2ZMDA

Crystal structure of human mps1 catalytic domain t686a mutant in complex with sp600125 inhibitor
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
280
structure length
259
Chain Sequence
ECISVKGRIYSILKQIGSGGSSKVFQVLNEKKQIYAIKYVNLEEADNQTLDSYRNEIAYLNKLQQHSDKIIRLYDYEITDQYIYMVMECGNIDLNSWLKKKKSIDPWERKSYWKNMLEAVHTIHQHGIVHSDLKPANFLIVDGMLKLIDFGIANQMDSQVGAVNYMPPEAIKDMISPKSDVWSLGCILYYMTYGKTPFQQIINQISKLHAIIDPNHEIEFPDIPEKDLQDVLKCCLKRDPKQRISIPELLAHPYVQIQT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Dual specificity protein kinase TTK
publication title Crystal structure of the catalytic domain of the mitotic checkpoint kinase Mps1 in complex with SP600125.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 71
structure length 259
sequence length 280
ec nomenclature ec 2.7.12.1: Dual-specificity kinase.
pdb deposition date 2008-04-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2zmdA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2zmdA01
3A4PA 1RDQE 3FYKX 4FSTA 1QL6A 3MESA 3DQWA 1ZYDA 4WNMA 3WF9A 4W9XA 5A4TA 4YC8A 4QQCA 5EW9A 4TYHA 4CFVA 1JSVA 2UW9A 2ZOQA 5EKOA 5EK7A 4B0GA 1VYZA 4DTAA 3H9RA 3PA3A 4JLCA 3EYGA 5D12A 3UVPA 4LL0A 3ULZA 2NNWB 4YSJA 5AX3A 3D94A 3QD4A 3UODA 2P3GX 2QOOA 5KHWA 1H1SA 4P2KA 5E90A 2R2PA 4HCTA 4YHJA 4BYIA 4E5WA 4USEA 3TG1A 3QAME 4MXYA 3NW7A 4X21A 3MPAA 3IDBA 3QD3A 3GB2A 4XV9A 3KEXA 2GS6A 3BE2A 2X0GA 3JUHA 5EW8A 3TKIA 4C3FA 5IA2A 5HX6A 3O8TA 4U9AA 4QRCA 4GJ2A 4HYUA 2OXYA 4DGGA 3V5JA 4QQTA 4ZZMA 4MXCA 3IW5A 5IEXA 3LXLA 4ZLYA 5DR2A 3L9PA 3FKNA 3BBWA 5HIDA 5K4JA 4FKQA 3TV6A 1JKLA 2F57A 2CNQA 3NUAA 5HU3A 5GZ8A 5C8MA 5CALA 3VRYA 3TM0A 5AJQA 4QMMA 4FGBA 1M17A 1WAKA 4IAIA 5DH3A 3UO5A 1Z5MA 1XWSA 3SXRA 3VUTA 2WMTA 3SGCA 3DA6A 4DYMA 3D5UA 3I0QA 2JGZA 4MX9A 5I9ZA 1NY3A 3V04A 2C5NA 2CKEA 3AGLA 3DZQA 5JFXA 5AV3A 1V0BA 5EYDA 4O7WA 3QXPA 2BAJA 3BPRA 1OKVA 2X8EA 2VWUA 3Q5ZA 4EC8A 2UZLA 5EI6A 1OM1A 2JIUA 2RFSA 2W9FB 2YLEA 4JIKA 4DAWA 5IA1A 2YZLA 4BR3A 3Q53A 1YW2A 4YJSA 4AZEA 3RWPA 3MFUA 5HTIA 1ZYJA 3O7LB 2J90A 3I4BA 2XJ0A 2HYYA 4MQ1A 4K11A 3KVXA 4JRVA 1W84A 3VJNA 3HVCA 3I81A 5TO8A 3C5IA 3H0ZA 4UWYA 4IE9A 1Q41A 3QLFA 4DE4A 4GYGA 4RC2A 3PVUA 2BFYA 2QOLA 4TZRA 4O22A 1OKWA 3NNVA 1OI9A 3Q9ZA 4HCVA 5CF5A 2GS7A 2VU3A 1OGUA 4BL1A 4L44A 3PZEA 3TUBA 3ORLA 4V01A 1PXNA 3IPHA 1DI9A 2P55A 4G3FA 3ZLSA 2PVHA 2JD5A 4O0RA 2GU8A 4FT5A 1ZXEA 2W4KA 3EFJA 3NEWA 4L00A 3OWLA 3GCPA 3FV8A 3IW7A 3KCKA 1E1VA 5AUTA 5AFVA 2J2IB 3RCJA 3VHEA 1Q8WA 5IQGA 4R5SA 3SG8A 2PHKA 2E9OA 4XJ0A 3WI6A 5KMOA 5LWMA 5FEDA 3Q3BA 2WMWA 5AUWA 3W2PA 2W99B 3FL5A 4U43A 3VW6A 3ZRLA 5DRBA 4KD1A 3GNIB 4PPAA 4AW0A 4DINA 2I6LA 4ZZOA 5K5XA 3D7TB 2C5VA 3OZ6A 3QX2A 4ZOGA 3IW4A 1H1RA 2C68A 4LMNA 3WE8A 3R1SA 4IADA 1MUOA 4TNBA 5CEOA 3OY1A 4AA4A 2J0LA 3BHUA 3ACKA 3E7VA 4EZ3A 1JVPP 1MRVA 1JPAA 2BDFA 4XOYA 5LQFA 4FV1A 4YJVA 4B4LA 3D5XA 5CI7A 2FO0A 3UZPA 2P4IA 5JFVA 5L2IA 1BKXA 2LGCA 1GY3A 2E9NA 2Z7LA 3O2MA 4D9TA 2BZHB 3MVLA 4O7YA 3EJ1A 3UC3A 3DKCA 4ZIMA 5T68A 3FSFA 4OBPA 5LVOA 1UNHA 2X7FA 3KMWA 4CTBA 4M97A 2FB8A 3CR0A 4U97A 2WIPA 4HJOA 1OL7A 3CQEA 2ETRA 2W1CA 3CEKA 5FEEA 3N51A 4RC4A 1GAGA 4YHFA 2VTRA 4MQ2A 1JKTA 4U6RA 3UVQA 3F2NA 3DB8A 1CMKE 1SNXA 4AG8A 5EQPA 1J91A 1FGIA 3OP5A 1LEWA 3BBTB 4BCNA 3U51A 4QP2A 4DT8A 4FNYA 4O0UA 2R0UA 2W7XA 2W5BA 1OECA 2YABA 3RVGA 4LRKA 3E64A 3DTCA 4PTEA 4AAAA 4C4FA 4NWMA 3VS3A 4O7VA 2R3FA 4PTGA 2I0YA 2ITOA 3C0IA 2VTJA 4F4PA 4F9AA 5M44A 4CSVA 5IQAA 3AD4A 3TZ9A 2XJ2A 5CSVA 4FTAA 4Y46A 5BX0A 3RPYA 2Y7JA 3MIAA 3R01A 3MBLA 4HGTA 5IH5A 4EOMA 4WNKA 2JDSA 3UVRA 2BRNA 4IACA 3QZHA 2QOBA 4JQ8A 3NMUF 3KRWA 5FDXA 2VWYA 3G51A 3ZCLA 5AIKA 4RIXA 4X3JA 5D11A 3EH9A 4XV2A 2J4ZA 3VAPA 4C0TA 3I7CA 3ZM9A 3C5UA 4M12A 1M7NA 1Q8YA 4MKCA 3VBXA 4EK5A 2ONLA 4C4JA 3GU8A 3WF7A 2WKMA 4I23A 2WQNA 5CEKA 4X2JA 4K2RA 3FMHA 4ITHA 1YI4A 2ZV2A 5DYJA 3CXWA 3AG9A 2XS0A 3E3PA 3H9OA 1PKGA 1YHSA 3LQ8A 4GCJA 4MF0A 1DI8A 3G5DA 3ORZA 4YJRA 5J5TA 3R1QA 4FSRA 2XUUA 4R5YA 4DN5A 4F70A 2ITNA 3OS3A 1YHWA 4DBXA 2OBJA 1OUKA 2GNJA 3FXXA 4IEBA 3ORTA 2VO7A 3KF4A 3DJ5A 2C6LA 2QNJA 5B2LA 3W2SA 2B54A 2ITXA 5C03A 3F61A 4B8LA 2OJGA 4IZ5A 3R7VA 2JEDA 5FGKA 5M57A 2QI8A 4USDA 5AR4A 3RCDA 3S2PA 3CIKA 3ODYX 5HE1A 2QO2A 4GV1A 4WUAA 4DTKA 5GJGA 3LMHA 2BCJA 5I4NA 4FK3A 3WF5A 2X7OA 4OGRA 2PVYA 1LP4A 5DRDA 4H58A 4BYJA 3LXPA 5HBHA 2VTOA 3W2QA 3R02A 4QP7A 3TEIA 5D7AA 3R9OA 3W55A 1U46A 2PE1A 4JG6A 3GUBA 1V1KA 4JBQA 5HTBA 4EZ5A 5KZIA 2YDIA 4DH8A 5I9YA 4WRSA 2O64A 4QMYA 3GU6A 4FSZA 2EXMA 2JFLA 4DEIA 3JR1A 1M2PA 4NFMA 2C6OA 4RWIA 2PK9A 2O0UA 4IANA 2XIZA 5CEIA 2XK3A 2HCKA 4YC3A 1O6KA 1WMKA 4ZSLA 2WTIA 2XNMA 3V6SA 3VBWA 4C4GA 1BL6A 2HENA 4LI5A 4X2FA 1Z9XA 2BRBA 2XKFA 1YVJA 3OVVA 5HG7A 4JAIA 4S34A 5KMMA 2A4LA 2XEYA 4GRBA 5AP3A 3UOJA 2XP2A 1Y8GA 1L3RE 4UBAA 4U80A 3ZZWA 5DMZA 5M4UA 2HOGA 3OBJA 5E8VA 4UV0A 5FXRA 3PJCA 3QTZA 3LAUA 3S0OA 1HCKA 4EHVA 3RBWA 2F2UA 3G9LX 3ITZA 4H3PA 3HA6A 1GIHA 2PE2A 4FUXA 2JLDA 2OU7A 4U0IA 4AOTA 3C0GA 4WSQA 2B7AA 4U8ZA 4QTCA 4RC3A 4FZ7A 4A4LA 3M2WA 4FODA 4FT7A 5HCZA 4C35A 4FTTA 3B2TA 5CU3A 2V5QA 3G6GA 4EUUA 4USFA 2WTKB 3GEQA 3NZ0A 1YI6A 4PPCA 1OITA 2PMNX 3R8PA 4HGSA 4GUEA 1ND4A 2QOFA 5T6KA 4FZFB 5HO8A 2WQMA 3FDNA 1OIQA 4EEVA 4RFZA 2O3PA 5JQ8A 5IEYA 5JGAA 3Q6UA 4AWIA 4IX5A 1OPLA 2WTWA 1SVHA 4BTKA 2UW7A 2WHBA 5A3XA 2IZUA 3D15A 1G5SA 5GINE 4IWDA 3UQFA 3RPRA 4EH3A 3OXZA 4DH1A 4MWIA 1JNKA 2W1ZA 3QQLA 4NM5A 3SOAA 5EYCA 2XK6A 4MK0A 3RALA 1J7UA 3TCPA 2C5OA 5FP5A 2FSMX 3QRUA 3KRJA 4KAOA 4TW9A 2VO3A 3IO7A 4G16A 3Q52A 1P14A 2CPKE 2X4ZA 4TYIA 4WHZA 3EFKA 2OF2A 1FOTA 2R7BA 2X6DA 4FKGA 2BMCA 2GNIA 2WTKC 5CX9A 5FM3A 4AA0A 5EYMA 1VYWA 3E8NA 5LMAA 2FSTX 3QTWA 3TNWA 3WZUA 3FY0A 4J8MA 4NU1A 2QC6A 4FIHA 4JDHA 4FSUA 3U8WA 5AUXA 5BVFA 3HRCA 3UO6A 3ROCA 3NUPA 2R3KA 4NKAA 3U4UA 3O23A 1I09A 3F3WA 2ZVAA 5HE0A 4BBMA 3LKMA 5DGZA 5K0KA 4ACMA 4AT4A 3MTFA 4MVFA 4EBVA 4AT3A 4EHGA 4CYIA 2F9GA 3KK9A 2XK7A 5DR9A 4I5CA 2E9VA 3FJQE 3K54A 4IB1A 4OBOA 4ZY4A 4FEUA 1YXXA 3PLAE 3EN5A 2C6IA 2G2IA 1KV2A 1R0PA 2I0EA 1R0EA 4MBJA 4NTTA 4AZFA 3PIXA 3R21A 1KV1A 4FV8A 3RJCA 3O71A 5CAVA 5HD7A 2C0TA 4I94A 3MVMA 5M06A 3DK7A 4EH2A 2BRHA 1JBPE 1REKA 4N6ZA 1TQMA 2VWWA 3DAEA 3QUEA 2V22A 1UVRA 3KL8A 4FTLA 2YWVA 2BUJA 3KCFA 1M2QA 2XBJA 3V8TA 3AMAA 3PZHA 3DXPA 2B9IA 5DG5A 3VUHA 2XNOA 2Y4IB 4E8AA 1NVRA 3V5PA 3P5KA 3E92A 3B8QA 3SOCA 3TZ7A 4O0XA 3UP7A 3NLBA 5IEVA 3SXSA 5J87A 3QQUA 3L1SA 3OT8A 4P7EA 2Z8CA 3BCEA 4EWQA 5EQYA 3GU4A 2P0CA 3NYOA 4AZSA 2ZV8A 4BCJA 4CG8A 2UVYA 4DFUA 4ALUA 3LFCA 4FSNA 4OTDA 5BYYA 3GC0A 4D5KA 5BUJA 5EH0A 4D28A 4F1TA 4X6RA 5BUIA 3VS4A 5FDPA 1UU9A 3QWKA 4C58A 1PXKA 2QU5A 4HYIA 4DFLA 5DPVA 4BI0A 1PXPA 3OBGA 4DF3A 3MA6A 3EN4A 4E5BA 4ACDA 3ETAA 3QLGA 4DLJA 3BGQA 1ZZLA 1Y57A 3PPKA 1ZYSA 4EOQA 2Y4IC 3UDBA 2HZ0A 3CY3A 5LWNA 3DJ6A 4F7SA 4IQ6A 5A4QA 3EKKA 4C57A 4A06A 4RJ4A 4S33A 3KRRA 4ZXTA 2OH0E 2XIXA 2ZM3A 4U42A 4W4WA 4Y73A 5CAUA 5JFSA 2YACA 3FI3A 3E93A 3EQGA 3MY1A 2J9MA 2R64A 3KC3A 4BDHA 5IQBA 4FNXA 3A7HA 2E2BA 1R1WA 1NA7A 4ZTNA 2W1HA 3TDWA 5CVHA 3ZO2A 5DN3A 5FUTA 2W06A 2WAJA 3NUXA 3R8ZA 4AACA 2ITZA 4RJ3A 2I40A 5C1QB 3R8LA 3QRKA 3OCBA 3MA3A 4K9YA 3F3TA 3A7FA 5IZFA 4JQ7A 5CWZA 3SD0A 3NUYA 2XK8A 4J8NA 4B7TA 4GU6A 4C2WA 4NW5A 4QP6A 1PYEA 1Q97A 4OTPA 3ZC6A 4F64A 2BZJA 2Y0AA 3DAKA 3OTVA 2Y4PA 3F5GA 5K0XA 5LVPA 1J1BA 4RFYA 4D55A 4AGWA 1Q61A 2GFSA 2JITA 2X8DA 3HMOA 4LUEA 4F1MA 4E6QA 3QQFA 3ZO4A 3POZA 5CXHA 1URWA 2P2HA 3AC5A 2IVUA 4XG3A 3W16A 3NIEA 3NCGA 1ZWSA 4BKYA 4FTMA 2OF4A 3V5LA 3BYMA 4FTNA 5L2WA 3FMMA 4CTCA 4Q5HA 4I6HA 5B2KA 3PY3A 3P4KA 1P4OA 2B52A 2G2HA 3SKCA 3CCNA 4RLLA 3TN8A 4MD8E 3R9NA 5LXMA 3ZDIA 4CZUA 4K33A 2UZEA 4PUZA 4ZK5A 5BVDA 1ZOGA 3CQWA 4I0TA 4IWOA 3OEZA 3VQHA 3RHKA 3DKFA 5AADA 4DEBA 4R3RA 3G9NA 3B2WA 5FP6A 5BVOA 3AOXA 4IFGA 1Y6AA 4MHAA 3AD5A 4A07A 1XH4A 2ZB0A 3ORXA 5HNGA 2B9JA 4DITA 4TWPA 2RFDA 3SRVB 4O0YA 1WBPA 3DTWA 4ACCA 2YIXA 4ANSA 4ZJVA 3V01A 4QP4A 5HE2A 3HNGA 1XBBA 4A7CA 2VWIA 3MPMA 2REIA 3QBNA 4RIYB 5AA8A 2UW5A 3SW7A 4Y5QA 2AC3A 4RX5A 2OZOA 3KXMA 3D2IA 3KRLA 4UXLA 3F88A 3C4FA 4II5A 4ASDA 5JGBA 1J3HA 3CTQA 4DCEA 3V5TA 2DS1A 1FMKA 3DBDA 3EQIA 3ZUVA 2NRYA 2W17A 2JFMA 4MH7A 1STCE 3Q4CA 1W7HA 4L45A 3DKOA 1XR1A 4Q9ZA 3P9JA 5AP1A 3U6IA 4EOKA 2WQBA 5M4FA 3TNPC 4ALVA 3OWKA 4DG2E 4KIKB 3K2LA 3H4JA 4E93A 2JDRA 1CTPE 4MAOA 4OTIA 1Q3DA 2F7XE 5CAQA 3U54A 5IQIA 1HOWA 3DZOA 2PVLA 3ZYAA 4AE6A 3QA8A 4CZYB 3OC1A 4EH4A 3FY2A 3PDTA 4CV9A 4O7LA 5IA5A 4QO9A 2VTHA 3BHYA 4QMSA 4XYFA 1FGKA 3GXLA 3ZFYA 4QP1A 5GNKA 4ZTMA 3MI9A 2O63A 3LFQA 4IZ7A 5AUZA 4DLIA 3QHWA 4ANOA 5KX8A 3SX9A 3UYSA 2ITWA 3FQEA 4IWQA 3SHEA 3LCOA 3V8WA 3E8CA 4FYOA 3G90X 3MN3A 4JNWA 4UMPA 4GH2A 4F9BA 3DNDA 2NP8A 5J95A 2C6KA 4KWPA 5ICPA 4DFNA 1XH8A 2VTQA 3CKWA 2QVSE 3EOCA 4QQ5A 2V0DA 3HMIA 2QLQA 2YFXA 4J98A 4EH5A 2C3IB 5F94A 3D7TA 3IECA 3RM6A 2IVSA 1Q99A 5EHLA 3BV3A 1XH5A 3VS7A 4BN1A 3R0TA 3OY3A 3AGMA 2A19B 3R2YA 4XG4A 4Z3VA 4YP8A 4HZRA 5BVEA 3N4TA 5AP0A 3EQPA 4YJNA 3EB0A 3QQKA 3F5UA 3HP5A 1H1WA 4FBXA 4I4EA 3UPXA 4CLJA 4BCQA 3BWFA 4ZJJA 4J1RA 2HWPA 5CNOA 3HGKA 2C6TA 4FEVA 4G1WA 1W82A 4G6OA 3BHTA 2JDVA 3IG7A 4AT5A 5KMLA 4O91A 3PXYA 4YLJA 4YJTA 4C7TA 4RVKA 3DQXA 4ZSEA 3P78A 5JN2A 3ORNA 2OFVA 2XIYA 3OD6X 4FV6A 3OF0A 4BHZA 1UWHA 2HY0A 3LJ2A 4W8DA 4ERWA 5KHXA 2PU8A 4DA5A 3QFVA 2O65A 1WBSA 2WU7A 2PUIA 2O5KA 4BTMA 4L46A 4RX9A 2G9XA 2UW8A 5E91A 3M1SA 3WIKA 3NVMB 3FBVA 3IQ7A 5AIRA 4HVDA 3E7OA 3AT4A 4L3JA 3NIZA 4CFWA 3LQ5A 3BLRA 4J95A 3VS0A 3VVHA 5H8BA 3H30A 3R00A 3DJ7A 4K1BA 4I92A 4C4HA 5HHWA 4RA5A 5DT0A 5HG5A 3ZO1A 2PZYA 3DGKA 2VGPA 1PXOA 3LXKA 5E8YA 2J0KA 4HOKA 4FIGA 3EHAA 1H1PA 2CN8A 4X0MA 5CF8A 5JZJA 3HV7A 2GTMA 3ZS5A 3GCUA 3UIUA 4PDOA 4ZY5A 4GIIA 4MXZA 4FKJA 4U41A 4O82A 3FE3A 4CRSA 1M14A 2YERA 3DCVA 5DT4A 1FVTA 5CSHA 3WF6A 4HVGA 5J1VA 4B99A 2W1EA 3I0OA 3OG7A 4NJDA 3RAHA 2Q0NA 4E1ZA 5I3OA 3THBA 2ZM4A 1HCLA 3LFAA 3CS9A 4FA2A 4O7RA 1YXTA 4X3FB 4FTQA 4U3YA 2YZAA 4UWBA 2YEXA 3BHHA 5C8KA 3IK3A 5C8NA 1BUHA 4JR7A 5L6WL 4RQVA 3VO3A 2JBOA 3KXNA 3VS6A 1J1CA 4D1SA 5HLPA 1U59A 4M3QA 4IDTA 4BDFA 3TZ8A 4R77A 3Q04A 2VTTA 4G3DA 4RSSA 4FK6A 2YDJA 3DT1A 2C4GA 2UV2A 5ANDA 4EHEA 4FT9A 3F9NA 2R5TA 1Y6BA 3C1XA 5HESA 2RSVA 4NJ3A 3D83A 4O0VA 5KUPA 3FLQA 2WEIA 4PWNA 4G31A 3IKAA 3Q4ZA 4YPDA 3G15A 3QWJA 3EQRA 3M11A 3REPA 3VWAA 2C3LA 4UY9A 4YSMA 3P86A 2CCHA 4Z7GA 4YUQA 4U7ZA 4CKJA 2YIQA 2YCSA 2G01A 5E1EA 3S4QA 3WZEA 4ZZNA 5KBRA 2VX1A 4PL4A 4V0GB 4X3FC 3RAWA 2QO7A 4EK3A 2C3KA 4UZDA 4XH6A 2X9FA 2FYSA 1GOLA 1SNUA 4FL3A 4BIEA 3C50A 4HCUA 2W4OA 3CC6A 4G9CA 4A9UA 2FGIA 3PXRA 3COKA 3NDMA 3Q60A 4TN6A 3LQ3A 4YC6A 4E6DA 5L2SA 1SVGA 4U44A 2JAMA 4WA9A 4ANNA 3W1FA 1SYKA 3NRMA 4EH7A 3KXHA 5AM6A 3GENA 3VBYA 1BX6A 2ZJWA 2C6MA 1VJYA 1CM8A 3FKOA 3MJ2A 4OBQA 1UA2A 2BTRA 1JAMA 2RFEA 2VO6A 3HX4A 4IB3A 4IWPA 1UV5A 1BYGA 4ERKA 3UMXA 2BRMA 3R9DA 3RHXA 3F69A 2WTVA 5IH4A 3LFBA 3ZLYA 3EZVA 2IN6A 3UGCA 3HV5A 4O81A 3FMDA 4UYNA 2YIYA 1PMEA 2WELA 2BALA 5BYZA 4BDIA 4YZCA 3VS2A 3FXWA 4F9WA 4DGNA 4L53A 1H24A 4LG4A 4EZ7A 2QR8A 4DG0E 3OCSA 1S9IA 2GNFA 2PMOX 4LOQA 4DBNA 1E9HA 3QZGA 3QQJA 1H01A 2ERKA 3I5ZA 4AU8A 4EOLA 3K3JA 5DFPA 2I0VA 3E87A 3PY0A 1JKKA 4RVTA 3ORMA 2YJSA 3KXZA 5J9YA 3JS2A 3FPMA 3A7GA 1KOBA 5DI1A 4YZNA 4E26A 4JR3A 4QMPA 4AX8A 5M51A 4BDAA 1MQBA 2BVAA 5DR6A 3BWJA 3MYGA 4YLKA 1H1QA 3KU2A 4JI9A 3UNZA 2W5AA 1H28A 1F5QA 4Q5EA 4BZNA 4FGRA 3RK5A 1V0OA 4FICA 1JKSA 2RKUA 3QF9A 3NYXA 4D4VA 5LJJA 1M52A 3WZKA 3GCSA 3MS9A 3RMFA 3DK3A 4I5PA 1ZMWA 3K5VA 2W05A 3E8DA 4IAZA 4C8BA 3BYOA 1MRUA 4G5JA 4M15A 2PZRA 2Z7RA 4PMPA 1W98A 5D10A 4CFFA 3FHIA 4FX3A 5IQDA 2BTSA 3C9WA 3AC2A 1YWNA 3OOMA 4IAYA 4AGCA 1GZKA 3NVKI 4F65A 2WMUA 4RX8A 1LEZA 2XF0A 4QYFA 1IRKA 3F5PA 4AN2A 4F6SA 4KIPA 3NWWA 5G1XA 2BHEA 3QD0A 4XBUA 3BYSA 3QRIA 4MBIA 3ZSHA 4EOPA 4LRMA 2QKRA 5JEBA 1KUTA 5LVMA 1CKJA 5G6VA 4GK2A 2C6EA 1OBDA 3UC4A 1ZY5A 4CGAA 3CGFA 4FSYA 3DY7A 1MRYA 4U5JA 1U5RA 3UE4A 2W96B 5AX9A 2IG7A 4UZHA 2VTPA 2OJ9A 3QHRA 3P7BA 3UJGA 1G3NA 2EWAA 5HLWA 3FMEA 3AQVA 5AR5A 1CSNA 2C3JA 1YI3A 5HTCA 5TT7A 1KWPA 3Q2JA 1QPJA 5DEWA 4TT7A 4A9RA 2Z02A 5HZNA 4M0ZA 3WE4A 1U54B 4D0XA 5K4IA 3CBLA 1KOAA 4BZOA 2B53A 2WMQA 4AZVA 1KE5A 3H3CA 4UWCA 4QMQA 4H1MA 4W9WA 4DC2A 3JXWA 3NUUA 3QUPA 4EHZA 3ZFMA 4A4XA 5CZHA 2XCKA 3G33A 4NIFB 4M66A 4QMWA 1X8BA 4WKQA 4JJRA 4BCKA 5L8KA 5BYLA 2YN8A 4FSQA 5GJFA 4IAFA 1FPUA 4CRLA 2YCFA 4H36A 4FL1A 5J79A 4KNBA 3MWUA 4D2VA 4S32A 4D0WA 2V55A 1LUFA 3VNTA 3G6HA 3R8UA 2EB3A 1PF8A 2R7IA 3O7LD 1UU3A 1PYXA 5F9EA 3QTSA 2OXDA 2RL5A 3L9LA 2EXCX 1YXVA 4AP7A 1DS5A 1UU8A 3FMNA 4RZVA 1ZZ2A 5H2UA 3WBLA 4CZTA 3R7GA 4A9SA 2QOQA 2F4JA 3GOKA 3WOWA 4QP8A 4K6ZA 4OT6A 3ZRKA 5IPJA 2R4BA 4DFXE 2VO0A 3E3BX 2H9VA 4QMOA 4R3CA 3FSKA 4HNIA 2HAKA 4IVCA 3ZLWA 3VN9A 1A9UA 1H4LA 2FSOX 2R3HA 3TJCA 4ALWA 1UU7A 4UX9A 2QG7A 4ZJIA 1WVYA 2ZV9A 1PMNA 4PP9A 2CKPA 3HAVA 3ZONA 1GZNA 3LM0A 2PSQA 2B9FA 5TR6A 4U40A 5CLPA 4IJ9A 4F99A 3IGOA 4OAUC 4O1OA 4QPMA 5JGDA 1M7QA 3SXFA 2IZSA 4Y83A 4FI1A 5DBXA 3RAIA 2XH5A 1FVRA 4EYMA 2PVJA 4GFGA 2FSLX 4WG3A 4RPVA 5EM8A 2WMAA 3PSCA 2W4JA 1XBCA 5T3QA 3QQHA 3FMLA 4ITJA 2R3GA 4DGLC 5C9CA 3SDJA 2J7TA 3EFLA 4YURA 3PYYA 1YKRA 3MH2A 4LOOA 5F4NA 4IC8A 5HICA 4BRXA 4FV5A 1FQ1B 3PP1A 3MB7A 4FTCA 4ASZA 3QTQA 4H3BA 5LMKC 1QPEA 4HZSA 1P2AA 2A27A 2O8YA 2UZNA 1AGWA 3UOHA 3E62A 3AC8A 4ZSAA 4LYNA 1WBOA 2VTLA 4TWCA 3U87A 2WTJA 4LV5A 2EB2A 4I22A 4WD5A 4E20A 2JIIA 4CG9A 3PE2A 3EWHA 4DEHA 5LCJA 3CJFA 3D4QA 5J8IA 4XP0A 2GNHA 2QU6A 2XCHA 4QTBA 5CU0A 4MXAA 2JAVA 5CI6A 4IW0A 3PG1A 2XNGA 3FEGA 2OSCA 1OL5A 2RG6A 2ZYBA 3CKXA 4X7QA 2QONA 4XG9A 3AD6A 3RAKA 2C0OA 3L8SA 4XX9A 4S2ZA 3GI3A 1TQPA 3F7ZA 2C30A 3PLSA 5ETIA 4FKRA 5HO7A 5LVNA 1YHVA 3BEGA 5ETCA 5ANOA 2GQGA 4D2RA 3K5UA 5ANJA 2J6MA 1O6LA 2JIVA 4IAKA 3LMIA 4OTHA 4DEGA 4DGMA 1Q62A 2W1DA 2EUFB 4JAJA 4M13A 5JRQA 2J0JA 2GS2A 1UKIA 2Y6OA 3RK9A 5IDPA 5EI8A 4RJ6A 5BMSA 5K9IA 3LFSA 4OTQA 2R3PA 5AR2A 5E8SA 4DEAA 3IONA 4UMUA 3COIA 3TV4A 4F7NA 5A6NA 1ZOEA 3FMJA 5FTOA 3QXOA 3C4EA 3K3IA 4MNEB 4YJQA 1OPKA 2VGOA 3KXGA 3LHJA 3IW6A 4DFBA 3OHTA 3H9FA 5HVYA 5GZ9A 3GFEA 3C4XA 3OW4A 4UN0C 2JKOA 3HECA 3TV7A 4FZ6A 3RNIA 3NAYA 3MFTA 5J1WA 1YXUA 3W8LA 2PUNA 3PG3A 2HZIA 2ZDUA 5DT3A 2GHGA 3KY2A 5EDPA 3T9IA 1IEPA 2VRXA 3ZLXA 3SRVA 4C34A 3U9NA 4MD7E 4YHTA 4D2SA 4PDYA 2WTDA 3DLSA 3LVPA 4HGEA 5AP7A 5HVKA 3PA4A 2YLFA 3PA5A 1OZ1A 3PVBA 4K77A 4RIYA 4L01A 4BKZA 4MBLA 2BDJA 2JKKA 3PXZA 4JRNA 2W1FA 5CVGA 5A4CA 4FL2A 5CY3A 3UMWA 5AAGA 2BR1A 2IZTA 2X1NA 1G8AA 5E8UA 5EHOA 1YDRE 4G6NA 4O7TA 3HDNA 3ZSIA 3ANQA 4DHFA 3DU8A 4TKSA 4YO6A 4U81A 4FVRA 3TNQB 2UW0A 4KKHA 4L3LA 1PMVA 3IOPA 1GZ8A 2XRWA 3MTLA 4J71A 4QYHA 1YQJA 5GZAA 2F49A 4FKOA 2XKDA 4TY1A 3FZSA 2YM8A 3SW4A 4KIKA 4RJ7A 1U4DA 3BLHA 4G9RA 1CDKA 3FC1X 1KSWA 5HU9A 4ZS0A 2GQSA 3HV4A 1WCCA 3O8PA 2XA4A 3JPVA 4FTKA 2BIYA 4GKIA 3GGFA 2A0CX 2Z60A 5HKMA 4BDDA 3FI8A 2R9SA 4ZP5A 5BVWA 1ZAOA 3PIYA 1NT2A 2P2IA 3QTUA 4QT1A 5I3RA 1KE9A 3LCKA 2OJJA 1QMZA 3KMMA 3PWDA 4M14A 4I5MA 4WBBB 3FYJX 3U4WA 5KCVA 4QP3A 1OL2A 3UQGA 5KMIA 5AUVA 3FLSA 3UOKA 5I9WA 4RLKA 2JDOA 4E6CA 4BTFA 4PY1A 3R7YA 2YITA 3Q96A 4AZTA 1H0WA 2CN5A 4ZSGA 4EYJA 5J9ZA 4GFMA 3DXQA 2XIRA 4MTAA 4EK8A 3FLZA 3RI1A 4I24A 4YZDA 3KREA 4TYEA 4LUDA 3QZFA 5HCYA 2CSNA 4C3RA 3W2RA 1PRYA 2R3QA 4G34A 1PMUA 3DK6A 4R3PA 5EM6A 3RNYA 4D1ZA 5HBJA 4OW8A 2OIBA 4HW7A 1OIYA 1PHKA 1CKIA 2EVAA 3ANRA 5LVLA 4ONAA 2VWXA 3PY1A 4Y8DA 5KO1A 4JT3A 3UBDA 4C59A 2Z7SA 4L7SA 3KFAA 4CXAA 4UMTA 3BQRA 5L2QA 3A8WA 2C6DA 4RJ5A 5EM5A 5L6PA 5IQEA 1RE8A 5AMNA 3ZFXA 2AUHA 3D5VA 3CE3A 4BGGA 4QMTA 4XP3A 4KABA 2WXVA 4QNAA 1H0VA 3ENMA 4CKIA 4I4FA 3EN6A 3Q4TA 1M2RA 4B9DA 2UZOA 1BI7A 4XLVA 5LARA 3OUKA 4N70A 4GIHA 4WG5A 2XJ1A 4DTBA 3PP0A 4TXCA 4LRJA 5BNJA 3CPCA 4DH5A 2IW6A 5KMJA 4EBWA 3ZUTA 4YJOA 5H8GA 5C4LA 2PE0A 3MH1A 3LXNA 2PTKA 2R3LA 4AGDA 4NM0A 2OZAB 3HV6A 4MNFA 3TZMA 5M56A 3DBCA 5CYIA 5EDRA 2UZVA 3BGZA 4GYIA 1V0PA 3BGPA 3QTXA 2VD5A 4IBMA 5FXQA 3Q2MA 4ZEGA 5L4QA 4D4YA 2KTYA 2UUEA 2OWBA 4PMSA 4BGHA 3CJGA 4MCVA 4GL9A 3RZBA 4F0FA 5ACBC 4PP7A 4GT5A 4TRLA 2ITTA 2UZDA 3W18A 4O7ZA 3V6RA 5M09A 2E9UA 5B0XA 3DKGA 3NUSA 5F20A 2VWBA 4FE2A 1BLXA 4FTJA 4NUSA 3QL8A 2R3JA 4G3CA 5DLSA 1UWJA 1WBTA 2IW9A 4PL3A 5ANKA 5CSPA 2ITQA 2H34A 4WRGA 5E7RA 1VR2A 2WNTA 2YM6A 3BZ3A 4L43A 4FOCA 4WG4A 4I1ZA 4ITIA 4NW6A 4FKSA 4H05A 3PXKA 4D5HA 4V04A 5IH6A 1QPDA 5K5NA 3O8UA 4QYYA 3UNJA 3ZU7A 4KRCA 2J51A 2QQ7A 3GCQA 4KS7A 3E88A 2W9ZB 3RINA 3AMYA 2GHMA 4FV2A 4UXQA 3T8OA 1IG1A 4NCTC 1Y91A 2PWLA 3WIGA 4AW5A 5M53A 4RMZA 4X3FA 4ANBA 3OWPA 2UW3A 3UZRA 2GMXA 3TTIA 3TXOA 5ETAA 2G15A 4O38A 4NL0A 2J0IA 3C7QA 4FKWA 4I5HA 5EI2A 4TWNA 1S9JA 3MY0A 3ENHA 3I60A 4JQEA 4K0YA 5AV0A 4RIWB 3CD8A 4UMRA 3QGWA 4KBCA 3L8PA 2OICA 2Y6MA 2CNVA 4TYGA 5IKWA 2JBPA 4IC7A 2QG5A 4JVGA 4ZY6A 3BU6A 3RK7A 4L68A 5DVRA 5FG8A 2WO6A 3PJ1A 3KRXA 2HY81 1OKZA 1GIJA 3C0HA 4JG8A 2IVVA 4MD9E 4OTRA 5FBNC 3BELA 4B6LA 4CEGA 2Z7QA 4J53A 3R9HA 4HPUE 2AYPA 1SM2A 2XIKA 4EOIA 4F0IA 1JWHA 4M68A 4E4MA 5CNNA 3L9MA 3TJDA 4BB4A 3FLYA 2PVKA 2CMWA 2ESMA 2VUWA 4D4RA 2CGVA 4QTDA 1ZYCA 3NPCA 4WIHA 4BTJA 4V0GA 4CCUA 2ETMA 3WF8A 3HL7A 5HBEA 4BBEA 5F1ZA 1H26A 4YZ9A 4FEXA 4TWOA 2JKMA 4J52A 5DWRA 4EJ7A 2X39A 2X7GA 4CMTA 4RVLA 4A9TA 4L52A 4ZMFA 3ZM4A 4L3PA 3QKKA 1MP8A 3DAJA 5CF4A 3WZDA 2X4FA 3QU0A 3CSVA 4RQKA 4PQNA 5E9EA 5JK3A 4XP2A 2IJMA 2HIWA 2PVFA 4PMTA 2GHLA 2GFCA 4CFMA 3MVJA 3OCGA 5HEZA 3C13A 4D4SA 3BKBA 1XH6A 3GQLA 2CGWA 3QRJA 3F5XA 2EU9A 2WMSA 4IX6A 4PDPA 4Y85A 4BBFA 1GJOA 3PXQA 5HX8A 4AW1A 2YCQA 3VQUA 2IO6A 4J96A 4E73A 4M67A 4XLIA 2AC5A 5C4KA 1JLUE 2CDZA 3BV2A 4HVIA 4FV7A 3V3VA 3VUMA 1QCFA 2R3IA 4B8MA 2ZM1A 3OROA 4ZTHA 4M69B 5HNBA 3R30A 5KZ0A 3VHKA 5BUEA 2ZMCA 4FG9A 3Q4UA 3F2RA 1FVVA 3MVHA 3V51A 1TKIA 5IA0A 4EI4A 2ITUA 2WD1A 4IX3A 3ZHPC 3GVUA 1MQ4A 5A54A 5H8EA 3P1AA 3PVWA 4KINA 4W8EA 4GG7A 2F2CB 4K8AA 4KSPA 4L8MA 2DQ7X 4CVAA 4IIRA 3RM7A 3HEGA 1TQIA 4FTIA 2VTNA 4UMQA 5L8LA 4BCFA 4QMZA 2V62A 4IFCA 2PPQA 4ZMEA 1K9AA 2HK5A 4GEOA 5FLFA 1REJA 5H9BA 3R7IA 4DEDA 4E6AA 4Q9SA 3PXFA 5GJDA 2ACXA 3CGOA 1ZMVA 3CTJA 5A4EA 5J7HA 1Z57A 1ZRZA 5I9UA 5FD2A 2CLXA 1CKPA 3WZJA 4APPA 2YIRA 5E8WA 2NO3A 4FTUA 4BC6A 3HA8A 1IA9A 3EN7A 5HI2A 3T3VA 5J5SA 5FM2A 2V7OA 4IHPA 3UNKA 1UNGA 4TNDA 2QLUA 3TDVA 4YBKA 3P23A 4HPTE 4I0SA 1OUYA 4JDKA 2GNGA 3SV0A 3QGYA 3S95A 4RWKA 3EQCA 3GT8A 3ALOA 3F3ZA 5CEMA 4ZLOA 3PJ3A 3ODZX 3ZBXA 2OIDA 3FXZA 4LGHA 3A4OX 3UO4A 4DFZE 3C4WA 3QALE 4C36A 3G0EA 4WO5A 4AZWA 4RG0A 1YWRA 5KMNA 3D2KA 1GZOA 3EQDA 4EC9A 4ARKA 2PY3A 4NEUA 1UKHA 3R63A 4CLIA 4FOBA 4CYJA 4E4XA 2IZRA 3OXTA 4G17A 5KNJA 3ZXTA 5IUHA 2BZIB 3NNXA 4H3QA 4I3ZA 4RBLA 4YPSA 3WILA 3FI4A 3EQHA 3FQHA 3W2OA 5GIPE 5JRSA 2OLCA 5TF9A 4F6UA 3NW6A 4BGQA 1OL1A 2F7EE 5A6OA 1JSUA 1ZYLA 2QODA 2VNWA 4I6QA 1TVOA 3OUNB 4NT4A 1U54A 3O0GA 3EQFA 4R7IA 3N4UA 3VULA 1OPJA 5K3YA 2BAQA 3QCQA 4RRVA 3QTRA 3TWJA 4O21A 4XRLA 1DAWA 2VV9A 3FZTA 3WYYA 4O0WA 3ZXZA 2ITPA 3KXXA 4NIFA 2YCRA 3UG1A 5AV4A 2WTCA 4WT6A 5CU6A 5E8TA 4V05A 4MF1A 4C62A 1QPCA 4R1YA 3VUIA 5IA4A 5DE2A 3QYZA 2HXQA 2VNYA 4LQMA 4YJUA 2ERZE 5BMMA 3OT3A 2OO8X 2ZAZA 2IWIA 3UP2A 3FL4A 3KMUA 4FZDB 3O17A 4ANQA 3PVGA 5TKDA 4P5ZA 5FTGA 3U9CA 1NVSA 4FVQA 3T9TA 4FIFA 1XH9A 4EOOA 1WFCA 2FH9A 4D1XA 3R71A 4LL5A 5CS6A 4E4NA 3ZEWA 3MW1A 5E8XA 2PUPA 4FTOA 4D58A 3LPBA 4U79A 5LMKA 4FTRA 4G6LA 3JYAA 3NYVA 4JX3A 3R22A 4WSYA 5CAPA 2BAKA 3MFRA 3L8XA 4FIEA 4EONA 5HD4A 5A14A 1PXMA 3R7UA 3FKLA 3Q9YA 4H39A 2KULA 2UZUE 3N9XA 3LFNA 3HUBA 4G5PA 1E1XA 4J99A 4O0TA 3PSBA 4XG2A 2NPQA 3LW0A 3EL8A 3TL8A 5HORA 3EIDA 3BYVA 2X2MA 4D2WA 5B7VA 5AP2A 5CXZA 3FUPA 4LOPA 1NW1A 3CD3A 4BCHA 4BY9E 4WBOA 3QRTA 3TNIA 3KN5A 4F6WA 4AFEA 3U6JA 2ZV7A 4KKGA 3Q9XA 1T46A 5J7BA 4FKTA 5BVKA 5TOZA 3TKHA 1EH4A 3DV3A 3F82A 4FKUA 4QOXA 2WMRA 3WYXA 3OOGA 3P7CA 3HZTA 2HZ4A 1PXLA 2ZDTA 3ULIA 5AP4A 5HE3A 3MY5A 4CT1A 1PJKA 4IDVA 4BCGA 2GNLA 5CT7A 5C01A 3DOGA 4L42A 3HLLA 5DA3A 3TUCA 4XG8A 3I79A 3LZBA 5FXSA 4QMVA 1YDSE 4JL9A 4QP9A 4EQCA 3LCSA 4RWJA 3UPZA 4O7SA 2X6EA 5HGIA 2RGPA 3BYUA 3NUNA 4GMYA 4XS2A 4HVSA 1BL7A 4CMOA 5HOAA 3F6XA 5LOHA 4FYNA 2CGXA 4FIJA 2OW3A 1GIIA 2HW6A 5AWMA 4BWXA 4JDJA 3FZPA 3QUDA 5CT0A 3I6WA 2IW8A 4IXPA 2BPMA 2Y8OA 1A48A 2JC6A 2UZWE 3A2CA 1LR4A 3PSDA 3QA0A 4O86A 4X2NA 1BMKA 1RJBA 3KQ7A 4I0RA 4JXFA 5E8ZA 3E63A 4F7LA 3FHRA 3ZRMA 2VN9A 4M7IA 3S1HA 2XVDA 3KK8A 2J50A 4EWHA 1H00A 2XRUA 3C51A 4BDKA 5KMKA 3AXWA 1FINA 4UALA 3LFEA 3VS1A 2QOKA 1KE6A 4P90A 2BDWA 4MNEA 1WVWA 5IUGA 3HDMA 5HCXA 4XRJA 3C4ZA 4IAAA 4C37A 3P0MA 3QQGA 3RTPA 5L2TA 3ELJA 4O6LA 1ZARA 3KGAA 3UTOA 3RPVA 4I20A 5FEQA 3ZSGA 4QNYA 4ZAUA 1KE7A 3KVWA 4X6QC 5IISA 3FQSA 2CKOA 1KE8A 2BRGA 4GG5A 4WNPA 3F66A 5IUIA 4HGLA 2BKKA 5GHVA 2C5YA 5EKNA 3HMNA 4BI1A 4F0GA 5A9UA 4GT4A 4O0SA 4S30A 3SA0A 4GK4A 3ORKA 4E4LA 4AUAA 3D5WA 2C1AA 2YHVA 1R39A 3QKLA 4PV0A 5CU4A 4AGUA 4JBVA 5CEPA 5AEPA 4Z55A 4YGAA 2XNNA 3FMKA 4BDCA 3FZRA 2QD9A 3II5A 4BF2A 4D2PA 4BDJA 4JBPA 4I93A 3CY2A 4CD0A 4BIBA 5M07A 3L8VA 4RGJA 3ZC5A 3AC4A 4GT3A 4AW2A 4AE9A 4J97A 3OCTA 4A9YA 1YRPA 5EOLA 3FC2A 4BWPA 4YNEA 3LFFA 4QMXA 4EJNA 2PULA 5CTPA 1L8TA 1K3AA 2G1TA 4YZMA 3RP9A 3R83A 2OJIA 1JQHA 4FV3A 3FZOA 3TNHA 1O6YA 2CHLA 3FLWA 4DCAA 2OGVA 5IQCA 4I6FA 4FMQA 3PPJA 3SQQA 2ETKA 2EXEA 4AQCA 4BHNA 3POOA 4MYGA 2CLQA 4DH7A 4R7BA 3FZ1A 4EKLA 4BIDA 5C27A 4ZTLA 3RPSA 1LPUA 2OH4A 4BI2A 3Q5IA 4FC0A 5DHJA 2C47A 2H96A 2HELA 4ID7A 1I44A 5EDQA 4C38A 5B2MA 4P5QA 3KULB 2VTSA 3EYHA 2XZSA 1H8FA 5M08A 3PTGA 3H10A 4RWLA 3GP0A 1Q8TA 1PXJA 2RF9A 4TYHB 2VTAA 4FV0A 4BCOA 5HO6A 4RZWA 3IS5A 5A4LA 2J5FA 1PKDA 1ATPE 4RJ8A 3DDQA 4Y95A 5EW3A 2ITVA 2B4SB 3BI6A 4I41A 3NAXA 1B6CB 4X2KA 5HG8A 1Q8ZA 4L9IA 3ATTA 3QCSA 2YISA 1H25A 3MJ1A 5EQEA 3SAYA 5L3AA 2OXXA 2SRCA 4EOSA 4QPSA 3NS9A 5ACKA 2XYUA 4LFIA 1Q5KA 4AF3A 5AV1A 3TIYA 4XV3A 3F3UA 5BPYA 2OFUA 4GVAA 2PMIA 3HMMA 4N6YA 2I7QA 3LE6A 5AV2A 2WB8A 5JQ5A 3HYHA 3MSSA 4QYEA 4ENXA 4CV8A 2PL0A 5DEYA 4ZTQA 2YM3A 4ASEA 4IJPA 4JDIA 4YZBA 3LFDA 3EL7A 4M84A 2JKQA 4C2VA 4F63A 1T45A 5CSXA 3D14A 5JT2A 4QQJA 4G3GA 4EQUA 4GKHA 2HW7A 2A2AA 2OZAA 4EOJA 4KUJA 5IU2A 1W8CA 4AN3A 4HVHA 3MB6A 3OTUA 4NCTA 3NR9A 3ID6C 2YDKA 4FVPA 4F09A 3H0YA 1SZMA 2FA2A 2VTIA 2XMYA 3NSZA 3R28A 4QMUA 4TPTA 5EFQA 4BCMA 2IVTA 1Q4LA 4MEDA 2I1MA 4ZTRA 4EL9A 3W2CA 5M4CA 3R9RA 3GC8A 2Z2WA 1XJDA 1OB3A 2XM9A 5ITAA 3UIXA 3U55A 2H8HA 3ZBFA 4F1OA 5J9LA 4FF8A 2GCDA 4F08A 4YNOA 3F3VA 3HKOA 3DBFA 4OUCA 5AUUA 4O6EA 3EN9A 4IM3A 4WOVA 4GVJA 4OTWA 5FBOA 4BVUA 3CTHA 5CQWA 3BIZA 2CNUA 2XBAA 3PRFA 4IMYA 4Z7HA 1JOWB 4AA5A 4BDEA 4X2GA 2QKWB 2YWPA 4NTSA 3R8MA 2QHNA 3MV5A 2I0HA 2A1AB 4CFXA 3G0FA 3JVRA 3SC1A 3A7IA 1FMOE 3B8RA 4CFUA 4JX7A 2W1GA 5IMXA 3BRBA 3S00A 4C4EA 5CAOA 1OKYA 3FLNC 3NCZA 3ZEPA 4YBJA 3E8EA 5HIBA 3BU5A 5C26A 4BKJA 2C0IA 3QCXA 3UYTA 4ZTSA 3HAMA 2QURA 2X9EA 1PXIA 1WBWA 3SG9A 2GPHA 3R1YA 1Y8YA 3G2FA 5CQUA 2FVDA 3F2AA 3CP9A 3HUCA 4O2ZA 3R7OA 3KKVA 3DNEA 5H3QA 3VC4A 4BDGA 4BCPA 4RIWA 4ASXA 5HIEA 4EK4A 3GBZA 2VWVA 5D9HA 3I7BA 3GOPA 3C4CA 3OXIA 3P7AA 3PPZA 4DH3A 3W33A 4GW8A 3BU3A 1R78A 5IMEA 5CEQA 3T3UA 4FNZA 3DBQA 5A46A 3FAAA 5AAEA 2WGJA 5CZIA 4G2FA 2QOHA 2F7ZE 2XNPA 3OWJA 3RWQA 3A60A 4H1JA 2CKQA 1RQQA 2XM8A 2PZ5A 3LCDA 2DWBA 3GU5A 4LMUA 2XKCA 3DFCB 5AP5A 4N57A 1Q3WA 3EKNA 2W0JA 5E92A 2BIKB 3AT3A 4EK6A 1OBGA 5JSMA 3MDYA 3BEAA 3COHA 4PPBA 3RPOA 1FBNA 3BQCA 3O96A 5ANEA 4LM5A 5KBQA 1ERKA 3NGAA 1J7IA 2WEVA 3DFAA 3IOKA 4XG6A 1APME 1U5QA 3A61A 3DDPA 2O2UA 1IA8A 1ZLTA 2WOUA 5EOBA 5HLNA 3QC9A 3BHVA 2XEZA 1R3CA 4F9YA 3SVVA 4JOAA 4W4XA 2WFYA 2W5HA 3PIZA 4YR8A 5AR7A 4RVMA 2RG5A 4RX7A 3A8XA 4MWHA 4NSTA 4M0YA 3AMBA 3QCYA 2QCSA 5KKRB 4C4IA 5KE0A 5AUYA 3QZIA 5IQHA 3ORPA 1YWVA 2UW4A 1IASA 5DIAA 5D7VA 5D1JA 3DB6A 4NZWB 3CQUA 3Q6WA 5EYKA 4QPAA 5CVFA 1P5EA 4LGDA 5JZNA 1B38A 5E1SA 3IDCA 4M69A 3VW8A 5IQFA 3BX5A 1XHAA 2X81A 1DM2A 2XNEA 3PRIA 4JS8A 3TTJA 4KA3A 3RGFA 4ACHA 5AAFA 2OK1A 5FTQA 4EUTA 5L8JA 2PVRA 3PWYA 4GFOA 4KSQA 5FWKK 5TE0A 2OIQA 2W1IA 2Q0BA 3OFMA 3TKUA 2GQRA 2GTNA 4PMMA 4PRJA 2RFNA 4BWKA 3FPQA 4IM0A 4CMUA 1YOMA 2ITYA 3EMGA 3S3IA 1YOLA 4XNEA 5KKRC 2QOIA 3O50A 2WMVA 2BHHA 2GDOA 4U45A 1BI8A 3NNUA 4XCUA 1AQ1A 3WARA 1A06A 2VX0A 4O83A 4YLLA 3ZH8A 3ZZEA 3W8QA 3UQCA 2UZBA 3P79A 1YXSA 2HZNA 3GCVA 1JSTA 3COMA 3MFSA 4NM3A 4RIXB 2QOCA 4AXAA 3KA0A 4FEWA 2PVNA 3KF7A 3UIBA 4IB5A 4K18A 4KIQA 4R6VA 5FRIA 1VZOA 4FT0A 3EQBA 3LCTA 4YU2A 4AS0A 3EFWA 4PL5A 2R3MA 4GU9A 1H07A 4YJPA 4Z16A 3PJ8A 2UW6A 5AM7A 5AP6A 2B55A 4RA4A 1ZY4A 3RKBA 4BFMA 2WQOA 4ANMA 3MH0A 3GQIA 4XG7A 1XQZA 4FG7A 4CQEA 3FI2A 5F95A 3OW3A 3CPBA 4IZYA 4NM7A 1J7LA 4GJ3A 1DAYA 4AOJA 4EQMA 4A4OA 3QKMA 4O84A 5IG1A 4ANLA 4NYEA 1F3MC 3VS5A 1ZMUA 4CFNA 3LM5A 4R7HA 4YO4A 2B0QA 5CENA 3GC7A 4R8QA 1OIRA 3VUKA 2WOTA 1PW2A 3ROYA 4FSMA 5AA9A 4Q2AA 3I6UA 4KIOA 4TTHB 4ENYA 2ONLC 2X8IA 2YAKA 4U3ZA 4YTHA 3VBQA 4PNIA 2WMXA 4QMNA 3IDPA 4N4SA 3IW8A 1PY5A 3MPTA 3U6HA 3VUDA 3FWQA 3VRZA 3JY0A 4J7BA 4PX6A 3LJ0A 2ZMDA 4Y5HA 3TACA 2V7AA 4W4VA 1P4FA 2XK4A 3DS6A 3L9NA 2PVMA 4HYHA 4GSBA 1VEBA 5CASA 2B9HA 2YA9A 4KB8A 4XEYA 4L6QA 3V8SA 3V5QA 1RW8A 1SVEA 2BROA 4FIIA 3HRFA 3OEFX 5AR3A 4UEUA 3D9VA 1GNGA 3AC1A 5ANIA 3BLQA 4S31A 5ETFA 4IVDA 3ZO3A 1OVEA 2XB7A 4EH9A 4MXOA 4ZSJA 3M42A 5HVJA 4FZAB 2YM5A 4W4YA 3NNWA 4M8TA 4GK3A 3LLAA 5FQDC 3UOLA 5HQ0A 4E3CA 3TI1A 1SMHA 5L6OA 3MH3A 1WVXA 3ORIA 4AFJA 4O1PA 4O7NA 2J0MB 4C02A 3VBVA 4Z9LA 4C3PA 4CNHA 1NXKA 2C69A 1OMWA 2VTMA 4NKSA 4RFMA 3LMGA 4HNFA 3JY9A 3KB7A 1YDTE 4I6BA 5DNRA 4AN9A 1UNLA 4QYGA 4KBAA 3HV3A 3NW5A 5LCKA 3TUDA 2R3RA 4UYAA 2R0IA 2R3NA 3N4VA 3GC9A 3ZDUA 4UB7A 4DFYA 4OT5A 4MXXA 4QTEA 4FKPA 2PZPA 1OL6A 1Q8UA 3QC4A 5BVNA 2P33A 4IZAA 2LAVA 3RZFA 3VJOA 4DEEA 2YJRA 3ERKA 3GU7A 1H27A 4JBOA 4FV4A 4O96A 5EHYA 3VBTA 3DXNA 2YM7A 5E4HA 4FR4A 4P4CA 3JVSA 2WZJA 4HYSA 5HG9A 3F7WA 5DOSA 3PJ2A 4KBKA 4EORA 2BILB 5M4IA 2Q83A 2YIWA 4PTCA 4IX4A 4EKKA 3GFWA 4OTGA 4IM2A 4IB0A 5CANA 4F7JA 3HRBA 4BDBA 4OAVB 1Q24A 2C1BA 3VIDA 4GS6A 2JDTA 3E5AA 4JIAA 5EG3A 1IAHA 2QO9A 3UIMA 2G2FA 4D9UA 2UZTA 3VF9A 3QX4A 2OJFE 2QHMA 4AOIA 3TIZA 3A62A 2BZKB 4F9CA 4XHKB 2BFXA 4BCIA 2BKZA 4XOZA 4XV1A 4APCA 4D2TA 1XKKA 3R1NA 4TL0A 3DPKA 5I9XA 2B1PA 5JMSA 2H6DA 4RIOA 4L67A 3ALNA 3CLYA 2UVZA 2WIHA 3PFQA 3R73A 1H08A 2HXLA 2Y9QA 3EZRA 4ZLZA 5M55A 3LOKA 1WBNA 1XBAA 3R04A 3VUGA 2VX3A 5EM7A 4EH6A 2OKRA 2E9PA 1W83A 2VAGA 3OMVA 4FKIA 3W32A 3TT0A 4C33A 1F0QA 4R78A 4DT9A 4E7WA 4QTAA 3ZMMA 3HP2A 2XKEA 4FKVA 4OTFA 3R7EA 4YTCA 2CCIA 4O27B 4YTFA 4LGGA 2WU6A 4FNWA 4YTIA 3ZOSA 5CU2A 2PUUA 1NVQA 2CJMA 3A7JA 3HMPA 4OR5A 4XMOA 1G8SA 3ATSA 1K2PA 2YM4A 5HNIX 4OLIA 3QYWA 3QTIA 4QMLA 3PUPA 2J5EA 5AR8A 4CT2A 4XUFA 2PMLX 3D7ZA 2VWZA 4CKRA 5IDNA 1URCA 4NK9A 4RT7A 1YOJA 5D41A 3ZTXA 5IA3A 4WUNA 3V5WA 4Y72A 2X2KA 2X2LA 4I21A 4QD6A 3SLSA 5I5ZA 1WBVA 4BICA 3A99A 1WZYA 1ZOHA 4FG8A 3AC3A 3QD2B 3P08A 2PYWA 4IVAA 2DYLA 3LLTA 3Q32A 3IGGA 2PZIA 4NFNA 3AT2A 3DBEA 1B39A 4CCBA 3W10A 4PDSA 2R3OA 3PE1A 5CSWA 3MGYA 5IF1A 3I1AA 4G3EA 4KRDA 4O2PA 4FEQA 4KS8A 5JH6A 4IH8A 4DGOA 3KN6A 1IAJA 5I9VA 4PNKA 2C5XA 3NYNA 4GUBA 4PF4A 4CQGA 4C61A 3D0EA 5CF6A 4FV9A 4KKEA 2QR7A 2YAAA 2NRUA 2WQEA 4ACGA 4NH1A 5ANGA 4FT3A 3I5NA 3MIYA 4WNOA 2FUMA 3R2BA 4L7FA 2DUVA 3Q9WA 4IVBA 2WPAA 4JG7A 3UZTA 3LIJA 2GSFA 4DG3E 2XNBA 2ZB1A 4FSWA 1XO2B 3ACJA 4ORKA 2XYNA 3R8VA 3LJ1A 1AD5A 2OI4X 4TYJA 2UVXA 4FUYA 3UG2A 4EH8A 2HWOA 2RIOA 2WMBA 3BE9A 4R1VA 5JKGA 4XBRA 4FKLA 3ET7A 5GIOE 4YMJA 4BZDA 3ZUUA 3R6XA 2IPXA 3VF8A 5JFWA 2XK9A 5I0BA 4N0SA 4ZS4A 4E5AX 1IR3A 2OG8A 1XH7A 3NX8A 1OIUA 2VZ6A 3DLZA 5LMBA 3O51A 1O9UA 5BQ0A 4LV8A 2CGUA 1W0XC 3KULA
chains in the Genus database with same CATH superfamily
3A4PA 4O4FA 1RDQE 3FYKX 4FSTA 1QL6A 3MESA 3DQWA 1ZYDA 4WNMA 3WF9A 4W9XA 5A4TA 4YC8A 4QQCA 5EW9A 4TYHA 4CFVA 1JSVA 2UW9A 2ZOQA 5EKOA 5EK7A 4B0GA 1VYZA 4DTAA 3H9RA 3PA3A 4JLCA 3EYGA 5D12A 3UVPA 4LL0A 3ULZA 2NNWB 4YSJA 5AX3A 3D94A 3QD4A 3UODA 2P3GX 2QOOA 5KHWA 1H1SA 4P2KA 5E90A 2R2PA 4HCTA 4YHJA 4BYIA 4E5WA 4USEA 3TG1A 3QAME 4MXYA 3NW7A 4X21A 3MPAA 3IDBA 3QD3A 3GB2A 4XV9A 3KEXA 2GS6A 3BE2A 2X0GA 3JUHA 5EW8A 3TKIA 4C3FA 5IA2A 5HX6A 3O8TA 4U9AA 4QRCA 4GJ2A 4HYUA 2OXYA 4DGGA 3V5JA 4QQTA 4ZZMA 4MXCA 3IW5A 5IEXA 3LXLA 4ZLYA 5DR2A 3L9PA 3FKNA 3BBWA 5HIDA 5K4JA 4FKQA 3TV6A 1JKLA 2F57A 2CNQA 3NUAA 5HU3A 5GZ8A 5C8MA 5CALA 3VRYA 3TM0A 5AJQA 2AEGA 4QMMA 4FGBA 1M17A 1WAKA 4IAIA 5DH3A 3UO5A 1Z5MA 1XWSA 3SXRA 3VUTA 2WMTA 3SGCA 3DA6A 4DYMA 3D5UA 3I0QA 2JGZA 4MX9A 5I9ZA 1NY3A 3V04A 2C5NA 2CKEA 3AGLA 3DZQA 5JFXA 5AV3A 1V0BA 5EYDA 4O7WA 3QXPA 2BAJA 3BPRA 1OKVA 2X8EA 2VWUA 3Q5ZA 4EC8A 2UZLA 5EI6A 1OM1A 2JIUA 2RFSA 2W9FB 2YLEA 4JIKA 4DAWA 5IA1A 2YZLA 4BR3A 3Q53A 1YW2A 4YJSA 4AZEA 3RWPA 3MFUA 5HTIA 1ZYJA 3O7LB 2J90A 3I4BA 2XJ0A 2HYYA 4MQ1A 4K11A 3KVXA 4JRVA 1W84A 3VJNA 3HVCA 3I81A 5TO8A 3C5IA 3H0ZA 4UWYA 4IE9A 1Q41A 3QLFA 4DE4A 4GYGA 4RC2A 3PVUA 2BFYA 2QOLA 4TZRA 4O22A 1OKWA 3NNVA 1OI9A 3Q9ZA 4HCVA 5CF5A 2GS7A 2VU3A 1OGUA 4BL1A 4L44A 3PZEA 3TUBA 3ORLA 4V01A 1PXNA 3IPHA 1DI9A 2P55A 4G3FA 3ZLSA 2PVHA 2JD5A 4O0RA 2GU8A 4FT5A 1ZXEA 4O4DA 2W4KA 3EFJA 3NEWA 4L00A 3OWLA 3GCPA 3FV8A 3IW7A 3KCKA 1E1VA 5AUTA 5AFVA 2J2IB 3RCJA 3VHEA 1Q8WA 5IQGA 4R5SA 3SG8A 2PHKA 2E9OA 4XJ0A 3WI6A 5KMOA 5LWMA 5FEDA 2XANA 3Q3BA 2WMWA 5AUWA 3W2PA 2W99B 3FL5A 4U43A 3VW6A 3ZRLA 5DRBA 4KD1A 3GNIB 4PPAA 4AW0A 4DINA 2I6LA 4ZZOA 5K5XA 3D7TB 2C5VA 3OZ6A 3QX2A 4ZOGA 3IW4A 1H1RA 2C68A 4LMNA 3WE8A 3R1SA 4IADA 1MUOA 4TNBA 5CEOA 3OY1A 4AA4A 2J0LA 3BHUA 3ACKA 3E7VA 4EZ3A 1JVPP 1MRVA 1JPAA 2BDFA 4XOYA 5LQFA 4FV1A 4YJVA 4B4LA 3D5XA 5CI7A 2FO0A 3UZPA 2P4IA 5JFVA 5L2IA 1BKXA 2LGCA 1GY3A 2E9NA 2Z7LA 3O2MA 4D9TA 2BZHB 3MVLA 4O7YA 3EJ1A 3UC3A 3DKCA 4ZIMA 5T68A 3FSFA 4OBPA 5LVOA 1UNHA 2X7FA 3KMWA 4CTBA 4M97A 2FB8A 3CR0A 4U97A 2WIPA 4HJOA 1OL7A 3CQEA 2ETRA 2W1CA 3CEKA 5FEEA 3N51A 4RC4A 1GAGA 4YHFA 2VTRA 4MQ2A 1JKTA 4U6RA 3UVQA 3F2NA 3DB8A 1CMKE 1SNXA 4AG8A 5EQPA 1J91A 1FGIA 3OP5A 1LEWA 3BBTB 4BCNA 3U51A 4QP2A 1ST0A 4DT8A 4FNYA 4O0UA 2R0UA 2W7XA 2W5BA 1OECA 2YABA 3RVGA 4LRKA 3E64A 3DTCA 4PTEA 4AAAA 4C4FA 4NWMA 3VS3A 4O7VA 2R3FA 4PTGA 2I0YA 2ITOA 3C0IA 2VTJA 4F4PA 4F9AA 5M44A 4CSVA 5IQAA 3AD4A 3TZ9A 2XJ2A 5CSVA 4FTAA 4Y46A 5BX0A 3RPYA 2Y7JA 3MIAA 3R01A 3MBLA 4HGTA 5IH5A 4EOMA 4WNKA 2JDSA 3UVRA 2BRNA 4IACA 3QZHA 2QOBA 4JQ8A 3NMUF 3KRWA 5FDXA 2VWYA 3G51A 3ZCLA 5AIKA 4RIXA 4X3JA 5D11A 3EH9A 4XV2A 2J4ZA 3VAPA 4C0TA 3I7CA 3ZM9A 3C5UA 4M12A 1M7NA 1Q8YA 4MKCA 3VBXA 4EK5A 2ONLA 4C4JA 3GU8A 3WF7A 2WKMA 4I23A 2WQNA 5CEKA 4X2JA 4K2RA 3FMHA 4ITHA 1YI4A 2ZV2A 5DYJA 3CXWA 3AG9A 2XS0A 3E3PA 3H9OA 1PKGA 1YHSA 3LQ8A 4GCJA 4MF0A 1DI8A 3G5DA 3ORZA 4YJRA 5J5TA 3R1QA 4FSRA 2XUUA 4R5YA 4DN5A 4F70A 2ITNA 3OS3A 1YHWA 4DBXA 2OBJA 1OUKA 2GNJA 3FXXA 4IEBA 3ORTA 1XMLA 4O4BB 2VO7A 3KF4A 3DJ5A 2C6LA 2QNJA 5B2LA 3W2SA 2B54A 2ITXA 5C03A 3F61A 4B8LA 2OJGA 4IZ5A 3R7VA 2JEDA 5FGKA 5M57A 2QI8A 4USDA 5AR4A 3RCDA 3S2PA 3CIKA 3ODYX 5HE1A 3BL9A 2QO2A 4GV1A 4WUAA 4DTKA 5GJGA 3LMHA 2BCJA 5I4NA 4FK3A 3WF5A 2X7OA 4OGRA 2PVYA 1LP4A 5DRDA 4H58A 4BYJA 3LXPA 5HBHA 2VTOA 3W2QA 3R02A 4QP7A 3TEIA 5D7AA 3R9OA 3W55A 1U46A 2PE1A 4JG6A 3GUBA 1V1KA 4JBQA 5HTBA 4EZ5A 5KZIA 2YDIA 4DH8A 5I9YA 4WRSA 2O64A 4QMYA 3GU6A 4FSZA 2EXMA 2JFLA 4DEIA 3JR1A 1M2PA 4NFMA 2C6OA 4RWIA 2PK9A 2O0UA 4IANA 2XIZA 5CEIA 2XK3A 2HCKA 4YC3A 1O6KA 1WMKA 4ZSLA 2WTIA 2XNMA 3V6SA 3VBWA 4C4GA 1BL6A 2HENA 4LI5A 4X2FA 1Z9XA 2BRBA 2XKFA 1YVJA 3OVVA 5HG7A 4JAIA 4S34A 5KMMA 2A4LA 2XEYA 1G8KA 4GRBA 5AP3A 3UOJA 2XP2A 1Y8GA 1L3RE 4UBAA 4U80A 3ZZWA 5DMZA 5M4UA 2HOGA 3OBJA 5E8VA 4UV0A 5FXRA 3PJCA 3QTZA 3LAUA 3S0OA 1HCKA 4EHVA 3RBWA 2F2UA 3G9LX 3ITZA 4H3PA 3HA6A 1GIHA 2PE2A 4FUXA 2JLDA 2OU7A 4U0IA 4AOTA 3C0GA 4WSQA 2B7AA 4U8ZA 4QTCA 4RC3A 4FZ7A 4A4LA 3M2WA 4FODA 4FT7A 5HCZA 4C35A 4FTTA 3B2TA 5CU3A 2AQXA 2V5QA 3G6GA 4EUUA 4USFA 2WTKB 3GEQA 3NZ0A 1YI6A 4PPCA 1OITA 2PMNX 3R8PA 4HGSA 4GUEA 1ND4A 2QOFA 5T6KA 4FZFB 5HO8A 2WQMA 3FDNA 1OIQA 4EEVA 4RFZA 2O3PA 5JQ8A 5IEYA 5JGAA 3Q6UA 4AWIA 4IX5A 1OPLA 2WTWA 1SVHA 4BTKA 2UW7A 2WHBA 5A3XA 2IZUA 3D15A 1G5SA 5GINE 4IWDA 3UQFA 3RPRA 4EH3A 3OXZA 4DH1A 4MWIA 1JNKA 2W1ZA 3QQLA 4NM5A 3SOAA 5EYCA 2XK6A 4MK0A 3RALA 1J7UA 3TCPA 2C5OA 5FP5A 2FSMX 3QRUA 3KRJA 4KAOA 4TW9A 2VO3A 3IO7A 4G16A 3Q52A 1P14A 2CPKE 2X4ZA 4TYIA 4WHZA 3EFKA 2OF2A 1FOTA 2R7BA 2X6DA 4FKGA 2BMCA 2GNIA 2WTKC 5CX9A 5FM3A 4AA0A 5EYMA 1VYWA 3E8NA 5LMAA 2FSTX 3QTWA 3TNWA 3WZUA 3FY0A 4J8MA 4NU1A 2QC6A 4FIHA 4JDHA 4FSUA 3U8WA 5AUXA 5BVFA 3HRCA 3UO6A 3ROCA 3NUPA 2R3KA 4NKAA 3U4UA 3O23A 1I09A 3F3WA 2ZVAA 5HE0A 4BBMA 3LKMA 5DGZA 5K0KA 4ACMA 4AT4A 3MTFA 4MVFA 4EBVA 4AT3A 4EHGA 4CYIA 2F9GA 3KK9A 2XK7A 5DR9A 4I5CA 2E9VA 3FJQE 3K54A 4IB1A 4OBOA 4ZY4A 4FEUA 1YXXA 3PLAE 3EN5A 2C6IA 2G2IA 1KV2A 1R0PA 2I0EA 1R0EA 4MBJA 4NTTA 4AZFA 3PIXA 3R21A 1KV1A 4FV8A 3RJCA 3O71A 5CAVA 5HD7A 2C0TA 4I94A 3MVMA 1ST4A 5M06A 3DK7A 4EH2A 2BRHA 1JBPE 1REKA 4N6ZA 1TQMA 2VWWA 3DAEA 3QUEA 2V22A 1UVRA 3KL8A 4FTLA 2YWVA 2BUJA 3KCFA 1M2QA 2XBJA 1W2DA 3V8TA 3AMAA 3PZHA 3DXPA 2B9IA 5DG5A 3VUHA 2XNOA 2Y4IB 4E8AA 1NVRA 3V5PA 3P5KA 3E92A 3B8QA 3SOCA 3TZ7A 4O0XA 3UP7A 3NLBA 5IEVA 3SXSA 5J87A 3QQUA 3L1SA 3OT8A 4P7EA 2Z8CA 3BCEA 4EWQA 5EQYA 3GU4A 2P0CA 3NYOA 4AZSA 2ZV8A 4BCJA 4CG8A 2UVYA 4DFUA 4ALUA 3LFCA 4FSNA 4OTDA 5BYYA 3GC0A 4D5KA 5BUJA 5EH0A 4D28A 4F1TA 4X6RA 5BUIA 3VS4A 5FDPA 1UU9A 3QWKA 4C58A 1PXKA 2QU5A 4HYIA 4DFLA 5DPVA 4BI0A 1PXPA 3OBGA 4DF3A 3MA6A 3EN4A 4E5BA 4ACDA 3ETAA 3QLGA 4DLJA 3BGQA 1ZZLA 1Y57A 3PPKA 1ZYSA 4EOQA 2Y4IC 3UDBA 2HZ0A 3CY3A 5LWNA 3DJ6A 4F7SA 4IQ6A 5A4QA 3EKKA 4C57A 4A06A 4RJ4A 4S33A 3KRRA 4ZXTA 2OH0E 2XIXA 2ZM3A 4U42A 4W4WA 4Y73A 5CAUA 5JFSA 2YACA 3FI3A 3E93A 3EQGA 3MY1A 2J9MA 2R64A 3KC3A 4BDHA 5IQBA 4FNXA 3A7HA 2E2BA 1R1WA 1NA7A 4ZTNA 2W1HA 3TDWA 5CVHA 3ZO2A 5DN3A 5FUTA 2W06A 2WAJA 3NUXA 3R8ZA 4AACA 2ITZA 4RJ3A 2I40A 5C1QB 3R8LA 3QRKA 3OCBA 3MA3A 4K9YA 3F3TA 3A7FA 5IZFA 4JQ7A 5CWZA 3SD0A 3NUYA 2XK8A 4J8NA 4B7TA 4GU6A 4C2WA 4NW5A 3PFYA 4QP6A 1PYEA 1Q97A 4OTPA 3ZC6A 4F64A 2BZJA 2Y0AA 3DAKA 3OTVA 2Y4PA 3F5GA 5K0XA 5LVPA 1J1BA 4RFYA 4D55A 4AGWA 1Q61A 2GFSA 2JITA 2X8DA 3HMOA 4LUEA 1G8JA 4F1MA 4E6QA 3QQFA 3ZO4A 3POZA 5CXHA 1URWA 2P2HA 3AC5A 2IVUA 4XG3A 3W16A 3NIEA 3NCGA 1ZWSA 4BKYA 4FTMA 4DDIA 2OF4A 3V5LA 3BYMA 4FTNA 5L2WA 3FMMA 4CTCA 4Q5HA 4QEBA 4I6HA 5B2KA 3PY3A 3P4KA 1P4OA 2B52A 2G2HA 3SKCA 3CCNA 4RLLA 3TN8A 2XALA 3ML1A 4MD8E 3R9NA 5LXMA 3ZDIA 4CZUA 4K33A 2UZEA 4PUZA 4ZK5A 5BVDA 1ZOGA 3CQWA 4I0TA 4IWOA 3OEZA 3VQHA 3RHKA 3DKFA 5AADA 4DEBA 2IF8A 3G9NA 3B2WA 4R3RA 5FP6A 3AOXA 4IFGA 5BVOA 1Y6AA 4MHAA 3AD5A 4A07A 1XH4A 2ZB0A 3ORXA 5HNGA 2B9JA 4DITA 4TWPA 2RFDA 3SRVB 4O0YA 1WBPA 3DTWA 4ACCA 2YIXA 4ANSA 4ZJVA 3V01A 4QP4A 5HE2A 3HNGA 1XBBA 4A7CA 2VWIA 3MPMA 2REIA 3QBNA 4RIYB 5AA8A 2UW5A 3SW7A 4Y5QA 2AC3A 4RX5A 2OZOA 3KXMA 3D2IA 3KRLA 4UXLA 3F88A 3C4FA 4II5A 4ASDA 5JGBA 1J3HA 3CTQA 4DCEA 3V5TA 2DS1A 1FMKA 3DBDA 3EQIA 3ZUVA 2NRYA 2W17A 2JFMA 4MH7A 1STCE 3Q4CA 1W7HA 4L45A 3DKOA 1XR1A 4Q9ZA 3P9JA 5AP1A 3U6IA 4EOKA 2WQBA 5M4FA 3TNPC 4ALVA 3OWKA 4DG2E 4KIKB 3K2LA 3H4JA 4E93A 2JDRA 1CTPE 4MAOA 4OTIA 1Q3DA 2F7XE 5CAQA 3U54A 5IQIA 1HOWA 3DZOA 2PVLA 3ZYAA 4AE6A 3QA8A 4CZYB 3OC1A 4EH4A 3FY2A 3PDTA 4CV9A 4O7LA 5IA5A 4QO9A 2VTHA 3BHYA 4QMSA 4XYFA 1FGKA 3GXLA 3ZFYA 4QP1A 5GNKA 4ZTMA 3MI9A 2O63A 3LFQA 4IZ7A 5AUZA 4DLIA 3QHWA 4ANOA 5KX8A 3SX9A 3UYSA 2ITWA 3FQEA 4IWQA 3SHEA 3LCOA 3V8WA 3E8CA 4FYOA 3G90X 3MN3A 4JNWA 4UMPA 4GH2A 4F9BA 3DNDA 2NP8A 5J95A 2C6KA 4KWPA 5ICPA 4DFNA 1XH8A 2VTQA 3CKWA 2QVSE 3EOCA 4QQ5A 2V0DA 3HMIA 2QLQA 2YFXA 4J98A 4EH5A 2C3IB 5F94A 3D7TA 3IECA 3RM6A 2IVSA 1Q99A 3W0QA 5EHLA 3BV3A 1XH5A 3VS7A 4BN1A 3R0TA 3OY3A 3AGMA 2A19B 3R2YA 4XG4A 4Z3VA 4YP8A 4HZRA 5BVEA 1OGYA 3N4TA 5AP0A 3EQPA 4YJNA 3EB0A 3QQKA 3F5UA 3HP5A 1H1WA 4FBXA 4I4EA 3UPXA 4CLJA 4BCQA 3BWFA 4ZJJA 4J1RA 2HWPA 5CNOA 3HGKA 2C6TA 4FEVA 4G1WA 1W82A 4G6OA 3AKJA 3BHTA 2JDVA 3IG7A 4AT5A 5KMLA 4O91A 3PXYA 4YLJA 4YJTA 4C7TA 4RVKA 3DQXA 4ZSEA 3P78A 5JN2A 3ORNA 2OFVA 2XIYA 3OD6X 4FV6A 3OF0A 4BHZA 1UWHA 2HY0A 3LJ2A 4W8DA 4ERWA 5KHXA 2PU8A 4DA5A 3QFVA 2O65A 1WBSA 2WU7A 2PUIA 2O5KA 4BTMA 4L46A 4RX9A 2G9XA 2UW8A 5E91A 3M1SA 3WIKA 3NVMB 3KIOC 3FBVA 3IQ7A 5AIRA 4HVDA 3E7OA 3AT4A 4L3JA 3NIZA 4CFWA 3TMOA 3LQ5A 3BLRA 4J95A 3VS0A 3VVHA 5H8BA 3H30A 3R00A 3DJ7A 4K1BA 4I92A 4C4HA 5HHWA 4RA5A 5DT0A 5HG5A 3ZO1A 2PZYA 3DGKA 2VGPA 1PXOA 3LXKA 5E8YA 2J0KA 4HOKA 4FIGA 3EHAA 1H1PA 2CN8A 4X0MA 5CF8A 5JZJA 3HV7A 2GTMA 3ZS5A 3GCUA 3UIUA 4PDOA 4ZY5A 4GIIA 4MXZA 4FKJA 4U41A 4O82A 3FE3A 4CRSA 1M14A 2YERA 3DCVA 5DT4A 1FVTA 5CSHA 3WF6A 4HVGA 5J1VA 4B99A 2W1EA 3I0OA 3OG7A 4NJDA 3RAHA 2Q0NA 4E1ZA 5I3OA 3THBA 2ZM4A 1HCLA 3LFAA 3CS9A 4FA2A 3NFGB 4O7RA 1YXTA 4X3FB 4FTQA 4U3YA 2YZAA 4UWBA 2YEXA 3BHHA 5C8KA 3IK3A 5C8NA 1BUHA 4JR7A 5L6WL 4RQVA 3VO3A 2JBOA 3KXNA 3VS6A 1J1CA 4D1SA 5HLPA 1U59A 4M3QA 4IDTA 4BDFA 3TZ8A 4R77A 3Q04A 2VTTA 4G3DA 4RSSA 4FK6A 2YDJA 3DT1A 2C4GA 2UV2A 5ANDA 4EHEA 4FT9A 3F9NA 2R5TA 1Y6BA 3C1XA 4FRFA 5HESA 2RSVA 4NJ3A 3D83A 4O0VA 5KUPA 3FLQA 2WEIA 4PWNA 4G31A 3IKAA 3Q4ZA 4YPDA 3G15A 3QWJA 3EQRA 3M11A 3REPA 3VWAA 2C3LA 4UY9A 4YSMA 3P86A 2CCHA 4Z7GA 4YUQA 4U7ZA 4CKJA 2YIQA 2YCSA 2G01A 5E1EA 3S4QA 3WZEA 4ZZNA 5KBRA 2VX1A 4PL4A 4V0GB 4X3FC 3RAWA 2QO7A 4EK3A 2C3KA 4UZDA 4XH6A 2X9FA 2FYSA 1GOLA 1SNUA 4FL3A 4BIEA 3C50A 4HCUA 2W4OA 3CC6A 4G9CA 4A9UA 2FGIA 3PXRA 3COKA 3NDMA 3Q60A 4TN6A 3LQ3A 4YC6A 4BJJB 4E6DA 5L2SA 1SVGA 4U44A 2JAMA 4WA9A 4ANNA 3W1FA 1SYKA 3NRMA 4EH7A 3KXHA 5AM6A 3GENA 3VBYA 1BX6A 2ZJWA 2C6MA 1VJYA 1CM8A 3FKOA 3MJ2A 4OBQA 1UA2A 2BTRA 1JAMA 2RFEA 2VO6A 3HX4A 4IB3A 4IWPA 1UV5A 1BYGA 4ERKA 3UMXA 2BRMA 3R9DA 3RHXA 3F69A 2WTVA 5IH4A 3LFBA 3ZLYA 3EZVA 2IN6A 3UGCA 3HV5A 4O81A 3FMDA 4UYNA 2YIYA 1PMEA 4DDGA 2WELA 2BALA 5BYZA 4BDIA 4YZCA 3VS2A 3FXWA 4F9WA 4DGNA 4L53A 1H24A 4LG4A 4EZ7A 2QR8A 4DG0E 3OCSA 1S9IA 2GNFA 2PMOX 4LOQA 4DBNA 1E9HA 3QZGA 3QQJA 1H01A 2ERKA 3I5ZA 4AU8A 4EOLA 3K3JA 5DFPA 2I0VA 3E87A 3PY0A 1JKKA 4RVTA 3ORMA 2YJSA 3KXZA 5J9YA 3JS2A 3FPMA 3BLAA 3A7GA 1KOBA 5DI1A 4YZNA 4E26A 4JR3A 4QMPA 4AX8A 5M51A 4BDAA 1MQBA 2BVAA 5DR6A 3BWJA 3MYGA 4YLKA 1H1QA 3KU2A 4JI9A 3UNZA 2W5AA 1H28A 1F5QA 4Q5EA 4BZNA 4FGRA 3RK5A 1V0OA 4FICA 1JKSA 2RKUA 3QF9A 4F78A 3NYXA 4D4VA 5LJJA 1M52A 3WZKA 3GCSA 3MS9A 3RMFA 3DK3A 4I5PA 1ZMWA 3K5VA 2W05A 3E8DA 4IAZA 4C8BA 3BYOA 1MRUA 4G5JA 4M15A 2PZRA 2Z7RA 4PMPA 1W98A 5D10A 4CFFA 3FHIA 4FX3A 5IQDA 2BTSA 3C9WA 3AC2A 1YWNA 3OOMA 4IAYA 4AGCA 1GZKA 3NVKI 4F65A 2WMUA 4RX8A 1LEZA 2XF0A 4QYFA 1IRKA 3F5PA 4AN2A 4F6SA 4KIPA 3NWWA 5G1XA 2BHEA 3QD0A 4XBUA 3BYSA 3QRIA 4MBIA 3ZSHA 4EOPA 4LRMA 2QKRA 5JEBA 1KUTA 5LVMA 1CKJA 5G6VA 4GK2A 2C6EA 1OBDA 3UC4A 1ZY5A 4CGAA 3CGFA 4FSYA 3DY7A 1MRYA 4U5JA 1U5RA 3UE4A 2W96B 5AX9A 2IG7A 4UZHA 2VTPA 2OJ9A 3QHRA 3P7BA 3UJGA 1G3NA 2EWAA 5HLWA 3FMEA 3AQVA 5AR5A 1CSNA 2C3JA 1YI3A 5HTCA 5TT7A 1KWPA 3Q2JA 1QPJA 5DEWA 4TT7A 4A9RA 2Z02A 5HZNA 4M0ZA 3WE4A 1U54B 4D0XA 5K4IA 3CBLA 1KOAA 4BZOA 2B53A 2WMQA 4AZVA 1KE5A 3H3CA 4UWCA 4QMQA 4H1MA 4W9WA 4DC2A 3JXWA 3NUUA 3QUPA 4EHZA 3ZFMA 2A98A 5CZHA 2XCKA 3G33A 4A4XA 4NIFB 4M66A 4QMWA 1X8BA 4WKQA 4JJRA 4BCKA 5L8KA 5BYLA 2YN8A 4FSQA 5GJFA 4IAFA 1FPUA 4CRLA 2YCFA 4H36A 4FL1A 5J79A 4KNBA 3MWUA 4D2VA 4S32A 4D0WA 2V55A 1LUFA 3VNTA 2X0OA 3G6HA 3R8UA 2EB3A 1PF8A 2R7IA 3O7LD 1UU3A 1PYXA 5F9EA 3QTSA 2OXDA 2RL5A 3L9LA 2EXCX 1YXVA 4AP7A 1DS5A 1UU8A 3FMNA 4RZVA 1ZZ2A 5H2UA 3WBLA 4CZTA 3R7GA 4A9SA 2QOQA 2F4JA 3GOKA 3WOWA 4QP8A 4K6ZA 4OT6A 3ZRKA 5IPJA 5BV3A 2R4BA 4DFXE 2VO0A 3E3BX 2H9VA 4QMOA 4R3CA 3FSKA 4HNIA 2HAKA 4IVCA 3ZLWA 3VN9A 1A9UA 2IEWA 1H4LA 2FSOX 2R3HA 3TJCA 4ALWA 3W0RA 1UU7A 4UX9A 2QG7A 4ZJIA 1WVYA 2ZV9A 1PMNA 4PP9A 2CKPA 3HAVA 3ZONA 1GZNA 3LM0A 2PSQA 2B9FA 5TR6A 4U40A 5CLPA 4IJ9A 4F99A 3IGOA 4OAUC 4O1OA 4QPMA 5JGDA 1M7QA 2XAOA 3SXFA 2IZSA 4Y83A 4FI1A 5DBXA 3RAIA 2XH5A 1FVRA 3UDZA 4EYMA 2PVJA 4GFGA 2FSLX 4WG3A 4RPVA 5EM8A 2WMAA 3PSCA 2W4JA 1XBCA 5T3QA 3QQHA 3FMLA 4ITJA 2R3GA 4DGLC 5C9CA 3SDJA 2J7TA 3EFLA 4YURA 3PYYA 1YKRA 3MH2A 4LOOA 5F4NA 4IC8A 5HICA 4BRXA 4FV5A 1FQ1B 3PP1A 3MB7A 4FTCA 4ASZA 3QTQA 4H3BA 5LMKC 1QPEA 4HZSA 1P2AA 2A27A 2O8YA 2UZNA 1AGWA 3UOHA 3E62A 3AC8A 4ZSAA 4LYNA 1WBOA 2VTLA 4TWCA 3U87A 2WTJA 4LV5A 2EB2A 4I22A 4WD5A 4E20A 2JIIA 4CG9A 3PE2A 3EWHA 4DEHA 5LCJA 3CJFA 3D4QA 5J8IA 4XP0A 2GNHA 2QU6A 2XCHA 4QTBA 5CU0A 4MXAA 2JAVA 5CI6A 4IW0A 3PG1A 2XNGA 3FEGA 2OSCA 1OL5A 2RG6A 2ZYBA 3CKXA 4X7QA 2QONA 4XG9A 3AD6A 3RAKA 2C0OA 3L8SA 4XX9A 4S2ZA 3GI3A 1TQPA 3F7ZA 2C30A 3PLSA 5ETIA 4FKRA 5HO7A 4AAYA 5LVNA 1YHVA 3BEGA 5ETCA 5ANOA 2GQGA 4D2RA 3K5UA 5ANJA 2J6MA 1O6LA 2JIVA 4IAKA 3LMIA 4OTHA 4DEGA 4DGMA 1Q62A 2W1DA 2EUFB 4JAJA 4M13A 5JRQA 2J0JA 2GS2A 1UKIA 2Y6OA 3RK9A 5IDPA 5EI8A 4RJ6A 5BMSA 5K9IA 3LFSA 4OTQA 2R3PA 5AR2A 5E8SA 4DEAA 3IONA 4UMUA 3COIA 3TV4A 4F7NA 5A6NA 1ZOEA 3FMJA 5FTOA 3QXOA 3C4EA 3K3IA 4MNEB 4YJQA 1OPKA 2VGOA 3KXGA 3LHJA 3AKLA 3IW6A 4DFBA 3OHTA 3H9FA 5HVYA 5GZ9A 3GFEA 3C4XA 3OW4A 4UN0C 3PUFC 2JKOA 3HECA 3TV7A 4FZ6A 3RNIA 3NAYA 3MFTA 5J1WA 1YXUA 3W8LA 2PUNA 3PG3A 2HZIA 2ZDUA 5DT3A 2GHGA 3KY2A 5EDPA 3T9IA 1IEPA 2VRXA 3ZLXA 3SRVA 4C34A 3U9NA 4MD7E 4YHTA 4D2SA 4PDYA 2WTDA 3DLSA 3LVPA 4HGEA 5AP7A 5HVKA 3PA4A 2YLFA 3PA5A 1OZ1A 3PVBA 4K77A 4RIYA 4L01A 4DHJA 4BKZA 4MBLA 2BDJA 2JKKA 3PXZA 4JRNA 2W1FA 5CVGA 5A4CA 4FL2A 5CY3A 3UMWA 5AAGA 2BR1A 2IZTA 2X1NA 1G8AA 5E8UA 5EHOA 1YDRE 4G6NA 4O7TA 3HDNA 3ZSIA 3ANQA 4DHFA 3DU8A 4TKSA 4YO6A 4U81A 4FVRA 3TNQB 2UW0A 4KKHA 4L3LA 1PMVA