4YPSA

(r)-2-phenylpyrrolidine substitute imidazopyridazines: a new class of potent and selective pan-trk inhibitors
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
294
structure length
280
Chain Sequence
GSGIRVHHIKRRDIVLKWELGEGKVFLAECHNLLDKMLVAVKALSESARQDFQREAELLTMLQHQHIVRFFGVCTEGRPLLMVFEYMRHGDLNRFLRSHGPDAKLLAGGEDVAPGPLGLGQLLAVASQVAAGMVYLAGLHFVHRDLATRNCLVGQGLVVKIGDMSRDIYSTDYYRVTMLPIRWMPPESILYRKFTTESDVWSFGVVLWEIFTYGKQPWYQLSNTEAIDCITQGRELERPRACPPEVYAIMRGCWQREPQQRHSIKDVHARLQALAQAPPV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transfease/transferase inhibitor
molecule keywords High affinity nerve growth factor receptor
publication title (R)-2-Phenylpyrrolidine Substituted Imidazopyridazines: A New Class of Potent and Selective Pan-TRK Inhibitors.
pubmed doi rcsb
source organism Homo sapiens
total genus 86
structure length 280
sequence length 294
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2015-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4ypsA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4ypsA01
5E7RA 2WMUA 2WOTA 2CMWA 5HE2A 3RPYA 4QMPA 2JIUA 5IDNA 3R7UA 5IQAA 4CKRA 2ZB0A 2GPHA 3R71A 3G51A 5CZIA 4I5PA 4M97A 4UEUA 2VWIA 2Z7LA 3EKKA 3QXPA 3U8WA 4GIIA 3IOPA 3LFNA 4O7NA 2BALA 4ID7A 4RFYA 3PVGA 4NWMA 4CSVA 5CENA 1M14A 5CXZA 5IF1A 4IAYA 3COIA 3OCSA 1PJKA 1JKSA 5CSWA 4BRXA 4BTJA 2XUUA 4C8BA 1U46A 5BQ0A 1ZZ2A 3CY2A 4LUEA 3COMA 4BKYA 4GU6A 4EOIA 2VAGA 3E93A 1PYXA 3FLZA 2BZJA 2PTKA 3UBDA 3GEQA 4JRNA 3UC3A 3WZEA 3P86A 3TG1A 4WNMA 4GK4A 4KNBA 5M07A 2GHGA 2FB8A 5D41A 3Q9WA 4C3RA 1ATPE 4MD7E 4BWKA 4GVAA 5HNBA 4FSRA 5LWMA 1FVTA 5IQHA 5ETCA 3TUBA 3ZMMA 4ANMA 4DTKA 3QUEA 5FDXA 2IW8A 3DAKA 4JDHA 1YQJA 4I24A 4RGJA 3RNIA 3EOCA 3RPSA 2O0UA 4FKPA 1PXMA 3OCTA 5HO6A 3MWUA 3DS6A 3FBVA 4BIBA 4FSMA 5LXMA 3GC7A 2WNTA 2F2UA 3PVUA 4GVJA 4FTCA 4BDBA 4D1XA 3OVVA 5KBQA 4NJDA 3FSFA 5JH6A 1XO2B 3EH9A 5HCYA 2GDOA 3VS7A 4G6OA 2UZVA 1XHAA 2BAQA 2JDVA 4BI1A 1YXTA 3C5UA 3EZRA 2X7GA 3GU5A 3R21A 3ODYX 1U59A 2Z7RA 3E64A 3HGKA 4AGWA 4D2PA 4C34A 5KMNA 2PK9A 3DXPA 5C8NA 4G6NA 1KE6A 2ZYBA 2EWAA 1URWA 4IMYA 4PDPA 4QQTA 2C6KA 1H07A 4EYJA 2OW3A 3ORPA 2OO8X 3GFEA 4IAIA 3HEGA 4FA2A 2OI4X 2UZEA 4NK9A 4YJUA 4DEGA 2ZMDA 3BLRA 4M0ZA 3H9RA 5HVYA 4LMNA 3SC1A 3VUIA 2C5NA 3RVGA 4TWOA 1CSNA 2OU7A 3AXWA 4EH2A 5BYLA 5F4NA 4P90A 4F0GA 4E1ZA 1VZOA 1TKIA 4PX6A 3F88A 4JS8A 2P2IA 3PE2A 4YJPA 3EIDA 4CCUA 1QPDA 3EQRA 4MXOA 4DEAA 5K3YA 1RE8A 4IAAA 4FTQA 4F64A 4EWQA 3RKBA 1WFCA 4AE6A 4L6QA 1OKYA 3Q96A 3KN5A 3BU3A 2QO2A 4F7LA 4JIKA 2R3NA 2Z7SA 3UNJA 1JLUE 3I0QA 3SVVA 3NZ0A 4CFNA 4ZY4A 4BKZA 2I0EA 1NVSA 3BEGA 2YM8A 3KU2A 3QRIA 4DFXE 4O2ZA 3QXOA 4C35A 4IQ6A 4FKUA 3MESA 5CALA 4FG7A 2CNQA 4YGAA 5CEMA 4LOQA 4FK3A 3VBWA 2W1IA 5AV3A 4XV9A 5M44A 4WG5A 4MXXA 1OITA 2ZVAA 2QOFA 4NM5A 4WA9A 3WF9A 3KRRA 5ICPA 2I40A 3QQUA 3CKXA 1XBAA 3PRIA 4IC7A 3FL4A 3THBA 4YNEA 4D2VA 1F3MC 2UW8A 4DG3E 3RK9A 3KMUA 2Z02A 2BZHB 3O96A 4DGGA 2YIXA 2HWPA 1V0BA 3MSSA 1XR1A 2JBPA 2R7BA 3ET7A 4H3PA 3SGCA 4L42A 2VWXA 3OEFX 4RT7A 2VTTA 3WILA 3FMKA 4DBNA 2IG7A 2QODA 3VS5A 3TT0A 4YUQA 3ZUTA 3EWHA 3MJ1A 4AT4A 2RFDA 3QBNA 5M51A 3FAAA 5HTIA 5EQPA 1XH7A 3SD0A 4F9YA 3FI3A 5IMEA 1ZOEA 4G16A 4O7ZA 1DM2A 4O0WA 2A4LA 4D2RA 3N4VA 4GUBA 2HELA 3KK8A 3NVMB 3AT2A 1J1CA 3IPHA 4N0SA 3IK3A 3BZ3A 3IOKA 3BBWA 3D2KA 1Q3WA 5C4LA 4I20A 4EHEA 2ERKA 1APME 2XEZA 4ZK5A 2GSFA 1PF8A 1PYEA 2XYUA 4QP9A 3LCKA 1PXJA 1F5QA 4FF8A 4V01A 3VW8A 1H1WA 4WT6A 5IA0A 3V04A 5GIOE 2GHMA 1KOAA 2X6DA 4AUAA 2A19B 4RLLA 4IH8A 3PFQA 4M8TA 2YISA 3CGFA 5HU9A 5IQGA 3TNHA 4DF3A 4CLJA 3S2PA 1YOJA 3P7AA 4IJ9A 3EHAA 4QP6A 3ACJA 2PVMA 5JGDA 3LXPA 2OK1A 3K54A 2HENA 4FKGA 3O0GA 4OTPA 3ZBFA 3ZLYA 4BCGA 2C0TA 2F2CB 3S00A 3HRCA 4NJ3A 3ALNA 3A61A 5HTBA 3BLQA 3V5JA 4AW1A 1KE5A 3CD8A 1U4DA 5EW3A 2OJJA 2XKCA 1ZOGA 2XJ1A 3R8PA 4HPTE 5GJDA 3PXZA 5CTPA 3SOAA 5IUIA 4CGAA 1PXKA 5I0BA 2X4FA 4LMUA 5B2LA 1K3AA 4YPDA 5E8XA 3AMBA 3BWJA 4UWYA 4BCJA 5IA3A 4EWHA 5AMNA 3C50A 4BDAA 3P79A 4O91A 1CKPA 4RIXA 3V6SA 3ZFYA 1U5RA 5KUPA 1Q97A 4ANNA 4RZVA 2B9HA 3NUXA 4G9RA 4XV2A 2ITUA 3BQCA 5ANIA 3KRJA 2WQBA 4FTLA 4ASXA 3QC4A 4N4SA 5B7VA 5KMMA 3OCBA 4IC8A 4K77A 1Q24A 1V1KA 1QPJA 2QG5A 3GGFA 4GRBA 4TNDA 5EM8A 3G0EA 3VVHA 1VEBA 4WRSA 3KRWA 3I81A 4OTHA 5BVWA 4I22A 3NNXA 4FIGA 1H1QA 3MVLA 2CLQA 4Q5EA 4QP4A 3K3JA 1I09A 4YZNA 4IB5A 4AT5A 3NCGA 4XG2A 4XS2A 4UMPA 4EH9A 4GJ3A 4AQCA 5AIRA 3MB7A 3E8CA 3R01A 4ZMEA 2W5BA 1V0PA 2XBAA 2SRCA 2QQ7A 3G33A 2OSCA 1H28A 1Q8WA 3G0FA 3NW7A 2VWBA 5HESA 4WNOA 4J98A 2W17A 4EJNA 2P2HA 2QURA 5DMZA 1NA7A 4QQCA 4IB3A 3DB8A 5HE1A 4BYIA 1XBCA 4TRLA 2QNJA 3W18A 5KMJA 5AFVA 2QU6A 3R73A 3F69A 3P7CA 3JR1A 4FV6A 4KIKA 1QCFA 4PY1A 2RSVA 4A06A 3Q2MA 5EQYA 2WMTA 3WE8A 2REIA 2X9FA 4TYHA 4D0XA 4GT3A 1PHKA 2UV2A 1W84A 5ETIA 3QTUA 5H8BA 3K5VA 1Q5KA 3HV3A 4X7QA 2UW4A 5CEKA 4J8NA 3RWPA 1ZLTA 2RFSA 4TL0A 4C33A 4CG8A 2ERZE 3K5UA 1FMKA 5L2WA 3WZJA 3CJFA 3Q9XA 2G01A 4XYFA 3DKFA 5BVOA 2R2PA 3KRXA 1YHWA 2QKRA 1U5QA 4HVHA 1JSUA 3LLTA 2WKMA 3EYHA 4UBAA 3ZSIA 3DXQA 3Q4TA 4BDEA 2Z8CA 4BF2A 3S1HA 4E4NA 1H0VA 4DFZE 3ZEWA 4XEYA 5HIEA 2CKEA 4RQKA 5BX0A 5A3XA 3LFAA 4DT9A 4YR8A 4GCJA 4LV5A 1QPEA 3Q53A 4RIWB 4BZOA 2YABA 2JDSA 2C0IA 4RSSA 3PRFA 3BKBA 4FSUA 4RX9A 4YZ9A 4YTHA 4GFOA 4H58A 4DAWA 5CWZA 2RL5A 4FIIA 2QOLA 3KVXA 4M69B 2UW0A 4FIHA 3P9JA 4L9IA 1CKIA 3F2RA 3RPVA 5CI6A 3PXYA 3ERKA 5J9ZA 5EI6A 4N57A 2NNWB 5JFXA 5IQEA 2CKQA 4ZTSA 2FA2A 2R9SA 4O7TA 4PTGA 5HG9A 4A9YA 5CY3A 2ZV9A 4XX9A 4ZTQA 3UMWA 4G31A 2OGVA 4AS0A 5BPYA 2PYWA 4YHTA 3OC1A 2VTIA 5FP5A 1PMVA 3ALOA 2OH0E 2X81A 4M12A 2ITTA 5F94A 4EYMA 1M17A 2GNIA 4PTEA 3CTHA 1S9JA 5KBRA 5IQFA 2ZV2A 1Y6AA 4XG3A 3VHEA 3MH2A 2BHHA 4J97A 4W8DA 4J99A 4TT7A 5HKMA 2YN8A 3FY0A 2R3FA 2C5XA 4FT0A 3TIYA 2RG5A 2I6LA 3IDCA 4QMOA 3GU4A 3AT4A 4QNYA 4EZ7A 4Z7HA 4TYIA 3C4FA 3UOKA 2UZDA 4YLLA 4OAUC 2E9PA 3PG1A 4BBEA 5JGBA 3KEXA 1XBBA 3ZZWA 2FSLX 2VWUA 3KXHA 4U80A 2HZIA 4FG9A 3FMNA 3VJNA 2WMVA 3VUKA 2HCKA 4G2FA 5AAGA 3M42A 1OL5A 2R3PA 1ZYSA 2BKZA 4QYHA 4HPUE 3MGYA 3MY1A 1FPUA 5C9CA 1Y8YA 3FL5A 3QL8A 2OIQA 4ORKA 1YXVA 3HKOA 5AX3A 2UVXA 5EHOA 3NNVA 2W99B 4A07A 2UVYA 3A8XA 3MY5A 4RJ5A 5JKGA 5BVEA 5M4UA 1H1SA 1OB3A 4IHPA 5FM3A 3UC4A 2O2UA 3ZO4A 1OBDA 3VUHA 2OH4A 2WMBA 2VUWA 3E7VA 1S9IA 2CCHA 2CLXA 1DI8A 1A9UA 3KA0A 3ZSHA 3W32A 4I6QA 3QC9A 3QTZA 4QTCA 4L01A 4BTKA 2B9FA 2JFMA 5GJFA 5I5ZA 4IB1A 2YM5A 3OOMA 4D2SA 2J7TA 1M2QA 3QZGA 3IGOA 2O65A 3CY3A 4ZSEA 2PE1A 3WI6A 3UOLA 2GQRA 2HAKA 4Z3VA 3ZLSA 3LOKA 4JG6A 4FVQA 4CZTA 2GNLA 3GC8A 2XB7A 4OLIA 5HTCA 4PRJA 3P1AA 4D2WA 4TWNA 4ACMA 4R6VA 4RZWA 5CLPA 2VTHA 3ORLA 5FUTA 3SG8A 1ND4A 3MH1A 4X3FC 3JPVA 1R0PA 5FRIA 3QGWA 5H2UA 4G3DA 3BI6A 5E8YA 3C1XA 3VUMA 2IPXA 1JNKA 4G5PA 4MD9E 4NTSA 4TWPA 4HVGA 5BUJA 4YZMA 3I6WA 5I9VA 5FTGA 5CX9A 1REJA 3RPRA 3AGMA 4H3QA 4IB0A 4C38A 4YLJA 1PKGA 4F4PA 4ZLOA 4FG8A 3BCEA 3ZUUA 5BVFA 5AUXA 3D94A 4U6RA 2J50A 4XBUA 3VBXA 4RPVA 4EH4A 2VTMA 3OWKA 3PJ2A 4RJ8A 5H8EA 5EI8A 5A4LA 1Z57A 2WZJA 3GU7A 5EKNA 4M13A 2YAAA 2PMOX 4FBXA 4O7LA 3ELJA 4O2PA 3WYYA 2JKOA 5IA5A 3KF4A 3MIYA 4KIPA 3OFMA 5I9YA 3F5PA 4EORA 3L9PA 4CFFA 4MEDA 4FT7A 4BI2A 2F4JA 4LGHA 3ZRKA 4YJOA 2Y4IC 4EHZA 2X7FA 3E8NA 3U87A 3FY2A 3AC8A 3G6GA 4MXCA 3G2FA 2UW5A 4KBAA 4BR3A 4CYIA 3FEGA 2W1ZA 4IVDA 3FPMA 3HECA 4WG3A 1A48A 4UYNA 4ACGA 2IW9A 3TKHA 3VWAA 2XKEA 3FC1X 2GTMA 4BHNA 4C4JA 5KKRB 4MQ2A 3UNKA 2W1GA 5FM2A 4ZY5A 2V7OA 3V6RA 5M4IA 3TZ9A 3HA8A 3JUHA 4AA4A 4RWJA 3A7JA 4ERKA 2PUIA 3NAXA 4QTBA 5CXHA 3I79A 5HQ0A 4ZSGA 4A4OA 5IA2A 3Q6WA 5JMSA 2OKRA 3UTOA 5A46A 4W4YA 4YMJA 1SVEA 1H8FA 2BROA 3V5WA 2F7ZE 3AD6A 3BU5A 4GG7A 3UZRA 2YDKA 5ANJA 2NRYA 4FV9A 3QRJA 1U54B 3NUSA 4IVCA 4FYNA 4LRMA 1X8BA 3DLSA 4PP7A 4L00A 4MTAA 5CU4A 2PL0A 1JQHA 5CVHA 3LMGA 4J95A 2XIXA 2ZB1A 1E1XA 4KBKA 4XOZA 4G34A 3QQFA 1WZYA 2ONLA 3QLFA 4N6YA 3W2OA 4EK3A 3PWYA 3OHTA 4EONA 3VBQA 1YWVA 1IEPA 2BIYA 3ANQA 2UW6A 3HV4A 3QRTA 1AGWA 3QZHA 4GKIA 4NEUA 4C2WA 3NPCA 3RMFA 3MN3A 2XRUA 4U43A 5JK3A 4O6EA 4U3ZA 3LJ0A 2EVAA 1ZMWA 2EUFB 3VW6A 5CAVA 3Q32A 4EZ3A 4ZIMA 3A60A 4E3CA 2VGOA 2XBJA 4GG5A 5ANKA 4YBKA 4JDIA 2G2FA 3SXRA 4ANBA 3AC1A 3GUBA 3EN6A 2VZ6A 2YCQA 3QX4A 4I23A 3I4BA 2PULA 5M08A 3BHTA 2QOCA 3PXRA 4PDYA 3ETAA 1LEZA 3F82A 3M1SA 4D5HA 5K0KA 1PXIA 2JDTA 3TL8A 5KX8A 4DFBA 5CEPA 3SG9A 4E5BA 4QP1A 2QOOA 5FP6A 2WMQA 3NRMA 4NM7A 5HORA 3W2PA 5LCKA 4C4EA 1O6LA 3REPA 1DAWA 2GFCA 3BEAA 4YP8A 3UP2A 3ZXZA 4X6QC 5HVKA 2VGPA 3FQHA 5B0XA 3U6HA 2C6TA 3A7GA 3KXMA 4O0XA 2VTAA 3ZC5A 1SNXA 1WVWA 2CGVA 2J0MB 5L6WL 4DGOA 1XH5A 2PSQA 3H30A 3OT8A 4YJTA 3H10A 3DFCB 4FV4A 5HOAA 4K2RA 4D2TA 2A0CX 3HDMA 4O0SA 2EB3A 3TI1A 5HG8A 1R1WA 1WBTA 4OTGA 5EG3A 1STCE 4NM3A 2WQMA 3E87A 5AX9A 5DT3A 4QMVA 3SXSA 4RVLA 2IW6A 4WNKA 4RIXB 4Y95A 4JI9A 2E9UA 4MAOA 3UYTA 5AA8A 3UIMA 3NUPA 4KWPA 3R22A 5IISA 4BCFA 2E9NA 2EB2A 3VS2A 4W4WA 4B7TA 5HG5A 2OXYA 4L68A 3DDQA 2DYLA 5M56A 5IA1A 2HXQA 4Q2AA 2VTOA 2WTCA 3A99A 3AC2A 3OXIA 2OFVA 2IO6A 5BUIA 2GS7A 3D9VA 2WU7A 3IW4A 3PXKA 3Q5IA 3C51A 4O7VA 1AD5A 3FMEA 4R3CA 5IEXA 4FI1A 3IG7A 2R3QA 5J5SA 2GFSA 2UW3A 3IECA 4GK2A 1Q8YA 4RVTA 5K5NA 4C37A 4FV8A 4S31A 3MA3A 3HNGA 1ERKA 2W4JA 5LARA 2IZUA 4IDTA 3VBTA 4NW5A 3WZKA 3D83A 4EQMA 1SYKA 2XK7A 3OY1A 3EMGA 5JRQA 3R1YA 5TR6A 4KIKB 4RC4A 4YHJA 1YWRA 3MW1A 4ASEA 2C5YA 3OD6X 4CD0A 1JOWB 4FYOA 4IFGA 2BAJA 5KZIA 4QMUA 3OCGA 4IANA 1Y6BA 2UUEA 4M14A 4AN2A 3UMXA 4PMSA 4U44A 2WQEA 2WMAA 4M15A 3CKWA 2E9OA 2X8IA 4WRGA 4CMUA 3H0YA 3HLLA 1ZYLA 2UZLA 3RNYA 4FIJA 4WUAA 3Q4CA 2RF9A 1UU8A 5CAUA 3UIBA 4V04A 2PZIA 4IX4A 4D1ZA 3QD3A 3D7ZA 3FLNC 4QQJA 3BRBA 1MRUA 3NIEA 5EDRA 3F6XA 4MQ1A 4S33A 2YJRA 3R9DA 4U9AA 3LW0A 5HVJA 3SOCA 2FH9A 4J8MA 2ESMA 4X2GA 3SRVB 4AE9A 4D5KA 4F9AA 3P08A 5ETFA 4BZDA 3R04A 3VF8A 5CF8A 3DTWA 4BFMA 5J79A 5L6PA 4HYSA 3PIZA 5EYCA 4JOAA 2FVDA 2Y0AA 5BVKA 5DR9A 1KV1A 3OUKA 4QMQA 2DWBA 1CKJA 1Q3DA 4L8MA 2CGWA 5EDQA 2F7EE 3R9RA 2VNYA 1XH8A 3B8RA 4FICA 3W8QA 1YHSA 4MKCA 4YC8A 3LHJA 4CQEA 5LMAA 2BTSA 2XK3A 3FSKA 4AZVA 1H0WA 2W1HA 1BYGA 5FEEA 1G3NA 5D7AA 4CQGA 2I7QA 2F57A 3V8TA 4BL1A 4F0FA 5IH6A 1URCA 4NZWB 3GFWA 4UMUA 3PYYA 1JWHA 4JQEA 2GHLA 1YXSA 5I3RA 4U0IA 2R3MA 3KXNA 4I6FA 3WARA 3DV3A 3ORZA 4YSJA 3ORMA 3HYHA 3TDWA 1MP8A 2ZMCA 4LL5A 3IW5A 3R1SA 5GJGA 3KREA 2Z60A 3R00A 4FZAB 3FV8A 4GFMA 4JAJA 4K8AA 3VBVA 4QYEA 4F7JA 3DBCA 3PY3A 4NIFA 4FT5A 4TXCA 4UXQA 4YJQA 5AR2A 4H05A 4O82A 4R7IA 1M7NA 1CTPE 4TPTA 3VULA 5DG5A 5KZ0A 3C4ZA 4EI4A 3GQLA 5A9UA 3WF5A 2X0GA 2ETMA 3EQCA 4FZDB 3KKVA 4RJ3A 4ZZNA 4ITHA 5C01A 4F70A 4FEWA 1HOWA 4IDVA 4DCEA 4EK8A 4KUJA 4AP7A 4ENXA 3RAKA 3F9NA 3DQWA 2EU9A 4EK5A 3NW5A 5I9XA 4M0YA 5CU0A 2R7IA 4FODA 4IE9A 1I44A 5H9BA 4IX6A 4NTTA 3FHRA 3L8SA 4OT5A 4O7WA 4Q5HA 4O0TA 3KCKA 2WOUA 3FQSA 4G3FA 2PVLA 3G90X 2GS2A 5EI2A 4O7YA 2P33A 3PSCA 3NUNA 4XJ0A 3L8PA 2HY81 3MTLA 4FTNA 1OMWA 4O6LA 4D4RA 4AW5A 3G5DA 4L44A 2VWWA 3KQ7A 4ACHA 2VWZA 4JBQA 4GUEA 4EUUA 3GENA 2YIRA 2FSOX 2WFYA 1GY3A 2AC5A 2X9EA 1O6YA 2VO6A 3LFFA 3O8TA 3OBJA 4I6BA 5CZHA 1ZY5A 4DN5A 5CEQA 3CS9A 4ACDA 4CV8A 4H39A 4NCTA 3FE3A 2ITPA 3RPOA 4AZTA 2XNMA 3GCVA 4NT4A 1OPKA 2G15A 2QONA 3RAIA 3FLYA 4RG0A 3TZMA 4LYNA 4JVGA 1YOMA 5DI1A 5IQDA 2ZV8A 3U54A 5HD4A 4YTCA 3FJQE 5JN2A 3DOGA 3DA6A 2CN5A 3QKKA 2ETKA 5HX8A 1T46A 1OZ1A 3OXZA 2FSMX 3A7IA 1QL6A 3F5XA 3LAUA 2BRHA 2V55A 3P7BA 2YAKA 4UV0A 4ACCA 4OR5A 3PA5A 4I5CA 5FTQA 3ZFMA 5BNJA 2XM9A 3AD5A 4IADA 4IAZA 4MHAA 3DBQA 3UPXA 2J9MA 3BYUA 4WD5A 3C4WA 3DAEA 3Q9YA 5D11A 3ZYAA 4BWXA 3BELA 4CXAA 3OY3A 3NR9A 4IWOA 4APCA 1OIYA 4QYYA 4EKLA 3R9NA 3W2SA 2Y6OA 4BCIA 2PVRA 3QZIA 4E4XA 5J1VA 4GMYA 5CYIA 2XJ0A 4BCPA 2UW9A 4YZBA 4D9TA 2C0OA 4KKGA 3DPKA 1GNGA 3QQLA 2XH5A 3AOXA 3OZ6A 2QOHA 3P78A 4O1OA 4UXLA 3C5IA 1KV2A 5L2QA 4BDHA 4ZS0A 3QGYA 2GQGA 2XMYA 3E7OA 3MJ2A 2R3LA 2WELA 1U54A 4GSBA 3SV0A 5AUTA 3PLSA 2W0JA 3EFKA 3VS6A 3ROCA 3ZLXA 4FT9A 5J8IA 4AZWA 3O17A 4I4EA 4OBPA 5AV0A 3ODZX 3R6XA 4XG7A 4L7FA 2XNEA 1W7HA 3FC2A 3WZDA 4IWDA 4YJRA 4USFA 3MI9A 4D0WA 1Q8ZA 3SKCA 5FBNC 5CANA 4C2VA 4PDOA 3TV7A 3W10A 3FMJA 4AAAA 1WBWA 3UPZA 5DNRA 3PLAE 3Q6UA 3QHRA 2WTKB 3RK5A 5D9HA 3DBEA 5AP5A 4DBXA 4RX8A 3BBTB 4O0RA 3TM0A 4H1JA 4FX3A 2R3JA 1ZRZA 1SMHA 1YHVA 4OT6A 5DR2A 3R8VA 5CAOA 1JAMA 3L9NA 5AEPA 3PP1A 3R7IA 3I7BA 5A4TA 4I21A 4PDSA 5CT7A 3KMMA 4QT1A 1PKDA 3KC3A 2W05A 3UYSA 4K9YA 4ZOGA 2C6DA 5EW9A 3IW8A 3R7EA 2CNUA 2YZLA 1PMEA 3DCVA 1ZZLA 4FKWA 3OW3A 5EYDA 4ZJIA 3ZXTA 2GTNA 2J51A 2O8YA 1MRYA 5HD7A 5TOZA 2QOQA 3U9NA 4DH5A 4FNWA 3U6IA 3HP2A 3MPMA 4F9CA 2QOBA 1ZYDA 3RGFA 3FLWA 4E5WA 4EH5A 3MA6A 4NM0A 5CSHA 5FD2A 3VHKA 4QQ5A 3GVUA 1SNUA 3CLYA 4QP8A 4EOJA 3MVJA 1UNGA 3VC4A 4NH1A 2YM7A 4UMQA 3AC4A 3VUDA 4ZJVA 1H08A 2KTYA 2PY3A 3GU6A 4KB8A 3S0OA 1GZ8A 3QA8A 1JVPP 4Y72A 5I9WA 3CPBA 3FXWA 2IZTA 3Q60A 4FTJA 3KXGA 1OL1A 3R02A 4ZY6A 1UWHA 1GOLA 3NX8A 4MBIA 3WF7A 4CG9A 3QU0A 4HVDA 2QOIA 4YZCA 3LM5A 2WIHA 3QX2A 4J7BA 3F2AA 3SDJA 4ANOA 5HCXA 2LAVA 5JZNA 5HHWA 3PA4A 5DWRA 2R3KA 4JAIA 3F3ZA 5JFVA 2J5FA 3DXNA 1W98A 4TWCA 4JX7A 4L3PA 3EQPA 4USDA 3VS3A 1LPUA 4QP7A 4BWPA 4HVSA 2FGIA 3R30A 4J96A 4LGDA 5BVNA 2C68A 4AN3A 4RWLA 3TXOA 5LMBA 5A4QA 2YLFA 2IJMA 4FKJA 1JKKA 4LV8A 1R3CA 3FZ1A 3P0MA 4BZNA 4Z55A 4R78A 4AGDA 4DFUA 2ZDUA 3MH3A 3UG1A 2F7XE 4EOOA 2VTJA 4D4YA 2YIYA 4W4XA 3CP9A 3NUUA 4F6SA 3T3UA 3UQCA 1YI6A 2B54A 4U41A 5J87A 4DFLA 4EOKA 3QZFA 2QO7A 4DH8A 4E73A 1Q41A 5E8WA 4S34A 3MIAA 5AA9A 2XNPA 2IVVA 4AZSA 4YTFA 1FMOE 4NSTA 4R77A 5M4FA 1Q4LA 4X2FA 4C4GA 1KUTA 2JFLA 5EOBA 2CPKE 4WO5A 1ZXEA 2C6MA 3D5WA 3QA0A 5HI2A 3O50A 2PVYA 4I0SA 1M7QA 1H1RA 4TYGA 4XG6A 3V51A 5JFSA 1OL7A 3GNIB 4O83A 3PA3A 2C1BA 2PHKA 4I3ZA 5CU2A 3CGOA 3VIDA 5KHXA 3UO5A 4EOMA 4WHZA 3OT3A 5LVNA 4CRLA 2HOGA 4H3BA 5M53A 1ZARA 3V5PA 3COHA 3RZBA 3KK9A 2YITA 5DLSA 3RI1A 4JG7A 3FQEA 3PIYA 2PUUA 3VBYA 3IQ7A 4HVIA 1B38A 3BYMA 3LXLA 1GIIA 2IWIA 2R3RA 5FBOA 3SRVA 3VAPA 2CKOA 5CF6A 4FT3A 2VO7A 1CM8A 4FMQA 5AP7A 1SZMA 2C3JA 2XKFA 2BZIB 2ITYA 3EQDA 2WTVA 4HCUA 3ZH8A 3CC6A 3GOPA 5HLNA 5M4CA 3VNTA 4FIEA 4EH3A 2OXXA 3F66A 2W1DA 4FSYA 3R7OA 4RWKA 1UU9A 2YCFA 4UZDA 2ZOQA 4W9WA 3UE4A 2BUJA 2WQOA 4FTKA 3FDNA 4W4VA 3L8XA 3JXWA 3FXXA 5EM7A 4B4LA 4AGCA 4FVRA 5LJJA 2PVJA 3OTVA 5IUHA 3PVBA 4U42A 3SW4A 3VF9A 4BY9E 1YI4A 5B2MA 5KKRC 2Q83A 3QD4A 1GJOA 2W9ZB 3M2WA 4MK0A 2XKDA 1IAJA 3HRBA 3QRKA 4I6HA 5AR3A 4CFMA 2Y9QA 4IW0A 5CF5A 4YTIA 5E8SA 3QF9A 2JKQA 2B9IA 3TDVA 2YIWA 3FZPA 3HA6A 4FKOA 2UZTA 3DJ5A 4O86A 4MH7A 2NO3A 3EZVA 4BCKA 4EK6A 4O7RA 1FOTA 2QLQA 4C3FA 3MFSA 5HLWA 2BZKB 3CQWA 4E7WA 4XRLA 2PE0A 4FKRA 4HCTA 4GFGA 4F08A 4AFJA 4XV3A 2XS0A 4IM2A 3DJ7A 3QAME 4HGEA 3R1QA 3HV6A 4C36A 1P4FA 2Z7QA 2VWVA 2BRBA 3HV7A 5IUGA 3QLGA 4HCVA 4BTFA 3EFJA 5ANEA 4JXFA 4BCHA 4EEVA 5KO1A 5LVOA 3OW4A 4YO6A 5A14A 5K5XA 3QQHA 5FLFA 4UN0C 1IG1A 3JY9A 2B52A 4LOPA 3AMAA 3WYXA 3W33A 5FEDA 4F7SA 1YKRA 3FZRA 3AC3A 4ZTRA 2CSNA 3DQXA 4R1YA 1BLXA 2ZJWA 5HNGA 2FYSA 3BHVA 3RALA 4DGMA 5J7HA 5L2IA 2WPAA 3FWQA 1TVOA 3R8MA 2OXDA 4ZMFA 2B4SB 4JLCA 1HCLA 2CGXA 4ZZMA 2UW7A 4KRCA 4NKSA 4NIFB 2C1AA 3TKUA 2W4KA 3C13A 4PL5A 3LQ3A 1PXNA 5GINE 2AC3A 2OF2A 2YCSA 1OL6A 4N6ZA 4JJRA 5H8GA 3R83A 3SQQA 3U4UA 4U81A 5LMKA 3QYZA 3NUYA 2JDOA 4BDDA 5A6NA 4O81A 3IW6A 4DITA 3KULB 3L8VA 2X8DA 2OBJA 3FZTA 4JBPA 4OTFA 3Q4ZA 4BDKA 4F9WA 4RC2A 2VN9A 3L9LA 4JR3A 4RX5A 3VS4A 3F3VA 1V0OA 5C8MA 3QHWA 3UODA 3DJ6A 2A1AB 1L3RE 4EC8A 2ZM4A 3EN9A 1ZWSA 2JBOA 3D7TB 4M68A 4MD8E 5F95A 5KMOA 3UG2A 3N9XA 3AGLA 3WOWA 2HW7A 3FUPA 4FV1A 3F3UA 3LFCA 3ID6C 4A9UA 3R7GA 3HX4A 3A62A 4BCOA 3HMNA 2HYYA 4WSYA 5EYMA 4Y85A 3ZC6A 4Y46A 2H9VA 5BMMA 3OBGA 1J7LA 4F99A 2VTRA 3HUCA 1VYWA 3O51A 4YBJA 4AN9A 5IQCA 5AP0A 3CTQA 3RM7A 3QWKA 4OTDA 2B53A 2W1CA 3QTRA 1UKHA 3G6HA 1F0QA 3PY0A 4DEDA 4ZAUA 4FTUA 4BBMA 3EL8A 4E6CA 2R3GA 3LCOA 4ZTHA 2WXVA 4B8MA 3OWPA 5DHJA 4EOLA 4TZRA 4Z9LA 4QMMA 4BTMA 1UKIA 4MNEB 4B9DA 4G3CA 2EXCX 3MBLA 1OBGA 4RFZA 4KAOA 2UZWE 2C30A 4XNEA 2VO3A 1NVRA 5CSVA 3H9OA 3AQVA 4AU8A 5AM7A 1IA9A 2BIKB 2P0CA 4RVKA 3U6JA 4FSZA 3TCPA 1REKA 2CHLA 4JDKA 4F1OA 5H3QA 3KGAA 4CCBA 5T68A 2X1NA 3IONA 4QMZA 4TNBA 3KL8A 4IJPA 2QHMA 2OJIA 1G8SA 3MVHA 3LJ2A 4FR4A 3PZEA 4LGGA 3BU6A 2J90A 5IPJA 2PUNA 1SM2A 4BCNA 3SX9A 4FVPA 3HMIA 5L8KA 3NCZA 4M84A 4ZP5A 1FQ1B 2WTIA 4WUNA 4QPAA 1BI7A 4D28A 2P4IA 3ZUVA 3RCDA 4C62A 4X0MA 1YRPA 4QYGA 1MRVA 4DYMA 5EW8A 3VQUA 2CCIA 2YA9A 4YHFA 2HK5A 4TTHB 4C02A 4FOCA 1OPJA 4CVAA 3FYKX 5LVMA 1J7UA 2XNGA 3JY0A 4PP9A 4MBJA 4DFYA 4MNFA 1LUFA 2HXLA 4O22A 5G6VA 4QMYA 3CBLA 5LVPA 3NWWA 4E6QA 2PZYA 5AUWA 4E93A 2O5KA 4F7NA 2XIKA 4DH1A 3QCSA 3D5VA 3IW7A 4JIAA 4BDJA 4PNIA 4IXPA 3EQBA 2XF0A 4DLJA 5JRSA 5C8KA 1VYZA 5C1QB 1OECA 5J95A 2JC6A 3BV3A 2E2BA 3E3PA 5DFPA 3POZA 4DEEA 5B2KA 4D58A 3CQEA 5DH3A 4CNHA 4DGNA 4NW6A 2BFYA 1WVYA 1RW8A 4Y5QA 3V5QA 5A4EA 4U79A 3K3IA 4EHGA 3P4KA 3UZTA 4S30A 2WMXA 3ANRA 3ZM9A 4XBRA 4KKEA 5E90A 4WBOA 2ITXA 4KBCA 4EH8A 5GZ8A 2YCRA 4RLKA 4DE4A 4IBMA 5HE0A 2YJSA 4ALWA 3I0OA 3MVMA 2XRWA 4FKVA 3H4JA 2GNGA 3IKAA 3IGGA 5CQWA 3G15A 4DHFA 4XCUA 4RQVA 2VX1A 4DGLC 4AW0A 3PJ8A 3LMHA 1M2RA 5IU2A 4ANQA 2R4BA 3KXXA 2YDJA 3OEZA 2XNOA 3DBDA 3ZO3A 4AFEA 1OIRA 3F5UA 3KY2A 2GNJA 4FV0A 4IVAA 5AP6A 4EC9A 4P5QA 1J1BA 2DUVA 4FEUA 1H26A 4BGGA 1UV5A 4DTAA 3NMUF 3TJCA 3NYVA 3R8ZA 1MQBA 5AP4A 2XCKA 1H1PA 4UWCA 5K4IA 2VD5A 3HVCA 4LI5A 3GC0A 4OBOA 4B0GA 5CSXA 1YDSE 2G1TA 4A9SA 4BBFA 4C4HA 3GQIA 4Y5HA 2DS1A 4UY9A 3DKGA 4XUFA 4Z7GA 4WNPA 3FLQA 3HV5A 5DPVA 1G8AA 2CN8A 3RAHA 2X4ZA 3EJ1A 4JNWA 4P5ZA 4EOPA 1ZOHA 5AIKA 5HBJA 3TEIA 2J2IB 4OTWA 4ZZOA 2PVFA 4GV1A 4GH2A 1BUHA 4ALVA 4FTIA 3Q4UA 4AACA 2F9GA 3A4OX 4AA5A 1Q61A 3WF8A 5AJQA 2PMIA 3GCUA 2OJGA 3BIZA 3KRLA 2J6MA 4HNIA 4I4FA 4X6RA 3RINA 1PRYA 3C9WA 3OMVA 2ZV7A 4YJSA 3C4EA 2XK6A 3UOJA 1MQ4A 3ZO1A 4LUDA 3EFWA 1GZOA 4ITIA 4AW2A 4UYAA 3W2RA 3A7HA 3I5ZA 4IAKA 4GEOA 4HZSA 4PV0A 2ACXA 4CTBA 1JBPE 4I0TA 4PMTA 1NVQA 4E5AX 5L3AA 4RIYA 2BDJA 3TJDA 5LMKC 5JEBA 3WBLA 5CAPA 5BUEA 3EB0A 4PPAA 4UMRA 4ANLA 5JQ5A 4FKQA 3NNWA 4FOBA 2QI8A 5CNNA 2V62A 3TZ7A 3LM0A 5AR8A 1Q99A 4YC3A 4R5SA 3ZOSA 5JGAA 1L8TA 2YHVA 2X39A 3BPRA 5JQ8A 2FSTX 4K33A 4YU2A 2ITVA 4C61A 2IN6A 1BI8A 5IH4A 4IX3A 2ZDTA 3R7VA 2YACA 2W5HA 3CR0A 4RMZA 1CDKA 5DT4A 4HW7A 2XEYA 4FUYA 2CKPA 4ZSJA 2Y4PA 4DG2E 4FGRA 4MWHA 3I6UA 1BL7A 4JR7A 4Y83A 3UVRA 5AADA 1XH9A 4BIDA 3IDPA 3E92A 4XP3A 2BMCA 3TZ8A 4FNXA 4AZFA 4JL9A 4ALUA 4OBQA 4TYEA 4ZLZA 3LMIA 4F63A 4C58A 5HO7A 5M57A 4NFNA 4R3RA 4UX9A 1XWSA 5J9LA 2ITOA 2RFNA 4RFMA 4EH7A 1PXLA 4E4LA 1NT2A 1YDTE 3TNWA 5TF9A 3U9CA 2QG7A 4YLKA 1K9AA 3FI2A 5EDPA 2V0DA 4XLVA 5KE0A 1YW2A 3LFDA 3E8DA 4HOKA 2C4GA 4AX8A 2WMSA 4QOXA 4PQNA 4XOYA 4EBVA 3B8QA 4IFCA 4FTOA 2WTKC 2BFXA 4GT5A 3SW7A 2C3IB 3UQGA 2OG8A 2GQSA 2WMWA 3JS2A 3T3VA 3UVQA 1BMKA 4C4IA 4FZ7A 3EQHA 1GIHA 2VV9A 2IVUA 2WAJA 3LFBA 5E8VA 1KSWA 3ZO2A 5AUUA 5IEVA 2JITA 3NDMA 2W9FB 3BX5A 4IACA 1IASA 4HYUA 3DNEA 3OF0A 4I5HA 4PNKA 3C4CA 3Q52A 4DG0E 4QMWA 3N4UA 5CF4A 5E92A 4F0IA 4JG8A 4RJ4A 3Q9ZA 4FZFB 5HBHA 5ACKA 4HYIA 1W0XC 1P2AA 3FMLA 3FZOA 3NYXA 1GZKA 3Q5ZA 4BGQA 1UNHA 2X2MA 5CS6A 5HCZA 2JEDA 1E9HA 2WD1A 4KS8A 3GU8A 2B55A 4B8LA 2G9XA 5DOSA 4H1MA 4MCVA 3NS9A 2JD5A 1OL2A 1XH6A 5GHVA 1WBNA 3GCPA 2VTPA 4O0VA 4BICA 2QOKA 2JDRA 2FUMA 3KULA 1NW1A 1K2PA 4O21A 2Y8OA 4UWBA 4DFNA 4DH7A 1E1VA 2ONLC 1BKXA 4BDIA 4O0YA 1Q8UA 4X2JA 1P14A 3MV5A 4DEBA 3FI8A 2XNNA 5CI7A 4QYFA 4ASZA 4RA5A 4V0GB 1OKZA 3UIUA 2CDZA 5I4NA 3PDTA 3EYGA 3FKLA 3D7TA 4FKSA 5E1SA 2XIRA 4ASDA 5IEYA 5J5TA 1H25A 4GYIA 5JSMA 4L52A 3ATTA 3W2CA 3R7YA 2HIWA 3NSZA 2C69A 3D15A 4WBBB 4ZXTA 4F6WA 4R7BA 4P7EA 4EKKA 2BCJA 4KS7A 3KF7A 2ITWA 2OICA 4LM5A 5DEWA 5L8LA 4AG8A 2JLDA 2W06A 1IA8A 4QP2A 2QHNA 3M11A 4FIFA 4U3YA 4XP0A 5AP3A 3ORXA 4JT3A 5LOHA 4V05A 5G1XA 2BRMA 2JKKA 5HO8A 2JIVA 3NAYA 1FGIA 2XCHA 3RBWA 2YFXA 3F7ZA 4GT4A 5L6OA 3CSVA 2HY0A 2VNWA 3OOGA 2XZSA 4Z16A 4YURA 2C3LA 3COKA 3KN6A 5CASA 2C3KA 4E4MA 3ZM4A 3FMHA 4FTRA 3ZONA 3O23A 3GCQA 4CRSA 3HRFA 3LFEA 3QCYA 5EHYA 3NLBA 2YERA 4YC6A 3ZBXA 4MNEA 1XQZA 3BGPA 3BYVA 3MH0A 3ZDUA 3PP0A 4DC2A 5L4QA 2CNVA 2OFUA 4ENYA 4F6UA 2QO9A 3ORIA 1J91A 3RK7A 4K0YA 4R8QA 4PUZA 4FTTA 5BMSA 1ZMVA 4IWQA 1KE9A 2YM4A 5IQIA 4M67A 4Y73A 1UNLA 3DGKA 4X21A 3PUPA 3OG7A 4QMTA 3Q2JA 3BE2A 3SXFA 4B6LA 5DYJA 2JGZA 3R63A 2BHEA 5DBXA 5IH5A 4GK3A 3RJCA 3W1FA 2QKWB 1PY5A 3GXLA 3LJ1A 1JSVA 3QTSA 3NUAA 5EFQA 4CT1A 3QD2B 5AAFA 4DA5A 1Z5MA 2JAVA 4A7CA 4G6LA 2ZAZA 4APPA 3UP7A 1W82A 2R3HA 3BGZA 4XP2A 5EM6A 4QMNA 4O27B 2WTJA 4XG4A 4ZSLA 2OZAA 4MF0A 1Y8GA 4XRJA 3DAJA 1ZYJA 3HL7A 3PXQA 1W8CA 4XLIA 3FZSA 4U5JA 3JVRA 4DH3A 4OGRA 1O9UA 3VUTA 2XP2A 4TKSA 4BB4A 4CKJA 5A4CA 2B1PA 2J4ZA 3LIJA 3HMMA 1PXOA 4ZLYA 3N4TA 3KVWA 4RRVA 1RJBA 4WG4A 4BI0A 3FPQA 4DEIA 3UVPA 4I41A 1A06A 5BYYA 2PMLX 3EN4A 2QU5A 3ITZA 3ZDIA 3PPKA 2R5TA 4D4VA 5DIAA 4AA0A 4DTBA 2RGPA 4FL1A 3ZU7A 4CZYB 4QMSA 5E8ZA 3TACA 5LWNA 5ETAA 5TT7A 3PSDA 4CFWA 2IZSA 4FV2A 3CJGA 3I1AA 4C57A 3BYSA 1TQMA 1P5EA 4LRKA 2C5OA 4FTMA 4PPBA 1Y91A 4ZJJA 3IDBA 3QALE 1LR4A 5AUYA 1OUKA 2R64A 3I5NA 5CNOA 3V01A 3GCSA 5EKOA 4A9RA 2YWPA 3PPZA 4GIHA 2QR8A 5AR4A 5DEYA 1M2PA 3DDPA 3POOA 2PMNX 4OTRA 4A4LA 3MDYA 3HP5A 3LCTA 3EQFA 4ANSA 5ANOA 3H9FA 3RM6A 4FNYA 4NYEA 3DZOA 3NW6A 4D55A 4YSMA 5DT0A 1HCKA 5D1JA 5HLPA 5LCJA 3UIXA 2XVDA 3A4PA 5KMIA 1H4LA 1UWJA 2GS6A 5AR7A 4LOOA 5FWKK 3R8LA 1PMNA 1SVGA 2XYNA 4UALA 3WZUA 4CV9A 4OW8A 2PVKA 2RIOA 4QPSA 5DN3A 4KINA 3F7WA 2QC6A 5KNJA 1OUYA 4JQ7A 5KMLA 4HGLA 3NNUA 5JFWA 5IA4A 3FMMA 5KCVA 2VTSA 3D0EA 4C59A 5TE0A 4NU1A 5FDPA 4G9CA 3RCJA 2RG6A 3F3TA 5FEQA 2UZOA 4CTCA 1EH4A 4AOJA 4DEHA 2IVTA 2XM8A 3ORNA 4FNZA 4IX5A 4FSWA 2Z2WA 4YJVA 1WAKA 2JIIA 3T9IA 2ZM3A 5EQEA 3VRZA 5DRBA 2BTRA 3DB6A 3UO4A 4X3FA 4F1MA 3OS3A 4HGSA 4QMLA 5CU3A 4I0RA 3LLAA 5TO8A 3CTJA 1GIJA 5GZ9A 3AD4A 4L67A 1LP4A 4RA4A 4TN6A 4L45A 5D7VA 5ANGA 5T6KA 4P4CA 5EHLA 3C0IA 3UJGA 2H6DA 3DFAA 3TNPC 4AF3A 4AOTA 3TUCA 2LGCA 3V8SA 4ARKA 3BLHA 5L2SA 2Q0NA 4YJNA 4BVUA 4KD1A 2O64A 4RJ7A 3SAYA 4X2KA 5ANDA 3PY1A 5AWMA 3IO7A 1UVRA 2R0IA 3ENHA 1YWNA 4MXZA 4FGBA 4CFXA 1J3HA 1T45A 5FQDC 2VO0A 1WBSA 2YZAA 3NYNA 2VU3A 4NUSA 3V5LA 5K9IA 2PVNA 2PPQA 3U55A 5M09A 5FG8A 5BVDA 3O7LD 2WQNA 4FE2A 4PMMA 3QQJA 2A27A 2AUHA 2X7OA 4G5JA 4CYJA 4JDJA 3T9TA 3R8UA 2RFEA 5A6OA 2BDWA 2I0VA 2V5QA 5FTOA 2VX0A 4NKAA 4QO9A 4E6DA 5FXQA 3TKIA 3MTFA 2XIYA 4L53A 1W83A 4K18A 4O0UA 3RZFA 3D5XA 2PZ5A 4QTDA 1OKVA 2J0IA 2I1MA 5E1EA 2VTQA 4JQ8A 5AUZA 3PPJA 4EHVA 1OM1A 2B7AA 2PUPA 5HZNA 5JT2A 3DK6A 1UU3A 4UMTA 5EOLA 3FKNA 4KA3A 1ZMUA 3D14A 4X3JA 5F1ZA 2OF4A 3NEWA 4S32A 3AG9A 5JZJA 1DI9A 3R2YA 1NY3A 4XV1A 4C4FA 5IDPA 2H96A 4C7TA 1P4OA 4BCMA 3ZHPC 2G2IA 4NCTC 3PE1A 3BWFA 3UNZA 2UVZA 5M55A 3ATSA 4FL2A 4XMOA 2BAKA 2XK9A 4ONAA 2I0HA 3MYGA 4G17A 1G5SA 4RIYB 4K11A 1UU7A 3GT8A 3D5UA 2FO0A 1TQIA 3JVSA 4L43A 4MXYA 3ROYA 4W8EA 4CFUA 4FC0A 4G3EA 3FLSA 2YDIA 2GCDA 3E5AA 3L9MA 2J0JA 4KKHA 4FV5A 2QR7A 3PJ1A 4QTAA 1Z9XA 2A2AA 4DCAA 3CIKA 3BQRA 1QMZA 4XH6A 2KULA 4E26A 3DK3A 3LQ5A 5GNKA 4AZEA 4FK6A 2C6EA 3BYOA 3QKMA 4O1PA 5HGIA 3S4QA 2E9VA 3A8WA 1PW2A 4RIOA 3LFQA 4EOSA 2C6OA 3VS0A 1ZAOA 5GIPE 2Q0BA 3LPBA 2DQ7X 3ORKA 5TKDA 4CMOA 3B2TA 4EL9A 3KCFA 3FI4A 4FSTA 1PXPA 5D10A 2G2HA 5HG7A 5I9ZA 4HYHA 3RWQA 3A7FA 3DLZA 4CFVA 5HNIX 4WOVA 4K6ZA 3LFSA 4GKHA 3BHYA 3AT3A 5EH0A 4BKJA 3QKLA 4QMXA 3HUBA 5L8JA 3PJ3A 2BR1A 1OIQA 3UQFA 3C0GA 3QTQA 2W1FA 3MB6A 5AAEA 2OWBA 2GNHA 4UB7A 1WBPA 3MY0A 4FTAA 5I3OA 1GAGA 3HMPA 3RTPA 2ITQA 3ACKA 3VUGA 4ZTMA 1H24A 5DGZA 3QQGA 3TUDA 2JAMA 4PTCA 2P3GX 3MFTA 4V0GA 3TNIA 4BYJA 4BC6A 4IIRA 5AV4A 4M66A 5AP2A 3NVKI 2CGUA 2C47A 5AP1A 2BKKA 1BL6A 3KB7A 3UGCA 3EN7A 2GMXA 5HBEA 2C6IA 4GJ2A 2YIQA 3OWJA 3S3IA 3ZFXA 4RC3A 4D1SA 4L3JA 2BPMA 3MPTA 4U45A 2BRGA 4F65A 4EQCA 3CXWA 3LVPA 4PMPA 4IZ5A 1DAYA 2QVSE 4RBLA 4KABA 3G9NA 4WIHA 2OJFE 5AV1A 4DLIA 4PL4A 2XNBA 3LXKA 3SLSA 3UOHA 1Q62A 3EQIA 2X2KA 4W9XA 2OLCA 3F5GA 2V7AA 3QCQA 4FV3A 4R1VA 5CVFA 3DKCA 4QTEA 4NFMA 2C6LA 2PE2A 4MF1A 4OUCA 1GZNA 3GI3A 2PVHA 5AR5A 2VRXA 4IZ7A 4OAVB 4IVBA 1UA2A 4R5YA 3RAWA 1KE7A 3OWLA 3F3WA 4AXAA 3TTIA 3B2WA 3QFVA 4GYGA 3EL7A 4J53A 1Q8TA 1NXKA 3PXFA 2W96B 4LG4A 3KMWA 3TIZA 3ULZA 3WF6A 3UDBA 3R2BA 4USEA 3PWDA 5HIDA 1R78A 2WTWA 3CEKA 3TN8A 1BX6A 4EUTA 4G3GA 2XK8A 1KOBA 3E88A 3G9LX 3R1NA 2B9JA 5AUVA 2EXMA 1OIUA 3FYJX 3SHEA 2OIDA 3RHKA 4EZ5A 4U97A 4FZ6A 3DTCA 5EM5A 4YZDA 2Y6MA 5J1WA 2PZPA 2OIBA 3VRYA 2I0YA 4OTIA 3VN9A 3EN5A 3NGAA 3FMDA 2WEVA 5L2TA 3SA0A 4UZHA 3MS9A 2WB8A 4HGTA 3GP0A 5CVGA 5C03A 2YWVA 4FSNA 3D4QA 4Q9SA 4EQUA 4EH6A 4QP3A 4MVFA 2PWLA 2ZM1A 3LCDA 4CT2A 2ITZA 3OTUA 5DVRA 4KIQA 5T3QA 2BVAA 4CZUA 3MPAA 4X2NA 5CEOA 3O8PA 4QRCA 5CT0A 5CAQA 3QTWA 4J71A 4B99A 2J5EA 1WBVA 1WBOA 2XK4A 3FKOA 3ENMA 4U40A 4O7SA 4XG9A 2O3PA 3O71A 4FSQA 1VJYA 2W7XA 2HZ4A 4G1WA 3ZS5A 1XKKA 2WHBA 3R0TA 5HU3A 5E4HA 3ORTA 3F61A 4R3PA 4FKTA 2HZNA 4F1TA 5K4JA 1OGUA 4GW8A 2X6EA 1WVXA 4ITJA 2XA4A 3QQKA 4IZYA 4LQMA 2R3IA 3DKOA 4MBLA 3ZTXA 1PMUA 1FVVA 4FEVA 2ITNA 5BYZA 3H0ZA 3TV6A 5M06A 3RHXA 4C0TA 1YDRE 2QLUA 3I7CA 3QD0A 4GL9A 4BDGA 4IWPA 2QD9A 1VR2A 3MFRA 4AT3A 5AM6A 4QNAA 4EBWA 2VTLA 1M52A 4XG8A 3HZTA 4FKLA 4Q9ZA 2X8EA 1AQ1A 3LE6A 1ZY4A 3VJOA 3OUNB 5HX6A 2R0UA 3QUPA 3W16A 1R0EA 3ZRMA 3W8LA 5J9YA 4YNOA 3EQGA 2OJ9A 3R9HA 1MUOA 1Y57A 3ZCLA 3GC9A 4WKQA 4EOQA 3WIKA 2OZAB 4U7ZA 2IVSA 4QPMA 3HDNA 3WE4A 3CE3A 1IAHA 4YO4A 1H00A 4FEXA 3W2QA 2WU6A 4FUXA 4O84A 3R9OA 5LQFA 4ZTLA 2YM6A 4PWNA 3VO3A 2H34A 4E20A 2J0LA 4L7SA 1JSTA 2WGJA 4DT8A 3KXZA 2VTNA 5KHWA 5I9UA 1J7IA 5AV2A 4IM0A 3AC5A 3DY7A 2F49A 1YVJA 2QCSA 3GB2A 4TY1A 4II5A 3FHIA 4PL3A 5K0XA 3QYWA 4BIEA 2X2LA 3NIZA 3P23A 3Q3BA 4RJ6A 4CLIA 4HJOA 2HWOA 2UZUE 5IKWA 4ZEGA 3V8WA 2P55A 2GNFA 1FGKA 3PTGA 4P2KA 1WMKA 3BHUA 3HAVA 3DBFA 3TNQB 1RQQA 5F9EA 4KSPA 3ZZEA 4ERWA 1B6CB 5HIBA 3E63A 4NL0A 4CEGA 5IMXA 2RKUA 1ZYCA 4M3QA 2VWYA 3PZHA 4BDCA 1H01A 2CJMA 3BE9A 5FXSA 4LFIA 1XH4A 1OVEA 4E6AA 4MX9A 4MWIA 3ZEPA 4D4SA 4I92A 4WSQA 3GBZA 3TTJA 4IZAA 1LEWA 4FKIA 5CEIA 1XJDA 3ZRLA 4KSQA 4AOIA 4E8AA 4QD6A 5FXRA 2WTDA 5E8UA 5E8TA 1H27A 4FL3A 3V3VA 4FV7A 5DR6A 3L1SA 4O38A 1FINA 2YLEA 5DE2A 3PVWA 4A9TA 5IZFA 2XJ2A 3DU8A 2H8HA 3H3CA 3CPCA 4O96A 5DA3A 3BHHA 3TWJA 1RDQE 4XHKB 5DRDA 4HZRA 3QCXA 5F20A 3WIGA 4BCQA 3QRUA 4H36A 4M7IA 1JKLA 4RVMA 5HE3A 2WIPA 1JKTA 4RX7A 3LXNA 2ETRA 5HEZA 4JBOA 2BILB 3CCNA 2J0KA 4OTQA 2WEIA 4YPSA 3UZPA 3W55A 2EXEA 5EK7A 2NRUA 3I60A 3Q04A 1FBNA 3ULIA 4K1BA 3QUDA 1YXXA 3O8UA 3V5TA 2W1EA 4FEQA 5ACBC 3HMOA 2YM3A 2JKMA 3OROA 1FVRA 3UO6A 3TV4A 4DINA 3GOKA 4BHZA 3OXTA 3EKNA 3ZLWA 1WCCA 1B39A 2NPQA 4LRJA 3PJCA 4R7HA 3OP5A 4GU9A 1OKWA 4X3FB 3RP9A 4BDFA 5IG1A 3MFUA 4A4XA 2B0QA 5J7BA 4CMTA 2Y7JA 2HZ0A 3HAMA 2UZNA 3DT1A 5E9EA 5EYKA 2WO6A 4U8ZA 5GZAA 5CSPA 3E62A 1YI3A 5FGKA 5HICA 4ZS4A 4IAFA 3S95A 1JPAA 5LVLA 3O2MA 4L3LA 4AGUA 5CU6A 4J1RA 3DZQA 4MYGA 4AWIA 5C4KA 5A54A 3EFLA 3T8OA 4MXAA 1DS5A 2NP8A 4I5MA 1YXUA 1KE8A 4PF4A 3DK7A 4JBVA 3PIXA 4KRDA 3BGQA 4LL0A 3U4WA 3A2CA 3LCSA 3R28A 3QWJA 3PG3A 4CKIA 4C3PA 2W4OA 2Y4IB 3DNDA 4PPCA 4RWIA 5D12A 4ZSAA 5C26A 2XIZA 3FXZA 2GU8A 2WMRA 5E91A 3LQ8A 4F9BA 3O7LB 3ZSGA 4ZTNA 3F2NA 4EK4A 4Y8DA 4RIWA 3E3BX 4TYJA 4BGHA 5IQBA 1R39A 2HW6A 3U51A 1IRKA 2PU8A 4F09A 3CD3A 4EJ7A 2V22A 4M69A 3LKMA 5ITAA 2R3OA 3K2LA 2BDFA 3BV2A 1YOLA 3JYAA 2W5AA 3PSBA 3LZBA 4I94A 3CQUA 2UZBA 3N51A 1OPLA 4IEBA 1OI9A 2O63A 1QPCA 3C4XA 3KFAA 4GS6A 4JRVA 4N70A 4JX3A 4TYHB 2IZRA 1KWPA 1O6KA 2C5VA 3II5A 3QTIA 4TW9A 3VQHA 3AMYA 3C7QA 3QTXA 1IR3A 3NYOA 3VS1A 1SVHA 4J52A 2OZOA 4I1ZA 4KIOA 2PZRA 3E8EA 3IS5A 1CMKE 2VX3A 3D2IA 2BRNA 5KMKA 4HNFA 3P5KA 3C0HA 4S2ZA 4BN1A 1TQPA 4L46A 5C27A 2YEXA 5CQUA 2AYPA 4IM3A 4D9UA 4I93A
chains in the Genus database with same CATH superfamily
5E7RA 4DHIB 2WMUA 2WOTA 2CMWA 5HE2A 3RPYA 4QMPA 2JIUA 5IDNA 3R7UA 5IQAA 4CKRA 2ZB0A 2GPHA 3R71A 3G51A 5CZIA 4I5PA 4QDEA 4M97A 4UEUA 2VWIA 2Z7LA 3EKKA 3QXPA 3U8WA 4GIIA 3IOPA 3LFNA 4O7NA 2BALA 4ID7A 4RFYA 3PVGA 4NWMA 4CSVA 5CENA 1M14A 5CXZA 5IF1A 4IAYA 3COIA 3OCSA 1PJKA 1JKSA 5CSWA 4BRXA 4BTJA 2XUUA 4C8BA 1U46A 5BQ0A 1ZZ2A 3CY2A 4LUEA 3COMA 4BKYA 4GU6A 4EOIA 2VAGA 3E93A 1PYXA 3FLZA 2BZJA 2PTKA 3UBDA 3GEQA 4JRNA 3UC3A 3WZEA 3P86A 3TG1A 4WNMA 3BLAA 4GK4A 4KNBA 4LV7A 5M07A 2GHGA 2FB8A 5D41A 3Q9WA 4C3RA 1ATPE 4MD7E 4BWKA 4GVAA 5HNBA 4FSRA 5LWMA 1FVTA 5IQHA 5ETCA 3TUBA 3ZMMA 4ANMA 4DTKA 3QUEA 5FDXA 4BJJB 2IW8A 3DAKA 4JDHA 1YQJA 4I24A 4RGJA 3RNIA 3EOCA 3RPSA 2O0UA 4FKPA 1PXMA 3OCTA 5HO6A 3MWUA 3DS6A 3FBVA 4BIBA 4FSMA 5LXMA 3GC7A 2WNTA 2F2UA 3PVUA 4GVJA 4FTCA 4BDBA 4D1XA 3OVVA 5KBQA 4NJDA 3FSFA 5JH6A 1XO2B 3EH9A 5HCYA 2GDOA 3VS7A 4G6OA 2UZVA 1XHAA 2BAQA 2JDVA 4BI1A 1YXTA 3C5UA 3EZRA 2X7GA 3GU5A 3R21A 4AXFA 3ODYX 1U59A 2Z7RA 3E64A 3HGKA 4AGWA 4D2PA 4C34A 5KMNA 2PK9A 3DXPA 5C8NA 4G6NA 1KE6A 2ZYBA 2EWAA 1URWA 4IMYA 4PDPA 4QQTA 2C6KA 1H07A 4EYJA 1W2DA 2OW3A 3ORPA 2OO8X 3GFEA 4IAIA 3HEGA 4FA2A 2OI4X 2UZEA 4NK9A 4YJUA 4DEGA 2ZMDA 3BLRA 4M0ZA 3H9RA 5HVYA 4LMNA 3SC1A 3VUIA 2C5NA 3RVGA 4TWOA 1CSNA 2OU7A 3AXWA 4EH2A 5BYLA 5F4NA 4P90A 4F0GA 4E1ZA 1VZOA 1TKIA 4PX6A 3F88A 4JS8A 2P2IA 3PE2A 4YJPA 3EIDA 4CCUA 3AKLA 1QPDA 3EQRA 4MXOA 4DEAA 5K3YA 1RE8A 4IAAA 4FTQA 4F64A 4EWQA 3RKBA 1WFCA 4AE6A 4L6QA 1OKYA 3Q96A 3KN5A 3BU3A 2NYAA 2QO2A 4F7LA 4JIKA 2R3NA 2Z7SA 3UNJA 1JLUE 3I0QA 3SVVA 3NZ0A 4CFNA 4ZY4A 4BKZA 2I0EA 1NVSA 3BEGA 2YM8A 3KU2A 3QRIA 4DFXE 4O2ZA 3QXOA 4C35A 4IQ6A 4FKUA 3MESA 5CALA 4FG7A 2CNQA 4YGAA 5CEMA 4LOQA 4FK3A 3VBWA 2W1IA 5AV3A 4XV9A 5M44A 4WG5A 4MXXA 1OITA 2ZVAA 2QOFA 4NM5A 4WA9A 3WF9A 3KRRA 5ICPA 2I40A 3QQUA 3CKXA 1XBAA 3PRIA 4IC7A 3FL4A 3THBA 4YNEA 4D2VA 1F3MC 2UW8A 4DG3E 3RK9A 3KMUA 2Z02A 2BZHB 3O96A 4DGGA 2YIXA 2HWPA 1V0BA 3MSSA 1XR1A 2JBPA 2R7BA 4O4BB 3ET7A 4H3PA 3SGCA 4L42A 2VWXA 3OEFX 4RT7A 2VTTA 3WILA 3FMKA 4DBNA 2IG7A 2QODA 3VS5A 3TT0A 4YUQA 3ZUTA 3EWHA 3MJ1A 4AT4A 2RFDA 3QBNA 5M51A 3FAAA 5HTIA 5EQPA 1XH7A 3SD0A 4F9YA 3FI3A 5IMEA 1ZOEA 4G16A 4O7ZA 1DM2A 4O0WA 2A4LA 4D2RA 3N4VA 4GUBA 2HELA 3KK8A 3NVMB 3AT2A 1J1CA 3IPHA 4N0SA 3IK3A 3BZ3A 3IOKA 3BBWA 3D2KA 1Q3WA 5C4LA 4I20A 4EHEA 2ERKA 1APME 2XEZA 4ZK5A 2GSFA 1PF8A 1PYEA 2XYUA 4QP9A 3LCKA 1PXJA 1F5QA 4FF8A 4V01A 3VW8A 1H1WA 4WT6A 5IA0A 3V04A 5GIOE 2GHMA 1KOAA 2X6DA 4AUAA 2A19B 4RLLA 4IH8A 3PFQA 4M8TA 2YISA 3CGFA 5HU9A 5IQGA 3TNHA 4DF3A 4CLJA 3S2PA 1YOJA 3P7AA 4IJ9A 3EHAA 4QP6A 3ACJA 4FJVA 2PVMA 5JGDA 3LXPA 2OK1A 3K54A 2HENA 4FKGA 3O0GA 4OTPA 3ZBFA 3ZLYA 4BCGA 2C0TA 2F2CB 3S00A 3HRCA 4NJ3A 3ALNA 3A61A 5HTBA 3BLQA 3V5JA 4AW1A 1KE5A 3CD8A 1U4DA 5EW3A 2OJJA 2XKCA 1ZOGA 2XJ1A 3R8PA 4HPTE 5GJDA 3PXZA 5CTPA 3SOAA 5IUIA 4CGAA 1PXKA 5I0BA 2X4FA 4LMUA 5B2LA 1K3AA 4YPDA 5E8XA 3AMBA 3BWJA 4UWYA 4BCJA 5IA3A 4EWHA 5AMNA 3C50A 4BDAA 3P79A 4O91A 1CKPA 4RIXA 3V6SA 3ZFYA 1U5RA 5KUPA 1Q97A 4ANNA 4RZVA 2B9HA 3NUXA 4G9RA 4XV2A 2ITUA 3BQCA 5ANIA 3KRJA 2WQBA 4FTLA 4ASXA 3QC4A 4N4SA 5B7VA 5KMMA 3OCBA 4IC8A 4K77A 1Q24A 2AEGA 1V1KA 1QPJA 4MUQA 2QG5A 3GGFA 4GRBA 4TNDA 5EM8A 3G0EA 3VVHA 2XAOA 1VEBA 4WRSA 3KRWA 3I81A 4OTHA 5BVWA 4I22A 3NNXA 4FIGA 1H1QA 3MVLA 2CLQA 4Q5EA 4QP4A 3K3JA 1I09A 4YZNA 4IB5A 4AT5A 3NCGA 4XG2A 4XS2A 4UMPA 4EH9A 4GJ3A 4AQCA 5AIRA 3MB7A 3E8CA 3R01A 4ZMEA 2W5BA 1V0PA 2XBAA 2SRCA 2QQ7A 3G33A 2OSCA 1H28A 1Q8WA 3G0FA 3NW7A 2VWBA 5HESA 4WNOA 4J98A 2W17A 4EJNA 2P2HA 2QURA 5DMZA 1NA7A 4QQCA 4IB3A 3DB8A 5HE1A 4BYIA 1XBCA 4TRLA 2QNJA 3W18A 5KMJA 5AFVA 2QU6A 4DHJA 3R73A 3F69A 3P7CA 3JR1A 1W2CA 4FV6A 4KIKA 1QCFA 4PY1A 2RSVA 4A06A 3Q2MA 5EQYA 2WMTA 3WE8A 2REIA 2X9FA 4TYHA 4D0XA 4GT3A 1PHKA 2UV2A 1W84A 5ETIA 1G8KA 3QTUA 5H8BA 3K5VA 1Q5KA 3HV3A 4X7QA 2UW4A 5CEKA 4J8NA 3RWPA 1ZLTA 2RFSA 4TL0A 4C33A 4CG8A 2ERZE 3K5UA 1FMKA 5L2WA 4QEBA 3WZJA 3CJFA 3Q9XA 2G01A 4XYFA 3DKFA 5BVOA 2R2PA 3KRXA 1YHWA 2QKRA 1U5QA 4HVHA 1JSUA 3LLTA 2WKMA 3EYHA 4UBAA 3ZSIA 3DXQA 3Q4TA 4BDEA 2Z8CA 4BF2A 3S1HA 3AKJA 4E4NA 1H0VA 4DFZE 3ZEWA 4XEYA 5HIEA 2CKEA 4RQKA 3PUFC 5BX0A 5A3XA 3LFAA 4DT9A 4YR8A 4GCJA 4LV5A 1QPEA 3Q53A 4RIWB 4BZOA 2YABA 2JDSA 2C0IA 4RSSA 3PRFA 3BKBA 4FSUA 4RX9A 4YZ9A 4YTHA 4GFOA 4H58A 4DAWA 5CWZA 2RL5A 4FIIA 2QOLA 3KVXA 4M69B 2UW0A 4FIHA 3P9JA 4L9IA 1CKIA 3F2RA 3RPVA 5CI6A 3PXYA 3ERKA 5J9ZA 5EI6A 4N57A 2NNWB 5JFXA 5IQEA 2CKQA 4ZTSA 2FA2A 2R9SA 4O7TA 4PTGA 5HG9A 4A9YA 5CY3A 2ZV9A 4XX9A 4ZTQA 3UMWA 4G31A 2OGVA 4AS0A 5BPYA 2PYWA 4YHTA 4FRFA 3OC1A 2VTIA 5FP5A 1PMVA 3ALOA 2OH0E 2X81A 4M12A 2ITTA 5F94A 4EYMA 1M17A 2GNIA 4PTEA 3CTHA 1S9JA 5KBRA 1OGYA 2XARA 2ZV2A 1Y6AA 4XG3A 3VHEA 5IQFA 3MH2A 2BHHA 4J97A 4W8DA 4J99A 4TT7A 5HKMA 2YN8A 3FY0A 2R3FA 2C5XA 4FT0A 3TIYA 2RG5A 2I6LA 3IDCA 4QMOA 3GU4A 3AT4A 4QNYA 4EZ7A 4Z7HA 4TYIA 3C4FA 3UOKA 2UZDA 4YLLA 4OAUC 2E9PA 3PG1A 4BBEA 5JGBA 3KEXA 1XBBA 3ZZWA 2FSLX 2VWUA 3KXHA 4U80A 2HZIA 4FG9A 3FMNA 3VJNA 2WMVA 3VUKA 2HCKA 4G2FA 5AAGA 3M42A 1OL5A 4JMQA 2R3PA 1ZYSA 2BKZA 4QYHA 4HPUE 3MGYA 3MY1A 1FPUA 5C9CA 1Y8YA 3FL5A 3QL8A 4O4DA 2OIQA 4ORKA 1YXVA 3HKOA 5AX3A 2UVXA 5EHOA 3NNVA 2W99B 4A07A 2UVYA 3A8XA 3MY5A 4RJ5A 5JKGA 5BVEA 5M4UA 1H1SA 1OB3A 4IHPA 5FM3A 3UC4A 2O2UA 3ZO4A 1OBDA 3VUHA 2OH4A 2WMBA 2VUWA 3E7VA 1S9IA 2CCHA 2CLXA 1DI8A 1A9UA 3KA0A 3ZSHA 3W32A 4I6QA 3QC9A 3QTZA 4QTCA 4L01A 4BTKA 2B9FA 2JFMA 5GJFA 5I5ZA 4IB1A 2YM5A 3OOMA 4D2SA 2J7TA 1M2QA 3QZGA 3IGOA 2O65A 3CY3A 4ZSEA 2PE1A 3WI6A 3UOLA 2GQRA 2HAKA 4Z3VA 3ZLSA 3LOKA 4JG6A 4FVQA 4CZTA 2GNLA 3GC8A 2XB7A 4OLIA 5HTCA 4PRJA 3P1AA 4D2WA 4TWNA 4ACMA 4R6VA 4RZWA 5CLPA 2VTHA 3ORLA 5FUTA 3SG8A 1ND4A 3MH1A 4X3FC 3JPVA 1R0PA 5FRIA 3QGWA 5H2UA 4G3DA 3BI6A 5E8YA 3C1XA 3VUMA 2IPXA 1JNKA 4G5PA 4MD9E 4NTSA 4TWPA 4HVGA 5BUJA 4YZMA 3I6WA 5I9VA 5FTGA 5CX9A 1REJA 3RPRA 3AGMA 4H3QA 4IB0A 4C38A 4YLJA 1PKGA 4F4PA 4ZLOA 4FG8A 3BCEA 3ZUUA 5BVFA 5AUXA 3D94A 4U6RA 2J50A 4XBUA 3VBXA 4RPVA 4EH4A 2VTMA 3OWKA 3PJ2A 4RJ8A 5H8EA 5EI8A 1W2FA 1Z57A 5A4LA 2WZJA 3GU7A 5EKNA 4M13A 2YAAA 2PMOX 4FBXA 4O7LA 3ELJA 4O2PA 3WYYA 2JKOA 5IA5A 3KF4A 3MIYA 4KIPA 3OFMA 5I9YA 3F5PA 4EORA 3L9PA 4CFFA 4MEDA 4FT7A 4BI2A 2F4JA 4LGHA 3ZRKA 4YJOA 2Y4IC 4EHZA 2X7FA 3E8NA 3U87A 3FY2A 3AC8A 3G6GA 4MXCA 3G2FA 2UW5A 4KBAA 4BR3A 4CYIA 3FEGA 2W1ZA 4IVDA 3FPMA 3HECA 4WG3A 1A48A 4UYNA 4ACGA 2IW9A 3TKHA 3VWAA 2XKEA 3FC1X 2GTMA 4BHNA 4C4JA 5KKRB 4MQ2A 3UNKA 2W1GA 5FM2A 4ZY5A 2V7OA 3V6RA 5M4IA 3TZ9A 3HA8A 3JUHA 4AA4A 4RWJA 3A7JA 4ERKA 2PUIA 3NAXA 4QTBA 5CXHA 3I79A 5HQ0A 4ZSGA 4A4OA 5IA2A 3Q6WA 5JMSA 2OKRA 3UTOA 5A46A 4W4YA 4YMJA 1SVEA 1H8FA 2BROA 3V5WA 2F7ZE 3AD6A 3BU5A 4GG7A 3UZRA 2YDKA 5ANJA 2NRYA 4FV9A 3QRJA 1TZDA 1U54B 3NUSA 4FYNA 4IVCA 1X8BA 3DLSA 4LRMA 4PP7A 4L00A 4MTAA 5CU4A 2PL0A 1JQHA 5CVHA 3LMGA 4J95A 2XIXA 2ZB1A 1E1XA 4KBKA 4XOZA 4G34A 3QQFA 1WZYA 2ONLA 3QLFA 4N6YA 3W2OA 4EK3A 3PWYA 3OHTA 4EONA 3VBQA 1YWVA 1IEPA 2BIYA 3ANQA 2UW6A 3HV4A 3QRTA 1AGWA 3QZHA 4GKIA 4NEUA 4C2WA 3NPCA 3RMFA 3MN3A 2XRUA 4U43A 5JK3A 4O6EA 4U3ZA 3LJ0A 2EVAA 1ZMWA 2EUFB 3VW6A 5CAVA 3Q32A 4EZ3A 4ZIMA 3A60A 4E3CA 2VGOA 2XBJA 4GG5A 5ANKA 4YBKA 4JDIA 2G2FA 3SXRA 4ANBA 3AC1A 3GUBA 3EN6A 2VZ6A 2YCQA 3QX4A 4I23A 3I4BA 2PULA 5M08A 3BHTA 2QOCA 3PXRA 4PDYA 3ETAA 1LEZA 3F82A 3M1SA 4D5HA 5K0KA 1PXIA 2JDTA 3TL8A 5KX8A 4DFBA 5CEPA 3SG9A 4E5BA 4QP1A 2QOOA 5FP6A 2WMQA 3NRMA 4NM7A 5HORA 3W2PA 4AXDA 5LCKA 4C4EA 1O6LA 3REPA 1DAWA 2GFCA 3BEAA 4YP8A 3UP2A 3ZXZA 4X6QC 5HVKA 2VGPA 3FQHA 5B0XA 3U6HA 2C6TA 3A7GA 3KXMA 4O0XA 2VTAA 3ZC5A 1SNXA 1WVWA 2AQXA 2CGVA 2J0MB 5L6WL 4DGOA 1XH5A 2PSQA 3H30A 3OT8A 4YJTA 3H10A 3DFCB 4FV4A 5HOAA 4K2RA 4D2TA 2A0CX 3HDMA 4O0SA 2EB3A 3TI1A 5HG8A 1R1WA 1WBTA 4OTGA 5EG3A 1STCE 4NM3A 2WQMA 3E87A 5AX9A 5DT3A 4QMVA 3SXSA 4RVLA 2IW6A 4WNKA 4RIXB 4Y95A 4JI9A 2E9UA 4MAOA 3UYTA 5AA8A 3UIMA 3NUPA 4KWPA 3R22A 5IISA 4BCFA 2E9NA 2EB2A 3VS2A 4W4WA 4B7TA 5HG5A 2OXYA 4L68A 3DDQA 2DYLA 5M56A 5IA1A 2HXQA 4Q2AA 2VTOA 2WTCA 3A99A 3AC2A 3OXIA 2OFVA 2IO6A 5BUIA 2GS7A 3D9VA 2WU7A 3IW4A 3PXKA 3Q5IA 3C51A 4O7VA 1AD5A 3FMEA 4R3CA 5IEXA 4FI1A 3IG7A 2R3QA 5J5SA 2GFSA 2UW3A 3IECA 4GK2A 1Q8YA 4RVTA 5K5NA 4C37A 4FV8A 4S31A 3MA3A 3HNGA 1ERKA 2W4JA 5LARA 2IZUA 4IDTA 3VBTA 4NW5A 3WZKA 3D83A 4EQMA 1SYKA 2XK7A 3OY1A 3EMGA 5JRQA 3R1YA 5TR6A 4KIKB 4RC4A 4YHJA 1YWRA 3MW1A 4ASEA 4AAYA 2C5YA 3OD6X 4CD0A 1JOWB 4FYOA 4IFGA 2BAJA 5KZIA 4QMUA 3OCGA 4IANA 1Y6BA 2UUEA 4M14A 4AN2A 3UMXA 4PMSA 4U44A 2WQEA 2WMAA 4M15A 3CKWA 2E9OA 2X8IA 4WRGA 4CMUA 3H0YA 3HLLA 1ZYLA 2UZLA 3RNYA 4FIJA 4WUAA 3Q4CA 2RF9A 1UU8A 5CAUA 3UIBA 4V04A 2PZIA 4IX4A 4D1ZA 3QD3A 3D7ZA 3FLNC 4QQJA 3BRBA 1MRUA 3KIOC 3NIEA 5EDRA 3F6XA 4MQ1A 4S33A 2YJRA 3R9DA 4U9AA 3LW0A 5HVJA 3SOCA 2FH9A 4J8MA 2ESMA 4X2GA 3SRVB 4AE9A 4D5KA 4F9AA 3BL7A 3ML1A 3P08A 5ETFA 4BZDA 3R04A 3VF8A 5CF8A 3DTWA 4BFMA 5J79A 5L6PA 4HYSA 3PIZA 3NFGB 5EYCA 4JOAA 2FVDA 2Y0AA 5BVKA 5DR9A 1KV1A 3OUKA 4QMQA 2DWBA 1CKJA 1Q3DA 4L8MA 2CGWA 5EDQA 2F7EE 3R9RA 2VNYA 1XH8A 3B8RA 4FICA 3W8QA 1YHSA 4DHZA 4MKCA 4YC8A 3LHJA 4CQEA 5LMAA 2BTSA 2XK3A 3FSKA 4AZVA 1H0WA 3P5JC 2W1HA 1BYGA 5FEEA 1G3NA 5D7AA 4CQGA 2I7QA 2F57A 3V8TA 4BL1A 4F0FA 5IH6A 1URCA 4NZWB 3GFWA 4UMUA 3PYYA 1JWHA 4JQEA 2GHLA 1YXSA 5I3RA 4U0IA 2R3MA 3KXNA 3AKKA 4I6FA 3WARA 3DV3A 3ORZA 4YSJA 3ORMA 3HYHA 3TDWA 1MP8A 2ZMCA 4LL5A 3IW5A 3R1SA 5GJGA 1ST4A 2Z60A 3R00A 4FZAB 3FV8A 4GFMA 4JAJA 4K8AA 3VBVA 3KREA 4QYEA 4F7JA 3DBCA 3PY3A 4NIFA 4FT5A 4TXCA 4UXQA 4YJQA 5AR2A 4H05A 4O82A 4R7IA 1M7NA 1CTPE 4TPTA 3VULA 5DG5A 5KZ0A 3C4ZA 4EI4A 3GQLA 5A9UA 3WF5A 2X0GA 2ETMA 3EQCA 4FZDB 3KKVA 4RJ3A 4ZZNA 4ITHA 5C01A 4F70A 4FEWA 1HOWA 4IDVA 4DCEA 4EK8A 4KUJA 4AP7A 4ENXA 3RAKA 3F9NA 3DQWA 2EU9A 4EK5A 3NW5A 5I9XA 4M0YA 5CU0A 2R7IA 4FODA 4IE9A 1I44A 5H9BA 4IX6A 4NTTA 3FHRA 3L8SA 4OT5A 4O7WA 4Q5HA 4O0TA 3KCKA 2WOUA 3FQSA 4G3FA 2PVLA 3G90X 2GS2A 5EI2A 4O7YA 2P33A 3PSCA 3NUNA 4XJ0A 3L8PA 2HY81 3MTLA 4FTNA 1OMWA 4O6LA 4D4RA 4AW5A 3G5DA 4L44A 2VWWA 3KQ7A 4ACHA 2VWZA 4JBQA 4GUEA 4EUUA 3GENA 2YIRA 2FSOX 2WFYA 1GY3A 2AC5A 2X9EA 1O6YA 2VO6A 3LFFA 3O8TA 3OBJA 4I6BA 5CZHA 1ZY5A 4DN5A 5CEQA 3CS9A 4ACDA 4CV8A 4H39A 4NCTA 3FE3A 2ITPA 3RPOA 4AZTA 2XNMA 3GCVA 4NT4A 1OPKA 2G15A 2QONA 3RAIA 3FLYA 4RG0A 3TZMA 4LYNA 4JVGA 1YOMA 5DI1A 5IQDA 2ZV8A 3U54A 5HD4A 4YTCA 3FJQE 5JN2A 3DOGA 3DA6A 2CN5A 3QKKA 2ETKA 5HX8A 1T46A 1OZ1A 3OXZA 3PFYA 2FSMX 3A7IA 1QL6A 3F5XA 3LAUA 2BRHA 2V55A 3P7BA 2YAKA 4UV0A 4ACCA 4OR5A 3PA5A 4I5CA 5FTQA 3W0PA 3ZFMA 5BNJA 2XM9A 3AD5A 4IADA 4IAZA 4MHAA 3DBQA 3UPXA 2J9MA 3BYUA 4WD5A 3C4WA 3DAEA 3Q9YA 5D11A 3ZYAA 1XMLA 4BWXA 3BELA 4CXAA 3OY3A 3NR9A 4IWOA 4APCA 1OIYA 4QYYA 4EKLA 3R9NA 3W2SA 2Y6OA 4BCIA 2PVRA 3QZIA 4E4XA 5J1VA 4GMYA 5CYIA 2XJ0A 4BCPA 2UW9A 4YZBA 4D9TA 2C0OA 4KKGA 3DPKA 1GNGA 3QQLA 2XH5A 3AOXA 3OZ6A 2QOHA 3P78A 4O1OA 4UXLA 3C5IA 1KV2A 5L2QA 4BDHA 4ZS0A 3QGYA 2GQGA 2XMYA 3E7OA 3MJ2A 2R3LA 2WELA 1U54A 4GSBA 3SV0A 5AUTA 3PLSA 2W0JA 3EFKA 3VS6A 3ROCA 3ZLXA 4FT9A 5J8IA 4AZWA 3O17A 4I4EA 4OBPA 5AV0A 3ODZX 3R6XA 4XG7A 4L7FA 2XNEA 1W7HA 3FC2A 3WZDA 4IWDA 4YJRA 4USFA 3MI9A 4D0WA 3W0QA 1Q8ZA 3SKCA 5FBNC 5CANA 4C2VA 4PDOA 3TV7A 3W10A 3FMJA 4AAAA 1WBWA 3UPZA 5DNRA 3PLAE 3Q6UA 3QHRA 2WTKB 3RK5A 5D9HA 3DBEA 5AP5A 4DBXA 4RX8A 3BBTB 4O0RA 3TM0A 4O4FA 4H1JA 4FX3A 2R3JA 1ZRZA 1SMHA 1YHVA 4OT6A 5DR2A 3R8VA 5CAOA 1JAMA 3L9NA 5AEPA 3PP1A 3R7IA 3I7BA 5A4TA 4I21A 4PDSA 5CT7A 3KMMA 4QT1A 1PKDA 3KC3A 2W05A 3UYSA 4K9YA 4ZOGA 2C6DA 4QDVA 5EW9A 3IW8A 3R7EA 2CNUA 2YZLA 1PMEA 3DCVA 1ZZLA 4DDGA 4FKWA 3OW3A 5EYDA 4ZJIA 3ZXTA 2GTNA 2J51A 2O8YA 1MRYA 5HD7A 5TOZA 2QOQA 3U9NA 4DH5A 4FNWA 3U6IA 3HP2A 3MPMA 4F9CA 2QOBA 1ZYDA 3RGFA 3FLWA 4E5WA 4EH5A 3MA6A 4NM0A 5CSHA 5FD2A 3VHKA 4QQ5A 3GVUA 1SNUA 3CLYA 4QP8A 4EOJA 3MVJA 1UNGA 3VC4A 4NH1A 2YM7A 4UMQA 3AC4A 3VUDA 4ZJVA 1H08A 2KTYA 2PY3A 3GU6A 4KB8A 3S0OA 1GZ8A 3QA8A 1JVPP 4Y72A 5I9WA 3CPBA 3FXWA 2IZTA 3Q60A 4FTJA 3KXGA 1OL1A 3R02A 4ZY6A 1UWHA 1GOLA 3NX8A 4MBIA 3WF7A 4CG9A 3QU0A 4HVDA 2QOIA 4YZCA 3LM5A 2WIHA 3QX2A 4J7BA 3F2AA 3SDJA 4ANOA 5HCXA 2LAVA 5JZNA 5HHWA 3PA4A 5DWRA 2R3KA 4JAIA 3F3ZA 5JFVA 2J5FA 3DXNA 1W98A 4TWCA 4JX7A 4L3PA 3EQPA 4USDA 3VS3A 1LPUA 4QP7A 4BWPA 4HVSA 2FGIA 3R30A 4J96A 4LGDA 5BVNA 2C68A 4AN3A 4RWLA 3TXOA 5LMBA 5A4QA 2YLFA 2IJMA 4FKJA 1JKKA 4LV8A 1R3CA 3FZ1A 3P0MA 4BZNA 4Z55A 4R78A 4AGDA 4DFUA 2ZDUA 3MH3A 3UG1A 2F7XE 4EOOA 2VTJA 4D4YA 2YIYA 4W4XA 3CP9A 3NUUA 4F6SA 3T3UA 3UQCA 1YI6A 2B54A 4U41A 5J87A 4DFLA 4EOKA 3QZFA 1ST0A 2QO7A 4DH8A 4E73A 1Q41A 5E8WA 4S34A 3MIAA 5AA9A 2XNPA 2IVVA 4AZSA 4YTFA 1FMOE 4NSTA 4R77A 5M4FA 1Q4LA 4X2FA 4C4GA 1KUTA 2JFLA 5EOBA 2CPKE 4WO5A 1ZXEA 2C6MA 3D5WA 3QA0A 5HI2A 3O50A 2PVYA 4I0SA 1M7QA 1H1RA 4TYGA 4XG6A 3V51A 5JFSA 1OL7A 3GNIB 4O83A 3PA3A 2C1BA 2PHKA 4I3ZA 5CU2A 3CGOA 3VIDA 5KHXA 3UO5A 4EOMA 4WHZA 3OT3A 5LVNA 4CRLA 2HOGA 4H3BA 5M53A 1ZARA 3V5PA 3COHA 3RZBA 3KK9A 2YITA 5DLSA 3RI1A 3TMOA 4JG7A 3FQEA 3PIYA 2PUUA 3VBYA 3IQ7A 4HVIA 1B38A 3BYMA 3LXLA 1GIIA 2IWIA 2R3RA 5FBOA 3SRVA 3VAPA 2CKOA 5CF6A 4FT3A 2VO7A 1CM8A 4FMQA 5AP7A 1SZMA 2C3JA 2XKFA 2BZIB 2ITYA 3EQDA 2WTVA 4HCUA 3ZH8A 3CC6A 3GOPA 5HLNA 5M4CA 3VNTA 4FIEA 4EH3A 2OXXA 3F66A 2W1DA 4FSYA 3R7OA 4RWKA 1UU9A 2YCFA 4UZDA 2ZOQA 4W9WA 3UE4A 2BUJA 2WQOA 4FTKA 3FDNA 4W4VA 3L8XA 3JXWA 3FXXA 5EM7A 4B4LA 4AGCA 4FVRA 5LJJA 2PVJA 3OTVA 5IUHA 3PVBA 4U42A 3SW4A 3VF9A 4BY9E 1YI4A 5B2MA 5KKRC 2Q83A 3QD4A 1GJOA 2W9ZB 3M2WA 4MK0A 2XKDA 1IAJA 3HRBA 3QRKA 4I6HA 5AR3A 4CFMA 2Y9QA 4IW0A 5CF5A 4YTIA 5E8SA 3QF9A 2JKQA 2B9IA 3TDVA 2YIWA 3FZPA 3HA6A 4FKOA 2UZTA 3DJ5A 4O86A 4MH7A 2NO3A 3EZVA 4BCKA 4EK6A 4O7RA 1FOTA 2QLQA 4C3FA 3MFSA 5HLWA 2BZKB 3CQWA 4E7WA 4XRLA 2PE0A 4FKRA 4HCTA 4GFGA 4F08A 4AFJA 4XV3A 2XS0A 4IM2A 3DJ7A 3QAME 4HGEA 3R1QA 3HV6A 4C36A 1P4FA 2Z7QA