA 4D0XA 2UZOA 2X8EA 1R1WA 1RJBA 2XK6A 2Z02A 2HW6A 1GZKA 4N70A 3UZRA 5CEPA 2GNIA 4D2SA 4NM0A 3RM6A 5ANGA 3V5LA 4C3RA 2BZIB 4L01A 4QYYA 2PTKA 3EOCA 4BKJA 4C4FA 4YC3A 4ANOA 2BKKA 5IQAA 3DKOA 3QQHA 3PA4A 3D7ZA 3PJCA 4J71A 2C6EA 5DLSA 2XK8A 4AA0A 2OK1A 2JBOA 4YTHA 2OJIA 1UU9A 5IMXA 4IB5A 5HU3A 3LXKA 3FI8A 1P4FA 2W1ZA 1SVHA 2ACXA 2XK9A 3BWJA 4AZWA 4UN0C 2QG7A 3I6WA 4CLIA 1JVPP 3KA0A 2GTNA 3N9XA 1H08A 5FXSA 3VBXA 1PJKA 4GIHA 5HBEA 1YDSE 2ZV8A 4JG8A 3ROYA 3I0OA 3VQUA 4Y5QA 4FIJA 4JNWA 5FP6A 3BYMA 3KN6A 3UMXA 3QRIA 3TEIA 4P5QA 1JAMA 4JQ7A 2R9SA 2UZTA 1H00A 3WYXA 2Z7LA 4R8QA 3ZSHA 3ODYX 2PVYA 1BKXA 2RFNA
chains in the Genus database with same CATH superfamily
1G8AA 2VZ6A 1GNGA 3Q9ZA 4D1XA 5FBOA 1VZOA 3U9NA 2GQSA 4K11A 2GTMA 3Q4ZA 4AN9A 3RK9A 4G5JA 3COHA 3KRLA 3FLQA 4FIGA 4YNOA 4BGGA 2YM6A 3UO4A 3S1HA 5CAQA 5FD2A 4U7ZA 3UIUA 4MKCA 4GCJA 4F7JA 4QYEA 5FEEA 2CNVA 4D1ZA 4ENYA 1V0OA 3OBJA 5E8WA 4A9SA 4GK2A 3MN3A 4PMSA 2EVAA 4TY1A 2X0QA 5J8IA 4EBWA 2UW8A 4JBPA 5FDXA 3QD3A 4EK3A 3Q2MA 2B9FA 5F9EA 1M52A 4BDKA 4L3PA 3R04A 3ZO3A 4ACHA 4EH4A 4G2FA 4I6BA 4DCEA 2YITA 4HCVA 1KOBA 4GFMA 3EQPA 4EBVA 5CY3A 1JOWB 3Q9XA 1PKDA 5JH6A 3SRVB 2XK4A 1PMNA 3GC8A 3HAMA 3I0QA 4FIHA 5I3OA 2XKFA 2BPMA 3EQFA 3RPOA 2VWZA 2YCSA 4RJ8A 3VRYA 4C2VA 4I22A 3QHWA 3FJQE 4F0FA 1JSUA 4L43A 3KEXA 1H24A 2OXYA 1SM2A 5JFXA 5BQ0A 4YZCA 2C1BA 3NUXA 4KD1A 1NXKA 3F2AA 5K0KA 2OH4A 4IIRA 5HIDA 4DEDA 3ORXA 2JDVA 2J9MA 4RBLA 4FV1A 2RG5A 3PG1A 2VWUA 4MX9A 4B99A 3VBWA 3HLLA 4E93A 3NPCA 4E5BA 2JDOA 5FWKK 5A14A 3FSKA 1QPDA 2HWOA 4F78A 2HIWA 3UOJA 3C1XA 3C0IA 5E8ZA 3MA3A 1L3RE 4DHFA 4HVDA 3FMEA 2PVJA 4FZFB 3OXTA 3NWWA 2QVSE 3D2IA 2HZ4A 4L45A 4NCTA 3W2QA 4CXAA 4XV3A 4C0TA 4WUNA 5HVKA 4CKIA 4IAKA 3C4CA 1YWRA 2X7GA 4DT8A 2O63A 4ZXTA 4BGHA 2WD1A 3QXOA 4X2GA 3DJ7A 5J95A 3ORKA 4GJ2A 5DI1A 3QRUA 4DYMA 1ZOGA 4O84A 3Q4CA 2YZAA 5CQUA 3TXOA 4EOQA 3QGYA 4U97A 3JR1A 1BYGA 2CDZA 2QOFA 3DT1A 2QONA 2ITUA 2EB3A 3LFQA 3W8LA 4CCUA 5HTBA 2IO6A 3LAUA 4FSYA 4KNBA 3ATSA 1PXKA 2ERZE 4QMNA 3QTXA 3TTIA 3GB2A 2BDFA 2R3GA 4ZTSA 2C6MA 2UW9A 4QYGA 3SXFA 3UG2A 4LRMA 4IBMA 4DEGA 1WBOA 4XG7A 4IVAA 1YXTA 4FI1A 3N4TA 3DDQA 2O64A 3FHIA 4JQEA 3D5UA 4Y83A 5K9IA 4GKHA 2BAQA 3P7AA 4YZNA 4BBEA 3OCGA 2Y4PA 3PVUA 1H26A 2B54A 3MVLA 4GFGA 3C5IA 4YNEA 5L8KA 4DGMA 2PUNA 4YUQA 3VS6A 2ZV2A 4L52A 1OL7A 4DH1A 2I7QA 4EYJA 2XP2A 4UALA 3V5TA 4ANNA 2EB2A 4XCUA 5L8JA 5KZ0A 2QO9A 2V62A 3KRXA 4FSQA 2WU6A 5CI6A 3VC4A 3MIAA 5A6NA 4LMUA 4ZY5A 4YZMA 5LWNA 5E7RA 5BUIA 4NT4A 1KWPA 2WTVA 4CRLA 3H4JA 1Q24A 2WIPA 1SVGA 3FZ1A 5ITAA 4L7FA 3BLAA 2BZJA 1O6YA 4RIWA 3CE3A 3KULA 4CFXA 2ETRA 3DA6A 3MFRA 2J0IA 3OWJA 2WZJA 3KU2A 2HW7A 5M55A 5AV0A 2VTLA 4MXOA 5I9YA 3I7CA 4RJ7A 3UO5A 2XBJA 2GHLA 2J50A 1ZARA 3P79A 4QTDA 3BV3A 3LFNA 4O38A 3UDZA 2YISA 3O71A 5B2LA 3R7GA 4CFUA 3FLSA 4FV2A 4U44A 3CD8A 3R00A 4F6UA 4RVKA 4C34A 3BU6A 4E6QA 4RWLA 5AR7A 4C62A 3PWDA 5JK3A 3FE3A 4OAUC 2GCDA 4ZJJA 3MH0A 3W2SA 2V55A 4RC3A 5FQDC 2R5TA 3HUCA 4EOSA 3C7QA 4IVDA 1TVOA 1OPKA 2CGXA 4AF3A 3CQWA 5AAEA 2H34A 2FSMX 4WO5A 5KHWA 4DH5A 1TFFA 3MY1A 4YR8A 5HIBA 3UVPA 5IISA 2GNHA 2OZAB 3CPBA 4QTCA 2OFVA 5A46A 2VO0A 1HCLA 2OXXA 3QZFA 4FR4A 3BWFA 5AA8A 4QT1A 5HLNA 3NW6A 4BDJA 3R6XA 5LCJA 4YTFA 4PTEA 5AAGA 4MUQA 1Q8YA 2Y7JA 4U79A 3UOLA 4FODA 4BI2A 2J7TA 2JIVA 2UZVA 3FMKA 3NYXA 5KX8A 5AIRA 4BDAA 4YSJA 4IDTA 5AMNA 5GJFA 4NKAA 4E20A 1Q8UA 3M11A 2UW7A 1SMHA 5C9CA 1WBTA 3LVPA 1ZYSA 4GEOA 4R7BA 5A4CA 5L8LA 4FEWA 2O8YA 1UU7A 3GFEA 3P9JA 2EWAA 2XYNA 4R5SA 5FLFA 2G9XA 5B2KA 3R9NA 4IE9A 3TACA 4AT4A 5HQ0A 2YDIA 5KMMA 1REKA 2WTCA 5D12A 3C50A 4J8MA 4QMTA 3JVRA 3OBGA 4PL3A 2F2UA 3KVXA 4XP2A 5IH4A 5LVOA 3W0PA 1YI6A 2CLXA 1KV2A 4FT7A 1PRYA 3HMIA 3R83A 4U42A 2UZWE 2ITXA 2PVKA 3DKFA 4XS2A 5M53A 2GFCA 5HNGA 2IVTA 5M4IA 4W4XA 3Q6UA 2CJMA 2YZLA 3K3JA 2NYAA 2VO3A 4KSPA 3A2CA 4NW6A 1WMKA 3V5WA 5CU0A 4HCTA 2X1NA 2X39A 2YIQA 5AM6A 4I6HA 3PDTA 3NZ0A 4FT3A 4XG3A 3FPQA 3HMMA 2V5QA 4C57A 2YCQA 4YBKA 5AA9A 1PYEA 4HVGA 4C33A 4CZUA 1B39A 4PMPA 3UC3A 5HLWA 2PE0A 3NEWA 3DJ5A 5K4IA 4O83A 2SRCA 3BLHA 4ZTQA 4JAIA 3GU6A 3HKOA 1T45A 1KSWA 3F82A 4QO9A 5IKWA 4RFZA 2CKQA 1Y6AA 4F63A 4YJQA 5AP0A 2JLDA 4O81A 2IPXA 3AD4A 4I5CA 4YZBA 1F5QA 5I9WA 4KB8A 1WVXA 5CSPA 5DR2A 3D4QA 3KRJA 1ZWSA 2QR7A 4GYIA 5TF9A 4DHJA 1CDKA 3V5PA 5IQIA 3QQUA 2WMUA 4CT1A 4D0WA 3TTJA 3NLBA 2PVMA 2XAMA 5CVFA 4BDCA 4MNFA 4KKGA 5EQEA 2C3LA 2C68A 2CHLA 4WT6A 4AGWA 3GCUA 4AQCA 2EXEA 4K6ZA 1ATPE 2Z2WA 3QD4A 2J6MA 2XCHA 3A4PA 1NVQA 1IA8A 3MA6A 2J0KA 3MSSA 3QWKA 4HVIA 2YWVA 2BDWA 5D10A 5BX0A 2Y0AA 4AP7A 4Y5HA 3S95A 4F9CA 3EQIA 3CCNA 4LGGA 1PKGA 2O65A 3E3BX 5CEKA 4YPSA 2Z7QA 4FG7A 3Q60A 3ZM4A 4AWIA 2WXVA 3IW7A 4ZSAA 3DFAA 5AFVA 3R8VA 2VTOA 4TN6A 1ST0A 4CEGA 2PVLA 2PVRA 4PNKA 3PXRA 5BVDA 3F3WA 3ORLA 3BV2A 4OT5A 2BRHA 5FXRA 1R3CA 3BYSA 2PVFA 4CCBA 1VYWA 4PV0A 3WE4A 5AR4A 1J1CA 2Q0BA 3UIMA 3OF0A 4GW8A 3BBTB 1Q97A 3VBQA 3QWJA 3PJ2A 3PRIA 5A4EA 4FICA 3BRBA 3VWAA 1B38A 4H05A 2OWBA 2VTTA 2R4BA 3ZUTA 4UBAA 2O5KA 4DITA 3AT3A 2PZIA 4EUUA 3MFUA 3ZO1A 3A99A 2IW9A 4G3DA 3LIJA 4NEUA 4RIYB 3NNUA 4F9AA 4AQKA 4MH7A 2OBJA 2Y4IC 4LOOA 2JAVA 4KBKA 4CTCA 4EOIA 2VNYA 1XMMA 3LFSA 1OUYA 3T9IA 1GIJA 5FTQA 4AN2A 4I6LA 4Q5HA 3KXGA 2C0OA 5J87A 3HUBA 5E8TA 3ZSGA 3BBWA 3AKKA 3BQCA 4KUJA 4S31A 2WQBA 3F9NA 4IWQA 2QURA 4LL0A 4BCNA 1OGUA 5AV2A 2QLQA 4I5HA 5EW8A 3C4XA 3C4ZA 4I5MA 1WBNA 3BYOA 5C1QB 4ZZOA 3PYYA 4UMUA 3AD5A 2Y6MA 4DINA 4E73A 4YO6A 3BGZA 3KVWA 2W9FB 2RGPA 3DDPA 4MD7E 4ZIMA 4UMPA 4FIIA 3JS2A 3NNWA 2XNNA 4MXZA 2F49A 3TI1A 4RX5A 3PUFC 2XM8A 3ORZA 4ENXA 5HCYA 4N6ZA 4KSQA 4JG6A 4BCGA 5A4TA 5ETIA 3DK6A 1Z9XA 3THBA 3QD0A 3G6GA 3WOWA 4LUEA 3A8WA 5JQ8A 3FDNA 3F7WA 4DFNA 3RWQA 1PF8A 4O4DA 4K18A 4V01A 3UNZA 3G51A 4MBLA 4RIWB 3KULB 4D28A 5I4NA 2WEIA 2XJ1A 3AC3A 3ZEPA 4FSTA 2KTYA 3TT0A 3VUTA 2XALA 2YLEA 3REPA 3UMWA 4WHZA 3BELA 4ZZMA 4D2WA 3NVMB 3U55A 4KBAA 2HZ0A 2Z60A 4YJPA 3CJGA 4NFMA 3E87A 2WMWA 3QTZA 5CNOA 3SVVA 4NW5A 5AJQA 4FTKA 4KIKA 4DEIA 5JGAA 2QKRA 2IW8A 3QLFA 4O7ZA 2VTSA 4L68A 4QNYA 4IJPA 5C8MA 2WGJA 3NGAA 3KQ7A 4IANA 4HZSA 1OL2A 1PY5A 1TZDA 4HGTA 3UVRA 5AP3A 4FT0A 4CG9A 3HAVA 1ZMUA 2QU5A 4FTIA 3FI4A 3FYJX 4FNZA 1R0PA 3R7VA 4CFVA 4ERKA 3I4BA 5IA2A 3DBEA 4YBJA 1VYZA 4XRLA 5HNBA 1Q8ZA 2RL5A 4R7HA 2W1HA 3WZJA 2NPQA 3PPKA 4M14A 4G3EA 4E8AA 3IECA 3CPCA 2QD9A 4BKZA 3PVGA 5E1SA 3GXLA 2W05A 1OVEA 4TKSA 3UJGA 5T3QA 2BZKB 1WBSA 2ZMDA 4M0ZA 2ERKA 3OW3A 4M69B 5DNRA 5HD4A 5LOHA 4M7IA 2X8IA 4I20A 3R9DA 5M4UA 2A98A 3SG8A 5CENA 1PXMA 3LFAA 4QNAA 4QMUA 3AC4A 4HGLA 2B52A 4UXLA 5M06A 2OH0E 4ORKA 1U5RA 3R30A 5EH0A 1NVRA 3IOPA 3TKHA 2E9NA 2QOCA 4AS0A 4AW5A 1CKIA 3L8SA 2ITOA 4DBXA 3KK8A 4II5A 2X9EA 5KHXA 4ARKA 4B4LA 3E8NA 5M4CA 3VRZA 1Y57A 4G6NA 3ZMMA 1WZYA 4ZSJA 1PXJA 2F7EE 2WTJA 3HRFA 4S30A 4IEBA 1K9AA 5EKNA 4WBOA 3S0OA 3LHJA 4IB1A 4OBOA 4W8DA 5DN3A 3V8WA 2WOTA 3P86A 2ZYBA 3GT8A 3R2YA 4U8ZA 4AT3A 3PSCA 3TNIA 2VTHA 1JKTA 3L9MA 3Q4TA 1YHWA 2JGZA 4O0UA 4A4LA 3FMDA 4BZOA 1V0BA 5CXHA 4APCA 2FVDA 4X0MA 4QPMA 4DEBA 3KY2A 5LJJA 2JC6A 4IB0A 5AR8A 3QGWA 4IDVA 5E9EA 3MH2A 2XJ0A 3HMOA 2B4SB 2RIOA 3OEZA 4FKJA 4OBPA 5AUZA 2XIZA 3V5QA 3RVGA 2XNPA 2ITVA 5H8GA 5LQFA 3OROA 2HY0A 3E92A 3WBLA 2XRWA 4IC7A 2RSVA 3B2WA 3FQEA 3CR0A 3MJ2A 5CX9A 1W2FA 2UZLA 5L6OA 2QG5A 2BRBA 3BIZA 3RBWA 1REJA 3FWQA 3WZUA 4CZYB 3ENMA 4J7BA 4BIBA 4DG2E 3L9NA 4FTCA 5AX3A 2BMCA 4BCJA 1CM8A 4L46A 4PMMA 4MK0A 5DT3A 3PA5A 3PUPA 2WPAA 2XKCA 3EN5A 3FI3A 3MY5A 5CEOA 3KREA 3BHHA 4O4EA 1I09A 3V51A 2G15A 3BX5A 3POOA 3NDMA 3QAME 3PE2A 2AC5A 5CZIA 4FNWA 4QDEA 5EDRA 3ZLSA 3LE6A 4R7IA 4QTAA 5IA5A 3S3IA 4CMUA 2E9PA 3OHTA 3O96A 3BU3A 4LRJA 3AXWA 5KKRC 2XB7A 3AC8A 3K5VA 4OTPA 4YJUA 4BTFA 3MV5A 3PVBA 3O8UA 4L67A 3COMA 3O2MA 4PDOA 5ANEA 4YTIA 1ZMWA 2FSLX 3EQHA 3ZH8A 3Q4UA 3ML1A 5CALA 4I23A 4XUFA 5K5NA 2PMIA 4C7TA 4ITJA 1OPJA 4EH7A 1GY3A 3QQFA 2PUIA 4IZAA 4C8BA 4BBFA 2YA9A 3TUBA 4XG9A 4O1OA 4TYGA 4GJ3A 2W4JA 3RTPA 3QX2A 4EORA 3TG1A 3KXMA 1DI8A 3U87A 4BC6A 4EC9A 2ZDUA 4JDJA 3ITZA 1PMEA 1UU3A 3NIEA 4FL2A 4UWCA 4H39A 3QFVA 1XKKA 4BF2A 3BU5A 3QU0A 4FSRA 4A06A 3BYVA 1YHSA 3N51A 4BBMA 4G9RA 4DFLA 3PLAE 3I6UA 4E6DA 2C5VA 3KXXA 4F0IA 4WNKA 3GBZA 1FPUA 3G0EA 2Z7SA 4LYNA 1M2RA 4QMXA 4BYIA 3ZTXA 3P1AA 4OR5A 4AAYA 5HX8A 2ESMA 3BL7A 4V05A 4BR3A 3TDVA 3WZEA 4ZAUA 4FC0A 1KUTA 1WCCA 4JBOA 3QF9A 2UW4A 3W2OA 3LZBA 4PDPA 3WZKA 3QCXA 2XRUA 4JOAA 4ASEA 4F9YA 1TQIA 3TN8A 2GSFA 4M15A 3TDWA 4IM0A 4RSSA 4RIOA 3QYZA 4ZTHA 1XH9A 4KIOA 3HP2A 2E9UA 1ZXEA 5AV1A 1BI7A 4F6WA 2FH9A 4WNOA 2WQNA 4YU2A 4JLCA 2YIYA 3QTIA 4FV0A 4CKJA 3UQFA 4O0RA 4L42A 4RJ3A 3D5VA 1QPCA 4EHZA 4AXEA 2VV9A 5HG9A 2IZTA 2BTRA 3IPHA 4QD6A 3DAJA 4X2KA 3VNTA 3VULA 2PMLX 3HZTA 4UWBA 4LV7A 3DPKA 3U6IA 3QQGA 5HORA 4FKVA 4BCQA 1YDTE 3AC1A 3GUBA 3OCBA 3OP5A 4JQ8A 4K8AA 2PZRA 3BKBA 3R2BA 4F7LA 4ANQA 3WIKA 2QKWB 5CYIA 5TOZA 2G2FA 3VUMA 3H9OA 4A9UA 2VWYA 3C4EA 5FEDA 1JSTA 3RPRA 4BZNA 5KMKA 1YI3A 2WO6A 3QKMA 4CMTA 4F08A 3Q96A 2WHBA 1G8JA 4FZDB 4LL5A 3QA0A 1WFCA 4K2RA 2IZRA 5T68A 2X9FA 1W82A 1FMKA 5FM2A 4FV5A 4IJ9A 2JKQA 1IASA 4PTCA 2R3MA 1EH4A 2A19B 3CGFA 2XBAA 4X2JA 4J95A 2JDRA 1YRPA 2QHMA 2W4OA 4R1VA 5HO7A 1OITA 2C6OA 2QU6A 5AUWA 3Q5ZA 5G1XA 3LMHA 4J99A 3FXZA 2PY3A 1SYKA 3KC3A 4FT9A 4TYHB 3V6RA 2OIDA 3MYGA 1OKZA 2PSQA 4H3QA 4B7TA 2XZSA 3DTWA 4KAOA 4KIKB 3KMMA 3VW6A 1Z57A 1PXOA 4U45A 4NL0A 5GHVA 4CTBA 5KBRA 5JZJA 1XR1A 4FOCA 3EZRA 4HYHA 5FUTA 2RF9A 5DEWA 3I60A 4H1JA 1H1QA 1M2QA 4YJNA 3AMAA 3HV6A 3IONA 4HGSA 2RKUA 2ITZA 3VS3A 2YAAA 3UNJA 3TL8A 4GT5A 4IMYA 2IVUA 3O8PA 3QXPA 5EYKA 5I9UA 2VAGA 4I4EA 3ZFXA 4AW1A 4AOJA 4A4XA 4PNIA 1MRYA 2GS7A 4JS8A 4FV8A 4ACDA 4IX3A 4QQJA 1JWHA 3DNDA 3GOKA 3C51A 4JDKA 2AUHA 4PY1A 4ALVA 5M56A 4E4MA 4F9BA 2DUVA 3SDJA 4G5PA 4OTIA 2C6DA 2HY81 4G6OA 4RVMA 1ND4A 4LOPA 4G3CA 5IQGA 4QQTA 2X8DA 3OY1A 2CKEA 3AKLA 3MIYA 2VWIA 3VONA 5L2WA 4AFEA 5HE0A 2J0JA 4XX9A 2CN5A 3LJ2A 4FYOA 3OS3A 3JY9A 3LLTA 3WF7A 2IEWA 4IM2A 4R1YA 2YHVA 3KKVA 4QDVA 3FLNC 5EYCA 3RI1A 3SOCA 3PXYA 2C6LA 5IPJA 3W0MA 2VWWA 5EM8A 2BUJA 3GU8A 4EWQA 3DS6A 1M7NA 3CY3A 2FB8A 4PWNA 4QMPA 3FZPA 3G15A 2C5XA 4AXDA 3ZLYA 4MVFA 5CEMA 5JSMA 4M66A 5KNJA 1L8TA 5BVWA 5BVOA 3R21A 1Y6BA 1CKJA 3E3PA 3FV8A 3IDCA 4HYIA 4AX8A 1YW2A 2REIA 4DAWA 4AG8A 2CNQA 3UDSA 4JG7A 4D4VA 3LKMA 4OT6A 3AGMA 5AR5A 3FC2A 4CFWA 2YDJA 4OTDA 3KXNA 4U43A 1W98A 2XNMA 5ANDA 5CSWA 3W2CA 4JBVA 1H1SA 2OGVA 1PXPA 3O7LB 3WF6A 3TM0A 3QCSA 5HE2A 2X7OA 1VLRA 4IXPA 3K3IA 4FKPA 4M13A 2VD5A 4A07A 2IW6A 2VTRA 2OJ9A 4TNBA 4RWJA 3R1QA 4WNPA 1PXIA 4AUAA 3FEGA 2XKEA 4K77A 2CSNA 5CAVA 2P0CA 4QMZA 3D15A 3OC1A 3P7CA 4ID7A 4EK5A 2FYSA 5EDPA 4RIYA 3SKCA 3OW4A 4NTSA 4AZTA 2AQXA 4E6CA 4EKKA 3KFAA 4W8EA 4RC4A 3ZZWA 4FKIA 1AQ1A 2F2CB 2OIBA 2IG7A 3OOGA 4MXCA 3SC1A 5LWMA 4TYIA 4QMVA 3QA8A 3QC9A 3QRKA 4GRBA 4RT7A 3RK7A 4CV9A 4D2RA 4U40A 2B55A 4RC2A 2QQ7A 3E88A 4G34A 4BCFA 2R3FA 3T8OA 5JKGA 4NM7A 3ERKA 4BHZA 4EI4A 3MW1A 5C4LA 3PIXA 3TV6A 3U8WA 4FG9A 2H8HA 4S33A 3WILA 4LM5A 2JFLA 3FPMA 5LARA 1YWNA 3W0OA 2C5YA 1OKYA 3QALE 1ZAOA 4UWYA 4YLLA 4O7LA 3EFLA 3NYNA 3VBTA 5JFVA 3V6SA 3VAPA 3TNWA 2DQ7X 2R7IA 3F69A 4ZTRA 4JT3A 4YC8A 2BALA 4FKTA 4EH9A 3G2FA 5M51A 2CMWA 3E7OA 4XP0A 5AM7A 2PVHA 4FZAB 4RQKA 3R7YA 2HZIA 2R3LA 3H30A 4I0TA 3S2PA 4EZ3A 5CAUA 3UP2A 5IQCA 4MHAA 5DHJA 4TNDA 4JX3A 5BMMA 3W8QA 2W1IA 2F4JA 2OG8A 4IQ6A 4P5ZA 1PXLA 3QZGA 4QPAA 1XH8A 4TWCA 4YC6A 2JEDA 2EUFB 5HG5A 4USDA 3SXSA 5IMEA 5M09A 5H9BA 1CSNA 2X4FA 4FTNA 2H6DA 2A2AA 4WG4A 2YCRA 3E93A 3PXKA 4CSVA 2CKPA 4DH3A 3HMNA 3OWPA 3W55A 3QTWA 4ITIA 3RHKA 1GOLA 3O17A 2PK9A 3FYKX 3HA6A 3RCJA 4F4PA 3F2NA 4QEBA 4O2PA 2P2HA 2YJRA 5BYZA 3JVSA 3CIKA 2PUPA 3G5DA 5IH5A 2ZV7A 1LPUA 1OZ1A 1WVWA 4F7NA 5FG8A 4D4SA 4CGAA 2XH5A 3AOXA 2YIXA 4KRDA 5G6VA 4F1MA 3O23A 4FEUA 2C0IA 3OFMA 3SA0A 2XS0A 3PJ8A 3F88A 2RG6A 5A54A 5CWZA 4FJVA 3EFKA 4NK9A 3QTQA 5HCXA 2PL0A 3P08A 5DT4A 4HCUA 2HXQA 3LCTA 2JDSA 1R39A 2B1PA 2WMBA 3IW8A 4IACA 5ETFA 3VN9A 5JEBA 5LMKA 3RK5A 4QYFA 4DTBA 4BN1A 2C3JA 4M69A 5AUYA 5AR2A 2XEYA 3JY0A 1O6KA 3GC9A 3R0TA 3AD6A 4JRVA 4RFMA 4XYFA 3ROCA 2Z7RA 1HOWA 3MH1A 3PZEA 3U51A 3R1YA 4CRSA 4XG2A 3R28A 4NSTA 2B9JA 2JKOA 3O7LD 4KINA 3WIGA 2WTKC 2XUUA 3FMJA 3MVMA 1T46A 3OVVA 4BKYA 2ONLA 3UVQA 2WMQA 3OT8A 5LVPA 3R7IA 3W33A 1B6CB 2C3IB 4GT3A 5D11A 4XNEA 3ZDUA 5C8NA 3G90X 4FKQA 4UZDA 4BI0A 2PE2A 3EL7A 3AC2A 5ICPA 5EYDA 2R3KA 1YKRA 4FIFA 3BE9A 1FBNA 4YTCA 1UKIA 4AFJA 5C27A 3GC7A 5ETCA 4C4EA 4EHVA 3LLAA 2UZBA 2JIUA 3ZXTA 2QO7A 5IDNA 4EKLA 4ZY6A 2VN9A 4PDYA 3PLSA 4C2WA 3CY2A 4OGRA 2QNJA 4QQCA 4FE2A 4FEXA 2W1FA 2X2MA 3ORTA 2WOUA 2F9GA 3NUAA 2PZYA 4APPA 1UU8A 4ANLA 4EH6A 2XKDA 3ZYAA 2QLUA 4X2NA 4CNHA 3DQWA 3S00A 1IAHA 2UW3A 3LM5A 4H58A 2I0HA 4LUDA 4RGJA 4GKIA 3GC0A 4F09A 3OT3A 4QTEA 4RQVA 2A4LA 2I1MA 2Z8CA 3GU4A 4NUSA 2GDOA 4O0YA 3ZONA 3F5XA 3NS9A 2VU3A 2VX0A 5ANJA 5JZNA 3H9RA 5LVLA 3F5GA 5TE0A 5D7VA 2WIHA 4G16A 4QMYA 2WTWA 3WZDA 3KXZA 4ZLZA 2W17A 3FMLA 3GCSA 3GCPA 1UA2A 3D94A 4HOKA 4P2KA 1W2CA 3RALA 3Q9WA 3OZ6A 3DNEA 2JD5A 2KULA 2Y4IB 3EQDA 3D9VA 3E8CA 3AT4A 4GH2A 1G8KA 3UIXA 3UPXA 3ZRMA 4I6QA 2NRYA 1OIUA 2W5BA 3COKA 4M8TA 5BUJA 4A4OA 3V5JA 4FNYA 4O0WA 2YDKA 4LGHA 1UNGA 1MRVA 1YWVA 2OF4A 3L8PA 3L8VA 4DG0E 1U4DA 2PYWA 4CKRA 5IZFA 1Z5MA 5EFQA 3CSVA 3P7BA 4PRJA 2FA2A 4TTHB 4GFOA 3I79A 4Q2AA 5DFPA 4DLIA 2HZNA 2RFSA 3IK3A 4BB4A 2P3GX 2ZDTA 3HX4A 2W7XA 1UKHA 3T9TA 4BGQA 5K0XA 2ITQA 3KK9A 3DLSA 3PE1A 4D5KA 2R64A 1XH6A 5IG1A 3VW8A 3UODA 2VTQA 3VHEA 4DDIA 3RNIA 4R78A 4D58A 3NRMA 3IW4A 3EFWA 4MF1A 1MQ4A 2XIYA 4RMZA 2YEXA 4EZ5A 2VGPA 4O0TA 5E8XA 3HV7A 3VUHA 4M97A 2YERA 3BZ3A 1Q5KA 4PF4A 3MPAA 1PXNA 4QMOA 2YLFA 3RAWA 4M12A 4UX9A 1Q62A 3RMFA 2NRUA 2C5NA 1W7HA 1VJYA 3PTGA 4M67A 5HBHA 3ATTA 4CQEA 4C4GA 4I92A 3GEQA 2X6EA 1SNXA 3OXZA 3R8ZA 3W10A 2R0UA 4U3YA 1DAWA 4G3GA 4JIAA 1F0QA 3FLZA 4FZ7A 4DN5A 3HP5A 3E64A 1UNLA 3DOGA 1OMWA 5HOAA 4BDDA 4EH8A 4CVAA 4BCOA 4IZ5A 5M57A 4NYEA 5BVKA 4RG0A 2C3KA 3W32A 2BIKB 4Z7HA 4YMJA 5CANA 1LP4A 3CS9A 4I6FA 2XIXA 1QPJA 3DQXA 3ZCLA 3GGFA 1XBBA 1OUKA 4GIIA 4L44A 2XNOA 2WQOA 1O6LA 2E9OA 3UOHA 3LFEA 4JXFA 4UV0A 4JX7A 3VS1A 3TKIA 4QMMA 3RCDA 3RAHA 4BDIA 2FGIA 2X6DA 3JXWA 5T6KA 5KUPA 2X4ZA 1QPEA 2WELA 5JQ5A 2UV2A 5J1VA 1JNKA 3F5PA 1URWA 5K5XA 4DTAA 4G17A 4XMOA 4I93A 1WAKA 4YJRA 5J9YA 4FTMA 5BVEA 2QR8A 4EYMA 4C38A 4C3FA 4YHFA 5HBJA 2ZFYA 4DEAA 4DCAA 3O5AA 5JMSA 3LQ5A 1G8SA 3R8MA 2RFEA 4EQUA 4Z55A 3P23A 3I81A 4J53A 3ZBFA 2CN8A 2W1EA 3UZPA 5CEQA 3GCVA 1RW8A 3IG7A