1OZ1A

P38 mitogen-activated kinase in complex with 4-azaindole inhibitor
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
348
structure length
344
Chain Sequence
RPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHTDDEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mitogen-activated protein kinase 14
publication title Design and synthesis of 4-azaindoles as inhibitors of p38 MAP kinase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 112
structure length 344
sequence length 348
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2003-04-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 1oz1A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 1oz1A01
3HVCA 1YDSE 2BDWA 4MXXA 3Q9YA 2JBOA 2YIQA 3THBA 4A7CA 3Q2JA 2WTVA 4AX8A 3OMVA 4KIOA 1PRYA 1STCE 1ZY4A 2WMUA 5KMOA 3CJGA 5ANIA 5IA2A 4YTCA 1JKLA 3AC2A 3QQGA 4IAZA 4A07A 5LMBA 3BHTA 3ROYA 2H8HA 4F64A 4CLJA 4S30A 4YLJA 2C5YA 2UV2A 4FKIA 4IACA 4AW1A 4FEWA 4I1ZA 3UDBA 5FGKA 3FMJA 5GIOE 3BYVA 5AIRA 5KZIA 3NUNA 5K4IA 4ITHA 3QCXA 2PZ5A 2XNNA 5IKWA 3PXRA 3F9NA 5AUXA 3RALA 1FGIA 4Y5QA 3EWHA 3LQ8A 1FVTA 4M66A 2C1BA 3LCDA 3P9JA 1FVVA 1UU9A 3PFQA 4APCA 2Z7QA 4P2KA 3O96A 5E4HA 4TYJA 5L8LA 1WBVA 4O82A 2PTKA 4CFUA 5L2WA 5AM7A 3LMIA 4I3ZA 4DEDA 4I5PA 1DS5A 1XBBA 2JDRA 4FZDB 3QUDA 5CXHA 4YP8A 4BTFA 3MY0A 4I94A 3M1SA 4S32A 5GJFA 4BWKA 2J0KA 1QPDA 4N0SA 3TG1A 3E8DA 4M3QA 4O0RA 3R9OA 2R5TA 3QZIA 2BRGA 4LG4A 3W10A 4ANNA 4RIYA 3LMHA 1ZOEA 5G1XA 2PVMA 3T9IA 3WBLA 4E5AX 4ZJVA 4USEA 3WIGA 3NYVA 3R7UA 4E4XA 4ZS4A 4CMTA 4N4SA 3I81A 5HBJA 4FSWA 2VO7A 1H1SA 5FP5A 5EQPA 1U59A 3MWUA 5HICA 2V7OA 4RC2A 3V8SA 5L2TA 2BRBA 3HV7A 1AGWA 2DWBA 3DLSA 3Q32A 4ENXA 2X8EA 4XBUA 1GIIA 3BIZA 4TZRA 2X8IA 3NIEA 4BWXA 3G0EA 3FPQA 3AGMA 3LFAA 3KXMA 4EH9A 3ATTA 2I40A 2REIA 5ICPA 4DTBA 4EL9A 3AT2A 3RHKA 1XQZA 3PY0A 2EXCX 4BCFA 2CNQA 4C8BA 3KRXA 1YHSA 3HRBA 4XV9A 5CF4A 3GENA 3ORLA 3R22A 3UO6A 4MD8E 3TL8A 5HD7A 2PMLX 3DZQA 4AZFA 5AR7A 3A2CA 2A4LA 4QP1A 4M0YA 3FI8A 5CEMA 3PPKA 1XH9A 4ZIMA 4MK0A 5I9WA 3LQ3A 3RAWA 3RK7A 2ZYBA 2X4ZA 3DY7A 2R3NA 4YMJA 5B0XA 4BCKA 3QTXA 3UC4A 1LPUA 4C57A 2YZLA 4R3PA 3BEAA 3ZZEA 1RE8A 2W1FA 4G6LA 4AU8A 4MYGA 4BYJA 3HMPA 4U44A 3F5UA 4F65A 2H6DA 4EBWA 3TNHA 4CYIA 1PXLA 1YHWA 4M7IA 4EK3A 4R1VA 5KMMA 1BYGA 1H4LA 2HENA 2X2LA 4C2WA 3TDWA 3ORZA 3VBWA 3BBTB 3HNGA 2X1NA 2O0UA 3ZO2A 5TOZA 3UJGA 2UW9A 3MV5A 4X2NA 4JLCA 4FV9A 4XUFA 3VUTA 3FC2A 3AT4A 2J9MA 3COKA 3QZFA 4EH8A 4N57A 2HY0A 1GIHA 3SX9A 3FLNC 4QYFA 4O7LA 3GI3A 3FSFA 4QMWA 1SVGA 3P0MA 4LV8A 1NVSA 2XM9A 4JL9A 2CMWA 5GJDA 5M4UA 2PSQA 5AUVA 4CTCA 5AAGA 1HOWA 1WBTA 3B2TA 4FSYA 3WIKA 3FI4A 3MW1A 2QG5A 5H9BA 1QPCA 4RVMA 4A4XA 4NL0A 4OAUC 2WQMA 2BMCA 3N9XA 4J7BA 5KBQA 3PY3A 3R71A 4FIGA 5M08A 4MQ2A 4QMXA 3HV5A 3R63A 5AR2A 5EM6A 5EYCA 4KAOA 4FIFA 5DR9A 4B6LA 2YLFA 4IEBA 2RFEA 3VS3A 4D4YA 4RRVA 1T46A 4IX5A 4C59A 4F6UA 2ITPA 4Q5HA 3R8LA 1YXTA 5BVNA 2Z02A 2ITXA 3Q9WA 1JQHA 1PKGA 4YGAA 5KZ0A 4RWJA 5CEKA 4DEGA 1H08A 3F3TA 2UW8A 3O50A 4D2WA 2OKRA 5I5ZA 2IZRA 3R1YA 4JOAA 5BVFA 2VTTA 4FT0A 4O2PA 2R64A 2ERKA 2BKKA 4PMTA 4DYMA 1JKKA 2WKMA 3DNEA 3IECA 4QTAA 3FXZA 3C4FA 4HVHA 4PQNA 4F08A 2J90A 3DGKA 3SV0A 3LFCA 4LMNA 4C2VA 3NLBA 4BBEA 4CV9A 5ETIA 3R8ZA 4R3RA 3JUHA 4RZWA 1OGUA 2OF4A 4EKLA 5L6PA 1XH8A 4MXAA 5EDQA 2XA4A 3KCKA 4GW8A 3IQ7A 1M17A 3ORKA 5IDPA 3RTPA 2ITNA 4ALUA 4O21A 4FL2A 2VX1A 3DJ7A 3MH1A 5IA4A 2C4GA 2WQOA 3FMLA 3F5PA 4P4CA 3AMBA 5A6OA 1MQBA 4WIHA 3GOPA 3QL8A 4PDYA 3SXRA 4JRVA 3QCSA 4HZSA 4DFUA 2CHLA 3LFBA 3ULZA 5JQ8A 4O2ZA 4ONAA 5J9YA 3MBLA 4L43A 3R7OA 3V01A 4HVGA 2X7GA 3W32A 4NYEA 3CTJA 4GL9A 2Z60A 2YDKA 1M2QA 4K1BA 3EFJA 3PZHA 2VTRA 5ITAA 1VYWA 1PMEA 3AT3A 4FV5A 3ORIA 3QD3A 4LUDA 4U43A 3ZSIA 2VTMA 5JEBA 3G0FA 1CDKA 2QVSE 5TE0A 5JGBA 3WE8A 4ZY5A 3D0EA 4KIPA 2XVDA 1ZAOA 3P1AA 4KSQA 2VTAA 4DFXE 5AEPA 3S0OA 4O7ZA 5IQIA 5EG3A 4K9YA 1R1WA 2BRMA 2VTNA 4X21A 4DTAA 2AUHA 3BU3A 4FVQA 4JX7A 4QTEA 4QMVA 2F7ZE 3PVWA 2F2CB 2XIRA 4I0RA 1XH4A 4HOKA 2WAJA 2YACA 3EQDA 4F0FA 2CJMA 3L9MA 4S33A 3DBCA 2W96B 4GG5A 1OUKA 3KULB 3ZRKA 3HDNA 2O5KA 4H1MA 3ZTXA 3SA0A 3OTUA 4IWOA 3W16A 4CFVA 1OIUA 3BHYA 3GB2A 3GU4A 5L8JA 5M56A 3AXWA 3GBZA 1SZMA 4EK8A 5DR6A 2HCKA 1E1VA 2WIHA 4NFNA 1L8TA 4IC7A 4XHKB 2W5BA 4F9YA 4QPAA 3IDCA 5DGZA 3VRZA 4D55A 5JZNA 1BKXA 3NCZA 3R83A 2Y4PA 4CKJA 4FGRA 3UVRA 2QKWB 5FBNC 4IB1A 1GIJA 2WPAA 3KC3A 4HCVA 1ZZLA 5JSMA 3TI1A 4OTFA 3OBGA 3TUCA 1F3MC 3CJFA 1YRPA 4IAYA 4HVDA 2PUUA 4O0VA 4ARKA 4HVSA 4XMOA 1Z5MA 3OUKA 3D14A 3KF7A 2WTKB 2A0CX 4FNWA 4RWLA 5LWNA 4O22A 2ZV7A 2YM3A 1Y57A 3QD0A 3BGQA 5CAUA 4U80A 4Y72A 4WKQA 2VUWA 5IEVA 4FV0A 5F9EA 5LCJA 4F7LA 4R7BA 5M51A 3RGFA 5I4NA 4UYAA 3UODA 3RCDA 1UU7A 4YR8A 4HCTA 3PSDA 4BCNA 1OIYA 3VBYA 1RDQE 3W2CA 1UU3A 3OG7A 3F5XA 4FI1A 4G3FA 4IZ5A 3VBTA 4XOYA 5LVPA 2BUJA 2YM8A 1R78A 3MIYA 3SW4A 1YHVA 3QC9A 1Q99A 4WSYA 2YABA 4EHVA 1Q3DA 3DBEA 3LCSA 2SRCA 4G5JA 4IZAA 4CCUA 4DA5A 3MFUA 3QRTA 4ZK5A 4EHEA 4JG7A 4GYIA 4E93A 5AWMA 2WFYA 2YAAA 1H0VA 3HRCA 2XJ2A 3KB7A 4O38A 4QYGA 4TTHB 4FR4A 1KOBA 3LJ2A 2B52A 4IWDA 3F5GA 3ZLSA 4FTQA 4B4LA 5KNJA 4JG6A 3NWWA 4MBJA 5HIEA 2W1ZA 5AP1A 1OL5A 2UZWE 4M67A 3HA8A 2BHEA 2W1HA 3IGOA 1U5RA 4PDOA 4QPMA 4CV8A 4PPBA 4EWHA 4HYIA 4L45A 3K2LA 4RT7A 4ZSLA 2WMBA 4DAWA 2OLCA 1TQIA 3DLZA 4YC3A 2PPQA 5DPVA 3VS2A 3C4ZA 4J8NA 3RBWA 5AADA 3QUEA 4O0XA 5A4EA 4ACGA 4FTMA 3NS9A 4XP0A 5FRIA 1J7LA 5A6NA 1XH7A 4FTNA 4J97A 4QOXA 4ASEA 3C1XA 5CNOA 2KTYA 3KK8A 3RVGA 4AP7A 3TJCA 2C3IB 4CLIA 4PTGA 2YWPA 2R3KA 5D12A 3D2KA 3JVSA 2IZTA 3O2MA 4HNFA 4IVDA 2GU8A 1VR2A 4UMRA 4Z9LA 4J1RA 4QYHA 3S2PA 4EBVA 3ALNA 4QMSA 4NTSA 3ZBFA 4M84A 4YUQA 5FDXA 3TNQB 4OTRA 4OTHA 3AC3A 4OTDA 4XRLA 1S9JA 1OM1A 4BZOA 2OF2A 5IF1A 4PMPA 2P2IA 2NPQA 4H39A 3Q53A 4RFMA 3P7BA 3NR9A 1H07A 2CGXA 4TT7A 4USDA 5C4LA 4EYJA 2ITVA 3GGFA 3DAJA 3DPKA 5LCKA 2YM7A 1OKWA 2XIZA 4YLKA 5FBOA 4DH8A 4QMPA 2XBAA 2BRNA 4FG8A 2W4JA 3R28A 4CZYB 2OJJA 2QCSA 3T8OA 4AN2A 3PA3A 5KX8A 5FUTA 4EOMA 1J1BA 3UGCA 1Q62A 4QMNA 3QTSA 5ETCA 2Y0AA 3ZLWA 4KKHA 3KRJA 4MNEB 3PXQA 4E4LA 3HMOA 4CNHA 3PWDA 2GFCA 4J96A 1KOAA 4GU6A 4UY9A 4BDAA 4LGGA 3FJQE 4IAFA 1OPKA 3HV6A 3LCKA 3GFWA 3MB7A 4DG0E 4YSJA 2QOKA 3ENHA 3MJ2A 3BCEA 1A48A 2GHLA 3KK9A 4ALVA 2C5OA 1FVRA 2OI4X 4RJ4A 5CF8A 3RAIA 3OTVA 3H0ZA 4B7TA 4C38A 3V5QA 2YN8A 2CKPA 2ZB1A 3HMNA 4KBAA 3P4KA 3BGZA 5E1EA 4DH3A 3U55A 5JRSA 3W2QA 3TXOA 4R78A 3H9OA 2PL0A 1J91A 5AIKA 4BTMA 3AC1A 1MP8A 3COMA 4FG9A 3TZMA 2R3IA 4GV1A 2CLXA 3WZEA 2JC6A 4IVBA 4Q5EA 3E93A 3EQIA 1BMKA 2CN5A 3DT1A 3I6UA 4QMTA 3TNPC 1PXOA 2C5NA 3PWYA 2W05A 1WBWA 4PDPA 5DWRA 2ITYA 3A60A 2XCHA 3PXFA 4ZZNA 3DK3A 1W8CA 4EOPA 3DXNA 4A9RA 2WHBA 4FKOA 1Q3WA 4I4EA 1IAJA 4Z16A 2VTLA 2IW8A 3LFSA 3KMUA 4EK6A 4ZSEA 5CENA 2YM4A 5I3RA 3PY1A 3PRFA 1PMUA 4UEUA 3HP2A 3JY0A 4ZS0A 3VF8A 2J51A 3Q4UA 1Y91A 4FK3A 2EU9A 3K5UA 3UG1A 4AG8A 3Q9ZA 4F1MA 3PYYA 5HG5A 4S34A 1PYEA 3GUBA 4FBXA 4L00A 2G2IA 4EK5A 3GCQA 3VS4A 3OBJA 5D11A 4G3EA 4MEDA 2VTQA 3GQIA 4BDHA 5IQGA 2F57A 1K2PA 3FLWA 3FY0A 4MWIA 1TQMA 3Q9XA 5L6WL 3QU0A 2V62A 2EUFB 4XX9A 2ZV2A 4PL3A 4YPDA 1YOLA 2FYSA 3OWKA 1GY3A 2UVYA 2Y9QA 4KRCA 4MNFA 5JKGA 2PVFA 4X7QA 1YXSA 1KE6A 4E6DA 1O9UA 5EYMA 2QD9A 2I0YA 3DOGA 4U3ZA 2PZPA 3LIJA 4JNWA 3GU6A 1J1CA 4ANOA 3GCVA 2QNJA 3II5A 2Y6MA 5KCVA 4O0SA 3UMWA 2GDOA 2I1MA 3UVQA 4O7WA 3BWFA 1H26A 2GS2A 1HCKA 4EOOA 3FZRA 4IVCA 4IC8A 1VZOA 1OZ1A 5DRBA 3BKBA 3TUBA 5HOAA 2XCKA 4OUCA 5HE2A 3UG2A 3PRIA 3C0GA 2BFXA 5CVHA 2JDTA 1YVJA 2WQNA 3DB6A 5E8ZA 5HVJA 1BI8A 4J8MA 1OB3A 4MNEA 5J87A 1K3AA 1URCA 2W9FB 3L1SA 4IDVA 5EOBA 1IAHA 3DBFA 2J5EA 1Q8TA 4USFA 3BE2A 3WI6A 3QRKA 4R8QA 4XP3A 1FOTA 2WMVA 3O0GA 4HPUE 1H24A 2J0MB 4KABA 4IFGA 3LM0A 2IPXA 2IVSA 3UQFA 2VV9A 4BDFA 1OVEA 4WBBB 1YOMA 4Y46A 4DFYA 3QX4A 4ZTNA 1WBSA 3U54A 3C51A 2EWAA 1URWA 4I6BA 4F9CA 4HGSA 4XRJA 3DJ6A 5TR6A 3G33A 5DT4A 4EHZA 3DK6A 5FXQA 4PWNA 1V0OA 2J7TA 3KA0A 3VWAA 2E9NA 2ETMA 4K2RA 3IW7A 3FKOA 3ZXZA 3PXZA 2OH0E 1GZ8A 2GFSA 5K9IA 3H4JA 1OKZA 1FPUA 3K3JA 2DS1A 4YLLA 4AN3A 3UIMA 5GIPE 3AC8A 2C47A 4EZ7A 3R8MA 4HNIA 4UBAA 4IXPA 4I41A 5M06A 3RPRA 5A3XA 1VYZA 1CM8A 5I9VA 4XV1A 3LE6A 2XZSA 3PG3A 2FB8A 1PMNA 5AUYA 3FZOA 3BV3A 3HGKA 1F0QA 4O0YA 3FDNA 3CPBA 1V1KA 4GJ3A 3BZ3A 3LXKA 4GK3A 3KRLA 3CEKA 4EOSA 2BZIB 3DV3A 5HNGA 5M44A 3MA6A 2P0CA 2R7IA 4FUXA 3C7QA 3TACA 2B55A 2ZDUA 1PYXA 4LGDA 4K33A 5IQEA 2X2MA 3BLHA 2GS6A 4RJ5A 2QU5A 3QALE 5HIBA 4AE6A 5BYYA 5AAEA 1WVXA 5KE0A 3U6HA 3FMKA 3M11A 4XP2A 2RG6A 3OFMA 3SOCA 4IX6A 5IMXA 3FYKX 1JSVA 4GVAA 2EB3A 5L2IA 3EZRA 2OJGA 3CCNA 2CGWA 2VTIA 4MCVA 3OOGA 3A4PA 2V55A 2HWPA 5HLNA 2FSLX 1CKJA 3EQPA 5HE1A 3R1SA 5DRDA 4TL0A 4JVGA 3VHEA 3OROA 3W2SA 3OY1A 3BHVA 5L6OA 2C5VA 4N70A 4EEVA 2WTKC 2HELA 3ZRMA 3MFTA 4YHJA 3QCQA 4CVAA 2WIPA 3HMMA 2FSOX 4S31A 4F7NA 5CEPA 3E8EA 3FI2A 4L7SA 1G3NA 3UQCA 2PYWA 4F6WA 3UQGA 1PXIA 4PV0A 4G16A 4NU1A 3CTQA 4AT4A 1YWVA 2QOOA 4R1YA 3AD6A 4BIEA 4L9IA 4AFEA 4WUAA 4ACDA 5IQFA 2G15A 3QA8A 4FV1A 2XS0A 4YJQA 1XR1A 3ZSGA 3A62A 2PZIA 4WHZA 2VGPA 3TZ7A 2XNGA 1E9HA 3LZBA 2WD1A 2UZOA 4FEQA 3DTCA 3V8WA 4F9BA 4RJ3A 4DEAA 5HBEA 3QQJA 4PF4A 4XG4A 4G34A 3C4WA 4XG7A 4LYNA 5D9HA 4I5HA 5HVYA 4AUAA 2UZEA 3OY3A 2BIKB 4MBIA 4O91A 4ASZA 2PU8A 4BKYA 2QONA 3OD6X 4F63A 3QYWA 2R3MA 5GZAA 4MX9A 1JSTA 2P55A 3SC1A 3QYZA 3O8TA 2PVLA 2GNJA 4GS6A 3R9HA 5CZHA 4B0GA 4F4PA 1P5EA 3KFAA 3A8WA 4I92A 1KV2A 3HUCA 1QPEA 3RAKA 5EYKA 3ETAA 3Q4CA 3SXFA 4ASDA 2WTCA 3GNIB 4U3YA 4U81A 2VO0A 4JRNA 5AMNA 3ZSHA 4AGUA 4OGRA 4U45A 2UZTA 2XKFA 4D58A 3QX2A 4JJRA 2QR7A 3I79A 4AA5A 4IHPA 3TNIA 1BUHA 4IADA 5AP7A 3EFKA 5KUPA 4TW9A 4I6FA 4S2ZA 2ESMA 1W82A 3GC7A 4D4SA 4FZ7A 1O6YA 1HCLA 2RFSA 4FYNA 2WMXA 3KL8A 3IOPA 2PE1A 2YHVA 3CP9A 1LEZA 2VX3A 3CPCA 4NZWB 2WNTA 3FAAA 2XNBA 2R3RA 2JDSA 5JRQA 1TQPA 5H3QA 3FLZA 3DQWA 3I7CA 3Q5IA 5IEYA 2CKOA 2XYNA 4KIQA 5AUZA 1XH6A 3A61A 2YWVA 1WFCA 2AYPA 4AQCA 2XEYA 3UVPA 3TTIA 5JMSA 4BCGA 2WZJA 4ZLZA 2ERZE 4WA9A 3T3UA 1K9AA 3V5TA 4ZLYA 2PY3A 5HD4A 5IPJA 2A27A 5IUGA 4DGLC 5M4IA 3CLYA 4GT3A 4DF3A 4RIXB 2W0JA 1ZMUA 4RJ7A 5EW3A 2RL5A 2ZVAA 3CQEA 3JYAA 3ZHPC 4RZVA 3KN5A 4FF8A 1S9IA 2YISA 4WO5A 2E9UA 4BDGA 5HZNA 1MUOA 4IAAA 4EJNA 4K8AA 3T9TA 3U9CA 5CSPA 1PKDA 3BWJA 2Q0NA 4JG8A 4V04A 3ANQA 2CCIA 3K5VA 3NCGA 4HYHA 3RI1A 5AV1A 3FBVA 1BL7A 5HG8A 1ZYJA 2R3JA 4G3CA 1YXUA 1QPJA 2WMAA 3WYYA 2ZOQA 1PXNA 4BRXA 2PE0A 3D15A 4GSBA 2QU6A 4WSQA 5AM6A 4MH7A 1UWHA 4IM0A 4CRLA 4L42A 1PXJA 5AP4A 4ZSJA 3NUXA 2IW6A 4JQ8A 2QOIA 2UUEA 2XMYA 3O51A 4YO6A 3QF9A 4D1ZA 3NW7A 5B2KA 1V0PA 3Q3BA 2UZDA 4UZHA 5FWKK 1QCFA 3SKCA 3GCSA 3QD4A 1NY3A 2Q0BA 4I24A 3LLTA 5CI6A 2OXDA 4FV7A 4AGDA 3O7LD 3UOJA 1CKIA 1ERKA 3HL7A 4Y73A 4M69B 3FZSA 3NUAA 2JGZA 4LQMA 4DLIA 3G51A 1G5SA 4FNZA 4UN0C 2VD5A 4QTDA 3LFQA 3CGOA 4XG9A 3RMFA 3DDQA 2GNGA 4GFMA 3UYSA 3R6XA 3ET7A 4UMPA 3FY2A 2BROA 2C3JA 4TRLA 5KHXA 5E8UA 3EMGA 3IPHA 4O6LA 4CTBA 5HU9A 4XYFA 4FTRA 3KXZA 2B9IA 4C61A 4DFBA 3WARA 4DHFA 4KWPA 3BEGA 3QHRA 4MKCA 4CT1A 5H8EA 4A9TA 5KMIA 4O1PA 3S1HA 2GNIA 1ZRZA 2ITWA 4J98A 4UV0A 4LRKA 4Y85A 4EUTA 5IDNA 2AC5A 4D1XA 2EXMA 3B8RA 3EZVA 4X3JA 1Q8WA 4I0TA 4JIKA 1SYKA 3D4QA 3D9VA 4YZNA 3RPVA 1O6KA 5EI6A 5BVEA 2X0GA 4YNOA 4QNAA 3QLFA 4FKJA 3BQCA 4Y5HA 3KVWA 3TV6A 1ZYCA 2YJRA 4IANA 3W33A 5CYIA 1XBCA 2JKMA 4XG6A 5DR2A 4BYIA 2XK6A 3DAEA 1WCCA 3FKNA 4ANBA 3MH3A 4IAIA 3PA5A 4GUBA 5IQAA 4YTFA 1XHAA 2X7FA 5J95A 2VU3A 2QODA 1OIRA 4FZAB 1H1RA 2G2FA 2OH4A 4L3LA 4WNMA 3RNIA 3WF9A 2XH5A 3R73A 2FGIA 5J1WA 3PVGA 3ZFXA 4QTBA 2YFXA 2WEIA 3E8NA 5LJJA 4BIDA 1YI3A 3EYGA 3TCPA 3DB8A 3COHA 4ZTMA 4G6OA 4BCMA 4D2SA 4FSTA 4RIXA 4H3QA 4GRBA 2ETKA 1E1XA 3LXLA 2XK4A 3E8CA 4BCHA 4KKEA 2WMSA 4E5WA 5CQWA 5JGAA 4JBOA 2C68A 3JR1A 3U87A 1SVEA 2QHNA 4IJPA 5FQDC 2V5QA 3M42A 4Z7HA 4NW5A 4L8MA 4D0WA 5M07A 5EHOA 3FMDA 4WD5A 5D10A 4IAKA 2QI8A 4NM7A 4NM3A 5TKDA 4LL5A 4F09A 1B38A 5HHWA 2VWVA 3UC3A 1OI9A 2OO8X 3FMNA 4ZJIA 2VTHA 4TY1A 4JBQA 3U8WA 2O64A 5AV4A 2JAVA 3ZUTA 3LAUA 4FT3A 3BLQA 5CTPA 5CT0A 2C0OA 3W18A 4ASXA 4YJSA 5E92A 3WF5A 4MQ1A 5AV2A 3UNKA 1SNUA 4X2GA 1R0PA 2YZAA 4JQEA 4AS0A 2Z7SA 3Q60A 3K3IA 4OT5A 5CVGA 3KMMA 3RZBA 3V51A 2FUMA 3RJCA 4XG2A 4JAIA 4IH8A 3PG1A 4E20A 3PP0A 4BI0A 3MIAA 3SQQA 3NNXA 5HG7A 4FIEA 4G3DA 3G15A 3BYMA 4CSVA 4M69A 4XH6A 4IM2A 4C4JA 3KXGA 2C6IA 4WRSA 3E5AA 3NW5A 3RPSA 3KREA 4G31A 3OWJA 5HNIX 4DEBA 4QMLA 4FGBA 4I0SA 3OC1A 4AT5A 2VN9A 3DFCB 2C6OA 4LFIA 3ZC5A 3TIZA 5CWZA 3ZBXA 2YIRA 2VO3A 4BGQA 1P14A 2UVXA 4BN1A 2PVRA 1PXKA 3BYUA 2VNWA 2C30A 4FMQA 5E7RA 4PY1A 1YQJA 5AV3A 5AP3A 2QLQA 4EQCA 3FQEA 4FZFB 4NJDA 4GKHA 3RCJA 4EORA 2XIKA 4YU2A 4OTQA 1LEWA 4ZJJA 3HMIA 2J5FA 3OP5A 2Z2WA 4DE4A 3AOXA 4U7ZA 3VAPA 4ITJA 4W4WA 5K0XA 3REPA 3FZPA 5BVWA 3R8VA 5E8XA 1I09A 5BUIA 3U4WA 3IO7A 4NCTA 4AZSA 3ODYX 4QP4A 5E8VA 3D7ZA 3Q52A 2PVHA 2R2PA 1YI4A 2PZYA 3KMWA 4R6VA 5HE3A 5CAOA 3HV4A 3COIA 3C13A 3CKXA 4O0TA 4W4YA 5L3AA 5IUIA 4QT1A 5KBRA 4QRCA 5M4CA 5CU6A 4LOOA 1W84A 4KINA 4WG5A 4BGHA 2XJ1A 4DBXA 4FV6A 4L6QA 1A9UA 4ZSGA 2XKCA 1RW8A 2ZV9A 4Q2AA 5GZ8A 3BV2A 4K77A 2ZAZA 4LOPA 4R7IA 4U79A 2X7OA 4AGWA 5B2LA 2BIYA 2BRHA 3A8XA 2QQ7A 4EZ3A 4IJ9A 2VTJA 4HYSA 3NMUF 2FA2A 3CY2A 4FOBA 5CX9A 5GHVA 3SDJA 1OBGA 1JWHA 2BAKA 1IR3A 2JFLA 2PVNA 2XIYA 4RIOA 4EWQA 3D5UA 5BQ0A 2CSNA 3BLRA 2R0IA 4B8LA 3ULIA 1OPJA 4TN6A 3VJNA 2PMNX 3C4EA 3UIBA 1APME 4BDDA 3OT3A 3BYSA 1JAMA 2R3PA 5JGDA 3MYGA 2CN8A 3G5DA 2P33A 4BZDA 5EOLA 2YLEA 2G9XA 5J5TA 2HK5A 1YWNA 3A7GA 3EN4A 5HGIA 2ITTA 2BZKB 3I4BA 3LM5A 5EHLA 2OXXA 4PP7A 5I9XA 3R7VA 3DQXA 2HIWA 5ETAA 3EFLA 3DZOA 5J8IA 2OJIA 4LRMA 4I5MA 2VAGA 3TIYA 4FTCA 5AP5A 4PMSA 5L8KA 2ZM4A 3D5WA 4QMYA 2IVVA 4IB3A 4DH7A 3SRVB 4C0TA 3TN8A 3MVMA 4FTUA 4J53A 2H96A 3CIKA 2QURA 3FLQA 2VX0A 3DKOA 5BUJA 2FSTX 3R01A 4RIWB 2O3PA 2X81A 2UZBA 3MTLA 2HXLA 1XO2B 3EB0A 4QQJA 3DKFA 5E8YA 3W2RA 4IBMA 4KS7A 5JK3A 2HXQA 4FYOA 3OW4A 2QR8A 3IK3A 2I0VA 2IW9A 2W99B 5C8KA 3QFVA 4RX9A 3DA6A 4KBCA 2Q83A 3MPAA 5D1JA 4P7EA 1Y6BA 3B8QA 4CFXA 4KUJA 4L46A 4AA4A 3O23A 1ZMWA 5FEEA 3U6JA 5JFVA 5IH6A 1OITA 2HY81 3NIZA 5AR5A 5HI2A 2OSCA 2W1CA 3NRMA 2YERA 5FTQA 2OXYA 4M12A 4DITA 4UX9A 3QQHA 4DFNA 3NAYA 4A4LA 3TZ8A 2BCJA 2YM6A 3UMXA 2GMXA 4LL0A 4FT9A 3MY1A 4FKUA 3CR0A 1GAGA 1ZY5A 3PJ2A 3RK9A 2JIVA 5IISA 5LMKA 3QTRA 4WRGA 1PW2A 1UVRA 5GNKA 2VGOA 3FLSA 5ANOA 4PMMA 4UWBA 5HLPA 4CRSA 4CZTA 2CLQA 1CSNA 3QTZA 5FM3A 5JH6A 2CKQA 4F99A 4F6SA 3SGCA 2XJ0A 5J7HA 4QD6A 3NYXA 3QZHA 3LKMA 2I0EA 1H27A 4FSZA 4L01A 5LVMA 2XF0A 1REJA 4PTCA 3SG8A 3C5IA 1SNXA 3EL8A 4AOJA 5IA1A 2YCQA 4DFLA 3O71A 2YEXA 3VIDA 5AR4A 3F7ZA 3FQHA 3L8SA 4KIKB 5DBXA 4AOIA 2J4ZA 4DLJA 4M68A 2QC6A 4D2VA 4UXQA 4CFFA 2A1AB 4EH7A 3HKOA 3ORXA 4G1WA 1JBPE 2RFDA 2IO6A 3ZYAA 5E1SA 1Z57A 2E9OA 2FSMX 2QO2A 4XG8A 5DE2A 4C4FA 3IW5A 5JQ5A 3KXNA 3QWJA 4FOCA 4M0ZA 5J79A 2C0TA 4QPSA 2WMTA 4JXFA 1O6LA 2O8YA 4BI2A 4XCUA 3RWPA 1FINA 4QO9A 3DKGA 2EVAA 2W06A 3R2BA 1UWJA 1XBAA 3GC0A 3RWQA 2OWBA 4U42A 5CF6A 3RK5A 3UPXA 5EH0A 4EUUA 4WNPA 3SXSA 5JT2A 3POZA 4ZLOA 5IH4A 3JVRA 4BCPA 5AX3A 3W2PA 2QOHA 4RLLA 5HU3A 2C6TA 5EQYA 4AZWA 3FE3A 4HZRA 3F3ZA 3Q04A 5IA3A 4NKAA 2QOCA 4DCEA 3V6SA 5IA0A 2JIIA 4FEXA 4AW0A 2NP8A 3OHTA 3SRVA 1WMKA 3DBDA 3BHUA 3ZRLA 4NK9A 3QRIA 2GNLA 4KRDA 5HNBA 4RIWA 2WOTA 4C34A 2F7XE 2J6MA 2HWOA 2CPKE 3I60A 4YO4A 3Q4ZA 3E3PA 3PSCA 5ANKA 3HLLA 1Q24A 4UYNA 4QMOA 4AF3A 4FEUA 3JPVA 4DEHA 3QQKA 1XKKA 4RVKA 3VUDA 2UW3A 5IMEA 3UOKA 1ZOHA 4QP8A 5AR8A 4ZTQA 3ALOA 5C26A 1KV1A 4JBVA 4L53A 5LARA 4EONA 2W9ZB 4EH2A 4V01A 4O96A 2GS7A 1PMVA 2UW4A 3QKLA 5IUHA 1JKTA 3ANRA 3P78A 4BIBA 4H05A 4NCTC 4BGGA 2BVAA 4EOQA 5ANJA 5F95A 4L52A 5EYDA 3VBXA 3TKIA 2YM5A 4KD1A 4BICA 5HCYA 5E90A 5TT7A 4RWKA 2W1EA 3MY5A 3CSVA 2VNYA 3QZGA 1GOLA 4TWCA 2ACXA 4FIIA 2R3HA 3FHRA 2VWWA 5DIAA 4OLIA 2F2UA 5BUEA 3KCFA 3VULA 5DYJA 4ANLA 3OXIA 4TYGA 4QP7A 2OJFE 2R3OA 4ZTHA 5EKNA 2Z8CA 3C0HA 3R1QA 4UWYA 4R7HA 4BDCA 3C4XA 3GC9A 3TZ9A 3UE4A 2XK3A 4FSRA 2VTPA 4QYYA 3RKBA 3SW7A 3R8UA 3VF9A 3FMMA 3FSKA 4E7WA 3RM7A 3ZEPA 4EQUA 5CASA 3UP7A 5CF5A 4OBQA 1U46A 3U51A 3WF8A 1MRUA 2WMRA 3OVVA 4FTIA 4KIKA 4YJVA 2PUNA 1PJKA 5AA9A 2RFNA 2UW7A 3GQLA 3EQFA 3N4VA 5FXSA 3RPYA 1BX6A 4JDHA 1ATPE 3BQRA 4NIFB 4RX8A 2BZHB 4JX3A 5CSHA 4EZ5A 4XLVA 2LAVA 4UWCA 3MESA 5GINE 5EM7A 2XRWA 2X39A 3PTGA 5ANGA 4W8DA 5AP6A 2LGCA 4FTKA 4JAJA 5DT0A 1G8SA 4YZBA 4BHZA 3FXWA 4X2KA 2H9VA 2X2KA 5HCXA 4ZZMA 4P5ZA 1H0WA 3AC5A 3OXTA 4K0YA 2OW3A 2XNMA 5CI7A 3R8PA 3E63A 4RA5A 4HGTA 3BU5A 4IZYA 4LV5A 4PNIA 4FKVA 4APPA 3UYTA 4ACMA 3DDPA 3NEWA 1UNLA 3LFEA 3ZU7A 4F70A 3U4UA 3HP5A 4X3FA 5CQUA 2JAMA 1JOWB 4RVLA 3ZO4A 2ITOA 4F0IA 3FV8A 4BTJA 3PIYA 2F9GA 3NNVA 1U54A 3WF7A 4I23A 1M2RA 5DOSA 1ZYSA 4FX3A 3KEXA 2AC3A 2XKDA 4MAOA 2QOFA 3ZS5A 5IQDA 3MVJA 4ID7A 4BKZA 2YITA 1VJYA 4ALWA 5AUTA 3KXXA 3FL4A 3UOLA 5DG5A 4BR3A 2IZUA 4BCOA 3VC4A 2B9HA 3VO3A 2ZM1A 3GCPA 3HAMA 5F94A 2IZSA 3VQHA 4FEVA 5KMKA 1Z9XA 4QTCA 2R3FA 4A4OA 3UNJA 3BHHA 4C4IA 4FV8A 3R21A 4E4NA 4ZAUA 5BNJA 4CKRA 2I7QA 3OW3A 5A4TA 3BBWA 4FKTA 3RZFA 3N4TA 4O7VA 3IDPA 4DBNA 2PK9A 3FXXA 5F1ZA 1Q8YA 2JKOA 1R39A 3CBLA 5EK7A 4DGOA 4YZCA 4V0GB 3E7VA 2W4OA 4PUZA 3GP0A 4ZOGA 2C0IA 3R04A 4IVAA 5LMKC 1ZYLA 3BGPA 5AUWA 2GQSA 5FEDA 3FEGA 5M09A 3ODZX 4MXCA 3TT0A 4BWPA 3MS9A 5J7BA 1KE9A 4XEYA 3GCUA 4RC3A 2BFYA 3UO4A 4IE9A 4P90A 3NYOA 4ZTLA 3FPMA 4BDIA 2ZJWA 4J99A 4DH1A 2QO9A 1OL6A 3H9RA 3MJ1A 4FUYA 4RQVA 2XBJA 1DI8A 3E3BX 4O84A 3HYHA 4MVFA 4NW6A 5BX0A 4TNDA 2BDFA 4OTGA 4YSMA 2XRUA 1UKIA 3HEGA 5JFWA 3AMAA 5HBHA 4E3CA 1MRVA 1ZXEA 4RLKA 4R5SA 2WO6A 5E91A 2P4IA 3QXPA 4GIHA 2ZM3A 3LQ5A 3PVBA 4GG7A 5LVOA 2GSFA 3DCVA 3ORPA 3VS1A 5IQCA 4EOJA 1IEPA 5CAPA 3UZRA 2C69A 3Q6UA 4QNYA 4L3JA 2OIQA 1YOJA 3MA3A 4UB7A 4DGGA 4TWNA 3EQHA 3HAVA 2UZLA 2ZV8A 2PMOX 3HRFA 4GFOA 4NIFA 4DGNA 4FODA 3SLSA 4D4RA 4D28A 1CKPA 4XBRA 1OUYA 2YDIA 3V5LA 1GZNA 4CCBA 4RWIA 2BTSA 5HG9A 2W7XA 2WXVA 3OZ6A 1WBOA 4H36A 5BVOA 3FC1X 2XKEA 5I9UA 2RIOA 1I44A 4B8MA 4YC6A 2A19B 5BPYA 1UNHA 5EM8A 4FSUA 4C36A 4BCIA 4O0UA 5CSXA 3I7BA 4Q9ZA 5LQFA 2EB2A 2HOGA 3QBNA 4II5A 1AD5A 3KRWA 4BCQA 4D5KA 2J50A 1Q61A 3VW6A 4GT4A 3D2IA 4A9SA 4YTIA 5CS6A 3TM0A 5E8SA 4TWOA 2R9SA 3KXHA 5EI8A 2OZAA 3NDMA 4D0XA 2G1TA 4RQKA 4DFZE 1F5QA 4FV4A 3ZDIA 3ZOSA 2HZNA 3TJDA 4B9DA 3R9DA 5KMLA 3P08A 1XWSA 3ZM9A 5DEWA 4BHNA 4O6EA 1ZWSA 3LMGA 1XJDA 3RNYA 4CG9A 1NVRA 2B9JA 2J0IA 3MTFA 5LXMA 1JVPP 5AX9A 3FHIA 5CEIA 3VBQA 4LOQA 5ANDA 4B99A 3POOA 3A7JA 2XYUA 3GT8A 2JDVA 3R30A 1PY5A 4YJNA 4YZMA 1QMZA 3FQSA 3GC8A 3U6IA 1H1WA 4I21A 2C3KA 4C37A 5J9LA 3NYNA 1YW2A 3F7WA 5CU4A 4ZSAA 4FNXA 4XV2A 3UBDA 3VRYA 1OKVA 3ATSA 3NNWA 5L2QA 5CAVA 5K4JA 3AQVA 4LM5A 4YNEA 1EH4A 2NRUA 2XIXA 3FUPA 3QA0A 2IN6A 4V0GA 1PHKA 4ZXTA 5JFSA 4NWMA 1YXXA 4RVTA 3NX8A 3VJOA 1GJOA 2VWZA 1JPAA 3PLSA 4ZMFA 1YDTE 4I4FA 2R4BA 3BPRA 3FWQA 4MXYA 3FMEA 3ZFMA 2X6EA 4OBPA 3R7EA 4D2RA 2XEZA 2Y6OA 3DKCA 2YIWA 5CU0A 5IH5A 4FK6A 2IVTA 3DXPA 4E6AA 4X2FA 4YZ9A 4AGCA 2A2AA 3CY3A 3F82A 4GKIA 3BELA 2V7AA 1R3CA 1YKRA 3H3CA 3OCGA 3WOWA 3LXNA 1FGKA 5JZJA 1J7UA 3ACKA 1P2AA 3PJ3A 3LPBA 3MB6A 5EW9A 2NO3A 2GNFA 5AFVA 2VWUA 4DEIA 4AACA 4FV3A 2F49A 4O7TA 5CU3A 2YJSA 3S3IA 3AGLA 4FKGA 5M53A 3A7IA 3ZMMA 4EH3A 5HLWA 4M8TA 3F88A 3PSBA 4U41A 3E92A 4F9AA 4BKJA 3DTWA 3VS0A 3N51A 2WEVA 1MRYA 3D94A 4RGJA 4W9WA 5AP2A 3ZUUA 4BZNA 4XJ0A 4O7NA 3OT8A 3R9NA 3EN6A 4Q9SA 3MVHA 2C6DA 2JBPA 3GXLA 4X3FC 1ZLTA 4WT6A 3ZFYA 5CT7A 3ORNA 4RMZA 5FEQA 4DN5A 3TTJA 2O2UA 1B39A 4H58A 5LVLA 5K5NA 4J71A 4NH1A 4FTLA 5M4FA 5C03A 3PE2A 2XNPA 2OFVA 5JN2A 2JFMA 4NTTA 1H01A 4D9TA 5DN3A 4TKSA 2PVYA 2OGVA 3E88A 3LFDA 4D2PA 5AP0A 4FVRA 4QQ5A 1Y8GA 1NW1A 3G2FA 1FBNA 3P7AA 1KUTA 4NUSA 2CGUA 4WUNA 5C27A 3OWLA 5C8MA 4OAVB 3VW8A 4AN9A 4BVUA 2FO0A 2B53A 2JKQA 3PPJA 4H3PA 4F1TA 5AV0A 2H34A 3MDYA 1KE7A 4AE9A 4KS8A 5A4LA 1ZYDA 3P86A 3HECA 4GJ2A 4KBKA 5T3QA 2HW6A 4MD9E 4QQCA 4D5HA 4FKPA 4X2JA 5HESA 5IA5A 5KHWA 2ITQA 5AUUA 3ROCA 2J2IB 4YJPA 5I9YA 4RC4A 3MVLA 3C50A 2WQEA 3WF6A 4PPCA 3V5JA 2X8DA 4FKWA 4H1JA 4PL5A 3ORMA 1W7HA 1H28A 3NUSA 2ZB0A 4M14A 3O7LB 4EOKA 3U9NA 4UZDA 3PPZA 1PXPA 2CKEA 2I0HA 3ZH8A 3EKNA 1Q97A 4DH5A 1H25A 4UMUA 5J5SA 3UZTA 1Q8UA 3H10A 1UV5A 2ZDTA 4EOLA 2W1IA 2ETRA 2V0DA 2YCFA 4DCAA 4FICA 4V05A 4LI5A 3ZDUA 3E64A 3MFRA 3BYOA 3EQGA 3PJCA 1OMWA 4I6QA 4XG3A 5D7VA 3VUIA 3MN3A 4CZUA 1V0BA 2OZOA 3ACJA 3O8UA 4Y83A 1QL6A 2WU6A 3NGAA 3ZONA 3OCTA 3VN9A 2XB7A 4K6ZA 4NKSA 4AA0A 5T68A 3ZM4A 1IASA 4KSPA 4AAAA 3F61A 4KKGA 5H8GA 4EI4A 1M7NA 4ZTSA 5KO1A 2PULA 5IZFA 3RP9A 3R7GA 4JDKA 5CAQA 4U6RA 3C4CA 4R77A 4FTTA 2Z7RA 3AD5A 4ZZOA 5HX6A 3AD4A 3HZTA 3CD8A 3EN5A 3VNTA 3E62A 1TKIA 4CXAA 3QTQA 3DK7A 3ENMA 3PXKA 3QLGA 4FTJA 1LP4A 1OL2A 3F3UA 3R7IA 3GU7A 4MTAA 5E8WA 4FT7A 4LMUA 4BFMA 4ANMA 2R0UA 2QOQA 5G6VA 3V04A 5JFXA 4MF0A 4BY9E 1Q8ZA 3H9FA 1W98A 2VZ6A 3M2WA 4FIHA 4EKKA 5ANEA 1ZOGA 4NT4A 3DJ5A 2OK1A 3W1FA 2OICA 2CCHA 4YPSA 1H00A 4GUEA 1JSUA 3EIDA 4GCJA 4JIAA 4O0WA 4X6QC 2GPHA 3CQUA 5I0BA 2YDJA 1J7IA 3EN7A 4BTKA 1JLUE 2VWXA 4L3PA 4OR5A 2YCRA 2YCSA 3BE9A 2FH9A 1Q5KA 3BRBA 2X9EA 4BBMA 3VS6A 3ZLXA 3WYXA 3PJ1A 2VRXA 4O1OA 3V5WA 5CALA 1PF8A 2WU7A 4C3FA 4BB4A 3DU8A 3V5PA 3FYJX 4XLIA 2B54A 3LLAA 2WTIA 5E9EA 4EQMA 3ORTA 3VUGA 3S00A 5J1VA 3NUPA 4RG0A 2QO7A 1BL6A 3LOKA 3PA4A 4WOVA 4CQEA 2WGJA 5C01A 1M7QA 4FC0A 5HEZA 2IG7A 2UZNA 5EKOA 1H8FA 2XK9A 4YJOA 4FKRA 3EJ1A 5AA8A 3GU5A 4C4HA 4GT5A 2C6KA 3IW6A 3IKAA 3ZEWA 5GJGA 4DINA 1W0XC 3EQBA 3Q6WA 4JT3A 3VS5A 5LWMA 4MF1A 3MGYA 4GU9A 3OEZA 5LMAA 3NVMB 1FQ1B 2IJMA 2PE2A 3Q4TA 4I5CA 4C4EA 5CANA 1YXVA 4XOZA 3LVPA 4MXOA 3WZUA 2R3QA 4U9AA 4X6RA 2ONLA 3P7CA 2BALA 3LW0A 5EW8A 4EK4A 5A54A 4E1ZA 3OF0A 3LXPA 3OOMA 4QMZA 2UW5A 4M97A 4FKQA 3QWKA 2YA9A 4BDKA 3G6GA 3VUHA 4I6HA 4F0GA 4C3RA 4A06A 5C4KA 3E87A 4TYEA 3HX4A 4PX6A 4HCUA 4C4GA 4RFZA 3O17A 4FKLA 4NM0A 1X8BA 4M13A 2J0LA 4FL3A 4QMMA 5A4CA 3LJ1A 4GK2A 4OBOA 1WAKA 4BL1A 5EDPA 3W8QA 3ZCLA 5HX8A 5CEQA 4IX4A 4TNBA 2Y4IC 2R3GA 5I9ZA 4IIRA 1OIQA 5F4NA 3F2NA 2W5AA 3A7FA 4AFJA 3F3WA 3F3VA 1ZMVA 5EDRA 4ANQA 3CQWA 3TKHA 3D83A 5FM2A 2XK7A 2C6LA 3NAXA 5CNNA 2CNVA 4BCJA 4TYHB 2XUUA 4FVPA 3IDBA 2G01A 2W5HA 3EFWA 4FSNA 3E7OA 4FNYA 5IG1A 4CD0A 3G9LX 4M15A 1KE5A 2RGPA 4GH2A 3QD2B 2KULA 2P3GX 4ACCA 3QGWA 5F20A 4G2FA 4IX3A 4QP3A 2B0QA 4G3GA 3OXZA 4NJ3A 1A06A 3SOAA 2WTJA 3PDTA 3NUUA 4OT6A 5KKRC 4AOTA 3TUDA 4PPAA 4DC2A 3V6RA 3NZ0A 3DFAA 3OWPA 4FG7A 3VS7A 4AW5A 4D2TA 4GK4A 2UW6A 3A7HA 4G9RA 4ITIA 3NW6A 1DAWA 4IQ6A 3GOKA 4O81A 3GFEA 5HO6A 3R7YA 1ZARA 5BMMA 4DEEA 3DAKA 3QKMA 2PHKA 4KA3A 2ZMCA 1Y8YA 3CTHA 5FTOA 3BU6A 2X9FA 3EQCA 5M55A 2J0JA 2BKZA 3I1AA 3LCTA 4F1OA 3D7TB 4ANSA 5HORA 2QG7A 3ID6C 1OL1A 2O65A 5HQ0A 1H1QA 1UKHA 3B2WA 3BI6A 2GHMA 3ZUVA 4IB0A 3H30A 4HGEA 1VEBA 3IG7A 1M52A 4U97A 3PIZA 4RFYA 3S4QA 4EJ7A 2HW7A 3UTOA 4ZEGA 4I93A 2BPMA 3OUNB 5DNRA 1PXMA 3PP1A 4L68A 3FZTA 3G6HA 3KVXA 5K3YA 3KRRA 3KKVA 3UOHA 5AAFA 4IWQA 4E6QA 4GFGA 4YHFA 2HYYA 4K18A 5EM5A 5CZIA 3WZDA 5HE0A 4CYJA 1TVOA 3HUBA 4CFWA 5IEXA 4WNKA 5DEYA 4ERKA 1ZZ2A 4A9UA 4DT8A 3QTIA 4AZVA 1IA8A 4EH5A 4ORKA 3QAME 3UPZA 3QGYA 5H2UA 2BZJA 5HO8A 3MFSA 4HVIA 3I6WA 2OJ9A 2BTRA 2Y7JA 5DA3A 3ZZWA 3R1NA 2WTWA 5HTBA 3SVVA 4EH6A 2JITA 5DVRA 1DAYA 2R3LA 3JS2A 5DMZA 5IU2A 3F6XA 5DI1A 1IRKA 2OIBA 2VWYA 5CSWA 5C1QB 5A9UA 1SMHA 2E2BA 4RA4A 1OKYA 2UVZA 1WBPA 2PWLA 3ITZA 2BHHA 2C6EA 3G90X 3LCOA 1GNGA 3ZO3A 3DXQA 1W83A 4H3BA 4U0IA 3FZ1A 4DT9A 4FE2A 2Y8OA 2GQGA 3PZEA 3R00A 4F9WA 4TXCA 4ZTRA 3RHXA 4FKSA 4QP2A 5K5XA 4GEOA 3ELJA 3D5XA 2JEDA 4J52A 2W17A 4PDSA 4WNOA 4I22A 4BDJA 3KULA 5IQHA 4N6ZA 4MXZA 2RG5A 1MQ4A 4ENYA 4IDTA 2CNUA 3MPTA 1OECA 2BR1A 4RPVA 5CSVA 4N6YA 1DM2A 3FKLA 2NNWB 2VWBA 3CD3A 1LR4A 3EQRA 1NA7A 3QHWA 4HGLA 5TF9A 3TV7A 4EYMA 4Z3VA 3G9NA 4TYHA 1M2PA 2C3LA 4UALA 4ZMEA 5CEOA 2PVJA 2IWIA 5C9CA 4WG4A 4IB5A 4FSMA 3W8LA 4HPTE 3D5VA 3W55A 3FLYA 3TV4A 3EOCA 3L9NA 4K11A 4G17A 1SM2A 1P4OA 2B7AA 5D7AA 2CGVA 5ACKA 4U5JA 3I0OA 4FTAA 3OS3A 3L8PA 3WILA 1FMOE 2OBJA 4X3FB 4D1SA 1R0EA 3CC6A 1WZYA 5D41A 4CKIA 2WOUA 4YBKA 1NXKA 4EC9A 3MSSA 5LVNA 4IZ7A 4AW2A 2GTNA 2OFUA 1REKA 1U54B 1OPLA 1T45A 4PTEA 3VUMA 1YWRA 3AG9A 5HVKA 3TWJA 3SHEA 3QQFA 4PNKA 5AJQA 4AT3A 3VVHA 2JIUA 5A46A 4ZP5A 3DBQA 3VHKA 2DQ7X 5HO7A 3C5UA 1B6CB 1NVQA 1P4FA 2RSVA 3D7TA 5FP6A 4FTOA 3EHAA 4NFMA 5AR3A 4O7RA 4RBLA 2WMQA 1OBDA 4KNBA 3PE1A 4DTKA 4P5QA 4LUEA 4DG2E 3CE3A 4C58A 4NEUA 5TO8A 2UZUE 4QP6A 3SAYA 2WQBA 2FVDA 3MPMA 4O27B 4BF2A 4YZDA 3UO5A 2GQRA 4BI1A 2QOBA 2RF9A 4L7FA 3CXWA 3C0IA 3R2YA 1YI6A 2ONLC 4J95A 5FG8A 1CMKE 4UXLA 4CQGA 4EH4A 4YJRA 4CMOA 2GCDA 1GZKA 2Z7LA 3IONA 5M57A 2GNHA 4FZ6A 4YJUA 4TWPA 4C33A 3L9PA 2WTDA 2R7BA 3IS5A 2B4SB 4W8EA 4Z7GA 5KMJA 3WE4A 5FLFA 2RKUA 3KQ7A 3WZJA 4G6NA 3NVKI 3JY9A 3EYHA 3WZKA 3LHJA 3KGAA 3QQLA 4EHGA 4G5PA 2HAKA 4ACHA 3S95A 4L67A 1KE8A 4X0MA 4BC6A 5BYLA 5A4QA 1L3RE 3MI9A 4FV2A 4JI9A 4CEGA 3F2RA 2HZ4A 4JDJA 5BVKA 2XK8A 2W1GA 2XM8A 2V22A 2OG8A 3O8PA 2PUIA 1FMKA 2O63A 3MH2A 4PRJA 5CY3A 2XNOA 2HZIA 2B9FA 3T3VA 3F69A 3C9WA 3EH9A 4CT2A 1UU8A 2NRYA 4E26A 4AZTA 3PXYA 3OCBA 2C1AA 2QKRA 4ERWA 2OIDA 5E8TA 3HV3A 3HDMA 5A14A 3UIXA 2P2HA 3TNWA 3ZO1A 3A4OX 3EL7A 3NPCA 4IMYA 3OEFX 4FA2A 2PUPA 3NUYA 3QXOA 5HIDA 1WBNA 2G2HA 4QMUA 1J3HA 3IW4A 4ZY4A 2GTMA 3QQUA 3ZXTA 3L8XA 4AZEA 3Q5ZA 2C5XA 3IOKA 1ND4A 3AC4A 3QTUA 2DYLA 2QOLA 3TEIA 4E6CA 4LRJA 3GU8A 3JXWA 4Y8DA 4AXAA 2X4FA 5HTCA 4ZY6A 4E4MA 4E5BA 3RAHA 4Z55A 3RM6A 2I6LA 3KU2A 4MD7E 4RSSA 4QMQA 1IA9A 4L44A 1U5QA 5CVFA 1Q41A 4GYGA 5ACBC 4R3CA 1LUFA 4F7JA 2OZAB 1WVYA 4W4XA 3OCSA 1JKSA 3HA6A 2B1PA 2X6DA 3KF4A 3P23A 3ZLYA 4DG3E 2VO6A 2WB8A 5FTGA 3BX5A 4HJOA 4OTPA 4I20A 3SD0A 3P79A 1UA2A 3CKWA 4MHAA 2QHMA 4O7SA 1H1PA 1KWPA 1XH5A 3PVUA 3R02A 4YTHA 2BAQA 2UW0A 5CU2A 5T6KA 2XNEA 3EN9A 3VUKA 5KMNA 3SG9A 3AMYA 4TYIA 4JBPA 2VWIA 5EQEA 3NNUA 5CLPA 4PL4A 5DH3A 3GEQA 3V3VA 3FMHA 4YHTA 4BDBA 2E9PA 1M14A 3VBVA 2F4JA 2VTSA 5BMSA 1NT2A 3FI3A 4W9XA 5EI2A 1JNKA 4IM3A 4U40A 3IGGA 2EXEA 4BDEA 1Q4LA 4CMUA 4JS8A 5GZ9A 2BAJA 5C8NA 4W4VA 3UNZA 5EHYA 3V8TA 5IQBA 2YIYA 1RJBA 4CFNA 3A99A 3QRJA 4YBJA 2W4KA 3GVUA 5I3OA 5K0KA 4QYEA 1G8AA 1IG1A 4O7YA 3R9RA 4E73A 4A9YA 1CTPE 3KN6A 4DGMA 4NSTA 4YURA 3I5NA 4C02A 3CS9A 3QUPA 1AQ1A 4PP9A 3MH0A 3W2OA 4GIIA 3TKUA 2ITZA 3CGFA 4OW8A 2F7EE 2JKKA 5DLSA 1GZOA 4O83A 3FL5A 3RINA 5DHJA 5FD2A 1U4DA 4JDIA 2C6MA 2PMIA 3ZC6A 4FSQA 3LFFA 3UIUA 1KSWA 3Q2MA 5HKMA 3QRUA 4MBLA 2JLDA 2PZRA 2Y4IB 3F2AA 3P5KA 5FXRA 5BYZA 4OTIA 5HCZA 4C62A 3ERKA 4KB8A 4XNEA 4OTWA 4EC8A 1SVHA 3RPOA 4O86A 4CG8A 2PVKA 4IFCA 3UP2A 4BBFA 4CFMA 1DI9A 3PJ8A 3L8VA 4GVJA 4RIYB 3NSZA 3QKKA 3DS6A 3R0TA 4Y95A 3PLAE 2GHGA 3LJ0A 2HZ0A 2YIXA 4FL1A 4RX5A 4D4VA 5EFQA 4C3PA 3QC4A 1BLXA 1YDRE 3EKKA 4IWPA 2ZMDA 4UMTA 2E9VA 3H0YA 3PIXA 2CDZA 4IW0A 4D9UA 1UNGA 2W1DA 2BILB 4HW7A 2WELA 2QLUA 4AWIA 3QTWA 5CXZA 4CGAA 1RQQA 4C35A 4RJ8A 2OU7A 4E8AA 5B7VA 5KKRB 4FIJA 3N4UA 2ITUA 4YJTA 5ETFA 4F7SA 2JDOA 4RX7A 3DNDA 2BDJA 4YC8A 5L4QA 3TDVA 1Y6AA 2JD5A 3QCYA 4JR3A 4U8ZA 2DUVA 2UZVA 3Q96A 4R5YA 4TPTA 3F66A 4RJ6A 4XV3A 5FDPA 4C7TA 2IVUA 2XP2A 5L2SA 2YAKA 4WG3A 4G9CA 2VTOA 3I5ZA 1OL7A 5HTIA 5DFPA 5BVDA 5H8BA 4JR7A 4WBOA 3UZPA 4QQTA 1WVWA 3LFNA 3PUPA 4QP9A 3I0QA 4UMQA 3KY2A 4NM5A 1BI7A 4EOIA 3VQUA 5LOHA 4GMYA 3K54A 4XS2A 2WMWA 4LGHA 5B2MA 4JQ7A 5DT3A 3L9LA 5J9ZA 4MWHA 4FT5A 4HYUA 3IW8A
chains in the Genus database with same CATH superfamily
3HVCA 1YDSE 2BDWA 4MXXA 3Q9YA 2JBOA 2YIQA 3THBA 4A7CA 3Q2JA 2WTVA 4AX8A 3OMVA 4KIOA 1PRYA 1STCE 1ZY4A 4AXCA 2WMUA 5KMOA 3CJGA 5ANIA 5IA2A 4YTCA 1JKLA 3AC2A 3PFYA 3QQGA 4IAZA 4A07A 5LMBA 3BHTA 3ROYA 2H8HA 4F64A 4CLJA 4S30A 4YLJA 2C5YA 2UV2A 4FKIA 4IACA 4AW1A 4FEWA 4I1ZA 3UDBA 5FGKA 3FMJA 5GIOE 3BYVA 5AIRA 5KZIA 3NUNA 5K4IA 4ITHA 3QCXA 2PZ5A 2XNNA 5IKWA 3PXRA 3F9NA 5AUXA 3RALA 1FGIA 4Y5QA 3EWHA 3LQ8A 1FVTA 4M66A 2C1BA 3LCDA 3P9JA 1FVVA 1UU9A 3PFQA 4APCA 2Z7QA 4P2KA 3O96A 5E4HA 4TYJA 5L8LA 1WBVA 4O82A 2PTKA 4CFUA 5L2WA 5AM7A 3LMIA 4I3ZA 4DEDA 4I5PA 1DS5A 1XBBA 2JDRA 4FZDB 3QUDA 5CXHA 4YP8A 4BTFA 3MY0A 4I94A 3M1SA 4S32A 5GJFA 4BWKA 2J0KA 1QPDA 4N0SA 3TG1A 3E8DA 4M3QA 4O0RA 3R9OA 2R5TA 3QZIA 2BRGA 4I6LA 4LG4A 3W10A 4ANNA 4RIYA 3LMHA 1ZOEA 5G1XA 2PVMA 3T9IA 3WBLA 4E5AX 4ZJVA 4USEA 3WIGA 3NYVA 3R7UA 4E4XA 4ZS4A 4CMTA 4N4SA 3I81A 5HBJA 4FSWA 2VO7A 4DDIA 1H1SA 5FP5A 5EQPA 1U59A 3MWUA 5HICA 2V7OA 4RC2A 3V8SA 5L2TA 2BRBA 3HV7A 1AGWA 2DWBA 3DLSA 3Q32A 4ENXA 2X8EA 4XBUA 1GIIA 3BIZA 4TZRA 2X8IA 3NIEA 4BWXA 3G0EA 3FPQA 3AGMA 3LFAA 3KXMA 4EH9A 3ATTA 2I40A 2REIA 5ICPA 4DTBA 4EL9A 3AT2A 3RHKA 1XQZA 3PY0A 2EXCX 4BCFA 2CNQA 4C8BA 3KRXA 1YHSA 3HRBA 4XV9A 5CF4A 3GENA 3ORLA 3W0NA 3R22A 3UO6A 4MD8E 3TL8A 5HD7A 2PMLX 3DZQA 4AZFA 5AR7A 3A2CA 2A4LA 4QP1A 4M0YA 3FI8A 5CEMA 3PPKA 1XH9A 4ZIMA 4MK0A 5I9WA 3LQ3A 3RAWA 3RK7A 2ZYBA 2X4ZA 3DY7A 2R3NA 4YMJA 5B0XA 4BCKA 3QTXA 3UC4A 1LPUA 4C57A 2YZLA 1G8KA 4R3PA 3BEAA 3ZZEA 1RE8A 2W1FA 4G6LA 4AU8A 4MYGA 4BYJA 3HMPA 4U44A 3F5UA 4F65A 2H6DA 4EBWA 3TNHA 4CYIA 1PXLA 1YHWA 4M7IA 4EK3A 4R1VA 5KMMA 1BYGA 1H4LA 2HENA 2X2LA 4C2WA 3TDWA 3ORZA 3VBWA 3BBTB 3HNGA 2X1NA 2O0UA 3ZO2A 5TOZA 3UJGA 2UW9A 3MV5A 4X2NA 4JLCA 4FV9A 4XUFA 3VUTA 3FC2A 3AT4A 2J9MA 3COKA 3QZFA 4EH8A 4N57A 2HY0A 1GIHA 3SX9A 3FLNC 4QYFA 4O7LA 3GI3A 3FSFA 4QMWA 1SVGA 3P0MA 4LV8A 1NVSA 2XM9A 4JL9A 2CMWA 5GJDA 5M4UA 2PSQA 5AUVA 4CTCA 5AAGA 1HOWA 1WBTA 3B2TA 4FSYA 3WIKA 3FI4A 3MW1A 2QG5A 5H9BA 1QPCA 4RVMA 4A4XA 4NL0A 4OAUC 2WQMA 2BMCA 3N9XA 4J7BA 5KBQA 3PY3A 3R71A 4FIGA 5M08A 4MQ2A 4QMXA 3HV5A 3R63A 5AR2A 5EM6A 5EYCA 4KAOA 4FIFA 5DR9A 4B6LA 2YLFA 4IEBA 2RFEA 3VS3A 4D4YA 4RRVA 1T46A 4IX5A 4C59A 4F6UA 2ITPA 4Q5HA 3R8LA 1YXTA 5BVNA 2Z02A 2ITXA 3Q9WA 1JQHA 1PKGA 4YGAA 5KZ0A 4RWJA 5CEKA 4DEGA 1H08A 3F3TA 2UW8A 3O50A 4D2WA 2OKRA 5I5ZA 2NYAA 2IZRA 3R1YA 4JOAA 5BVFA 2VTTA 4FT0A 4O2PA 2R64A 2ERKA 2BKKA 4PMTA 4DYMA 1JKKA 2WKMA 3DNEA 3IECA 4QTAA 3FXZA 3C4FA 4HVHA 4PQNA 4F08A 2J90A 3DGKA 3SV0A 3LFCA 4LMNA 4C2VA 3NLBA 4BBEA 4CV9A 5ETIA 3R8ZA 4R3RA 1XMMA 3JUHA 4RZWA 1OGUA 2OF4A 4EKLA 5L6PA 1XH8A 4MXAA 5EDQA 2XA4A 3KCKA 4GW8A 3IQ7A 1M17A 3ORKA 5IDPA 3RTPA 2ITNA 4ALUA 4O21A 4FL2A 2VX1A 3DJ7A 3MH1A 5IA4A 2C4GA 2WQOA 3FMLA 3F5PA 4P4CA 3AMBA 5A6OA 1MQBA 4WIHA 3GOPA 3QL8A 4PDYA 3SXRA 4JRVA 3QCSA 4HZSA 4DFUA 2CHLA 3LFBA 3ULZA 5JQ8A 4O2ZA 4ONAA 5J9YA 3MBLA 4L43A 3R7OA 3V01A 4HVGA 2X7GA 3W32A 1ST0A 3CTJA 4GL9A 2Z60A 2YDKA 1M2QA 4K1BA 3EFJA 3PZHA 2VTRA 4O4CA 5ITAA 1VYWA 1PMEA 3AT3A 4FV5A 3ORIA 3QD3A 4LUDA 4U43A 3ZSIA 2VTMA 5JEBA 3G0FA 1CDKA 2QVSE 5TE0A 5JGBA 3WE8A 4ZY5A 3D0EA 4KIPA 2XVDA 1ZAOA 3P1AA 4KSQA 2VTAA 4DFXE 5AEPA 3S0OA 4O7ZA 3W0QA 5IQIA 5EG3A 4K9YA 1R1WA 2BRMA 2VTNA 4X21A 4DTAA 2AUHA 3BU3A 4FVQA 4JX7A 4QTEA 4QMVA 2F7ZE 3PVWA 2F2CB 2XIRA 4I0RA 1XH4A 4HOKA 2WAJA 2YACA 3EQDA 4F0FA 2CJMA 3L9MA 4S33A 3DBCA 2W96B 4GG5A 1OUKA 3KULB 3ZRKA 3HDNA 2O5KA 4H1MA 3ZTXA 3SA0A 3OTUA 4IWOA 3W16A 4CFVA 1OIUA 3BHYA 3GB2A 3GU4A 5L8JA 5M56A 3AXWA 3GBZA 1SZMA 4EK8A 5DR6A 2HCKA 1E1VA 2WIHA 4NFNA 1L8TA 4IC7A 4XHKB 2W5BA 4F9YA 4QPAA 3IDCA 5DGZA 3VRZA 4D55A 5JZNA 1BKXA 3NCZA 3R83A 2Y4PA 4CKJA 4FGRA 3UVRA 2QKWB 5FBNC 4IB1A 1GIJA 2WPAA 3KC3A 4HCVA 1ZZLA 5JSMA 3TI1A 3BL9A 4OTFA 3OBGA 3TUCA 1F3MC 3CJFA 1YRPA 4IAYA 4HVDA 2PUUA 4O0VA 4ARKA 4HVSA 4XMOA 1Z5MA 3OUKA 3D14A 3KF7A 2WTKB 2A0CX 4FNWA 4RWLA 5LWNA 4O22A 2ZV7A 2YM3A 1Y57A 3QD0A 3BGQA 5CAUA 4U80A 4Y72A 4WKQA 2VUWA 5IEVA 4FV0A 5F9EA 5LCJA 4F7LA 4R7BA 5M51A 3RGFA 5I4NA 4UYAA 3UODA 3RCDA 1UU7A 4YR8A 4HCTA 3PSDA 4BCNA 1OIYA 3VBYA 1RDQE 3W2CA 1UU3A 3OG7A 3F5XA 4FI1A 4G3FA 4IZ5A 3VBTA 4XOYA 5LVPA 4F78A 1W2FA 2BUJA 2YM8A 1R78A 3MIYA 3SW4A 1YHVA 3QC9A 1Q99A 4WSYA 2YABA 4EHVA 1Q3DA 3DBEA 3LCSA 2SRCA 4G5JA 4IZAA 4O4EA 4CCUA 4DA5A 3MFUA 3QRTA 4ZK5A 4EHEA 4JG7A 4GYIA 4E93A 5AWMA 2WFYA 2YAAA 1H0VA 3HRCA 2XJ2A 3KB7A 4O38A 4QYGA 4TTHB 4FR4A 1KOBA 3LJ2A 2AEGA 2B52A 4IWDA 3F5GA 3ZLSA 4FTQA 4B4LA 5KNJA 4JG6A 3NWWA 4MBJA 5HIEA 2W1ZA 5AP1A 1OL5A 2UZWE 4M67A 3HA8A 2BHEA 2W1HA 3IGOA 1U5RA 4PDOA 4QPMA 4CV8A 4PPBA 4EWHA 4HYIA 4L45A 3K2LA 4RT7A 4ZSLA 2WMBA 4DAWA 2OLCA 1TQIA 3DLZA 4YC3A 2PPQA 5DPVA 3VS2A 3C4ZA 4BJJA 4J8NA 3RBWA 5AADA 3QUEA 4O0XA 5A4EA 4ACGA 4FTMA 3NS9A 4XP0A 5FRIA 1J7LA 5A6NA 1XH7A 4FTNA 4J97A 4QOXA 4ASEA 3C1XA 5CNOA 2KTYA 2IEWA 3KK8A 3RVGA 4AP7A 3TJCA 2C3IB 4CLIA 4PTGA 2YWPA 2R3KA 5D12A 3D2KA 3JVSA 2IZTA 3O2MA 4HNFA 4IVDA 2GU8A 1VR2A 4UMRA 4Z9LA 4J1RA 4QYHA 3S2PA 4EBVA 3ALNA 4QMSA 4NTSA 3ZBFA 4M84A 4YUQA 4LDTA 5FDXA 3TNQB 4OTRA 4OTHA 3AC3A 4OTDA 4XRLA 1S9JA 1OM1A 4BZOA 2OF2A 5IF1A 4PMPA 2P2IA 2NPQA 4H39A 3Q53A 4RFMA 3P7BA 3NR9A 1H07A 2CGXA 4TT7A 4USDA 5C4LA 4EYJA 2ITVA 3GGFA 3DAJA 3DPKA 5LCKA 2YM7A 1OKWA 2XIZA 4YLKA 5FBOA 4DH8A 4QMPA 2XBAA 2BRNA 4FG8A 2W4JA 3R28A 4CZYB 2OJJA 2QCSA 3T8OA 4AN2A 3PA3A 5KX8A 5FUTA 4EOMA 1J1BA 3UGCA 1Q62A 4QMNA 3QTSA 5ETCA 2Y0AA 3ZLWA 4KKHA 3KRJA 4MNEB 3PXQA 4E4LA 3HMOA 4CNHA 3PWDA 2GFCA 4J96A 1KOAA 4GU6A 4UY9A 4BDAA 4LGGA 3FJQE 4IAFA 1OPKA 3HV6A 3LCKA 3GFWA 3MB7A 4DG0E 4YSJA 2QOKA 3ENHA 3MJ2A 3BCEA 1A48A 2GHLA 3KK9A 4ALVA 2C5OA 1FVRA 2OI4X 4RJ4A 5CF8A 3RAIA 3OTVA 3H0ZA 4B7TA 4C38A 3V5QA 2YN8A 2CKPA 2ZB1A 3HMNA 4KBAA 3P4KA 3BGZA 5E1EA 4DH3A 3U55A 5JRSA 3W2QA 3TXOA 4R78A 3H9OA 2PL0A 1J91A 5AIKA 4BTMA 3AC1A 3TMOA 1MP8A 3COMA 4FG9A 3TZMA 2R3IA 4GV1A 2CLXA 3WZEA 2JC6A 4IVBA 4Q5EA 3E93A 4QEBA 3EQIA 1BMKA 2CN5A 3DT1A 3I6UA 4QMTA 3TNPC 1PXOA 2XALA 2C5NA 3PWYA 2W05A 1WBWA 4PDPA 5DWRA 3A60A 2ITYA 2XCHA 3PXFA 4ZZNA 3DK3A 1W8CA 4EOPA 3DXNA 4A9RA 2WHBA 4FKOA 1Q3WA 4I4EA 1IAJA 4Z16A 2VTLA 2IW8A 4DHZA 3LFSA 3KMUA 4EK6A 4ZSEA 5CENA 2YM4A 5I3RA 3PY1A 3PRFA 2IF8A 1PMUA 4UEUA 3HP2A 3JY0A 4ZS0A 3VF8A 2J51A 3Q4UA 1Y91A 4FK3A 2EU9A 3K5UA 3UG1A 4AG8A 3Q9ZA 4F1MA 3PYYA 5HG5A 4S34A 1PYEA 3GUBA 4FBXA 4L00A 2G2IA 4EK5A 3GCQA 3VS4A 3OBJA 5D11A 4G3EA 4MEDA 2VTQA 3GQIA 4BDHA 5IQGA 2F57A 1K2PA 3FLWA 3FY0A 4MWIA 1TQMA 3Q9XA 5L6WL 3QU0A 2V62A 2EUFB 4XX9A 2ZV2A 4PL3A 4YPDA 1YOLA 2FYSA 3OWKA 1GY3A 2UVYA 2Y9QA 4KRCA 4MNFA 5JKGA 2PVFA 4X7QA 1YXSA 1KE6A 4E6DA 1O9UA 5EYMA 2QD9A 2I0YA 3DOGA 4U3ZA 2PZPA 3LIJA 4JNWA 3GU6A 1J1CA 4ANOA 3GCVA 2QNJA 3II5A 2Y6MA 5KCVA 4O0SA 3UMWA 2GDOA 2I1MA 3UVQA 4O7WA 3BWFA 1H26A 2GS2A 1HCKA 4EOOA 3FZRA 4IVCA 4IC8A 1VZOA 1OZ1A 5DRBA 3BKBA 3TUBA 5HOAA 2XCKA 4OUCA 5HE2A 4JMQA 3UG2A 3PRIA 3C0GA 2BFXA 5CVHA 2JDTA 1YVJA 2WQNA 3DB6A 5E8ZA 5HVJA 1BI8A 4J8MA 1OB3A 4MNEA 5J87A 1K3AA 1URCA 2W9FB 3L1SA 4IDVA 5EOBA 1IAHA 3DBFA 2J5EA 1Q8TA 4USFA 3BE2A 3WI6A 3QRKA 4R8QA 4XP3A 1FOTA 2WMVA 3O0GA 4HPUE 1H24A 2J0MB 4KABA 4IFGA 3NFGB 3LM0A 2IPXA 2IVSA 3UQFA 2VV9A 4BDFA 1OVEA 4WBBB 1YOMA 4Y46A 4DFYA 3QX4A 4ZTNA 1WBSA 3U54A 3C51A 2EWAA 1URWA 4I6BA 4F9CA 4HGSA 4XRJA 3DJ6A 5TR6A 3G33A 5DT4A 4EHZA 3DK6A 5FXQA 4PWNA 1V0OA 2J7TA 3KA0A 3VWAA 2E9NA 2ETMA 4K2RA 3IW7A 3FKOA 3ZXZA 3PXZA 2OH0E 1GZ8A 2GFSA 5K9IA 3H4JA 1OKZA 1FPUA 3K3JA 2DS1A 4YLLA 4AN3A 3UIMA 5GIPE 3AC8A 2C47A 4EZ7A 3R8MA 4HNIA 4UBAA 4IXPA 4I41A 5M06A 3RPRA 5A3XA 1VYZA 1CM8A 5I9VA 4XV1A 3LE6A 2XZSA 3PG3A 2FB8A 1PMNA 5AUYA 3FZOA 3BV3A 3HGKA 1F0QA 4O0YA 3FDNA 3CPBA 1V1KA 4GJ3A 3BZ3A 2X0PA 3LXKA 4GK3A 3KRLA 3CEKA 4EOSA 2BZIB 3DV3A 5HNGA 5M44A 3MA6A 2P0CA 2R7IA 4FUXA 3C7QA 3TACA 2B55A 2ZDUA 1PYXA 4LGDA 4K33A 5IQEA 2X2MA 3BLHA 2GS6A 4RJ5A 2QU5A 3QALE 5HIBA 4AE6A 5BYYA 5AAEA 1WVXA 5KE0A 3U6HA 3AKLA 3FMKA 3M11A 4XP2A 2RG6A 3OFMA 3SOCA 4IX6A 5IMXA 3FYKX 1JSVA 4GVAA 2EB3A 5L2IA 3EZRA 2OJGA 3CCNA 2CGWA 2VTIA 4MCVA 3OOGA 3A4PA 2V55A 2HWPA 5HLNA 2FSLX 1CKJA 3EQPA 5HE1A 3R1SA 5DRDA 4TL0A 4JVGA 3VHEA 3ML1A 3OROA 3W2SA 3OY1A 3BHVA 5L6OA 2C5VA 4N70A 4EEVA 2WTKC 2HELA 3ZRMA 3MFTA 4YHJA 3QCQA 4CVAA 2WIPA 3TYKA 3HMMA 2FSOX 4S31A 4F7NA 5CEPA 3E8EA 3FI2A 4L7SA 1G3NA 3UQCA 2PYWA 4F6WA 3UQGA 1PXIA 4PV0A 4G16A 4NU1A 3CTQA 4AT4A 1YWVA 2QOOA 4R1YA 3AD6A 4BIEA 4L9IA 4AFEA 4WUAA 4ACDA 5IQFA 2G15A 3QA8A 4FV1A 2XS0A 4YJQA 1XR1A 3ZSGA 3A62A 2PZIA 4WHZA 2VGPA 3TZ7A 2XNGA 1E9HA 3LZBA 2WD1A 2UZOA 4FEQA 3DTCA 3V8WA 4F9BA 4RJ3A 4DEAA 5HBEA 3QQJA 4PF4A 4XG4A 4G34A 3C4WA 4XG7A 4LYNA 5D9HA 4I5HA 5HVYA 4AUAA 2UZEA 3OY3A 2BIKB 4MBIA 4O91A 4ASZA 2PU8A 4BKYA 2QONA 2X0QA 4AXDA 3OD6X 4F63A 3QYWA 2R3MA 5GZAA 4MX9A 1JSTA 2P55A 3SC1A 3QYZA 3O8TA 2PVLA 2GNJA 4GS6A 3R9HA 5CZHA 4B0GA 4F4PA 1P5EA 3KFAA 3A8WA 4I92A 1KV2A 3HUCA 1QPEA 3RAKA 5EYKA 3ETAA 3Q4CA 3SXFA 4ASDA 2WTCA 3GNIB 4U3YA 4U81A 2VO0A 4JRNA 5AMNA 3ZSHA 4AGUA 4OGRA 4U45A 2UZTA 2XKFA 4D58A 3QX2A 4JJRA 2QR7A 3I79A 4AA5A 4IHPA 3TNIA 1BUHA 4IADA 5AP7A 3EFKA 5KUPA 4TW9A 4I6FA 4S2ZA 2ESMA 1W82A 3GC7A 4D4SA 4FZ7A 1O6YA 1HCLA 2RFSA 4FYNA 2WMXA 3KL8A 3IOPA 2PE1A 2YHVA 3CP9A 1LEZA 2VX3A 3CPCA 4NZWB 2WNTA 3FAAA 2XNBA 2R3RA 2JDSA 5JRQA 1TQPA 5H3QA 3FLZA 3DQWA 3I7CA 3Q5IA 5IEYA 2CKOA 2XYNA 4KIQA 5AUZA 1XH6A 3A61A 3W0PA 2YWVA 1WFCA 2AYPA 4AQCA 2XEYA 3UVPA 3TTIA 5JMSA 4BCGA 2WZJA 4ZLZA 2ERZE 4WA9A 3T3UA 1K9AA 3V5TA 4ZLYA 2PY3A 5HD4A 5IPJA 2A27A 5IUGA 4DGLC 5M4IA 3CLYA 4GT3A 4DF3A 4RIXB 2W0JA 1ZMUA 4RJ7A 5EW3A 2RL5A 2ZVAA 3CQEA 3JYAA 3ZHPC 4RZVA 3KN5A 4FF8A 1S9IA 2YISA 4WO5A 2E9UA 4BDGA 5HZNA 1MUOA 4IAAA 4EJNA 4K8AA 3T9TA 3U9CA 5CSPA 1PKDA 3BWJA 2Q0NA 4JG8A 4V04A 3ANQA 4DDGA 2CCIA 3K5VA 3NCGA 4HYHA 3RI1A 5AV1A 3FBVA 1BL7A 5HG8A 1ZYJA 2R3JA 4G3CA 1YXUA 1QPJA 2WMAA 3WYYA 2ZOQA 1PXNA 4BRXA 2PE0A 3D15A 4GSBA 2QU6A 4WSQA 5AM6A 4MH7A 1UWHA 4IM0A 4CRLA 4L42A 1PXJA 5AP4A 4ZSJA 3NUXA 2IW6A 4JQ8A 4AXFA 2QOIA 2UUEA 2XMYA 3O51A 4YO6A 3QF9A 4D1ZA 3NW7A 5B2KA 1V0PA 3Q3BA 2UZDA 4UZHA 5FWKK 1QCFA 3SKCA 3GCSA 3QD4A 1NY3A 2Q0BA 4I24A 3LLTA 5CI6A 2OXDA 4FV7A 4AGDA 3O7LD 3UOJA 1CKIA 1ERKA 3HL7A 4Y73A 4M69B 3FZSA 3NUAA 2JGZA 4LQMA 4DLIA 3G51A 1G5SA 3UDTA 4FNZA 4UN0C 2VD5A 4QTDA 3LFQA 3CGOA 4XG9A 3RMFA 3DDQA 2GNGA 4GFMA 3UYSA 3R6XA 3ET7A 4UMPA 3FY2A 2BROA 2C3JA 4TRLA 5KHXA 5E8UA 3EMGA 3IPHA 4O6LA 4CTBA 5HU9A 4XYFA 4FTRA 3KXZA 2B9IA 4C61A 4DFBA 3WARA 4DHFA 4KWPA 3BEGA 3QHRA 4MKCA 4CT1A 5H8EA 4A9TA 5KMIA 4O1PA 3S1HA 2GNIA 1ZRZA 2ITWA 4J98A 4UV0A 4LRKA 4Y85A 4EUTA 5IDNA 2AC5A 4D1XA 2EXMA 3B8RA 3EZVA 4X3JA 1Q8WA 4I0TA 4JIKA 1SYKA 3D4QA 3D9VA 4YZNA 3RPVA 1O6KA 5EI6A 5BVEA 2X0GA 4YNOA 4QNAA 3QLFA 4FKJA 3BQCA 4Y5HA 3KVWA 3TV6A 1ZYCA 2YJRA 4IANA 3W33A 5CYIA 1XBCA 2JKMA 4XG6A 5DR2A 4BYIA 2XK6A 3DAEA 1WCCA 3FKNA 4ANBA 3MH3A 4IAIA 3PA5A 4GUBA 5IQAA 4YTFA 1XHAA 2X7FA 5J95A 2VU3A 2QODA 1OIRA 4FZAB 1H1RA 2G2FA 2OH4A 4L3LA 4WNMA 3RNIA 3WF9A 2XH5A 3R73A 2FGIA 5J1WA 3PVGA 3ZFXA 4QTBA 2YFXA 2WEIA 3E8NA 5LJJA 4BIDA 1YI3A 3EYGA 3TCPA 3DB8A 3COHA 4ZTMA 4G6OA 4BCMA 4D2SA 4FSTA 4RIXA 4H3QA 4GRBA 3P5JC 2ETKA 1E1XA 3LXLA 2XK4A 3E8CA 4BCHA 4KKEA 2WMSA 4E5WA 5CQWA 5JGAA 4JBOA 2C68A 3JR1A 3U87A 1SVEA 2QHNA 4IJPA 5FQDC 2V5QA 3M42A 4Z7HA 4NW5A 4L8MA 4D0WA 5M07A 5EHOA 3FMDA 4WD5A 5D10A 4IAKA 2QI8A 4NM7A 4NM3A 5TKDA 4LL5A 4F09A 1B38A 1XMLA 5HHWA 2VWVA 3UC3A 1OI9A 2OO8X 3FMNA 4ZJIA 2VTHA 4TY1A 4JBQA 3U8WA 2O64A 5AV4A 2JAVA 3ZUTA 3LAUA 4FT3A 3BLQA 5CTPA 5CT0A 2C0OA 3W18A 4ASXA 4YJSA 5E92A 3WF5A 4MQ1A 5AV2A 3UNKA 1SNUA 4X2GA 1R0PA 2YZAA 4JQEA 4AS0A 2Z7SA 3Q60A 3K3IA 4OT5A 5CVGA 3KMMA 3RZBA 3V51A 2FUMA 3RJCA 4XG2A 4JAIA 4IH8A 3PG1A 4E20A 3PP0A 4BI0A 3MIAA 3SQQA 3NNXA 5HG7A 4FIEA 4G3DA 3G15A 3BYMA 4CSVA 4M69A 4XH6A 4IM2A 4C4JA 3KXGA 2C6IA 4WRSA 3E5AA 3NW5A 3RPSA 3KREA 4G31A 3OWJA 3AKKA 5HNIX 4DEBA 4QMLA 4FGBA 4I0SA 3OC1A 4AT5A 2VN9A 3DFCB 2C6OA 4LFIA 3ZC5A 3TIZA 5CWZA 3ZBXA 2YIRA 2VO3A 4BGQA 1P14A 2UVXA 4BN1A 2PVRA 1PXKA 3BYUA 2VNWA 2C30A 4FMQA 5E7RA 4PY1A 1YQJA 5AV3A 5AP3A 2QLQA 4EQCA 3FQEA 4FZFB 4NJDA 4GKHA 3RCJA 4EORA 2XIKA 4YU2A 4OTQA 1LEWA 4ZJJA 3HMIA 2J5FA 3OP5A 2Z2WA 4DE4A 3AOXA 4U7ZA 3VAPA 4ITJA 4W4WA 5K0XA 3REPA 3FZPA 5BVWA 3R8VA 5E8XA 1I09A 5BUIA 3U4WA 3IO7A 4NCTA 4AZSA 3ODYX 4QP4A 5E8VA 3D7ZA 3Q52A 2PVHA 2R2PA 1YI4A 2PZYA 3KMWA 4R6VA 5HE3A 5CAOA 3HV4A 3COIA 3C13A 3CKXA 4O0TA 4W4YA 5L3AA 5IUIA 4QT1A 5KBRA 4QRCA 5M4CA 5CU6A 4LOOA 1W84A 4KINA 4WG5A 4BGHA 2XJ1A 4DBXA 4FV6A 4L6QA 1A9UA 4ZSGA 2XKCA 1RW8A 2ZV9A 4Q2AA 5GZ8A 3BV2A 4K77A 2ZAZA 4LOPA 4R7IA 4U79A 2X7OA 4AGWA 5B2LA 2BIYA 2BRHA 3A8XA 2XANA 2QQ7A 4EZ3A 4IJ9A 2VTJA 4HYSA 3NMUF 2FA2A 3CY2A 4FOBA 5CX9A 5GHVA 3SDJA 1OBGA 1JWHA 2BAKA 1IR3A 2JFLA 2PVNA 2XIYA 4RIOA 4EWQA 3D5UA 5BQ0A 2CSNA 3BLRA 2R0IA 4B8LA 3ULIA 1OPJA 4TN6A 3VJNA 2PMNX 3C4EA 3UIBA 1APME 4BDDA 3OT3A 4AXEA 3BYSA 1JAMA 2R3PA 5JGDA 3MYGA 2CN8A 3G5DA 2P33A 4BZDA 5EOLA 2YLEA 2G9XA 5J5TA 2HK5A 1YWNA 3A7GA 3EN4A 5HGIA 2ITTA 2BZKB 3I4BA 3LM5A 5EHLA 2OXXA 4PP7A 5I9XA 3R7VA 3DQXA 2HIWA 5ETAA 3EFLA 3DZOA 5J8IA 2OJIA 4LRMA 4I5MA 2VAGA 3TIYA 4FTCA 5AP5A 4PMSA 5L8KA 2ZM4A 3D5WA 4QMYA 2IVVA 4IB3A 4DH7A 3SRVB 4C0TA 3TN8A 3MVMA 4FTUA 4J53A 2H96A 3CIKA 2QURA 3FLQA 2VX0A 3DKOA 5BUJA 2FSTX 3R01A 4RIWB 2O3PA 2X81A 2UZBA 3MTLA 2HXLA 1XO2B 3EB0A 4QQJA 3DKFA 5E8YA 3W2RA 4IBMA 4KS7A 5JK3A 2HXQA 4FYOA 3OW4A 2QR8A 3IK3A 2I0VA 2IW9A 2W99B 5C8KA 3QFVA 4RX9A 3DA6A 4KBCA 2Q83A 3MPAA 5D1JA 4P7EA 1Y6BA 3B8QA 4CFXA 4KUJA 4L46A 4AA4A 3O23A 1ZMWA 5FEEA 3U6JA 5JFVA 5IH6A 1OITA 2HY81 3NIZA 5AR5A 5HI2A 2OSCA 2W1CA 3NRMA 2YERA 5FTQA 2OXYA 4M12A 4DITA 4UX9A 3QQHA 4DFNA 3NAYA 4A4LA 3TZ8A 2BCJA 2YM6A 3UMXA 2GMXA 4LL0A 4FT9A 3MY1A 4FKUA 3CR0A 1GAGA 1ZY5A 3PJ2A 3RK9A 2JIVA 5IIS