3OOGA

Human camp-dependent protein kinase in complex with a small fragment
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
335
structure length
333
Chain Sequence
KEFLAKAKEDFLKKWESPAQNTAHLDQFERIKTLGTGSFGRVMLVKHKETGNHYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMVMEYVPGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGFAKRVKGRTWLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFATTDWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEEEIRVINEKCGKEFSEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords cAMP-dependent protein kinase catalytic subunit alpha
publication title Fragment based drug design on human PKA
rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 106
structure length 333
sequence length 335
ec nomenclature ec 2.7.11.11: cAMP-dependent protein kinase.
pdb deposition date 2010-08-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3oogA01
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3oogA02
5ITAA 4UYNA 2VTTA 3KRJA 4WHZA 4WUAA 3VUHA 2X9FA 3EQDA 4CMUA 3SQQA 1DAYA 3NZ0A 4NWMA 4A06A 2WFYA 1SZMA 3MFTA 1KOBA 4IC7A 3R7GA 4CZUA 3SG8A 4FNZA 2PVMA 4IX5A 2XJ1A 4YPSA 4W9WA 3ZZWA 4O7SA 2XKEA 2OXYA 4LM5A 4XEYA 1XQZA 2V5QA 3VULA 3UC4A 3DDPA 5TE0A 3KA0A 3C4WA 3NNXA 3RMFA 2O0UA 3RAIA 4ZTNA 4AW5A 3BHUA 4EZ3A 2FYSA 2PZPA 3PXYA 2ZM1A 3NYVA 4P7EA 1PHKA 2C1AA 3BYSA 3NVMB 4QNYA 1KOAA 4FEVA 2QLQA 3CIKA 4J98A 3ROCA 3QZIA 4Z9LA 4HNFA 3NYOA 2PYWA 4U40A 3MVHA 4LOQA 3LFSA 2WQNA 3KXZA 2W1FA 3R2YA 3OZ6A 5F1ZA 4I5HA 2XF0A 4NCTA 3G0FA 2J50A 3VS3A 5FUTA 4FTCA 4D1SA 3QD2B 3IW4A 4NM0A 3BU3A 1PKGA 3LCSA 4CLJA 3PLSA 5BVOA 3PIYA 2C6OA 4DN5A 4K11A 4AN9A 2EU9A 3TNHA 2XIYA 4TY1A 4FZ7A 4BKYA 3LFFA 2O64A 3N51A 5C1QB 3CQUA 3FV8A 1OL1A 3FL5A 5JZJA 2DS1A 5FWKK 4NT4A 4AG8A 5LWMA 5JGDA 2XB7A 1OZ1A 2IPXA 5L2QA 4E20A 5LCKA 4NL0A 4AOTA 4YJTA 4AU8A 5HICA 5AV4A 3NUXA 5J7BA 2HW6A 4FIEA 4ZP5A 3UIBA 4BCPA 5IEXA 3U54A 3T9TA 4JBQA 1YKRA 1G5SA 2E9NA 4UMQA 4YC8A 4QP1A 5IA2A 3WI6A 2BKZA 3LFQA 3QTRA 4RIXB 3I5NA 4LFIA 2HK5A 4I3ZA 4YPDA 3I7CA 3FC1X 3R02A 1MP8A 4OAUC 2CKQA 2HZNA 3CCNA 4JDKA 5TOZA 4GU9A 1I09A 2P4IA 3DCVA 4CFMA 1QMZA 5LJJA 1OIUA 1PKDA 4QP9A 4C37A 5KX8A 2UZWE 3QA0A 2C6IA 3QX4A 3GU8A 2BR1A 2QLUA 4UWCA 2BVAA 2W0JA 3I0OA 3F82A 4U5JA 1STCE 1J91A 2KULA 4BCKA 5JQ5A 3AD5A 4ZMFA 4YHJA 2R0UA 4R5SA 5ANDA 2VGOA 3PVBA 2CGXA 3MH1A 4KKEA 4BTMA 4K2RA 4V0GB 5L6PA 5CAUA 3LCOA 3OHTA 5IQAA 4U3YA 2CMWA 3CD8A 5CI7A 2BMCA 4DEHA 4Z7HA 4Y5HA 1YDTE 1SM2A 5JFVA 1XR1A 1ZYLA 5CF8A 2OKRA 3HRCA 3VUMA 1W83A 1P5EA 1W8CA 1JKSA 2QOHA 3QYWA 4IAFA 4K33A 5DR9A 5L8LA 3ZUUA 2GQGA 4W4YA 2QG7A 3E8NA 4NFMA 1SVHA 2H6DA 4HVGA 4M14A 1T45A 2B7AA 4ZJJA 4G3EA 5DN3A 4G1WA 3MY0A 4K18A 4PV0A 3MTLA 3U87A 4CRLA 4QQJA 4DH8A 3C0HA 5D7AA 3BE9A 5E8WA 4CFNA 3OCSA 1PXPA 1KE5A 3D2IA 3HV7A 2JITA 4WKQA 4G16A 4MBLA 3Q2JA 2X0GA 5JK3A 2WMVA 2VD5A 3QXPA 1YXVA 5HE0A 3WZDA 4XG9A 5CSPA 5E8XA 2HYYA 5HO8A 4EQMA 5LMBA 2H9VA 1OKWA 3R00A 4NKSA 2A19B 3DBQA 1VR2A 3FI2A 4TKSA 4TPTA 3HMOA 2WD1A 3MSSA 4TWCA 5JFXA 2AYPA 1IASA 4Y8DA 4O27B 2QNJA 5AFVA 4Y95A 3G33A 4J97A 3UO5A 2XNOA 3HAVA 3ZDIA 2QKWB 3BBTB 2VWVA 3FE3A 4CFVA 5JGAA 2FVDA 3ORTA 4JQEA 2CNUA 4QOXA 5AWMA 4CEGA 3K2LA 4CYJA 2ZV9A 3DAEA 4CV8A 2VRXA 3UO6A 4BY9E 3TXOA 5CU2A 4A9UA 4DG0E 4FNWA 3EFJA 2I0EA 3E7OA 4HOKA 5H2UA 5FP6A 2YCRA 2F57A 4KIKB 4CXAA 2ITQA 2IVUA 3V51A 4DEDA 4RWJA 4C34A 3BE2A 2PMLX 4GKHA 5DT3A 2WMAA 3OWPA 1PXMA 4H36A 4FTLA 2J0JA 2FSMX 3HP5A 4XOZA 4YJSA 4ONAA 4DGOA 3LOKA 1ZAOA 4YNEA 4N70A 3MYGA 4XV1A 3V6RA 2CNVA 3GCUA 2RFSA 3PG1A 2CSNA 5AADA 3BQCA 3ID6C 2W9FB 4E73A 4CG8A 2FO0A 2C68A 2WTJA 4C3RA 3TV7A 3PRFA 4I92A 4XV3A 2V7OA 4FVRA 3VW8A 2OLCA 4GIHA 1CTPE 1PXJA 4IZ5A 3VUGA 3WE4A 4ASXA 4Z16A 4QMUA 5FRIA 5J1VA 3RCJA 2YFXA 1OKVA 2BPMA 4C4HA 4KBKA 1H8FA 2OFVA 5JKGA 4MQ1A 2XZSA 3FLNC 3OEZA 4HZSA 4ANNA 4G17A 5IDPA 4L7FA 4GIIA 4EQCA 2CKPA 3WIKA 1YW2A 3V5LA 1PW2A 4DAWA 4TN6A 2GDOA 3E64A 1BYGA 4J96A 5DR6A 4FTOA 3HX4A 4IVCA 4UMRA 1PXNA 2ETMA 3Q53A 4FKJA 5J8IA 4MD9E 5HG7A 3Q4TA 3S0OA 4C62A 3V04A 3FLZA 2YM4A 3PIZA 5TT7A 5CEOA 1PYEA 4PX6A 5IA4A 4N6ZA 3NGAA 4G5JA 2YWPA 3QC9A 3P78A 4XG6A 3PG3A 3BU5A 3HUCA 3MPMA 4F0GA 4O84A 2BZIB 3PUPA 3C9WA 3QTXA 3T8OA 4RLKA 4DHFA 3ZM9A 4QT1A 3K5VA 4J8MA 3ULZA 2YIRA 5IQDA 1RW8A 1YOMA 1R0PA 1TQIA 2F9GA 4E26A 4C7TA 2QR8A 5HIBA 5JZNA 4G6NA 4PF4A 5AEPA 2RSVA 2J4ZA 1DAWA 3PXZA 1YRPA 3M42A 4JQ8A 5A4EA 1YWNA 3P4KA 1PRYA 4PRJA 3Q3BA 1U54B 5B7VA 3O2MA 3ZO1A 4EKLA 4NJDA 1IA8A 4DEIA 3D9VA 2FA2A 3QUDA 4RGJA 2B55A 3Q4UA 5AR5A 4MH7A 3E93A 3FDNA 2PTKA 3GUBA 4FSRA 5DGZA 1H4LA 3DY7A 4OR5A 4FX3A 4NEUA 5DVRA 2W1CA 5LMKA 5IQHA 1W82A 5CSXA 5LVLA 4C02A 5DPVA 1FMOE 5FGKA 5BMMA 4X3FA 4E5AX 1OBGA 1IEPA 1PF8A 2VO6A 3BYVA 4WD5A 4DH3A 3CGFA 4BTFA 1QCFA 2CNQA 4JRVA 3QQFA 4FT0A 3ZBFA 3FWQA 2XK8A 3MB6A 4FOBA 2JIIA 4RIWB 1AQ1A 3JS2A 3ZHPC 4DEAA 3KMWA 3OT8A 2BCJA 5AUVA 4D2SA 4WBOA 4G9CA 2XJ0A 4U43A 4TXCA 4LUEA 2X6DA 3QUPA 4ZXTA 3OT3A 2ZM4A 3D83A 3POOA 4LGGA 5DNRA 1ZYSA 3LFNA 4AAAA 1J7UA 4C4EA 4JNWA 3IDCA 3EQPA 5AUXA 4AWIA 3PXFA 4JG8A 5E91A 2ZM3A 3C0IA 3QCXA 3POZA 5F20A 3VRYA 3FI8A 2CLQA 2BAKA 1F3MC 4LGHA 3O96A 4FL2A 4PQNA 3F2RA 4C35A 4DFZE 2RFEA 4CFFA 1O6KA 3PZEA 1WBOA 3CD3A 4HVHA 4FKQA 2EXMA 3EQRA 1Q8ZA 3NNVA 5EYKA 3TKUA 4A9YA 2HELA 2PE2A 3JY9A 3CC6A 4QMLA 5EQYA 4TNBA 4GK4A 4ZTSA 4ZMEA 3PY3A 5DFPA 3VS7A 1JPAA 4YBJA 3RAKA 4RQVA 2VWYA 4X3FB 2WMSA 3KK8A 3G9LX 3TIZA 3ATTA 3UOLA 4OBPA 3LJ1A 5DIAA 4DFNA 3D0EA 3KU2A 4MEDA 1WVXA 1DS5A 1OECA 2VTMA 3I60A 4LV5A 3TZ8A 4RVMA 5E8YA 2WQEA 4UBAA 3H10A 4DEBA 2C6MA 2HENA 3NPCA 3PVWA 4FKWA 4UZDA 3S3IA 3TZ9A 3HRBA 2IG7A 1BUHA 3WYYA 3QL8A 3PPKA 5KHWA 2ZMCA 1Q99A 2WMRA 5CI6A 3F5UA 4KAOA 1P4OA 4FTRA 1Q3DA 4NTSA 4DYMA 3R21A 1H1SA 3ZBXA 3CP9A 1J1BA 3R9NA 2IVTA 5C4LA 2JIVA 4QMZA 3LQ3A 4CTCA 2HY0A 4XBUA 4MX9A 4AOIA 2WAJA 4YJQA 3ZTXA 4RPVA 3GI3A 5ACKA 3ORMA 2BFYA 4M68A 2GFCA 5C4KA 2WTKB 4CCUA 4QMXA 2R3MA 3OW4A 2Z02A 1MUOA 4D4YA 2J7TA 1B39A 3EL8A 4ASZA 2JDSA 3FY2A 3QGYA 1UA2A 4M84A 2QOCA 4FK6A 5HLNA 4F08A 2OZOA 2XCKA 5BVDA 4O7ZA 3RINA 4EK5A 2ITOA 2YCSA 4XX9A 4XG8A 3ZSIA 2OFUA 4EH2A 3Q32A 4KSQA 4DBNA 1OL2A 2IWIA 2JKKA 4KIQA 4XNEA 5BYYA 4Q2AA 3SAYA 1YHWA 4BF2A 5K9IA 4QMMA 2UW4A 4IM3A 1YOLA 2BIKB 4DGMA 2P55A 3PWYA 4GKIA 4KBAA 3OY1A 4RLLA 1R3CA 5IEVA 3IG7A 5JN2A 3AMAA 4IVDA 5HCXA 3OG7A 1H26A 4I6QA 3Q9ZA 1X8BA 4O0TA 4ALUA 4IB0A 2YHVA 3FLYA 3HMMA 4M0ZA 3EZVA 5CQWA 2QO9A 5GIOE 1PXIA 3OXTA 2Z2WA 2C0OA 4GYGA 4EOOA 3DZQA 2PUPA 3SXFA 3MPTA 3M11A 1Z57A 4KIOA 4TWOA 3VS0A 3FI3A 2GS6A 3VWAA 1ZRZA 5A3XA 5J1WA 4EEVA 4IAYA 5EM6A 5M4UA 4FIHA 4UZHA 4O7TA 3IO7A 1Z5MA 1F0QA 2QONA 4B8LA 5C03A 3FXZA 1Y91A 3ENHA 3UO4A 2FSTX 5FBOA 1ZY5A 1VZOA 1VYWA 5CNNA 5L6WL 2X6EA 3QRIA 4GG5A 1DI8A 2JKOA 2PZYA 2VO3A 4XUFA 1UNHA 4RT7A 4ZTMA 3EKNA 4J7BA 3BYMA 4O6LA 5G6VA 4BBMA 4NW5A 3ZFXA 3KXGA 4BCQA 4HVDA 3LFBA 4GRBA 4ZZMA 3R8UA 2GHMA 5E92A 1KUTA 5T6KA 4DA5A 4RJ5A 3V01A 4L9IA 4D55A 4JDJA 4DFYA 5H8GA 2ITPA 3WF9A 5A46A 5JFWA 2V55A 3SD0A 1P4FA 3MVMA 4FOCA 3RAHA 3IOKA 3QCSA 1YXTA 1TQPA 2WQBA 4BVUA 4MTAA 4TYJA 4I94A 3CQEA 3MB7A 1JSUA 3R0TA 4CT2A 4DT9A 3AXWA 1OL7A 2RIOA 3A60A 2WQMA 2GNFA 2HWPA 1DI9A 1GZNA 2RG5A 3R73A 4W4VA 2X9EA 3HDMA 1Q24A 1KE8A 3F6XA 5DEWA 1H08A 3U4UA 4QP2A 3GFWA 3ZXTA 4R3RA 1T46A 1OPJA 3L9NA 4P5QA 3LJ0A 4OTIA 3EL7A 4FTNA 3AGLA 5AUYA 2YLFA 5FD2A 1PMNA 2X2LA 3ANQA 3O51A 3PSCA 3R01A 4I93A 4TNDA 3GU5A 5E4HA 4DGLC 4U7ZA 2IZTA 3NS9A 3VBWA 5CYIA 2WTVA 3CKWA 4AW1A 3RPVA 4MKCA 5AAGA 2VX3A 2X1NA 5K0XA 5CXHA 5L8KA 3QD3A 4Q9ZA 2X8IA 3BQRA 4W9XA 3WYXA 4FIGA 4QTAA 4XG7A 3LJ2A 5BUJA 2JBOA 5D1JA 2BAQA 2RKUA 2R3OA 3VBQA 3ZC5A 2C0IA 4FKUA 3T9IA 4C59A 2I7QA 3FYJX 3OC1A 5CX9A 4FKIA 2PZRA 2BKKA 5EOLA 3DJ5A 1H1QA 2W1DA 4MWIA 5TKDA 3ZUTA 4CNHA 3P1AA 4O91A 4O2ZA 3TNPC 1SMHA 4YZBA 5HHWA 2R3LA 4IDVA 1GOLA 3UJGA 4BCFA 1JKLA 1URCA 3FQEA 3TIYA 5B2LA 3VBYA 4BKZA 4ACCA 4BCGA 2W5BA 4BGQA 3Q4CA 1M7QA 5HQ0A 4CT1A 2PSQA 4M13A 4U3ZA 4AFEA 2JC6A 3FMHA 3FHRA 4ZTHA 3CSVA 4F70A 1Q3WA 3MGYA 3LIJA 3Q4ZA 3QRJA 2G2HA 4FODA 5AAFA 3LPBA 4APPA 5AA9A 3QAME 1R39A 4BI2A 4QTCA 2WXVA 3AMBA 4GU6A 1JSTA 4HPTE 4I41A 4BDJA 3CLYA 4TW9A 3NMUF 2HY81 3FLQA 3QLGA 4AGCA 1GY3A 1FVRA 2GNLA 4FR4A 3W10A 1XH8A 4EUUA 4XP3A 2GCDA 3Q52A 1OL5A 5CANA 2UV2A 4GL9A 2I0HA 4ZS4A 2C1BA 3HUBA 2E9OA 4QTBA 1M7NA 2QC6A 4GH2A 4P2KA 4W4XA 1G8SA 1PXOA 3UC3A 2JBPA 4FKLA 3UP7A 3VUIA 2R3KA 4E4NA 4EJ7A 2HZ4A 4HGSA 5LWNA 2F2UA 3TZMA 1JWHA 3GC9A 4GJ3A 3CJGA 3O0GA 4IADA 4LRKA 4RC2A 3M1SA 3BHYA 3ZRLA 1E9HA 4QMNA 4FTAA 4GT5A 3WZUA 5BYLA 3P7CA 2OZAB 1PXLA 5DBXA 5IQEA 3BV2A 5M09A 4YC3A 3DLZA 4QPAA 3TN8A 3QRTA 5AJQA 2CHLA 4MVFA 1ATPE 3DFAA 4M66A 1M2QA 1B38A 1WMKA 4FTUA 5EOBA 2ITTA 3HL7A 4G2FA 5I9VA 3CTQA 5K0KA 4KA3A 5E1SA 2C6EA 2XP2A 5EW9A 3DU8A 4RBLA 4MAOA 4I4FA 4FK3A 2XYNA 3GOKA 1MQ4A 4IJPA 4JXFA 5B2MA 4C8BA 4D9UA 4EK8A 3NVKI 2O5KA 2VWBA 4QYYA 5KCVA 3KY2A 3EN6A 4R8QA 3E62A 3KB7A 4TL0A 3UPZA 4BHNA 1A06A 2XK3A 2CKOA 4S33A 5FP5A 3PVGA 4LGDA 1OGUA 4D4SA 5HCZA 5J79A 3MH3A 1W84A 5IQBA 3W1FA 5D7VA 4FG7A 4D58A 4M69A 3P5KA 3EN9A 4M8TA 4GUBA 3U6JA 2ONLC 4DF3A 3OXIA 3L8SA 3R7VA 2F4JA 1GZKA 3MPAA 2YLEA 2XM8A 4KINA 4AFJA 4D2RA 4EL9A 3N4VA 2E9VA 5M07A 5EYMA 3C7QA 4I0TA 1NVSA 1MRUA 4FT7A 3DA6A 4HYUA 4QMOA 3OWKA 4EK6A 2P33A 3MY5A 4BR3A 5LVOA 4EH3A 3UOHA 5J5TA 4I20A 5E9EA 4F6WA 3C0GA 4CYIA 3KGAA 3PTGA 4BC6A 4QMSA 5HKMA 4EK4A 3SRVA 3G90X 4YP8A 4HJOA 2YM5A 4I21A 4E6CA 5AR4A 4BL1A 2GU8A 2WMQA 4ITIA 3C5UA 2QOOA 4A9RA 4YU2A 3WZJA 3OCGA 3UYSA 2R3QA 4FV0A 5CLPA 4YNOA 4XBRA 4YGAA 2WO6A 3V8TA 4ARKA 3ORNA 2QD9A 4FKSA 5T68A 3TV6A 3VUKA 1ZYDA 4AA0A 4F6SA 4I22A 4CZTA 1QPJA 3A7GA 3A7HA 4YJRA 2XNGA 1Z9XA 2R3JA 3BGQA 3PXKA 4RFMA 3QTIA 4CKRA 4UWYA 3FMJA 3ORIA 3QCYA 3UNKA 3QZHA 1NW1A 4M69B 3FZTA 3GFEA 2P2IA 4NIFB 4MNFA 2EB3A 3R71A 4YTHA 4D5KA 4K9YA 1FBNA 4KBCA 3VQUA 2J90A 5EHOA 3KL8A 4H3PA 1R0EA 4AW0A 3L9PA 4AT4A 1ZOEA 3AT2A 1IA9A 1BX6A 1FVVA 5BX0A 3BGPA 3VHEA 2AC5A 3KN6A 3IQ7A 3OUKA 1P14A 2HIWA 3VQHA 3HA8A 2WMXA 2X7GA 3F66A 4IIRA 4Y46A 3UTOA 5C8NA 4EI4A 3COKA 5AP3A 4WA9A 2BUJA 3SRVB 4MHAA 4RIXA 4WOVA 4EQUA 5IQIA 4BKJA 4EJNA 4QP7A 4ITJA 4G6OA 4GCJA 3E63A 4O22A 3D7TA 4TRLA 4FA2A 4QP3A 4RRVA 3MN3A 5CU6A 3ORPA 4Q5EA 2F7ZE 2GSFA 2WTWA 3F5XA 1E1XA 2B9HA 2NO3A 3DS6A 3LVPA 4IFCA 1CKPA 4Q5HA 4LOOA 3WILA 4YZNA 4YMJA 3PXQA 2J9MA 3LFEA 1JLUE 2ZB1A 4PTEA 3R1SA 5AIKA 4JVGA 4WSYA 4ERKA 4ZLOA 4V0GA 3ZRMA 4RWLA 4OTFA 3QQUA 1XHAA 1OPLA 2B4SB 2NRUA 3I81A 5JGBA 3LMIA 5AV3A 3HMIA 5AP6A 4E4LA 4X6RA 1ZMVA 2XEZA 2O2UA 3AC3A 4FV2A 4DC2A 4TYHB 3FI4A 3A8XA 2WKMA 2WU6A 3DLSA 3AQVA 3QKLA 3IS5A 4FI1A 4IB1A 3OTVA 4IWOA 5EW3A 3RK5A 1KE9A 3D5UA 3QTQA 4C61A 4HPUE 1YDSE 2OG8A 2YIYA 3GU7A 3MVJA 2P3GX 5IU2A 3NAXA 2XKCA 2VTRA 4X21A 5CTPA 4FSNA 4R3CA 5C8MA 4WG3A 2PUNA 2PY3A 3W2CA 1KE6A 1V1KA 3FZOA 4CQEA 3H9OA 4R7BA 3ZLWA 2O65A 3NR9A 1FOTA 3HEGA 4PWNA 5FDXA 5HBEA 3GCSA 4ITHA 2I0VA 4I24A 2UW9A 3IKAA 3ZM4A 3WZKA 3CS9A 3ZFYA 5IF1A 2UW5A 2JFMA 4R78A 3PJCA 3P7AA 1PJKA 1JKTA 3F2NA 3RKBA 3E7VA 3S95A 3D7TB 2B9JA 4G3CA 4EOIA 4FSQA 3KXMA 5K4JA 3GC0A 4F7SA 3FLWA 1FVTA 4QPSA 3HGKA 5FG8A 1ZARA 3PSDA 2BRMA 2GS7A 4AACA 4AZSA 1PYXA 5L2TA 2C3KA 4S31A 3TJDA 5HBJA 2J2IB 1QPDA 3IDBA 3L8VA 4YZ9A 3K54A 3QBNA 2JEDA 3QHRA 4OTHA 4OTDA 2XH5A 3V5PA 3COMA 4RJ6A 5EG3A 3UVQA 3ROYA 4FC0A 1ZMWA 4MXCA 2ERZE 5DG5A 5IA5A 3QQKA 4U41A 2R0IA 4PDSA 4G34A 4QYHA 2OH0E 3JVRA 1H27A 4KIKA 5ETIA 1XO2B 4F7JA 4YSJA 3GOPA 2XBJA 3GCVA 3HMNA 4BIDA 4O7WA 2ETRA 5AP7A 3TKIA 3FKLA 2I6LA 3BU6A 4GFOA 1YXSA 4U6RA 3E92A 4ZY5A 3FKNA 2QU6A 4JT3A 1U5QA 5DH3A 1YDRE 1U5RA 5ANIA 3UVRA 4C33A 5ANOA 5M4FA 4O82A 4TYGA 4RZVA 2B9IA 2X4FA 2W06A 3OS3A 3UYTA 2JKMA 1WBVA 4K8AA 5M53A 4ZOGA 4X7QA 3TG1A 1RE8A 3W18A 4FE2A 3PPJA 3O8TA 3OBGA 4B0GA 4GMYA 4UEUA 1FQ1B 3F5PA 4UN0C 3DJ7A 4XMOA 4I0RA 4Y83A 3SA0A 4Y72A 3VN9A 1YI4A 3F2AA 3KRLA 4F9AA 5LVMA 3MA6A 4L3PA 4ACGA 5LMAA 4CFUA 3HMPA 4X2JA 4E93A 3TTIA 1JAMA 3JY0A 4MYGA 4CSVA 4D0WA 4NH1A 3VS1A 3RTPA 4B4LA 5E8ZA 4MBJA 1LP4A 1V0OA 4FICA 1SNUA 3IW8A 2G9XA 3QTZA 1OL6A 3I6UA 4FZFB 4R5YA 1CM8A 3W33A 5CENA 3GT8A 2A0CX 4HGEA 4FSTA 4IZAA 4FF8A 3GBZA 4EZ7A 4DH1A 2NP8A 3U6IA 5GINE 4ZLYA 2VWXA 2FSOX 4H3BA 1M17A 1UKIA 4F7NA 2ERKA 4FZAB 4NM5A 4JX3A 4X6QC 2YN8A 4CV9A 3R1NA 1UU7A 1J3HA 4FKOA 4DGGA 4FTJA 2FGIA 1A48A 4L7SA 4PMTA 3V5JA 5AV1A 4BCNA 1GZ8A 5CEMA 2VTIA 5M08A 2C6TA 4WUNA 2W5HA 3G0EA 1PMUA 4IAAA 4R7HA 3HV3A 5HNBA 3RNIA 3TWJA 3UQGA 4E7WA 4I6BA 4IWPA 4N57A 4QD6A 2CDZA 2C5VA 4XYFA 5KE0A 4K77A 4NYEA 3FBVA 4JLCA 2HOGA 1O6LA 1M14A 3SLSA 3TNWA 2GHGA 4FEUA 5HE1A 4DLIA 3MJ2A 5CEPA 2BROA 2IW6A 3EHAA 2OW3A 1U54A 1JQHA 4YLJA 4CFXA 1G3NA 2WEIA 3VIDA 5GJFA 4FYNA 3C4CA 3IDPA 1PXKA 3QHWA 3OUNB 4M15A 5F9EA 2IVVA 3U4WA 3KREA 5FXRA 5LVPA 5CY3A 3R2BA 3HV5A 2Z8CA 3L8XA 2WPAA 2W5AA 3ODYX 2A2AA 3TNIA 3WF7A 4WNKA 4ZZOA 3MA3A 4IXPA 4XV9A 2XNMA 3C51A 5HOAA 3KN5A 1EH4A 3D94A 4RJ4A 2SRCA 4JS8A 3SV0A 3QWJA 1NY3A 4DFBA 3G5DA 3ZRKA 3SXSA 3E8DA 1ZZ2A 2ITNA 4JL9A 5BVFA 3KMUA 3DKOA 4MBIA 3VS4A 4ZLZA 3I1AA 4LV8A 4RIWA 5AV0A 4F9CA 5H3QA 4XHKB 4FZ6A 5K5NA 3FXWA 2GNIA 5HEZA 4DLJA 5IKWA 4JDIA 2WOUA 4XV2A 4DFUA 4HYSA 3FZSA 3FY0A 4HGTA 2QQ7A 4X2FA 2JDVA 3R8PA 4IW0A 1ERKA 4AXAA 4AZFA 3D7ZA 4NUSA 3K3JA 3Q6UA 5KMJA 3LMGA 1YOJA 2UZTA 2XNPA 5KKRB 4FEWA 3B8QA 2RF9A 4PTCA 3II5A 1H0VA 4USDA 4MCVA 4A4LA 1YHVA 4PY1A 1ZZLA 2VTJA 3MJ1A 3NYXA 4J95A 2UW0A 4O2PA 4O7NA 4PL3A 4I1ZA 3TT0A 5HO7A 2XVDA 3VS5A 5KZ0A 4XS2A 4J53A 3NSZA 4CRSA 3L9LA 3PE1A 2Y4IC 5HI2A 3CKXA 5D12A 3R1YA 3QWKA 1RJBA 1YVJA 3PE2A 1RDQE 2OICA 2W05A 2PVFA 2ONLA 3FZ1A 2QCSA 3VF8A 3KF7A 2R64A 4UMPA 2BTRA 3PXRA 3NUPA 1UU9A 2PVJA 3BKBA 5CSVA 2VTPA 3PWDA 3QA8A 4FG9A 4FV1A 5CAVA 2C47A 4E5WA 5CAQA 3B2WA 5AR3A 4O7YA 3RPOA 4L52A 4LL5A 4DEEA 2C5NA 4MNEA 3NUUA 3EQHA 3JVSA 2VTNA 3TTJA 4II5A 4BDCA 2R5TA 4QPMA 3EN5A 4LRJA 4EOPA 4JAJA 5EFQA 2UUEA 1Q8TA 2ITVA 5B0XA 4YR8A 4EH5A 4Y5QA 3MTFA 5AIRA 3AC4A 4U45A 3F88A 5HTBA 5HU3A 5J9LA 4CZYB 5AP1A 3V6SA 3EN7A 1XH5A 4LRMA 4JQ7A 4XRLA 3BLHA 1REJA 3DOGA 4AOJA 3ZLYA 3ELJA 4JX7A 4WNPA 1ZYJA 4E8AA 2YACA 4O0VA 3F7WA 3IOPA 1K3AA 2RFNA 4H39A 3MFUA 3LZBA 2XRWA 3W2RA 5KHXA 3OOMA 2RG6A 3EN4A 2OJJA 2YDIA 3S1HA 3PLAE 3OD6X 4AQCA 3FHIA 3FXXA 3R7UA 5HORA 2C5OA 3R7YA 3ZYAA 4CG9A 2OI4X 2V0DA 3ZZEA 2GNGA 3TUCA 3OWJA 3F3ZA 3O50A 2GMXA 2R3HA 5CAOA 4E4MA 4NU1A 2R3PA 1NVQA 2PULA 3E87A 2WEVA 4RA4A 4HVIA 3KULB 3PJ8A 4ORKA 3CTJA 3P23A 2QHMA 4CGAA 2G2IA 4RX8A 2CPKE 2IW8A 4A9TA 2W99B 3UZRA 1OM1A 4IAKA 4MNEB 2J5FA 1XBCA 2VTLA 4Y73A 4U79A 5M56A 3I7BA 4GG7A 2PL0A 2XIKA 5F4NA 4YSMA 3QQGA 4NTTA 3DBFA 3TM0A 3LFDA 2QODA 4C3PA 3V5QA 3EIDA 4EOQA 4FL1A 3CR0A 2OJGA 2C6KA 2NRYA 3A7JA 3FSFA 3QC4A 4IZ7A 3RI1A 3TEIA 1MRYA 3P86A 3LAUA 5L2SA 4EHGA 1CDKA 2J51A 3PP0A 4WIHA 1Q8YA 3OVVA 3DKFA 3GENA 4IE9A 3QCQA 3DBDA 4CLIA 3N4TA 4BDIA 4F6UA 4BGGA 4ANOA 4UMUA 1W0XC 3WOWA 4DFXE 1BL6A 3SC1A 3LXNA 3E3PA 3LHJA 4DG3E 1H25A 4IVAA 4DTAA 3AC5A 5AUWA 4BDKA 5AX3A 2QG5A 3FQHA 3VW6A 3HV4A 4HZRA 1UKHA 3UZPA 3U6HA 4BCHA 1Q8UA 3EFKA 4L46A 5ETFA 3QTSA 4PPCA 4F9YA 4YO6A 2UZLA 4NCTC 5I4NA 3H4JA 4BDHA 2VNWA 4IWDA 2H96A 5HVJA 3A4OX 5I3RA 1NT2A 3QTUA 3F3WA 5IQFA 2Q0NA 1SVGA 4JDHA 1H24A 4JAIA 5ANJA 4BCMA 4M97A 3UE4A 3QD0A 3R8ZA 4BIBA 3GU4A 4C4FA 2XK6A 1YI3A 1WBSA 4FKRA 3RPYA 4AX8A 1H0WA 3VS2A 3FUPA 2ACXA 1Y6AA 5HVYA 3QQLA 2XEYA 4BDFA 2CKEA 4ZTQA 2YABA 3OTUA 4FNYA 5IA1A 3W2QA 4OW8A 5FXSA 1KV2A 3NNWA 5CU3A 1XKKA 4A9SA 2OK1A 3RP9A 4EH9A 4RWIA 3QFVA 4KIPA 5AR2A 3BIZA 4JRNA 4LUDA 3R7OA 5HVKA 2HW7A 4YLLA 4F64A 3R9OA 4O0WA 5DE2A 3RJCA 2WU7A 3HVCA 3R8VA 2FH9A 2ZV7A 2VX1A 3AC2A 4GT4A 4L43A 4M3QA 2GTMA 4FTTA 4MK0A 4QYFA 5JRSA 1LUFA 4P4CA 1OB3A 5CZHA 4RVKA 5TO8A 2VUWA 3R9HA 2WIPA 2OH4A 4YO4A 1FGIA 1YHSA 4TWNA 3JUHA 2W1HA 4YJVA 4I6HA 3HP2A 4MXZA 4D1XA 1L3RE 1TKIA 4RVTA 3LW0A 3OF0A 4CQGA 4JOAA 4IBMA 4U0IA 4E5BA 5GZ8A 3UMWA 4O0RA 3UPXA 2XMYA 5K5XA 5CVGA 4MXXA 4EORA 4WNOA 2XYUA 4L3JA 5GJDA 5A6NA 4FGRA 2R3IA 4OAVB 2W1ZA 3ACKA 5BVKA 1IRKA 4RX9A 4IWQA 5EI6A 3W55A 4Z3VA 2I1MA 4EBVA 4AGWA 4D5HA 5J95A 3Q5IA 4YZMA 2WOTA 3CXWA 3BEGA 3BCEA 4IEBA 2GFSA 3AC8A 4EK3A 2CLXA 1VEBA 2QOKA 1NA7A 4IX6A 1WFCA 4XG2A 4D0XA 3RWQA 3VUTA 3Q5ZA 5HLWA 3C5IA 4FTMA 2QOIA 5ANEA 1XBAA 4LI5A 4BCOA 4RIOA 3C50A 1APME 4QP4A 4I5MA 2Z7LA 3ZFMA 3Q9YA 3A2CA 3DV3A 4RG0A 4YJOA 3VAPA 4CKIA 2NNWB 3ENMA 3ERKA 3ODZX 3P79A 4EYJA 1HCLA 5H8EA 5M4IA 5AP5A 5F95A 2GHLA 5IUIA 1S9IA 3QRUA 4IJ9A 2CCIA 5EI2A 4S34A 1YWRA 3QALE 3GQIA 3NIZA 5L8JA 2Y6MA 4FV5A 3FJQE 3ZDUA 4H05A 2C0TA 5HD7A 3MH0A 2G01A 4M0YA 4PPAA 4X3JA 2ITUA 5L4QA 1XWSA 4JIAA 3KXXA 3BWFA 3MESA 2PWLA 4UALA 4DTBA 2JLDA 4F65A 2X81A 4QMTA 4XJ0A 4F4PA 4AGUA 2V7AA 5KMIA 1TQMA 4FIFA 2R2PA 4L8MA 2QU5A 2OZAA 3QKMA 4FUXA 2FUMA 2YJSA 2W1EA 3WARA 2QR7A 4AN3A 4JG7A 3S00A 3LCDA 4UXQA 4YUQA 1U59A 5M57A 3BHVA 4O0UA 4E3CA 2XK7A 4QQCA 1RQQA 3DB6A 3LQ8A 3OMVA 4IZYA 4FL3A 1Q4LA 2QO2A 2QVSE 2CN5A 3BHTA 4G6LA 4Q9SA 3TUBA 3BHHA 1WCCA 3DDQA 4FSMA 4I5CA 4MQ2A 3VC4A 3DK7A 2REIA 3KVWA 5HNIX 3HNGA 3G51A 4QMVA 3UIMA 2Z60A 3JXWA 2JFLA 5CWZA 3LCTA 5KKRC 2BDJA 4FSWA 5HE3A 5E7RA 4O7LA 5E8SA 4GVAA 3OCBA 3LFCA 4BDGA 3W2PA 1XH6A 2C3JA 4ZJIA 3WIGA 5A4QA 3NW6A 4EUTA 4O0SA 5HG9A 3RHXA 2J0IA 4QO9A 4IX3A 5LVNA 2R3FA 4YJPA 5FM3A 2Z7RA 2YISA 1URWA 2WB8A 1J1CA 1SVEA 3NYNA 5EM7A 3TZ7A 5FBNC 3V8WA 4AZVA 1ZXEA 3UP2A 2B1PA 4TTHB 4HCTA 2BZJA 5KBQA 1UU8A 4WBBB 4NJ3A 5HD4A 5DHJA 4OTQA 2X8DA 2EWAA 2YM6A 3EB0A 5E8UA 5IUHA 2XIXA 4V05A 2F49A 4AF3A 1AD5A 4AT3A 3DGKA 5KMNA 4CFWA 2O63A 2F7EE 3PIXA 3ZSGA 1NXKA 3P08A 4TWPA 3IW6A 4WG5A 2R9SA 4ZZNA 4FZDB 3LMHA 3FPMA 1JSVA 5DT4A 2HZ0A 3Q6WA 4RX7A 4BCIA 2AC3A 1ZOGA 2G1TA 4HNIA 5A4TA 4EOMA 2XIRA 3I4BA 3R63A 3IK3A 4QYGA 3Q9XA 2ZDTA 4P90A 5B2KA 3R8MA 5I5ZA 1WBNA 4QTDA 4MF1A 4C4IA 1WBTA 2ITZA 2R3GA 5EDPA 3RK9A 3ZONA 4WT6A 3N9XA 1LR4A 3I79A 4JR7A 3QGWA 4JJRA 3MIAA 2DUVA 1GIHA 4HYHA 3LE6A 1YI6A 4BDDA 4XP2A 4I0SA 2UZEA 2R3RA 4YHFA 4OBOA 2HXLA 3ORLA 2WGJA 5AUTA 2VTQA 3IECA 2XKDA 3AT4A 3FKOA 2JGZA 2XIZA 3A7FA 4IM2A 2OSCA 4LMUA 2WMTA 2BAJA 3Q04A 1MRVA 1UU3A 4NIFA 2YAKA 4LOPA 3NUNA 2JDOA 2VWZA 2YIWA 3D5XA 3RZFA 5H9BA 1F5QA 4XG3A 4JBPA 5I3OA 4AE9A 3QD4A 1UV5A 1WZYA 3DT1A 3WF6A 4YZCA 2XBAA 5HTIA 4BICA 3COHA 4GK3A 4DG2E 4FV4A 2PHKA 1YWVA 4YJUA 3BEAA 4B8MA 1S9JA 5M44A 2WHBA 3U9NA 4IM0A 2BFXA 4FSYA 4EZ5A 3EOCA 4FT3A 3DKGA 4ASDA 3FAAA 3PZHA 4C2WA 2UVZA 4J71A 3GU6A 4BCJA 2VTOA 3TI1A 3FMLA 1V0BA 4FEXA 2PZ5A 3OXZA 3CJFA 4ANSA 1OITA 4OTGA 4NK9A 4RC4A 4TYIA 5FEEA 2Y8OA 3O17A 4I6FA 4RJ3A 4ZJVA 3A8WA 3P7BA 4AZEA 4L53A 3UDBA 3RPRA 4ERWA 5JQ8A 2F2CB 2J6MA 4MF0A 4FV6A 3KCFA 5HCYA 3SW4A 3D15A 4AP7A 5BPYA 1H07A 4O7VA 5HBHA 1O6YA 2C5XA 3OROA 3IONA 2Y4IB 3I6WA 4UY9A 5E90A 5ETAA 4NSTA 5CU0A 2DWBA 2G15A 2ZVAA 3BV3A 1ZYCA 3MBLA 4WSQA 5C27A 4ZY6A 5ANGA 3VRZA 3NNUA 5HIEA 4TYHA 5D9HA 5AP2A 2IW9A 4IDTA 3V5WA 3NLBA 3ZO4A 3KVXA 3D14A 2PK9A 3DTWA 5GNKA 3N4UA 2OF4A 2E2BA 1WBPA 2EXEA 3PA3A 3QUEA 2WELA 4N4SA 4QP6A 4WRSA 3CPCA 4BZOA 4C2VA 3QZGA 5GZAA 3G6HA 2R4BA 2C30A 1JKKA 4MD8E 5EI8A 4EHZA 3LLTA 5DRDA 3D5VA 1GIIA 4F7LA 4IACA 3QU0A 5A9UA 1HCKA 4IB3A 2X7FA 4I23A 4QNAA 4PMSA 4RC3A 5DLSA 4HGLA 4J52A 3HV6A 4FKVA 2VU3A 4D2PA 4WRGA 2Y9QA 3RK7A 5E8TA 5IG1A 2RFDA 4ZIMA 4OGRA 4RVLA 5IDNA 3FMNA 1K9AA 1FPUA 2R7IA 3OW3A 5AX9A 2UZOA 4QP8A 5DA3A 4IHPA 2DQ7X 4A4OA 4ACMA 4F63A 4RMZA 5LQFA 4XLIA 4GFGA 2VTHA 1OMWA 2VWWA 3NW5A 4CCBA 4BZNA 3DQWA 2VV9A 3L9MA 3UG2A 4L01A 4RIYB 3F61A 4C4JA 5DEYA 3W2OA 2A27A 2R3NA 4DINA 1W7HA 1SNXA 4WG4A 4XH6A 3OWLA 2BRNA 4O86A 3UQCA 4EONA 2WMUA 4AGDA 4FV3A 4XP0A 4E1ZA 4EOLA 3E8CA 3CPBA 3UMXA 4EWQA 4YTCA 4GV1A 3H9FA 2YM3A 3ZO2A 3GB2A 3CY2A 3QKKA 2Q83A 4C36A 3G9NA 4GVJA 2H34A 4M67A 4W8EA 3ATSA 5GJGA 5AMNA 4EH6A 4F1MA 5CF5A 4RZWA 1XH4A 2QOBA 4MXOA 3EJ1A 3C4FA 3TDVA 5AP0A 3GGFA 3ZCLA 4AA5A 2OF2A 1Q61A 2C6DA 4F9WA 1J7IA 2XCHA 4L68A 2C3LA 2UZUE 2YEXA 1KE7A 1P2AA 1UNLA 2QKRA 4OLIA 5CASA 3CQWA 2WTIA 3TKHA 2OO8X 3K5UA 4LYNA 4FMQA 5J7HA 4GSBA 1BL7A 4DBXA 1YXXA 3QRKA 5EHLA 5KZIA 2YCQA 3VUDA 4ANQA 4DH7A 4CD0A 1M2RA 3GP0A 5IEYA 4QYEA 2WZJA 2ITYA 2BRHA 3AD6A 4C3FA 1BKXA 2FB8A 2WNTA 2C5YA 3ET7A 5FEQA 3EH9A 3TCPA 3UNJA 4TZRA 3DZOA 4GT3A 4HCUA 5DWRA 5CSWA 5FTOA 4O83A 2BDFA 4BDAA 3IW5A 5I9ZA 3DBCA 3FYKX 4ACHA 1VJYA 3HECA 3C4EA 4K0YA 5D41A 3LQ5A 4MWHA 2AUHA 1R1WA 5BVEA 1ZMUA 3PJ1A 3Q60A 3AD4A 1LEZA 4J8NA 3QYZA 1FINA 5I9WA 4BBEA 5IPJA 1GZOA 2VTAA 3H3CA 4C4GA 4TT7A 3LXKA 5HG5A 3O8UA 4YC6A 4ZK5A 4AT5A 3H0YA 3V3VA 1IG1A 5KBRA 2LAVA 2EXCX 3ULIA 3SKCA 4GUEA 1YQJA 1O9UA 3PFQA 2E9PA 2QURA 2Q0BA 5JSMA 3PRIA 5I9UA 2I0YA 3IGGA 1JBPE 5L6OA 3B8RA 1W98A 2W9ZB 4X0MA 3MIYA 5CALA 2YIQA 3UIUA 3W2SA 3UOJA 2VAGA 2PVHA 3R22A 4H1MA 3H9RA 4EOJA 3BWJA 2ZJWA 3UOKA 4QQTA 5A4CA 2W96B 5KMKA 3R04A 5CAPA 3GNIB 2IVSA 5CT0A 3AGMA 5DRBA 2UVXA 4QMWA 4ZSAA 5GHVA 3GCQA 5J5SA 4BZDA 2I40A 3C13A 4ZS0A 3R6XA 1WBWA 2Y6OA 1XBBA 1ZLTA 4JI9A 1PMEA 2JAMA 1GIJA 2UZBA 5HNGA 3THBA 4XLVA 3CGOA 3BYUA 3C4XA 3RHKA 4O81A 4LG4A 3A99A 4ANMA 5CNOA 3UNZA 2X7OA 2QI8A 3BELA 3ZLSA 4F99A 4QRCA 2X2KA 5IMXA 4FKGA 3EZRA 3DXQA 5AUZA 3EQCA 4S2ZA 4BWKA 1WVYA 4FIIA 4FV8A 5HE2A 2J0LA 4RQKA 3MFRA 2YA9A 4FV7A 3R9RA 2UZDA 4HYIA 3REPA 2OBJA 5AP4A 4BTJA 4U97A 4YHTA 2PMIA 3NW7A 4FTKA 4E6QA 3NIEA 4PNKA 4I5PA 3A4PA 3A7IA 3ZMMA 3OOGA 2Z7QA 4U80A 3G15A 3E88A 1H00A 4ALWA 5EKNA 1OPKA 5HLPA 3ZSHA 5EK7A 2BHEA 5KUPA 1IAHA 2OIBA 3MH2A 4BYIA 5M06A 4FNXA 2JKQA 5C26A 2W1GA 3F5GA 3BLQA 2IN6A 4O21A 3MV5A 4X2GA 4ZTRA 3NX8A 2F7XE 3GEQA 4YURA 4C58A 4WNMA 4OUCA 2Y4PA 4H1JA 4UMTA 3D4QA 2JDRA 4IH8A 4F0FA 3FPQA 3CEKA 4IVBA 5J9YA 3MS9A 3ZC6A 1I44A 5AUUA 4KSPA 3UZTA 4L00A 4QMQA 4G3GA 4NW6A 4XRJA 5C01A 1AGWA 2O3PA 4R6VA 2ESMA 4EH4A 3LFAA 4KUJA 3U55A 2UZNA 4JIKA 3HZTA 5FQDC 3M2WA 2VN9A 3O71A 2GPHA 4BB4A 2X2MA 3RAWA 3SW7A 2JD5A 3A61A 3O7LB 2BRBA 4HCVA 5CS6A 4UX9A 3VHKA 1QPCA 3LXLA 2OXXA 4CMTA 2GQSA 2P0CA 4C0TA 5GZ9A 3NUSA 4DGNA 4IX4A 4EWHA 4KABA 3HRFA 2PVNA 2YDJA 4F0IA 5HGIA 5CEIA 3FSKA 4ENXA 3QF9A 3WE8A 3IW7A 2XJ2A 1FMKA 3FZRA 3UODA 2LGCA 4FT5A 4BN1A 4F1OA 3RPSA 3ZLXA 4PUZA 5DI1A 3R30A 2XK9A 4KKGA 4PDPA 3ALNA 4C57A 4LQMA 4XG4A 3ACJA 4G3DA 3RM6A 5C9CA 2P2HA 3UGCA 3LXPA 5A54A 2BHHA 3SG9A 3HA6A 3T3UA 4OT6A 2VO7A 3NAYA 3EQIA 5IH4A 2CN8A 4BIEA 1LEWA 2PUIA 2B52A 3KEXA 3JYAA 4EKKA 3I0QA 2O8YA 2BILB 2EVAA 4ANLA 4FKTA 2BDWA 5EM5A 4CKJA 3WF8A 4N0SA 2OXDA 1V0PA 3K3IA 4OTWA 4M12A 2W1IA 2RL5A 4L67A 2YIXA 4PL5A 2HCKA 1BI8A 3MY1A 4IC8A 5L3AA 3CE3A 3T3VA 4A4XA 1ZY4A 4AS0A 5JMSA 3QQHA 2Z7SA 3ALOA 2PE1A 3E8EA 3DTCA 3OY3A 4G31A 5TF9A 3C1XA 2WTCA 4JG6A 3KXHA 1H1RA 4YTFA 3FC2A 3SDJA 3ITZA 2X39A 4E6AA 5CQUA 4F9BA 3KXNA 4NZWB 1FGKA 3NDMA 3ZU7A 5FDPA 5CU4A 2B54A 3ORXA 4ZEGA 1NVRA 3KULA 4BBFA 4Z7GA 3PSBA 2B9FA 2XK4A 3ZUVA 4D2VA 3SOCA 5ACBC 3R8LA 5FM2A 2WIHA 4RA5A 3RBWA 5HX8A 3EQFA 3PA4A 4PPBA 2HZIA 3VJOA 3DAJA 1H1PA 3MWUA 4J99A 4O0XA 4TYEA 2OJ9A 4RFYA 2ZDUA 5CEKA 4P5ZA 2WQOA 4LL0A 2BALA 3O8PA 1CMKE 2YERA 1J7LA 4NM3A 3NUAA 3DJ6A 2EUFB 2W4JA 2QOLA 4UB7A 1U46A 4K1BA 3MI9A 4R1VA 3DK6A 1OBDA 3FEGA 5A14A 3UBDA 1UNGA 4FVQA 4PP9A 4QQ5A 1GJOA 3DXPA 3IPHA 1Q41A 4EH8A 4RWKA 3W8QA 1H28A 4FT9A 4YZDA 3UIXA 1U4DA 3NCZA 1GAGA 2G2FA 2ZAZA 4BWXA 3RVGA 4HW7A 1M52A 3ANRA 5IZFA 4PDYA 4CTBA 2PZIA 2FSLX 4USFA 5EM8A 4D2WA 4GK2A 2E9UA 5D10A 2Y7JA 4O6EA 5HIDA 5HZNA 2VWUA 5CT7A 5LCJA 5EYDA 4IB5A 4BGHA 3TDWA 3LM0A 3FMDA 5EDQA 5T3QA 4EYMA 1CSNA 4K6ZA 4OTRA 3PY1A 3SX9A 2YJRA 4ANBA 4R7IA 2RGPA 3SHEA 1OIQA 2H8HA 2YM8A 3MFSA 4PP7A 3KRXA 3TACA 1B6CB 4RFZA 2QHNA 3NEWA 3UVPA 4D4RA 5AM6A 2CCHA 1JNKA 3RALA 3VBXA 4G5PA 3F3TA 4KRDA 4X2NA 1UWHA 2XS0A 2PMNX 4FVPA 4D1ZA 4E4XA 2W4OA 5FTGA 2JIUA 4N6YA 2VNYA 3ZS5A 4PMMA 1XH9A 2J5EA 5CXZA 3LKMA 4L6QA 5BVWA 2YZLA 3RZBA 2VZ6A 4DITA 3FMKA 4S30A 3DB8A 4FSZA 2A4LA 4UYAA 5HX6A 2XNEA 3KFAA 3O23A 2IZUA 2J0KA 3W8LA 4AZTA 4BTKA 4OBQA 5FLFA 1LPUA 3F3UA 3ZEPA 5A6OA 5BVNA 3SGCA 2VTSA 3U9CA 4U44A 3D5WA 1VYZA 2GTNA 5KMLA 5DMZA 2V62A 2BIYA 4IFGA 2WMWA 5DR2A 2R7BA 4FG8A 2CGVA 1ZWSA 2NPQA 4D9TA 2QOFA 3C4ZA 4G3FA 4ZSEA 4RJ7A 2QO7A 4BRXA 5HU9A 3EFLA 3EMGA 5KMOA 2YITA 3RWPA 3QX2A 2OGVA 3LLAA 1CKJA 4KWPA 1XJDA 4B9DA 4BHZA 3KMMA 3BI6A 5BQ0A 4D2TA 4DCAA 3VNTA 3EWHA 5M55A 4FUYA 3CBLA 2PVKA 3QQJA 1OIYA 2EB2A 3FQSA 1K2PA 4EOSA 2BZHB 4KD1A 4JBOA 5I0BA 5ANKA 4J1RA 1SYKA 4A07A 2PU8A 4OTPA 5EH0A 5AV2A 3DQXA 4BFMA 1Q62A 2BTSA 2W17A 5M51A 3Q96A 3PJ2A 2PVRA 4D4VA 2XUUA 3LM5A 5J87A 4ZY4A 1A9UA 3EQBA 4JBVA 1OKYA 2JAVA 3BLRA 2OIDA 2CGUA 4Y85A 4ID7A 3DFCB 3E3BX 1OIRA 4PNIA 3EYHA 2PMOX 4UV0A 4XOYA 3HKOA 4FYOA 2OU7A 2GS2A 3WZEA 4W8DA 4B7TA 2XRUA 4EHEA 3JR1A 1Y6BA 4GJ2A 3F7ZA 2ZOQA 3Q9WA 5BMSA 3RNYA 2Y0AA 5L2WA 3HAMA 3BGZA 3DNEA 3KK9A 3P9JA 3OEFX 3LCKA 1ND4A 1JVPP 4MXAA 3QTWA 3EFWA 2OWBA 5E8VA 3G6GA 4F1TA 3G2FA 4UXLA 1WAKA 5BUEA 2C3IB 3DKCA 4BYJA 2DYLA 4USEA 3FMMA 5CF4A 5ICPA 1UVRA 3UG1A 5L2IA 3SOAA 5C8KA 2ZV8A 2ZV2A 1UWJA 5HTCA 4EC8A 3DBEA 3DK3A 2OIQA 2XNNA 2B0QA 5EQEA 1MQBA 4DEGA 4ENYA 3ORKA 4AUAA 3GXLA 3WF5A 3DPKA 3R7IA 5IH5A 4GEOA 3V8SA 5EW8A 2CJMA 3A62A 1R78A 4YBKA 4KB8A 3V5TA 3KCKA 3KF4A 4S32A 3TL8A 3OFMA 3TV4A 2HXQA 5IMEA 2W7XA 4MXYA 3S4QA 4DFLA 3MW1A 2UW3A 5IA3A 3QZFA 5FEDA 4BI0A 2VWIA 5DT0A 4MD7E 4FEQA 1DM2A 2OJFE 5ETCA 4A7CA 2J0MB 5JFSA 4O1PA 4ZSGA 5LARA 3GC8A 1OI9A 4ASEA 5J9ZA 2C69A 3F69A 4YJNA 4ACDA 4FTQA 4QMPA 3PVUA 4L3LA 4B6LA 1Y8GA 3AMYA 4I4EA 3ORZA 4GFMA 1KSWA 1Y8YA 4OT5A 4CMOA 4FTIA 5AM7A 3W16A 2PE0A 3ETAA 3FZPA 3PPZA 3VBTA 3SVVA 4H3QA 4E6DA 2CGWA 3R7EA 4FSUA 4NFNA 4AA4A 2ETKA 2XA4A 4IAIA 4RJ8A 3DNDA 3H30A 4ZSLA 3D2KA 4GS6A 4PMPA 3KRRA 2A1AB 1KWPA 3HLLA 5A4LA 3R83A 3EKKA 3F3VA 5CVFA 3TUDA 5E1EA 1G8AA 4IMYA 2ITXA 3NUYA 3U51A 3AG9A 2UVYA 2W4KA 4FBXA 2YM7A 4PTGA 2XKFA 5HO6A 4RX5A 1CKIA 3W32A 3PA5A 3AC1A 3CY3A 4DT8A 3COIA 2HAKA 1H01A 3GC7A 3EQGA 4X2KA 2OJIA 4CVAA 3HYHA 3OBJA 4R1YA 5EHYA 3JPVA 4EOKA 2UW7A 3UQFA 5BUIA 5CZIA 2YCFA 3ZOSA 5F94A 4U81A 4NM7A 3FMEA 3PYYA 3VF9A 2IJMA 5EYCA 3CTHA 4L42A 5IQGA 2JDTA 4KS8A 3OCTA 3BYOA 5JH6A 4UWBA 5AA8A 3PDTA 5HESA 4PDOA 4ZTLA 3WBLA 1H1WA 4AZWA 2WTDA 1Q8WA 2YWVA 4LMNA 1Y57A 3L8PA 3IGOA 2YAAA 2KTYA 2VGPA 3DXNA 4O96A 4PL4A 1KV1A 4EBWA 5IUGA 3NRMA 4BDBA 5JRQA 2GNJA 4W4WA 5K4IA 5GIPE 4KNBA 5LOHA 3HDNA 4F09A 3PJ3A 3BRBA 2QOQA 2PVLA 4U9AA 2PPQA 3P0MA 4DTKA 5CEQA 2HWOA 4DE4A 4V01A 2ITWA 4YTIA 2IO6A 4IAZA 4YLKA 4M7IA 2VX0A 3DAKA 4L44A 1PMVA 3BBWA 3BX5A 3OP5A 4U42A 4AE6A 3E5AA 3EYGA 4H58A 3SXRA 2V22A 1OUYA 5CVHA 5K3YA 5JEBA 4QTEA 1IR3A 4KKHA 1WVWA 4ALVA 4DH5A 4O1OA 4QMYA 4XCUA 1OUKA 1XH7A 1JOWB 3GVUA 3MDYA 5HG8A 3RCDA 3ZEWA 3L1SA 3KC3A 2IZRA 1IAJA 5DOSA 4G9RA 3ZH8A 1BLXA 2WMBA 4R77A 2ZB0A 4ZAUA 3BPRA 4NKAA 5KNJA 3TJCA 4IANA 5BNJA 3KQ7A 4FV9A 3ZO3A 2GNHA 1QPEA 4APCA 5EDRA 4IQ6A 3VS6A 5IA0A 3MVLA 3F9NA 5JT2A 2UZVA 2BRGA 4U8ZA 2GQRA 4O0YA 2XM9A 5AR7A 4FIJA 3R28A 3R9DA 4D28A 4EHVA 3NWWA 2XNBA 3VJNA 5EKOA 5H8BA 3U8WA 5DYJA 4DCEA 4RSSA 4EC9A 5LXMA 3KRWA 4R3PA 5FXQA 3S2PA 5G1XA 4C38A 4FGBA 3BZ3A 3QXOA 1YXUA 5LMKC 5M4CA 1OVEA 4FKPA 3TNQB 3O7LD 5TR6A 1M2PA 4X3FC 5KO1A 5D11A 5AAEA 5IQCA 4B99A 1ZOHA 1TVOA 2YZAA 1GNGA 4L45A 3ZXZA 3PY0A 4AN2A 1OKZA 2C4GA 4ZSJA 3VVHA 3R1QA 1REKA 1E1VA 5EQPA 1Q5KA 4BI1A 5KMMA 2X4ZA 5IH6A 3GQLA 3GCPA 3RM7A 5CSHA 2PUUA 5FTQA 5BYZA 1BMKA 2ZYBA 3B2TA 3Q2MA 2PVYA 2VO0A 3FL4A 4GYIA 1Q97A 2X8EA 2IZSA 5I9XA 3VBVA 4RIYA 1BI7A 3QLFA 4JR3A 4Z55A 3AOXA 4KRCA 4GW8A 3PP1A 4O38A 4BDEA 3I5ZA 3FLSA 3KKVA 4WO5A 4HVSA 1L8TA 2C6LA 4BWPA 4V04A 1HOWA 3NCGA 4KS7A 2ZMDA 1PY5A 3AT3A 4AW2A 2UW8A 5I9YA 5IISA 5AR8A 2WTKC 3RGFA 2BZKB 2UW6A 2YDKA 1QL6A 3H0ZA 3VO3A 4O7RA 4EH7A 2B53A 5CF6A
chains in the Genus database with same CATH superfamily
5ITAA 4UYNA 2VTTA 3KRJA 4WHZA 4WUAA 3VUHA 2X9FA 3EQDA 4CMUA 3SQQA 1DAYA 3NZ0A 4NWMA 4A06A 2WFYA 1SZMA 3MFTA 1KOBA 4IC7A 3R7GA 4CZUA 3SG8A 4FNZA 2PVMA 4IX5A 2XJ1A 4YPSA 4W9WA 3ZZWA 4O7SA 2XKEA 2OXYA 4LM5A 4XEYA 1XQZA 2V5QA 3VULA 3UC4A 3DDPA 5TE0A 3KA0A 3C4WA 3NNXA 3RMFA 2O0UA 3RAIA 4ZTNA 1W2DA 3BHUA 4AW5A 4EZ3A 2FYSA 2PZPA 3PXYA 2ZM1A 3NYVA 4P7EA 1PHKA 2C1AA 3BYSA 3NVMB 4QNYA 1KOAA 4FEVA 2QLQA 3CIKA 4J98A 3ROCA 3QZIA 4Z9LA 4HNFA 3NYOA 2PYWA 4U40A 3MVHA 4LOQA 3LFSA 2WQNA 3KXZA 2W1FA 3R2YA 3OZ6A 5F1ZA 4I5HA 2XF0A 4NCTA 3G0FA 2J50A 3VS3A 5FUTA 4FTCA 4D1SA 3QD2B 3IW4A 4NM0A 3BU3A 1PKGA 3LCSA 4CLJA 3PLSA 5BVOA 3PIYA 2C6OA 4DN5A 4K11A 4AN9A 2AEGA 2EU9A 3TNHA 2XIYA 4TY1A 4FZ7A 4BKYA 3LFFA 2O64A 3N51A 5C1QB 3CQUA 3FV8A 1OL1A 3FL5A 5JZJA 2DS1A 5FWKK 4NT4A 4AG8A 5LWMA 4AXCA 5JGDA 2XB7A 1OZ1A 2IPXA 5L2QA 4E20A 5LCKA 4NL0A 4AOTA 4YJTA 4AU8A 5HICA 5AV4A 3NUXA 5J7BA 2HW6A 4FIEA 4ZP5A 3UIBA 4BCPA 5IEXA 3U54A 3T9TA 4JBQA 1YKRA 1G5SA 2E9NA 4UMQA 4YC8A 4QP1A 5IA2A 3WI6A 2BKZA 3LFQA 3QTRA 4RIXB 3I5NA 4LFIA 2HK5A 4I3ZA 4YPDA 3I7CA 3FC1X 3R02A 1MP8A 4OAUC 2CKQA 2HZNA 3CCNA 4JDKA 5TOZA 4GU9A 1I09A 2P4IA 3DCVA 4CFMA 1QMZA 5LJJA 1OIUA 1PKDA 4QP9A 4C37A 5KX8A 2UZWE 3QA0A 2C6IA 3QX4A 3GU8A 2BR1A 2QLUA 4UWCA 2BVAA 2W0JA 3I0OA 3F82A 4U5JA 1STCE 1J91A 2KULA 4BCKA 5JQ5A 3AD5A 4ZMFA 4YHJA 2R0UA 4R5SA 5ANDA 2VGOA 3PVBA 2CGXA 3MH1A 4KKEA 4BTMA 4K2RA 4V0GB 5L6PA 4LDTA 5CAUA 3LCOA 3OHTA 5IQAA 4U3YA 2CMWA 3CD8A 5CI7A 2BMCA 4DEHA 4Z7HA 4Y5HA 1YDTE 1SM2A 5JFVA 1XR1A 1ZYLA 5CF8A 2OKRA 3HRCA 3VUMA 1W83A 1P5EA 1W8CA 1JKSA 2QOHA 3QYWA 4IAFA 4K33A 5DR9A 5L8LA 3ZUUA 2GQGA 4W4YA 2QG7A 3E8NA 4NFMA 1SVHA 2H6DA 4HVGA 4M14A 1T45A 2B7AA 4ZJJA 4G3EA 5DN3A 4G1WA 3MY0A 4K18A 4PV0A 3MTLA 3U87A 4CRLA 4QQJA 4DH8A 3C0HA 5D7AA 3BE9A 5E8WA 4CFNA 3OCSA 1PXPA 1KE5A 3D2IA 3HV7A 2JITA 4WKQA 4G16A 4MBLA 3Q2JA 2X0GA 5JK3A 2WMVA 2VD5A 3QXPA 1YXVA 5HE0A 3WZDA 4XG9A 5CSPA 5E8XA 2HYYA 5HO8A 4EQMA 5LMBA 2H9VA 1OKWA 3R00A 4NKSA 2A19B 3DBQA 1VR2A 3FI2A 4TKSA 4TPTA 3HMOA 2WD1A 3MSSA 4TWCA 5JFXA 2AYPA 1IASA 4Y8DA 4O27B 2QNJA 5AFVA 4Y95A 3G33A 4J97A 3UO5A 2XNOA 3HAVA 3ZDIA 2QKWB 3BBTB 2VWVA 3FE3A 4CFVA 5JGAA 2FVDA 3ORTA 4JQEA 2CNUA 4QOXA 5AWMA 4CEGA 3K2LA 4CYJA 2ZV9A 3DAEA 4CV8A 2VRXA 3UO6A 4BY9E 3TXOA 5CU2A 4A9UA 4DG0E 4FNWA 3EFJA 2I0EA 3E7OA 4HOKA 5H2UA 5FP6A 2YCRA 2F57A 4KIKB 4CXAA 2ITQA 2IVUA 3V51A 4DEDA 4RWJA 4C34A 3BE2A 2PMLX 4GKHA 5DT3A 2WMAA 3OWPA 1PXMA 4H36A 4FTLA 2J0JA 2FSMX 3HP5A 4XOZA 4YJSA 4ONAA 4DGOA 3LOKA 1ZAOA 4YNEA 4N70A 3MYGA 4XV1A 3V6RA 2CNVA 3GCUA 2RFSA 3PG1A 2CSNA 5AADA 3BQCA 3ID6C 2W9FB 4E73A 4CG8A 2FO0A 2C68A 2WTJA 4C3RA 3TV7A 3PRFA 4I92A 4XV3A 2V7OA 4FVRA 3VW8A 2OLCA 4GIHA 1CTPE 1PXJA 4IZ5A 3VUGA 3WE4A 4ASXA 4Z16A 4QMUA 5FRIA 5J1VA 3RCJA 2YFXA 1OKVA 2BPMA 4C4HA 4KBKA 1H8FA 2OFVA 5JKGA 4MQ1A 2XZSA 3FLNC 3OEZA 4HZSA 4ANNA 4G17A 5IDPA 4L7FA 4GIIA 4EQCA 2CKPA 4QDEA 3WIKA 1YW2A 3V5LA 1PW2A 4DAWA 4TN6A 2GDOA 3E64A 1BYGA 4J96A 5DR6A 4FTOA 3HX4A 4IVCA 4UMRA 1PXNA 2ETMA 3Q53A 4FKJA 5J8IA 4MD9E 5HG7A 3Q4TA 3S0OA 4C62A 3V04A 3FLZA 2YM4A 3PIZA 5TT7A 5CEOA 1PYEA 4PX6A 5IA4A 4N6ZA 3NGAA 4G5JA 2YWPA 3QC9A 4AAYA 3P78A 4XG6A 3PG3A 3BU5A 3HUCA 3MPMA 4F0GA 4O84A 2BZIB 3PUPA 3C9WA 3QTXA 3T8OA 4RLKA 4DHFA 3ZM9A 4QT1A 3K5VA 4J8MA 3ULZA 2YIRA 5IQDA 1RW8A 1YOMA 1R0PA 1TQIA 2F9GA 4E26A 4C7TA 2QR8A 5HIBA 5JZNA 4G6NA 4PF4A 5AEPA 2XAOA 2RSVA 2J4ZA 1DAWA 3PXZA 1YRPA 3M42A 4JQ8A 5A4EA 1YWNA 3P4KA 1PRYA 4PRJA 3Q3BA 1U54B 5B7VA 3O2MA 3ZO1A 4EKLA 4NJDA 1IA8A 4DEIA 3D9VA 2FA2A 3QUDA 4RGJA 2B55A 3Q4UA 5AR5A 4MH7A 3E93A 3FDNA 2PTKA 3GUBA 4FSRA 5DGZA 1H4LA 3DY7A 4OR5A 4FX3A 4NEUA 5DVRA 3TMOA 2W1CA 5LMKA 5IQHA 1W82A 5CSXA 5LVLA 4C02A 5DPVA 1FMOE 5FGKA 5BMMA 4X3FA 4E5AX 1OBGA 1IEPA 1PF8A 2VO6A 3BYVA 4WD5A 4DH3A 3CGFA 4BTFA 1QCFA 2CNQA 4JRVA 3QQFA 4FT0A 3ZBFA 3FWQA 2XK8A 3MB6A 4FOBA 2JIIA 4RIWB 1AQ1A 3JS2A 3ZHPC 4DEAA 1ST4A 3KMWA 3OT8A 2BCJA 5AUVA 4D2SA 4WBOA 4G9CA 2XJ0A 3UDTA 4U43A 4TXCA 4LUEA 2X6DA 3QUPA 4ZXTA 3OT3A 2ZM4A 3D83A 3POOA 4LGGA 5DNRA 1ZYSA 3LFNA 4AAAA 1J7UA 4C4EA 4JNWA 3IDCA 3EQPA 5AUXA 4AWIA 3PXFA 4JG8A 5E91A 2ZM3A 3C0IA 3QCXA 3POZA 5F20A 3VRYA 3FI8A 2CLQA 2BAKA 1F3MC 4LGHA 3O96A 4FL2A 4PQNA 3F2RA 4C35A 4DFZE 2RFEA 4CFFA 1O6KA 3PZEA 1WBOA 3CD3A 4HVHA 4FKQA 2EXMA 3EQRA 1Q8ZA 3NNVA 5EYKA 3TKUA 4A9YA 2HELA 2PE2A 4BJJA 3JY9A 3CC6A 4QMLA 5EQYA 4TNBA 4GK4A 4ZTSA 4ZMEA 3PY3A 5DFPA 3VS7A 1JPAA 4YBJA 3RAKA 4RQVA 2VWYA 4X3FB 2WMSA 3KK8A 3G9LX 3TIZA 3ATTA 3UOLA 4OBPA 3LJ1A 5DIAA 4DFNA 3D0EA 3KU2A 4MEDA 1WVXA 1DS5A 1OECA 2VTMA 3I60A 4LV5A 3TZ8A 4RVMA 5E8YA 2WQEA 4UBAA 3H10A 4DEBA 2C6MA 2HENA 3NPCA 3PVWA 4FKWA 4UZDA 3S3IA 3TZ9A 3HRBA 2IG7A 1BUHA 3WYYA 3QL8A 3PPKA 5KHWA 2ZMCA 1Q99A 2WMRA 5CI6A 3F5UA 4KAOA 1P4OA 4FTRA 1Q3DA 4NTSA 4DYMA 3R21A 1H1SA 3ZBXA 3CP9A 1J1BA 3R9NA 2IVTA 5C4LA 2JIVA 4QMZA 3LQ3A 4CTCA 2HY0A 4O4DA 4XBUA 4MX9A 4AOIA 2WAJA 4YJQA 3ZTXA 4RPVA 3GI3A 5ACKA 3ORMA 2BFYA 4M68A 2GFCA 5C4KA 2WTKB 4CCUA 4QMXA 2R3MA 3OW4A 2Z02A 1MUOA 4D4YA 2J7TA 1B39A 3EL8A 4ASZA 2JDSA 3FY2A 3QGYA 1UA2A 4M84A 2QOCA 4FK6A 5HLNA 4F08A 2OZOA 2XCKA 4DHJA 5BVDA 4O7ZA 3RINA 4EK5A 2ITOA 2YCSA 4XX9A 4XG8A 3ZSIA 2OFUA 4EH2A 3Q32A 4KSQA 4DBNA 1OL2A 2IWIA 2JKKA 4KIQA 4XNEA 5BYYA 4Q2AA 3SAYA 1YHWA 4BF2A 5K9IA 4QMMA 2UW4A 4IM3A 1YOLA 2BIKB 1TZDA 4DGMA 2P55A 3PWYA 4GKIA 4KBAA 3OY1A 4RLLA 1R3CA 5IEVA 3IG7A 5JN2A 3AMAA 4IVDA 5HCXA 3OG7A 1H26A 4I6QA 3Q9ZA 1X8BA 4O0TA 4ALUA 4IB0A 2YHVA 3FLYA 3HMMA 4M0ZA 3EZVA 5CQWA 2QO9A 5GIOE 1PXIA 3OXTA 2Z2WA 2C0OA 4GYGA 4EOOA 3DZQA 2PUPA 3SXFA 3MPTA 3M11A 1Z57A 4KIOA 4TWOA 3VS0A 3FI3A 2GS6A 3VWAA 1ZRZA 5A3XA 5J1WA 4EEVA 4IAYA 5EM6A 5M4UA 4FIHA 4UZHA 4O7TA 3IO7A 1Z5MA 1F0QA 2QONA 4B8LA 5C03A 3FXZA 1Y91A 2AQXA 3ENHA 2FSTX 5FBOA 1ZY5A 3UO4A 1VZOA 1VYWA 5CNNA 5L6WL 2X6EA 3QRIA 4GG5A 1DI8A 2JKOA 2PZYA 2VO3A 4XUFA 1UNHA 4RT7A 4ZTMA 3EKNA 4J7BA 3BYMA 4O6LA 5G6VA 4BBMA 4MUQA 4NW5A 3ZFXA 3KXGA 4BCQA 4HVDA 3LFBA 4GRBA 4ZZMA 3R8UA 2GHMA 5E92A 1KUTA 5T6KA 4DA5A 4RJ5A 3V01A 4L9IA 4D55A 4JDJA 4DFYA 5H8GA 2ITPA 3WF9A 5A46A 5JFWA 2V55A 3SD0A 1P4FA 3MVMA 4FOCA 3RAHA 3IOKA 3QCSA 1YXTA 1TQPA 2WQBA 4BVUA 4MTAA 4TYJA 4I94A 3CQEA 3MB7A 1JSUA 3R0TA 4CT2A 4DT9A 3AXWA 1OL7A 2RIOA 3A60A 2WQMA 2GNFA 2HWPA 1DI9A 1GZNA 2RG5A 3R73A 4W4VA 2X9EA 3HDMA 1Q24A 1KE8A 3F6XA 5DEWA 1H08A 3U4UA 4QP2A 3GFWA 3ZXTA 4R3RA 1T46A 1OPJA 3L9NA 4P5QA 3LJ0A 4OTIA 3EL7A 4FTNA 3AGLA 5AUYA 2YLFA 5FD2A 1PMNA 2X2LA 3ANQA 3O51A 3PSCA 3R01A 4I93A 4TNDA 3GU5A 5E4HA 4DGLC 4U7ZA 2IZTA 3NS9A 3VBWA 5CYIA 2WTVA 3CKWA 4AW1A 3RPVA 4MKCA 5AAGA 2VX3A 2X1NA 5K0XA 5CXHA 5L8KA 3QD3A 4Q9ZA 2X8IA 3BQRA 4W9XA 3WYXA 4FIGA 4QTAA 4XG7A 3LJ2A 5BUJA 2JBOA 5D1JA 2BAQA 2RKUA 2R3OA 3VBQA 3ZC5A 2C0IA 4FKUA 3T9IA 4C59A 2I7QA 3FYJX 3OC1A 5CX9A 4FKIA 2PZRA 2BKKA 5EOLA 3DJ5A 1H1QA 2W1DA 4MWIA 5TKDA 3ZUTA 4CNHA 3P1AA 4O91A 4O2ZA 3TNPC 1SMHA 4YZBA 5HHWA 2R3LA 4IDVA 1GOLA 3UJGA 4BCFA 1JKLA 1URCA 3FQEA 3TIYA 5B2LA 3VBYA 3UDZA 4BKZA 4ACCA 4BCGA 2W5BA 4BGQA 3Q4CA 4QEBA 1M7QA 5HQ0A 4CT1A 2PSQA 4M13A 4U3ZA 4AFEA 2JC6A 3FMHA 3FHRA 4ZTHA 3CSVA 4F70A 1Q3WA 3MGYA 3LIJA 3Q4ZA 3QRJA 2G2HA 4FODA 5AAFA 3LPBA 4APPA 5AA9A 3QAME 1R39A 4BI2A 4QTCA 2WXVA 3AMBA 4GU6A 1JSTA 4HPTE 4I41A 4BDJA 3CLYA 4TW9A 3NMUF 2HY81 3FLQA 3QLGA 4AGCA 1GY3A 1FVRA 2GNLA 4FRFA 4FR4A 1XH8A 3W10A 4EUUA 4XP3A 2GCDA 3Q52A 1OL5A 5CANA 2UV2A 4GL9A 2I0HA 4ZS4A 2C1BA 3HUBA 2E9OA 4QTBA 1M7NA 2QC6A 4GH2A 4P2KA 4W4XA 1G8SA 1PXOA 3UC3A 2JBPA 4FKLA 3UP7A 3VUIA 2R3KA 4E4NA 4FJVA 4EJ7A 2HZ4A 4HGSA 5LWNA 2F2UA 3TZMA 1JWHA 3GC9A 4GJ3A 3CJGA 3O0GA 4IADA 4LRKA 4RC2A 3M1SA 3BHYA 3ZRLA 1E9HA 4QMNA 4FTAA 4GT5A 3W0NA 3WZUA 5BYLA 3P7CA 3O5AA 2OZAB 1PXLA 5DBXA 5IQEA 3BV2A 5M09A 4YC3A 3DLZA 4QPAA 3TN8A 3QRTA 5AJQA 2CHLA 4MVFA 1ATPE 3DFAA 4M66A 1M2QA 1B38A 1WMKA 4FTUA 5EOBA 2ITTA 3HL7A 4G2FA 5I9VA 3CTQA 4DHZA 5K0KA 4KA3A 5E1SA 2C6EA 2XP2A 5EW9A 3DU8A 4RBLA 4MAOA 4I4FA 4FK3A 2XYNA 3GOKA 1MQ4A 4IJPA 4JXFA 5B2MA 4C8BA 4D9UA 4EK8A 3NVKI 2O5KA 2X0PA 2VWBA 4QYYA 5KCVA 3KY2A 3EN6A 4R8QA 3E62A 3KB7A 4TL0A 3UPZA 4BHNA 1A06A 2XK3A 2CKOA 4S33A 5FP5A 3PVGA 4LGDA 1OGUA 4D4SA 5HCZA 5J79A 3MH3A 1W84A 5IQBA 3W1FA 5D7VA 4FG7A 4D58A 4M69A 3P5KA 3EN9A 4M8TA 4GUBA 3U6JA 2ONLC 3W0QA 4DF3A 3OXIA 3AKLA 3L8SA 3R7VA 2F4JA 1GZKA 3MPAA 2YLEA 2XM8A 4KINA 4AFJA 4D2RA 4EL9A 3N4VA 2E9VA 5M07A 5EYMA 3C7QA 4I0TA 1NVSA 1MRUA 4FT7A 3DA6A 4HYUA 4QMOA 3OWKA 4EK6A 2P33A 3MY5A 4BR3A 5LVOA 4EH3A 3UOHA 5J5TA 4I20A 5E9EA 4F6WA 3TYKA 3C0GA 4CYIA 3KGAA 3PTGA 4BC6A 4QMSA 5HKMA 4EK4A 3SRVA 3G90X 4YP8A 4HJOA 2YM5A 4I21A 4E6CA 5AR4A 4BL1A 2GU8A 2WMQA 4ITIA 3C5UA 2QOOA 4A9RA 4YU2A 3WZJA 3OCGA 3UYSA 2R3QA 4FV0A 5CLPA 4YNOA 4XBRA 4YGAA 2WO6A 3V8TA 4ARKA 3ORNA 2QD9A 4FKSA 5T68A 3TV6A 3VUKA 1ZYDA 4AA0A 4F6SA 4I22A 4CZTA 1QPJA 3A7GA 3A7HA 4YJRA 2XNGA 1Z9XA 2R3JA 3BGQA 3PXKA 4RFMA 3QTIA 4CKRA 4UWYA 3FMJA 3ORIA 3QCYA 3UNKA 3QZHA 1NW1A 4M69B 3FZTA 3GFEA 2P2IA 4NIFB 4MNFA 2EB3A 3R71A 4YTHA 4D5KA 4K9YA 1FBNA 4KBCA 3VQUA 2J90A 5EHOA 3KL8A 4H3PA 1R0EA 4AW0A 3L9PA 4AT4A 1ZOEA 3AT2A 1IA9A 1BX6A 1FVVA 5BX0A 3BGPA 3VHEA 2AC5A 3KN6A 3IQ7A 3OUKA 1P14A 2HIWA 3VQHA 3HA8A 2WMXA 2X7GA 3F66A 4IIRA 4Y46A 3UTOA 5C8NA 4EI4A 3COKA 5AP3A 4WA9A 2BUJA 3SRVB 4MHAA 4RIXA 4WOVA 4EQUA 5IQIA 4BKJA 4EJNA 4QP7A 4ITJA 4G6OA 4GCJA 3E63A 4O22A 3D7TA 4TRLA 4FA2A 4QP3A 4RRVA 3MN3A 5CU6A 3ORPA 4Q5EA 2F7ZE 2GSFA 2WTWA 3F5XA 1E1XA 2B9HA 2NO3A 3DS6A 3LVPA 4IFCA 1CKPA 4Q5HA 4LOOA 3WILA 4YZNA 4YMJA 3PXQA 2J9MA 3LFEA 1JLUE 2ZB1A 4PTEA 3R1SA 5AIKA 4JVGA 4WSYA 4ERKA 4ZLOA 4V0GA 3ZRMA 4RWLA 4OTFA 3QQUA 1XHAA 1OPLA 2B4SB 2NRUA 3I81A 5JGBA 3LMIA 5AV3A 3HMIA 5AP6A 4E4LA 4X6RA 1ZMVA 2XEZA 2O2UA 3AC3A 4FV2A 4DC2A 4TYHB 3FI4A 3A8XA 2WKMA 2WU6A 3DLSA 3AQVA 3QKLA 3IS5A 4FI1A 4IB1A 3OTVA 4IWOA 5EW3A 3RK5A 1KE9A 3D5UA 3QTQA 4C61A 4HPUE 1YDSE 2OG8A 2YIYA 3GU7A 3MVJA 2P3GX 5IU2A 3NAXA 2XKCA 2VTRA 4X21A 5CTPA 4FSNA 4R3CA 5C8MA 4WG3A 2PUNA 2PY3A 3W2CA 1KE6A 1V1KA 3FZOA 4CQEA 3H9OA 4R7BA 3ZLWA 2O65A 3NR9A 1FOTA 3HEGA 4PWNA 5FDXA 5HBEA 3GCSA 4ITHA 2I0VA 4I24A 2UW9A 3IKAA 3ZM4A 3WZKA 3CS9A 3ZFYA 5IF1A 2UW5A 2JFMA 4R78A 3PJCA 3P7AA 1PJKA 1JKTA 3F2NA 3RKBA 3E7VA 3S95A 3D7TB 2B9JA 4G3CA 4EOIA 4FSQA 3KXMA 5K4JA 3GC0A 4F7SA 3FLWA 1FVTA 4QPSA 3HGKA 5FG8A 1ZARA 3PSDA 2BRMA 2GS7A 4AACA 4AZSA 1PYXA 5L2TA 2C3KA 4S31A 3TJDA 5HBJA 2J2IB 1QPDA 3IDBA 3L8VA 4YZ9A 3K54A 3QBNA 2JEDA 3QHRA 4OTHA 4OTDA 2XH5A 3V5PA 3COMA 4RJ6A 5EG3A 3UVQA 3ROYA 4FC0A 1ZMWA 4MXCA 2ERZE 5DG5A 5IA5A 3QQKA 4U41A 2R0IA 4PDSA 1G8KA 4G34A 4QYHA 2OH0E 3JVRA 1H27A 4KIKA 5ETIA 1XO2B 4F7JA 4YSJA 3GOPA 2XBJA 3GCVA 3HMNA 4BIDA 4O7WA 2ETRA 5AP7A 3TKIA 3FKLA 2I6LA 3BU6A 4GFOA 1YXSA 4U6RA 3E92A 4ZY5A 3FKNA 2QU6A 4JT3A 1U5QA 5DH3A 1YDRE 1U5RA 5ANIA 3UVRA 4C33A 5ANOA 5M4FA 4O82A 4TYGA 4RZVA 2B9IA 2X4FA 2W06A 3OS3A 3UYTA 2JKMA 1WBVA 4K8AA 5M53A 4ZOGA 4X7QA 3TG1A 1RE8A 3W18A 4FE2A 3PPJA 3O8TA 3OBGA 4B0GA 4GMYA 4UEUA 1FQ1B 3F5PA 4UN0C 3DJ7A 4XMOA 4I0RA 4Y83A 3SA0A 4Y72A 3VN9A 1YI4A 3F2AA 3KRLA 4F9AA 5LVMA 3MA6A 4L3PA 3BLAA 4ACGA 5LMAA 4CFUA 3HMPA 4X2JA 4I6LA 4E93A 3TTIA 1JAMA 3BL9A 3JY0A 4MYGA 4CSVA 4D0WA 4NH1A 3VS1A 3RTPA 4B4LA 5E8ZA 3NFFB 4MBJA 1LP4A 1V0OA 4FICA 1SNUA 3IW8A 2G9XA 3QTZA 1OL6A 3I6UA 4FZFB 4R5YA 1CM8A 3W33A 5CENA 3GT8A 2A0CX 4HGEA 4FSTA 4IZAA 4FF8A 3GBZA 4EZ7A 4DH1A 2NP8A 3U6IA 5GINE 4ZLYA 2VWXA 2FSOX 4H3BA 1M17A 1UKIA 4F7NA 2ERKA 4FZAB 4NM5A 4JX3A 4X6QC 2YN8A 4CV9A 3R1NA 1UU7A 1J3HA 4FKOA 4DGGA 4FTJA 2FGIA 1A48A 4L7SA 4PMTA 3V5JA 5AV1A 4BCNA 1GZ8A 5CEMA 2VTIA 5M08A 2C6TA 4WUNA 2W5HA 3G0EA 1PMUA 4IAAA 4R7HA 3HV3A 5HNBA 3RNIA 3TWJA 3UQGA 4E7WA 4I6BA 4IWPA 4N57A 4QD6A 2CDZA 2C5VA 4XYFA 5KE0A 4K77A 4NYEA 3FBVA 4JLCA 2HOGA 1O6LA 1M14A 3SLSA 3TNWA 2GHGA 4FEUA 5HE1A 4DLIA 3MJ2A 5CEPA 2BROA 2IW6A 3EHAA 2OW3A 1U54A 1JQHA 4YLJA 4CFXA 1G3NA 2WEIA 3VIDA 5GJFA 3PFYA 4FYNA 2IEWA 3C4CA 1PXKA 3IDPA 3OUNB 3QHWA 4M15A 5F9EA 2IVVA 3U4WA 3KREA 5FXRA 5LVPA 5CY3A 3R2BA 3HV5A 3W0SA 2Z8CA 3L8XA 2WPAA 2W5AA 3ODYX 2A2AA 3TNIA 3WF7A 4WNKA 4ZZOA 3MA3A 4IXPA 4XV9A 2XNMA 3C51A 5HOAA 3KN5A 1EH4A 3D94A 4RJ4A 2SRCA 4JS8A 3SV0A 3QWJA 1NY3A 4DFBA 3G5DA 3ZRKA 3SXSA 3E8DA 1ZZ2A 2ITNA 4JL9A 5BVFA 3KMUA 3DKOA 4MBIA 3VS4A 4ZLZA 3I1AA 4LV8A 4RIWA 5AV0A 4F9CA 5H3QA 4XHKB 4FZ6A 5K5NA 3FXWA 2GNIA 5HEZA 4DLJA 5IKWA 4JDIA 2WOUA 4XV2A 4DFUA 4HYSA 3FZSA 3FY0A 4HGTA 2QQ7A 4X2FA 2JDVA 3R8PA 4IW0A 1ERKA 4AXAA 4AZFA 3D7ZA 4NUSA 3K3JA 3Q6UA 5KMJA 3LMGA 1YOJA 2UZTA 2XNPA 5KKRB 2XAMA 4FEWA 3B8QA 2RF9A 4PTCA 3II5A 1H0VA 4USDA 4MCVA 4A4LA 1YHVA 4PY1A 1ZZLA 2VTJA 3MJ1A 3NYXA 4J95A 2UW0A 4O2PA 4O7NA 4PL3A 4I1ZA 3TT0A 5HO7A 2XVDA 3VS5A 5KZ0A 4XS2A 4J53A 3NSZA 4CRSA 3L9LA 3PE1A 2Y4IC 5HI2A 3CKXA 5D12A 3R1YA 3QWKA 1RJBA 1YVJA 3PE2A 1RDQE 2OICA 2W05A 2PVFA 2ONLA 3FZ1A 2QCSA 3VF8A 3KF7A 2R64A 4UMPA 2BTRA 3PXRA 3NUPA 1UU9A 2PVJA 3BKBA 5CSVA 2VTPA 3PWDA 3QA8A 4FG9A 4FV1A 5CAVA 2C47A 4DDIA 4E5WA 5CAQA 3B2WA 5AR3A 4O7YA 3RPOA 4L52A 4LL5A 4DEEA 2C5NA 4MNEA 3NUUA 3EQHA 3JVSA 2VTNA 3TTJA 4II5A 4BDCA 2R5TA 4QPMA 3EN5A 4LRJA 4EOPA 4JAJA 5EFQA 2UUEA 1Q8TA 2ITVA 5B0XA 4YR8A 4EH5A 4Y5QA 3MTFA 5AIRA 3W0OA 3AC4A 4U45A 3F88A 5HTBA 5HU3A 5J9LA 4CZYB 5AP1A 3V6SA 3EN7A 1XH5A 4LRMA 4JQ7A 4XRLA 3BLHA 1REJA 3DOGA 4AOJA 3ZLYA 3ELJA 4JX7A 4WNPA 1ZYJA 4E8AA 2YACA 4O0VA 3F7WA 3IOPA 1K3AA 2RFNA 4H39A 3MFUA 3LZBA 2XRWA 3W2RA 5KHXA 3OOMA 2RG6A 3EN4A 2OJJA 2YDIA 3S1HA 3PLAE 3OD6X 4AQCA 3FHIA 3FXXA 3R7UA 5HORA 2C5OA 3R7YA 3ZYAA 4CG9A 2OI4X 3VONA 2V0DA 3ZZEA 2GNGA 3TUCA 3OWJA 3F3ZA 3O50A 2GMXA 2R3HA 5CAOA 4E4MA 4NU1A 3W0PA 2R3PA 1NVQA 2PULA 3E87A 2WEVA 4RA4A 4HVIA 3KULB 3PJ8A 4ORKA 3CTJA 3P23A 2QHMA 4CGAA 2G2IA 4RX8A 2CPKE 2IW8A 4AXDA 4A9TA 2W99B 3UZRA 1OM1A 4IAKA 4MNEB 2J5FA 1XBCA 2VTLA 4Y73A 4U79A 5M56A