2ZMDA

Crystal structure of human mps1 catalytic domain t686a mutant in complex with sp600125 inhibitor
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
280
structure length
259
Chain Sequence
ECISVKGRIYSILKQIGSGGSSKVFQVLNEKKQIYAIKYVNLEEADNQTLDSYRNEIAYLNKLQQHSDKIIRLYDYEITDQYIYMVMECGNIDLNSWLKKKKSIDPWERKSYWKNMLEAVHTIHQHGIVHSDLKPANFLIVDGMLKLIDFGIANQMDSQVGAVNYMPPEAIKDMISPKSDVWSLGCILYYMTYGKTPFQQIINQISKLHAIIDPNHEIEFPDIPEKDLQDVLKCCLKRDPKQRISIPELLAHPYVQIQT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords Dual specificity protein kinase TTK
publication title Crystal structure of the catalytic domain of the mitotic checkpoint kinase Mps1 in complex with SP600125.
pubmed doi rcsb
source organism Homo sapiens
total genus 71
structure length 259
sequence length 280
ec nomenclature ec 2.7.12.1: Dual-specificity kinase.
pdb deposition date 2008-04-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2zmdA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2zmdA01
3UIXA 1U54B 3WZUA 3AD6A 1QPEA 3QTSA 4RIXB 5CWZA 4G6NA 5DWRA 3LJ1A 4AF3A 2XZSA 2OZOA 3ZTXA 5HG8A 3R1YA 4EOKA 3D7TA 3HMPA 2JIIA 4X21A 3P9JA 1QPCA 3VHEA 1SNUA 5I3OA 4K0YA 1J91A 2BR1A 2XF0A 2ZV7A 3QRTA 4ORKA 4XX9A 2VUWA 4A9UA 3P79A 3PSDA 4KKEA 5FTGA 4DTBA 1MQBA 2QKWB 2C5OA 3PJ8A 2YIYA 5BPYA 4RVKA 2R3MA 1H0WA 4EH2A 4YZDA 3HEGA 4CEGA 3ET7A 2UZOA 3KGAA 2R7IA 3DZQA 2BVAA 3R7EA 3R9HA 3TZMA 5JK3A 1OIRA 4GJ3A 1REJA 4TKSA 4YR8A 2PZIA 2OXXA 2GTMA 2FUMA 2OJIA 4I92A 3BELA 2Z7LA 4K8AA 4M69A 5HESA 1ZZLA 2CGUA 2OZAA 3FL5A 4DEHA 5HD7A 5KHXA 4MH7A 3VS0A 2XNNA 3CQUA 4PUZA 3FZRA 5EG3A 2OJFE 3V6SA 2PULA 3QUEA 4DFZE 4EJNA 1OL7A 4BCFA 5BVOA 4KIKA 3D5WA 3R04A 3ENHA 4PL4A 4UN0C 1XH9A 2Y4IC 4D1ZA 3F7WA 4PMPA 4OLIA 4JBQA 2CGXA 3HP5A 4GL9A 5E8TA 4Z3VA 3E8CA 5A4LA 3MV5A 3N4VA 4GUBA 4ZJIA 3GU8A 5DBXA 5CEMA 4XLVA 3IOKA 4UMQA 3FMDA 3IGOA 5AP5A 2BHHA 4ZSJA 3R8MA 5FTOA 1OZ1A 5AA8A 5CEPA 3HGKA 4YLJA 1FPUA 4XP2A 3IS5A 1Q61A 3GENA 4PWNA 3TNPC 4I93A 4RWIA 3PIXA 4F7SA 2J2IB 3TNWA 4J99A 5JMSA 4UYAA 4XBRA 3P0MA 3RPOA 2ERKA 4BKZA 4WT6A 4XBUA 3WE8A 5C26A 4MK0A 2CKQA 1WVWA 3SQQA 4ZTHA 3F9NA 3FYJX 4E6CA 2BCJA 1JBPE 1TQMA 4AAAA 4C4HA 2XIYA 3WIKA 2PSQA 3LXKA 3MFTA 4X0MA 4JXFA 3R73A 2PVNA 2CCHA 1FGIA 4FICA 3LFDA 4IZYA 4IWQA 1VJYA 4HJOA 1F5QA 4EONA 1FVRA 2QOLA 3DKOA 4DEAA 4UBAA 5CEKA 5D7AA 3ZLSA 2QU5A 4EEVA 5KCVA 2UZNA 2WTJA 3POZA 3QHWA 4D4SA 2ESMA 5H8EA 3TEIA 4JBPA 3IOPA 5HLNA 2IVSA 2WEIA 2Y4IB 2YDKA 3QKMA 3CXWA 4GYIA 4MD7E 4CT2A 4U7ZA 3VUTA 1PMEA 2BIYA 3UP7A 4LQMA 4A4OA 4FZ7A 3C4XA 5E91A 5EM5A 3SOAA 4YUQA 3DXQA 2GFSA 4FK3A 4APPA 1V0BA 1ZXEA 2E9UA 3C4EA 1Z57A 3L9NA 3NAYA 3U55A 3BYUA 3P7CA 4J95A 4NIFB 3CQWA 3SRVA 2GQRA 5IUIA 4YPDA 2XM9A 4RG0A 5DG5A 4ACCA 4GT5A 4LM5A 3AT2A 1W8CA 3FUPA 1TKIA 3GOKA 3CE3A 4YURA 4JDKA 4X3JA 5GHVA 4MF0A 3SG8A 1OGUA 2UW6A 4II5A 4YJOA 5LQFA 4BDAA 2X8IA 4W4WA 3ZHPC 2XNMA 2PUNA 5IQGA 3UO4A 4YC3A 3VUMA 4B4LA 5EKNA 5LWMA 2C30A 2X7OA 3E7VA 1GIJA 3FJQE 5AR2A 3E8EA 3ZO4A 4CFVA 2OIBA 3OG7A 2F7XE 2J0LA 4K33A 2VWIA 4OTWA 5I9WA 3HMOA 3R8PA 4JQ7A 4IVCA 3ZC5A 3ZSGA 1ZYJA 4FGBA 2B9FA 1OI9A 2WTWA 4KBAA 2XK9A 2PY3A 4ASDA 2IPXA 4NM3A 1JPAA 2X39A 4BI2A 3RGFA 4ANNA 4ERKA 1AGWA 3DJ6A 2XJ2A 3CCNA 3I0OA 2VX1A 5L6OA 5CT0A 4DBXA 4UY9A 5AP1A 4X3FA 5EOLA 2XYUA 4W9XA 4IWPA 2GQGA 2XEZA 4RX7A 5BYLA 5IQCA 1Z5MA 3C0IA 4B9DA 5J1VA 4C4JA 4DINA 3CKXA 4FG7A 4J71A 3CPCA 4PY1A 3U8WA 2P33A 3WYXA 4ZSAA 2RSVA 5IA1A 3QC9A 5IEXA 4FT9A 3PRIA 3UG1A 2XYNA 5AP6A 2O8YA 4O27B 2XKDA 3WF5A 3WZDA 4F65A 4AFJA 4C57A 3O8UA 4KKHA 2HWOA 4RFZA 1UU3A 4EORA 5L2TA 1XBCA 3KXMA 1HOWA 5EYKA 4C7TA 3MWUA 3UNZA 3BU6A 3VQUA 2UW5A 2VD5A 3FLSA 4Z9LA 4IM2A 5HNBA 4AN3A 3AOXA 3OW4A 3R1SA 4ZMEA 3LW0A 1M7NA 4DF3A 3TV6A 3EN9A 3OP5A 5E8ZA 2R0UA 4ZJVA 4TYGA 4U0IA 3QTUA 4I5HA 1YW2A 5IH6A 1JOWB 5CEQA 3Q9YA 4J52A 4TYHA 2OIDA 4J8NA 4JDJA 1OECA 4BKJA 4G5PA 3UO5A 2VTIA 1Y6BA 5E8UA 4C33A 5AMNA 2R3FA 1UU8A 1OPJA 4Y85A 4CV8A 4CMOA 4E3CA 3FI4A 4O7TA 3O8TA 2VTNA 2ZV2A 3PPJA 3LFQA 4CSVA 3MFRA 1H26A 4F6UA 2VGPA 4A7CA 4YJPA 2WMAA 4D2WA 1UU7A 1PXOA 3EMGA 3PA5A 4XOZA 1CKPA 5M55A 4D2PA 3A7FA 3AGMA 2B55A 4OTRA 1VEBA 4FTTA 3R01A 4IMYA 3FI8A 2PVJA 2VWVA 4IDTA 2J90A 4JIKA 3HKOA 1J7LA 3EL7A 4GFMA 4L53A 5IQIA 4FTNA 5I0BA 5DVRA 5FEDA 2EWAA 4FV5A 4CT1A 1H1QA 3F5PA 2RIOA 5ETIA 4A07A 2VN9A 3WARA 2E9PA 4XMOA 1E1XA 2RG6A 3HRBA 1OIQA 3NYXA 2V62A 1QMZA 1X8BA 4D5HA 3Q4UA 5AWMA 4GW8A 3QD2B 4XHKB 4QPSA 1W83A 2H34A 4FSMA 5AV3A 4FVQA 3EWHA 4X2KA 4EBWA 3A8XA 3VULA 1NT2A 1PXLA 3O71A 3QLGA 2AUHA 2WIHA 2WB8A 3W2CA 3OEZA 4FSZA 4CFXA 3VW6A 4G6LA 1Y91A 1ZMVA 2FH9A 2C3JA 4GV1A 3SLSA 3GEQA 4ANLA 4ZOGA 2X2KA 3SXFA 5GZAA 3EQPA 5EQYA 3V5JA 5CT7A 2IVTA 2ZVAA 4ZP5A 3G15A 4BVUA 4O86A 4IWDA 3PSBA 4UMPA 4RIYB 2CDZA 1YHSA 2JGZA 1U46A 4L8MA 4D4RA 3DB6A 4MBJA 2OO8X 3HV4A 3R7UA 5HICA 3R8ZA 5BMSA 3R7GA 3FLYA 4EH4A 4W9WA 5KBQA 2GQSA 4AOTA 3F3UA 4YTFA 4I4FA 5CI7A 4FGRA 4ZSGA 5LMKC 4ZSLA 1TQPA 1XBAA 5DMZA 3PXFA 4V04A 4XNEA 3CJGA 3OXZA 2B9JA 4RLLA 1AQ1A 3P86A 3G51A 3UYTA 1M17A 3QZIA 2VTPA 4JAIA 4AWIA 3WF8A 4USEA 4DTAA 2PMIA 2IO6A 5IDNA 4AE6A 3KRXA 3UO6A 5I9YA 3GFEA 4AZWA 2I7QA 3QFVA 4DCAA 3TXOA 4GG5A 4C37A 4BWXA 3S00A 1DS5A 2XNPA 3L9PA 5IUHA 1P4OA 4L6QA 4YLLA 2C0IA 4RJ3A 3ZO1A 4XLIA 4X2GA 4IX6A 3PE1A 3F61A 1IA8A 2G2FA 4KSQA 2W05A 4GJ2A 5B7VA 4J53A 4OTIA 3C1XA 1MRUA 3VQHA 4A9YA 4RX9A 4HCUA 2VX0A 4H36A 4OGRA 4AZTA 4C3FA 5M4IA 2C6OA 5GZ9A 5K5NA 5ANKA 3ULIA 2JKOA 3C5UA 2W96B 2XUUA 3AC4A 3LXPA 1YDSE 5IQEA 3UODA 3WZJA 3DKCA 3NVMB 3ENMA 3IQ7A 1ND4A 1URWA 4HVHA 5IQDA 4Q5HA 4R1VA 5CNOA 5ANIA 2VWWA 3KMUA 5HTBA 3KMMA 5I3RA 1PXPA 3F2AA 4JVGA 4ZTSA 3T3VA 1FVVA 1Y8GA 3NUYA 4MCVA 4QTCA 4YHTA 4O7WA 1NW1A 4O21A 4ZMFA 4CZTA 2ONLA 2DWBA 3PA3A 1YHVA 3QKLA 4NW6A 4EQMA 5JZJA 3P1AA 5GJDA 3FLZA 3OCSA 3HV7A 3PY3A 5CF6A 1QPJA 2YM7A 2W1EA 4WG5A 4BB4A 2X2MA 4ZJJA 5JGDA 1J3HA 2HZNA 3IW5A 3KN6A 4H3QA 3EZRA 5DGZA 4M68A 4QQCA 3QC4A 2GS6A 4GFOA 3DAEA 4QMQA 3AMAA 5GNKA 2YHVA 3F5XA 1Q3DA 2O0UA 3O50A 3W32A 4TYJA 3MVHA 3CR0A 5J5SA 4M13A 3KXZA 3GB2A 5E8SA 3BQRA 3C0HA 3EFLA 3R7VA 4YO4A 3FXXA 5EI2A 5CYIA 4ASEA 5EDRA 5A6NA 3HL7A 4USDA 3VS3A 4EHVA 3LKMA 4RZWA 4D9UA 4E4XA 4IANA 3Q96A 1YI4A 2J5EA 4JDIA 5ANGA 3VN9A 3E8NA 3HV5A 2V7OA 5HVYA 3LMHA 4U44A 2AC5A 4LGGA 2PVYA 4CYIA 4CMTA 2EB3A 1LPUA 5EHYA 3F66A 1J1CA 3HX4A 3O7LD 5AUYA 5C8KA 4FSWA 4P5ZA 5JH6A 3LCDA 4F99A 2VTMA 5IF1A 3HECA 4M0ZA 3KL8A 3LIJA 5DT0A 3TZ7A 5CZIA 2YCFA 4FTAA 5KZIA 3R9OA 4C02A 3TUCA 2VRXA 3IONA 4I41A 4N4SA 2ZDUA 4G5JA 3L1SA 4KIOA 3WILA 3MH1A 5HU9A 2O63A 3IW6A 4BCGA 5ICPA 3C4FA 2PE1A 1WBNA 2Y6MA 3LFEA 5DRDA 5E90A 1GZ8A 5CXHA 3NIEA 4IWOA 4ZTQA 5A9UA 2PU8A 4BBEA 4PRJA 4JR3A 4MXZA 4XV2A 3JY9A 3PP1A 5EH0A 4A9TA 4I6BA 4MX9A 4WA9A 2HZ4A 2EXMA 3A61A 4NM5A 4ZEGA 2RF9A 2OSCA 2A19B 2WTVA 3ZFXA 1UKIA 1BLXA 3RINA 4LL0A 4S31A 2C5NA 3ZM9A 2NRYA 1WVYA 3VS2A 2GNFA 4TWCA 5E92A 4HVSA 3FKNA 4PV0A 3VWAA 3DU8A 1Y6AA 4FTKA 4FNXA 4Q2AA 3FQHA 4F6WA 3QXPA 3L8XA 3GCVA 4FIFA 4ZTNA 3P7BA 2JAVA 4EI4A 3MDYA 3NNWA 4L7FA 4FZFB 4TL0A 3U6IA 4EHGA 3KCKA 3LFCA 3DNEA 2WELA 5CU3A 5IMXA 2P55A 1UNHA 5A4QA 4MF1A 2GNHA 3DKGA 4CRLA 5J9LA 4O7VA 4PMTA 4K77A 3HDMA 4UMRA 3L9LA 3G5DA 4OTHA 3Q4CA 5F20A 5D41A 3PPKA 4E8AA 1NVRA 4FT7A 3F2RA 1MP8A 3DBEA 4JBVA 5BVEA 1JAMA 4NTSA 4RGJA 3UDBA 3KKVA 3FKLA 3B2TA 3QQUA 5K4JA 3F3VA 4JQ8A 2UZEA 4BC6A 2R4BA 2XIKA 5D1JA 1A9UA 5JN2A 2HWPA 2PZ5A 4G6OA 4QP2A 5HIBA 3ACJA 4PDPA 4R3CA 3TNQB 5HE0A 3FAAA 2VAGA 1G8SA 1YKRA 3FZPA 5LJJA 4M97A 5LARA 1WBPA 4FZDB 1CMKE 4WUNA 2V0DA 5FUTA 3QQKA 1ZYDA 2B9HA 3PXKA 3C13A 4BCHA 4RX5A 5FG8A 3MVMA 4FV3A 2WQBA 3TJDA 1BMKA 2YM4A 4NJ3A 4NW5A 3MN3A 2PMLX 4QMNA 1CM8A 1ZYLA 4RA4A 3TKUA 4AFEA 3ZRMA 4IB0A 5E8XA 4A06A 2W9ZB 5KZ0A 2LAVA 1J7UA 4C4EA 2J6MA 1UU9A 4ANQA 3FMJA 4E5AX 2PZRA 4PTCA 2W1DA 4PP7A 4AQCA 4WBBB 3BZ3A 2QNJA 2QOBA 4Q9ZA 4DH5A 4ZLYA 5AA9A 3BE9A 4O81A 1QCFA 4G3EA 4HNFA 4H3PA 5J9YA 3BV2A 4LMNA 5DNRA 4HGTA 4I5PA 1B6CB 3HA6A 3BHHA 2WMXA 4IAFA 4D2VA 4U43A 2XS0A 3MB6A 4UB7A 4ZTMA 1SVHA 4FIJA 4N6ZA 2HK5A 4ACMA 2EVAA 2YJSA 1OIYA 5L2WA 4KIQA 4B8MA 4YPSA 1XKKA 5AR7A 5IMEA 2WQNA 2ZM4A 3E3PA 3PWYA 5KMNA 1ERKA 2XNBA 2WGJA 3FPMA 3MIAA 4BDKA 3MJ1A 5A46A 4ZZNA 1WBSA 5J8IA 5J79A 3NVKI 3R7IA 2R3GA 1KOAA 4XV3A 4R5SA 5D12A 4FV1A 3EKKA 3NSZA 1Q41A 5KMOA 4U8ZA 3MA6A 4FKJA 2W7XA 3ZOSA 1G3NA 3K2LA 3FBVA 4HGEA 2W5HA 3R63A 4I5MA 2QOQA 4J98A 4XV9A 3BKBA 2GU8A 5HKMA 2IW9A 3CY3A 4BZNA 4CQEA 4I0RA 2XM8A 2WMQA 2X7GA 3GC7A 4KS8A 3W16A 4EOPA 1IEPA 3L8VA 3QTRA 5FXRA 4MQ1A 4X3FC 4IIRA 3UIUA 4JOAA 4ENYA 3V8TA 4ENXA 5M06A 3GU7A 2B1PA 3L9MA 3FHRA 1YWNA 5BUEA 3C4WA 4DEIA 2WOTA 3EKNA 2BRBA 5D9HA 5HE1A 5EQEA 4HPTE 5JFSA 4BCKA 3DNDA 2R5TA 4FVRA 2YIQA 3NGAA 1DAYA 3JUHA 2CJMA 2C6EA 3KF7A 3H3CA 2RFDA 1H24A 3QKKA 3VRYA 2G15A 3VAPA 2WTCA 3H9OA 3QUDA 3Q52A 4O0TA 4IM0A 3CPBA 1OL6A 4DG3E 3NPCA 4U3ZA 5CVFA 3RAHA 5CQUA 2Z7SA 4HGLA 1TQIA 5CSHA 3HUBA 4HYIA 2F2UA 2GS7A 1E1VA 4L3PA 4YTIA 3KRLA 4PL5A 3H4JA 1ZYCA 3KK8A 3MI9A 5HG9A 4CFMA 1ZMWA 3I7CA 4FT3A 4YZBA 3B2WA 4L68A 4DEBA 3QTIA 3FZTA 4UWYA 3A7IA 1R0EA 4MXOA 3PXYA 2A0CX 4BCJA 5IA3A 3E92A 4GS6A 2NO3A 2UVYA 2QR8A 2YN8A 3A62A 3DPKA 4XP0A 4L45A 2FSTX 3P4KA 3QRUA 4G9RA 3EFJA 3R2YA 5EOBA 4ANMA 3HAVA 4QTBA 4BWKA 5AV2A 3TKHA 5EI8A 4BDFA 4C58A 5HIEA 4X3FB 3VS5A 4EZ5A 4R77A 5G6VA 4DGGA 3O96A 4UYNA 3KMWA 4MXYA 1Q97A 2R3PA 3BQCA 1URCA 3BRBA 3NDMA 5ANJA 4FSNA 4MD9E 4EL9A 2O2UA 1JSVA 4BGQA 4EOOA 3AC5A 1PXKA 2J0MB 3NLBA 1VYWA 4U42A 2PPQA 4WSQA 4AT4A 2HZ0A 1Q8WA 4BZOA 4G3DA 5AP3A 4FOBA 3DXPA 1R78A 5AP7A 5HEZA 2ZM3A 3COKA 2HOGA 3KRJA 4FTJA 5D10A 3IW8A 4F6SA 2IJMA 4AACA 5IZFA 5EW9A 3EH9A 4M67A 4KIPA 3VHKA 4IB5A 3RP9A 4PTEA 5FM3A 5CF4A 3NMUF 5DR2A 3F69A 4EH7A 3EN7A 1W98A 1ZWSA 3OBJA 3FMNA 4S2ZA 4CFFA 4ZAUA 1JKSA 3TUDA 5HIDA 2J5FA 3QQLA 3QX4A 5FTQA 3PXRA 3F88A 4QYHA 5LVNA 4LRJA 2ZDTA 4FEVA 3Q32A 1YDTE 3KY2A 3QCQA 3EYHA 1KE6A 3PSCA 5FXSA 5DHJA 1XR1A 2R3IA 2HXLA 4Q9SA 2VO3A 3VS1A 5A4TA 4USFA 3NWWA 1PKGA 1O6LA 2DQ7X 4ZZMA 4HVIA 2CKEA 3ALNA 5BVNA 4APCA 4W4XA 5AJQA 4QYFA 1VZOA 3PLSA 4BHZA 4BFMA 3LFNA 4Y73A 4BICA 4FEWA 2XVDA 3AMBA 3SXSA 1KOBA 2EXEA 3SAYA 4EOIA 5FGKA 3HMMA 4RC4A 3OXTA 4TY1A 3WE4A 4D2RA 2QOFA 4FUXA 5ETCA 4G1WA 2C1AA 2Z7QA 4AZFA 5TT7A 4IZ5A 3QTWA 3R7YA 4I5CA 2B54A 5LVLA 4QP1A 3CS9A 3F6XA 3K3IA 5EM6A 4NYEA 4FL1A 4NM7A 1JKKA 4E20A 1Z9XA 3Q6UA 4IZAA 2ITOA 2PMOX 4FKTA 3PP0A 1OVEA 4NJDA 4QQJA 2XMYA 5LCKA 4AN9A 4DGOA 4MNEA 3ERKA 4KWPA 4YZCA 3U9CA 3R6XA 4WIHA 3IECA 4BBFA 2Q83A 4TPTA 3RZBA 2IG7A 4AT3A 2UZTA 4FIHA 4EYMA 3F3ZA 2YZLA 4FKOA 4C62A 2R2PA 1OB3A 2J0IA 3VF8A 3W8LA 5CF5A 4ZS4A 4MEDA 4PDYA 5JZNA 4OBOA 2NRUA 2WMSA 3DDQA 3EYGA 3EIDA 3FMMA 4IH8A 4YJTA 4RIWB 2IZSA 3RPYA 4GRBA 4Y46A 4XH6A 1YI6A 1BI7A 4GU9A 4CLJA 1OKZA 3A2CA 5EQPA 2HCKA 4LV8A 5F1ZA 4G3CA 3NR9A 5H9BA 3V04A 3MY0A 4GIIA 3LJ2A 4G3GA 4B7TA 3CEKA 3PVGA 3NZ0A 2C3KA 3ANQA 3SOCA 1M2PA 5BVWA 2YM8A 3T9IA 4A9RA 4FNWA 4AS0A 1XH7A 4N70A 3IO7A 4DFLA 4EHEA 4EK8A 4CCUA 4WG3A 5KMIA 4KBKA 3SG9A 3ZRLA 2YA9A 2C0TA 2HIWA 2GPHA 3SXRA 3BX5A 4YJRA 4GK3A 2IZUA 4FA2A 5JFWA 4DT8A 1OKYA 3JVSA 3FXWA 4F1TA 3REPA 4JNWA 4ACGA 4QP6A 4BKYA 4BRXA 2C0OA 2PK9A 3DQWA 3HA8A 4ITHA 2WMTA 4BZDA 4QMMA 4RSSA 5HX6A 4CNHA 1SM2A 4DH7A 2BALA 4XG6A 2JKMA 4NM0A 4O22A 4R7BA 1GJOA 1WBVA 3GCQA 5AUVA 5L3AA 4P5QA 5LMAA 5FWKK 2DYLA 3BEGA 3KXNA 3NUUA 4HCTA 1W7HA 3ODZX 3UMWA 4IQ6A 5CEOA 3DLSA 3GI3A 3UVPA 3MPTA 5A4EA 5CAUA 3Q9ZA 1Q4LA 3FQEA 4I6QA 3ZS5A 3Q5ZA 3DGKA 3KVWA 1XBBA 5LOHA 3P08A 2BDJA 2YJRA 5JFXA 5M4UA 2X9EA 3CQEA 3OWPA 2OH4A 2BTSA 4BGGA 3SGCA 3QWJA 3Q60A 3QF9A 3VC4A 3KULB 2Y6OA 3JS2A 4N6YA 1LEZA 4BYJA 4KAOA 4EWQA 1NXKA 2ZJWA 3FZOA 4P4CA 4RLKA 4WRGA 3DXNA 4L43A 3R30A 4TWPA 3FPQA 2R9SA 2QHMA 3PXQA 4FSTA 2WMRA 4AOJA 1BX6A 1VYZA 4AW1A 4DGLC 3UVQA 4IB3A 3RWQA 3ZDIA 4JRVA 3GC8A 3OOGA 3ZBFA 4C3PA 3R00A 3V5PA 3W55A 1JWHA 2QO2A 3C4ZA 3E87A 4OW8A 3RI1A 4FKVA 3ITZA 4LMUA 5C8MA 4CTBA 2W17A 2OG8A 3C5IA 4I1ZA 2BAJA 4C4IA 3LCOA 5F9EA 3OTVA 3QGYA 4E4MA 3SW4A 4IHPA 4EQUA 4HYSA 3KXGA 3WIGA 3OCBA 5KNJA 2PE2A 2H8HA 4NKSA 4O2ZA 5A6OA 2H9VA 3AXWA 1WBWA 3CSVA 5TOZA 2WMVA 3FMKA 2PE0A 1YWVA 3QCXA 4FNZA 1GZNA 5HE2A 2H96A 3ID6C 2VNYA 5DI1A 2FB8A 3I60A 3NAXA 1BL6A 1JSUA 3BWFA 3W8QA 4C4FA 3PY0A 4ZXTA 3HAMA 4ANBA 2Y0AA 1WBTA 1O6KA 1ZOEA 2JBOA 2RFNA 3GQIA 3P5KA 4L42A 4FC0A 4OBQA 2WMBA 4FV2A 2PVFA 3VS6A 4DEGA 5GJGA 3GCUA 5HBJA 3QYWA 3LLAA 5JKGA 4BDBA 5HX8A 3TM0A 2A27A 5FQDC 5K9IA 3W2SA 2BAQA 4GT3A 4X6RA 3RK7A 1H08A 3P23A 2QC6A 4D58A 4O0UA 3KA0A 5L4QA 4GCJA 4QMVA 1SZMA 3UIMA 4OR5A 3NYOA 1XJDA 2P0CA 5TO8A 2QLUA 4CFNA 4IVAA 4ID7A 3PLAE 3AG9A 1PXIA 5HE3A 4RJ4A 4O7NA 5L8JA 1RW8A 1ZYSA 1F0QA 5B2KA 2LGCA 4OBPA 4BCQA 3UOLA 2QHNA 5E8VA 3SV0A 4DEDA 3KRWA 1PW2A 3W2RA 1XH4A 5IEYA 4PDOA 1K2PA 1B38A 3F5UA 4ANOA 3IW7A 1U54A 2OI4X 4GU6A 4RJ5A 5KUPA 4LRKA 4I22A 4RIXA 2YM5A 2Y8OA 4S34A 4NUSA 5H3QA 4Z55A 3U87A 2JDVA 4M15A 4RFMA 4C0TA 5AUTA 1RDQE 4YBKA 2WU7A 2OWBA 3A7GA 3Q2MA 5DH3A 4O7ZA 3TNHA 5DEWA 3TJCA 3ZLYA 5JRSA 1XH6A 3R8LA 4BTFA 3G0EA 3C4CA 3I81A 4EC8A 5CASA 3UG2A 3FSFA 3RCDA 3RNIA 3H10A 4EUUA 2OLCA 5ITAA 3TL8A 2JIUA 3IDBA 4IAYA 3BIZA 4I23A 3OY3A 4EOQA 4ALUA 5L8LA 4Y72A 3QLFA 4C2VA 3UNKA 2YABA 4GG7A 1JNKA 3R28A 3UZPA 5BVDA 4D55A 2W1GA 5CSWA 2IZTA 4JL9A 2BKZA 4J8MA 4FKGA 2CPKE 5H8BA 3LHJA 1YRPA 4BDGA 5K4IA 3JR1A 5C8NA 4CQGA 2XNEA 3ZRKA 4ZSEA 4MHAA 5HLWA 2VTQA 5GINE 1ZZ2A 3COHA 2QOCA 4XP3A 1JVPP 2BZJA 4IX3A 2R64A 4A9SA 4DG2E 3CGOA 1B39A 3QU0A 2OW3A 4QOXA 3NUAA 1YVJA 1FQ1B 1FVTA 3V01A 4QTEA 2QOHA 2F49A 2BDWA 5EYCA 5C4KA 3EFKA 4P7EA 2XK8A 3MY5A 3OWJA 4K2RA 4ZY5A 4DH8A 4AT5A 4DTKA 4FV9A 4ZLZA 4YHJA 1UWHA 3MS9A 3BGZA 2WNTA 4QMYA 5E7RA 4M8TA 4FL2A 4RZVA 2W1CA 3V6RA 4AX8A 2NNWB 4IVDA 3FWQA 2YLEA 3E7OA 4OT5A 3CC6A 3R83A 4O91A 4AXAA 4UXLA 3OROA 2YFXA 4YZNA 2YCSA 4DFUA 4EOMA 3O17A 3DAJA 1PXMA 5HBHA 4BTJA 4AW5A 2ZOQA 4HYUA 5IH5A 1OL2A 4JX3A 5IU2A 3ZMMA 2HW7A 2V55A 1YXUA 4DITA 4XUFA 3MFUA 2UW8A 1KV2A 2X9FA 1OUKA 3QA8A 4AZVA 3ZUUA 3GOPA 3MPMA 4QP7A 3R7OA 3V51A 2XNOA 1ZY4A 3E64A 3TN8A 2Q0NA 3QX2A 3KQ7A 2ETKA 3ORLA 4JG8A 3RNYA 2RGPA 2I6LA 2B4SB 2XCHA 3BU3A 3DCVA 1S9IA 1CDKA 4V0GB 4WHZA 3WOWA 4QP3A 2O64A 2ZB1A 4EJ7A 4KA3A 4KSPA 5HO8A 3BHYA 4KB8A 2RFSA 4F9BA 2QOIA 3LAUA 3ZU7A 4MXXA 4CKJA 4JG6A 2ZMDA 4GVAA 4YSMA 4WD5A 5HG5A 5M57A 4IACA 5HHWA 3LFSA 4HW7A 4F1OA 2E9NA 2XK6A 2BIKB 2XIZA 3H0YA 4GUEA 4QMWA 5HQ0A 2OGVA 1BKXA 3CP9A 2OBJA 4MXAA 4E6DA 4F7LA 3ALOA 5BYZA 3RCJA 2VTTA 5AR5A 2HW6A 3VF9A 3I0QA 3R8VA 4GMYA 4U80A 1G8AA 2UZLA 3PUPA 5AUWA 4RWLA 2YAAA 2XJ1A 1PYEA 2HXQA 3I4BA 2E9OA 4Q5EA 3ZFMA 4IX5A 4FSRA 4IAAA 4YHFA 5AUUA 4L67A 3PG3A 3B8QA 5HOAA 3UZRA 4EHZA 3GNIB 3DOGA 5IEVA 1FGKA 2GNLA 4LUEA 4NWMA 3ZDUA 2X81A 4YU2A 5B0XA 4Z7HA 3RPRA 3U9NA 1HCKA 1M2RA 3N9XA 5CEIA 2VWBA 3OC1A 3OWKA 4I24A 4JR7A 4PQNA 1M2QA 3UPXA 5EKOA 5FD2A 2X0GA 2CCIA 2VTOA 1R1WA 3IDPA 1R0PA 1JKTA 3T8OA 1ZMUA 4HZSA 3V8SA 3E63A 4F7NA 3TDWA 4Z16A 4V05A 3P78A 4AZEA 3D5VA 2ITZA 5AR4A 1YI3A 2I40A 5EK7A 1FINA 3NS9A 4FZ6A 4LI5A 1WCCA 1PJKA 5AIKA 5K0KA 4QQ5A 2PMNX 2VTSA 2VWZA 4YO6A 2W99B 5BVFA 3SVVA 3FEGA 2WMUA 3EL8A 3AC8A 4RJ8A 3DJ5A 2OFVA 4JBOA 3W2QA 4KKGA 4FV4A 5IQBA 5EM7A 2FO0A 5HCYA 4AA4A 1FBNA 4FKIA 5J7HA 4NH1A 2IW8A 3LM5A 5F95A 2G9XA 4PNIA 3HUCA 5ANEA 3VBTA 1M14A 3TTJA 5E1EA 3OT8A 4DYMA 4LOQA 4DG0E 5LMBA 2JEDA 3D83A 4FG9A 3LVPA 2C5YA 4HVGA 2VV9A 2QVSE 4FV6A 4R6VA 1YOMA 3UVRA 1YHWA 2YM6A 1ZLTA 4TYEA 4Y5QA 4C38A 1H4LA 5C4LA 1YDRE 4FI1A 4FNYA 3VS7A 2BZHB 3R22A 4XG7A 1OITA 2UW7A 4XJ0A 4D4YA 4NU1A 3SC1A 4JRNA 4IC7A 5TF9A 5M09A 3K5UA 4XCUA 3OD6X 2XK4A 2YEXA 5FP6A 1WVXA 2VX3A 1XH8A 2GNIA 2PYWA 4IM3A 3R9RA 3QZHA 4LV5A 1DM2A 3NW6A 3O7LB 4ACDA 3DBQA 2JC6A 3MB7A 1K9AA 4JQEA 1S9JA 4FT5A 3NEWA 2HYYA 4BIDA 4X2NA 4WBOA 2C4GA 3IK3A 4FIGA 5HI2A 3E5AA 2F7EE 2AYPA 2BILB 3A7JA 5DE2A 5EDQA 4DGMA 4IDVA 3TZ8A 3LFFA 4UXQA 5CXZA 3A4OX 1KE9A 3TUBA 3A60A 3TIYA 1MRYA 3IKAA 4FT0A 4YJVA 2UZDA 1IA9A 2VWXA 3RAWA 4RMZA 4BIBA 3D7TB 4I21A 1KV1A 2YIWA 4H1JA 3UC4A 4FE2A 5ACBC 4YP8A 1YXXA 1YWRA 4Y8DA 2E2BA 3PZEA 2QOOA 2PHKA 3SHEA 2UW3A 4BYIA 3LXLA 5IUGA 4FTOA 3RZFA 3FI2A 3V8WA 4FTQA 5K3YA 2HZIA 3NW7A 2OH0E 3VUGA 4C35A 3LFAA 3BHUA 1U59A 4IFGA 1NVSA 4MTAA 1OKVA 4IW0A 2DS1A 3F2NA 5A3XA 2W9FB 3LCSA 5CU6A 4BTKA 3IGGA 3NNVA 3I5ZA 5C01A 3ZUTA 4OTDA 4UMUA 5JSMA 3Q9WA 3NUSA 5BNJA 4FF8A 4QPAA 4ITIA 5AX9A 4M69B 4CFUA 2OZAB 3S1HA 4RC3A 2EXCX 5I9UA 4NTTA 3PJ1A 4NT4A 3NRMA 2RKUA 1SNXA 4O6EA 5T6KA 3MSSA 3AT3A 1KE8A 4FV8A 2W1HA 4RRVA 1T46A 2I0VA 3ROYA 3FZ1A 1IAHA 3ZUVA 4KIKB 3DK3A 3F3WA 3D4QA 5IA5A 3OEFX 4HYHA 3QWKA 4D2SA 4F09A 3HV6A 1MQ4A 3FLNC 4E1ZA 3DT1A 5BUIA 2CGWA 2JD5A 5KKRC 4EH8A 4F0GA 2FSLX 4EH9A 3IW4A 5F4NA 4AA0A 4M14A 1FOTA 4I3ZA 2NPQA 3DBFA 4F70A 2W5BA 2XRWA 4O38A 1CSNA 2J50A 3FLWA 4YNOA 5JGAA 2CN5A 5I9VA 3Q53A 2HENA 5AM6A 2G2IA 3ZZWA 4FTUA 2XIXA 3OUNB 5BUJA 2GTNA 1BI8A 3NNUA 3OWLA 3Q04A 4AE9A 4OUCA 2W4OA 5I5ZA 1DI9A 2V7AA 3ZBXA 4DLIA 4FK6A 3MH2A 5ANOA 4EUTA 2PZPA 5HG7A 4IB1A 3C50A 4FKSA 3BHTA 2ERZE 4RX8A 1KE7A 2GHMA 4AW2A 1O6YA 3OMVA 4LOOA 4R3PA 4WNKA 3HRCA 5FXQA 3FXZA 1H27A 3RPSA 4DEEA 4JLCA 2W5AA 2X8DA 3W2PA 5M08A 2PUUA 1W82A 2W1IA 3GXLA 4YMJA 3D2IA 4MVFA 3U6HA 4GK4A 4CMUA 3I5NA 4CRSA 2OJJA 3S4QA 4GT4A 4GIHA 4GFGA 5IG1A 2GCDA 5HGIA 2PUPA 1PF8A 4H1MA 5L6WL 1PY5A 2XH5A 4IAIA 4O0XA 4QP9A 3VIDA 2EUFB 3G9LX 3R21A 4R1YA 4F9CA 3OY1A 4E4NA 5EFQA 4YJSA 4O0YA 5H2UA 3RM6A 4B8LA 3A8WA 3VUDA 2WOUA 1QPDA 3QA0A 3SRVB 4R7HA 5J9ZA 2R3HA 4PMSA 4M7IA 1OPKA 4QNYA 3SDJA 5M4CA 3LMGA 5CU4A 3VVHA 4BBMA 4O84A 2I0HA 3SW7A 3MFSA 4LFIA 4PPBA 4CTCA 3RK5A 2B7AA 1OPLA 3EN6A 5LMKA 3ZM4A 4U40A 4MWIA 5CQWA 3G0FA 2W1FA 4U3YA 5CLPA 3MY1A 4D5KA 5CANA 4HZRA 5HORA 2R0IA 2Z02A 2C6IA 1GIIA 1Y8YA 2FSMX 4UV0A 5IH4A 4RVTA 1G5SA 4D28A 3BYOA 2QG7A 2PL0A 1V0PA 4CLIA 2PTKA 3OW3A 4QO9A 3RK9A 5EI6A 3I6WA 2C6LA 2QCSA 2WD1A 4FX3A 1H1SA 3MA3A 1QL6A 3RVGA 3AC1A 3DZOA 3EN5A 3QALE 4XRJA 3QCSA 4C8BA 3GFWA 4EKKA 4QT1A 3A99A 4HPUE 5TR6A 2XKCA 4QMPA 3R9NA 5LWNA 2C47A 1OMWA 2C5VA 2GMXA 2JDTA 3H0ZA 3MVLA 1PMVA 2QG5A 4EQCA 3L8PA 2X8EA 3QQFA 1CKJA 1H0VA 3GU6A 3HLLA 3K5VA 5JT2A 1H07A 2I0YA 1NY3A 5TKDA 4EOLA 5LVOA 3O0GA 3FLQA 1H1RA 1PXJA 3VO3A 3PVBA 2BDFA 3G9NA 5CSXA 4WO5A 2R7BA 5CSVA 3CGFA 5M56A 3DTWA 4FODA 5JGBA 3LQ8A 4I6HA 3ZZEA 4O0WA 4D9TA 4J1RA 4ONAA 4UZDA 1J7IA 1HCLA 1PYXA 3QYZA 1REKA 1U5QA 3HDNA 2X2LA 2ZM1A 4FBXA 3WZEA 3UQFA 2ZAZA 3D2KA 3PVUA 5AP0A 2QKRA 3FMLA 3VW8A 3CY2A 1M7QA 5F94A 2GHLA 4QRCA 3LCKA 1IR3A 2QO7A 4C34A 5KO1A 4ZY4A 5CAQA 3ORXA 2PVRA 3FI3A 5L2QA 3AQVA 3LE6A 4ERWA 3ATTA 4TYHB 3Q5IA 4IX4A 2OF4A 3NUXA 4QPMA 5DLSA 4JJRA 5FDXA 4O82A 2YDIA 3ORMA 4L9IA 4L52A 5FEQA 1GY3A 4RC2A 1OBDA 4NL0A 2CGVA 2R3OA 2O5KA 5CENA 4DFYA 3EQIA 4JI9A 3QQJA 2R3RA 4QP4A 5CNNA 3S2PA 5BYYA 2QONA 3C0GA 4BHNA 3I1AA 1H00A 3JY0A 3PTGA 3KEXA 2WEVA 4NK9A 4W4VA 4ZS0A 5FM2A 2HY0A 1FMKA 3U4UA 1YQJA 3SKCA 3ORIA 3QAME 4G17A 4RVLA 4TW9A 4Y83A 4MBLA 4RWKA 4WSYA 5A4CA 4LGDA 2Z60A 3ZO2A 1NA7A 2BUJA 2F7ZE 4LUDA 3KF4A 5AR3A 2VTJA 3COMA 3V5TA 5AV4A 5IA0A 4O2PA 3THBA 3NCZA 1K3AA 4X2FA 4H05A 4QMSA 2WQOA 3TTIA 3F3TA 1XHAA 3MW1A 4MYGA 1JSTA 4MAOA 3TCPA 1NVQA 1H01A 3H9RA 1W0XC 4FV0A 4U6RA 2BPMA 2C6DA 2X7FA 3E88A 4PL3A 1Q62A 5D11A 5DRBA 4EH5A 3BU5A 3WYYA 2JITA 3AGLA 2CNVA 2OJ9A 3R2BA 4JX7A 3Q3BA 3BLHA 4QNAA 4L7SA 3D5XA 5IA4A 1KE5A 3KU2A 5L2IA 2QO9A 5A54A 3DK6A 3G2FA 3F7ZA 2XKEA 2Y9QA 1H1WA 4FEQA 3W1FA 2BRMA 4TN6A 3W2OA 3RJCA 3MBLA 3TDVA 5HCXA 3I7BA 1ATPE 4ARKA 4EOJA 5CF8A 4GKIA 2XKFA 5CU0A 3W33A 4DA5A 4EKLA 2X4FA 3T9TA 5M51A 5IISA 4GK2A 4RVMA 5EYMA 3V5WA 2R3JA 4CFWA 2VWYA 4AA5A 3QGWA 5CALA 5C03A 4CXAA 4E6QA 3BE2A 3NIZA 4M66A 4C61A 2PZYA 5JRQA 4O7LA 1AD5A 3DFCB 4C2WA 4I94A 4ZLOA 4BDHA 3OOMA 4LOPA 4ZIMA 2B0QA 3FY2A 1J1BA 2VGOA 5J1WA 4XS2A 3C9WA 3KCFA 3LXNA 3I6UA 5BMMA 4DFXE 2VNWA 2UUEA 3GT8A 4S33A 4K1BA 4P2KA 3VBXA 2OFUA 4N0SA 3DB8A 4DN5A 3LFBA 2XP2A 3D94A 3PPZA 5FDPA 3ORZA 2ONLC 3GCPA 4H3BA 3BYMA 4XEYA 1KUTA 4M12A 4MXCA 4AGDA 2CSNA 1OL1A 3QUPA 1H8FA 4F64A 3BCEA 4JS8A 3VNTA 3R0TA 4RFYA 1ZRZA 1H28A 2Y7JA 3FQSA 1KSWA 4W8EA 3I79A 1UA2A 4Y5HA 4N57A 2X6EA 4UWCA 5CU2A 4DLJA 3EZVA 4PTGA 4F63A 1IRKA 3UP2A 1LP4A 4M84A 4EK4A 1DI8A 3TZ9A 3RHKA 3UYSA 3WZKA 1YOJA 3UNJA 4AGWA 2JDRA 5CI6A 4JG7A 1A48A 4Y95A 4FEUA 3VUHA 2OKRA 5EW3A 3VRZA 4D0XA 4F4PA 3R71A 4FYNA 4G34A 2WO6A 4YJUA 5AR8A 2QR7A 2BROA 4FTIA 4DH1A 4EK3A 5KMJA 3NW5A 5E8WA 2XIRA 3UPZA 4S30A 4YGAA 4FKPA 4RPVA 1P14A 4E5WA 3ZXTA 3EQFA 2WPAA 5C9CA 2IVUA 4HOKA 3QTXA 3G6GA 3MH3A 2C6TA 3JYAA 3P7AA 4B6LA 1M52A 3RKBA 3IPHA 5J95A 4DC2A 3EQCA 3OCTA 3FYKX 3FC2A 3FKOA 4R78A 3FHIA 4YLKA 2IVVA 5DFPA 3RBWA 2CN8A 5GIOE 4YZMA 5K0XA 4IXPA 4C3RA 2XBJA 2BFYA 4UX9A 4FKQA 4H58A 3BEAA 2YISA 3F82A 1I09A 1UV5A 4R7IA 4CKIA 3U6JA 3KK9A 4FUYA 2W4KA 2GFCA 4I0TA 5CX9A 3LZBA 5AM7A 3WBLA 4BCOA 1BL7A 4IVBA 4OT6A 3GP0A 5D7VA 3POOA 3O23A 1SVGA 2FGIA 4MQ2A 1UNLA 3FL4A 5FLFA 1JQHA 2VO6A 3TT0A 3D15A 4O1PA 3HRFA 3FSKA 3DFAA 4TYIA 3GQLA 5JQ8A 2R3QA 2BHEA 2QURA 4OAVB 2WIPA 3BWJA 4TWNA 4EK6A 5IPJA 3PJ2A 3QRKA 4ZK5A 4FSUA 4MKCA 2ITXA 4EYJA 3RM7A 1W84A 2Z2WA 2YACA 4FZAB 2B52A 3M42A 5EYDA 4FTRA 4ZY6A 4WNOA 4X7QA 2WKMA 3FMHA 3QTQA 1PXNA 3OXIA 4D2TA 2KULA 2YAKA 4DCEA 4F9AA 5B2MA 1JKLA 2UV2A 4QMXA 2BZKB 4XG2A 5CVHA 3RHXA 1GNGA 2ITNA 2AC3A 3AMYA 3PIZA 3PIYA 2C5XA 3BV3A 4K18A 4UALA 1Y57A 3UZTA 3FY0A 2PUIA 3PVWA 4G3FA 5DPVA 3TV7A 4BWPA 2QD9A 3E3BX 2J7TA 4FVPA 1OBGA 2PVKA 3AC3A 3PXZA 2I0EA 4D4VA 2F2CB 3EQHA 3ANRA 3EOCA 5IQFA 3UQCA 1PHKA 3CBLA 3H9FA 2XK7A 3HMNA 3GU4A 2ZYBA 3S0OA 5I4NA 3AD4A 4GSBA 4NCTA 5L2SA 1STCE 3CTHA 1APME 5IKWA 4CCBA 4EZ7A 4OAUC 2IWIA 3ODYX 3COIA 4GVJA 2YDJA 5CZHA 4E7WA 5KMMA 5HCZA 4K6ZA 2JFMA 3G33A 4GH2A 3R8UA 4I6FA 2BFXA 3PY1A 5G1XA 2XBAA 5AIRA 1OKWA 3DQXA 4G31A 4TWOA 3DDPA 4UZHA 2YWVA 4G2FA 2XJ0A 2BRHA 5E4HA 4BF2A 2R3LA 5AX3A 3JPVA 4FR4A 3KB7A 4F0FA 2ITPA 1RQQA 3RWPA 3WI6A 4QMTA 3QBNA 2A4LA 4MNFA 4CYJA 2E9VA 4IJPA 3FMEA 1IG1A 3E93A 3LCTA 1WAKA 3BLRA 3GCSA 3VBVA 1XO2B 1Q5KA 3IDCA 3EN4A 2UVZA 4ASZA 3OZ6A 1L8TA 4S32A 2FA2A 2VTRA 4AGUA 4JAJA 3TKIA 4DE4A 3UOKA 4U97A 2WZJA 3PG1A 3E8DA 1V1KA 3QQHA 5C27A 4OTQA 2DUVA 1YXSA 1LEWA 4IBMA 3DAKA 3ZEPA 4J96A 2CMWA 3NX8A 3OFMA 3BGPA 5JFVA 3QHRA 4E26A 2JBPA 3U54A 3WF6A 1R39A 4PDSA 4I20A 1OIUA 3RALA 1H25A 4DH3A 5HNIX 4K11A 1I44A 4UEUA 3ROCA 4RIWA 4BDDA 1GZOA 3IG7A 2C6KA 4IEBA 5CAVA 2BMCA 2UZBA 3KN5A 4L3LA 2ETRA 4XOYA 3QD0A 4QTDA 2IW6A 2C69A 3NYNA 3DS6A 1PMUA 3DBCA 1UNGA 3DBDA 1BUHA 4KRCA 3KC3A 3UJGA 4ALWA 5I9XA 1P4FA 3GU5A 2O65A 4IE9A 4DFNA 1GOLA 4R5YA 3RPVA 3NCGA 5AP2A 2REIA 3CD8A 3FDNA 2JKKA 5ACKA 3W10A 5M07A 4FV7A 4L44A 3FC1X 3PFQA 3ZXZA 5DR6A 3E62A 1DAWA 3OF0A 3ELJA 3N4UA 2ITQA 5E1SA 2OIQA 1U5RA 3RAIA 4FTLA 3HVCA 3PZHA 3TIZA 4TXCA 4CVAA 3MESA 3WF7A 1Q8UA 2ITUA 3CLYA 2H6DA 2JKQA 5TE0A 5E9EA 4XG4A 3ORTA 2W0JA 4PMMA 3MTLA 2OXDA 3LMIA 5DT4A 5HTIA 2JLDA 3OVVA 5AP4A 3UOHA 1MUOA 3EFWA 2I1MA 3QRJA 5T3QA 4CD0A 5DIAA 2C1BA 2CNUA 4DFBA 4UWBA 3ZFYA 4NIFA 2QQ7A 2SRCA 1WZYA 4QTAA 4FKRA 1KWPA 3OUKA 2XB7A 4U41A 4U81A 3ZSHA 2BKKA 2UZUE 4TTHB 2HAKA 2PVMA 1ZY5A 4BCPA 5HO7A 3BLQA 3TWJA 3U4WA 1Q3WA 2VWUA 3OTUA 5EHOA 2OICA 2XK3A 5DA3A 2C3IB 4E5BA 4FYOA 1YXTA 4WG4A 3PRFA 5AV1A 3UGCA 5M4FA 4O7RA 3LM0A 3M11A 1YOLA 2A1AB 2CHLA 4FKUA 4IC8A 3KULA 3NUNA 4JT3A 3H30A 3PJ3A 4U9AA 3UQGA 3B8RA 3DLZA 3DY7A 4QMOA 1Q99A 4RIOA 4XG9A 4BY9E 2Y4PA 3TNIA 4CZYB 2JAMA 3QXOA 4W4YA 5M44A 5FRIA 2UVXA 3AT4A 2JDSA 3DTCA 3VJNA 4EZ3A 5CY3A 5HVKA 2PVHA 1OUYA 4O0VA 3SA0A 5IQHA 2XNGA 3M1SA 5J87A 5IA2A 3QL8A 2YERA 3PDTA 3LOKA 4LL5A 2YIRA 4L46A 3DK7A 4NSTA 4LYNA 4RWJA 4WOVA 4HVDA 5ETAA 3VUIA 4YJQA 2XCKA 4ITJA 2VU3A 4KBCA 3QCYA 3N4TA 4U45A 4FSYA 3D0EA 4TT7A 1U4DA 2WXVA 2VO0A 5EDPA 2J0JA 4B99A 1SMHA 4ACHA 2YZAA 3TACA 5LVMA 3GC0A 4IZ7A 3ZH8A 5K5XA 2J4ZA 1E9HA 2B9IA 4IFCA 1Q8TA 3OBGA 4QMZA 1Q24A 4PNKA 4AUAA 3QZGA 3PE2A 4GEOA 5ETFA 5HNGA 5DOSA 3LPBA 4ZTLA 3TV4A 3S95A 1PMNA 1XQZA 3II5A 3ZEWA 1JLUE 1GAGA 3CTQA 3UIBA 4AN2A 2VTAA 4FTCA 3RAKA 5ANDA 1IASA 2WHBA 3C7QA 5H8GA 5HZNA 2C3LA 4QMLA 4FEXA 4AOIA 2ZV9A 3Q6WA 1TVOA 4F9YA 2W4JA 1T45A 2O3PA 3QRIA 3HNGA 4YC6A 3CJFA 3UBDA 4E6AA 1CTPE 4NFMA 1SYKA 3ETAA 4RJ7A 5CSPA 3LLTA 4PPCA 4X6QC 2F57A 3MYGA 4OTGA 2WTDA 4YC8A 3GVUA 4Z7GA 4FIIA 4QQTA 2YLFA 2UW4A 5IQAA 4NKAA 3VJOA 4BCIA 4BIEA 3RTPA 4XG8A 3BHVA 2PVLA 4L01A 2GDOA 4A4LA 1P2AA 1EH4A 5HLPA 2XEYA 4BDEA 2NP8A 3UMXA 3R1NA 3EB0A 4KRDA 1L3RE 1IAJA 1R3CA 1Q8YA 1RJBA 3W18A 5DYJA 3ZCLA 1UWJA 1WMKA 1LUFA 2J9MA 2OU7A 4QYYA 4BI0A 4EH6A 1PRYA 3ACKA 2HY81 5HD4A 5KMLA 5AAEA 5EM8A 2OXYA 5AUXA 5DN3A 4JDHA 4HNIA 3EQRA 5CS6A 3T3UA 4F0IA 2Z7RA 4C4GA 3ZONA 4YJNA 2X6DA 2X4ZA 3BYVA 4MBIA 2BRNA 3EQDA 3TI1A 2V5QA 3EQBA 2X1NA 3MGYA 3OS3A 4GYGA 3EHAA 4AGCA 4XG3A 4D1XA 2WQEA 4HGSA 1MRVA 2P2IA 4YTHA 4AG8A 3MVJA 2G2HA 4XYFA 3KVXA 2CNQA 4RQVA 3ATSA 1FMOE 3A7HA 4WNPA 2RFEA 3VBWA 4LRMA 4WRSA 3ZLWA 5FP5A 5HVJA 3BBTB 3K3JA 3O51A 2HELA 2WU6A 4M3QA 4ANSA 3ZO3A 4DAWA 3ORPA 4OTPA 1PKDA 1GIHA 4BN1A 2JIVA 4C36A 5HO6A 2QOKA 5HBEA 4V01A 4EBVA 4F1MA 3Q4TA 4TZRA 4BGHA 3O2MA 2V22A 4MD8E 4RA5A 3KREA 4DBNA 4XV1A 4QP8A 3NYVA 4L3JA 3VS4A 3LJ0A 3PJCA 4TRLA 4IAKA 4YBJA 3ULZA 1YXVA 5T68A 3DJ7A 4YSJA 4DGNA 2WTKC 4YNEA 2CKOA 3MJ2A 3UTOA 2YCQA 4L00A 3C51A 4NZWB 2FYSA 2P3GX 4JIAA 4EC9A 5KMKA 1OM1A 3ZYAA 3AC2A 5LVPA 5FBOA 1OL5A 4EH3A 3HZTA 4KS7A 4I0SA 4C59A 2UW9A 5DT3A 2ITTA 4F9WA 2UZVA 4PF4A 4MNEB 1XWSA 3CD3A 3GC9A 4RIYA 4TNDA 4U5JA 2P2HA 1XH5A 2BAKA 4XRLA 4FSQA 4WUAA 2C6MA 5AEPA 3HMIA 2VTHA 4FTMA 4G9CA 4IJ9A 4J97A 5EHLA 2F4JA 4AW0A 4KD1A 5AAGA 5L8KA 5LXMA 5AV0A 3BI6A 3FZSA 4WNMA 4NFNA 3PA4A 2WTIA 3KRRA 3Q9XA 5DR9A 3VBYA 4F08A 2R3NA 3HYHA 2R3KA 3OCGA 3DKFA 4EWHA 3JXWA 3SD0A 1ZOHA 2UW0A 2JFLA 3UC3A 1BYGA 3JVRA 3L8SA 2C68A 3QD4A 3RMFA 5J7BA 4ZTRA 3ZSIA 3BPRA 4P90A 4O6LA 4B0GA 2QODA 3M2WA 3MIYA 3V3VA 2FVDA 4PX6A 5I9ZA 4AP7A 4BDCA 5FEEA 5BQ0A 3BGQA 3D9VA 4K9YA 5IDPA 3A4PA 5M53A 5GIPE 2ETMA 2GNGA 3MH0A 4V0GA 2WTKB 5CTPA 4RT7A 2B53A 2IZRA 3GBZA 5BX0A 2P4IA 1RE8A 5C1QB 3VUKA 3TG1A 5GJFA 2RG5A 2XRUA 2EB2A 2WMWA 2QI8A 2YCRA 4RJ6A 5KKRB 1ZARA 2GHGA 2YITA 2Z8CA 4LG4A 3U51A 3CTJA 4D1SA 2J0KA 3V5LA 5KX8A 4BDIA 3KFAA 4FKLA 4EOSA 5DEYA 2VO7A 2OK1A 2G1TA 3R9DA 2ITWA 2OJGA 3LQ5A 5J5TA 4BL1A 1ZOGA 1VR2A 2RL5A 3DV3A 4ALVA 2BZIB 5AFVA 1F3MC 3HV3A 3QD3A 3QQGA 4RQKA 3D5UA 3SX9A 5CVGA 4AZSA 5JEBA 2YM3A 4DT9A 4FMQA 1V0OA 2GS2A 1A06A 2ITYA 4YZ9A 2GNJA 1CKIA 3BBWA 2UZWE 4IAZA 4BTMA 3V5QA 2YIXA 3HP2A 3UE4A 4E4LA 4LGHA 4E73A 2OF2A 4EK5A 5KE0A 1UVRA 3G90X 3NNXA 3WF9A 5JQ5A 4O0RA 4BCMA 4FIEA 3N51A 3FE3A 4YTCA 1P5EA 4PPAA 3GGFA 4TNBA 2VZ6A 4ZZOA 2QLQA 1SVEA 4PP9A 5HU3A 4QD6A 3EJ1A 4CG9A 5AADA 5GZ8A 4HCVA 4IADA 2BRGA 3S3IA 4O7YA 3QZFA 4BCNA 1WFCA 4RBLA 4AU8A 3BYSA 3D7ZA 5KBRA 3R02A 3OHTA 2J51A 5BVKA 3LQ3A 3Q4ZA 1Q8ZA 4FKWA 5EW8A 5FBNC 4O0SA 4FG8A 3D14A 2W1ZA 4I4EA 4O1OA 3FV8A 4GKHA 4QYGA 2ZV8A 2ZMCA 2WAJA 4QMUA 2A2AA 2JDOA 3GUBA 3O8PA 4FL3A 3G6HA 3KXXA 4CZUA 4R3RA 2G01A 4D0WA 2CKPA 4CGAA 4O7SA 2XA4A 3ZC6A 5L6PA 3DA6A 2CLQA 4BDJA 1H1PA 4MWHA 3F5GA 4FOCA 2IN6A 4NCTC 1O9UA 2KTYA 3AD5A 4UMTA 3VBQA 4KUJA 5KHWA 3MPAA 2PWLA 3MTFA 5HTCA 4R8QA 4ASXA 1UKHA 2YWPA 3KXHA 4QYEA 4BI1A 5CAOA 4O83A 4CV9A 4CKRA 4KINA 3ORNA 1WBOA 3OT3A 3QTZA 5CAPA 3CKWA 2EU9A 3R1QA 4W8DA 3UOJA 1LR4A 2CLXA 5B2LA 4WKQA 4DHFA 5A14A 4M0YA 2FSOX 2VTLA 2F9GA 2WFYA 4J7BA 4H39A 2ITVA 5AUZA 4O96A 3CIKA 4X2JA 3ORKA 4A4XA 2W06A 1ZAOA 3EQGA 4G16A 2GSFA 4F7JA 2Q0BA 2ZB0A 3Q2JA 3PYYA 2BTRA 4KABA 1GZKA 2QU6A 2ACXA 5AAFA 4BR3A 3PWDA 5LCJA 3ZLXA 4E93A 4NEUA 3NUPA 3K54A 4U79A 4KNBA 4CG8A 5E8YA 4OTFA 2WQMA
chains in the Genus database with same CATH superfamily
3UIXA 1U54B 3WZUA 3AD6A 1QPEA 3QTSA 4RIXB 5CWZA 4G6NA 5DWRA 3LJ1A 4AF3A 2XZSA 2OZOA 3ZTXA 5HG8A 3R1YA 4EOKA 3D7TA 3HMPA 2JIIA 4X21A 3P9JA 1QPCA 3VHEA 1SNUA 5I3OA 4K0YA 1J91A 2BR1A 2XF0A 2ZV7A 3QRTA 4ORKA 4XX9A 2VUWA 4A9UA 3P79A 3PSDA 4KKEA 5FTGA 4DTBA 1MQBA 2QKWB 2C5OA 3PJ8A 2YIYA 5BPYA 4RVKA 2R3MA 1H0WA 4EH2A 4YZDA 3HEGA 4CEGA 3ET7A 2UZOA 3PUFC 3KGAA 2R7IA 3DZQA 2BVAA 3R7EA 3R9HA 3TZMA 5JK3A 1OIRA 4GJ3A 1REJA 4TKSA 4YR8A 2PZIA 2OXXA 2GTMA 2FUMA 2OJIA 4I92A 3BELA 2Z7LA 4K8AA 4M69A 5HESA 1ZZLA 2CGUA 2OZAA 3FL5A 4DEHA 5HD7A 5KHXA 4MH7A 3VS0A 2XNNA 3CQUA 4PUZA 3FZRA 5EG3A 2OJFE 3V6SA 2PULA 3QUEA 4DFZE 4EJNA 1OL7A 4BCFA 5BVOA 4KIKA 3D5WA 3R04A 3ENHA 4PL4A 4UN0C 1XH9A 2Y4IC 4D1ZA 3F7WA 4PMPA 4OLIA 4JBQA 2CGXA 3HP5A 4GL9A 5E8TA 4Z3VA 3E8CA 5A4LA 3MV5A 3N4VA 4GUBA 4ZJIA 3GU8A 5DBXA 5CEMA 4XLVA 3IOKA 4UMQA 3FMDA 3IGOA 5AP5A 2BHHA 4ZSJA 3R8MA 5FTOA 1OZ1A 5AA8A 5CEPA 3HGKA 4YLJA 1FPUA 4XP2A 3IS5A 1Q61A 3GENA 4PWNA 3TNPC 4I93A 4RWIA 3PIXA 4F7SA 2J2IB 3TNWA 4J99A 5JMSA 4UYAA 4XBRA 3P0MA 3RPOA 2ERKA 4BKZA 4WT6A 4XBUA 3WE8A 5C26A 4MK0A 2CKQA 1WVWA 3SQQA 4ZTHA 3F9NA 3FYJX 4E6CA 2BCJA 1JBPE 1TQMA 4AAAA 4C4HA 2XIYA 3WIKA 2PSQA 3LXKA 3MFTA 4X0MA 4JXFA 3R73A 2PVNA 2CCHA 1FGIA 4FICA 3LFDA 4IZYA 4IWQA 1VJYA 4HJOA 1F5QA 4EONA 1FVRA 2QOLA 3DKOA 4DEAA 4UBAA 5CEKA 5D7AA 3ZLSA 2QU5A 4BJJA 4EEVA 5KCVA 2UZNA 2WTJA 3POZA 3QHWA 4D4SA 2ESMA 5H8EA 3TEIA 4JBPA 3IOPA 5HLNA 2IVSA 2WEIA 2Y4IB 2YDKA 3QKMA 3CXWA 4GYIA 4MD7E 4CT2A 4U7ZA 3VUTA 1PMEA 2BIYA 3UP7A 4LQMA 4A4OA 4FZ7A 3C4XA 5E91A 5EM5A 3SOAA 4YUQA 3DXQA 2GFSA 4FK3A 4APPA 1V0BA 1ZXEA 2E9UA 3C4EA 1Z57A 3L9NA 3NAYA 3U55A 3BYUA 3P7CA 4J95A 4NIFB 3CQWA 3SRVA 2GQRA 5IUIA 4YPDA 2XM9A 4RG0A 5DG5A 4ACCA 4GT5A 4LM5A 3AT2A 1W8CA 3FUPA 1TKIA 3GOKA 3CE3A 4YURA 1TFFA 4JDKA 4X3JA 5GHVA 4MF0A 3SG8A 1OGUA 2UW6A 3NFFB 4II5A 4YJOA 5LQFA 4BDAA 2X8IA 4W4WA 3ZHPC 2XNMA 2PUNA 5IQGA 3UO4A 4YC3A 3VUMA 4B4LA 5EKNA 5LWMA 2C30A 2X7OA 3E7VA 1GIJA 3FJQE 5AR2A 3E8EA 3ZO4A 4CFVA 2OIBA 3OG7A 2F7XE 2J0LA 4K33A 2VWIA 4OTWA 1TZDA 5I9WA 3HMOA 3R8PA 4JQ7A 4IVCA 3ZC5A 3ZSGA 1ZYJA 3UDSA 4FGBA 2B9FA 1OI9A 2WTWA 4KBAA 2XK9A 2PY3A 4ASDA 2IPXA 4NM3A 1JPAA 2X39A 4BI2A 3RGFA 4ANNA 4ERKA 1AGWA 3DJ6A 2XJ2A 3CCNA 3I0OA 2VX1A 5L6OA 5CT0A 4DBXA 4UY9A 5AP1A 4X3FA 5EOLA 2XYUA 4W9XA 4IWPA 2GQGA 2XEZA 4RX7A 5BYLA 5IQCA 1Z5MA 3C0IA 4B9DA 5J1VA 4C4JA 4DINA 3CKXA 4FG7A 4J71A 3CPCA 4PY1A 3U8WA 2P33A 3WYXA 4ZSAA 2RSVA 5IA1A 3QC9A 5IEXA 4FT9A 3PRIA 3UG1A 2XYNA 5AP6A 2O8YA 4O27B 2XKDA 3WF5A 3WZDA 4F65A 4AFJA 4C57A 3O8UA 4KKHA 2HWOA 4RFZA 1UU3A 4EORA 5L2TA 1XBCA 3KXMA 1HOWA 5EYKA 4C7TA 3MWUA 3UNZA 3BU6A 3VQUA 2UW5A 2VD5A 3FLSA 4Z9LA 4IM2A 5HNBA 4AN3A 3AOXA 3OW4A 3R1SA 4ZMEA 3LW0A 1M7NA 4DF3A 3TV6A 3EN9A 3OP5A 3VONA 5E8ZA 2R0UA 4ZJVA 4TYGA 4U0IA 3QTUA 4I5HA 1YW2A 5IH6A 1JOWB 5CEQA 3ML1A 3Q9YA 4J52A 4TYHA 2OIDA 4J8NA 4JDJA 1OECA 4BKJA 4G5PA 3UO5A 2VTIA 1Y6BA 5E8UA 4C33A 5AMNA 2R3FA 1UU8A 1OPJA 4Y85A 4CV8A 4CMOA 4E3CA 3FI4A 4O7TA 3O8TA 3W0NA 2VTNA 2ZV2A 3PPJA 3LFQA 4CSVA 3MFRA 1H26A 4F6UA 2VGPA 4A7CA 3W0QA 4YJPA 2WMAA 1VLRA 4D2WA 1UU7A 1PXOA 3EMGA 3PA5A 4XOZA 1CKPA 5M55A 4D2PA 3A7FA 3AGMA 2B55A 4OTRA 1VEBA 4FTTA 3R01A 4IMYA 3FI8A 2PVJA 2VWVA 4IDTA 2J90A 4JIKA 3HKOA 1J7LA 3EL7A 4GFMA 4L53A 5IQIA 4FTNA 5I0BA 5DVRA 5FEDA 2EWAA 4FV5A 4CT1A 1H1QA 3F5PA 2RIOA 5ETIA 4A07A 2VN9A 3WARA 2E9PA 4XMOA 1E1XA 2RG6A 3HRBA 1OIQA 3NYXA 2V62A 1QMZA 1X8BA 4D5HA 3Q4UA 5AWMA 4GW8A 3QD2B 4XHKB 4QPSA 1W83A 2H34A 4FSMA 5AV3A 4FVQA 3EWHA 4X2KA 4EBWA 3A8XA 3VULA 1NT2A 1PXLA 3O71A 3QLGA 2AUHA 2WIHA 2WB8A 3W2CA 3OEZA 4FSZA 4CFXA 3VW6A 1G8JA 4G6LA 1Y91A 1ZMVA 2FH9A 2C3JA 4GV1A 3SLSA 3GEQA 4ANLA 4ZOGA 2X2KA 3SXFA 5GZAA 3EQPA 1OGYA 5EQYA 3V5JA 5CT7A 2IVTA 2ZVAA 4ZP5A 3G15A 4BVUA 4O86A 4IWDA 3PSBA 4UMPA 4RIYB 2CDZA 1YHSA 2JGZA 1U46A 4L8MA 4D4RA 3DB6A 4MBJA 4AXEA 5BV3A 2OO8X 3HV4A 3R7UA 5HICA 3R8ZA 5BMSA 3R7GA 3FLYA 4EH4A 4W9WA 5KBQA 2GQSA 4AOTA 3F3UA 4YTFA 4I4FA 5CI7A 4FGRA 4ZSGA 5LMKC 4ZSLA 1TQPA 1XBAA 5DMZA 3PXFA 4V04A 4XNEA 3CJGA 3OXZA 2B9JA 4RLLA 1AQ1A 3P86A 3G51A 3UYTA 1M17A 3QZIA 4DHJA 2VTPA 4JAIA 4AWIA 3WF8A 4USEA 4DTAA 2PMIA 2IO6A 5IDNA 4AE6A 3KRXA 3UO6A 2IEWA 3GFEA 5I9YA 4AZWA 2I7QA 3QFVA 4DCAA 3TXOA 4GG5A 4C37A 4BWXA 3S00A 1DS5A 2XNPA 3L9PA 5IUHA 1P4OA 4L6QA 4YLLA 2C0IA 4RJ3A 3ZO1A 4XLIA 4X2GA 4IX6A 3PE1A 3F61A 1IA8A 2G2FA 4KSQA 2W05A 4GJ2A 5B7VA 4J53A 4OTIA 3C1XA 1MRUA 3VQHA 4A9YA 4RX9A 4HCUA 2VX0A 4H36A 4OGRA 4AZTA 4C3FA 5M4IA 2C6OA 5GZ9A 5K5NA 5ANKA 3ULIA 2JKOA 3C5UA 2W96B 2XUUA 3AC4A 3LXPA 1YDSE 5IQEA 3UODA 3WZJA 3DKCA 3NVMB 3ENMA 3IQ7A 1ND4A 1URWA 4HVHA 5IQDA 4Q5HA 4I6LA 4R1VA 4DDIA 5CNOA 5ANIA 2VWWA 3KMUA 5HTBA 3KMMA 5I3RA 1PXPA 3F2AA 4JVGA 4ZTSA 3T3VA 1FVVA 1Y8GA 2X0OA 3NUYA 4MCVA 4QTCA 4YHTA 4O7WA 1NW1A 4O21A 4ZMFA 4CZTA 2ONLA 2DWBA 3PA3A 1YHVA 3QKLA 4NW6A 4EQMA 5JZJA 3P1AA 5GJDA 3FLZA 3OCSA 3HV7A 3PY3A 5CF6A 1QPJA 2YM7A 2W1EA 4WG5A 4BB4A 2X2MA 4ZJJA 5JGDA 1J3HA 2HZNA 3IW5A 3KN6A 4H3QA 3EZRA 5DGZA 4M68A 4QQCA 3QC4A 2GS6A 4GFOA 3DAEA 4QMQA 3AMAA 5GNKA 2YHVA 3F5XA 1Q3DA 2O0UA 3O50A 3W32A 4TYJA 3MVHA 3CR0A 5J5SA 4M13A 3KXZA 3GB2A 5E8SA 3BQRA 3C0HA 3EFLA 3R7VA 4YO4A 3FXXA 5EI2A 5CYIA 4ASEA 5EDRA 5A6NA 3HL7A 4USDA 3VS3A 4EHVA 3LKMA 4RZWA 4D9UA 4E4XA 4IANA 3Q96A 1YI4A 2J5EA 4JDIA 5ANGA 3VN9A 3E8NA 3HV5A 2V7OA 5HVYA 3LMHA 4U44A 2AC5A 3BLAA 4LGGA 2PVYA 4CYIA 4CMTA 2EB3A 1LPUA 5EHYA 3F66A 1J1CA 3HX4A 3O7LD 5AUYA 5C8KA 4FSWA 4P5ZA 5JH6A 3LCDA 4F99A 2VTMA 5IF1A 3HECA 4M0ZA 3KL8A 3LIJA 5DT0A 3TZ7A 5CZIA 2YCFA 4FTAA 5KZIA 3R9OA 4C02A 3TUCA 2VRXA 3IONA 4I41A 4N4SA 2ZDUA 4G5JA 3L1SA 4KIOA 3WILA 3MH1A 5HU9A 2O63A 3IW6A 4BCGA 5ICPA 3C4FA 2PE1A 1WBNA 2Y6MA 3LFEA 5DRDA 5E90A 1GZ8A 5CXHA 3NIEA 4IWOA 4ZTQA 5A9UA 2PU8A 4BBEA 4PRJA 4JR3A 4MXZA 4XV2A 3JY9A 3PP1A 5EH0A 4A9TA 4I6BA 4MX9A 4WA9A 2HZ4A 2EXMA 3A61A 4NM5A 4ZEGA 2RF9A 2OSCA 2A19B 2WTVA 3ZFXA 1UKIA 1BLXA 3RINA 4LL0A 4S31A 4QDVA 2C5NA 3ZM9A 2NRYA 1WVYA 3VS2A 2GNFA 4TWCA 3W0PA 5E92A 4HVSA 3FKNA 4PV0A 3VWAA 3DU8A 1Y6AA 4FTKA 4FNXA 4Q2AA 3FQHA 4F6WA 3QXPA 3L8XA 3GCVA 4FIFA 4ZTNA 3P7BA 2JAVA 4EI4A 3MDYA 3NNWA 4L7FA 4FZFB 4TL0A 3U6IA 4EHGA 3KCKA 3LFCA 3DNEA 2WELA 5CU3A 5IMXA 2P55A 1UNHA 5A4QA 4MF1A 2GNHA 3DKGA 4CRLA 5J9LA 4O7VA 4PMTA 4K77A 3HDMA 4UMRA 3L9LA 3G5DA 4OTHA 3Q4CA 5F20A 5D41A 3PPKA 4E8AA 1NVRA 4FT7A 3F2RA 1MP8A 3DBEA 4JBVA 5BVEA 1JAMA 4NTSA 4RGJA 3UDBA 3KKVA 3FKLA 3B2TA 3QQUA 5K4JA 3F3VA 4JQ8A 2UZEA 4BC6A 2R4BA 2XIKA 2X0PA 5D1JA 1A9UA 5JN2A 2HWPA 2PZ5A 4G6OA 4QP2A 5HIBA 3ACJA 4PDPA 4R3CA 3TNQB 5HE0A 3FAAA 2VAGA 1G8SA 1YKRA 3FZPA 5LJJA 4M97A 5LARA 1WBPA 4FZDB 1CMKE 4FJVA 4WUNA 2V0DA 5FUTA 3QQKA 1ZYDA 2B9HA 3PXKA 3C13A 4BCHA 4RX5A 5FG8A 3MVMA 4FV3A 2WQBA 3TJDA 1BMKA 2YM4A 4NJ3A 4NW5A 3MN3A 2PMLX 4O4BB 4QMNA 1CM8A 1ZYLA 4RA4A 3TKUA 4AFEA 3ZRMA 4IB0A 5E8XA 4A06A 2W9ZB 5KZ0A 2LAVA 1J7UA 4C4EA 2J6MA 1UU9A 4ANQA 3FMJA 4E5AX 2PZRA 4PTCA 2W1DA 4PP7A 4AQCA 4WBBB 3BZ3A 2QNJA 2QOBA 4Q9ZA 4DH5A 4ZLYA 5AA9A 3BE9A 4O81A 1QCFA 4G3EA 4HNFA 4H3PA 5J9YA 3BV2A 4LMNA 5DNRA 1G8KA 4HGTA 4I5PA 1B6CB 3HA6A 3KIOC 3BHHA 2WMXA 4IAFA 4D2VA 4U43A 2XS0A 3MB6A 4UB7A 4ZTMA 1SVHA 4FIJA 4N6ZA 2HK5A 4ACMA 2EVAA 2YJSA 1OIYA 5L2WA 4KIQA 4B8MA 4YPSA 1XKKA 5AR7A 5IMEA 2WQNA 2ZM4A 3E3PA 3PWYA 5KMNA 1ERKA 2XNBA 2WGJA 3FPMA 3MIAA 4BDKA 3MJ1A 5A46A 4ZZNA 1WBSA 5J8IA 5J79A 3NVKI 3R7IA 2R3GA 1KOAA 4XV3A 4R5SA 5D12A 4FV1A 3EKKA 3NSZA 4BJJB 1Q41A 5KMOA 4U8ZA 3MA6A 4FKJA 4LV7A 2W7XA 3ZOSA 1G3NA 3K2LA 3FBVA 4HGEA 2W5HA 3R63A 4I5MA 2QOQA 4J98A 4XV9A 3BKBA 2GU8A 5HKMA 2IW9A 3CY3A 4BZNA 4CQEA 4I0RA 2XM8A 2WMQA 2X7GA 3GC7A 4KS8A 3W16A 4EOPA 1IEPA 3L8VA 3QTRA 5FXRA 4MQ1A 4X3FC 4IIRA 3UIUA 4JOAA 4ENYA 3V8TA 4ENXA 4DHZA 5M06A 3GU7A 2B1PA 3L9MA 3FHRA 1YWNA 5BUEA 3C4WA 4DEIA 2WOTA 3EKNA 2BRBA 5D9HA 5HE1A 5EQEA 4HPTE 5JFSA 4BCKA 3DNDA 2R5TA 4FVRA 2YIQA 3NGAA 1DAYA 3JUHA 2CJMA 2C6EA 3KF7A 3H3CA 2RFDA 1H24A 3QKKA 3VRYA 2G15A 3VAPA 2WTCA 3H9OA 3QUDA 3Q52A 4O0TA 4QEBA 4IM0A 3CPBA 1OL6A 4DG3E 3NPCA 4U3ZA 5CVFA 3RAHA 5CQUA 2Z7SA 4HGLA 1TQIA 5CSHA 3HUBA 4HYIA 2F2UA 2GS7A 1E1VA 4L3PA 4YTIA 3KRLA 4PL5A 3H4JA 1ZYCA 3KK8A 3MI9A 5HG9A 4CFMA 1ZMWA 3I7CA 4FT3A 4YZBA 3B2WA 4L68A 4DEBA 3QTIA 3FZTA 4UWYA 3A7IA 1R0EA 4MXOA 3PXYA 2A0CX 4BCJA 5IA3A 3E92A 4GS6A 2NO3A 2UVYA 2QR8A 2YN8A 3A62A 3DPKA 4XP0A 4L45A 2FSTX 3P4KA 3QRUA 4G9RA 3EFJA 3R2YA 5EOBA 4ANMA 3HAVA 4QTBA 4BWKA 5AV2A 3TKHA 5EI8A 4BDFA 4C58A 5HIEA 4X3FB 3VS5A 4EZ5A 4R77A 5G6VA 4DGGA 2IF8A 3O96A 4UYNA 3KMWA 4MXYA 1Q97A 2R3PA 3BQCA 1URCA 3BRBA 3NDMA 5ANJA 4FSNA 4MD9E 4EL9A 2O2UA 1JSVA 3AKLA 4BGQA 4EOOA 3AC5A 1PXKA 2J0MB 3NLBA 1VYWA 4U42A 2PPQA 4WSQA 4AT4A 2HZ0A 1Q8WA 4BZOA 1W2CA 4G3DA 5AP3A 4FOBA 3DXPA 1R78A 5AP7A 5HEZA 2ZM3A 3COKA 2HOGA 3KRJA 4FTJA 5D10A 3IW8A 4F6SA 2IJMA 4AACA 5IZFA 5EW9A 3EH9A 4M67A 4KIPA 3VHKA 4IB5A 3RP9A 4PTEA 5FM3A 5CF4A 3NMUF 5DR2A 3F69A 4EH7A 3EN7A 1W98A 1ZWSA 3OBJA 3FMNA 4S2ZA 4CFFA 4ZAUA 1JKSA 3TUDA 5HIDA 2J5FA 3QQLA 3QX4A 5FTQA 3PXRA 3F88A 4QYHA 5LVNA 4LRJA 2ZDTA 4FEVA 3Q32A 1YDTE 3KY2A 3QCQA 3EYHA 1KE6A 3PSCA 5FXSA 5DHJA 1XR1A 2R3IA 2HXLA 4Q9SA 2VO3A 3VS1A 5A4TA 4USFA 3NWWA 1PKGA 1O6LA 2DQ7X 4ZZMA 4HVIA 2CKEA 3ALNA 5BVNA 4APCA 4W4XA 5AJQA 4QYFA 1VZOA 3PLSA 4BHZA 4BFMA 3LFNA 4Y73A 4BICA 4FEWA 2XVDA 3AMBA 3SXSA 1KOBA 2EXEA 3SAYA 4EOIA 5FGKA 3HMMA 4RC4A 3OXTA 4TY1A 3WE4A 4D2RA 2QOFA 4FUXA 5ETCA 4G1WA 2C1AA 2Z7QA 4AZFA 5TT7A 4IZ5A 3QTWA 3R7YA 4I5CA 2B54A 5LVLA 4QP1A 3CS9A 3F6XA 3K3IA 5EM6A 4NYEA 4FL1A 4NM7A 1JKKA 4E20A 1Z9XA 3Q6UA 4IZAA 2ITOA 2PMOX 4FKTA 3PP0A 1OVEA 4NJDA 4QQJA 2XMYA 5LCKA 4AN9A 4DGOA 4MNEA 3ERKA 4KWPA 4YZCA 3U9CA 3R6XA 4WIHA 3IECA 4BBFA 2Q83A 4TPTA 3RZBA 2IG7A 4AT3A 2UZTA 4FIHA 4EYMA 3F3ZA 2YZLA 4FKOA 4C62A 2R2PA 1OB3A 2J0IA 3VF8A 3W8LA 5CF5A 4ZS4A 4MEDA 4PDYA 5JZNA 4OBOA 2NRUA 2WMSA 3DDQA 3EYGA 3EIDA 3FMMA 4IH8A 4YJTA 4RIWB 2IZSA 3RPYA 4GRBA 4Y46A 4XH6A 1YI6A 1BI7A 4GU9A 4CLJA 1OKZA 3A2CA 5EQPA 2HCKA 4LV8A 5F1ZA 4G3CA 3NR9A 2XALA 5H9BA 3V04A 3MY0A 4GIIA 3LJ2A 4G3GA 4B7TA 3CEKA 3PVGA 3NZ0A 2C3KA 3ANQA 3SOCA 1M2PA 5BVWA 2YM8A 3T9IA 4A9RA 4FNWA 4AS0A 1XH7A 4N70A 3IO7A 4DFLA 4EHEA 4EK8A 4CCUA 4WG3A 5KMIA 4KBKA 3SG9A 3ZRLA 2YA9A 2C0TA 2HIWA 2GPHA 3SXRA 3BX5A 4YJRA 4GK3A 2IZUA 4FA2A 5JFWA 4DT8A 1OKYA 4AXFA 3JVSA 3FXWA 4F1TA 3REPA 3PFYA 4JNWA 4ACGA 4QP6A 4BKYA 4BRXA 2C0OA 2PK9A 3DQWA 3HA8A 4ITHA 2WMTA 4BZDA 4QMMA 4RSSA 5HX6A 4CNHA 1SM2A 4DH7A 2BALA 4XG6A 2JKMA 4NM0A 4O22A 4R7BA 1GJOA 1WBVA 3GCQA 5AUVA 5L3AA 4P5QA 5LMAA 5FWKK 2DYLA 3BEGA 3KXNA 3NUUA 4HCTA 1W7HA 3ODZX 3UMWA 4IQ6A 5CEOA 3DLSA 3GI3A 3UVPA 3MPTA 5A4EA 5CAUA 3Q9ZA 1Q4LA 3FQEA 4I6QA 3ZS5A 3Q5ZA 3DGKA 3KVWA 1XBBA 5LOHA 3P08A 2BDJA 2YJRA 5JFXA 5M4UA 2X9EA 3CQEA 3OWPA 2OH4A 2BTSA 4BGGA 3SGCA 3QWJA 3Q60A 3QF9A 3VC4A 3KULB 2Y6OA 3JS2A 4N6YA 1LEZA 4BYJA 4KAOA 4EWQA 3AKKA 1NXKA 2ZJWA 3FZOA 4P4CA 4RLKA 4WRGA 3DXNA 4L43A 3R30A 4TWPA 3FPQA 2R9SA 2QHMA 3PXQA 4FSTA 4AXDA 2WMRA 4AOJA 1BX6A 1VYZA 4AW1A 4DGLC 3UVQA 4IB3A 3RWQA 3ZDIA 4JRVA 3GC8A 3OOGA 3ZBFA 4C3PA 3R00A 3V5PA 3W55A 1JWHA 2QO2A 3C4ZA 3E87A 4OW8A 3RI1A 4FKVA 3ITZA 4LMUA 5C8MA 4CTBA 2W17A 2OG8A 3C5IA 4I1ZA 2BAJA 4C4IA 3LCOA 5F9EA 3OTVA 3BL9A 3QGYA 4E4MA 3SW4A 4IHPA 4EQUA 4HYSA 3KXGA 3WIGA 3OCBA 5KNJA 2PE2A 2H8HA 4NKSA 4O2ZA 5A6OA 2H9VA 3AXWA 1WBWA 3CSVA 5TOZA 2WMVA 3FMKA 2PE0A 1YWVA 3QCXA 4FNZA 1GZNA 5HE2A 2H96A 3ID6C 2VNYA 5DI1A 2FB8A 3I60A 3NAXA 1BL6A 1JSUA 3BWFA 3W8QA 4C4FA 3PY0A 4ZXTA 3HAMA 4ANBA 2Y0AA 1WBTA 1O6KA 1ZOEA 2JBOA 2RFNA 3GQIA 3P5KA 4L42A 4FC0A 4OBQA 2WMBA 4FV2A 2PVFA 3VS6A 4DEGA 5GJGA 3GCUA 5HBJA 3QYWA 3LLAA 5JKGA 4BDBA 5HX8A 3TM0A 2A27A 5FQDC 5K9IA 3W2SA 2BAQA 4GT3A 4X6RA 3RK7A 1H08A 3P23A 2QC6A 4D58A 4O0UA 3KA0A 5L4QA 4GCJA 4QMVA 1SZMA 2A98A 3UIMA 4OR5A 3NYOA 1XJDA 2P0CA 5TO8A 2QLUA 4CFNA 4IVAA 4ID7A 3PLAE 3AG9A 1PXIA 5HE3A 4RJ4A 4O7NA 5L8JA 1RW8A 1ZYSA 1F0QA 5B2KA 2LGCA 4OBPA 4BCQA 3UOLA 2QHNA 5E8VA 3SV0A 4DEDA 3KRWA 1PW2A 3W2RA 1XH4A 5IEYA 4PDOA 1K2PA 1B38A 3F5UA 4ANOA 3IW7A 1U54A 2OI4X 4GU6A 4RJ5A 5KUPA 4LRKA 4I22A 4RIXA 2YM5A 2Y8OA 4S34A 4NUSA 5H3QA 4Z55A 3U87A 2JDVA 4M15A 4RFMA 4C0TA 5AUTA 1RDQE 4YBKA 2WU7A 2OWBA 3A7GA 3Q2MA 5DH3A 4O7ZA 3TNHA 5DEWA 3TJCA 3ZLYA 5JRSA 1XH6A 3R8LA 4BTFA 3G0EA 3C4CA 3I81A 4EC8A 5CASA 3UG2A 3FSFA 3RCDA 3RNIA 3H10A 4EUUA 2OLCA 5ITAA 3TL8A 4AQKA 2JIUA 3IDBA 4IAYA 3BIZA 4I23A 3OY3A 4EOQA 4ALUA 5L8LA 4Y72A 3QLFA 4C2VA 3UNKA 2YABA 4GG7A 1JNKA 3R28A 3UZPA 5BVDA 4D55A 2W1GA 5CSWA 2IZTA 4JL9A 2BKZA 4J8MA 4FKGA 2CPKE 5H8BA 3LHJA 1YRPA 4BDGA 5K4IA 3JR1A 5C8NA 4CQGA 2XNEA 3ZRKA 4ZSEA 4MHAA 5HLWA 2VTQA 5GINE 1ZZ2A 3COHA 2QOCA 4XP3A 1JVPP 2BZJA 4IX3A 2R64A 4A9SA 4DG2E 3CGOA 1B39A 3QU0A 2OW3A 4QOXA 3NUAA 1YVJA 1FQ1B 1FVTA 3V01A 4QTEA 2QOHA 2F49A 2BDWA 5EYCA 5C4KA 3EFKA 4P7EA 2XK8A 3MY5A 3OWJA 4K2RA 4ZY5A 4DH8A 4AT5A 4DTKA 4FV9A 4ZLZA 4YHJA 1UWHA 3MS9A 3BGZA 2WNTA 4QMYA 5E7RA 4M8TA 4FL2A 4RZVA 2W1CA 3V6RA 4AX8A 2NNWB 4IVDA 3FWQA 2YLEA 3E7OA 4OT5A 3CC6A 3R83A 4O91A 4AXAA 4UXLA 3OROA 2YFXA 4YZNA 2YCSA 4DFUA 4EOMA 3O17A 3DAJA 1PXMA 5HBHA 4BTJA 4AW5A 2ZOQA 4HYUA 5IH5A 1OL2A 4JX3A 5IU2A 3ZMMA 2HW7A 2V55A 1YXUA 4DITA 4XUFA 3MFUA 2UW8A 1KV2A 2X9FA 1OUKA 3QA8A 4AZVA 3ZUUA 3GOPA 3MPMA 4QP7A 3R7OA 3V51A 2XNOA 1ZY4A 3E64A 3TN8A 2Q0NA 3QX2A 3KQ7A 2ETKA 3ORLA 4JG8A 3RNYA 2RGPA 2I6LA 2B4SB 2XCHA 3BU3A 3DCVA 1S9IA 1W2DA 1CDKA 4V0GB 4WHZA 3WOWA 4QP3A 2O64A 2ZB1A 4EJ7A 4KA3A 4KSPA 5HO8A 3BHYA 4KB8A 2RFSA 4F9BA 2QOIA 3LAUA 3ZU7A 4MXXA 4CKJA 4JG6A 2ZMDA 4GVAA 4YSMA 4WD5A 5HG5A 5M57A 4IACA 5HHWA 3LFSA 1XMMA 2XARA 4HW7A 4F1OA 2E9NA 2XK6A 2BIKB 2XIZA 3H0YA 4GUEA 4QMWA 5HQ0A 3O5AA 2OGVA 1BKXA 3CP9A 2OBJA 4MXAA 4E6DA 4F7LA 3ALOA 5BYZA 3RCJA 2VTTA 5AR5A 2HW6A 3VF9A 3I0QA 3R8VA 4GMYA 4U80A 1G8AA 2UZLA 3PUPA 5AUWA 4RWLA 2YAAA 2XJ1A 1PYEA 2HXQA 3I4BA 2E9OA 4Q5EA 3ZFMA 4IX5A