3LCSA

Crystal structure of the anaplastic lymphoma kinase catalytic domain
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
304
structure length
304
Chain Sequence
YCFAGKTSSISDLKEVPRKNITLIRGLGHGAFGEVYEGQVSGMPNDPSPLQVAVKTLPEVCSEQDELDFLMEALIISKFNHQNIVRCIGVSLQSLPRFILLELMAGGDLKSFLRETRPRPSQPSSLAMLDLLHVARDIACGCQYLEENHFIHRDIAARNCLLTCPGPGRVAKIGDFGMARDIYRAGYYRKGGCAMLPVKWMPPEAFMEGIFTSKTDTWSFGVLLWEIFSLGYMPYPSKSNQEVLEFVTSGGRMDPPKNCPGPVYRIMTQCWQHQPEDRPNFAIILERIEYCTQDPDVINTALPI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords ALK tyrosine kinase receptor
publication title Crystal structure of the ALK (anaplastic lymphoma kinase) catalytic domain.
pubmed doi rcsb
source organism Homo sapiens
total genus 103
structure length 304
sequence length 304
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2010-01-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3lcsA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3lcsA01
3VQUA 3BZ3A 4DFXE 3HMOA 2O64A 1G3NA 2YZLA 5IA4A 4PPCA 4BBEA 4LFIA 5GJGA 4CCUA 2GQRA 2VU3A 4GMYA 4LI5A 2O0UA 5FP6A 1GZNA 4CZTA 4A9UA 4M12A 2CSNA 3GENA 3MFRA 3N9XA 3QHWA 5HTIA 4GT5A 4AX8A 2ZDTA 3UIMA 2YDIA 1J1CA 3Q32A 3TG1A 3NCGA 3ZZEA 2WMQA 2XEZA 3ET7A 5DNRA 2Y9QA 5TOZA 1A9UA 1J1BA 3QZGA 4L9IA 5FEEA 3OT8A 2W17A 4HCVA 4BCFA 3R2YA 1JKTA 3E8DA 4NM0A 3PWYA 4KRDA 3NVMB 5DYJA 1WBOA 4F0FA 4D2RA 4O84A 1RW8A 2QODA 2PMLX 4K9YA 2OW3A 5E92A 3EQIA 4BDIA 3FKLA 2BZKB 2WHBA 3O0GA 5CENA 3SAYA 5HVKA 4YO6A 1H1QA 1UA2A 3NYVA 5BVOA 3QTRA 2ZV7A 5KMMA 4DAWA 3N51A 2F7XE 4ANBA 2BMCA 4E4XA 3UTOA 4EH4A 4TNDA 4F7NA 4FKUA 4BZOA 4RX5A 4NIFB 4NTSA 2BHEA 3CS9A 3OFMA 2R0IA 4BI1A 4C7TA 4CSVA 4F65A 4BWKA 3UZRA 5M07A 2X0GA 2W06A 3E3PA 3ANQA 3HECA 4IBMA 1FMOE 3MN3A 4II5A 3IW7A 2XKDA 3QRKA 4D1SA 5HQ0A 3MIAA 2C47A 1DS5A 4O1OA 2E9NA 3CY2A 4IM0A 2QU5A 3A7FA 3OWLA 4ASZA 4YTHA 3PVWA 4ASEA 1YXXA 3P7AA 4O6EA 2WB8A 4Z3VA 3LJ2A 4IB3A 3A99A 3B2TA 4UB7A 2A0CX 3ZH8A 2AUHA 4R7HA 2H6DA 1YXTA 5H8BA 4LOPA 4A4OA 3O2MA 4GK3A 5CEKA 4QRCA 1PKGA 1UU3A 4AF3A 4QTBA 2QOHA 4EBWA 3U6IA 4XG2A 1W0XC 3KCFA 3OCBA 3ZBXA 3NYOA 4FOCA 3P7CA 4O0UA 3E64A 3KC3A 2BCJA 2JBOA 2WQNA 3G9NA 3GUBA 2UZBA 2R4BA 3VN9A 3SGCA 3OEZA 4EZ7A 1OGUA 2QKWB 2YFXA 3EMGA 2OIQA 3V5JA 2JDTA 4LGDA 5EYCA 4F7JA 4N57A 4I0RA 2UW6A 1QCFA 4JXFA 3WARA 2HY0A 4FYNA 3Q04A 4R5YA 1G5SA 4X3FB 4RJ4A 1O6YA 4BR3A 3PLAE 4I92A 2BDJA 3VF8A 1QPJA 2IVUA 2WAJA 5DH3A 5H3QA 5H9BA 5HE0A 4WUAA 2W1IA 5GNKA 3WZKA 2ZAZA 3QKLA 3PVUA 4XOYA 2PUUA 2J0IA 3LFSA 1WBTA 5CY3A 2DWBA 4BY9E 3GQIA 2VTAA 3PSCA 3HEGA 4RQVA 4K18A 5KZ0A 1SZMA 3RI1A 2QG7A 5GIPE 2HW6A 1H01A 4JX3A 1JSTA 3W18A 1YOMA 4QO9A 4EBVA 2W7XA 2WTCA 3V8SA 3Q2MA 3BU3A 5L2SA 4W8DA 1BL7A 5D7AA 3FHRA 2C3KA 4FBXA 3TV4A 4DBXA 4YURA 1XH9A 2CLXA 2P33A 2WD1A 3PY3A 4EK8A 4D2TA 1OUKA 4I5PA 2WMRA 3ACKA 3UDBA 4F70A 1BI8A 3QC9A 1IG1A 4ZXTA 2WMWA 4QMVA 1RQQA 3UP2A 5JN2A 3CC6A 5AV0A 3FKOA 1PJKA 3OZ6A 3CXWA 2GQSA 3F2RA 3DXQA 3QCYA 2WTKB 3Q9XA 2YACA 4DC2A 3W10A 1JBPE 2E9VA 3B8RA 4FEWA 4MXXA 3UQFA 3UIUA 4FZDB 2X4FA 2YDJA 2W1ZA 2PVLA 2C5VA 2ZVAA 3AQVA 4NJDA 3WF9A 4O7NA 3PG1A 4I0TA 4C3FA 4AW2A 1NVQA 2DUVA 2WTJA 4QMXA 4QP8A 4DEBA 1U46A 5IPJA 5IQFA 2SRCA 1Q41A 3K5VA 3MVMA 4JQ8A 5J87A 3R7VA 4EOKA 4QMQA 4O82A 4RLKA 1XJDA 2WTKC 3GC7A 3RCJA 3HUBA 4ANMA 2CCIA 4RA4A 4OTHA 3EYGA 4FUXA 4OTGA 4QOXA 3D4QA 5ANGA 1PXMA 3F69A 4RVTA 5HO6A 4IAZA 5DA3A 4GH2A 1Q8UA 1ZXEA 3WZUA 4HYSA 3GCVA 3HNGA 4YZMA 4J95A 5AR2A 2OI4X 2V55A 5HE2A 5EQEA 4CV9A 4RMZA 3SRVA 4YZCA 4FTAA 2VWIA 2H8HA 2R3IA 3RM7A 3V5QA 5CSPA 3PVBA 4E6AA 3ZEWA 5AR5A 3PPZA 4X2KA 2WGJA 3FPQA 1NVRA 2LGCA 4I23A 2YISA 2CGXA 3QWJA 2PE0A 3P7BA 2QNJA 3L9LA 4JQEA 5HVJA 4AE9A 1I44A 3QRTA 4WO5A 2FGIA 1U59A 1ZOHA 3FMDA 3PRIA 1YXVA 5AUWA 3R9HA 3UVQA 5I5ZA 4RX9A 3Q6WA 1PMUA 4AAAA 5E90A 1MRYA 3QA0A 5K0KA 5DT3A 3WZEA 4XX9A 5DRDA 4HYUA 4EH6A 3I4BA 2IVTA 2Y6OA 2W1GA 4XYFA 3RWQA 3H9OA 4J98A 2ITTA 5I0BA 5JQ8A 3ELJA 4ZZMA 3QD0A 5L4QA 4GUEA 4R3CA 5JZNA 3P08A 4CQGA 2JDSA 4L7SA 4JBOA 4BBMA 3LXNA 4ORKA 3SG9A 3NVKI 3C51A 5JSMA 4W4VA 1FGIA 5EM6A 5L2QA 5TF9A 4NK9A 3OT3A 2V0DA 2VAGA 3GC9A 4I94A 3G15A 4DFNA 1ZY4A 5CAPA 5KNJA 2J7TA 3PLSA 3TIZA 2PU8A 4O2ZA 3U8WA 4XV9A 4DITA 5DBXA 3M1SA 5JFVA 4MEDA 3FKNA 2WO6A 3EQFA 3FUPA 4N4SA 4FG8A 5AUZA 4MX9A 1H24A 2VNYA 2RFDA 3C5UA 3I0QA 4D1ZA 4RIYB 1XH4A 3A61A 4AA4A 2F9GA 3SVVA 4OTPA 5EHLA 3KY2A 3FYJX 5HO7A 3A60A 5AMNA 2C6IA 2VWYA 5CLPA 3I60A 4BDHA 5C8NA 2BHHA 3MJ2A 1Q4LA 2RFSA 3EQCA 3KXMA 4D58A 4QQTA 3AC4A 4S30A 5HD4A 3IPHA 2P2IA 1E1XA 3ZDIA 2WZJA 4MBJA 3G6GA 1PXLA 4MNEB 3TM0A 2X2LA 2RFEA 2HCKA 3CKXA 3QCSA 4C4FA 4EEVA 4EHEA 2YERA 3BGQA 5K4IA 3NUNA 5IF1A 4BTFA 4TT7A 4DEEA 2VGPA 3LIJA 5AX9A 3R22A 1PXJA 2ZMDA 4M14A 2OK1A 2VO6A 4BF2A 1BMKA 4NKAA 4K0YA 3JY9A 4GVJA 3COHA 5B7VA 4UMUA 3KK8A 3NUSA 3EL8A 2YN8A 4FSTA 4TYHA 4DTAA 4F1TA 5CS6A 3GU6A 4LYNA 4DBNA 4M15A 4IAYA 1SNUA 3OMVA 3R7UA 1RE8A 2CN8A 1MQBA 3H4JA 3WF6A 4UMRA 4TTHB 2JKOA 5L3AA 3DFCB 4RJ5A 3QZIA 2VTOA 4KSQA 4QMMA 1P4FA 4QNAA 4EH3A 5H2UA 5I9UA 3GP0A 2PPQA 4HNFA 3DDPA 4BN1A 3BV2A 3LLTA 4QPMA 4BYIA 4IDVA 4GSBA 5L2IA 4CFWA 2VX1A 4O83A 3QCQA 3DNEA 2PL0A 2R3MA 4U8ZA 4YSMA 3VAPA 3AD5A 4QYYA 1IASA 2OXDA 4QPAA 5E1SA 2RSVA 1YWNA 3RGFA 3GCSA 2V62A 3R8MA 2YM8A 5CYIA 1CM8A 3R73A 4TYJA 1HCLA 4OGRA 5JGDA 3FZPA 3QYZA 2X8DA 5FM3A 3SXSA 2C6KA 3KMUA 3DTCA 1S9IA 2RL5A 4F6UA 5L6OA 1UKHA 1KV2A 4BCNA 3PP1A 2I0EA 3QQUA 4ZTMA 3WE8A 3LQ3A 1NXKA 3R7GA 4H3PA 3WIKA 4PDYA 3C13A 4G3CA 4X3JA 1FGKA 2OXXA 3FI4A 4RVLA 2C6LA 2UW8A 4NZWB 4C59A 4AW5A 4ANNA 2XYNA 3WYYA 2IW9A 4AT3A 1XHAA 4FKOA 1Q99A 2W9FB 3DJ7A 3AT3A 3E92A 3G0EA 4MWHA 3G9LX 5LXMA 3BHTA 4AFJA 5C8KA 4H39A 3R8VA 5AUUA 4WNPA 3KVWA 3LFDA 4EOJA 3QQJA 4ANQA 3BRBA 3OY3A 5EDRA 3ZFXA 3UIBA 2UW5A 4KS7A 3ENMA 1UWHA 3UYSA 4F1MA 5AA9A 3MTFA 4FV2A 2GTNA 4XV3A 4UWYA 1OIYA 4A9YA 4E26A 4YHFA 5IQDA 4F0IA 4L3PA 4I20A 4AGUA 4L00A 1TKIA 5IKWA 3AT4A 4BIEA 1WZYA 3KF4A 2OXYA 4G3GA 2BROA 4EQUA 1KE5A 5B0XA 4NT4A 3R9NA 3VBTA 3O7LD 2O63A 3D9VA 3Q5ZA 3BBTB 4HPUE 2KULA 3PZHA 4NIFA 4E5BA 2R3HA 4DFZE 3DBFA 3IW4A 1Z57A 4HPTE 2OLCA 2YCRA 2I0VA 4E6QA 4N70A 2WMTA 3NIZA 4TN6A 2WMSA 3FMEA 5GIOE 5JRQA 3DKOA 2X2MA 3TEIA 5BYLA 4KBCA 5JZJA 2WTWA 2VTPA 3F5PA 4EOSA 4DA5A 1XH8A 4IAFA 2B0QA 3O96A 3D83A 3F2NA 3NUPA 5ETCA 3KL8A 1ZY5A 3IKAA 3PY0A 4C02A 3D14A 3F9NA 4JIAA 4YHJA 3UG2A 2F2UA 2BKZA 3QQHA 4LUDA 4MXZA 4QMTA 4ZY6A 4FX3A 5K0XA 4YGAA 5L8LA 5HIDA 3NGAA 4USEA 1H1SA 4PP7A 4O7WA 5H8GA 4CFFA 1IAJA 4KA3A 5HLWA 4ONAA 1ZLTA 5A9UA 5JMSA 3AG9A 4CKIA 4DH5A 4BGHA 2OICA 4LUEA 4Q9SA 3BE2A 2XCHA 3BYMA 4XV1A 4BB4A 3SW7A 3G6HA 2OGVA 3HDNA 4OLIA 4EH7A 4YO4A 3QRJA 4MF1A 2ZV9A 2IG7A 4KIPA 4ZEGA 4TNBA 2W5BA 3TXOA 3S0OA 5A6NA 4F6SA 1STCE 4WBOA 5D10A 4NW5A 1X8BA 2XIYA 3Q5IA 3ZU7A 3WE4A 2PUPA 5DVRA 2V22A 4CFVA 4NU1A 5FEQA 4O96A 1H28A 3I79A 5AP7A 2R0UA 3UYTA 4NCTC 5ANIA 3VUHA 5J7BA 4HZRA 1UNGA 5HI2A 3RZFA 4G16A 2GNJA 4FGBA 2YM6A 3TJCA 5CEPA 3DQWA 4QQJA 4HW7A 5AA8A 2QR8A 5JQ5A 3OCTA 3AC5A 5KZIA 2BR1A 5BVDA 4J96A 2JFLA 4Q5HA 1PMVA 3E93A 5E7RA 4EYMA 2FVDA 4WG4A 2AYPA 4FIIA 5BVWA 3CTQA 4FV5A 4BC6A 3LPBA 5GZ8A 5IQIA 4LV5A 2XJ0A 1K9AA 4TYGA 4QMUA 1Q97A 1MP8A 3AT2A 5KCVA 4DH1A 4K77A 3VUDA 4FIJA 3PJ2A 3EFKA 4AZEA 3ZFYA 3OUKA 4E93A 1B39A 2WU6A 1KWPA 3KXXA 1KE9A 4EOOA 4FSRA 2GCDA 4FTUA 5BVNA 4O21A 5CX9A 5HBEA 3HKOA 1H00A 2I7QA 4BCGA 2NP8A 2YCFA 1YOJA 2Y4IB 4D4YA 1P2AA 1APME 4EONA 4TWNA 3QTIA 1FPUA 4FSMA 4RA5A 4X6QC 5CXZA 4B8MA 3TNPC 5HU3A 3FSKA 3RAKA 3R71A 3MH2A 3FY0A 3BU6A 4BDCA 2OJFE 3RALA 3BHUA 1UNHA 5E8VA 1V0PA 5BUJA 3PSDA 2BFXA 4M8TA 1P5EA 4QP9A 4H1JA 3E88A 4GFOA 4EKLA 3KMWA 5J79A 2Y4IC 4EK5A 2HIWA 3MS9A 2B4SB 2XF0A 3E8EA 3F88A 4YC3A 5IA1A 3AXWA 4X2NA 3UO5A 1Q61A 2HY81 2OH4A 1GOLA 3MVJA 3Q9WA 2C3IB 3HV6A 4LOQA 3LQ5A 4U42A 4IVDA 4GG5A 4X2JA 2YABA 3DS6A 1V0OA 1ZZ2A 4NJ3A 3F6XA 3ZLSA 2OU7A 3BYUA 4R5SA 3WF7A 5JK3A 3V8WA 5DHJA 3PVGA 4BCJA 5DE2A 4NFNA 4XG7A 4DEAA 1JNKA 3COKA 4IANA 2QOBA 5IMXA 4D4VA 2W0JA 5BUEA 3NZ0A 5IA0A 1YQJA 3F82A 2C6OA 5CI6A 4DEDA 3LMGA 4JBVA 1IA9A 4E73A 3ACJA 3ZM4A 2F49A 2JD5A 3GCQA 2Z7RA 4JL9A 4A4LA 5BQ0A 4O7ZA 4BCPA 2G2FA 3UVPA 4FKQA 4X6RA 2IVSA 3EIDA 4ZTNA 2UZUE 5AUTA 4B8LA 3HDMA 1BYGA 4GG7A 1O9UA 5M08A 5AM6A 4UEUA 3U9NA 5IU2A 1KOBA 3MIYA 2GDOA 2C30A 3A2CA 4JS8A 2JKKA 3K2LA 4D0WA 2OF2A 4G3DA 3LLAA 3ZYAA 3F3ZA 4D1XA 1DAYA 2PY3A 3PFQA 3ALNA 3Q2JA 2ITXA 4G34A 4FSZA 3GXLA 4HVIA 4AOIA 1ZRZA 3GT8A 4QTDA 5G1XA 3WF8A 3C4CA 4Z7HA 5J5TA 2ITYA 4FSWA 1BLXA 3DKCA 4IWPA 2HOGA 5IEVA 2J0LA 2FB8A 3TUCA 4FYOA 2ZJWA 3OWKA 4E8AA 1JWHA 3K3JA 3Q6UA 4O86A 4JDKA 5HICA 3GU8A 1MQ4A 3QD4A 4Z16A 5I9ZA 4YUQA 4UV0A 3WF5A 3DPKA 4B9DA 4DEGA 5E91A 2WIPA 4RIOA 3HA8A 1PMEA 4QTAA 4C0TA 3FI2A 1XKKA 2UW9A 3PJ3A 3SD0A 5EQYA 4U3YA 2OSCA 2OJ9A 1M7QA 4G3EA 4CT1A 2CNQA 4FV8A 2XK9A 2X8IA 5I9YA 5L6PA 5EW8A 3FJQE 3EQDA 5EI6A 5AFVA 2UW4A 1SVHA 4MAOA 4FT9A 5EKOA 1ZOEA 4CNHA 4CFUA 2FO0A 2GS2A 3W2SA 4RIYA 3RVGA 4CG8A 5DN3A 4TXCA 4JOAA 5A46A 3UOJA 4J1RA 2UZVA 2UVXA 3DK3A 4ZY4A 4JIKA 1DM2A 2C0IA 1M17A 2JAMA 5AUVA 4AFEA 4AW1A 1RDQE 4C4HA 3KCKA 3R21A 2I0HA 5HNBA 2B55A 3JPVA 4KIOA 2WMBA 1Q5KA 3V5TA 5CVGA 3OOMA 4AA0A 3IOKA 3R0TA 2I0YA 1WAKA 3CBLA 2UZEA 4RWKA 1U54B 2NRYA 4X2FA 4AZSA 4N6ZA 4QP2A 4JDJA 3PJ8A 4IJ9A 4I21A 4XRJA 3RPSA 1YHVA 2BDWA 3CIKA 3QRIA 4MNEA 5CU3A 3ROCA 3KQ7A 1H1WA 3N4VA 4RFYA 3ORLA 3POZA 4BHZA 4ZLYA 4WG3A 4N0SA 5HGIA 1GZOA 5J9ZA 4WNKA 3RAWA 4F9AA 3DT1A 4BKYA 3AGMA 3PXRA 1CKPA 2W1CA 3KU2A 2BRMA 3T9TA 3BYSA 2Z7LA 1OKWA 3MA3A 3PA4A 3PPJA 4AN3A 2ERZE 5F94A 1OL5A 3EFJA 3VJOA 2X4ZA 4FKLA 3IOPA 1DAWA 3DBEA 4BWPA 4RFMA 5CAQA 3R28A 4DFYA 4EK4A 1H4LA 3S00A 3UPZA 1WBSA 3EN4A 5AADA 3OCGA 4DFLA 4M3QA 3GFEA 3QFVA 2XK7A 5E8TA 4TY1A 1E9HA 1ERKA 4KB8A 5ICPA 4ZTSA 5L2TA 2J0KA 4FSYA 4F1OA 3C0IA 5HG7A 3VBWA 2W05A 2C0TA 4DGMA 5F95A 3FXZA 4Y85A 3I0OA 4CV8A 4EI4A 3HA6A 3BQRA 3R63A 3FI8A 3QGYA 4G5JA 3UO4A 4XP2A 3RK9A 3CTJA 2GHMA 4HJOA 5AP4A 5AR3A 4NL0A 3UQGA 1OPJA 1REKA 2B9IA 4RSSA 4PMPA 5L2WA 1KE7A 4HNIA 4DGNA 2H9VA 2YM5A 3MB6A 2PE2A 4FTOA 2X6EA 3V3VA 3NEWA 4KINA 4J97A 3IDCA 4JLCA 3QZFA 2V7OA 2UW7A 4PL4A 4JBQA 3A62A 4TRLA 4GL9A 4E3CA 4ID7A 5AP6A 4B6LA 4KIQA 4AXAA 3V51A 5K9IA 5FQDC 4E4NA 1ND4A 5HTCA 3D7TB 1CDKA 4FIHA 1KE6A 4BCHA 3HP5A 1Y8GA 1YRPA 2BAJA 3AMAA 3IK3A 2ZV8A 3DOGA 4EHVA 2QCSA 4A06A 1IEPA 5EHOA 4HCTA 1M7NA 1Q24A 5K5XA 3HMMA 2XK6A 3GC8A 3ULZA 2R3FA 1IRKA 2WKMA 3NUYA 4XG9A 3GOPA 3QXOA 4J8MA 3O23A 3FQSA 4XG4A 4NH1A 3VNTA 2J9MA 3LMIA 3A8WA 5JH6A 3DTWA 3II5A 2V7AA 3ATTA 4YBJA 4CRLA 5A4LA 4R78A 4O7SA 4BDDA 2WNTA 1Q3DA 2CGUA 3KK9A 5I9XA 3MI9A 3OXIA 4FTIA 5DI1A 1GNGA 2VX0A 5M51A 1TQMA 2GNGA 2ETKA 3I7CA 4GJ3A 3Q53A 3W2CA 4BZDA 4YPDA 5BMMA 3HP2A 3V5PA 4GKHA 4IEBA 5L8KA 4FKTA 1YI4A 3VS1A 3RP9A 5LVLA 4IDTA 3HMNA 4W4XA 4ENYA 4MYGA 5AAGA 4C4EA 4EOLA 2C6MA 1PHKA 3FQHA 3LQ8A 3QUDA 5JGAA 1JOWB 3SOCA 2FSOX 4R77A 1W98A 4EHZA 3FMMA 2J5EA 2VTJA 4FKRA 3NRMA 4FOBA 4K6ZA 4PRJA 3RK7A 4F4PA 5IQBA 4TYIA 4Y5HA 3G90X 3UZPA 5E8ZA 3CJGA 2ZV2A 1M14A 2X1NA 4LRMA 4QQ5A 1HOWA 3EHAA 4BKZA 5BX0A 5IQGA 1URWA 3QQKA 3UO6A 4WG5A 2W4OA 3RTPA 4RVKA 2XYUA 2C69A 3R30A 4ZK5A 2O8YA 4O91A 3MGYA 2CKQA 1AQ1A 2ZB0A 1YI3A 3Q60A 3UOKA 1JSUA 4NFMA 4GJ2A 5HNGA 1ZYDA 3GGFA 4FSNA 3MPAA 2OWBA 4JRVA 4BIBA 4KWPA 4BRXA 4IFGA 4KRCA 3QTUA 5LVOA 3MH0A 4RG0A 4YZDA 2JIIA 3TZMA 4X3FC 4BHNA 3ZO2A 3KXNA 5ETAA 3KRXA 3Q4TA 4D2WA 5LMKA 2R2PA 4G6LA 4YJPA 3ZUTA 4BCOA 4O0SA 4M84A 4NCTA 3FQEA 3DJ6A 4J99A 1UNLA 3QTZA 4JQ7A 2C1BA 3IDPA 4IAKA 5AX3A 4NSTA 3NW5A 3GU7A 2OIBA 3LFNA 1S9JA 2UZDA 2YJSA 2PYWA 2IO6A 3FLSA 4NM7A 5M4CA 5CF8A 2WEIA 4MHAA 4ZSJA 3QQLA 4JAJA 3FPMA 4I5CA 4XOZA 2VTTA 4YTFA 4J8NA 2F2CB 3O51A 3R8UA 4AG8A 4U44A 4IAIA 5B2LA 2B9FA 4U6RA 2IWIA 5CU4A 1VZOA 3R9RA 4RX7A 3F5UA 4KBKA 3W2RA 4AOJA 2OJIA 4QTEA 3RNIA 3E8CA 4LRJA 4PTGA 4AU8A 3D5UA 4FV9A 4PL5A 3D94A 4Z9LA 2RGPA 4XRLA 4RGJA 3O8UA 4FA2A 3Q3BA 2VTIA 3CY3A 4IZAA 4S32A 4OAVB 2CMWA 2C68A 3LXLA 4GK4A 1QPEA 1PW2A 3VHKA 4F6WA 3CPCA 1XWSA 4JVGA 3EN5A 2NPQA 2GFCA 3R6XA 4V0GB 2X7FA 3HRCA 1OI9A 3QKKA 4LOOA 4R6VA 2PVHA 3PXQA 4A9RA 1WVWA 4C35A 5F1ZA 1EH4A 3L8XA 5ANOA 5DGZA 4H3QA 2GNLA 3FE3A 4IFCA 5KHXA 3KXZA 3MFUA 2WQMA 2Q0BA 4G3FA 4UALA 4Y5QA 2PVYA 3JUHA 3O71A 5LCJA 4CYIA 4LGHA 4DGOA 3MH3A 2O65A 4F08A 2PUIA 3DXPA 3JVSA 4DFUA 4I4EA 2WQOA 4M69B 3ZC6A 4D5KA 4BBFA 4ZLOA 2E9OA 2R3JA 2YAKA 4ZIMA 2UZTA 3K3IA 3FZOA 4IZ5A 4FTJA 3NW7A 5D7VA 4S33A 5DWRA 4E20A 3P79A 4NYEA 4L45A 4YLJA 5IUGA 5KMLA 4KKEA 2UZNA 1UWJA 5LVMA 4PF4A 3VS3A 4AA5A 3U6JA 4F63A 2CPKE 2DQ7X 4GT3A 3BX5A 2UZLA 2XIZA 4U41A 3HV4A 5EDPA 5L8JA 2ITPA 4IB5A 3C1XA 1UU7A 1H07A 3ZHPC 5HIEA 4FV4A 4USDA 1UV5A 5JRSA 4LM5A 3W55A 4P5QA 5FTQA 4EWHA 3RCDA 4E5AX 1GZKA 5ANJA 4G6NA 3BQCA 4OAUC 4ZY5A 3SX9A 1R1WA 2XP2A 4IE9A 2YHVA 3EB0A 2HZIA 3QXPA 3NAXA 3ULIA 4CZYB 2OZAB 2C6DA 2R3NA 3RM6A 4D2VA 3LKMA 4W8EA 3BKBA 1Q8TA 5J8IA 3CGOA 3H9RA 3NLBA 1J7LA 4TYEA 4JT3A 2RG6A 2X8EA 3BBWA 3FV8A 4HYHA 4ACGA 2PMNX 4IVCA 3DK7A 4F99A 4HOKA 5HLPA 3FLQA 3PIYA 4M66A 4PPAA 5HVYA 3LCOA 3LJ1A 2FYSA 1WCCA 3E87A 5AUYA 2WTVA 3DQXA 5CWZA 1W8CA 3PPKA 4L42A 4OTDA 3R01A 2PULA 4I6BA 4C37A 2ITQA 4XG6A 3IS5A 3RPOA 5BNJA 5HLNA 5HTBA 4O7LA 2OJGA 2UVYA 3I1AA 4IWQA 3KA0A 2IJMA 4QPSA 3JVRA 4RJ7A 1H26A 1IA8A 3D2KA 4Q2AA 1GIJA 2RF9A 4U3ZA 4XLIA 2XRWA 3ZXTA 2VO0A 2X39A 4I41A 1QPDA 2OF4A 4FTKA 3TZ9A 4C36A 3L1SA 4FTLA 5DFPA 3TZ8A 5LQFA 2IZTA 3C9WA 2ERKA 3AD6A 4FT0A 2P4IA 3MYGA 3NYXA 1SYKA 5ETFA 2UV2A 1OL2A 3TZ7A 3WOWA 4WSQA 4FKVA 5C8MA 3R00A 4HVGA 2ZB1A 2YM4A 3WZJA 3VUKA 3L9PA 2VTHA 2BRHA 3VUTA 1Y8YA 2BTSA 3LW0A 3U51A 3UNKA 5JFXA 3O8PA 4PDPA 3W1FA 4FNYA 4GIHA 5BPYA 3VBXA 4FT5A 4CLIA 4IB0A 4YPSA 4N6YA 4O81A 5IA3A 4XNEA 1QPCA 3R8ZA 1H8FA 2PVFA 3TUBA 2G01A 1U54A 2XKFA 3F66A 3OTVA 4UZHA 4DFBA 2WXVA 2WPAA 3MDYA 4HGTA 4ZS4A 2EU9A 3U4UA 4F09A 4KIKB 4DT9A 4WIHA 5AR8A 4AZVA 4TL0A 1Q3WA 2XNOA 2R7IA 3F5XA 4O0XA 5BUIA 3JS2A 4IWOA 4ASDA 3G5DA 1J7IA 2Q83A 4OTIA 4Y72A 5HBHA 2HWOA 4ENXA 5CAUA 4FEUA 2JLDA 3T9IA 5IEYA 4R7IA 3PE1A 1J3HA 2EWAA 3HRFA 4UMPA 3F3UA 5E9EA 2EB3A 1FMKA 2XNPA 4XS2A 1G8SA 4EK6A 3SKCA 4CYJA 2VTSA 5FLFA 5J1VA 3NCZA 4DEIA 4UX9A 4CMUA 3CD8A 5HEZA 2FSLX 4FKSA 2I6LA 2XMYA 4RLLA 5CNNA 3CD3A 4FZFB 2R3LA 3FMJA 4F7LA 3DJ5A 4ZJVA 4GYGA 2GNIA 5FBNC 3FL5A 4EQMA 2XJ1A 1ZYLA 4BDJA 3UG1A 2X7GA 3EQRA 4PMSA 4FZ6A 5LARA 3OVVA 5C4KA 5M44A 4XMOA 3FWQA 3GOKA 5HKMA 5CXHA 3D5WA 5A4QA 5I9VA 2KTYA 3F5GA 1ATPE 4IC7A 4RWLA 4CFXA 3F3TA 4O27B 3ZONA 2PVNA 3P4KA 3FMKA 3IECA 2GS7A 5KX8A 2BZHB 3W2QA 4PNIA 5I3RA 5E8XA 3ORTA 3UIXA 4F9CA 3EZVA 4FVQA 2PZYA 5CAOA 2ZDUA 3A8XA 2JFMA 4JDHA 2ZYBA 1BI7A 4YJQA 3PA5A 4IC8A 1MRVA 4A9SA 2G15A 3QWKA 5FP5A 2BFYA 3FZTA 3V5LA 4RZWA 5K4JA 4IADA 5IZFA 2EUFB 2BALA 4U5JA 5G6VA 4BDGA 5JFWA 4DE4A 2VTLA 1U5QA 2PMIA 4FIFA 3ZLYA 2FA2A 3LM0A 4FSQA 4DEHA 5LWMA 2PVKA 2DS1A 5IA5A 3W2OA 3D7TA 4PWNA 3VULA 4C4IA 3F7ZA 3OWJA 4EZ5A 4P7EA 4XLVA 5AJQA 3F7WA 4V01A 5J9LA 5IQEA 2VO3A 1W84A 4YHTA 3G51A 3TT0A 4BL1A 1OKVA 3F61A 1OL1A 2H34A 3DBQA 2XBJA 3KB7A 4U7ZA 4A07A 4BGQA 4F9YA 2VWVA 4CT2A 5CAVA 2W99B 4OUCA 3QU0A 3EKNA 5M55A 5ANEA 3PTGA 4S34A 1ZZLA 5CANA 4O38A 4E4LA 2BTRA 3QAME 2Y8OA 5E8UA 2YJRA 3LXKA 3MB7A 4MXCA 3W8LA 2WIHA 1IAHA 3E3BX 5KHWA 1OPLA 3ORXA 4D28A 3ZTXA 4APPA 3RAIA 5LOHA 1YI6A 3AC1A 1PYXA 5KBQA 1J91A 3N4TA 4RJ3A 4MCVA 4CMTA 5DMZA 5EI2A 5A3XA 4DCAA 4GEOA 2GQGA 4YJRA 3ZRKA 2WOUA 2XKCA 4MXAA 3PXYA 4PMTA 5EYDA 4BFMA 5M09A 4B7TA 4ZSAA 2PMOX 4WSYA 3FC1X 5EYKA 3KFAA 3DA6A 4HGLA 4FZAB 4X3FA 3RWPA 2CDZA 3S3IA 3BIZA 4EOIA 4AN2A 2QR7A 4FKWA 4PMMA 4HGSA 5EH0A 3QKMA 3RPYA 1PF8A 4FI1A 2IZSA 1GZ8A 2QONA 3A4PA 3QL8A 3ODZX 2UW3A 4YJTA 4M0YA 3MH1A 5T68A 2CKEA 1OBGA 5ANKA 2PVMA 4RZVA 5HG9A 2VWXA 3NNVA 1OB3A 3BHYA 4FL2A 4QYEA 4B0GA 2GNHA 3EQPA 3M2WA 5D11A 4O6LA 1O6KA 2H96A 1M2RA 4L52A 4APCA 1YXUA 3QHRA 3UVRA 2BZIB 3LJ0A 4YC6A 4ZZOA 1IR3A 5HX8A 5I4NA 1H1RA 5C03A 2BIKB 3PIXA 2GHGA 5M4UA 1JQHA 3QF9A 3UBDA 2VD5A 1WBPA 3M11A 3CQWA 4O0WA 1XQZA 1TVOA 3BLQA 4JG8A 1MUOA 1Z5MA 2J2IB 2ITVA 2JGZA 3DNDA 3RBWA 2W5AA 1LP4A 5EG3A 5BYZA 2C3LA 4FGRA 2BRBA 2IW6A 2PZ5A 3PP0A 1SNXA 4L3LA 3ZFMA 5J7HA 5DPVA 5CVHA 4CEGA 2PZRA 3BELA 3NUXA 4RPVA 2BVAA 1SM2A 2LAVA 3V8TA 2XK8A 5HZNA 4UMTA 4JRNA 3OY1A 4UY9A 3DZQA 5CSXA 2O3PA 3UNJA 5JFSA 3DAEA 4G9CA 5BYYA 5HG5A 4FEQA 2UZOA 4CTCA 2R3QA 3U87A 4HVDA 3BYVA 1YWRA 2QU6A 4RFZA 4WUNA 2Z60A 4FTQA 1Q8ZA 4IM2A 3ZO4A 4UYAA 5LJJA 1NA7A 5LMBA 1WBVA 3R7IA 5KMKA 3TTJA 4DN5A 1BX6A 3RHXA 4EUTA 5DIAA 3DAKA 1CTPE 4G17A 4TWPA 5AV4A 5ANDA 2W4JA 2HAKA 3RJCA 5BVFA 4OTWA 3KVXA 3GC0A 3I81A 1Y57A 2ZOQA 4RC2A 3EQGA 4C2WA 3DLSA 2BRGA 3ROYA 4I6HA 3H0YA 4V0GA 3FL4A 4FTRA 4A4XA 5CI7A 2XH5A 4XBRA 1I09A 3RMFA 3NYNA 4I1ZA 3VRZA 4MQ1A 3SA0A 2IZUA 4G9RA 5HU9A 2YIQA 5EK7A 3TUDA 3UZTA 3C4XA 4AGWA 3PXZA 4OT6A 4GFMA 3OBGA 2J0JA 4AZWA 2F7ZE 4X7QA 3OF0A 2PK9A 4ITJA 3RK5A 2YLEA 3TV7A 4D5HA 3OG7A 5DR2A 4KD1A 2J6MA 4RBLA 2VTMA 4ANLA 4AOTA 1OL6A 2GHLA 4OBPA 3GI3A 1FOTA 1XO2B 2OFVA 4GK2A 3P0MA 2B53A 3TKUA 2HZ0A 4MQ2A 2WMUA 2BRNA 3E62A 3C50A 3VBYA 4J52A 3FLZA 4HGEA 2IZRA 3IG7A 3PE2A 4O0YA 5FG8A 2R3RA 5AP5A 4XH6A 4EH9A 1FINA 3EZRA 4ZZNA 3NUAA 2XK3A 4O0VA 3QYWA 5DG5A 4F7SA 3QGWA 3BHVA 3PYYA 4C33A 2C5OA 2J0MB 5B2KA 3O8TA 5EKNA 2E9PA 2WMXA 2QC6A 2F4JA 3DKGA 3H10A 1SMHA 1ZMWA 2XBAA 2YLFA 5D9HA 4ZMEA 3IDBA 2YDKA 3OXTA 4K2RA 2XJ2A 2X9FA 4YJVA 2C5XA 4FKPA 4NW6A 1V1KA 2Z7QA 4U0IA 3EWHA 4BDFA 1XH6A 2FSTX 3GFWA 3FXXA 2QOCA 4EUUA 5HNIX 3VS7A 4RJ8A 3F2AA 5CF4A 1JKSA 3FBVA 4L53A 2AC5A 2RG5A 5IUHA 1YWVA 3PJ1A 4U79A 5FRIA 2J51A 5M53A 3QTQA 4BIDA 3IW8A 2OZAA 4EL9A 1OMWA 4UYNA 3PG3A 1O6LA 4RC3A 3VC4A 3G0FA 5AAFA 3ZC5A 1QMZA 3OOGA 5GZAA 3P86A 1GIIA 1OIRA 2CNVA 3R7EA 3NR9A 4YLLA 4JI9A 2WFYA 1ZMUA 2Z8CA 1OUYA 2CLQA 3D5XA 3P5KA 3A7IA 3MPTA 3FDNA 4R1YA 3PJCA 4AWIA 2C4GA 4RT7A 4O0TA 2VTNA 3FY2A 3NDMA 4CLJA 2PTKA 1OM1A 4I0SA 2IW8A 3T3UA 3ZXZA 1PMNA 2YM7A 5HORA 3DK6A 3L8SA 4O22A 2C0OA 4IJPA 4KKGA 3QD2B 4XP0A 3Q4CA 3D0EA 3TKIA 4UBAA 4YJSA 3LMHA 3QC4A 3FI3A 3NW6A 4DYMA 3K5UA 3M42A 4BTKA 5JGBA 1H08A 4AZTA 4PTEA 4EZ3A 3S2PA 2A27A 2GMXA 2VTQA 4ITIA 4EOMA 3OCSA 2G2IA 2PHKA 3G33A 3DGKA 2P3GX 5FM2A 4CZUA 5HOAA 1ZOGA 2YM3A 5FDXA 5I9WA 3U55A 3TNQB 2WQEA 5JEBA 4S2ZA 3LE6A 3Q9ZA 4NWMA 2BPMA 1F5QA 1LUFA 4MD7E 5CTPA 3W33A 2UVZA 2RIOA 3BCEA 3DV3A 3ZBFA 5IDNA 4ZLZA 2ITOA 3HV5A 1WVYA 3B8QA 4MD8E 4XG8A 4USFA 4ACDA 2CJMA 2VWBA 4L67A 4IHPA 3OW4A 3MVLA 2HXQA 4EH8A 3CLYA 3Q4ZA 2ITUA 2OIDA 4AP7A 4NM5A 3SOAA 5EI8A 4KIKA 4P5ZA 3PDTA 4I5HA 2QHNA 5EW9A 2XNMA 4C4JA 1JLUE 4PTCA 3EN7A 1K3AA 1M52A 3HL7A 5A54A 1E1VA 3NSZA 4FZ7A 4WOVA 4U9AA 3U54A 1XBAA 5K3YA 3ORNA 3D15A 4EC9A 4O7TA 3OTUA 3VBVA 3IQ7A 4FEXA 4D9TA 3QTXA 4FODA 4YSJA 5I3OA 4EK3A 2BAQA 2ITWA 2JBPA 2ZMCA 4GYIA 4IX5A 4RIWB 3A7GA 3VS0A 1TQIA 3ORPA 5CSVA 2VZ6A 1M2QA 1GIHA 1JVPP 1VEBA 3DKFA 3COIA 3NAYA 3KRJA 4X2GA 3EYHA 3VW8A 2GSFA 4C3RA 5FDPA 4DF3A 2GU8A 4P4CA 2HYYA 5AIKA 1Y6AA 1ZYJA 2ETRA 3ZOSA 3V5WA 4C2VA 2QLQA 5AP0A 4ZMFA 2YA9A 2GNFA 3R02A 3CPBA 3SXFA 2ETMA 3IGGA 4MF0A 1OIQA 4CFNA 3C4FA 3CKWA 5KMOA 4E1ZA 4U80A 3WZDA 2W1EA 4OW8A 3OD6X 4G31A 4MH7A 2QOLA 3RHKA 1WMKA 2QOFA 2ITZA 3LFAA 4AACA 4NKSA 4FL3A 3AOXA 4GS6A 2OBJA 4KS8A 2BZJA 2Z02A 4YJNA 3GU4A 3C4ZA 3MY1A 5CU2A 3R7OA 1PXPA 3TNWA 5JKGA 3OROA 3TDVA 5HCXA 1OKYA 4QMWA 4QP1A 2XNNA 3H3CA 5FXRA 2F57A 2WU7A 3IGOA 3MVHA 3VF9A 4EWQA 5ACBC 5HESA 2O2UA 2ZM4A 4CD0A 4EJ7A 2CGWA 3VUMA 3ZRLA 4PP9A 4ANOA 3UMXA 4L46A 4E4MA 4HVSA 5EM7A 3R9DA 3SLSA 4H3BA 1OZ1A 3HX4A 4U43A 2XIKA 3DZOA 5HG8A 1G8AA 4CRSA 3G2FA 5HCYA 4AGDA 3CQUA 2A19B 1FQ1B 2PWLA 3QX4A 4KBAA 5HCZA 2JC6A 3S95A 3UNZA 3VJNA 4DGGA 2I40A 4QMSA 3ZM9A 4QMPA 4GVAA 3HLLA 5HX6A 2WELA 3MV5A 4FVRA 4TWCA 2C6EA 3KRLA 1SVEA 1M2PA 4HCUA 3VS4A 3LFFA 1JKLA 4D9UA 3FHIA 2QQ7A 4JR3A 4U45A 3VUIA 4M13A 5DR6A 4U97A 3R2BA 3VS6A 4FV6A 4P2KA 2R5TA 4EHGA 4BDKA 4CMOA 5EQPA 4R3PA 1B6CB 4RJ6A 5A14A 4XUFA 3ZDUA 3R1YA 1ZAOA 3C4EA 5CF6A 4CGAA 1ZWSA 3EN6A 4EJNA 3DXNA 4JBPA 3CCNA 4QYHA 4X21A 5LVNA 3LFBA 3F3WA 4E5WA 4UXQA 4JR7A 3DAJA 5CQWA 4HVHA 2XB7A 3SXRA 2YIYA 4I4FA 4YP8A 3ZO1A 4RRVA 4WRGA 1YDSE 4FT7A 1GY3A 5E1EA 4C4GA 3NS9A 1BUHA 5E4HA 3V6RA 4TW9A 1H1PA 3KREA 2W9ZB 3UE4A 4ACHA 5A6OA 3IO7A 3MPMA 4FR4A 4XG3A 4AT5A 1YW2A 4FK6A 2ESMA 2VN9A 5BMSA 2XM8A 3PSBA 5C26A 5HHWA 3FMLA 4OBQA 3I6WA 3A7HA 3C4WA 3EOCA 4BWXA 3LCDA 4XV2A 4YZ9A 3R1NA 4WKQA 2RKUA 3V6SA 4FIGA 4I6FA 3EQHA 3PXKA 3BGPA 4FG9A 5FGKA 4DT8A 1R0EA 3L9NA 5CF5A 1ZYSA 3ZEPA 2R3GA 3QTWA 4O1PA 5C4LA 3LXPA 5HIBA 4E7WA 4IWDA 4K11A 3HAMA 2X9EA 4ZTQA 3REPA 1JSVA 2I1MA 3Q4UA 3HV7A 4ZAUA 5LWNA 3FMHA 2E9UA 4L3JA 2ZM1A 2DYLA 4I6QA 4C3PA 4KKHA 5M06A 5C1QB 4Y73A 3CTHA 3ZUVA 2GTMA 2BUJA 3GQLA 4Y46A 3LFEA 5GJDA 4A9TA 1H27A 5CEIA 2OJJA 3HYHA 5F4NA 3PXFA 2Y6MA 5AEPA 1PXKA 4IX6A 4BKJA 2YIRA 2PSQA 3EQBA 5J9YA 5KMJA 1WBNA 4CQEA 4EOPA 1UKIA 2ONLC 5EOBA 3KRWA 3KEXA 4EKKA 1HCKA 1R39A 5KMNA 1NVSA 3NWWA 4GCJA 5D41A 5LMAA 3C0GA 1GJOA 5BVEA 4D0XA 3ZMMA 2JDVA 4MXYA 5DEYA 2WEVA 3TACA 4ZSLA 4W4YA 4W9XA 4DH8A 2WTDA 3DCVA 4JG6A 4RX8A 2YZAA 5EM8A 3LCSA 5CU0A 3WYXA 2A2AA 2ACXA 2G9XA 4EH2A 2C5YA 2XKEA 3TCPA 3VRYA 3LOKA 5CZHA 3NPCA 1A48A 3CGFA 4FKJA 4CKRA 2JKQA 4L6QA 5A4EA 4NTTA 3ORMA 3EKKA 4TZRA 3VW6A 1NY3A 4E6DA 2IVVA 4GU6A 4BVUA 4QYGA 5CEOA 1Y6BA 3BLHA 1NW1A 4KUJA 4F0GA 4Y8DA 4FF8A 4RWIA 4X0MA 2GS6A 3KULB 4KAOA 3W32A 2Q0NA 3VS5A 2VWWA 3DBCA 3LCKA 4IAAA 3SV0A 4ZTLA 2XUUA 1Z9XA 3O50A 1ZMVA 3C7QA 4C58A 3ATSA 5IH6A 4Q5EA 4YZNA 4QT1A 3PRFA 3ALOA 4FMQA 4I22A 4DINA 3QUPA 5HE1A 3DBDA 4LL0A 1DI8A 2EXCX 2XNBA 1W83A 1YDRE 3BWJA 3FSFA 3QLGA 4Z55A 4C57A 5IMEA 5DEWA 4V04A 1Y91A 2C5NA 2B9HA 4FK3A 4IB1A 4MVFA 5CVFA 3VUGA 1OL7A 5E8SA 1FBNA 3LAUA 2BILB 3RINA 1PXOA 3H30A 3IW6A 4IIRA 4KABA 4QQCA 3HVCA 5EYMA 4AT4A 4C61A 4OTQA 2QVSE 2QO7A 3HUCA 1GAGA 1R3CA 3UP7A 4B99A 4F9WA 3QLFA 4IH8A 1CMKE 4ASXA 3A7JA 5TE0A 3PWDA 4DHFA 4MXOA 4PY1A 5D1JA 2QURA 4FNZA 2NO3A 3TDWA 2YIXA 1ZARA 5AP1A 1FVVA 3QX2A 5ETIA 3MY5A 4LQMA 4WD5A 3LCTA 4EH5A 5CT7A 4DH7A 2QKRA 3KRRA 3CEKA 2QOOA 5C01A 1YHSA 2X6DA 3MSSA 4U40A 3U4WA 4WHZA 4O7RA 3SG8A 3R04A 4RIXB 1PRYA 2BDFA 1VYWA 2HW7A 4QMZA 2G1TA 4YNEA 1WFCA 3DB6A 3PUPA 1SVGA 3RKBA 3ZCLA 3EFWA 3ZZWA 4FV0A 3RPRA 3SC1A 2V5QA 4QMNA 3F3VA 3CJFA 3OUNB 4A7CA 2XIXA 4L01A 4C62A 3FXWA 4QMLA 2QO2A 2W1DA 2WTIA 4QYFA 4BGGA 1CSNA 5KE0A 4JJRA 5GZ9A 1MRUA 4XHKB 4H58A 3ID6C 2R7BA 5IQCA 2B7AA 2X81A 3MJ1A 3AMBA 3ODYX 4M97A 4CFMA 5IISA 4PX6A 2A1AB 2HELA 1UVRA 2Z2WA 2Y0AA 4GT4A 3A4OX 4QP4A 3I5ZA 4I93A 3FC2A 5FTGA 1CKIA 1VYZA 2B54A 3BV3A 5FTOA 3P1AA 3KKVA 3QALE 2QHMA 4UZDA 4NEUA 4M0ZA 3IONA 5D12A 3ZS5A 5ITAA 4FT3A 3AC3A 3BEAA 5IEXA 3BEGA 5M4FA 4YC8A 3THBA 4XP3A 2OO8X 1VJYA 2XNEA 1R78A 1YHWA 2VV9A 3AC8A 5M56A 2YWVA 3QA8A 3RNYA 4JNWA 1KOAA 3OC1A 3R1QA 3RAHA 4ITHA 2QD9A 2YAAA 5AP2A 4ACMA 5DRBA 4AS0A 5DR9A 4GIIA 4OTRA 3TL8A 5CASA 4M68A 4RC4A 5CU6A 5E8WA 3R8PA 2W4KA 3JR1A 2XZSA 5AM7A 1XR1A 4YLKA 5EOLA 4L44A 2XRUA 3ORKA 3RZBA 2Y7JA 4DH3A 5F9EA 1J7UA 4GKIA 1CKJA 4R1VA 5LVPA 2UUEA 4GRBA 2B9JA 1LPUA 2RFNA 4I5MA 4ERKA 4G6OA 4HYIA 3KXHA 4GFGA 2JDOA 2JKMA 4W4WA 4L7FA 5CQUA 3CSVA 5IQHA 3LZBA 3FZRA 5CSHA 4GU9A 3ZLXA 4TWOA 3GCPA 4KNBA 3C5IA 5FD2A 3TJDA 3BU5A 4QD6A 4DLIA 3BPRA 4XBUA 3SQQA 4WNOA 4BTJA 1OBDA 3R9OA 3QCXA 3RPVA 3UODA 3W2PA 3TNHA 4MWIA 2BAKA 3QRUA 4O7VA 4BDAA 2YWPA 2X7OA 3VS2A 3D7ZA 2ITNA 3L9MA 3BGZA 4PDOA 4C34A 5TO8A 4G1WA 4ALVA 2P55A 2YIWA 4R7BA 4O0RA 4P90A 3UOLA 2PZIA 3E63A 4IVBA 4RQKA 4AGCA 5EFQA 4FL1A 4RIWA 3PA3A 5A4CA 2OZOA 4BDBA 1LEWA 5JT2A 2P2HA 3WBLA 3KGAA 4ALUA 4H1MA 4IQ6A 4AN9A 2BIYA 3CP9A 3QQGA 4NUSA 4FV1A 4B4LA 2EVAA 3FEGA 3P9JA 5CZIA 4YNOA 2Z7SA 2W5HA 4QTCA 3VIDA 4FV3A 5KKRB 2NNWB 1KV1A 4O7YA 3PZEA 4FICA 5CEMA 5AV2A 5DT4A 2E2BA 1RJBA 3LHJA 5F20A 1URCA 4RVMA 2VTRA 5C27A 4FEVA 1KUTA 4FUYA 2XNGA 1UU9A 4Q9ZA 3NNWA 2GFSA 3BYOA 4ZSEA 3K54A 2VGOA 1BKXA 1REJA 2REIA 4ZSGA 2J90A 4FIEA 2CNUA 4YTIA 1AGWA 5KKRC 5ACKA 2WQBA 2XS0A 5FXSA 2QOKA 1LR4A 2XK4A 2YITA 3OW3A 4MKCA 3SDJA 4BCQA 4YTCA 3HAVA 4CG9A 5IDPA 3UMWA 3NNXA 5AAEA 3MBLA 4JDIA 3DB8A 3GU5A 3MFTA 4FC0A 2WMVA 2YCSA 3POOA 3WIGA 4ZJIA 4FNWA 4O2PA 4LG4A 2QLUA 2UZWE 3JXWA 5C9CA 4RWJA 3TKHA 5TT7A 2XCKA 4J71A 3OS3A 3VWAA 4H36A 4IX3A 4YJUA 5HBJA 5B2MA 5FXQA 5AV3A 3CQEA 3SHEA 3E5AA 2XM9A 5J5SA 4BCKA 4MBLA 4IMYA 1H0VA 3KN5A 1KSWA 1OECA 2JAVA 4GUBA 3T3VA 2IN6A 3GBZA 4D55A 3FZ1A 2PUNA 1YKRA 3EH9A 4OBOA 4PPBA 4YR8A 3KF7A 5DOSA 3B2WA 1H0WA 1VR2A 3WILA 3LFQA 3T8OA 3TTIA 3QQFA 2XEYA 3DFAA 3GEQA 5HO8A 3E8NA 1FVRA 3TI1A 4DG0E 5HE3A 5FWKK 5CEQA 2O5KA 2QG5A 3L8VA 3QTSA 1ZYCA 2HZ4A 4PV0A 3R7YA 3OP5A 4FSUA 2VX3A 5EHYA 4FG7A 3HMIA 2X2KA 1LEZA 2XVDA 2VNWA 3I6UA 4FKGA 3NX8A 4IZ7A 4WRSA 4K1BA 5AR4A 3FMNA 5AWMA 4D2SA 4AZFA 4FTTA 4H05A 4QP6A 3ZSHA 3N4UA 4ZJJA 3CR0A 3KMMA 4QP3A 2XIRA 2VUWA 4FTMA 4M67A 3MW1A 3UGCA 2C3JA 5LMKC 3NUUA 4PNKA 4BI0A 4AW0A 5LCKA 4IACA 2QI8A 3EN9A 2OH0E 1H25A 2OG8A 5BVKA 4D2PA 5IG1A 2QOIA 4XEYA 5GINE 3Q96A 1NT2A 3ANRA 3W16A 4FVPA 1K2PA 5L6WL 2EB2A 3ORZA 3Q9YA 4F64A 2W1HA 2B52A 1Q8YA 2Y4PA 4EORA 5A4TA 5KUPA 2JIVA 4L68A 3L8PA 3DY7A 4J53A 3I7BA 3UJGA 2ONLA 4MTAA 4ZS0A 5FUTA 3V04A 4PDSA 3H9FA 3QUEA 4R8QA 4BICA 1OVEA 3BE9A 3O17A 2UW0A 5GHVA 3I5NA 2CKPA 3HMPA 3COMA 4MD9E 3ITZA 3ZRMA 4ACCA 4WBBB 4ARKA 3GVUA 3VO3A 4U81A 4IW0A 4BYJA 4IX4A 1V0BA 3FYKX 1TQPA 3TWJA 5M4IA 4EOQA 3VBQA 3SRVB 2HWPA 4HZSA 1YVJA 4WT6A 1R0PA 1T46A 1WBWA 1YOLA 3EJ1A 4L43A 5TR6A 3MFSA 2W1FA 4GV1A 4K33A 4CCBA 5IH5A 5KBRA 2CN5A 1PXNA 3OBJA 3Q52A 4G5PA 3FZSA 4UWBA 1YXSA 3BWFA 1PXIA 2R3PA 5EM5A 4CVAA 5J1WA 4DGLC 4JX7A 2PVRA 2JIUA 4IZYA 4ZP5A 3QBNA 3ENHA 4CXAA 3OXZA 3UOHA 3NNUA 4QMOA 4ZOGA 4CKJA 4F9BA 3QD3A 3MY0A 3DDQA 4ALWA 2AC3A 4BCMA 1L8TA 3AC2A 1AD5A 4C8BA 4R3RA 4JAIA 4IM3A 4AUAA 3R83A 3VVHA 2IPXA 3SW4A 3KULA 5KO1A 5FBOA 2QOQA 1F0QA 4M69A 3P78A 3UC3A 3TNIA 3ZUUA 4NM3A 1UU8A 2J5FA 2W96B 3D2IA 3VHEA 4G2FA 3OHTA 5E8YA 5HD7A 3R1SA 4LGGA 2YEXA 3JYAA 5DT0A 4FTCA 5K5NA 3JY0A 5CT0A 3LFCA 3BHHA 4LL5A 4W9WA 4Y95A 4BTMA 4FV7A 4EC8A 3NMUF 2B1PA 1WVXA 3QZHA 2FSMX 4DCEA 2PVJA 5T6KA 2QO9A 3MTLA 1U4DA 4OT5A 3IW5A 4TPTA 3S4QA 5TKDA 4PL3A 1F3MC 2A4LA 1XBCA 5AIRA 4ZTRA 5IA2A 4V05A 2VWUA 4UXLA 1Q8WA 3TV6A 2CHLA 4UWCA 3WI6A 2VRXA 2C1AA 4DLJA 4QNYA 1B38A 2C6TA 1A06A 1JPAA 2XA4A 3C0HA 2CGVA 3FLYA 4UN0C 4FE2A 4DTBA 2FH9A 5IUIA 3GB2A 4BZNA 3KXGA 3MWUA 2R3KA 3V01A 2JITA 4OTFA 2OKRA 2R3OA 4CTBA 4UMQA 3GCUA 4GW8A 4YJOA 3ERKA 2CCHA 3ZO3A 3FLNC 4JG7A 5AV1A 1KE8A 4IXPA 3DU8A 3LM5A 2GPHA 3AD4A 5M57A 2HENA 2PZPA 2WOTA 3BLRA 3MA6A 4XJ0A 4WA9A 4RIXA 1JAMA 5CSWA 3TN8A 4FKIA 1BL6A 1W82A 2EXEA 4J7BA 4PUZA 5J95A 4D4SA 4I24A 3W8QA 3H0ZA 4LRKA 3O7LB 4AQCA 3HGKA 3FLWA 3U6HA 3ZSGA 2R9SA 4Y83A 4YZBA 1L3RE 4FNXA 5IQAA 3R8LA 2HK5A 3EFLA 4MNFA 4MBIA 4BCIA 1OKZA 3HV3A 3LVPA 3EL7A 4M7IA 3UPXA 5T3QA 4C38A 5KMIA 3OEFX 4XCUA 4ZTHA 1YDTE 2BKKA 2J4ZA 2R64A 2HXLA 4WNMA 4QMYA 4TYHB 2CKOA 1W7HA 2OFUA 3AGLA 5EW3A 4YMJA 4LMNA 5CNOA 3PY1A 2HZNA 4ERWA 1XH5A 3D5VA 2G2HA 3NIEA 1JKKA 1P4OA 4LMUA 1PY5A 1PYEA 2WMAA 3E7OA 4I3ZA 1OPKA 4BDEA 3FAAA 4KSPA 2ZM3A 3PIZA 4EYJA 4MK0A 3HZTA 4DG2E 4DTKA 4OR5A 1XH7A 2JDRA 3P23A 2F7EE 4LV8A 1T45A 4S31A 4YBKA 3U9CA 4Z7GA 1OITA 4K8AA 2NRUA 1OIUA 4D4RA 4EQCA 2JEDA 3HRBA 1DI9A 1QL6A 3ETAA 5DLSA 2YCQA 2PE1A 5FEDA 5CALA 3ZLWA 3DLZA 3E7VA 4E6CA 1XBBA 4DG3E 3AMYA 1P14A 3ZSIA 1FVTA 1Q62A 3CE3A 2VO7A 3ORIA 1U5RA 4QP7A 5AR7A 4AE6A 4BI2A 3S1HA 3MESA 2FUMA 4L8MA 2J50A 3TIYA 3BI6A 4YU2A 4ANSA 3VQHA 3OWPA 2EXMA 3KN6A 5AP3A 5AUXA 5GJFA 5H8EA 4FTNA 3UC4A 3UQCA 4IVAA 5EDQA 2P0CA 2VWZA 4PQNA 4TKSA 5IH4A 3GNIB 1PKDA
chains in the Genus database with same CATH superfamily
3VQUA 3BZ3A 4DFXE 3HMOA 2O64A 1G3NA 2YZLA 5IA4A 4PPCA 4BBEA 4LFIA 5GJGA 4CCUA 2GQRA 2VU3A 4GMYA 4LI5A 2O0UA 5FP6A 1GZNA 4CZTA 4A9UA 4M12A 2CSNA 3GENA 3MFRA 3N9XA 3QHWA 5HTIA 4GT5A 4AX8A 2ZDTA 3UIMA 2YDIA 1J1CA 3Q32A 3TG1A 3NCGA 3ZZEA 2WMQA 2XEZA 3ET7A 5DNRA 2Y9QA 5TOZA 1A9UA 1J1BA 3QZGA 4L9IA 5FEEA 3OT8A 2W17A 4HCVA 4BCFA 3R2YA 1JKTA 3E8DA 4NM0A 3PWYA 4KRDA 3NVMB 5DYJA 1WBOA 4F0FA 4D2RA 4O84A 1RW8A 2QODA 2PMLX 4K9YA 2OW3A 5E92A 3EQIA 4BDIA 3FKLA 2BZKB 2WHBA 3O0GA 5CENA 3SAYA 5HVKA 4YO6A 1H1QA 1UA2A 3NYVA 5BVOA 3QTRA 2ZV7A 5KMMA 4DAWA 3N51A 2F7XE 4ANBA 2BMCA 4E4XA 3UTOA 4EH4A 4TNDA 4F7NA 4FKUA 4BZOA 4RX5A 4NIFB 4NTSA 3W0RA 2BHEA 3CS9A 3OFMA 2R0IA 4BI1A 4C7TA 4CSVA 4F65A 4BWKA 3UZRA 5M07A 2X0GA 2W06A 3E3PA 3ANQA 3HECA 4IBMA 1FMOE 3MN3A 4II5A 3IW7A 2XKDA 3QRKA 4D1SA 5HQ0A 3MIAA 2C47A 1DS5A 4O1OA 2E9NA 3CY2A 4IM0A 2QU5A 3A7FA 3OWLA 4ASZA 4YTHA 3PVWA 4ASEA 1YXXA 3P7AA 4O6EA 2WB8A 4Z3VA 3LJ2A 4IB3A 3A99A 3B2TA 4UB7A 2A0CX 3ZH8A 2AUHA 4R7HA 2H6DA 1YXTA 5H8BA 4LOPA 4A4OA 3O2MA 4GK3A 5CEKA 4QRCA 1PKGA 1UU3A 4AF3A 4QTBA 2QOHA 4EBWA 3U6IA 4XG2A 1W0XC 3KCFA 3OCBA 3ZBXA 3NYOA 4FOCA 3P7CA 4O0UA 3E64A 3KC3A 2BCJA 2JBOA 2WQNA 3G9NA 3GUBA 2UZBA 2R4BA 3VN9A 3SGCA 3OEZA 4EZ7A 1OGUA 2QKWB 2YFXA 3EMGA 2OIQA 3V5JA 2JDTA 4LGDA 5EYCA 4F7JA 4N57A 4I0RA 2UW6A 1QCFA 2AQXA 4JXFA 2HY0A 4FYNA 3Q04A 4R5YA 3WARA 1G5SA 4X3FB 4RJ4A 1O6YA 4BR3A 3PLAE 4I92A 2BDJA 3VF8A 4O4FA 1QPJA 2IVUA 2WAJA 5DH3A 5H3QA 5H9BA 5HE0A 4WUAA 2W1IA 5GNKA 3WZKA 4AXEA 1TZDA 2ZAZA 3QKLA 3PVUA 4XOYA 2PUUA 2J0IA 3LFSA 1WBTA 5CY3A 2DWBA 4BY9E 3GQIA 3PFYA 2VTAA 3PSCA 3HEGA 4RQVA 4K18A 5KZ0A 1SZMA 3RI1A 2QG7A 5GIPE 2HW6A 1H01A 4JX3A 1JSTA 3W18A 1YOMA 4QO9A 4EBVA 2W7XA 2WTCA 3V8SA 3Q2MA 3BU3A 5L2SA 4W8DA 1BL7A 5D7AA 3FHRA 2C3KA 4FBXA 3TV4A 4DBXA 4YURA 1XH9A 2CLXA 2P33A 2WD1A 3PY3A 4EK8A 4D2TA 1OUKA 4I5PA 2WMRA 3ACKA 3UDBA 4F70A 1BI8A 3QC9A 1IG1A 4ZXTA 2WMWA 4QMVA 3BL9A 1RQQA 3UP2A 5JN2A 3CC6A 5AV0A 3FKOA 1PJKA 3OZ6A 3CXWA 2GQSA 3F2RA 3DXQA 3QCYA 2WTKB 3Q9XA 2YACA 4DC2A 3W10A 1JBPE 2E9VA 3B8RA 4FEWA 4MXXA 3UQFA 3UIUA 4FZDB 2X4FA 2YDJA 2W1ZA 2PVLA 2C5VA 2ZVAA 3AQVA 4NJDA 3WF9A 4O7NA 3PG1A 4I0TA 4C3FA 4AW2A 1NVQA 2DUVA 2WTJA 4QMXA 4QP8A 4DEBA 1U46A 5IPJA 5IQFA 2SRCA 1Q41A 3K5VA 3MVMA 4JQ8A 5J87A 3R7VA 4EOKA 4QMQA 4O82A 4RLKA 1XJDA 2WTKC 3GC7A 3RCJA 3HUBA 4ANMA 2CCIA 4RA4A 4OTHA 3EYGA 4FUXA 4OTGA 4QOXA 3D4QA 5ANGA 1PXMA 3F69A 4RVTA 5HO6A 4IAZA 5DA3A 4GH2A 3UDTA 1Q8UA 1ZXEA 3WZUA 4HYSA 3GCVA 3HNGA 4YZMA 4J95A 5AR2A 2OI4X 2V55A 5HE2A 5EQEA 4CV9A 4RMZA 3SRVA 4YZCA 4FTAA 2VWIA 2H8HA 2R3IA 3RM7A 3V5QA 5CSPA 3PVBA 4E6AA 3ZEWA 5AR5A 3PPZA 4X2KA 2WGJA 3FPQA 1NVRA 2LGCA 4I23A 2YISA 2CGXA 3QWJA 2PE0A 3P7BA 2QNJA 3L9LA 4JQEA 5HVJA 4AE9A 1I44A 3QRTA 4WO5A 2FGIA 1U59A 1ZOHA 3FMDA 3PRIA 1YXVA 5AUWA 3R9HA 3UVQA 5I5ZA 4RX9A 3Q6WA 1PMUA 4AAAA 5E90A 1MRYA 3QA0A 5K0KA 5DT3A 3WZEA 4XX9A 5DRDA 4HYUA 4EH6A 3I4BA 2IVTA 2Y6OA 2W1GA 4XYFA 3RWQA 3H9OA 4J98A 2ITTA 5I0BA 5JQ8A 3ELJA 4ZZMA 3QD0A 5L4QA 4GUEA 4R3CA 5JZNA 3P08A 3NFFB 4CQGA 2JDSA 4L7SA 4JBOA 4BBMA 3LXNA 4ORKA 3SG9A 3NVKI 3C51A 5JSMA 4W4VA 1FGIA 5EM6A 5L2QA 5TF9A 4NK9A 3OT3A 2V0DA 2VAGA 3GC9A 4I94A 3G15A 4DFNA 1ZY4A 5CAPA 5KNJA 2J7TA 3PLSA 3TIZA 2PU8A 4O2ZA 3U8WA 4XV9A 4DITA 4AXFA 5DBXA 3M1SA 5JFVA 4MEDA 3FKNA 2WO6A 3EQFA 3FUPA 4N4SA 4FG8A 5AUZA 4MX9A 1H24A 2VNYA 2RFDA 3C5UA 3I0QA 4D1ZA 4RIYB 1XH4A 3A61A 4AA4A 2F9GA 3SVVA 4OTPA 5EHLA 3KY2A 3FYJX 5HO7A 3A60A 5AMNA 2C6IA 2VWYA 5CLPA 3I60A 4BDHA 5C8NA 2BHHA 3MJ2A 1Q4LA 2RFSA 3EQCA 3KXMA 4D58A 4QQTA 3AC4A 4S30A 5HD4A 3IPHA 3AKJA 2P2IA 1E1XA 3ZDIA 2WZJA 4MBJA 3G6GA 1PXLA 4MNEB 3TM0A 2X2LA 2RFEA 2HCKA 3CKXA 3QCSA 4C4FA 4EEVA 4EHEA 2YERA 3BGQA 5K4IA 3NUNA 5IF1A 4BTFA 4TT7A 4DEEA 2VGPA 3LIJA 5AX9A 3R22A 1PXJA 2ZMDA 4M14A 2OK1A 2VO6A 4BF2A 1BMKA 4NKAA 4K0YA 3JY9A 4GVJA 3COHA 5B7VA 4UMUA 3KK8A 3NUSA 3EL8A 2YN8A 4FSTA 4TYHA 4DTAA 4F1TA 5CS6A 3GU6A 4LYNA 4DBNA 4M15A 4IAYA 1SNUA 3OMVA 3R7UA 1RE8A 2CN8A 1MQBA 3H4JA 3WF6A 4UMRA 4TTHB 2JKOA 5L3AA 3DFCB 4RJ5A 3QZIA 2VTOA 4KSQA 4QMMA 1P4FA 4QNAA 4EH3A 5H2UA 5I9UA 3GP0A 2PPQA 4HNFA 3DDPA 4BN1A 3BV2A 3LLTA 4QPMA 4BYIA 4IDVA 4GSBA 5L2IA 4CFWA 2VX1A 4O83A 3QCQA 3DNEA 2PL0A 2R3MA 4U8ZA 4YSMA 3VAPA 3AD5A 4QYYA 1IASA 2OXDA 4QPAA 5E1SA 2RSVA 1YWNA 3RGFA 3GCSA 2V62A 3R8MA 2YM8A 5CYIA 1CM8A 3R73A 4TYJA 1HCLA 4OGRA 5JGDA 3FZPA 3QYZA 2X8DA 5FM3A 3SXSA 2C6KA 3KMUA 3DTCA 1S9IA 2RL5A 4F6UA 5L6OA 1UKHA 1KV2A 4BCNA 3PP1A 2I0EA 3QQUA 4ZTMA 3WE8A 3LQ3A 1NXKA 3R7GA 4H3PA 3WIKA 4PDYA 3C13A 4G3CA 4X3JA 1FGKA 2OXXA 3FI4A 4RVLA 2C6LA 2UW8A 4NZWB 4C59A 4AW5A 4ANNA 2XYNA 3WYYA 2IW9A 4AT3A 1XHAA 4FKOA 1Q99A 2W9FB 3DJ7A 3AT3A 3E92A 3G0EA 4MWHA 3G9LX 5LXMA 3BHTA 4AFJA 5C8KA 4H39A 3R8VA 5AUUA 4WNPA 3KVWA 3LFDA 4EOJA 3QQJA 4ANQA 3BRBA 3OY3A 5EDRA 3ZFXA 3UIBA 2UW5A 4KS7A 3ENMA 1UWHA 3UYSA 4F1MA 5AA9A 3MTFA 4FV2A 2GTNA 4XV3A 4UWYA 1OIYA 4A9YA 4E26A 4YHFA 5IQDA 4F0IA 4L3PA 4I20A 4AGUA 4L00A 1TKIA 5IKWA 3AT4A 4BIEA 1WZYA 3KF4A 2OXYA 4G3GA 2BROA 4EQUA 1KE5A 5B0XA 4NT4A 3R9NA 3VBTA 3O7LD 4I6LA 2O63A 3D9VA 2XAOA 3Q5ZA 3BBTB 4HPUE 2KULA 3PZHA 4NIFA 4E5BA 2R3HA 4DFZE 3DBFA 3IW4A 1Z57A 4HPTE 2OLCA 2YCRA 2I0VA 4E6QA 4DHIB 4N70A 2WMTA 3NIZA 4TN6A 2WMSA 3FMEA 5GIOE 5JRQA 3DKOA 2X2MA 3TEIA 5BYLA 4KBCA 5JZJA 2WTWA 2VTPA 3F5PA 4EOSA 4DA5A 1XH8A 4IAFA 2B0QA 3O96A 3D83A 3F2NA 3NUPA 5ETCA 3KL8A 1ZY5A 3IKAA 3PY0A 4C02A 3D14A 3F9NA 4JIAA 4YHJA 3UG2A 2F2UA 2BKZA 3QQHA 4LUDA 4MXZA 4QMTA 4ZY6A 4FX3A 5K0XA 4YGAA 5L8LA 5HIDA 3NGAA 4USEA 1H1SA 4PP7A 4O7WA 5H8GA 4CFFA 1IAJA 4KA3A 5HLWA 4ONAA 1ZLTA 5A9UA 5JMSA 3AG9A 4CKIA 4DH5A 4BGHA 2OICA 4LUEA 4Q9SA 3BE2A 2XCHA 3BYMA 4XV1A 4BB4A 3SW7A 3G6HA 2OGVA 3HDNA 4OLIA 4EH7A 4YO4A 3TYKA 3QRJA 4MF1A 2ZV9A 2IG7A 4KIPA 4ZEGA 1VLRA 4TNBA 2W5BA 3TXOA 3S0OA 5A6NA 4F6SA 1STCE 4WBOA 5D10A 4NW5A 1X8BA 2XANA 2XIYA 3Q5IA 3ZU7A 3WE4A 2PUPA 5DVRA 2V22A 4MUQA 4CFVA 4NU1A 5FEQA 4O96A 1H28A 3I79A 5AP7A 2R0UA 3UYTA 4NCTC 5ANIA 3VUHA 5J7BA 4HZRA 1UNGA 5HI2A 3RZFA 4G16A 2GNJA 4FGBA 2YM6A 3TJCA 5CEPA 3DQWA 4QQJA 4HW7A 5AA8A 2QR8A 5JQ5A 3OCTA 3AC5A 5KZIA 2BR1A 5BVDA 4J96A 2JFLA 4Q5HA 1PMVA 3E93A 5E7RA 4EYMA 2FVDA 4WG4A 2AYPA 4FIIA 5BVWA 3CTQA 4FV5A 4BC6A 3LPBA 5GZ8A 5IQIA 4LV5A 2XJ0A 1K9AA 4TYGA 4QMUA 1Q97A 1MP8A 3AT2A 5KCVA 4DH1A 4K77A 3VUDA 4FIJA 3PJ2A 3EFKA 4AZEA 3ZFYA 3OUKA 4E93A 1B39A 2WU6A 1KWPA 3KXXA 1KE9A 4EOOA 2XAMA 4FSRA 2GCDA 4FTUA 5BVNA 4O21A 5CX9A 5HBEA 3HKOA 1H00A 2I7QA 4BCGA 2NP8A 2YCFA 1YOJA 2Y4IB 4D4YA 1P2AA 1APME 4EONA 4TWNA 3QTIA 1FPUA 4FSMA 4RA5A 4X6QC 5CXZA 4B8MA 3TNPC 5HU3A 3FSKA 3RAKA 3R71A 3MH2A 3FY0A 3BU6A 4BDCA 2OJFE 3RALA 3BHUA 1UNHA 5E8VA 1V0PA 5BUJA 3PSDA 2BFXA 4M8TA 1P5EA 4QP9A 4H1JA 3E88A 4GFOA 4EKLA 3KMWA 5J79A 2Y4IC 4EK5A 2HIWA 3MS9A 2B4SB 2XF0A 3E8EA 3F88A 4YC3A 5IA1A 3AXWA 4X2NA 3UO5A 1Q61A 2HY81 2OH4A 2X0PA 1GOLA 3MVJA 3Q9WA 2C3IB 3HV6A 4LOQA 3LQ5A 4U42A 4IVDA 4GG5A 4X2JA 2YABA 3DS6A 1V0OA 1ZZ2A 4NJ3A 3F6XA 3ZLSA 2OU7A 3BYUA 4R5SA 3WF7A 5JK3A 3V8WA 3BLAA 5DHJA 3PVGA 4BCJA 5DE2A 4NFNA 4XG7A 4DEAA 1JNKA 3COKA 4IANA 2QOBA 5IMXA 4D4VA 2W0JA 5BUEA 3NZ0A 5IA0A 1YQJA 3F82A 2C6OA 5CI6A 4DEDA 3LMGA 4JBVA 1IA9A 4E73A 3ACJA 3ZM4A 2F49A 2JD5A 3GCQA 2Z7RA 4JL9A 4A4LA 5BQ0A 3ML1A 4BCPA 2G2FA 3UVPA 4FKQA 4X6RA 2IVSA 3EIDA 4ZTNA 2UZUE 5AUTA 4B8LA 3HDMA 1BYGA 4GG7A 1O9UA 5M08A 5AM6A 4UEUA 3U9NA 5IU2A 1KOBA 3MIYA 2GDOA 2C30A 3A2CA 4JS8A 2JKKA 3K2LA 4D0WA 2OF2A 4G3DA 3LLAA 3ZYAA 3F3ZA 4D1XA 1DAYA 2PY3A 3PFQA 3ALNA 3Q2JA 2ITXA 4G34A 4FSZA 3GXLA 4HVIA 4AOIA 1ZRZA 3GT8A 4QTDA 5G1XA 3WF8A 3C4CA 4Z7HA 5J5TA 2ITYA 4FSWA 1BLXA 3DKCA 4IWPA 2HOGA 5IEVA 2J0LA 2FB8A 3TUCA 4FYOA 2ZJWA 3OWKA 4E8AA 1JWHA 3K3JA 3AKLA 3Q6UA 4O86A 4JDKA 5HICA 3GU8A 1MQ4A 3QD4A 4Z16A 5I9ZA 4YUQA 4AXCA 4UV0A 3WF5A 3DPKA 4B9DA 4DEGA 5E91A 2WIPA 4RIOA 3HA8A 1PMEA 4QTAA 4C0TA 3FI2A 1XKKA 2UW9A 3PJ3A 3SD0A 5EQYA 4U3YA 2OSCA 2OJ9A 1M7QA 4G3EA 4CT1A 2CNQA 4FV8A 2XK9A 2X8IA 5I9YA 5L6PA 5EW8A 3FJQE 3EQDA 5EI6A 5AFVA 2UW4A 1SVHA 4MAOA 4FT9A 5EKOA 1ZOEA 4CNHA 4CFUA 2FO0A 2GS2A 3W2SA 4RIYA 3RVGA 4CG8A 5DN3A 4TXCA 4JOAA 5A46A 3UOJA 4J1RA 2UZVA 2UVXA 3DK3A 4ZY4A 4JIKA 1DM2A 2C0IA 1M17A 2JAMA 5AUVA 4AFEA 4AW1A 1RDQE 4C4HA 3KCKA 3R21A 2I0HA 5HNBA 2B55A 3JPVA 4KIOA 2WMBA 1Q5KA 3V5TA 5CVGA 3OOMA 4AA0A 3IOKA 3R0TA 2I0YA 1WAKA 3CBLA 2UZEA 4RWKA 1U54B 2NRYA 4X2FA 4AZSA 4N6ZA 4QP2A 4JDJA 3PJ8A 4IJ9A 4I21A 4XRJA 3RPSA 1YHVA 2BDWA 3CIKA 3QRIA 4MNEA 5CU3A 3ROCA 3KQ7A 1H1WA 3N4VA 4RFYA 3ORLA 3POZA 4BHZA 4ZLYA 3W0MA 4WG3A 4N0SA 5HGIA 1GZOA 5J9ZA 4WNKA 3RAWA 4F9AA 3DT1A 4BKYA 3AGMA 3PXRA 1CKPA 2W1CA 3KU2A 2BRMA 3T9TA 3BYSA 2Z7LA 1OKWA 3MA3A 3PA4A 3PPJA 4AN3A 3O5AA 2ERZE 5F94A 1OL5A 3EFJA 3VJOA 2X4ZA 4FKLA 3IOPA 3UDSA 1DAWA 3DBEA 4BWPA 4RFMA 5CAQA 3R28A 4DFYA 4EK4A 1H4LA 3S00A 3UPZA 1WBSA 3EN4A 5AADA 3OCGA 4DFLA 4M3QA 3GFEA 3QFVA 2XK7A 5E8TA 4AQKA 4TY1A 1E9HA 1ERKA 4KB8A 5ICPA 4ZTSA 5L2TA 2J0KA 4FSYA 4F1OA 4QDVA 3C0IA 5HG7A 3VBWA 2W05A 2C0TA 4DGMA 5F95A 3FXZA 4Y85A 3I0OA 4CV8A 4EI4A 3HA6A 3BQRA 3R63A 3FI8A 3QGYA 4G5JA 3UO4A 4XP2A 3RK9A 3CTJA 2GHMA 4HJOA 5AP4A 5AR3A 4NL0A 3UQGA 1OPJA 1REKA 2B9IA 4RSSA 4PMPA 5L2WA 1KE7A 4O4EA 4HNIA 4DGNA 2H9VA 2YM5A 3MB6A 2PE2A 4FTOA 2X6EA 3V3VA 3NEWA 4KINA 4J97A 3IDCA 4JLCA 3QZFA 2V7OA 2UW7A 4PL4A 4JBQA 3A62A 4TRLA 4GL9A 4E3CA 4ID7A 5AP6A 4B6LA 4KIQA 4AXAA 3V51A 5K9IA 5FQDC 4E4NA 1ND4A 5HTCA 3D7TB 1CDKA 4FIHA 1KE6A 4BCHA 2XALA 3HP5A 1Y8GA 1YRPA 2BAJA 3AMAA 3IK3A 2ZV8A 3DOGA 4EHVA 2QCSA 4A06A 3W0OA 1IEPA 5EHOA 4HCTA 1M7NA 1Q24A 5K5XA 3HMMA 2XK6A 3GC8A 3ULZA 2R3FA 1IRKA 2WKMA 3NUYA 4XG9A 3GOPA 3QXOA 4J8MA 3O23A 3FQSA 4XG4A 4NH1A 3VNTA 2J9MA 3LMIA 3A8WA 5JH6A 3DTWA 3II5A 2V7AA 3ATTA 4YBJA 4CRLA 5A4LA 4R78A 4O7SA 4BDDA 2WNTA 1Q3DA 2CGUA 3KK9A 5I9XA 3MI9A 3OXIA 4FTIA 5DI1A 1GNGA 2VX0A 5M51A 1TQMA 2GNGA 2ETKA 3I7CA 4GJ3A 3Q53A 3W2CA 4BZDA 4YPDA 5BMMA 3HP2A 3V5PA 4GKHA 4IEBA 5L8KA 4FKTA 1YI4A 3VS1A 3RP9A 5LVLA 4IDTA 3HMNA 4W4XA 4ENYA 4MYGA 5AAGA 4C4EA 4EOLA 2C6MA 1PHKA 3FQHA 3LQ8A 3QUDA 5JGAA 1JOWB 3SOCA 2FSOX 4R77A 1W98A 4EHZA 3FMMA 2J5EA 2VTJA 4FKRA 3NRMA 4FOBA 4K6ZA 4PRJA 3RK7A 4F4PA 5IQBA 4TYIA 4Y5HA 3G90X 3UZPA 5E8ZA 3CJGA 2ZV2A 1M14A 2X1NA 4LRMA 4QQ5A 1HOWA 3EHAA 4BKZA 1ST0A 5BX0A 5IQGA 1URWA 3QQKA 3UO6A 4WG5A 2W4OA 3RTPA 4RVKA 2XYUA 2C69A 3R30A 4ZK5A 2O8YA 4O91A 3MGYA 2CKQA 1AQ1A 2ZB0A 1YI3A 3Q60A 3UOKA 1JSUA 4NFMA 4GJ2A 5HNGA 1ZYDA 3GGFA 4FSNA 3MPAA 2OWBA 4JRVA 4BIBA 4KWPA 4BRXA 4IFGA 4KRCA 3QTUA 5LVOA 3MH0A 4RG0A 4YZDA 2JIIA 3TZMA 4X3FC 4BHNA 3ZO2A 3KXNA 5ETAA 3KRXA 3Q4TA 4D2WA 5LMKA 2R2PA 4G6LA 4YJPA 3KIOC 3ZUTA 4BCOA 4O0SA 4M84A 4NCTA 3FQEA 3DJ6A 4J99A 1UNLA 3VONA 3QTZA 4JQ7A 2C1BA 1ST4A 3IDPA 4IAKA 5AX3A 4NSTA 3NW5A 3GU7A 2OIBA 3LFNA 1S9JA 2UZDA 2YJSA 2PYWA 2IO6A 3FLSA 4NM7A 5M4CA 5CF8A 2WEIA 4MHAA 4ZSJA 3QQLA 4JAJA 3FPMA 4I5CA 4XOZA 2VTTA 4YTFA 4J8NA 1G8JA 2F2CB 3O51A 3R8UA 4AG8A 4U44A 4IAIA 5B2LA 2B9FA 4U6RA 2IWIA 5CU4A 4FRFA 1VZOA 3R9RA 4RX7A 3F5UA 4KBKA 3W2RA 4AOJA 2OJIA 4QTEA 4BJJB 3RNIA 3E8CA 4LRJA 4PTGA 4AU8A 3D5UA 4FV9A 4PL5A 3D94A 4Z9LA 2RGPA 4XRLA 4RGJA 3O8UA 4FA2A 3Q3BA 2VTIA 3CY3A 4IZAA 4S32A 4OAVB 2CMWA 2C68A 3LXLA 4GK4A 1QPEA 1PW2A 3VHKA 4F6WA 3CPCA 1XWSA 4JVGA 3EN5A 2NPQA 2GFCA 3R6XA 4V0GB 2X7FA 3HRCA 1OI9A 3QKKA 4LOOA 4R6VA 2PVHA 3PXQA 4A9RA 1WVWA 4C35A 5F1ZA 1EH4A 3L8XA 5ANOA 5DGZA 4H3QA 2GNLA 3FE3A 4IFCA 5KHXA 3KXZA 3MFUA 2WQMA 2Q0BA 4G3FA 4UALA 4Y5QA 2PVYA 3JUHA 3O71A 5LCJA 4CYIA 4LGHA 4DGOA 3MH3A 2O65A 4F08A 2PUIA 3DXPA 3JVSA 4DFUA 4I4EA 2WQOA 4M69B 3ZC6A 4D5KA 4BBFA 4ZLOA 2E9OA 2R3JA 2YAKA 4ZIMA 2UZTA 3K3IA 3FZOA 4IZ5A 4FTJA 3NW7A 5D7VA 4S33A 5DWRA 4E20A 3P79A 4NYEA 4L45A 4YLJA 5IUGA 2NYAA 5KMLA 4KKEA 2UZNA 3AKKA 1UWJA 5LVMA 4PF4A 3VS3A 4AA5A 3U6JA 4F63A 2CPKE 2DQ7X 4GT3A 3BX5A 2UZLA 2XIZA 4U41A 3HV4A 5EDPA 5L8JA 2ITPA 4IB5A 3C1XA 1UU7A 1H07A 3ZHPC 5HIEA 4FV4A 4USDA 1UV5A 5JRSA 4LM5A 3W55A 4JMQA 4P5QA 5FTQA 4EWHA 3RCDA 4E5AX 1GZKA 5ANJA 4G6NA 3BQCA 4OAUC 4ZY5A 3SX9A 1R1WA 2XP2A 4IE9A 2YHVA 3EB0A 2HZIA 3QXPA 3NAXA 3ULIA 4CZYB 2OZAB 2C6DA 2R3NA 3RM6A 4D2VA 3LKMA 4W8EA 3BKBA 1Q8TA 5J8IA 3CGOA 3H9RA 3NLBA 1J7LA 4TYEA 4JT3A 2RG6A 2X8EA 3BBWA 3FV8A 4HYHA 4ACGA 2PMNX 4IVCA 3DK7A 4F99A 4HOKA 5HLPA 3FLQA 4DDGA 3PIYA 4M66A 4PPAA 5HVYA 3LCOA 3LJ1A 2FYSA 1WCCA 3E87A 5AUYA 2WTVA 3DQXA 5CWZA 1W8CA 3PPKA 4L42A 4OTDA 3R01A 2PULA 4I6BA 4C37A 2ITQA 4XG6A 3IS5A 3RPOA 5BNJA 5HLNA 5HTBA 4O7LA 2OJGA 2UVYA 3I1AA 4IWQA 3KA0A 2IJMA 4QPSA 3JVRA 4RJ7A 1H26A 1IA8A 3D2KA 4Q2AA 1GIJA 2RF9A 4U3ZA 4XLIA 2XRWA 3ZXTA 2VO0A 2X39A 4I41A 1QPDA 2OF4A 4FTKA 3TZ9A 4C36A 3L1SA 4FTLA 5DFPA 3TZ8A 5LQFA 2IZTA 3C9WA 2ERKA 3AD6A 4FT0A 2P4IA 3MYGA 3NYXA 1SYKA 5ETFA 2UV2A 1OL2A 3TZ7A 3WOWA 4WSQA 3W0SA 4FKVA 5C8MA 3R00A 4HVGA 2ZB1A 2YM4A 3WZJA 3VUKA 3L9PA 2VTHA 2BRHA 3VUTA 1Y8YA 2BTSA 3LW0A 3U51A 3UNKA 5JFXA 3O8PA 4PDPA 3W1FA 4FNYA 4GIHA 5BPYA 3VBXA 4FT5A 4CLIA 4IB0A 4YPSA 4N6YA 4O81A 5IA3A 4XNEA 1QPCA 3R8ZA 1H8FA 2PVFA 3TUBA 2G01A 1U54A 2XKFA 3F66A 3OTVA 4UZHA 4DFBA 2WXVA 2WPAA 3MDYA 4HGTA 4ZS4A 2EU9A 3U4UA 4F09A 4KIKB 4DT9A 4WIHA 5AR8A 4AZVA 4TL0A 1Q3WA 2XNOA 2R7IA 3F5XA 4O0XA 5BUIA 3JS2A 4IWOA 4ASDA 3G5DA 1J7IA 2Q83A 4OTIA 4Y72A 5HBHA 2HWOA 4ENXA 5CAUA 4FEUA 2JLDA 3T9IA 4O7ZA 5IEYA 4R7IA 3PE1A 1J3HA 2EWAA 3HRFA 4UMPA 3F3UA 5E9EA 2EB3A 1FMKA 2XNPA 4XS2A 1G8SA 4EK6A 3SKCA 4CYJA 2VTSA 5FLFA 5J1VA 3NCZA 4DEIA 4UX9A 4CMUA 3CD8A 5HEZA 2FSLX 4FKSA 2I6LA 2XMYA 4RLLA 5CNNA 3CD3A 4FZFB 2R3LA 3FMJA 4F7LA 3DJ5A 4ZJVA 4GYGA 2GNIA 5FBNC 3FL5A 4EQMA 2XJ1A 1ZYLA 4BDJA 3UG1A 2X7GA 3EQRA 4PMSA 4FZ6A 5LARA 3OVVA 5C4KA 5M44A 4XMOA 3FWQA 3GOKA 5HKMA 5CXHA 3D5WA 5A4QA 4QDEA 5I9VA 2KTYA 3F5GA 1ATPE 4IC7A 4RWLA 4CFXA 3F3TA 4O27B 3ZONA 2PVNA 3P4KA 3FMKA 3IECA 2GS7A 5KX8A 2BZHB 3W2QA 4PNIA 5I3RA 5E8XA 3ORTA 3UIXA 4F9CA 3EZVA 4FVQA 2PZYA