3TG1A

Crystal structure of p38alpha in complex with a mapk docking partner
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
348
structure length
334
Chain Sequence
RPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGHRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLAQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/hydrolase
molecule keywords Mitogen-activated protein kinase 14
publication title A Distinct Interaction Mode Revealed by the Crystal Structure of the Kinase p38alpha with the MAPK Binding Domain of the Phosphatase MKP5.
pubmed doi rcsb
source organism Mus musculus
total genus 92
structure length 334
sequence length 348
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2011-08-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3tg1A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3tg1A01
2W1FA 3A61A 5CU6A 4BWPA 3G0EA 5FLFA 1YHVA 2YIQA 4Q2AA 3E87A 3PTGA 3DNDA 3UYTA 5EHLA 3E3BX 2R3HA 4U97A 3MFRA 2QI8A 4O84A 4IH8A 5EK7A 3UYSA 1UWHA 3D7TA 4WG3A 3I7BA 3UQFA 2YAKA 3HDMA 1ZAOA 2UW5A 2E9PA 3EYGA 4KBKA 2GDOA 3VS7A 4HGTA 5EDPA 1ZY5A 5B2LA 2OO8X 4E5AX 4KIQA 4J8NA 4QMNA 3AGMA 3COIA 3Q2MA 4NH1A 4ZEGA 4P5QA 2HW6A 4DH1A 3F5GA 4OTPA 4AU8A 2IN6A 4X2KA 5T68A 3BYMA 4ZSEA 3MI9A 4HYUA 4YNOA 4CFFA 1K3AA 4I20A 3OT3A 4AN3A 3QGYA 5EW8A 3E63A 2BAKA 2XKFA 4F7NA 3UO4A 3IK3A 4EOPA 4R3RA 4WO5A 3CY2A 1J7IA 1OBDA 4R77A 2I0HA 4LGHA 4O0YA 4DTAA 4DF3A 1XH6A 1OGUA 2CN5A 4MEDA 2YHVA 3QTSA 3BE9A 4F7SA 5C01A 1GJOA 2VTIA 3S2PA 3TIYA 4ASEA 2ITPA 4FKGA 1M2RA 4ZTSA 3ANQA 3ATSA 5EQPA 4EUUA 3D0EA 2PTKA 3H9RA 4FNXA 2XUUA 2JAMA 4AA0A 4AFEA 4K2RA 3HECA 4D55A 4D2WA 5HTCA 4PTCA 5IUHA 4BIEA 4UWBA 3CKXA 4JBPA 4XUFA 3VS4A 3BHVA 2BRBA 1PW2A 4EK3A 3LCSA 4RFYA 3SOAA 5JFWA 4QYHA 4YJNA 4L42A 4XG6A 5AUYA 2XB7A 3TTIA 4ZTQA 2J0MB 4OTWA 4IIRA 4RZVA 5ANJA 2GFCA 4DGNA 1XHAA 3ZLXA 4ITIA 4NW6A 4FKQA 1Y8YA 3FV8A 1TQIA 3PZEA 3PY3A 2JDRA 5AUUA 4KKGA 2C5OA 2OJIA 3FPMA 3L9MA 3DBFA 4QMZA 5FDXA 5JSMA 1MRUA 3QTWA 3TN8A 2DUVA 3MYGA 3EL7A 4FTTA 1FQ1B 3GVUA 3MY1A 4CTCA 5AFVA 3LMHA 2W4OA 4DITA 4NM3A 1VR2A 3FZPA 3GCQA 2JDOA 2ZMCA 3PE1A 4Y85A 4A4XA 4BZOA 2UZBA 4FKIA 3TUBA 5HIDA 1KE8A 4YBJA 4FSRA 3H4JA 2R5TA 2PPQA 5EYKA 4ASXA 1P14A 4L7SA 1YWNA 3BEAA 3LW0A 3TT0A 3FLWA 4O6EA 5BMSA 3RMFA 2VGPA 2OXYA 4LRKA 3F2NA 3ODYX 1QCFA 4FT7A 2ETMA 2PZYA 3ZCLA 2GTMA 2GNJA 4CLIA 5TR6A 4O81A 3UNJA 2Y8OA 2A1AB 4R5YA 2X2MA 3BYOA 3W8QA 3F9NA 4EORA 3NW6A 1ZZ2A 3NYNA 3VUHA 4O7SA 2B9IA 2O8YA 1MQBA 4FEXA 3MH2A 4O7TA 4O7NA 5GJGA 5HU3A 4RIXA 2XVDA 1BMKA 2CGWA 2WD1A 4U6RA 4C3RA 4AXAA 4EZ3A 3TDWA 3VAPA 1JKKA 3RK5A 3DU8A 4G2FA 3JXWA 4J71A 4UXQA 5BVKA 4OUCA 5DA3A 5DLSA 2OU7A 3GFEA 4ITHA 4O0WA 3UGCA 2YITA 4C33A 3PSDA 4JG7A 4QP6A 3E62A 3CPBA 4LMUA 1OMWA 1H1PA 5JKGA 3NYXA 4ZTHA 1XH9A 4GG5A 4TNDA 3A7IA 3D4QA 1M17A 3F3TA 3KK8A 5EQEA 2J2IB 3ZM9A 2WO6A 2OXXA 5J79A 4CGAA 3BBTB 1OKVA 4OTGA 3MY0A 4G6NA 3QL8A 1WMKA 3QQFA 3CQWA 2GCDA 4FT5A 4IVDA 3C1XA 3VW6A 2VWXA 1YQJA 2WMSA 4OW8A 3ZZWA 2PVMA 4CEGA 2G01A 2XJ1A 1R3CA 4FG7A 1Q8ZA 4C4EA 4D4YA 4D4VA 3LM5A 2EUFB 1DS5A 4QTAA 3FHIA 5A54A 2WIHA 1PMNA 5LVPA 4PP9A 3CLYA 4M69B 5L2QA 3WF9A 1ZYCA 3OXTA 4NL0A 4CG9A 4L6QA 3FZTA 1QPDA 4GK2A 4TYGA 2C6TA 3NX8A 4O21A 3FKOA 2IZSA 2VTLA 1UU8A 1VZOA 4QPSA 3SG8A 2X8EA 2W06A 3A60A 3BRBA 4HCVA 1M2PA 4BCOA 3DXPA 1CMKE 5HO8A 3K3IA 3ORLA 2YWPA 1O6KA 3NEWA 4FT9A 5HHWA 3MFUA 4LI5A 2XZSA 3AT2A 5I4NA 5C4KA 2BAQA 2QLQA 2QOIA 4JNWA 2YEXA 4KA3A 3DLZA 3TNQB 4ZAUA 2FSTX 2HAKA 2YDIA 4E5WA 3KRXA 3EFKA 3C4EA 3UOLA 3NRMA 3QCYA 5ICPA 3GC9A 4IX4A 3KMUA 5CI7A 2P2IA 2HXQA 2WMAA 2WTVA 4HCTA 3BGQA 4P7EA 2E2BA 2HZNA 2C5NA 3I1AA 2JEDA 2VGOA 3RAWA 3NUPA 3R9DA 3W55A 3TV4A 3ZM4A 2HXLA 3GBZA 2H8HA 3F82A 3ZLSA 1PXJA 3GU6A 4EH4A 3Q6WA 2JKKA 3EZRA 2HYYA 3O23A 2J90A 4O1PA 4ALVA 1H27A 2DYLA 2F7XE 3IS5A 2HZIA 3IONA 4YJOA 4U9AA 5A3XA 2YM4A 3BCEA 4YHJA 2WNTA 3GCUA 4GJ2A 3V5TA 3LJ0A 4EHVA 4JRNA 3Q9WA 3NVMB 3DZQA 4K0YA 3ZONA 4QMYA 4NUSA 3SW4A 1BX6A 2O0UA 2J0LA 3NPCA 4E3CA 5CANA 2ONLC 4JX7A 1OL1A 5AP7A 4LOPA 1RJBA 3CKWA 4C4HA 4XBRA 4D0XA 5IQAA 2VTQA 3OEFX 2FSLX 3PDTA 3F61A 5DOSA 4ENXA 1URWA 4JDIA 2YIYA 1PKGA 4GFGA 4X2GA 3SRVB 4CYIA 3JR1A 5CF4A 3CS9A 4BDFA 2B0QA 3Q9ZA 4QTCA 1CTPE 2QR8A 4QMQA 2VWIA 3A7FA 5KNJA 2OIQA 4K18A 3PZHA 2WEVA 4PWNA 4YZ9A 3V8WA 3CQUA 2Y6OA 1OKYA 4M66A 3G9NA 4AZFA 3OCBA 4XG4A 2P4IA 3OF0A 3R8ZA 1V0BA 1KV1A 2ACXA 4EHGA 3RNIA 3KEXA 2CGVA 3QKMA 4MQ2A 2VN9A 4IC7A 3CE3A 3DB6A 4YUQA 5J9ZA 3R0TA 2CNQA 3DK3A 4CFWA 5L6PA 4O22A 4PPBA 2OJ9A 2BDJA 2OH4A 3GCSA 4EONA 1ZWSA 5E8SA 1LUFA 2NP8A 1IAHA 2RGPA 2QO2A 4KD1A 2W1DA 2B53A 1VJYA 1PJKA 4YJQA 3SW7A 1ZMWA 3ZHPC 3R2YA 4BICA 1OPLA 5FRIA 3PJ8A 3OXIA 3OWKA 4GYGA 4E93A 2VWYA 2I7QA 5HCYA 4CG8A 2J0IA 4BBMA 3I79A 1R78A 5TO8A 4DAWA 3TJDA 3VUTA 1Q62A 3VUIA 4QMTA 3QX4A 5IA4A 3GC8A 4BDIA 4WUNA 5BX0A 5DT4A 3DXNA 3S0OA 2DWBA 4FA2A 2XJ2A 4RLKA 2G2HA 2UZLA 3EKNA 4M68A 2ITQA 4OR5A 3VRZA 5BQ0A 3LJ2A 1WZYA 5B0XA 1FOTA 5DN3A 4BY9E 3FKNA 3TV6A 4FBXA 3UP2A 4FI1A 5J95A 2ERZE 2C1AA 4FKWA 4NKSA 3UVPA 3FYJX 3PA4A 3DLSA 4FKLA 3FL4A 4TWPA 2OG8A 3ZMMA 3BU5A 1PXPA 4X7QA 4EK6A 3Q3BA 3OZ6A 4XV2A 4C58A 3W2RA 5JZJA 5A4QA 4OAUC 1Q41A 3KXMA 1FMOE 3OROA 2ONLA 4KUJA 5B2KA 5LMAA 4E5BA 2I1MA 3ORZA 3MH1A 4QMXA 2WMUA 3G6HA 3H9OA 4XH6A 3ZXTA 4J1RA 4BZNA 3VC4A 3HMMA 4F65A 3ORXA 2Y0AA 2J50A 4D58A 3CBLA 1DAYA 2GSFA 2C4GA 4D2PA 4TYIA 4ARKA 5DPVA 3PP0A 1A48A 4DYMA 5CZIA 2JKQA 4N0SA 5DHJA 4IZ7A 1Q99A 3D9VA 1P2AA 3EHAA 3M42A 1WBTA 3QCXA 3IPHA 4BC6A 2W1EA 3CGFA 1G8SA 3C4ZA 1RE8A 3Q5ZA 4B99A 3ZFXA 3F5UA 3NS9A 4FNZA 4DA5A 3RALA 5J5TA 2BRNA 3OEZA 3PJ3A 3ZTXA 4YTFA 2XYUA 3R63A 3Q6UA 3DJ5A 4U8ZA 4KB8A 4MKCA 4CYJA 3VUMA 4HZSA 3ACJA 4H1MA 4RQVA 5AR7A 3BGPA 5CALA 4AOJA 1ATPE 4LQMA 4XG3A 3NCZA 5B2MA 5E4HA 3FZRA 5EHOA 5HG8A 4JBQA 3HP2A 2FH9A 1KWPA 1K9AA 2QR7A 3BLQA 3C5UA 4XLVA 5D12A 4FMQA 5ANDA 3GB2A 4DFYA 3HAVA 4K8AA 4I4EA 3QC9A 2GQGA 2UZTA 2X6EA 3HNGA 4BBEA 4QMMA 3FC2A 5FM3A 1ZZLA 5HQ0A 3Q4TA 5EYCA 5FTQA 2FYSA 3ZDIA 3C4WA 2CNUA 5EQYA 2WTWA 5F4NA 3OTVA 4AN9A 3LQ3A 3BLHA 3HYHA 3G6GA 2XIKA 4CZYB 2O5KA 3NUNA 4JLCA 4F9AA 3TKUA 4FKOA 2J0KA 3SGCA 3BHTA 4RVLA 1WBPA 3MW1A 3FLQA 1IASA 4RIOA 4YPDA 3I81A 4BWXA 3U55A 2WTDA 3GOKA 3OCTA 4XG2A 2YISA 4LM5A 4WIHA 3E8CA 4R7BA 2R3JA 3I5NA 4ZZOA 3DXQA 2BPMA 5GIOE 3SG9A 5F94A 1E1XA 4PDPA 3R2BA 4F1TA 4U0IA 2VX0A 4EWHA 4NM7A 1Z9XA 3PXQA 3D7TB 2RFEA 4MTAA 4IDTA 4P90A 3S3IA 3ZDUA 5IDPA 3AXWA 4ZOGA 4BKYA 2QONA 2WB8A 5DI1A 1NT2A 4DEGA 1I09A 1YXTA 2HWPA 2E9UA 2JITA 4C3PA 4L52A 2C0TA 3ZZEA 3LPBA 4QTDA 4C62A 4OLIA 5AP4A 2AC5A 2CGUA 3F2AA 4LUDA 1FGKA 4NEUA 3T3VA 5IUGA 1P4FA 2ESMA 4RLLA 1V0PA 2Y9QA 4U81A 2VNYA 2JIVA 5CAQA 4BI0A 2WQMA 4BIDA 1OECA 4FTIA 3MVMA 4EH5A 5CF8A 4PP7A 3O8UA 2PU8A 5H8BA 5A46A 5E8TA 1Y8GA 3QCQA 3FI2A 4D9UA 2W9FB 4FV3A 4BF2A 3E5AA 4D4SA 4RVMA 3BI6A 2XCKA 1DI8A 3DGKA 2OJGA 4JL9A 5F1ZA 3WBLA 4B8LA 5CF6A 4I6FA 4F6SA 3MTLA 5GHVA 3FC1X 3Q4UA 2P0CA 3NAXA 2QOQA 4GMYA 1FVRA 5CSPA 5HX6A 3TM0A 4TN6A 3ZSHA 4CV9A 4UY9A 3AC5A 4PMSA 1XQZA 2VTOA 2XIZA 3O50A 5FQDC 3NR9A 4BCGA 4O7RA 1PXKA 1YW2A 1U46A 4QYFA 1H1WA 3U6HA 3QWKA 2BMCA 3AC1A 1MRVA 4IWPA 3BHHA 4AOTA 4XG7A 2C5VA 3VULA 3QAME 3KQ7A 4FL3A 3A2CA 3K5UA 3IW5A 3QRIA 3U87A 3LFBA 4FG9A 1UNLA 4GFMA 3RTPA 4ERWA 2Q83A 1W98A 5CSXA 3U8WA 2Z02A 2PMLX 2X2KA 3EQPA 2VWBA 4IANA 4JG8A 5AV3A 2RG6A 4PL5A 2W5HA 1OI9A 4YBKA 3DB8A 4A9RA 3RJCA 4MNFA 4XJ0A 2BTSA 3PLAE 4AA5A 5K0KA 3EQRA 3MGYA 2X7FA 2BFXA 5B7VA 3FSFA 4KIKA 2YM6A 4EH3A 4O0SA 4F0GA 3DKGA 4FL1A 1I44A 3ORPA 5AP6A 5IMXA 5JZNA 4EYJA 2YN8A 4C57A 2V62A 3CGOA 2X2LA 4AOIA 5JGBA 1OPKA 1QL6A 3QQJA 4YZCA 2YLEA 4QPMA 3QD2B 2J5EA 3V5LA 5CAUA 4DHFA 4PDOA 2PWLA 1YOMA 4O91A 4DC2A 2IZUA 2XJ0A 3F69A 3GCPA 3R01A 4MWIA 4Y5QA 5HI2A 5I3OA 4BI1A 5KMLA 4FZFB 3W1FA 4TXCA 3N4VA 5AUWA 3QLGA 4M12A 4TT7A 1WFCA 4GUBA 5CVFA 3RP9A 5L8JA 4UMRA 3PVBA 4MXYA 5E92A 4JRVA 3OW3A 4N6YA 1U54A 4BDKA 3UOKA 3W32A 4AW0A 4BTFA 2PVNA 5AV1A 3C4CA 1IR3A 3DTCA 5J9LA 2FSMX 4RIXB 4YP8A 1H08A 4FIEA 3VBYA 1P5EA 3V5PA 4M0YA 1YI4A 4AA4A 4C34A 4CFMA 3P86A 3HZTA 4OTFA 3SC1A 2WQEA 2LGCA 3COKA 3R9HA 5CSWA 5HE0A 4OAVB 3UNKA 1ZYLA 3ZC5A 2YJRA 5K4IA 4CMTA 3F3ZA 4YLKA 4EHZA 1LP4A 1Y6AA 3U4WA 2QKRA 3RPVA 2PL0A 2XIYA 4ALUA 2IZRA 5KKRC 3RBWA 1WBSA 3MVHA 2XK8A 3MV5A 4IJPA 3QFVA 5ANGA 4EK8A 3ZO2A 4F9CA 4FNYA 3ZUUA 3BELA 3BBWA 5C9CA 5BMMA 3MB7A 3RPOA 4FZDB 1J1BA 2UW9A 3EFJA 3P79A 3GQIA 4IDVA 4NSTA 4O0VA 3FUPA 3COMA 3ORTA 3RWPA 4G3EA 4ANNA 4BCIA 2IVTA 1ZOEA 4XOZA 3Q96A 2O64A 4YTIA 2NRUA 5EI6A 3KULA 2OGVA 1WVXA 4OT5A 2C3KA 2Y4IC 4OTIA 4UXLA 4XCUA 1APME 4O38A 2BDWA 2DS1A 2GS6A 2IZTA 2B9JA 4BDEA 3QXPA 4PDSA 3OC1A 4X3FA 4QRCA 4A4OA 4BDBA 1NY3A 3H10A 2JBPA 3FMLA 2P55A 3N9XA 3RM7A 2C3IB 4JI9A 2QOHA 3W18A 4DEAA 1SZMA 3ULZA 3FWQA 1SVGA 3DOGA 4WT6A 4APPA 3QRTA 4QOXA 4E4LA 2WELA 3OY1A 4QMOA 5JFVA 2HK5A 3H3CA 5IISA 3TNWA 4WRGA 1PHKA 4ACMA 4TYHA 4FEVA 4JXFA 2E9OA 4C4JA 2XK6A 3GC0A 4UB7A 3NGAA 1LEWA 5DT0A 4EEVA 3B2WA 2WTKC 4YLLA 5LOHA 4I93A 3FYKX 2GS7A 4R3CA 2VTSA 3F6XA 3RZBA 3W2PA 3DKFA 4FTKA 4HVHA 1IEPA 5CYIA 1GZOA 1IG1A 3UBDA 1WVYA 5F95A 4CFXA 4FEWA 3LKMA 5IZFA 3LXKA 1A06A 3ZS5A 2YLFA 4PDYA 3IW6A 5I9XA 1H1QA 3BQCA 4IWOA 5EG3A 3QA8A 3THBA 3PWDA 5J87A 3VW8A 1W0XC 2UZUE 2YJSA 4RIWA 3POOA 1OIUA 5HEZA 3MIYA 4O86A 3T3UA 3PWYA 2CKOA 1YXUA 5CAOA 3QTQA 4QO9A 2CGXA 2CPKE 1NVQA 2VTMA 5KMKA 4CQEA 1CSNA 3ZFMA 3P0MA 3RHKA 3V6RA 5D7AA 3WE4A 4CNHA 2OZAA 1Q8TA 4BRXA 4ZLZA 1XO2B 3DKCA 4FV8A 4Z7GA 4BBFA 4K11A 4QP1A 3PY1A 4FG8A 3OOMA 1IA9A 3LAUA 4ORKA 4V01A 3D15A 3GU8A 2B54A 4R7IA 5DT3A 3ANRA 3A62A 1WAKA 2OJFE 5AWMA 2W4JA 4ZY6A 5HO6A 4GW8A 3QRKA 2GNLA 3QQKA 4H58A 3LQ5A 1S9IA 1U5RA 2OK1A 3D5WA 3JY9A 4ID7A 3TZ8A 4ACDA 1UVRA 4N57A 3OWLA 1H25A 4FIIA 3OWJA 4YJTA 2OBJA 1ND4A 3E93A 1H28A 1BLXA 1H0WA 3CCNA 5AAFA 4XRJA 4EZ7A 5C03A 5CEKA 3HA8A 5I3RA 1KOBA 4I6HA 2QG5A 2X7GA 3KC3A 3PJ1A 4BVUA 4IEBA 3RGFA 3N4TA 1ZRZA 3JVRA 5HU9A 4P2KA 3PIXA 3VBQA 2UVZA 2B7AA 2R4BA 4ANOA 1W83A 4AZWA 3P23A 2YABA 2E9NA 1YI6A 1RW8A 4XHKB 1MP8A 3O0GA 2RIOA 4XV3A 3ZEWA 3KXGA 4TW9A 3QTRA 4BYJA 4V05A 5EHYA 5C1QB 3A8WA 3FJQE 4B6LA 5IDNA 2YIRA 4FOCA 1OUKA 1YHWA 4RMZA 3F88A 4KABA 2GNHA 3TNIA 5J9YA 4FTMA 2XS0A 3P08A 2Z2WA 1QPEA 4NK9A 5CZHA 4UALA 5H3QA 2O3PA 3TIZA 3UQCA 3S4QA 2ZVAA 2ZB0A 3MN3A 4HVDA 5IUIA 4HVIA 4O7ZA 3DAKA 4X6QC 1QMZA 3CC6A 4EOLA 3MH3A 5C8NA 2OIBA 3TG1A 4ZS4A 1VYZA 3EN7A 3UJGA 2PZRA 3ROCA 4FNWA 3WI6A 4DH5A 5H8GA 5DE2A 4L67A 2OI4X 3LFDA 1NVSA 4G3FA 4K33A 2XRUA 2YCQA 1SYKA 3BWJA 5IEVA 1OZ1A 4A9TA 4RA5A 5TF9A 4B4LA 4AP7A 4NWMA 3PXYA 2YCSA 4TYEA 5IA2A 4LRMA 2CSNA 3LJ1A 4J98A 3F5PA 4Q5EA 5TKDA 3ZRLA 4TZRA 1GIIA 5CU2A 2EWAA 5IQGA 3BKBA 3DBQA 5I9WA 3OUKA 4FEUA 4TPTA 1R0EA 2BRHA 5C8KA 5IQEA 5CT7A 2XP2A 3D83A 1YI3A 5HNBA 4RWKA 4YC6A 2PZ5A 4E6AA 4L00A 4BDHA 5J5SA 1J1CA 3U54A 3TKHA 4HVSA 3F3UA 4NKAA 4O1OA 4EH2A 5FXRA 4WD5A 4FIHA 3S1HA 2QOKA 3HV4A 4D1XA 5HIEA 4U3YA 3KY2A 1OPJA 5CS6A 3K54A 3LFFA 4GFOA 2X9EA 2PZIA 4PMTA 5AX9A 4RWJA 5L2SA 2SRCA 2GHGA 3PXRA 2PE0A 4GVJA 2XM8A 3NYOA 4JOAA 3ENHA 1OBGA 5E1SA 3PYYA 3FSKA 5ETFA 4BFMA 4IAKA 3TZMA 5AAEA 3TZ9A 4BN1A 5C4LA 5A4CA 4UYAA 2Z7LA 4FTCA 5KZ0A 3C4FA 4R8QA 2QOCA 2R3LA 4GG7A 5FD2A 2C68A 3LLAA 5KHWA 5K0XA 2VRXA 4D2VA 3KXHA 4E7WA 1CKJA 4FV5A 2YIXA 4AGCA 4PTGA 4JVGA 2XKEA 4APCA 5E8XA 4CZTA 3KMWA 4AE9A 1H8FA 3VS2A 4W4WA 4BCMA 5BVDA 5L3AA 5GINE 3QZHA 2BFYA 4FIGA 2IW9A 4JDJA 2NNWB 2VUWA 3QX2A 2CKPA 3TZ7A 3UIUA 5E8UA 2G2FA 3ZU7A 4MD9E 5H9BA 4HNIA 1XH4A 4BIBA 1DI9A 1UU7A 2YACA 4O82A 4OTQA 2X0GA 1YKRA 4W4VA 4WBOA 4ZTLA 3FLSA 4GIIA 5T3QA 3LIJA 4YU2A 5FWKK 5FXQA 5E8ZA 3GU4A 5KCVA 2E9VA 3CTHA 3DT1A 3HUCA 3IW8A 3MPAA 3MVJA 3MWUA 4BHZA 3QYZA 1O9UA 4HCUA 4X0MA 4AE6A 3TCPA 3PXKA 4PRJA 3IW4A 3DK7A 4A06A 2R0UA 3BQRA 3W33A 4WG4A 3H9FA 5CXZA 3RVGA 1L3RE 5FUTA 3FBVA 4BL1A 5L4QA 3W10A 2PHKA 3L8VA 4QQJA 1U59A 3BHYA 4LMNA 1FPUA 2W5AA 4J52A 4XS2A 1ZARA 1UNHA 4CV8A 5M51A 2ZV8A 3EH9A 2V55A 4RPVA 2IW6A 1KUTA 4NTTA 4YGAA 5EM5A 5FDPA 4JIAA 4FGRA 1XH8A 1PMVA 5IQFA 3QQHA 5ETCA 4AGUA 2GHLA 2XF0A 2UZDA 3LHJA 5KMJA 2XCHA 4FSWA 3NUXA 1PXLA 3LFCA 4LV8A 5BVFA 4IAIA 4EUTA 5C8MA 2UW3A 4Q9ZA 2CLXA 4H3QA 1XBBA 3HMPA 5AP0A 4DBNA 4I5HA 1K2PA 3QZFA 4MD7E 2IO6A 3UOJA 4GCJA 3AC2A 5ANIA 2XH5A 3JPVA 3OCGA 2C3JA 2WMBA 5DFPA 4U45A 5JRSA 5KE0A 3RWQA 2QD9A 3WF7A 5KZIA 4XG8A 4W4XA 5KO1A 2ITNA 1CKPA 4AGDA 2ITXA 1YOJA 3UMWA 3ZYAA 3FZ1A 5IA3A 3GXLA 1CKIA 4L9IA 3UE4A 1GNGA 2ZB1A 4FVPA 4EJNA 4RJ5A 4BYIA 2A27A 2GQSA 3VN9A 5M08A 3C0GA 4L53A 4W9WA 5BVNA 2ZDUA 4IWQA 2A4LA 4FTUA 2F2UA 4FKTA 5J8IA 5LARA 4QMVA 4FX3A 4LGGA 1UV5A 4XV9A 1Q97A 2WMTA 4RIYA 4WOVA 1OIRA 3IOPA 4ZIMA 2CCHA 2KULA 4GKHA 2ITYA 4OGRA 4FV0A 5G6VA 4G6OA 3LOKA 3JUHA 3HDNA 4XV1A 5HNGA 3Q9XA 3DAJA 3TXOA 4X2NA 3S95A 3NMUF 5E8WA 4C8BA 3PVUA 3SAYA 2W99B 3DDQA 3BYVA 3G0FA 2Z7RA 2JDTA 5E7RA 4ITJA 5GZAA 5D9HA 2VO3A 3LQ8A 3PFQA 4KIKB 5CF5A 3C9WA 1SMHA 1JVPP 1TKIA 3NUSA 3CEKA 2YCFA 2C30A 3TV7A 4B0GA 4NFNA 3PY0A 1Q24A 4RZWA 5CU4A 5DVRA 1KE6A 5M07A 2G15A 4ZJIA 5LJJA 1T46A 1JSVA 3CPCA 3RAKA 3V04A 3D2KA 3O96A 2ZOQA 1M14A 1R0PA 3PVGA 4USDA 5CENA 4S33A 4JQEA 3SXSA 1H1RA 4UZHA 5JEBA 2CMWA 2I0EA 5M4UA 4AX8A 2PUNA 4IB1A 2NRYA 4DFLA 2I6LA 3RKBA 4U44A 4OTDA 1YOLA 2PE1A 2QO7A 3P7AA 4HGLA 5I5ZA 2ETRA 4JBOA 3PE2A 4RFMA 2OIDA 4QP2A 3SA0A 3GU7A 3WOWA 4FSZA 3QD3A 4LOQA 3KB7A 1U54B 4K9YA 4AG8A 2X39A 4G9RA 4R1YA 2H34A 2VWZA 4Y46A 5CEPA 1Q8YA 3VVHA 5TE0A 2QURA 4FKPA 3KK9A 3NW5A 5J1VA 4M8TA 2XM9A 5E9EA 1ZXEA 3NZ0A 3VRYA 4C4FA 4HYSA 1XR1A 2WXVA 3OMVA 4DG3E 4QYEA 3R22A 4M7IA 5DGZA 4IB5A 4BDJA 5M4CA 5AR2A 4EK5A 3QXOA 5M56A 2F9GA 2QC6A 4ANBA 2RFNA 3MSSA 4FYOA 4AZVA 1AGWA 4I0SA 4FV4A 5I9VA 1LR4A 2X81A 4FV6A 4X3JA 4MYGA 1H26A 2F4JA 2WOTA 3R83A 4Z3VA 5KBRA 2V5QA 5D11A 3ZSIA 5KMMA 4GU9A 4C3FA 2PZPA 4PPCA 4JQ8A 2VWWA 2BCJA 3NNWA 4QNAA 3WF5A 2Q0NA 4LG4A 3KULB 2RF9A 1J7UA 4GEOA 5HVJA 2WTJA 4M13A 2W96B 4DEIA 4GKIA 2GPHA 2PULA 4RRVA 2C1BA 2XMYA 2WIPA 4AT5A 3QTUA 4ZTMA 5BVEA 3PG3A 2I0YA 2X4FA 4U40A 4X3FB 5FEEA 3QZIA 2JGZA 4C2VA 1OL2A 3IW7A 4KSPA 4NU1A 4X2JA 2UW4A 5AADA 3QRJA 4D1SA 4JIKA 2WU6A 4CLJA 1H00A 2R3FA 5I9ZA 3SD0A 4IB3A 3MJ2A 4QMWA 2VTTA 4YC8A 4TWOA 2UW7A 4FVQA 1B39A 1F5QA 2VZ6A 3OW4A 3R1NA 5LWNA 4H05A 4ANSA 2A19B 1KE9A 2CKEA 4GT4A 4IACA 2ZM4A 2PVKA 4OBQA 3F3VA 4RX9A 3QU0A 5DH3A 1Y57A 4TYHB 1TQMA 3E7VA 3HMOA 3KN6A 3MFTA 4QTBA 4XBUA 5M06A 4QT1A 4DBXA 3BEGA 3BZ3A 4BWKA 5LVNA 2BTRA 3I6WA 3DNEA 2OFVA 3AC4A 4FKJA 3L8XA 2VTHA 2R3GA 3TACA 4FZ7A 3DCVA 4ZS0A 4D9TA 3KVXA 3FE3A 4Z7HA 4EH8A 2JDSA 3H0ZA 4YLJA 3PLSA 3PXZA 4J53A 5EM7A 1NA7A 5AR8A 3TNHA 3I6UA 3U6IA 2C6IA 2WU7A 4DFNA 3PRFA 3ZUVA 4PPAA 4BCFA 5M09A 1J91A 4FZAB 4FSYA 4NT4A 4U80A 4EBVA 2JD5A 3QF9A 4AN2A 3DV3A 3PPZA 2ZJWA 4BZDA 3LCOA 3PSCA 4PF4A 4DG0E 4PUZA 3DFAA 2UZVA 1SVEA 3C0IA 3H0YA 1FVVA 3BHUA 3E92A 4IQ6A 4RIWB 4XRLA 3WILA 4AFJA 5HBEA 4IX6A 2BR1A 4MD8E 5DR2A 4MK0A 5DR6A 4CZUA 3VS6A 3H30A 5HX8A 3CTJA 3TJCA 5FM2A 1YRPA 3B2TA 4FIJA 2PVHA 4GK4A 1P4OA 1XBAA 3IDBA 2QG7A 3OFMA 1PXIA 2OZAB 2EB2A 1Q5KA 4KRDA 5JQ8A 3SX9A 3D14A 4FODA 3GQLA 5DEYA 4JT3A 2W1IA 4L44A 4QTEA 3E3PA 2FA2A 3UVRA 4L46A 3FMHA 1CDKA 3LFEA 2HZ0A 2VTJA 5L2WA 3BYUA 3UNZA 3OCSA 1WBOA 4IZYA 1GOLA 1YXSA 2BKZA 2ITUA 2GS2A 4F7JA 2Y4PA 5FGKA 3G15A 4ZY5A 4ASDA 3TUDA 2WMVA 5AMNA 4EC9A 5JQ5A 4EK4A 2YM7A 2ZMDA 1WBWA 3EIDA 3ORMA 4IAAA 4ZTNA 3MTFA 3WZKA 4IAZA 2IJMA 3KVWA 4QMLA 3UG1A 4BKJA 2BALA 1YWVA 3DAEA 4C4GA 2XEZA 4PQNA 4ZJVA 3FI8A 4EHEA 4YHTA 3G90X 2WQOA 4CCBA 1ZY4A 3NDMA 3OS3A 1UWJA 2W0JA 3EL8A 4USFA 3IG7A 3EQGA 3RK9A 4DT8A 2V7OA 3PSBA 2ETKA 2YCRA 4Z9LA 4F99A 3D5UA 2I0VA 1OB3A 1AD5A 5HE1A 4AF3A 4K6ZA 4MCVA 4M97A 3M1SA 5L8KA 3F5XA 3CSVA 3HA6A 2XEYA 5CTPA 4C7TA 4HPTE 3FQSA 5EYDA 4O7LA 4K1BA 4BCHA 3QALE 4USEA 5ANKA 4LRJA 3KU2A 2UW0A 4GIHA 5AIRA 3TTJA 4A4LA 4WKQA 3U9CA 2BDFA 2RL5A 4FTOA 2QU5A 4IVAA 3P5KA 3VHEA 2YM5A 4U42A 2F7ZE 1UKIA 1R1WA 4E6DA 1KE5A 3DBDA 1EH4A 3Q5IA 5GNKA 2BKKA 2YDJA 4BHNA 4AUAA 1ZMVA 4LGDA 3W2CA 1Z5MA 3OP5A 3NAYA 2FVDA 2WEIA 4O7YA 4S30A 4JBVA 4MX9A 2F2CB 4IM0A 3VO3A 2J6MA 1VEBA 3VUGA 3VWAA 4IB0A 4WSQA 3R8PA 5DRBA 4BCJA 2LAVA 2UUEA 1Q3WA 4IVCA 3ZLWA 5A4LA 4OTHA 5ACKA 5LMKC 4QMPA 4QPAA 3TEIA 3R9RA 4Q5HA 4TTHB 1GIHA 2XNMA 4PL3A 2VWVA 5F20A 1DM2A 4EOKA 2Z60A 2BIKB 1KV2A 4HZRA 4OBOA 3RZFA 5H8EA 5ANEA 3ZO3A 4BGQA 3R1YA 4D5KA 4JQ7A 4FYNA 4CXAA 3ORNA 4G1WA 5FBNC 3SV0A 4BB4A 1BL6A 3GT8A 3L9LA 3R02A 3FXZA 3OTUA 4JAIA 4BTKA 3R6XA 2XNPA 4ZSAA 3UPZA 2B9HA 1FVTA 3U4UA 4I5MA 3FHRA 4PY1A 3DFCB 4QYGA 2CJMA 4A9YA 3AC3A 3EYHA 1L8TA 4F1OA 2YZAA 3TI1A 3BE2A 3WZDA 3SLSA 3IGGA 4UMUA 2J5FA 4IZAA 4Z55A 2VTPA 3GEQA 3UVQA 3KREA 2ZAZA 4XX9A 3DK6A 3QBNA 3V8TA 3FMNA 4D2TA 4W9XA 4DEDA 1QPCA 4FV1A 2W05A 4RA4A 2ZDTA 3FL5A 4IVBA 5HTIA 2J4ZA 4FSTA 4IXPA 1LEZA 2XBJA 4QMSA 2VNWA 4S2ZA 4I0TA 3EOCA 4AT3A 4EQMA 5IF1A 1WVWA 2G2IA 2WOUA 4KWPA 3R9NA 3RPYA 3EQHA 4CCUA 4EWQA 4E1ZA 1W84A 4UWYA 4G3GA 4ZSLA 2OXDA 2C6DA 2EB3A 2H9VA 2ZV2A 2OF4A 4I22A 4FUXA 2FO0A 3PA5A 1WCCA 3ZXZA 5AM7A 5ITAA 3HAMA 4X2FA 1U5QA 3TNPC 3QTIA 3FMEA 2HELA 4S34A 4ZLYA 4MF0A 4PX6A 4U3ZA 5ANOA 3UG2A 2WFYA 4RSSA 3QD0A 4ZMEA 5E90A 5EH0A 4F4PA 3P1AA 5A6NA 3PJ2A 4F0IA 2WTCA 3WARA 4BCKA 3E8EA 3L9NA 2JKMA 3ZRKA 2EXCX 2R3QA 3A4PA 4G16A 1NW1A 4ZMFA 4WRSA 3LFQA 5LMKA 4XP0A 5FTOA 4NJ3A 4M3QA 1OIQA 3UO5A 5IKWA 3HGKA 1W8CA 3GC7A 5CAPA 4M14A 1OVEA 3MBLA 3VQUA 4R78A 2Y6MA 2X9FA 2Y7JA 3BV2A 3FY2A 3POZA 4JAJA 3WIGA 4XYFA 4MF1A 1HCKA 3MFSA 3FDNA 3NW7A 2C6OA 2F7EE 3QC4A 2J9MA 4YJVA 1IRKA 3A99A 5KHXA 4RX7A 4R7HA 3ZLYA 5DEWA 2CLQA 4N4SA 3E7OA 4RBLA 4D2SA 5IH5A 4YO4A 1W7HA 4RJ7A 4V04A 3QKKA 3RPSA 3MY5A 4FSMA 4U79A 4I3ZA 3LM0A 3KXNA 2ZV7A 4M15A 2BUJA 3WYXA 1S9JA 1UU3A 1XKKA 2BRGA 4AS0A 2QHNA 2V7AA 3ITZA 2H96A 4F6WA 2PVFA 4E4XA 2QCSA 4FIFA 3FZSA 2ERKA 3DBEA 2A2AA 4MXAA 3PA3A 5AUVA 2W5BA 3DQWA 5EFQA 2GQRA 3ZFYA 2QQ7A 4WNMA 5CU3A 3VUKA 2QODA 4DGMA 5BUIA 1JKLA 3LXLA 3O2MA 3MIAA 5C27A 4F7LA 1UNGA 3MVLA 4FSUA 4EQUA 3O8TA 3R7VA 2AUHA 3PIZA 4K77A 4DH7A 3LFNA 4G5PA 2PVLA 1H1SA 3CIKA 4G17A 4MHAA 1JNKA 3TUCA 4E6QA 1G5SA 2Q0BA 2XKCA 4XP2A 2W9ZB 4BCPA 3QQUA 4CMOA 5LWMA 3O51A 4XP3A 3V01A 2QOFA 4HOKA 4FKVA 5BUJA 4YZBA 4R3PA 4X6RA 3C51A 2FSOX 2C0IA 4FEQA 3DA6A 2C6LA 2RFSA 3QA0A 4HNFA 3R8MA 3TDVA 2W17A 4WHZA 2ITVA 2ITWA 4RX8A 4DLJA 2C5YA 3M11A 1T45A 4LUEA 3ERKA 2OZOA 1XH7A 3MDYA 3W8LA 4NTSA 5CLPA 4B8MA 2EXMA 2GU8A 5L8LA 5EYMA 3O17A 2CCIA 5LCKA 4GK3A 2PMIA 4YO6A 4RWIA 4U7ZA 3EFWA 4AT4A 4D1ZA 5KMOA 4L7FA 2X6DA 3Q52A 4RIYB 4YR8A 4E8AA 3UIBA 4LV5A 3RM6A 5FTGA 4RJ6A 3IDPA 3AD4A 4KAOA 3P4KA 5D1JA 4TNBA 3Q60A 3QKLA 2W1GA 3QUEA 3UIMA 2IWIA 3PPJA 3MPTA 2QLUA 1M52A 3GNIB 4MBLA 4YTHA 2VAGA 3OOGA 5CVGA 4CKJA 3QZGA 2HY0A 2G1TA 2KTYA 3EN4A 1MQ4A 4O83A 2XK4A 4QQ5A 3HV6A 4KINA 3D7ZA 3MS9A 1SVHA 2XA4A 4F70A 5AR5A 1AQ1A 3FQHA 4LL5A 1XBCA 4ZK5A 2PMNX 4HYIA 2BAJA 4L68A 1Z57A 3UPXA 4DTBA 5DIAA 3IECA 4UWCA 1JQHA 4DEBA 3UOHA 2UZEA 5ETAA 5BYYA 4WG5A 1H0VA 2XIRA 2IG7A 2VU3A 3PIYA 4H3PA 1PY5A 5GZ9A 2XK9A 3NUUA 5LCJA 4J96A 4MAOA 4ZSGA 4QNYA 3M2WA 5AUTA 4BR3A 5DNRA 2WMXA 3EN6A 4EL9A 3MESA 4A9SA 4BCQA 1UKHA 4KKEA 4CFNA 3QD4A 3QTXA 5TOZA 4S31A 4X21A 4Y73A 3SOCA 3UC4A 5LVLA 4ZP5A 5CWZA 5TT7A 2C6KA 4CFVA 5EW9A 4CQGA 3UZTA 2OSCA 1BYGA 3SHEA 3OBJA 4WNKA 4ZXTA 2C5XA 3CJFA 1JBPE 3FAAA 4W8EA 3VNTA 4A07A 5JK3A 4Y83A 3REPA 4DLIA 3I4BA 4TWCA 2HIWA 1VYWA 2YZLA 2WQNA 4FR4A 4NZWB 4JG6A 4G31A 3SXFA 5K5XA 1TVOA 2XYNA 5T6KA 2OLCA 3ATTA 4R6VA 5I0BA 3NYVA 3EQCA 3A7HA 5AR3A 3LMGA 2ITOA 4H3BA 4E6CA 2R7IA 4UYNA 4J99A 4F1MA 5JFSA 5M53A 4YJSA 3B8RA 3R1SA 2W7XA 1Q3DA 2VTRA 2GTNA 4TYJA 2WMRA 3V8SA 4AZTA 4ZY4A 3HMNA 4Y72A 2PVYA 1Y91A 1YHSA 4C38A 1E9HA 4I41A 2BIYA 3R7OA 3Q53A 4O6LA 4YZNA 2JC6A 3C7QA 5I9UA 4IWDA 3Q32A 4O2PA 1W82A 5AR4A 3VF9A 4F09A 4KBCA 4II5A 3HVCA 5EOBA 5KX8A 5AA9A 4EBWA 3LXNA 4PV0A 4DFBA 3KCKA 2QOLA 4BGGA 1FGIA 3CR0A 3BX5A 2CDZA 1JOWB 5AA8A 4JR3A 1ZYJA 3FI4A 4YHFA 2B52A 3VF8A 3W2OA 5M55A 1ZOGA 3KL8A 4PNKA 2BHHA 5CY3A 1FINA 4JJRA 1KOAA 4R5SA 4I23A 3F66A 4IADA 3PVWA 4NM5A 4EOJA 4PNIA 5IQIA 3DDPA 3BU3A 3DTWA 2WMQA 4C02A 1YXXA 2XNBA 5DMZA 1RQQA 2UZWE 3AT4A 3O7LD 5IEYA 3WZEA 2YDKA 4ONAA 2WQBA 4UZDA 5J7HA 4F9YA 3DJ7A 3RAIA 2ZM1A 2C47A 3D2IA 4V0GA 4GUEA 3MB6A 4DFXE 2G9XA 3QRUA 3KN5A 5AP1A 4FC0A 4L43A 5FEQA 3V51A 5IG1A 4DCAA 3JYAA 3LE6A 4E4MA 1R39A 1F0QA 3O7LB 2XK3A 2J51A 4F64A 4RC4A 3R7IA 2EVAA 2PUPA 4RVTA 4AW1A 3KFAA 1XWSA 4DH3A 4YTCA 4HGEA 1REJA 4AAAA 1OKWA 3NSZA 3R7GA 3EQIA 3G5DA 1X8BA 2XK7A 3QUPA 2RG5A 3PXFA 4LYNA 1ZYDA 4O2ZA 3ZSGA 5J7BA 4EOOA 4FK6A 2HOGA 1Q8WA 4I24A 4NIFA 2VTNA 4A9UA 4ASZA 5AM6A 1PMUA 2R3NA 4HVGA 3QQLA 2R3MA 4UBAA 4XG9A 3LLTA 1U4DA 4FUYA 3RNYA 2X8IA 1HOWA 2VX1A 3LCDA 3LFSA 1YDRE 3DJ6A 3FKLA 4AW2A 1YWRA 2WGJA 3KRWA 2QOOA 5HESA 3I0OA 4I94A 4QP8A 5FBOA 4ZZNA 5M4FA 5M4IA 4PTEA 1O6YA 3O8PA 3Q04A 2WZJA 5AP3A 2VWUA 2PUIA 5HLWA 2VO6A 1YVJA 2R3RA 2WKMA 4BKZA 3QTZA 4CKRA 3NNUA 4JX3A 2HY81 4EKLA 4AWIA 3SXRA 5AAGA 2FB8A 3NIEA 3D5XA 4OBPA 4MNEA 3AMAA 3OBGA 5BYLA 1GIJA 4YNEA 2YWVA 2BROA 5CNOA 4DFZE 4HGSA 1ZLTA 4F6UA 4HYHA 3EB0A 2W1ZA 2HZ4A 3EN5A 3A7GA 4Q9SA 3R28A 5LXMA 3V3VA 4G3DA 4PMMA 1H24A 1URCA 1PYXA 2JIIA 3D94A 4OTRA 1G3NA 3UZRA 3MA6A 5AEPA 3R7YA 5EW3A 2ITTA 2VX3A 4RQKA 4YSMA 4FV2A 4BTMA 4DGOA 2PUUA 3PG1A 4ZJJA 4DGGA 3DS6A 4N70A 3C13A 3ZRMA 5GIPE 4RJ3A 4C61A 4QP9A 3BLRA 4I1ZA 5HTBA 2AYPA 2CN8A 5KMIA 4IM3A 4P5ZA 3IKAA 1MRYA 3WZJA 3S00A 5L6OA 3AMYA 4YMJA 1O6LA 5A4EA 3FPQA 5BNJA 3BIZA 3QGWA 3EWHA 3CP9A 4TRLA 3KXXA 3UIXA 1H01A 2OWBA 3AT3A 5HBHA 3SVVA 4ACGA 1PXOA 5GJFA 3DBCA 2J7TA 3EMGA 3KRJA 3EJ1A 4IAYA 4IHPA 4BDCA 2OF2A 3G33A 1JPAA 5AIKA 3F7WA 2GNGA 3C50A 4KKHA 4L3JA 3R7UA 3HUBA 3GU5A 4YJRA 2W1HA 4IAFA 4AW5A 5HD4A 2WMWA 4FKUA 5BPYA 1YXVA 4KIOA 3FMMA 1B6CB 2J0JA 5IA1A 4EYMA 4RX5A 4FL2A 4FSQA 3EQDA 2R9SA 3ENMA 4HPUE 3KF7A 4RT7A 1Y6BA 2PY3A 1PKDA 1YDSE 3HRBA 5JGDA 2NO3A 5AP5A 5FEDA 1UU9A 4AACA 3Q4CA 4O0TA 4KS7A 5L2TA 4M67A 2R7BA 5HICA 2VTAA 4DINA 5M44A 3UODA 5DWRA 3EZVA 3QWJA 2GMXA 2O2UA 3UZPA 3HX4A 3COHA 4L45A 4M0ZA 3AD5A 4IBMA 5CI6A 4RVKA 3NVKI 4JDKA 4G3CA 2A0CX 3BYSA 3HV3A 4Z16A 3LMIA 4LL0A 5IMEA 3ZEPA 3LFAA 3HRFA 1WBNA 3P78A 3W2SA 4WUAA 4MXXA 3CJGA 5EKNA 3AOXA 2EU9A 4Y8DA 3R7EA 4TY1A 4O7WA 5D41A 5CT0A 4B9DA 2R3KA 4ALWA 4EOQA 2UW6A 3NIZA 4YJUA 5JRQA 1F3MC 5LQFA 2HWOA 2PVJA 3PPKA 3ODZX 4FOBA 1BUHA 3QCSA 5FP6A 2IPXA 4CSVA 5LVOA 2Z7QA 3GOPA 5DYJA 4FKRA 2W4KA 4PMPA 3AGLA 4ZTRA 3T9TA 2PSQA 4YC3A 4QMUA 1ZOHA 3HRCA 3VBWA 5LMBA 1CM8A 4H36A 3QQGA 2R3PA 4KIPA 2BZJA 4HJOA 3PRIA 4L01A 2PK9A 3GCVA 3CQEA 4YPSA 3G9LX 4I5CA 4DN5A 2QNJA 4GSBA 5EDQA 5HE3A 3KA0A 2PMOX 3TL8A 3R04A 3LCTA 2B1PA 4ZLOA 2YAAA 4AQCA 1QPJA 3KRLA 4GRBA 4FTLA 4FTQA 3QLFA 3FY0A 5ACBC 2P3GX 2H6DA 5FG8A 3Q2JA 4C0TA 5HVKA 4ACCA 3RK7A 3EN9A 3ACKA 3KF4A 5IQDA 4BGHA 4KS8A 2C3LA 1H4LA 3A8XA 3KKVA 2RKUA 3NWWA 4J8MA 5DRDA 4CT1A 3OD6X 4D4RA 1JLUE 4IFCA 3ZC6A 5CEMA 2OW3A 1OITA 3R8UA 1V1KA 3OT8A 4UV0A 5HKMA 3RCDA 2QU6A 1OKZA 2ZM3A 3FMKA 4CVAA 4KNBA 4ERKA 5J1WA 4EC8A 2XNNA 3JY0A 5EOLA 3DZOA 3VHKA 3HP5A 2UVYA 5HLPA 4QQTA 1TQPA 5CEIA 4QQCA 4RG0A 1IA8A 4I5PA 3ZBFA 5F9EA 3V5QA 1A9UA 3LZBA 4J97A 5BUEA 2ZYBA 2B9FA 5IEXA 3GFWA 2QOBA 3NUYA 3CTQA 3VIDA 3GGFA 3RI1A 2WPAA 4CFUA 2C69A 2QKWB 5AV4A 3I0QA 2YIWA 4W8DA 5I9YA 2EXEA 4QD6A 4ZZMA 5M57A 1JKSA 2HENA 3E88A 2ITZA 3KRRA 4U5JA 2P2HA 3W2QA 5AV0A 4D2RA 4F9WA 4MBIA 5K9IA 4H1JA 3QHRA 4MXOA 2GNIA 4I6QA 3SQQA 2JKOA 3VUDA 4BI2A 3VS1A 5HNIX 2IVSA 4WA9A 1PF8A 3V5JA 4ANMA 4MBJA 2OJJA 3FI3A 3NUAA 4FTRA 3VQHA 1SNXA 4FVRA 3VS0A 3WIKA 2DQ7X 2UZOA 3N4UA 3EQFA 3T9IA 4CT2A 5HIBA 1YDTE 1UA2A 2XIXA 3FLYA 4PL4A 3EQBA 4IX5A 5D10A 3D5VA 3R71A 3FQEA 3MJ1A 3FLZA 5E8YA 3R8LA 4WSYA 4M84A 4O27B 3MH0A 4EOSA 3G51A 4FV9A 4RFZA 3FMJA 4RJ8A 4QP3A 5JGAA 4HW7A 2VV9A 5KKRB 3IGOA 2X1NA 4IX3A 5CQUA 5JMSA 4GYIA 4MQ1A 3SDJA 4CTBA 5LVMA 4FV7A 5EDRA 5A6OA 5CEQA 2BHEA 3GUBA 3Q9YA 3OHTA 5AUXA 3R21A 4O0XA 3OVVA 4IM2A 4I21A 4FT0A 2VO0A 5GZ8A 3ZO4A 4GS6A 3A7JA 3UO6A 4FICA 5HORA 3R73A 3W16A 1MUOA 4O0RA 2Y4IB 5EM6A 2O65A 4L8MA 4UN0C 3ORKA 3HV7A 3JS2A 3KGAA 3ALNA 5IU2A 3LCKA 4FZ6A 3UMXA 2JBOA 4YZDA 2AC3A 4EOIA 3GI3A 5E8VA 2VD5A 4E4NA 5IQBA 2R2PA 1PRYA 3I7CA 4F08A 4YSJA 1RDQE 4GT5A 3K2LA 2XBAA 3KCFA 4UX9A 4M69A 2W1CA 4G9CA 3FMDA 4MXCA 5C26A 2RFDA 2I40A 5FP5A 1BI8A 3I5ZA 5CASA 3U6JA 1J3HA 4EH6A 3RINA 3SKCA 4CKIA 2BZIB 3ULIA 5JT2A 4FGBA 4NCTC 2WTKB 5H2UA 5BYZA 4EKKA 4GH2A 2GHMA 4EOMA 3VS3A 4IE9A 3CD8A 3L9PA 2YERA 1LPUA 2Z7SA 5IQHA 2UV2A 5AJQA 1FBNA 4C4IA 3LXPA 3L8SA 2R3IA 4AZSA 4QP4A 5CNNA 5CU0A 1NXKA 2OH0E 1JSTA 3AD6A 4UMPA 4WNPA 2HW7A 2OICA 2BZKB 5FXSA 3U9NA 4RC2A 1GZKA 2R64A 5CSVA 5IA0A 3G2FA 3N51A 5DG5A 2UVXA 3EKKA 4J95A 2BVAA 5K4JA 2C6EA 2XNOA 2IVVA 3BPRA 4C37A 2JDVA 3K3JA 1SNUA 4AGWA 3V6SA 2QO9A 4KBAA 2CHLA 4QP7A 3F7ZA 3BU6A 4CRSA 1Q8UA 4AZEA 2BRMA 3R1QA 3OUNB 5A14A 4Y5HA 1GZNA 4DEEA 3O71A 5CVHA 4TWNA 4WNOA 3HKOA 5CX9A 5AUZA 4YURA 1ZYSA 3LVPA 3KXZA 3AG9A 3L1SA 3AQVA 2R0IA 2X4ZA 2IW8A 4DH8A 4EQCA 3WF6A 4RC3A 1OUYA 3ALOA 4EH7A 3NCGA 4I4FA 5EM8A 1GAGA 3QUDA 4C35A 4D0WA 4CRLA 1KSWA 4FKSA 4IFGA 1JWHA 1BKXA 1GY3A 4GVAA 3TWJA 2PYWA 3HL7A 5CAVA 4BDAA 3NLBA 4ENYA 4MWHA 5ETIA 1HCLA 4IZ5A 3SRVA 4TKSA 1IAJA 2NPQA 3K5VA 4MH7A 1BI7A 2X8DA 1G8AA 5DBXA 3AMBA 1STCE 5AX3A 1ERKA 5HZNA 4KRCA 1BL7A 1PMEA 4GJ3A 2ZV9A 3NNXA 4H39A 5DR9A 3ZO1A 3F3WA 2C6MA 3BV3A 4RGJA 4YJPA 5L6WL 4RJ4A 3ZBXA 1Q4LA 5E91A 3HMIA 4X3FC 3MA3A 2JLDA 3QHWA 4NCTA 5HD7A 5CXHA 5CSHA 3ETAA 1H07A 4EH9A 2V0DA 3PP1A 3R00A 4FT3A 4DGLC 4FTJA 3BWFA 4F63A 1PXMA 2UZNA 4TL0A 3R8VA 4FE2A 3FXXA 4V0GB 2XRWA 3ET7A 3E64A 3IOKA 3C4XA 3DPKA 4G34A 3JVSA 3R30A 5BVWA 4U41A 2QHMA 4I92A 4A7CA 3IO7A 4DCEA 4E20A 5HBJA 5AV2A 3UDBA 3F2RA 5IQCA 2OFUA 3UTOA 3PJCA 3WE8A 4O7VA 1M2QA 2QVSE 3ZUTA 3II5A 4IC8A 5KUPA 4C59A 4O96A 4ZSJA 4GV1A 1GZ8A 2IVUA 2B55A 1KE7A 2Z8CA 2XNEA 4G5JA 4NYEA 2GFSA 4L3PA 2WAJA 2RSVA 4LOOA 3FXWA 2F57A 2JAVA 3R9OA 4NIFB 5HG9A 3T8OA 3UQGA 4F9BA 1XJDA 4QYYA 3IQ7A 1NVRA 1PYEA 2P33A 4NJDA 4DEHA 5HOAA 4XLIA 4OT6A 4GU6A 3CD3A 3OY3A 3KMMA 5HO7A 4ANLA 1B38A 1M7NA 4S32A 5G1XA 2F49A 4FTNA 4IJ9A 2CKQA 3C0HA 1OL5A 2JIUA 3UP7A 1JAMA 3WZUA 4W4YA 4D28A 1REKA 3VJOA 3PUPA 2YA9A 3VBVA 4JR7A 2WTIA 4YZMA 3U51A 4XNEA 4EI4A 5JH6A 1V0OA 5JFXA 3VBTA 1OIYA 3ZOSA 4IW0A 5KBQA 1Q61A 3FEGA 4CD0A 3E8NA 4DT9A 4XMOA 3HEGA 4E73A 3AC8A 4BDDA 3C5IA 2YM8A 2YM3A 3P7CA 3ROYA 2XKDA 2C0OA 3HLLA 5EKOA 4IMYA 4NW5A 2HCKA 4JDHA 4MNEB 4DG2E 3BGZA 4CMUA 3NNVA 4DFUA 4JS8A 5K5NA 5A4TA 5AP2A 5IH6A 3DQXA 4WBBB 3OG7A 4Y95A 4J7BA 3ZH8A 4GL9A 3CY3A 1JSUA 5HCZA 2BZHB 4FF8A 5KMNA 4C2WA 1PXNA 3IDCA 4XOYA 4D5HA 1E1VA 3TKIA 4L3LA 3A4OX 3GENA 4KSQA 1FMKA 3MPMA 4RWLA 5K3YA 4XEYA 3ID6C 3L8PA 2OKRA 3OWPA 4FTAA 4UMQA 2VO7A 4BDGA 1OL7A 4ACHA 1OL6A 4P4CA 5IH4A 4MXZA 4U43A 3E8DA 3RCJA 1DAWA 3VJNA 2V22A 3GP0A 2B4SB 4UEUA 5BVOA 4O0UA 1OM1A 5HE2A 4G6LA 4F0FA 4R1VA 2CNVA 4I0RA 3ORIA 4NFMA 2WHBA 5GJDA 2O63A 2XNGA 4B7TA 4C36A 3UC3A 5L2IA 4EJ7A 4DTKA 2FUMA 3I60A 4DE4A 2PVRA 3B8QA 3CXWA 3Q4ZA 3WF8A 1ZMUA 4BTJA 4LFIA 3ELJA 2UW8A 5EI8A 1WBVA 1M7QA 1JKTA 4I6BA 3DY7A 5A9UA 4NM0A 5CEOA 5JN2A 3P9JA 2JFMA 3P7BA 3QYWA 3WYYA 2X7OA 3FLNC 1SM2A 3RPRA 4GT3A 3RAHA 5IPJA 5HGIA 3DKOA 5D7VA 5HCXA 3V5WA 5HLNA 2YFXA 3FZOA 5CQWA 5E1EA 4E26A 1XH5A 2REIA 5IA5A 4FK3A 3OXZA 4MVFA 2GNFA 3EFLA 3RHXA 4N6ZA 4FSNA 4UMTA 5HVYA 4ANQA 3VBXA 5HG5A 4BCNA 2PE2A 4EZ5A 2BILB 2R3OA 2JFLA 1J7LA 5EI2A 2FGIA 5HG7A 3HV5A 3VS5A
chains in the Genus database with same CATH superfamily
2W1FA 3A61A 5CU6A 4BWPA 3G0EA 5FLFA 1YHVA 2YIQA 4Q2AA 3E87A 3PTGA 3DNDA 3UYTA 5EHLA 3E3BX 2R3HA 4U97A 3MFRA 2QI8A 4O84A 4IH8A 5EK7A 3UYSA 1UWHA 3D7TA 4WG3A 3I7BA 3UQFA 2YAKA 3HDMA 1ZAOA 2UW5A 2E9PA 2XAMA 3EYGA 4KBKA 2GDOA 3VS7A 4HGTA 5EDPA 1ZY5A 5B2LA 2OO8X 4E5AX 4KIQA 4J8NA 4QMNA 3AGMA 3COIA 3Q2MA 4NH1A 4ZEGA 4P5QA 2HW6A 4DH1A 3F5GA 4OTPA 4AU8A 2IN6A 4X2KA 5T68A 3BYMA 4ZSEA 3MI9A 4HYUA 4YNOA 4CFFA 1K3AA 4I20A 3OT3A 4AN3A 3QGYA 5EW8A 3E63A 2BAKA 2XKFA 4F7NA 3UO4A 3IK3A 4EOPA 4R3RA 4WO5A 3CY2A 1J7IA 1OBDA 4R77A 2I0HA 4LGHA 4O0YA 4DTAA 4DF3A 1XH6A 1OGUA 2CN5A 4MEDA 2YHVA 3QTSA 3BE9A 4F7SA 5C01A 1GJOA 2VTIA 3S2PA 3TIYA 4ASEA 2ITPA 4FKGA 1M2RA 4ZTSA 3ANQA 3ATSA 5EQPA 4EUUA 3D0EA 2PTKA 3H9RA 4FNXA 2XUUA 2JAMA 4AA0A 4AFEA 4K2RA 3HECA 4D55A 4D2WA 5HTCA 4PTCA 5IUHA 4BIEA 4UWBA 3CKXA 4JBPA 4XUFA 3VS4A 3BHVA 2BRBA 1PW2A 4EK3A 3LCSA 4RFYA 3SOAA 5JFWA 4QYHA 4YJNA 4L42A 4XG6A 5AUYA 2XB7A 3TTIA 4ZTQA 2J0MB 4OTWA 4IIRA 4RZVA 5ANJA 2GFCA 4DGNA 1XHAA 3ZLXA 4ITIA 4NW6A 4FKQA 1Y8YA 3FV8A 1TQIA 3PZEA 3PY3A 2JDRA 5AUUA 4KKGA 2C5OA 2OJIA 3FPMA 3L9MA 3DBFA 4QMZA 5FDXA 5JSMA 1MRUA 3QTWA 3TN8A 2DUVA 3MYGA 3EL7A 4FTTA 1FQ1B 3GVUA 3MY1A 4CTCA 5AFVA 3LMHA 2W4OA 4DITA 4NM3A 1VR2A 3FZPA 3GCQA 2JDOA 2ZMCA 3PE1A 4Y85A 4A4XA 4BZOA 2UZBA 4FKIA 3TUBA 5HIDA 1KE8A 4YBJA 4FSRA 3H4JA 2R5TA 2PPQA 5EYKA 4ASXA 1P14A 4L7SA 1YWNA 3BEAA 3LW0A 3TT0A 3FLWA 4O6EA 5BMSA 3RMFA 2VGPA 2OXYA 4LRKA 3F2NA 3ODYX 1QCFA 4FT7A 2ETMA 2PZYA 3ZCLA 2GTMA 2GNJA 4CLIA 5TR6A 4O81A 3UNJA 2Y8OA 2A1AB 4R5YA 2X2MA 3BYOA 3W8QA 3F9NA 4EORA 3NW6A 1ZZ2A 3NYNA 3VUHA 4O7SA 2AQXA 2B9IA 2O8YA 1MQBA 4FEXA 3MH2A 4O7TA 4O7NA 5GJGA 5HU3A 4RIXA 2XVDA 1BMKA 2CGWA 2WD1A 4U6RA 4C3RA 4AXAA 4EZ3A 3TDWA 3VAPA 4AXFA 1JKKA 3RK5A 3DU8A 4G2FA 3JXWA 4J71A 4UXQA 5BVKA 4OUCA 5DA3A 5DLSA 2OU7A 3GFEA 4ITHA 4O0WA 3UGCA 2YITA 4C33A 3PSDA 4JG7A 4QP6A 3E62A 3CPBA 4LMUA 1OMWA 4O4BB 1H1PA 5JKGA 3NYXA 4ZTHA 1XH9A 4GG5A 4TNDA 3A7IA 3D4QA 1M17A 3F3TA 2XAOA 3KK8A 5EQEA 2J2IB 3ZM9A 2WO6A 2OXXA 5J79A 4CGAA 3BBTB 1OKVA 4OTGA 3MY0A 4G6NA 3QL8A 1WMKA 3QQFA 2GCDA 3CQWA 4FT5A 4IVDA 3C1XA 3VW6A 2VWXA 1YQJA 2WMSA 4OW8A 3ZZWA 2PVMA 4CEGA 2G01A 2XJ1A 1R3CA 4FG7A 1Q8ZA 4C4EA 4D4YA 4D4VA 3LM5A 2EUFB 1DS5A 4QTAA 3FHIA 5A54A 2WIHA 1PMNA 5LVPA 4PP9A 3CLYA 4M69B 5L2QA 3WF9A 1ZYCA 3OXTA 4NL0A 4CG9A 4L6QA 3FZTA 1QPDA 4GK2A 4TYGA 2C6TA 3NX8A 4O21A 3FKOA 2IZSA 2VTLA 1UU8A 1VZOA 4QPSA 3SG8A 2X8EA 2W06A 3A60A 3BRBA 4HCVA 1M2PA 4BCOA 3DXPA 1CMKE 5HO8A 3K3IA 3ORLA 2YWPA 1O6KA 3NEWA 4FT9A 5HHWA 3MFUA 4LI5A 2XZSA 3AT2A 5I4NA 5C4KA 2BAQA 2QLQA 2QOIA 4JNWA 2YEXA 4KA3A 3DLZA 3TNQB 4ZAUA 2FSTX 2HAKA 2YDIA 4E5WA 3KRXA 3EFKA 3C4EA 3UOLA 3NRMA 3QCYA 5ICPA 3GC9A 4IX4A 3KMUA 5CI7A 2P2IA 2HXQA 2WMAA 2WTVA 4HCTA 3BGQA 4P7EA 2E2BA 2HZNA 2C5NA 3I1AA 2JEDA 2VGOA 3RAWA 3NUPA 3R9DA 3W55A 3TV4A 3ZM4A 2HXLA 3GBZA 2H8HA 3F82A 3ZLSA 1PXJA 3GU6A 4EH4A 3Q6WA 2JKKA 3EZRA 2HYYA 3O23A 2J90A 4O1PA 4ALVA 1H27A 2DYLA 2F7XE 3IS5A 2HZIA 3IONA 4YJOA 4U9AA 5A3XA 2YM4A 3BCEA 4YHJA 2WNTA 3GCUA 4GJ2A 3V5TA 3LJ0A 4EHVA 4JRNA 3Q9WA 3NVMB 3DZQA 4K0YA 3ZONA 3W0PA 4QMYA 4NUSA 3SW4A 1BX6A 2O0UA 2J0LA 3NPCA 4E3CA 5CANA 2ONLC 4JX7A 1OL1A 5AP7A 4LOPA 1RJBA 3CKWA 4C4HA 4XBRA 4D0XA 5IQAA 2VTQA 3OEFX 2FSLX 3PDTA 3F61A 5DOSA 4ENXA 1URWA 4JDIA 2YIYA 1PKGA 4GFGA 4X2GA 3SRVB 4CYIA 3JR1A 3BLAA 5CF4A 3CS9A 4BDFA 2B0QA 3Q9ZA 4QTCA 1CTPE 2QR8A 4QMQA 1ST4A 2VWIA 3A7FA 5KNJA 2OIQA 4K18A 3PZHA 2WEVA 4PWNA 4YZ9A 3V8WA 3CQUA 2Y6OA 1OKYA 4M66A 3G9NA 4AZFA 3OCBA 4XG4A 2P4IA 3OF0A 3R8ZA 1V0BA 1KV1A 2ACXA 4EHGA 3RNIA 3KEXA 2CGVA 3QKMA 3UDTA 4MQ2A 2VN9A 4IC7A 3CE3A 3DB6A 4YUQA 5J9ZA 1W2CA 3R0TA 2CNQA 3DK3A 4CFWA 5L6PA 4O22A 4PPBA 2OJ9A 2BDJA 2OH4A 3GCSA 4EONA 1ZWSA 5E8SA 1LUFA 2NP8A 1IAHA 2RGPA 2QO2A 4KD1A 2W1DA 2B53A 1VJYA 1PJKA 4YJQA 3SW7A 1ZMWA 3ZHPC 3R2YA 4BICA 1OPLA 5FRIA 3PJ8A 3OXIA 3OWKA 4GYGA 4E93A 2VWYA 2I7QA 5HCYA 4CG8A 2J0IA 4BBMA 3I79A 1R78A 5TO8A 4DAWA 3TJDA 3VUTA 1Q62A 3VUIA 4QMTA 3QX4A 5IA4A 3GC8A 4BDIA 4WUNA 5BX0A 5DT4A 3DXNA 3S0OA 2DWBA 4FA2A 2XJ2A 4RLKA 2G2HA 2UZLA 3EKNA 4M68A 2ITQA 4OR5A 3VRZA 5BQ0A 3LJ2A 1WZYA 5B0XA 1FOTA 5DN3A 3W0NA 4BY9E 3FKNA 3TV6A 4FBXA 3UP2A 4FI1A 5J95A 2ERZE 2C1AA 4FKWA 4NKSA 3UVPA 3FYJX 3PA4A 3DLSA 4FKLA 3FL4A 4TWPA 2OG8A 3ZMMA 3BU5A 1PXPA 4X7QA 4EK6A 3Q3BA 3OZ6A 4XV2A 4C58A 3W2RA 5JZJA 3P5JC 3W0OA 5A4QA 4OAUC 1Q41A 3KXMA 1FMOE 3OROA 2ONLA 4KUJA 5B2KA 5LMAA 4E5BA 2I1MA 3ORZA 3MH1A 4QMXA 2WMUA 3G6HA 3H9OA 4XH6A 3ZXTA 4J1RA 4BZNA 3VC4A 3HMMA 4F65A 3ORXA 2Y0AA 2J50A 4D58A 3CBLA 1DAYA 2GSFA 2C4GA 4D2PA 4TYIA 4ARKA 2IEWA 5DPVA 3PP0A 1A48A 4DYMA 5CZIA 2JKQA 4N0SA 5DHJA 4IZ7A 1Q99A 3D9VA 1P2AA 3EHAA 3M42A 1WBTA 3QCXA 4AXEA 3IPHA 4BC6A 2W1EA 3CGFA 1G8SA 3C4ZA 1RE8A 3Q5ZA 4B99A 3ZFXA 3F5UA 3NS9A 4FNZA 4DA5A 3RALA 5J5TA 2BRNA 3OEZA 3PJ3A 3ZTXA 4YTFA 2XYUA 3R63A 3Q6UA 3DJ5A 4U8ZA 4KB8A 4MKCA 4CYJA 3VUMA 4HZSA 3ACJA 4H1MA 4RQVA 5AR7A 4FRFA 3BGPA 5CALA 4AOJA 1ATPE 4LQMA 4XG3A 3NCZA 5B2MA 5E4HA 4DHZA 3FZRA 5EHOA 5HG8A 4JBQA 3HP2A 2FH9A 1KWPA 1K9AA 2QR7A 3BLQA 3C5UA 4XLVA 5D12A 4FMQA 5ANDA 3GB2A 4DFYA 3HAVA 4K8AA 4I4EA 3QC9A 2GQGA 2UZTA 2X6EA 3HNGA 4BBEA 4QMMA 3FC2A 5FM3A 1ZZLA 5HQ0A 3Q4TA 5EYCA 5FTQA 2FYSA 3ZDIA 3C4WA 2CNUA 5EQYA 2WTWA 5F4NA 3OTVA 4AN9A 3LQ3A 3BLHA 3HYHA 3G6GA 2XIKA 4CZYB 2O5KA 3NUNA 4JLCA 4F9AA 3TKUA 4FKOA 2J0KA 3SGCA 3BHTA 4RVLA 1WBPA 3MW1A 3FLQA 1IASA 4RIOA 4YPDA 3I81A 4BWXA 4QDVA 3U55A 2WTDA 3GOKA 3OCTA 4XG2A 2YISA 4LM5A 4WIHA 3E8CA 4R7BA 2R3JA 3I5NA 4ZZOA 3DXQA 2BPMA 5GIOE 3SG9A 5F94A 1E1XA 4PDPA 3R2BA 4F1TA 4U0IA 2VX0A 4EWHA 4NM7A 1Z9XA 3PXQA 3D7TB 2RFEA 4MTAA 4IDTA 4P90A 3S3IA 3ZDUA 5IDPA 3AXWA 4ZOGA 4BKYA 2QONA 2WB8A 5DI1A 1NT2A 4DEGA 1I09A 1YXTA 2HWPA 2E9UA 2JITA 4C3PA 4L52A 2C0TA 3ZZEA 3LPBA 4QTDA 4C62A 4OLIA 5AP4A 2AC5A 2CGUA 3F2AA 4LUDA 1FGKA 4NEUA 3T3VA 5IUGA 1P4FA 2ESMA 4RLLA 1V0PA 2Y9QA 4U81A 2VNYA 2JIVA 5CAQA 4BI0A 2WQMA 4BIDA 1OECA 4FTIA 3MVMA 4EH5A 5CF8A 4PP7A 3O8UA 2PU8A 5H8BA 5A46A 5E8TA 1Y8GA 3QCQA 3FI2A 4D9UA 2W9FB 4FV3A 4BF2A 3E5AA 4D4SA 4RVMA 3BI6A 2XCKA 1DI8A 3DGKA 2OJGA 4JL9A 5F1ZA 3WBLA 4B8LA 5CF6A 4I6FA 4F6SA 3MTLA 5GHVA 3FC1X 3Q4UA 2P0CA 3NAXA 2QOQA 4GMYA 1FVRA 5CSPA 5HX6A 3TM0A 4TN6A 3ZSHA 4CV9A 4UY9A 3AC5A 4PMSA 1XQZA 2VTOA 2XIZA 3O50A 5FQDC 3NR9A 4BCGA 4O7RA 1PXKA 1YW2A 1U46A 4QYFA 1H1WA 3U6HA 3QWKA 2BMCA 3AC1A 1MRVA 4IWPA 3BHHA 4AOTA 4XG7A 2C5VA 3VULA 3QAME 3KQ7A 4FL3A 3A2CA 3K5UA 3IW5A 3QRIA 3U87A 3LFBA 4FG9A 1UNLA 4GFMA 3RTPA 4ERWA 3PFYA 2Q83A 1W98A 5CSXA 3U8WA 2Z02A 2PMLX 2X2KA 3EQPA 2VWBA 4IANA 4JG8A 5AV3A 2RG6A 4PL5A 2W5HA 1OI9A 4YBKA 3DB8A 4A9RA 3RJCA 4MNFA 4XJ0A 2BTSA 3PLAE 4AA5A 5K0KA 3EQRA 3MGYA 2X7FA 2BFXA 5B7VA 3FSFA 4KIKA 2YM6A 4EH3A 4O0SA 4F0GA 3DKGA 4FL1A 1I44A 3ORPA 5AP6A 5IMXA 5JZNA 4EYJA 2YN8A 4C57A 2V62A 3CGOA 2X2LA 4AOIA 5JGBA 1OPKA 1QL6A 3QQJA 4YZCA 2YLEA 4QPMA 3QD2B 2J5EA 3V5LA 5CAUA 4DHFA 4PDOA 2PWLA 1YOMA 4O91A 4DC2A 2IZUA 2XJ0A 3F69A 3GCPA 3R01A 4MWIA 4Y5QA 5HI2A 5I3OA 4BI1A 5KMLA 4FZFB 3W1FA 4TXCA 3N4VA 5AUWA 3QLGA 4M12A 4TT7A 1WFCA 4GUBA 5CVFA 3RP9A 5L8JA 4UMRA 3PVBA 4MXYA 5E92A 4JRVA 3OW3A 4N6YA 1U54A 4BDKA 3UOKA 3W32A 4AW0A 4BTFA 2PVNA 5AV1A 3C4CA 1IR3A 3DTCA 5J9LA 2FSMX 4RIXB 4YP8A 1H08A 4FIEA 3VBYA 1P5EA 3V5PA 4M0YA 1YI4A 4AA4A 4C34A 4CFMA 3P86A 3HZTA 4OTFA 3SC1A 2WQEA 2LGCA 3COKA 3R9HA 5CSWA 5HE0A 4OAVB 3UNKA 1ZYLA 3ZC5A 2YJRA 5K4IA 4CMTA 3F3ZA 4YLKA 4EHZA 1LP4A 1Y6AA 3U4WA 2QKRA 3RPVA 2PL0A 2XIYA 4AXCA 4ALUA 2IZRA 5KKRC 3RBWA 1WBSA 3MVHA 2XK8A 3MV5A 4IJPA 3QFVA 5ANGA 2A98A 3ZO2A 4EK8A 4F9CA 4FNYA 3ZUUA 3BELA 3BBWA 5C9CA 5BMMA 3MB7A 3RPOA 4FZDB 1J1BA 2UW9A 3EFJA 3P79A 3GQIA 4IDVA 4NSTA 4O0VA 3FUPA 3COMA 3ORTA 3UDZA 3RWPA 4G3EA 4ANNA 4BCIA 2IVTA 1ZOEA 4XOZA 3Q96A 2O64A 4YTIA 2NRUA 5EI6A 3KULA 2OGVA 1WVXA 4OT5A 2C3KA 3VONA 2Y4IC 4OTIA 4UXLA 4XCUA 1APME 4O38A 2BDWA 2DS1A 2GS6A 2IZTA 1ST0A 2B9JA 4BDEA 3QXPA 4PDSA 3OC1A 4X3FA 4QRCA 4A4OA 4BDBA 1NY3A 3H10A 2JBPA 3FMLA 2P55A 3N9XA 3RM7A 2C3IB 2XALA 4JI9A 2QOHA 3W18A 4DEAA 1SZMA 3ULZA 3PUFC 4F78A 3FWQA 1SVGA 3DOGA 4WT6A 4APPA 4AQKA 3QRTA 4QOXA 4E4LA 2WELA 3OY1A 4QMOA 5JFVA 2HK5A 3H3CA 5IISA 3TNWA 4WRGA 1PHKA 4ACMA 4TYHA 4FEVA 4JXFA 2E9OA 4C4JA 2XK6A 3GC0A 4UB7A 3NGAA 1LEWA 5DT0A 4EEVA 3B2WA 2WTKC 4YLLA 5LOHA 4I93A 3FYKX 2GS7A 4R3CA 4BJJA 2VTSA 3F6XA 3RZBA 3W2PA 3DKFA 4FTKA 4HVHA 1IEPA 5CYIA 1GZOA 1IG1A 3UBDA 1WVYA 5F95A 4CFXA 4FEWA 3LKMA 5IZFA 3LXKA 1A06A 3ZS5A 2YLFA 3NFFB 3IW6A 5I9XA 1H1QA 3BQCA 4IWOA 5EG3A 4PDYA 3QA8A 3THBA 4O4CA 3PWDA 5J87A 3VW8A 1W0XC 2UZUE 2YJSA 4RIWA 3POOA 1OIUA 5HEZA 3MIYA 4O86A 3T3UA 3PWYA 2CKOA 1YXUA 5CAOA 3QTQA 4QO9A 2CGXA 2CPKE 1NVQA 2VTMA 5KMKA 4CQEA 1CSNA 3ZFMA 3P0MA 3RHKA 3V6RA 5D7AA 3WE4A 4CNHA 4LDTA 2OZAA 1Q8TA 4BRXA 4ZLZA 1XO2B 3DKCA 4FV8A 4Z7GA 4BBFA 4K11A 4QP1A 3PY1A 4FG8A 3OOMA 1IA9A 3LAUA 4ORKA 4V01A 3D15A 3GU8A 2B54A 4R7IA 5DT3A 3ANRA 3A62A 1WAKA 2OJFE 5AWMA 2W4JA 4ZY6A 5HO6A 4GW8A 3QRKA 2GNLA 3QQKA 4H58A 3LQ5A 1S9IA 1U5RA 2OK1A 3D5WA 3JY9A 4ID7A 3TZ8A 4ACDA 1UVRA 4N57A 3OWLA 1H25A 4FIIA 3OWJA 4YJTA 2OBJA 1ND4A 3E93A 1H28A 1BLXA 1H0WA 3CCNA 5AAFA 4XRJA 4EZ7A 5C03A 5CEKA 3HA8A 5I3RA 1KOBA 4I6HA 2QG5A 2X7GA 3KC3A 3PJ1A 4BVUA 4IEBA 3RGFA 3N4TA 1ZRZA 3JVRA 5HU9A 4P2KA 3PIXA 3VBQA 2UVZA 2B7AA 2R4BA 4ANOA 1W83A 4AZWA 3P23A 2YABA 2E9NA 1YI6A 2NYAA 1RW8A 4XHKB 1MP8A 3O0GA 2RIOA 4XV3A 3ZEWA 3KXGA 4TW9A 3QTRA 4BYJA 4V05A 5EHYA 5C1QB 3A8WA 3FJQE 4B6LA 5IDNA 2YIRA 4FOCA 1OUKA 1YHWA 4RMZA 3F88A 4KABA 2GNHA 3TNIA 5J9YA 4FTMA 2XS0A 3P08A 2Z2WA 1QPEA 4NK9A 5CZHA 4UALA 5H3QA 2O3PA 3TIZA 3UQCA 3S4QA 2ZVAA 2ZB0A 3MN3A 4HVDA 5IUIA 4HVIA 4O7ZA 3DAKA 4X6QC 1QMZA 3CC6A 4EOLA 3MH3A 5C8NA 2OIBA 3TG1A 4ZS4A 1VYZA 3EN7A 3UJGA 2PZRA 3ROCA 4FNWA 3WI6A 4DH5A 5H8GA 5DE2A 4L67A 2OI4X 3LFDA 1NVSA 4G3FA 4K33A 2XRUA 2YCQA 1SYKA 3BWJA 5IEVA 1OZ1A 4A9TA 4RA5A 5TF9A 4B4LA 4AP7A 4NWMA 3PXYA 2YCSA 4TYEA 5IA2A 4LRMA 2CSNA 3LJ1A 4J98A 3F5PA 4Q5EA 5TKDA 3ZRLA 4TZRA 1GIIA 5CU2A 2EWAA 5IQGA 3BKBA 3DBQA 5I9WA 3OUKA 4FEUA 4TPTA 1R0EA 2BRHA 5C8KA 5IQEA 5CT7A 2XP2A 3D83A 1YI3A 5HNBA 4RWKA 4YC6A 2PZ5A 4E6AA 4L00A 4BDHA 5J5SA 1J1CA 3U54A 3TKHA 4HVSA 3F3UA 4NKAA 4O1OA 4EH2A 5FXRA 4WD5A 4FIHA 3S1HA 2QOKA 1TFFA 3HV4A 4D1XA 5HIEA 4U3YA 3KY2A 1OPJA 5CS6A 3K54A 3LFFA 4GFOA 2X9EA 2PZIA 4PMTA 5AX9A 4RWJA 5L2SA 3W0MA 2SRCA 2GHGA 3PXRA 2PE0A 4GVJA 2XM8A 3NYOA 4JOAA 3ENHA 1OBGA 5E1SA 3PYYA 3FSKA 5ETFA 4BFMA 4IAKA 3TZMA 5AAEA 3TZ9A 4BN1A 5C4LA 5A4CA 4UYAA 2Z7LA 4FTCA 5KZ0A 3C4FA 4R8QA 2QOCA 2R3LA 4GG7A 5FD2A 2C68A 3LLAA 5KHWA 5K0XA 2VRXA 4D2VA 3KXHA 4E7WA 1CKJA 4FV5A 2YIXA 4AGCA 4PTGA 4JVGA 2XKEA 4APCA 5E8XA 4CZTA 3KMWA 4AE9A 1H8FA 3VS2A 4W4WA 4O4FA 4BCMA 5BVDA 5L3AA 5GINE 3QZHA 2BFYA 4FIGA 2IW9A 4JDJA 2NNWB 2VUWA 3QX2A 2CKPA 3TZ7A 3UIUA 5E8UA 2G2FA 3ZU7A 4MD9E 5H9BA 4HNIA 1XH4A 4BIBA 1DI9A 1UU7A 2YACA 4QEBA 4O82A 4OTQA 2X0GA 1YKRA 4W4VA 4WBOA 4ZTLA 3FLSA 4GIIA 5T3QA 3LIJA 4YU2A 5FWKK 5FXQA 5E8ZA 3GU4A 5KCVA 2E9VA 3CTHA 3DT1A 3HUCA 3IW8A 3MPAA 3MVJA 3MWUA 4BHZA 3QYZA 1O9UA 4HCUA 4X0MA 4AE6A 3TCPA 3PXKA 4PRJA 3IW4A 3DK7A 4A06A 2R0UA 3BQRA 3W33A 4WG4A 3H9FA 5CXZA 3RVGA 1L3RE 5FUTA 3FBVA 4BL1A 5L4QA 3W10A 2PHKA 3L8VA 4QQJA 1U59A 3BHYA 4LMNA 1FPUA 2W5AA 4J52A 4XS2A 1ZARA 1UNHA 4CV8A 5M51A 2ZV8A 3EH9A 2V55A 4RPVA 2IW6A 1KUTA 4NTTA 4YGAA 5EM5A 5FDPA 4JIAA 4FGRA 1XH8A 1PMVA 5IQFA 3QQHA 5ETCA 4AGUA 2GHLA 2XF0A 2UZDA 3LHJA 5KMJA 2XCHA 4FSWA 3NUXA 1PXLA 3LFCA 4LV8A 5BVFA 4IAIA 4EUTA 3BL7A 5C8MA 2UW3A 4Q9ZA 2CLXA 4H3QA 1XBBA 4DHJA 3HMPA 5AP0A 4DBNA 4I5HA 1K2PA 3QZFA 4MD7E 2IO6A 3UOJA 4GCJA 3AC2A 5ANIA 2XH5A 3JPVA 1XMLA 3OCGA 2C3JA 2WMBA 5DFPA 4U45A 5JRSA 5KE0A 3RWQA 2QD9A 3WF7A 5KZIA 4XG8A 4W4XA 5KO1A 2ITNA 1CKPA 4AGDA 2ITXA 1YOJA 3UMWA 3ZYAA 3FZ1A 5IA3A 3GXLA 1CKIA 4L9IA 3UE4A 1GNGA 2ZB1A 4FVPA 4EJNA 4RJ5A 4BYIA 2A27A 2GQSA 3VN9A 5M08A 3C0GA 4L53A 4W9WA 5BVNA 2ZDUA 4IWQA 2A4LA 4FTUA 2F2UA 4FKTA 5J8IA 5LARA 4QMVA 4FX3A 4LGGA 1UV5A 4XV9A 1Q97A 2WMTA 4RIYA 4WOVA 1OIRA 3IOPA 4ZIMA 2CCHA 2KULA 1G8JA 2ITYA 4OGRA 4GKHA 4FV0A 5G6VA 4G6OA 3LOKA 3JUHA 3HDNA 4XV1A 5HNGA 3Q9XA 3DAJA 3TXOA 4X2NA 3S95A 3NMUF 5E8WA 4C8BA 3PVUA 3SAYA 2W99B 3DDQA 3BYVA 3G0FA 2Z7RA 2JDTA 5E7RA 4ITJA 5GZAA 5D9HA 2VO3A 3LQ8A 3PFQA 4KIKB 5CF5A 3C9WA 1SMHA 1JVPP 1TKIA 3NUSA 4O4EA 3CEKA 2YCFA 2C30A 3TV7A 4B0GA 4NFNA 4AXDA 3PY0A 1Q24A 4RZWA 5CU4A 5DVRA 1KE6A 5M07A 2G15A 4ZJIA 5LJJA 1T46A 1JSVA 3CPCA 3RAKA 3V04A 3D2KA 3O96A 2ZOQA 1M14A 1R0PA 3PVGA 4USDA 5CENA 4S33A 4JQEA 3SXSA 1H1RA 4UZHA 5JEBA 2CMWA 2I0EA 5M4UA 4AX8A 2PUNA 4IB1A 2NRYA 4DFLA 2I6LA 3RKBA 4U44A 4OTDA 1YOLA 2PE1A 2QO7A 3P7AA 4HGLA 5I5ZA 3TMOA 2ETRA 4JBOA 3PE2A 4RFMA 2OIDA 4QP2A 3SA0A 3GU7A 3WOWA 4FSZA 3QD3A 4LOQA 3KB7A 1U54B 4K9YA 4AG8A 2X39A 4G9RA 4R1YA 2H34A 2VWZA 4Y46A 5CEPA 1Q8YA 3VVHA 5TE0A 2QURA 4FKPA 3KK9A 3NW5A 5J1VA 4M8TA 2XM9A 5E9EA 1ZXEA 3NZ0A 4AAYA 3VRYA 4C4FA 4HYSA 1XR1A 2WXVA 3OMVA 4DG3E 3KIOC 4QYEA 3R22A 4M7IA 5DGZA 4IB5A 4BDJA 5M4CA 5AR2A 4EK5A 3QXOA 5M56A 2F9GA 2QC6A 4ANBA 2RFNA 3MSSA 4FYOA 4AZVA 1AGWA 4I0SA 3W0RA 4FV4A 5I9VA 1LR4A 2X81A 4FV6A 4X3JA 4MYGA 1H26A 2F4JA 2WOTA 3R83A 4Z3VA 5KBRA 2V5QA 5D11A 3ZSIA 5KMMA 4GU9A 4C3FA 2PZPA 4PPCA 4JQ8A 2VWWA 2BCJA 3NNWA 4QNAA 3WF5A 2Q0NA 4LG4A 3KULB 2RF9A 1J7UA 4GEOA 5HVJA 2WTJA 4M13A 2W96B 4DEIA 4GKIA 2GPHA 2PULA 4RRVA 2C1BA 2XMYA 2WIPA 4AT5A 3QTUA 4ZTMA 5BVEA 3PG3A 2I0YA 2X4FA 4U40A 4X3FB 5FEEA 3QZIA 3W0QA 2JGZA 4C2VA 1OL2A 3IW7A 4KSPA 4NU1A 4X2JA 2UW4A 5AADA 3QRJA 4D1SA 4JIKA 2WU6A 4CLJA 1H00A 2R3FA 5I9ZA 3SD0A 3UDSA 4IB3A 3MJ2A 4QMWA 2VTTA 4YC8A 4TWOA 2UW7A 4FVQA 1B39A 1F5QA 2VZ6A 3OW4A 3R1NA 5LWNA 4H05A 4ANSA 2A19B 1KE9A 2CKEA 4GT4A 4IACA 2ZM4A 2PVKA 4OBQA 3F3VA 4RX9A 3QU0A 5DH3A 1Y57A 4TYHB 1TQMA