4YPSA

(r)-2-phenylpyrrolidine substitute imidazopyridazines: a new class of potent and selective pan-trk inhibitors
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
294
structure length
280
Chain Sequence
GSGIRVHHIKRRDIVLKWELGEGKVFLAECHNLLDKMLVAVKALSESARQDFQREAELLTMLQHQHIVRFFGVCTEGRPLLMVFEYMRHGDLNRFLRSHGPDAKLLAGGEDVAPGPLGLGQLLAVASQVAAGMVYLAGLHFVHRDLATRNCLVGQGLVVKIGDMSRDIYSTDYYRVTMLPIRWMPPESILYRKFTTESDVWSFGVVLWEIFTYGKQPWYQLSNTEAIDCITQGRELERPRACPPEVYAIMRGCWQREPQQRHSIKDVHARLQALAQAPPV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords High affinity nerve growth factor receptor
publication title (R)-2-Phenylpyrrolidine Substituted Imidazopyridazines: A New Class of Potent and Selective Pan-TRK Inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transfease/transferase inhibitor
total genus 86
structure length 280
sequence length 294
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2015-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4ypsA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4ypsA01
4AT4A 3FLSA 4W4XA 2WU6A 4FTCA 5FXQA 5HO7A 3TKIA 3BLHA 4FEVA 2ZM3A 4I6BA 5M08A 4A9YA 1Y8GA 5CSVA 2UW9A 4XG6A 4NKAA 3MVJA 1WZYA 4DCAA 1IASA 1WVXA 3OCGA 3CIKA 5EH0A 5HE2A 4A4XA 2W4KA 5CF6A 1YVJA 2HZNA 3P86A 4IZAA 4EJNA 3O17A 3FMDA 3EKNA 3SOCA 5CNNA 5EHYA 2R3GA 4FKIA 3UVQA 4ZAUA 3AC1A 2YDKA 4RFYA 3UG1A 4BDJA 3CTQA 2HCKA 4ANQA 1FGIA 4O0SA 4EK5A 4Z3VA 2CNUA 4ZTHA 4IX5A 5IH6A 2OKRA 4M15A 3NZ0A 2B52A 5I9ZA 3E88A 1GIIA 4J8MA 3M2WA 1FQ1B 1YXVA 2VWVA 2F9GA 2VRXA 5HLWA 5EI6A 3H0ZA 3EFLA 3QQGA 4GG7A 1M7QA 3LCDA 4PTGA 1E1VA 4UXLA 4AS0A 4DFYA 5FD2A 4S32A 2XEYA 4DEDA 4IH8A 2BRNA 3OUNB 5DG5A 3CPCA 5AUVA 3R28A 4ZK5A 1KV2A 2YLFA 4CSVA 4K0YA 4DFUA 1X8BA 4PY1A 2IZUA 5JFXA 5DEWA 3I60A 1VZOA 2OF4A 2BTSA 4DEAA 3EKKA 2YFXA 4QPMA 4EOIA 2BKZA 4K11A 5GIPE 1IAJA 3CLYA 5LCJA 1UU3A 3HRBA 2VTQA 4ZY5A 3MFUA 2DYLA 2ETMA 3A7GA 4GUEA 3D4QA 4QP6A 4RLKA 1W84A 2GHGA 4OTWA 1NXKA 3TT0A 2WZJA 4G1WA 3K54A 1ZMWA 4AWIA 3H0YA 5I9YA 4O1PA 4YHFA 2CDZA 4BCMA 3OMVA 1YQJA 5HE3A 3ACJA 5DFPA 5EFQA 3RK7A 3O0GA 4IJPA 3Q96A 5EM7A 3KN5A 3UE4A 5FTOA 3FMMA 3RI1A 4C2WA 4BYJA 5HKMA 3BV2A 2QOIA 5HI2A 3PXKA 2PVNA 4XEYA 3LIJA 3CGFA 4QMPA 3V6SA 4USDA 4B99A 3GU4A 3EQRA 3K3JA 5FP6A 3RJCA 5GZ8A 2XIXA 3DQXA 2BVAA 2F2UA 3C4ZA 3CKWA 5HO8A 2W9FB 2GQSA 5CEKA 4XG4A 4D4YA 4KS8A 4LFIA 5TR6A 5ANIA 5FBOA 2BIKB 3OUKA 3HYHA 4MD8E 3KMUA 5AUWA 3ZZWA 4D0XA 4E93A 4CZYB 5BYYA 3DXQA 3QAME 1BUHA 3CEKA 3DJ7A 3LMIA 3PZHA 4DTKA 3CQWA 2WTIA 4TYGA 4AN9A 4DCEA 4RX5A 5JEBA 4UMPA 3G90X 2WMSA 2WTKC 4C4FA 3C0GA 4D1SA 3QA0A 4J52A 2PE1A 4RC3A 4D0WA 2PUPA 1CMKE 4KWPA 4M68A 3VWAA 4A7CA 2BIYA 2OJ9A 4I4EA 4NW5A 3ULZA 3LKMA 4TY1A 5ITAA 3DAKA 4FNWA 4QNYA 4EONA 4QPSA 4BZNA 4FR4A 4O1OA 3VBYA 5DLSA 3TIZA 4DT9A 5KBRA 4Y83A 5I9UA 4BCFA 3UZPA 4QQTA 4BHZA 5A3XA 5E9EA 1HCLA 2IN6A 4BB4A 4BCGA 2JKKA 3N4TA 4NZWB 4F1TA 4RFZA 1WBOA 5FLFA 5IDPA 4JDKA 4ZJJA 1UWHA 4WUAA 2J51A 4A9SA 4I92A 4DG0E 3ENHA 2YHVA 1YXUA 1TQMA 1QPCA 3C51A 3Q6UA 1OKYA 4LMNA 2BHEA 2HK5A 1CKPA 2R3IA 1YDSE 2FSOX 4B8LA 3EN6A 4QMLA 3EQIA 4L43A 4O96A 3TKUA 4BWKA 3MWUA 1YOJA 1OPKA 1K3AA 2XB7A 3DZQA 4FTQA 4GW8A 4IZYA 4FTAA 4LM5A 4YBKA 5BVKA 4ASXA 3PG3A 3UNJA 5KE0A 1ZMUA 2W17A 4IACA 5LVOA 4PMMA 4B7TA 4MBIA 4RG0A 3MJ2A 3RHXA 3RAWA 1AGWA 4IWDA 5FEQA 2BALA 3JPVA 2PY3A 5KZIA 3R71A 5J8IA 2FYSA 3S4QA 3LMHA 1H27A 2B9IA 1RW8A 3GT8A 3Q60A 3F3ZA 4GYGA 4N70A 1G8AA 3M42A 4FICA 1Q99A 4BBEA 4OAVB 2QO7A 2YISA 1Q4LA 2JBPA 1S9IA 2XNMA 4FTRA 4IC8A 4TT7A 2BZJA 3LAUA 5E7RA 2J4ZA 4NK9A 3F7WA 5M09A 2B9JA 3U6HA 4Y5QA 4X6RA 4XUFA 1XBCA 4YJTA 3JYAA 3FZPA 4AAAA 5JRQA 4NCTC 4O86A 4QTAA 5KX8A 2GTNA 2HYYA 2HY81 3OXTA 2BUJA 2B53A 4QTCA 4XCUA 4BTKA 4UEUA 4U8ZA 2WEVA 4AU8A 3EN7A 3ZRMA 1YRPA 4H3BA 2P4IA 4FZFB 4A9UA 2I0HA 2J0IA 2ITWA 4GK4A 5IU2A 5HNIX 1LEZA 4KBCA 2RIOA 4ACHA 2I0YA 2F7EE 2ZM1A 5HE1A 3SAYA 3ID6C 1W7HA 2JD5A 3W16A 1OIQA 1YI4A 3M1SA 4YJNA 4EL9A 4RA5A 2HENA 2QLUA 5ANKA 1DI9A 4JXFA 1CDKA 4XOZA 2JDVA 4YHTA 3RVGA 5FBNC 4BGGA 4O0XA 2Y4IC 4UYAA 5KKRB 4DE4A 3QX4A 3CJGA 4R5SA 4NTTA 4X3FC 3UOHA 3R8ZA 4BY9E 3NUYA 3HA8A 3CPBA 4O0TA 4ALUA 4EBWA 5JKGA 3FQSA 3R6XA 3NW5A 2PU8A 4L7FA 4GK3A 5EQPA 5C8MA 4C62A 4E8AA 3CTHA 3SXFA 5IQHA 4D9UA 4EYMA 4J98A 3FXZA 4QP3A 1UU8A 4CFXA 3FBVA 3D5WA 1YDTE 4ZTMA 2CNQA 2IVTA 3GU5A 3EQCA 4UZDA 4FYOA 1WVWA 5IEXA 5JH6A 3QYWA 3PVGA 2WTKB 2PVMA 3MFRA 4FV5A 5EDPA 2R0UA 5HICA 4F0GA 1YHSA 2C0TA 5JMSA 2DS1A 4HJOA 5AX3A 5L3AA 5DT3A 2QONA 2VWZA 3W2QA 3UMXA 3CP9A 2GCDA 4EHEA 4S30A 5IUHA 4OGRA 3G2FA 3DS6A 5HNGA 4PQNA 4RVMA 4F7SA 4LGGA 3LQ8A 5M4CA 1NW1A 5EI2A 3VS4A 3LM0A 3FHRA 4LV5A 4C2VA 3HV4A 1UA2A 3IW5A 4AZWA 4F9BA 2YCFA 4U3ZA 1YXXA 3I4BA 4M0YA 2QHMA 5HESA 4D5HA 1H24A 2C6KA 4CGAA 2B7AA 3GP0A 4HVDA 3NS9A 5HVJA 4JS8A 3FE3A 4LGHA 2Z7SA 3GGFA 3KRJA 3BWFA 4GG5A 3ZO2A 1JNKA 3L9LA 2XIZA 2EVAA 3ZC6A 4CT1A 4AW5A 1SVHA 1BYGA 3V8WA 4GRBA 2O3PA 4K6ZA 3TG1A 3NCZA 3U6IA 3PLAE 3NDMA 3QQUA 5M55A 1LP4A 1H0WA 3KCFA 5CEQA 4O6LA 5B2LA 3W2RA 3O71A 4HYSA 4IQ6A 4EH9A 2UZDA 4ENXA 5JFSA 3ZH8A 4E4XA 4WO5A 4L46A 5AP2A 2H8HA 1U5RA 3V5QA 4G3EA 2G2IA 4OTDA 4TKSA 3VBWA 2I0VA 3WOWA 4BCJA 1KE7A 5C4KA 3H4JA 4IANA 2IZRA 3ZSGA 4E1ZA 4GT3A 4O0VA 2XJ0A 2WKMA 5EYKA 3RAHA 2YZLA 5AIRA 1AQ1A 4PTCA 3AC5A 3KXGA 5DA3A 2C1BA 5IQIA 2ERKA 4HVHA 3DGKA 4NCTA 2QO9A 2XK7A 3T3VA 2CKQA 3FSKA 3HMPA 2I40A 3E5AA 3MIAA 1XH9A 3NUSA 5CLPA 2A1AB 3FQEA 5K3YA 1GIHA 3RCJA 4C38A 5B2MA 5LOHA 4G9CA 4YO4A 3F5XA 3HMMA 3R2BA 4MTAA 4BI0A 3LXNA 5J1WA 2BTRA 4FIIA 1G8SA 2EB3A 4NKSA 4MH7A 3GOPA 2YA9A 3SOAA 2Y6OA 3ZSHA 1UWJA 3GBZA 4GH2A 4KSPA 2OI4X 3I79A 4LI5A 4Y72A 4M0ZA 1Q8ZA 4ZXTA 4FEUA 4KINA 4PF4A 3KREA 4AXAA 1FVVA 5IUIA 5TT7A 1U54A 3JVRA 2FSLX 2J90A 3FPMA 3TNPC 1U54B 5LMKC 2ZAZA 3AQVA 1JKSA 3G6GA 4GFMA 3NUNA 3VF8A 3ZFXA 4NJ3A 2R7IA 3FWQA 2W1CA 4AX8A 2WO6A 3NUUA 2ZDUA 3BE2A 4C36A 4YPSA 3VS1A 4FE2A 4TYEA 4C58A 3PXYA 2Y4IB 3KF7A 4X3FA 4X3FB 3GXLA 4YTHA 4FK6A 3C9WA 4OT5A 2XCKA 4FKVA 2E9OA 2CSNA 4OTGA 4PDPA 4APPA 4YO6A 4EBVA 3NX8A 3OD6X 4RIWA 3K5UA 5H8GA 5EDRA 4F09A 3NUXA 4FT7A 4RIWB 2YM8A 4BBFA 4J97A 5BQ0A 3BBWA 5IA3A 2R3PA 3Q9ZA 4EKLA 1PRYA 4FT5A 1BI8A 4IM3A 4D2WA 2CGWA 4CMTA 2XIYA 3DKGA 4C59A 4FKJA 1JWHA 3DFAA 4ZSLA 5JGAA 4FZ7A 4A9TA 2Z2WA 3HUBA 3BGZA 3KA0A 3PFQA 5L2TA 4G3DA 4EUTA 4WRGA 1CM8A 4QMQA 1FMKA 3FL5A 2XP2A 1W82A 3IDPA 4ZSEA 2B4SB 3E62A 5CASA 5JQ8A 3HLLA 3GUBA 3C4CA 3THBA 5HBEA 3WIKA 1ZYSA 4H36A 3MFTA 4AACA 1H8FA 4MXAA 5FXRA 5ICPA 4G9RA 4AOTA 3HKOA 3NW6A 4QMTA 3KY2A 5ACBC 4FG7A 4P7EA 3V5TA 3DB8A 2O63A 3FZRA 4FSYA 4BIEA 1BKXA 2CKEA 3OY3A 2BRHA 4FSZA 4IAYA 5CVHA 2QR7A 3MY1A 4AGUA 3COHA 3S2PA 2VUWA 2H9VA 5FP5A 4CV9A 5F1ZA 2RSVA 3D7TA 4FTIA 4ZMFA 3FZTA 1H1QA 2G2HA 3JS2A 3LM5A 2I6LA 3PXZA 4IVAA 4RGJA 1DAWA 3RAKA 4EOPA 4F9CA 4AZTA 3QL8A 4I5MA 4IZ7A 1Q3WA 4UMUA 3G9LX 3CD8A 3WZUA 4O84A 3P7AA 2PTKA 3QHWA 3UNZA 1OPLA 1ZYDA 2ITUA 3ZLSA 5TE0A 1OKZA 4X7QA 4L3PA 3RNYA 3ZRKA 4YC3A 3A8WA 2JIUA 5G1XA 3QZGA 1UKIA 3LCSA 2J7TA 3TZ7A 4TPTA 4TYIA 4ZP5A 4A07A 2XIRA 3PDTA 4MWIA 5CF8A 3WF7A 2CCIA 3FDNA 3KQ7A 4AFJA 1R0EA 3PYYA 4FTKA 3SC1A 1RE8A 2WIPA 5IMEA 2QKWB 3SKCA 4FV3A 4KIOA 3S1HA 4EC8A 5C27A 2XMYA 3P79A 3EQPA 3R1SA 3E7OA 3DK7A 3ODYX 3D83A 4O0WA 4ZS4A 2VWBA 1ZOGA 3ORTA 4V01A 5DT4A 5DGZA 3ZO4A 3IKAA 2XKEA 2Y8OA 3FZSA 4A4OA 2BKKA 4FEWA 2HWOA 4R3RA 4O27B 1A9UA 3QRIA 3ELJA 3LFBA 5DHJA 4Z9LA 3RP9A 2LGCA 2CHLA 4PNKA 5HVYA 3OZ6A 5KUPA 5BYLA 5HHWA 4DITA 4USEA 3R83A 2PK9A 3UDBA 2WD1A 2OICA 4XG9A 2VX3A 4PUZA 3VUDA 1PY5A 1V0OA 3MB7A 3RPYA 2FSMX 4AZVA 4Y73A 5LMKA 3BHUA 2UV2A 3I6UA 5FRIA 1PF8A 1Y91A 3L9NA 3QFVA 4P5ZA 5CZHA 2VN9A 2J6MA 2X0GA 3R8VA 4U3YA 2ZMCA 3ZDIA 4JDIA 3UMWA 4CMOA 2C0IA 1WMKA 5L8LA 1WBVA 3BRBA 1GZ8A 2EUFB 1YHVA 2B55A 2YN8A 3PWYA 4FC0A 3FI8A 3DK6A 5ANEA 1Q8YA 5HIEA 2G01A 4FX3A 5IQFA 4V05A 1WBTA 4FF8A 2BAKA 4AN2A 2R3FA 4EH2A 3ALOA 2UZUE 3OEFX 2CNVA 2VTJA 4DEBA 3KK8A 3LFNA 3MIYA 3NNWA 4MQ2A 2F49A 2XNGA 3WZKA 4RIYA 3ETAA 1PHKA 4BCIA 4D9TA 4HVGA 1UNHA 4ZLZA 3E8DA 2XKCA 2QOBA 3NYVA 3OCBA 4D4SA 4YNOA 1JOWB 3ZUTA 4EHZA 1MRYA 2ACXA 4XBRA 1QPDA 4PNIA 2C69A 3GU6A 4HW7A 3QGYA 3ROYA 5DRDA 4JBPA 2FA2A 3LFEA 4LL5A 3ZBFA 4DGGA 4CNHA 3A60A 2ETRA 2R2PA 4JQ7A 2OXXA 3TV6A 4OBQA 4CD0A 3PJCA 3KB7A 2WMTA 1Y6AA 1U4DA 4R78A 3UQCA 3G5DA 2NP8A 4U44A 2E9NA 4AOJA 1SNXA 3A8XA 3FLWA 2ZV7A 1RQQA 3AT2A 3QU0A 2V22A 2ZV9A 5KCVA 2O2UA 1H26A 4BCQA 2WOUA 3OT3A 4Q9SA 2QR8A 2I7QA 1OECA 1PXLA 1M2PA 2ESMA 3L9MA 4AT5A 5CAVA 2W06A 5F94A 1Q97A 1VYWA 3DNEA 1J91A 4BWXA 3P0MA 3VS3A 5GINE 1WFCA 2Y0AA 4UV0A 4YJPA 3LFDA 4UALA 3D5VA 4FTTA 3HUCA 4FL3A 3T8OA 1E1XA 4JBQA 5A4EA 4D58A 5JT2A 3QCSA 3UOLA 3W2OA 4DTAA 5K4IA 5A6NA 2WFYA 3CBLA 3DDQA 3GENA 3PPZA 3G33A 5M07A 4HVIA 1XH6A 2VZ6A 2YIXA 1MQ4A 3LQ3A 3R7UA 4QTEA 4B8MA 3NNVA 5LVNA 3IW6A 3QQKA 2VTHA 3COIA 3R22A 4YTCA 4R5YA 3I81A 4QMXA 1B39A 3MY0A 4KABA 3HP5A 4CQGA 3N51A 2DWBA 2ZV2A 4QO9A 4NW6A 1DM2A 3P78A 4ONAA 5AIKA 5FM2A 5EI8A 3ZLXA 4GU9A 2ITQA 4DN5A 2YM3A 1WBSA 2UZWE 3R8UA 1JPAA 4CEGA 1ZARA 4JG7A 3EOCA 4O22A 5KNJA 2VTTA 4EYJA 4QP7A 5ETFA 5CENA 3BQCA 2PMOX 1VYZA 4KIPA 4MEDA 3QALE 3VC4A 1Q62A 2VNYA 3KRRA 2UUEA 3OBJA 4BF2A 4X0MA 3R7OA 4FNZA 3HEGA 3PRIA 3BYMA 4BKZA 3QD0A 2QOQA 3PSCA 4IEBA 4L68A 2WB8A 4PWNA 3UC4A 4G6LA 3R2YA 4MX9A 4JR3A 2ITOA 4WRSA 4BDKA 3V5LA 3HX4A 4DEHA 3PA3A 3R9OA 4ALWA 4F6UA 1YWVA 2BPMA 1ZY5A 3O8TA 4N6ZA 4XV3A 4HGSA 5IEYA 4N57A 1ZZ2A 4V04A 4NIFB 2NO3A 4ANNA 3WF8A 4G6OA 4GJ2A 4O83A 3GVUA 2CPKE 4RIXA 2F7XE 3QD4A 1JQHA 3TEIA 2X8EA 4RIXB 2XKFA 4ZTRA 4O7NA 2ITTA 3LXPA 3CY2A 2PSQA 4K1BA 5AR5A 3I7BA 4CMUA 3D14A 4QMOA 3DTCA 2C3JA 3MS9A 1FMOE 5M44A 5IQDA 3IQ7A 1OUYA 3RPOA 5CXHA 4QT1A 2IO6A 2E9PA 3QX2A 5D7AA 4D2SA 1ND4A 1Q5KA 4YNEA 3MW1A 2IZSA 4EH8A 3MH1A 4BDFA 5CF5A 4HZSA 4FV2A 4YJRA 2G15A 3ERKA 4F64A 2GNJA 1H1SA 4XV2A 4QQJA 1YXSA 4MKCA 3DCVA 3QKMA 2C6MA 2W05A 4DHFA 2WMUA 3QQFA 2GSFA 2HY0A 1PYXA 4EI4A 2SRCA 3DK3A 3VUTA 4KKEA 1O6YA 4RRVA 4N4SA 1Q8UA 2ITPA 3LFAA 4D4RA 2RL5A 3R9RA 3C50A 3RZBA 5HLPA 3Q4UA 5CQWA 2ZDTA 3BWJA 2XK9A 2UW8A 3BI6A 5AJQA 2ZOQA 3WE4A 2A2AA 3PXQA 4FKWA 2V5QA 3MGYA 2IWIA 4LRJA 5CSHA 2JAMA 4L3LA 2C6TA 4JDJA 1I44A 2UW3A 3UVRA 4BKJA 2GDOA 3W33A 2RG6A 1YOLA 3QXOA 3VHKA 4AP7A 2NPQA 3BV3A 5C01A 2X1NA 5LQFA 2QCSA 4UXQA 4UZHA 2JC6A 4RVTA 2EU9A 4JRVA 3UO5A 3TTJA 2OXYA 2UVZA 3FI2A 4ANBA 4UMTA 1ZRZA 3N4UA 1OPJA 5E90A 3MVLA 2EXCX 4Y46A 3BHYA 1FINA 3R0TA 3BHHA 4JNWA 3G9NA 3QTSA 4UMQA 4YZBA 3RAIA 5LXMA 3FC1X 2YDJA 5DOSA 2OSCA 2J2IB 4TZRA 4D5KA 3IG7A 5HZNA 3PXRA 2OFVA 3ZLWA 4KRDA 2PZRA 1XJDA 4LOPA 4UMRA 4J1RA 3FHIA 4TYJA 3ZONA 1PMVA 4KNBA 4O82A 3MVHA 1LEWA 3DJ6A 3TWJA 3TV7A 1UU7A 4J95A 4N6YA 2HWPA 4L6QA 3F2RA 4QMYA 2WIHA 4R7HA 3PJ8A 4FKQA 3RBWA 2PUIA 3AC3A 4LL0A 4OTIA 5I0BA 4DH7A 1ZXEA 4KKHA 3U8WA 2HZIA 3S3IA 3C0HA 5E8VA 5JFWA 2OFUA 4GVJA 4O21A 3U9CA 3DOGA 5J9YA 2XJ2A 4YTFA 3R63A 3QBNA 4TWPA 4WIHA 4R6VA 5E8TA 5F4NA 3NW7A 2HOGA 2ITZA 4C33A 4ANLA 2Z7RA 4WG5A 5C26A 3OVVA 4NM7A 5DVRA 2UW7A 3WIGA 4CYIA 3MBLA 3DXNA 4H39A 4KB8A 2R3RA 4YUQA 2YM5A 2GMXA 2Y4PA 3HV3A 5E1SA 4EK3A 3RM6A 5HLNA 2QOFA 1SYKA 3ZZEA 3FYJX 4IE9A 4D28A 4QMVA 4P5QA 3FKNA 4IB5A 2XNEA 4O38A 2JLDA 4PPAA 3EH9A 4R3CA 2QOLA 4XHKB 4CVAA 3GQIA 5D7VA 5HORA 2VWXA 3OWKA 1YDRE 4FV0A 4NM3A 4MXOA 3RWQA 4U41A 3TZ8A 3W10A 3SW4A 4Z7GA 1AD5A 3MVMA 4DC2A 5K5XA 4P4CA 1Q41A 3FC2A 3H3CA 4O91A 3B2WA 1JVPP 3F66A 2VO3A 3IECA 2WQEA 5KZ0A 2R0IA 4RT7A 4GT4A 2WMQA 3VAPA 3VIDA 3HL7A 1GOLA 3I0QA 4AE9A 4DGNA 5EKNA 3IPHA 3ORXA 4FKTA 3ZM4A 3ZXTA 3W2SA 2PZPA 4CTCA 4G17A 3Q53A 2PVLA 3ZC5A 2PE2A 2XZSA 3E8NA 1Q8TA 3ZEWA 5DR2A 4TTHB 3NWWA 2WMBA 3SX9A 3V8TA 4GIIA 3LCOA 3QYZA 4ZY6A 5JFVA 4FOCA 4GL9A 2RGPA 1ZOEA 5K9IA 4KRCA 2R3NA 3ORLA 3VBXA 3WF5A 4YZMA 4HZRA 2E2BA 4M7IA 3PP0A 2W1EA 4ACDA 1H07A 5B2KA 3F3UA 1QL6A 3CGOA 3RGFA 4M3QA 1ZOHA 5CVGA 2HW6A 4FODA 5JRSA 4ITHA 5HE0A 2WOTA 3W8QA 1QMZA 3HMIA 3KRWA 3BEGA 5K5NA 5HTIA 3K3IA 2BCJA 3VQUA 1H08A 4ANSA 2NRYA 3K5VA 4FZDB 4AGWA 5IA1A 3CY3A 4NUSA 4FNXA 4PTEA 3R8LA 3ZDUA 5BUJA 3WF9A 4KKGA 3O2MA 2H6DA 4CKJA 4ASDA 5I3RA 4EORA 3ORZA 4Z16A 2CJMA 2W5HA 3UGCA 3O96A 1A48A 2GQRA 3KMWA 4V0GA 5K0XA 4UWYA 2VNWA 4V0GB 3UP7A 1H1PA 1OL1A 1P4FA 2FSTX 3MB6A 3KXMA 3RKBA 4O7SA 4O7TA 5KMLA 5E8WA 2YJRA 5HU9A 5BUEA 2ERZE 2WHBA 4F9YA 2J0MB 2WQMA 3HV7A 3KXXA 3OFMA 4O0UA 4DEGA 3O23A 4YHJA 2C4GA 2EXMA 3PVWA 2IW8A 2R3QA 4HYIA 2X2MA 2CCHA 4YZDA 5JZJA 5AV1A 1PXKA 4E5BA 1GZNA 1OIRA 3E3PA 4AE6A 1OL7A 3FKLA 3GI3A 4IVBA 4CFUA 3HVCA 5CWZA 4JBOA 1NT2A 3E92A 2R9SA 4KA3A 4K77A 4BYIA 5GZAA 1OBGA 3MPMA 5KMOA 3MY5A 5CSWA 2J5EA 3UPXA 3WYXA 5HIDA 1GJOA 2QOOA 4S33A 2YDIA 2OO8X 3UYSA 4F4PA 3LXLA 5BMSA 4C3FA 4H3PA 4BBMA 4FL2A 4BGHA 3W18A 1PW2A 3ATTA 4BN1A 5E8UA 1SNUA 3H10A 4PV0A 3NSZA 4YLJA 5CVFA 4CCBA 5EDQA 3FLYA 1IRKA 2BRGA 2V7OA 2OU7A 4RC4A 4TYHA 3WE8A 4A9RA 4BI2A 5JGBA 4KIKA 1V1KA 2GHMA 3ANRA 4L8MA 5JN2A 3R7GA 4D55A 1H28A 5GIOE 4BZDA 3AD4A 3I5ZA 4X2GA 1EH4A 3C5UA 5AA8A 3F3WA 5FTQA 5AFVA 4QMUA 1HOWA 4E6QA 3ZBXA 5HX6A 4F65A 3MN3A 3BX5A 4NT4A 2WMRA 4XX9A 2XK3A 4FV6A 4DTBA 2XK6A 2LAVA 4OTRA 3VJOA 3KVWA 3EB0A 4F1OA 1WAKA 4BDHA 4F6WA 4HYUA 3OCTA 4XS2A 2OIQA 4R7IA 4F0IA 2W1FA 4B9DA 5C03A 1LR4A 4QP4A 2RFNA 4WNOA 4BL1A 2GNHA 4QP2A 4X3JA 4E5AX 4I41A 4ERWA 2QURA 3PIXA 1NVRA 4C34A 2QKRA 1Q61A 3PJ2A 1P2AA 4YZCA 4RC2A 3A7HA 3TN8A 2Y6MA 4DFXE 2PYWA 1REKA 5D9HA 4GV1A 4EZ5A 5DWRA 5HOAA 2YITA 4ACMA 1IA9A 4EQCA 3U54A 3UIBA 4CXAA 2X7GA 3G15A 3QKKA 3TJCA 1YWNA 1ZZLA 3ZCLA 1WCCA 4ASZA 3IW4A 3D2IA 5HG8A 4RJ7A 1PMNA 3L8SA 4FTJA 3CJFA 3G6HA 5H2UA 4FSNA 4PDOA 5ANJA 4BKYA 2XK4A 2CGUA 2R3OA 1K2PA 4YGAA 5FXSA 5HIBA 1OB3A 2VWYA 4IB1A 3W32A 3GU7A 3QZFA 1OIYA 4FV7A 3KL8A 1U5QA 3VS7A 3BYUA 2Q83A 3P08A 5AX9A 4EWQA 1B38A 2WXVA 1KV1A 3D94A 4E20A 4TWCA 3FMHA 4YJQA 3T9TA 3PRFA 3KN6A 4JRNA 4I0RA 4DLIA 5CEOA 4QP1A 3QLGA 2UW5A 2IVUA 3A7FA 5A4CA 4WG3A 4MNEA 3Q52A 4FSUA 4BTMA 2PMLX 5ACKA 2QI8A 3DBFA 3BGPA 5LVLA 2C68A 1T46A 3FLQA 3BYSA 3DQWA 3AT3A 3U4WA 3GB2A 4IC7A 1H1RA 4NM5A 3EQDA 4QPAA 3FEGA 5JGDA 4DA5A 2XKDA 2O0UA 1T45A 2QU5A 3EHAA 3IGGA 2IVVA 4ZTSA 5C1QB 2AC5A 2KTYA 2J50A 4QMZA 3QA8A 4EOJA 2OIBA 2ZJWA 3G0FA 4Q2AA 3D5XA 5LMAA 4PL5A 2PPQA 3MI9A 3GQLA 4JIAA 3RPRA 2ZYBA 4RJ4A 1DS5A 2OXDA 4U6RA 4XOYA 5LARA 4DAWA 4NSTA 4DGLC 4YU2A 2VWWA 5AR4A 2GS7A 4U7ZA 2JAVA 1J1CA 2UVXA 4U45A 5GJFA 2C6LA 1OGUA 4GMYA 5M4UA 5EW8A 4KD1A 3EFWA 4RJ5A 1M14A 2F4JA 4M12A 4C35A 4DFZE 3GFEA 3UO4A 5EM6A 4BDIA 3H30A 4MXCA 4BDBA 4CKRA 4GT5A 3VVHA 2PZYA 4RSSA 4GKHA 4GYIA 1QPEA 3C7QA 1PMEA 3FI4A 3V01A 4DGMA 3NGAA 4M67A 5BUIA 4XH6A 4IDVA 4CQEA 3NVMB 3FLNC 4WNMA 2P3GX 2Z60A 4KAOA 4EHVA 5KMMA 3QUPA 2WTDA 4BIBA 3UZTA 2F2CB 1XR1A 3I0OA 4AFEA 4FYNA 4LUDA 3V5PA 2VO0A 3QTQA 3D0EA 3IDCA 5J9LA 5EHLA 4BHNA 2A0CX 3P9JA 4CFWA 2XNOA 5G6VA 4ZJIA 3LJ2A 4WKQA 4O7ZA 4MF0A 2OJFE 2QLQA 3VHEA 1REJA 4K33A 5FEEA 2Y7JA 3HDMA 4A06A 5EK7A 3SW7A 2XRWA 1OITA 2KULA 5CY3A 5KMIA 2J9MA 3BE9A 4I0TA 1XHAA 2BRMA 5LWMA 3IW8A 4U81A 5BPYA 4H05A 2IJMA 1Y6BA 4FMQA 4O7YA 4DGOA 3HNGA 5HCXA 4DG2E 2W1IA 4C57A 4M14A 3DBCA 2JKOA 2REIA 2C0OA 2BFXA 3SVVA 4O7RA 4QMWA 3PIYA 5D11A 2VTNA 4C4GA 4EH6A 3C4EA 4U80A 2B9HA 3KEXA 3KMMA 4HOKA 5CT7A 2QG7A 4EJ7A 5IA5A 3QKLA 3BHVA 3NUAA 4FBXA 2R4BA 3EL7A 4OAUC 3R7VA 3CQUA 4CRSA 1JKTA 4DYMA 4BC6A 1XH8A 2R3MA 5ANGA 2OLCA 1UNLA 4YZ9A 1MRUA 1SVEA 2JDTA 3E8CA 4MWHA 4MHAA 4ZEGA 3SXRA 4IX6A 3KXNA 3LMGA 5IEVA 2QNJA 2XK8A 3F61A 3MH0A 1Z5MA 3CE3A 3S00A 1GIJA 4NFNA 1IR3A 4RJ6A 2C6IA 3F9NA 4AQCA 4EUUA 3V5WA 2ZM4A 4FUXA 4ID7A 1YKRA 3L8PA 1PXMA 3D7TB 4O7LA 3EQGA 3OS3A 2QHNA 4BVUA 3HRFA 1IA8A 2YIWA 1OUKA 3O50A 4UB7A 5E4HA 1H4LA 3GCPA 4LYNA 5HVKA 2OGVA 4MQ1A 3UNKA 4U97A 1R1WA 4NYEA 3E93A 4RX9A 1M52A 4ZIMA 4RA4A 2QODA 3HV6A 5TF9A 2HW7A 4QNAA 5K4JA 1KE6A 1H01A 2C6OA 2P33A 2WTWA 1XBAA 5J5TA 2FH9A 4DH5A 4XLVA 5CU3A 1K9AA 4IVDA 1OKWA 4CFNA 3UIXA 2OBJA 3DNDA 2GFSA 4P2KA 3RHKA 4FVRA 4RX7A 3UP2A 4U42A 3A2CA 3TDVA 4XP0A 1RJBA 3UYTA 1OBDA 5GNKA 3OW4A 2W99B 2VGPA 4II5A 4QYGA 4EH4A 1SM2A 1GZKA 3FZOA 3Q04A 3SG9A 1F5QA 2W96B 2QOHA 3SD0A 5JSMA 1NVSA 3PY0A 3R01A 2W1GA 3EQFA 3ZRLA 5A4LA 3PLSA 4FSMA 2OH4A 2CN8A 4MVFA 5E8XA 4JQEA 5CYIA 3HDNA 3DTWA 5AUYA 2JEDA 2HZ4A 5E8ZA 3DKCA 3EWHA 3JY0A 3W55A 2I1MA 2WMWA 4IFGA 3ZTXA 2QG5A 4C0TA 4ZTQA 3TM0A 3LQ5A 4WUNA 1WBPA 3Q4TA 3OCSA 2HIWA 2UZNA 2W1ZA 1BL6A 4EOMA 3R02A 3NRMA 5IQAA 1XBBA 3NEWA 2GNGA 3PP1A 4I21A 5AUXA 2PVKA 5HNBA 1Q3DA 3LJ1A 5I3OA 2WTVA 4FEQA 4FKRA 3AD6A 2C5VA 1E9HA 3Q9YA 2PUUA 4BDEA 2OW3A 4BCKA 2CLQA 2IVSA 2W0JA 4IDTA 5DR9A 4AW2A 2W1HA 4LOOA 4ORKA 3VQHA 1MRVA 3BIZA 5AP1A 2JFLA 2PE0A 3ORMA 4WNKA 2XBAA 1Q24A 3E63A 3EQHA 1ZLTA 4FIEA 3ORKA 3QQJA 4RWKA 5BNJA 2B0QA 4CG8A 3AT4A 3FY0A 4WSYA 3UPZA 3TL8A 5KBQA 2P2HA 4EOSA 2PZ5A 3II5A 4L52A 4RIYB 5DH3A 1YOMA 4RZWA 2PVJA 4NEUA 5HBHA 3SRVA 4FIFA 5J5SA 5AP7A 4XG3A 2VTIA 2PVHA 4H58A 4O0YA 4DF3A 4R3PA 2BZKB 1OL5A 4UWBA 4L53A 2C5OA 4JT3A 5CEPA 4I4FA 4FG8A 3C5IA 1W0XC 4IAAA 3A62A 4I6QA 5I4NA 3U6JA 3IDBA 4F9AA 4ANMA 3UIMA 3SHEA 2VTSA 3ROCA 2VWIA 3WZEA 5DE2A 2YWPA 3WF6A 2C5YA 3C4XA 3E64A 4IIRA 4IB0A 2R3HA 4JJRA 4NJDA 3OEZA 3TTIA 1J7LA 2WTJA 3F5PA 4IX4A 4KBAA 3A4OX 4L7SA 4TXCA 2X4FA 4FTOA 4F9WA 3NIZA 5L6WL 5L4QA 4ZSGA 4ASEA 5L6PA 3SGCA 2IW6A 2ZB0A 3NPCA 2OH0E 4FIHA 4K8AA 5AP6A 1R3CA 4WSQA 2QO2A 5HGIA 3RINA 2ZB1A 4ZSAA 1URWA 5HG9A 2YM6A 1J7IA 3OOGA 3FMNA 3DKFA 2J0LA 3Q4CA 5H8BA 4G3CA 5CALA 2Y9QA 4J71A 3R9NA 5M4IA 5DBXA 5EW9A 5CTPA 3V5JA 4O7VA 2C3LA 4RQKA 3O7LB 2VTAA 4X2NA 2ZMDA 1UU9A 5E1EA 3EFKA 3OWJA 4OBOA 3H9RA 4IJ9A 3TXOA 3VW8A 3FMJA 3FY2A 4YJSA 3HZTA 2IG7A 4YP8A 3GC7A 5EKOA 4IMYA 5AR3A 1ZWSA 4QRCA 2BILB 2RFSA 3MYGA 5AM7A 4AN3A 3IONA 3POOA 5JZNA 5M51A 3QTIA 3SDJA 3EQBA 1O6LA 3QGWA 2PUNA 2X4ZA 3NYNA 3ZFMA 3JR1A 2EWAA 3BLRA 3ZSIA 4R7BA 5B7VA 2C1AA 3V6RA 3Q9WA 2CKOA 1S9JA 3LE6A 2CGXA 3FUPA 5IZFA 3O51A 1CKIA 2JKMA 3BHTA 3QC9A 5CI6A 4ZTLA 3KU2A 2ITXA 5LCKA 3DAJA 5C8KA 2PVFA 3NMUF 2BZIB 1H25A 3ZM9A 2XNBA 5FG8A 4ENYA 2VGOA 4F99A 3TZMA 5HEZA 5IKWA 2W5AA 3VUIA 3FMEA 4OTQA 4MK0A 3E8EA 4FK3A 4NTSA 5DIAA 3ET7A 1WVYA 4BIDA 2X6DA 4E26A 5IDNA 4JVGA 4AA5A 4DBXA 2HAKA 2ETKA 3R8PA 4G5JA 4HNIA 2WQNA 3IS5A 4O6EA 3UG2A 1BI7A 3LCTA 3TDWA 3TUBA 2UZOA 2JDOA 2WAJA 4KS7A 5J9ZA 5L6OA 3EFJA 5EYMA 4EQMA 2WELA 1BX6A 5H9BA 4OUCA 4CT2A 4YLKA 4IAFA 4JG8A 3BYVA 3P4KA 3KULA 1R39A 3EIDA 5EM8A 2UZEA 3FXXA 4I0SA 4X21A 4FGBA 4EOLA 3VUMA 4J96A 5TKDA 4BI1A 1J3HA 2C6DA 4BFMA 3FZ1A 3OF0A 2B9FA 3CC6A 4FKGA 4BCOA 3BBTB 4FSTA 4ARKA 3VBVA 4JL9A 1OL2A 1YXTA 3A7JA 2PMIA 3D15A 4L44A 4PMPA 3QF9A 1KE8A 2GNLA 2YZAA 3A61A 4FEXA 1OZ1A 3MTFA 5CX9A 3QWJA 2X2KA 3R21A 4X2JA 2YAKA 1JKKA 4DEIA 3AMBA 3FI3A 4IBMA 5H8EA 3KXZA 4RVLA 3U51A 2G1TA 4MXZA 2J0JA 5HX8A 1JBPE 1QCFA 1U59A 5CEIA 4IFCA 4AZFA 4JBVA 3EN4A 5L2QA 1OMWA 2UVYA 2XS0A 4EH7A 3LLAA 1TQIA 3VUKA 5FUTA 4U0IA 2W9ZB 3BLQA 1VR2A 3FMKA 2VTLA 4BR3A 4XNEA 1W98A 2DUVA 2E9VA 2OJIA 1P14A 3BCEA 4F7LA 4LV8A 2PL0A 5EG3A 1NA7A 3QZHA 3RK5A 4C61A 3MTLA 5I9WA 3FAAA 3DU8A 4ZSJA 3SQQA 1J1BA 2EB2A 4L3JA 3GEQA 5FQDC 2PWLA 1JSTA 3EJ1A 4BCPA 4G6NA 4Q5EA 4MAOA 3VF9A 4X2FA 4PPBA 4FV8A 3LFFA 3RTPA 4S34A 4FUYA 3EZRA 4CZUA 2H34A 3F69A 2GQGA 3DXPA 4X6QC 4FT3A 4F08A 5C4LA 1MP8A 3VBQA 3QCXA 4U79A 5CS6A 4BDAA 3R7YA 2OJJA 2PHKA 4W4YA 3W2CA 5AAGA 5CU0A 4QTBA 4CTBA 3GC9A 3H9FA 3PE1A 3UO6A 4EWHA 4LGDA 3Q32A 1STCE 1O9UA 4E6AA 1FBNA 2YLEA 2BFYA 1B6CB 2XH5A 1O6KA 4PPCA 2UZBA 3ANQA 1NVQA 5L2IA 2YCRA 4I23A 3F3VA 4TNDA 5J7HA 2YWVA 4WBOA 2BZHB 3COKA 4QD6A 2HELA 3G51A 4QYFA 5IH4A 4RQVA 5IF1A 3OXZA 4HCVA 4CV8A 4DEEA 4JDHA 3AMYA 5HO6A 2JGZA 4EKKA 3F5GA 2J0KA 2JFMA 4D2RA 1BL7A 3QD3A 4W4VA 2BHHA 2RG5A 4TN6A 1LPUA 2C3KA 5EM5A 1FGKA 2G2FA 3HA6A 2XIKA 5CU4A 3L1SA 4IWPA 1URCA 4MXXA 2OWBA 4O2ZA 3GOKA 1PXPA 4H3QA 4J8NA 4QMMA 3P7BA 5JK3A 2C5XA 1M2RA 2UZLA 2QQ7A 2WPAA 4LUEA 4Y95A 3FKOA 3PPKA 3EN5A 4J53A 5K0KA 5AMNA 4TNBA 1PXJA 1MUOA 5CU6A 4F1MA 3QQHA 4OBPA 1DAYA 4IM0A 2YEXA 4YC6A 5DT0A 2X8IA 3RM7A 3NVKI 1RDQE 3ENMA 3AC4A 3QTXA 1Y57A 1PXNA 3KXHA 4PDSA 3AG9A 4O0RA 5AV2A 2BRBA 4FT9A 3S95A 2YAAA 3MA6A 2WTCA 3ZMMA 4FKPA 2R5TA 3PXFA 4FTUA 2XF0A 4BICA 4USFA 4Y85A 4FGRA 3MDYA 2Q0NA 3QUDA 3PA4A 3BQRA 4XP2A 4D1XA 3TNIA 2BAQA 5DR6A 5AADA 4U40A 1ERKA 4JI9A 4LOQA 4GSBA 2G9XA 3ORIA 3WARA 3QRJA 4FG9A 4UBAA 1JLUE 5KKRC 4ZLOA 4AZSA 2FGIA 1F0QA 2V7AA 3V04A 4AGCA 5AUUA 4EZ7A 3W8LA 4LQMA 5IUGA 4E6DA 1PXOA 5F20A 4AUAA 2Z02A 4G34A 3P7CA 3F82A 1PYEA 4L45A 2ONLC 4AA4A 4C37A 3NYOA 3GNIB 3PPJA 1JAMA 1MQBA 3R30A 4RBLA 3ZU7A 4RPVA 3FV8A 4FA2A 4M66A 2ITVA 1YW2A 4HPUE 3BGQA 3OG7A 3JUHA 4ITIA 4XP3A 4KSQA 4RWJA 3VN9A 3UZRA 4DFBA 3D2KA 2HZ0A 4MF1A 3R1NA 3EN9A 3ALNA 2W1DA 2YIQA 2QD9A 5E92A 5IISA 4RJ3A 5AAFA 1OIUA 1ZYJA 4D2PA 4GUBA 4JX7A 5A14A 1DI8A 2W5BA 4JQ8A 2VV9A 3NIEA 1SZMA 2QVSE 4GFGA 5CF4A 4TRLA 3LXKA 3ODZX 5L2SA 2X7OA 3CQEA 3W2PA 1JKLA 1SVGA 2QC6A 3OWPA 2XRUA 1OM1A 2F7ZE 3IW7A 3QCYA 4EOOA 5IQBA 4LRMA 4EOKA 2BROA 3ZHPC 2XM9A 4DBNA 4PDYA 4AW1A 4CG9A 5BX0A 5AP4A 5KMKA 2VO7A 2VWUA 4FL1A 4IWQA 4N0SA 1VEBA 4PMTA 4AA0A 1UNGA 5CAUA 5J7BA 5BVEA 4GVAA 3Q4ZA 5EQYA 1BMKA 3QXPA 4GJ3A 5TO8A 2C6EA 5C9CA 2XYUA 4XYFA 5E91A 1GAGA 4ZZOA 3CTJA 2HXQA 3GFWA 3RPSA 5DYJA 3F7ZA 4BZOA 4E4LA 4QTDA 1WBNA 3OOMA 4Y8DA 3ZXZA 1YHWA 4EH5A 3CSVA 3QD2B 3WBLA 4QQ5A 3DBDA 4C4JA 4E7WA 1YI3A 1Z57A 4GU6A 1H1WA 4AGDA 4XMOA 4DH8A 3L8VA 3AXWA 2J5FA 4FSWA 4MYGA 3RCDA 4BDCA 3VUHA 1L3RE 1XWSA 2Q0BA 3JY9A 5AP0A 1KE9A 4YR8A 2NNWB 2PMNX 2X8DA 3PY1A 4L00A 2RKUA 5GZ9A 5D12A 5LMBA 4LRKA 2XEZA 1GZOA 3HAVA 3BELA 4TL0A 4I93A 4C7TA 3QTWA 4QYYA 4S2ZA 4QYEA 2R3JA 1KSWA 3AC8A 4AW0A 4L01A 2VU3A 3ZLYA 4TYHB 4U43A 4P90A 2F57A 4I22A 4KIKB 3U87A 4WHZA 2O5KA 5CSPA 5CT0A 4I3ZA 4FSRA 3V51A 4QQCA 4F7NA 5HCZA 5AV3A 3OW3A 3V8SA 2P55A 1FPUA 2A4LA 3C4WA 3ITZA 5BMMA 3RZFA 3N9XA 3A99A 2GPHA 1KWPA 1GY3A 2A27A 3KCKA 3ULIA 4YSMA 4HVSA 3GCSA 1YWRA 3QQLA 4UY9A 4ZZMA 3T9IA 3VBTA 3WZDA 5IQGA 2GHLA 2GS2A 3EMGA 4FOBA 2IW9A 4ZTNA 4H1JA 3ACKA 3GCQA 1GNGA 1Q8WA 2YERA 3NYXA 3U55A 2AC3A 1A06A 2UW6A 3AC2A 4YJUA 4OW8A 2GU8A 4RWLA 4HGEA 3DV3A 3VS6A 3D5UA 4U9AA 4DLJA 4RJ8A 4L67A 3ZO3A 4BTFA 5ETCA 1XO2B 3BKBA 4MBLA 5FWKK 3PA5A 4LG4A 2CGVA 4FTLA 2VX1A 4K9YA 5AWMA 2XNPA 2R3KA 4IM2A 5AR8A 4OTFA 2ITNA 4I24A 3CXWA 3KRLA 4TW9A 2VTRA 3NNUA 5FEDA 2ONLA 4XG2A 3ZEPA 2Z8CA 3LW0A 3Q9XA 1KOBA 2BR1A 4X2KA 2P2IA 3QRKA 3I1AA 3COMA 4IVCA 4C3RA 3WI6A 5AUTA 4D1ZA 3OBGA 2NRUA 4I5HA 4FTNA 4Z7HA 5I5ZA 1M17A 2XCHA 3WILA 3EYGA 5LWNA 5M4FA 2YJSA 4CYJA 4E4MA 3OTVA 4E6CA 5LJJA 1H0VA 1TKIA 4WD5A 2BMCA 2YM4A 3P23A 3CKXA 4JOAA 3KGAA 4CFMA 2CLXA 2XBJA 4AT3A 3PVBA 4RZVA 5CI7A 3OP5A 4BCHA 3PE2A 3DLZA 4HCTA 1FOTA 2I0EA 2VAGA 2GNIA 3I6WA 3BU5A 4WG4A 3ORPA 1UV5A 2GNFA 4ACCA 4JX3A 3DAEA 3HAMA 4CCUA 4HNFA 1G5SA 2C5NA 2PVRA 3HV5A 5IA0A 3OY1A 3P1AA 4GKIA 3IGOA 4FIJA 3FQHA 4MNEB 4FZ6A 3P5KA 4PP9A 4M84A 2W7XA 3KK9A 5BYZA 4CLIA 1V0PA 3Q2JA 5DMZA 4W9XA 1W83A 4KUJA 3DDPA 2JDRA 4I94A 3SG8A 2GFCA 3RPVA 3TIYA 5DRBA 4FVPA 4JIKA 2FO0A 4G5PA 3ZFYA 1PJKA 4WT6A 1H00A 3E3BX 2PULA 5ETIA 3QUEA 5ANDA 3K2LA 4G3FA 1OI9A 3QC4A 4CFFA 3UVPA 4EK4A 5GJDA 3MJ1A 4QMNA 2WMVA 2XNNA 4EC9A 5HTBA 3VJNA 3FYKX 5GHVA 4CKIA 4R1VA 4GFOA 3WYYA 3MSSA 5FGKA 5ETAA 5FDPA 1TVOA 1JSUA 3O8PA 4M13A 4M8TA 4Q5HA 2UW4A 2XVDA 4NWMA 5A46A 5DNRA 3OT8A 4MD9E 1XQZA 4E73A 1IEPA 2YIRA 3DB6A 4TWOA 5LVPA 3IK3A 1OKVA 3OHTA 4QP9A 2R7BA 3TKHA 2O8YA 4C02A 2CMWA 4HCUA 3RMFA 2OF2A 3M11A 4ALVA 1M7NA 3NAYA 1BLXA 3PVUA 1FVTA 4QOXA 4PL3A 2ITYA 5IQCA 3QZIA 1IG1A 4IADA 5HG7A 5HU3A 3PG1A 5AP5A 5I9VA 3CD3A 1M2QA 4JR7A 5I9XA 3FLZA 4IHPA 4NL0A 3OROA 3UOKA 4XRLA 5EOBA 2X39A 5A54A 1SMHA 4MD7E 4AG8A 4BDGA 3TI1A 3IO7A 4PMSA 1ATPE 4BWPA 3HMOA 4WOVA 4Z55A 4UYNA 3DKOA 1R78A 4I6FA 1HCKA 3LFQA 5CEMA 4EQUA 3MH3A 2JBOA 2CN5A 5KMJA 4IAZA 1XH4A 1WBWA 2O65A 3GC8A 5DEYA 2RFEA 4I6HA 4J99A 3VRYA 4I20A 2WMXA 5DI1A 5AUZA 5E8YA 3B2TA 4BRXA 3VS5A 3LOKA 4QMSA 2C3IB 5CZIA 4BTJA 3CR0A 2WMAA 3OTUA 4FZAB 3AD5A 5BVWA 5A6OA 4IB3A 4D2VA 4U5JA 1XKKA 4ZLYA 2X2LA 5AM6A 3O7LD 3VULA 5CXZA 3UC3A 5HQ0A 2YM7A 2C47A 3TNWA 2BDWA 4F0FA 4YBJA 4YSJA 5IQEA 4HPTE 3E7VA 3ATSA 4FSQA 2IZTA 1G3NA 4PRJA 2BDFA 2WQOA 3IOKA 3MPAA 4E5WA 5J87A 4FI1A 3WZJA 1KOAA 4AZEA 3E87A 4GIHA 2GS6A 3KC3A 4R1YA 5ANOA 3TNHA 4OTPA 2OJGA 2VX0A 3UTOA 5KHWA 3N4VA 4R8QA 3PJ3A 4L42A 4RVKA 4TWNA 4GCJA 3CCNA 3PWDA 3C1XA 5J95A 2H96A 4C3PA 3SA0A 3TUCA 3AOXA 2R64A 2RF9A 4FV1A 4IAKA 1ZMVA 3GC0A 3OC1A 1CSNA 3ORNA 4K18A 1CTPE 3REPA 3HRCA 1Y8YA 4RMZA 4EHGA 3I7CA 4IX3A 1Z9XA 5BVOA 3DFCB 5KO1A 2B1PA 5T3QA 3HMNA 4PP7A 3S0OA 3QRTA 5E8SA 2JKQA 5AV4A 3HECA 5AP3A 5EQEA 3U9NA 2X7FA 2X81A 1KE5A 3TV4A 5HBJA 3G0EA 3F6XA 3VUGA 5A4QA 4KBKA 1ZYCA 4ACGA 3ZOSA 3UBDA 3DLSA 2FVDA 3LJ0A 2CKPA 3D9VA 5BVFA 3BEAA 3V3VA 3MV5A 3B8QA 2WU7A 1PMUA 5L8KA 1P5EA 3BYOA 4XJ0A 4J7BA 5J79A 2JIVA 2W4JA 3LHJA 4PL4A 4XG8A 3SXSA 4IZ5A 3VNTA 4ZJVA 4R77A 4L9IA 1W8CA 3PUPA 5D41A 4ERKA 5HTCA 3PTGA 4C4IA 3KRXA 3F5UA 5AAEA 5HD4A 5F95A 4ZS0A 4JG6A 3EL8A 3KFAA 4YZNA 2ZV8A 3FJQE 3GCVA 3LPBA 3MA3A 4OT6A 5AR2A 3DA6A 4AOIA 1FVRA 2WEIA 5L8JA 3R73A 5HG5A 4JAIA 4XG7A 2FUMA 3RALA 4CRLA 3U4UA 2JIIA 4DG3E 2OZOA 5J1VA 1OL6A 2QOCA 2JITA 4YPDA 5CSXA 4UX9A 3B8RA 1APME 4OR5A 4DFNA 4W8DA 3PZEA 4B4LA 4EK6A 2DQ7X 4M97A 1XH5A 3A7IA 3CS9A 4DH1A 3UOJA 3C4FA 4RLLA 1I09A 3H9OA 4ZOGA 2V0DA 4WNPA 2PZIA 5D1JA 4FKSA 5JQ5A 4GEOA 3RNIA 4CFVA 3T3UA 3R9HA 3FSFA 2BDJA 4EOQA 1UKHA 3R1YA 2YCSA 3VW6A 3TACA 2R3LA 3NAXA 3DJ5A 4ITJA 1LUFA 3DY7A 5DN3A 2V62A 2XUUA 4XRJA 5AA9A 4WA9A 4S31A 3VRZA 3JVSA 5CANA 3AGMA 4H1MA 2XA4A 3PIZA 1UVRA 3QHRA 4Y5HA 2GTMA 2Z7QA 5KMNA 4G3GA 4MXYA 4E4NA 2VO6A 3ZO1A 3QLFA 3QTZA 2UZVA 2O64A 3SRVB 2FB8A 4OTHA 4XBUA 3R7EA 2VTPA 3BU6A 3PSDA 3NCGA 5B0XA 2RFDA 3Q2MA 3C0IA 5AR7A 4M69A 1R0PA 2YABA 1ZAOA 5T6KA 5IA2A 4M69B 5EYDA 2XYNA 1ZY4A 3JXWA 5EOLA 5BVDA 4YC8A 3FPQA 4DFLA 2X9FA 3UODA 2X6EA 2BAJA 5CU2A 4XV9A 1F3MC 4G31A 3EZVA 3QCQA 2QOKA 4FIGA 4F6SA 1OVEA 4K2RA 4UN0C 2E9UA 3D7ZA 5M06A 1CKJA 3UJGA 5GJGA 3DPKA 2V55A 1P4OA 5M57A 5TOZA 4FV4A 4D4VA 4PX6A 5FTGA 3IOPA 3LCKA 5F9EA 2JDSA 3QTUA 5AV0A 4MBJA 3DT1A 5M56A 4I1ZA 3F2NA 4I5PA 4F7JA 3MPTA 4APCA 5FM3A 2OZAA 3MH2A 4Q9ZA 3QWKA 1NY3A 2OZAB 2UW0A 4EH3A 4AF3A 4F70A 5H3QA 2HXLA 3LVPA 3NLBA 3LZBA 4CZTA 4YTIA 3HP2A 5IG1A 3R1QA 4QYHA 3UIUA 4BDDA 4C4EA 3GCUA 1PKGA 3Q5ZA 4WBBB 5T68A 5CAPA 3R04A 4D2TA 5CAQA 4O7WA 3TCPA 4W8EA 4RIOA 4FNYA 3R7IA 4IXPA 3NR9A 4E3CA 2B54A 4JLCA 3VS0A 3W1FA 4I5CA 5IMXA 2XM8A 3POZA 1PXIA 1YI6A 4YJVA 3R8MA 3GU8A 1ZYLA 3VO3A 2WGJA 1PKDA 3MFSA 4FTMA 4FV9A 4IAIA 5EHOA 2ZVAA 3PJ1A 3I5NA 2AUHA 1JSVA 3SV0A 4RX8A 3LLTA 1QPJA 4O2PA 4ANOA 4FVQA 4FT0A 3OXIA 2YCQA 3PSBA 4YLLA 4FKUA 5AEPA 4YMJA 4W4WA 4QP8A 4EK8A 2OIDA 2XJ1A 3UQFA 2EXEA 2YACA 5KHXA 3KVXA 4IWOA 3BZ3A 3C13A 3TUDA 3NUPA 3KF4A 3ZS5A 5L2WA 2IPXA 4CLJA 1U46A 3ZYAA 3PY3A 4HGLA 2W4OA 5D10A 3R00A 3OWLA 4XV1A 3FL4A 3TNQB 3HGKA 3L8XA 4NFMA 4YJOA 4C8BA 4B0GA 4G2FA 4FKLA 4W9WA 3KULB 5BVNA 1L8TA 4ZMEA 3NNXA 4O81A 4B6LA 5CNOA 3AMAA 3Q3BA 2QU6A 2PVYA 4HYHA 4MCVA 5EYCA 4EEVA 5A4TA 1J7UA 4G16A 3MESA 4GK2A 4JAJA 4BGQA 3F2AA 4DH3A 4OLIA 3Q5IA 3RWPA 2UZTA 1IAHA 3RK9A 5FDXA 5HD7A 4EZ3A 4RWIA 4DINA 4KIQA 2VTOA 1XH7A 4ZY4A 2WQBA 2YIYA 3A4PA 4NM0A 1KUTA 3O8UA 4DT8A 4XLIA 4IW0A 4NIFA 3QRUA 5A9UA 3QTRA 1VJYA 2WNTA 3R9DA 3ZUUA 5CAOA 2P0CA 2C30A 4NU1A 4RFMA 4FKOA 5CQUA 2X9EA 3AGLA 3EYHA 5C8NA 3F3TA 3SLSA 3DZOA 4C4HA 4ZZNA 5M53A 3ZUVA 5IPJA 5EW3A 2OK1A 2VD5A 3DBQA 5HCYA 4LMUA 3L9PA 2AYPA 3LFCA 3UQGA 4YURA 5IH5A 3FMLA 3F88A 3TJDA 3FXWA 3LFSA 5DPVA 3BPRA 4F63A 2VTMA 3Q6WA 3KKVA 4GS6A 3VS2A 2Z7LA 3DBEA 4MNFA 4A4LA 5LVMA 1TQPA 2OG8A 4HGTA 1V0BA 2A19B 3BU3A 4NH1A 4BCNA 5IA4A 4UWCA 3TZ9A
chains in the Genus database with same CATH superfamily
4AT4A 3FLSA 4W4XA 2WU6A 4FTCA 5FXQA 5HO7A 3TKIA 3BLHA 4FEVA 2ZM3A 4I6BA 5M08A 4A9YA 1Y8GA 5CSVA 2UW9A 4XG6A 4NKAA 3MVJA 1WZYA 4DCAA 1IASA 1WVXA 3OCGA 3CIKA 5EH0A 5HE2A 4A4XA 1XMLA 2W4KA 5CF6A 1YVJA 2HZNA 3P86A 4IZAA 4EJNA 3O17A 3FMDA 3EKNA 3SOCA 5CNNA 5EHYA 2R3GA 4FKIA 3UVQA 4ZAUA 3AC1A 2YDKA 4RFYA 3UG1A 4BDJA 3CTQA 2HCKA 4ANQA 1FGIA 4O0SA 4EK5A 4Z3VA 2CNUA 4ZTHA 4IX5A 5IH6A 2XARA 3UDSA 2OKRA 4M15A 3NZ0A 2B52A 5I9ZA 3E88A 1GIIA 4J8MA 3M2WA 1FQ1B 1YXVA 2VWVA 2F9GA 2VRXA 5HLWA 5EI6A 3H0ZA 3EFLA 3QQGA 4GG7A 1M7QA 3LCDA 4PTGA 1E1VA 4UXLA 4AS0A 4DFYA 5FD2A 4S32A 2XEYA 4DEDA 4IH8A 2BRNA 3OUNB 5DG5A 3CPCA 5AUVA 3R28A 4ZK5A 1KV2A 2YLFA 4CSVA 4K0YA 4DFUA 1X8BA 4PY1A 2IZUA 5JFXA 5DEWA 4O4CA 3I60A 1VZOA 2OF4A 2BTSA 4DEAA 3EKKA 2YFXA 4QPMA 4EOIA 2BKZA 4K11A 5GIPE 1IAJA 3CLYA 5LCJA 1UU3A 3HRBA 2VTQA 4ZY5A 3MFUA 2DYLA 2ETMA 3A7GA 4GUEA 3D4QA 4QP6A 4RLKA 1W84A 2GHGA 4OTWA 1NXKA 3TT0A 2WZJA 4G1WA 3K54A 1ZMWA 4AWIA 3H0YA 5I9YA 4O1PA 4YHFA 2CDZA 4BCMA 3OMVA 1YQJA 5HE3A 3ACJA 5DFPA 5EFQA 3RK7A 3O0GA 4IJPA 3Q96A 5EM7A 3KN5A 3UE4A 5FTOA 3FMMA 3RI1A 4C2WA 4BYJA 5HKMA 3BV2A 2QOIA 5HI2A 3PXKA 2PVNA 4XEYA 3LIJA 3CGFA 4QMPA 3V6SA 4USDA 4B99A 3GU4A 3EQRA 3K3JA 5FP6A 3RJCA 5GZ8A 2XIXA 3DQXA 2BVAA 2F2UA 3C4ZA 3CKWA 5HO8A 2W9FB 2GQSA 5CEKA 4XG4A 4D4YA 4KS8A 4LFIA 5TR6A 5ANIA 5FBOA 2BIKB 3OUKA 3HYHA 4MD8E 3KMUA 5AUWA 3ZZWA 4D0XA 4E93A 4CZYB 5BYYA 3DXQA 3QAME 1BUHA 3CEKA 3DJ7A 1TFFA 3PZHA 1VLRA 3LMIA 4DTKA 3CQWA 2WTIA 4TYGA 4AN9A 4DCEA 4RX5A 5JEBA 4UMPA 3G90X 2WMSA 2WTKC 4C4FA 3C0GA 4D1SA 3QA0A 4J52A 2PE1A 4RC3A 4D0WA 2PUPA 1CMKE 4KWPA 4M68A 3VWAA 4A7CA 2BIYA 2OJ9A 4I4EA 4NW5A 3ULZA 3LKMA 4TY1A 5ITAA 3DAKA 4FNWA 4QNYA 4EONA 4QPSA 4BZNA 4FR4A 4O1OA 3VBYA 5DLSA 3TIZA 4DT9A 5KBRA 4Y83A 5I9UA 4BCFA 3UZPA 4QQTA 4BHZA 5A3XA 5E9EA 1HCLA 2IN6A 4BB4A 4BCGA 2JKKA 3N4TA 4NZWB 4F1TA 4RFZA 1WBOA 5FLFA 5IDPA 4JDKA 4ZJJA 1UWHA 4WUAA 2J51A 4A9SA 4I92A 4DG0E 3ENHA 2YHVA 1YXUA 1TQMA 1QPCA 3C51A 3Q6UA 1OKYA 4LMNA 2BHEA 4AAYA 2HK5A 1CKPA 2R3IA 1YDSE 2FSOX 4B8LA 3EN6A 4QMLA 3EQIA 4L43A 4O96A 3TKUA 3W0NA 4AQKA 4BWKA 3MWUA 1YOJA 1OPKA 1K3AA 2XB7A 3DZQA 4FTQA 4GW8A 4IZYA 4FTAA 4LM5A 4YBKA 5BVKA 4ASXA 2AEGA 3PG3A 3UNJA 5KE0A 1ZMUA 2W17A 4IACA 5LVOA 4PMMA 4B7TA 4MBIA 4RG0A 3MJ2A 3RHXA 3RAWA 1AGWA 4IWDA 5FEQA 2BALA 3JPVA 2PY3A 5KZIA 3R71A 5J8IA 2FYSA 3S4QA 3LMHA 1H27A 2B9IA 1RW8A 3GT8A 3Q60A 3F3ZA 4GYGA 4N70A 1G8AA 3M42A 4FICA 1Q99A 4BBEA 4OAVB 2QO7A 2YISA 1Q4LA 2JBPA 1S9IA 2XNMA 4FTRA 4IC8A 4TT7A 2BZJA 3LAUA 5E7RA 2J4ZA 4NK9A 3F7WA 5M09A 2B9JA 3U6HA 4Y5QA 4X6RA 4XUFA 1XBCA 4YJTA 3JYAA 3FZPA 4AAAA 5JRQA 4NCTC 4O86A 4QTAA 5KX8A 2GTNA 2HYYA 2HY81 3OXTA 2BUJA 2B53A 4QTCA 4XCUA 4BTKA 4UEUA 4U8ZA 2WEVA 4AU8A 3EN7A 3ZRMA 1YRPA 4H3BA 2P4IA 4FZFB 4A9UA 2I0HA 2J0IA 2ITWA 4GK4A 5IU2A 5HNIX 1LEZA 4KBCA 2RIOA 4ACHA 2I0YA 2F7EE 2ZM1A 5HE1A 3SAYA 3ID6C 1W7HA 2JD5A 3W16A 1OIQA 1YI4A 3M1SA 4YJNA 4EL9A 4RA5A 2HENA 2QLUA 5ANKA 1DI9A 4JXFA 1CDKA 4XOZA 2JDVA 4YHTA 3RVGA 5FBNC 4BGGA 4O0XA 2Y4IC 4UYAA 5KKRB 4DE4A 3QX4A 3CJGA 4R5SA 4NTTA 4X3FC 3UOHA 3R8ZA 4BY9E 3NUYA 3HA8A 3CPBA 4O0TA 4ALUA 4EBWA 5JKGA 3FQSA 3R6XA 3NW5A 2PU8A 4L7FA 4GK3A 5EQPA 5C8MA 4C62A 4E8AA 3CTHA 3SXFA 5IQHA 4D9UA 4EYMA 4J98A 2AQXA 3FXZA 4QP3A 1UU8A 4CFXA 3FBVA 3D5WA 1YDTE 4ZTMA 2CNQA 2IVTA 3GU5A 3EQCA 4UZDA 4FYOA 1WVWA 5IEXA 5JH6A 3QYWA 3PVGA 2WTKB 2PVMA 3MFRA 4FV5A 5EDPA 2R0UA 5HICA 4F0GA 2X0OA 1YHSA 2C0TA 5JMSA 2DS1A 4HJOA 5AX3A 5L3AA 5DT3A 2QONA 2VWZA 3W2QA 3UMXA 3CP9A 2ZFYA 2GCDA 4EHEA 4S30A 5IUHA 4OGRA 3G2FA 3DS6A 5HNGA 4PQNA 4RVMA 4F7SA 4LGGA 3LQ8A 5M4CA 1NW1A 5EI2A 3VS4A 3LM0A 3FHRA 4LV5A 4C2VA 3HV4A 1UA2A 3IW5A 4AZWA 4F9BA 2YCFA 4U3ZA 1YXXA 3I4BA 4M0YA 2QHMA 5HESA 4D5HA 1H24A 2C6KA 4CGAA 1W2DA 2B7AA 3GP0A 3NS9A 4HVDA 5HVJA 4JS8A 3FE3A 4LGHA 2Z7SA 3GGFA 3KRJA 3BWFA 4GG5A 3ZO2A 1JNKA 3L9LA 2XIZA 2EVAA 3ZC6A 4CT1A 4AW5A 1SVHA 1BYGA 3V8WA 4GRBA 2O3PA 4K6ZA 3TG1A 3NCZA 3U6IA 3PLAE 3NDMA 3QQUA 5M55A 1LP4A 1H0WA 3KCFA 5CEQA 4O6LA 5B2LA 3W2RA 3O71A 4HYSA 4IQ6A 4EH9A 2UZDA 4ENXA 5JFSA 3W0RA 3ZH8A 4E4XA 4WO5A 4L46A 5AP2A 2H8HA 1U5RA 3V5QA 4G3EA 2G2IA 4OTDA 4TKSA 3VBWA 2I0VA 3WOWA 3KIOC 4BCJA 1KE7A 5C4KA 3H4JA 4IANA 2IZRA 3ZSGA 4E1ZA 4GT3A 4O0VA 2XJ0A 2WKMA 5EYKA 3RAHA 2YZLA 5AIRA 1AQ1A 4PTCA 3AC5A 3KXGA 5DA3A 2C1BA 5IQIA 2ERKA 4HVHA 3DGKA 4NCTA 2QO9A 2XK7A 3T3VA 2CKQA 3FSKA 3HMPA 2I40A 3E5AA 3MIAA 1XH9A 3NUSA 5CLPA 2A1AB 3FQEA 5K3YA 1GIHA 3RCJA 4C38A 5B2MA 5LOHA 4G9CA 4YO4A 3F5XA 3HMMA 3R2BA 4MTAA 4BI0A 3LXNA 5J1WA 4QDVA 2BTRA 4FIIA 1G8SA 2EB3A 4NKSA 4MH7A 3GOPA 2YA9A 3SOAA 2Y6OA 3ZSHA 1UWJA 3GBZA 4GH2A 4KSPA 2OI4X 3I79A 4LI5A 4Y72A 4M0ZA 1Q8ZA 4ZXTA 4FEUA 4KINA 4PF4A 3KREA 4AXAA 1FVVA 5IUIA 5TT7A 1U54A 3JVRA 2FSLX 2J90A 3FPMA 3TNPC 1U54B 5LMKC 2ZAZA 3AQVA 1JKSA 3G6GA 4GFMA 3NUNA 3VF8A 3ZFXA 4NJ3A 2R7IA 3FWQA 2W1CA 4AX8A 2WO6A 3NUUA 2ZDUA 3BE2A 4C36A 4YPSA 3VS1A 4FE2A 4TYEA 4C58A 3PXYA 2Y4IB 3KF7A 4X3FA 4X3FB 3GXLA 4YTHA 4FK6A 3C9WA 4OT5A 2XCKA 4FKVA 2E9OA 2CSNA 4OTGA 4PDPA 4APPA 4YO6A 4EBVA 3NX8A 3OD6X 4RIWA 3K5UA 5H8GA 5EDRA 4F09A 3NUXA 4FT7A 4RIWB 2YM8A 4BBFA 4J97A 5BQ0A 3BBWA 5IA3A 2R3PA 3Q9ZA 4EKLA 1PRYA 4FT5A 1BI8A 4IM3A 4D2WA 2CGWA 4CMTA 2XIYA 3DKGA 4C59A 4FKJA 1JWHA 3DFAA 4ZSLA 5JGAA 4FZ7A 4A9TA 2Z2WA 3HUBA 3BGZA 3KA0A 3PFQA 5L2TA 4G3DA 4EUTA 4WRGA 1CM8A 4QMQA 1FMKA 3FL5A 2XP2A 1W82A 3IDPA 4ZSEA 2B4SB 3E62A 5CASA 5JQ8A 3HLLA 3GUBA 3C4CA 3THBA 5HBEA 3WIKA 1ZYSA 4H36A 3MFTA 4AACA 1H8FA 4MXAA 5FXRA 5ICPA 4G9RA 4AOTA 3HKOA 3NW6A 4QMTA 3KY2A 5ACBC 4FG7A 4P7EA 3V5TA 3DB8A 5BV3A 2O63A 3FZRA 4FSYA 4BIEA 1BKXA 2CKEA 3OY3A 2BRHA 4FSZA 4IAYA 5CVHA 2QR7A 3MY1A 4AGUA 3COHA 3S2PA 2VUWA 2H9VA 5FP5A 4CV9A 5F1ZA 2RSVA 3D7TA 4FTIA 4ZMFA 3FZTA 1H1QA 2G2HA 3JS2A 3LM5A 2I6LA 3PXZA 4IVAA 4RGJA 1DAWA 3RAKA 4EOPA 4F9CA 4AZTA 3QL8A 4I5MA 4IZ7A 1Q3WA 4UMUA 3G9LX 3CD8A 3WZUA 4O84A 3P7AA 2PTKA 3QHWA 3UNZA 1OPLA 1ZYDA 2ITUA 3ZLSA 5TE0A 1OKZA 4X7QA 4L3PA 3RNYA 3ZRKA 4YC3A 3A8WA 2JIUA 5G1XA 3QZGA 1UKIA 3LCSA 2J7TA 3TZ7A 4TPTA 4TYIA 4ZP5A 4A07A 2XIRA 3PDTA 4MWIA 5CF8A 3WF7A 2CCIA 3FDNA 3KQ7A 4AFJA 1R0EA 3PYYA 4FTKA 3SC1A 1RE8A 2WIPA 5IMEA 2QKWB 3SKCA 4FV3A 4KIOA 3S1HA 4EC8A 5C27A 2XMYA 3P79A 3EQPA 3R1SA 3E7OA 3DK7A 3ODYX 3D83A 4O0WA 4ZS4A 2VWBA 1ZOGA 3PUFC 3ORTA 4V01A 5DT4A 5DGZA 3ZO4A 3IKAA 2XKEA 2Y8OA 3FZSA 4A4OA 2BKKA 4FEWA 2HWOA 4R3RA 4O27B 1A9UA 3QRIA 3ELJA 3LFBA 5DHJA 4Z9LA 3RP9A 2LGCA 2CHLA 4PNKA 5HVYA 3OZ6A 5KUPA 5BYLA 5HHWA 4DITA 4USEA 3R83A 2PK9A 3UDBA 2WD1A 2OICA 4XG9A 2VX3A 4PUZA 3VUDA 1PY5A 1V0OA 3MB7A 3RPYA 2FSMX 4AZVA 4Y73A 5LMKA 3BHUA 2UV2A 3I6UA 5FRIA 1PF8A 1Y91A 3L9NA 3QFVA 4P5ZA 5CZHA 2VN9A 2J6MA 2X0GA 3R8VA 4U3YA 2ZMCA 3ZDIA 4JDIA 3UMWA 4CMOA 2C0IA 1WMKA 5L8LA 1WBVA 3BRBA 1GZ8A 2EUFB 1YHVA 2B55A 2YN8A 3PWYA 4FC0A 3FI8A 3DK6A 5ANEA 1Q8YA 5HIEA 2G01A 4FX3A 5IQFA 4V05A 1WBTA 4FF8A 2BAKA 4AN2A 2R3FA 4EH2A 3ALOA 2UZUE 3OEFX 2CNVA 2VTJA 4DEBA 3KK8A 3LFNA 3MIYA 3NNWA 4MQ2A 2F49A 2X0PA 2XNGA 3WZKA 4RIYA 3ETAA 1PHKA 4BCIA 4D9TA 4HVGA 1UNHA 4ZLZA 3E8DA 2XKCA 2QOBA 3NYVA 3OCBA 4D4SA 4YNOA 1JOWB 3ZUTA 4EHZA 1MRYA 2ACXA 4XBRA 1QPDA 4PNIA 2C69A 3GU6A 4HW7A 3QGYA 3ROYA 5DRDA 4JBPA 2FA2A 3LFEA 4LL5A 3ZBFA 4DGGA 4CNHA 3A60A 2ETRA 4LV7A 2R2PA 4JQ7A 2OXXA 3TV6A 4OBQA 4CD0A 3PJCA 3KB7A 2WMTA 1Y6AA 1U4DA 4R78A 3UQCA 3G5DA 2NP8A 4U44A 2E9NA 4AOJA 1SNXA 3A8XA 3FLWA 2ZV7A 1RQQA 3AT2A 3QU0A 2V22A 2ZV9A 5KCVA 2O2UA 1H26A 4BCQA 2WOUA 3OT3A 4Q9SA 2QR8A 2I7QA 1OECA 1PXLA 1M2PA 2ESMA 3L9MA 4AT5A 5CAVA 2W06A 5F94A 1Q97A 1VYWA 3DNEA 1J91A 4BWXA 3P0MA 3VS3A 5GINE 1WFCA 2Y0AA 4UV0A 4YJPA 3LFDA 4UALA 3D5VA 4FTTA 3HUCA 4FL3A 3T8OA 1E1XA 4JBQA 5A4EA 4D58A 5JT2A 3QCSA 3UOLA 3W2OA 4DTAA 5K4IA 5A6NA 2WFYA 3CBLA 3DDQA 3GENA 3PPZA 3G33A 5M07A 4HVIA 1XH6A 2VZ6A 2YIXA 1MQ4A 3LQ3A 3R7UA 4QTEA 4B8MA 3NNVA 5LVNA 3IW6A 3QQKA 2VTHA 3COIA 3R22A 4YTCA 4R5YA 3W0MA 3I81A 4QMXA 1B39A 3MY0A 4KABA 3HP5A 4CQGA 3N51A 2DWBA 2ZV2A 4QO9A 4NW6A 1DM2A 3P78A 4ONAA 5AIKA 5FM2A 5EI8A 3ZLXA 4GU9A 2ITQA 4DN5A 2YM3A 1WBSA 2UZWE 3R8UA 1JPAA 4CEGA 1ZARA 4JG7A 3EOCA 4O22A 5KNJA 2VTTA 4EYJA 3PFYA 4QP7A 5ETFA 5CENA 3BQCA 2PMOX 1VYZA 4KIPA 4MEDA 3QALE 3VC4A 1Q62A 2VNYA 3KRRA 2UUEA 3OBJA 4BF2A 4X0MA 3R7OA 4FNZA 3HEGA 3PRIA 3BYMA 4BKZA 4AXCA 3QD0A 2QOQA 3PSCA 4IEBA 4L68A 2WB8A 4PWNA 3UC4A 4G6LA 3R2YA 4MX9A 4JR3A 2ITOA 4WRSA 4BDKA 3V5LA 3HX4A 4DEHA 3PA3A 4O4BB 3R9OA 4ALWA 1YWVA 2BPMA 1ZY5A 3O8TA 4N6ZA 4XV3A 4HGSA 5IEYA 4N57A 1ZZ2A 4V04A 4NIFB 2NO3A 4ANNA 4QEBA 3WF8A 4G6OA 4GJ2A 4O83A 3GVUA 2CPKE 4RIXA 2F7XE 3QD4A 1JQHA 3TEIA 2X8EA 4RIXB 2XKFA 4ZTRA 4O7NA 2ITTA 3LXPA 3CY2A 2PSQA 4K1BA 5AR5A 1W2CA 3I7BA 4CMUA 3D14A 4QMOA 3DTCA 2C3JA 3MS9A 1FMOE 5M44A 5IQDA 3IQ7A 1OUYA 3RPOA 5CXHA 4QT1A 2IO6A 2E9PA 3QX2A 5D7AA 4D2SA 1ND4A 3W0OA 1Q5KA 4YNEA 3MW1A 2IZSA 4EH8A 3MH1A 4BDFA 5CF5A 4HZSA 4FV2A 4YJRA 2G15A 3ERKA 4F64A 4MUQA 2GNJA 1H1SA 4XV2A 4QQJA 1YXSA 4MKCA 4BJJA 3DCVA 3QKMA 2C6MA 2W05A 4DHFA 2WMUA 3QQFA 2GSFA 2HY0A 1PYXA 4EI4A 2SRCA 3DK3A 3VUTA 4KKEA 1O6YA 4RRVA 4N4SA 1Q8UA 2ITPA 3LFAA 4D4RA 2RL5A 3R9RA 3C50A 3RZBA 5HLPA 3Q4UA 5CQWA 2ZDTA 3BWJA 2XK9A 2UW8A 3BI6A 5AJQA 2ZOQA 3WE4A 2A2AA 3ML1A 3PXQA 4FKWA 2V5QA 3MGYA 2IWIA 4LRJA 5CSHA 4DDGA 2JAMA 4L3LA 2C6TA 4JDJA 1I44A 2UW3A 3UVRA 4BKJA 2GDOA 3W33A 2RG6A 1YOLA 3QXOA 3VHKA 4AP7A 2NPQA 3BV3A 5C01A 2X1NA 5LQFA 2QCSA 4UXQA 3AKLA 4UZHA 2JC6A 4RVTA 2EU9A 4JRVA 3UO5A 3TTJA 2OXYA 2UVZA 3FI2A 4ANBA 4UMTA 1ZRZA 3N4UA 1OPJA 5E90A 3MVLA 2EXCX 4Y46A 3BHYA 1FINA 3R0TA 3BHHA 4JNWA 3G9NA 3QTSA 2X0QA 4UMQA 4YZBA 3RAIA 3FC1X 2YDJA 5DOSA 2OSCA 2J2IB 4TZRA 4D5KA 3IG7A 5HZNA 3PXRA 2OFVA 3ZLWA 4KRDA 2PZRA 1XJDA 4LOPA 4UMRA 4J1RA 3FHIA 4TYJA 3ZONA 1PMVA 4KNBA 4O82A 3MVHA 1LEWA 3DJ6A 3TWJA 3TV7A 1UU7A 4J95A 4N6YA 2HWPA 4L6QA 3F2RA 4QMYA 2WIHA 4R7HA 3PJ8A 4FKQA 3RBWA 2PUIA 3AC3A 4LL0A 4OTIA 5I0BA 4DH7A 1ZXEA 4KKHA 3U8WA 2HZIA 3S3IA 3C0HA 5E8VA 5JFWA 2OFUA 4GVJA 4O21A 3U9CA 3DOGA 5J9YA 2XJ2A 4YTFA 3R63A 3QBNA 4TWPA 4WIHA 4R6VA 5E8TA 5F4NA 3NW7A 2HOGA 2ITZA 4C33A 4ANLA 2Z7RA 4WG5A 5C26A 3OVVA 4NM7A 5DVRA 2UW7A 3WIGA 4CYIA 3MBLA 3DXNA 4H39A 4KB8A 2R3RA 4YUQA 2YM5A 2GMXA 2Y4PA 3HV3A 5E1SA 4EK3A 3RM6A 5HLNA 2QOFA 1SYKA 3ZZEA 3FYJX 4IE9A 4D28A 4QMVA 4P5QA 3FKNA 4IB5A 2XNEA 4O38A 2JLDA 4PPAA 3EH9A 4R3CA 2QOLA 4XHKB 4CVAA 3GQIA 5D7VA 5HORA 2VWXA 3OWKA 1YDRE 4FV0A 4NM3A 4MXOA 3RWQA 4U41A 3TZ8A 3W10A 3SW4A 4FRFA 4Z7GA 1AD5A 3MVMA 4DC2A 5K5XA 4P4CA 1Q41A 3FC2A 3H3CA 4O91A 3B2WA 1JVPP 3F66A 2VO3A 3IECA 2WQEA 5KZ0A 2R0IA 4RT7A 4GT4A 2WMQA 3VAPA 3VIDA 3HL7A 1GOLA 3I0QA 4AE9A 4DGNA 5EKNA 3IPHA 3ORXA 4FKTA 3ZM4A 3ZXTA 3W2SA 2PZPA 4CTCA 4G17A 3Q53A 2PVLA 3ZC5A 2PE2A 2XZSA 3E8NA 1Q8TA 3ZEWA 5DR2A 4TTHB 3NWWA 2WMBA 3SX9A 3V8TA 4GIIA 3LCOA 3QYZA 3UDZA 4ZY6A 5JFVA 4FOCA 4GL9A 2RGPA 1ZOEA 5K9IA 4KRCA 2R3NA 3ORLA 3VBXA 3WF5A 4YZMA 4HZRA 2E2BA 4M7IA 3PP0A 2W1EA 3W0QA 4ACDA 1H07A 5B2KA 3F3UA 1QL6A 3CGOA 3RGFA 4M3QA 1ZOHA 5CVGA 2HW6A 4FODA 5JRSA 4ITHA 5HE0A 2WOTA 3W8QA 1QMZA 3HMIA 3KRWA 3BEGA 5K5NA 5HTIA 3K3IA 2BCJA 3VQUA 1H08A 4ANSA 2NRYA 3K5VA 4FZDB 4AGWA 5IA1A 3CY3A 4NUSA 4FNXA 4PTEA 3R8LA 3ZDUA 5BUJA 3WF9A 4KKGA 3O2MA 2H6DA 4CKJA 4ASDA 5I3RA 4EORA 3ORZA 4Z16A 2CJMA 2W5HA 3UGCA 3O96A 1A48A 2GQRA 3KMWA 4V0GA 5K0XA 4UWYA 2VNWA 4V0GB 3UP7A 3BL7A 1H1PA 1OL1A 1P4FA 2FSTX 3MB6A 3KXMA 3RKBA 4O7SA 4O7TA 5KMLA 5E8WA 2YJRA 5HU9A 5BUEA 2ERZE 2WHBA 4F9YA 2J0MB 2WQMA 3HV7A 3KXXA 3OFMA 4O0UA 4DEGA 3O23A 4YHJA 2C4GA 2EXMA 3PVWA 2IW8A 2R3QA 4HYIA 2X2MA 2CCHA 4YZDA 5JZJA 5AV1A 1PXKA 4E5BA 1GZNA 1OIRA 3E3PA 1G8KA 4AE6A 1OL7A 3FKLA 3GI3A 4IVBA 4CFUA 3HVCA 5CWZA 5LXMA 4JBOA 1NT2A 3E92A 2R9SA 4KA3A 4K77A 4BYIA 5GZAA 1OBGA 3MPMA 5KMOA 3MY5A 5CSWA 2J5EA 3UPXA 3WYXA 5HIDA 1GJOA 2QOOA 4S33A 2YDIA 2OO8X 3UYSA 4F4PA 3LXLA 5BMSA 4C3FA 4H3PA 4BBMA 4FL2A 4BGHA 3W18A 1PW2A 3ATTA 4BN1A 5E8UA 1SNUA 3H10A 4PV0A 3NSZA 4YLJA 5CVFA 4CCBA 4QDEA 5EDQA 3FLYA 1IRKA 2BRGA 2V7OA 2OU7A 4RC4A 4TYHA 3WE8A 1TZDA 4A9RA 4BI2A 4KIKA 1V1KA 2GHMA 3ANRA 4L8MA 5JN2A 3R7GA 4D55A 1H28A 5GIOE 4BZDA 3AD4A 3I5ZA 4X2GA 1EH4A 3C5UA 5AA8A 3F3WA 5FTQA 5AFVA 4QMUA 1HOWA 4E6QA 3ZBXA 5HX6A 4F65A 3MN3A 3BX5A 4NT4A 2WMRA 4XX9A 2XK3A 4FV6A 4DTBA 2XK6A 2LAVA 4OTRA 3VJOA 3KVWA 3EB0A 4F1OA 1WAKA 4BDHA 4F6WA 4HYUA 3OCTA 4XS2A 2OIQA 4R7IA 4F0IA 2W1FA 4B9DA 5C03A 1LR4A 4QP4A 2RFNA 4WNOA 4BL1A 2GNHA 4QP2A 4X3JA 4E5AX 4I41A 4ERWA 2QURA 3PIXA 1NVRA 4C34A 2QKRA 1XMMA 1Q61A 3PJ2A 1P2AA 4YZCA 4RC2A 3A7HA 3TN8A 2Y6MA 4DFXE 2PYWA 1REKA 5D9HA 3NFGB 4GV1A 4EZ5A 5DWRA 5HOAA 2YITA 4ACMA 1IA9A 4EQCA 3U54A 3UIBA 4CXAA 2X7GA 3G15A 3QKKA 3TJCA 1YWNA 1ZZLA 3ZCLA 1WCCA 4ASZA 3IW4A 3D2IA 5HG8A 4RJ7A 1PMNA 3L8SA 4FTJA 3CJFA 3G6HA 5H2UA 4FSNA 4PDOA 5ANJA 4BKYA 2XK4A 2CGUA 2R3OA 1K2PA 4YGAA 5FXSA 5HIBA 1OB3A 2VWYA 4IB1A 3W32A 3GU7A 3QZFA 1OIYA 4FV7A 4FJVA 3KL8A 1U5QA 3VS7A 3BYUA 2Q83A 3P08A 5AX9A 4EWQA 1B38A 2WXVA 1KV1A 3D94A 4E20A 4TWCA 3FMHA 4YJQA 3T9TA 3PRFA 3KN6A 4JRNA 4I0RA 4DLIA 5CEOA 4QP1A 3QLGA 2UW5A 2IVUA 3A7FA 5A4CA 4WG3A 4MNEA 3Q52A 4FSUA 4BTMA 2PMLX 5ACKA 2QI8A 3DBFA 3BGPA 5LVLA 2C68A 1T46A 3FLQA 3BYSA 3DQWA 3AT3A 3U4WA 3GB2A 4IC7A 1H1RA 4NM5A 3EQDA 4QPAA 3FEGA 5JGDA 4DA5A 2XKDA 2O0UA 1T45A 2QU5A 3EHAA 3IGGA 2IVVA 4ZTSA 5C1QB 2AC5A 2KTYA 2J50A 4QMZA 3QA8A 4EOJA 2OIBA 2ZJWA 3G0FA 4Q2AA 3D5XA 5LMAA 4PL5A 2PPQA 3MI9A 3GQLA 4JIAA 3RPRA 2ZYBA 4RJ4A 1DS5A 2OXDA 4U6RA 4XOYA 5LARA 4DAWA 4NSTA 4DGLC 4YU2A 2VWWA 5AR4A 2GS7A 4U7ZA 3AKKA 2JAVA 1J1CA 2UVXA 4U45A 5GJFA 2C6LA 1OGUA 4GMYA 5M4UA 5EW8A 4KD1A 3EFWA 4RJ5A 1M14A 2F4JA 4M12A 4C35A 4DFZE 3GFEA 3UO4A 5EM6A 4BDIA 3H30A 4MXCA 4BDBA 4CKRA 4GT5A 3VVHA 2PZYA 4RSSA 4GKHA 4JMQA 4GYIA 1QPEA 3C7QA 1PMEA 3FI4A 3V01A 4DGMA 3NGAA 4M67A 5BUIA 4XH6A 4IDVA 4CQEA 3NVMB 3FLNC 4WNMA 2P3GX 2Z60A 4KAOA 4EHVA 5KMMA 3QUPA 2WTDA 4BIBA 3UZTA 2F2C