1OZ1A

P38 mitogen-activated kinase in complex with 4-azaindole inhibitor
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
348
structure length
344
Chain Sequence
RPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHTDDEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Mitogen-activated protein kinase 14
publication title Design and synthesis of 4-azaindoles as inhibitors of p38 MAP kinase.
pubmed doi rcsb
source organism Homo sapiens
total genus 112
structure length 344
sequence length 348
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2003-04-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 1oz1A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 1oz1A01
3BHHA 3F5XA 4YBKA 2PE1A 4JOAA 4AZFA 3F66A 4O22A 4BDBA 2BALA 5KBRA 4ZJJA 3QL8A 3RZFA 3S4QA 4ZLOA 2IJMA 4FKTA 2OBJA 4U5JA 4BGGA 4YU2A 5FUTA 2ZMDA 5K9IA 2C3JA 3AD5A 3OW3A 3ZFXA 1ZOHA 3VRZA 3E7VA 3LXKA 2ITXA 3PSCA 5L8LA 3QUPA 2WEIA 3DK3A 4PV0A 2WMXA 3ENMA 4LRMA 5M09A 2PVRA 4J98A 3KRWA 2XKEA 4BDCA 1H07A 4JR3A 2BRBA 3OWKA 4AFJA 3T8OA 3OD6X 1JKLA 1NXKA 2QD9A 5E9EA 3E88A 3O7LD 2G2FA 4KAOA 1BYGA 1XH6A 1WZYA 2UW5A 1J1CA 5J1WA 5HORA 1WAKA 5LARA 3WIKA 4ZTNA 3V8SA 2R3MA 2ITNA 1PXOA 4FV1A 3CQWA 2CNVA 3L9MA 5E8VA 5JRSA 5JMSA 2C1AA 2Z8CA 5C8NA 4WNKA 4A07A 3KULA 2PK9A 4AT3A 2C6KA 4BTJA 3D5UA 1FVRA 3WZUA 5A14A 2OH0E 4AZWA 3F69A 4E20A 4CD0A 4F9WA 4NCTA 4YJNA 5AUVA 3VO3A 1HCLA 2PZRA 2WTJA 3F3TA 3FSKA 3LVPA 5AJQA 4DH7A 1Y57A 3TZ9A 3V5LA 3N4UA 2VTAA 3SX9A 2VTTA 4TKSA 1H08A 4FR4A 4GFMA 5AR4A 4RJ4A 2XK7A 5C1QB 5CF6A 4LYNA 2X8IA 4G9CA 3VJNA 4FKWA 4FZ6A 4XS2A 2VX1A 2B9HA 3QD4A 3QGYA 3TTIA 1H00A 2UZVA 2WMWA 3FLNC 4MD7E 2LAVA 5KMOA 3P7AA 2QCSA 3G90X 4GL9A 3HAVA 3QTSA 3FPMA 4TNDA 4KKGA 2XRWA 4M69A 2EVAA 5CWZA 4F70A 2C6IA 2GQGA 4G2FA 1UVRA 2C5XA 2UV2A 2VO3A 3ZXTA 3TKHA 2VNWA 3PA5A 4X2GA 3W10A 5HZNA 3E8NA 4CYJA 3AXWA 5LVOA 3DS6A 4IX6A 4QP2A 4BBEA 2BHHA 3HMOA 3PP0A 4YTCA 5LXMA 1KV1A 3ZO2A 3LFBA 3PPKA 3Q6UA 3QQHA 1YDSE 3TV4A 2CDZA 3HKOA 3NUNA 3DOGA 1WBTA 3TNPC 5ETCA 5HIBA 1PW2A 3DCVA 3UIXA 2WMSA 3KXGA 2DYLA 3GQLA 5F95A 3PXKA 1EH4A 3DNEA 4BFMA 4IFGA 4YZNA 5AR8A 4ANMA 1PXPA 3HDMA 5JFSA 5ANIA 4EUTA 4ZMFA 3MH3A 4RIYA 4RC4A 4ANSA 5EYMA 5J9YA 3Q04A 3SVVA 2EU9A 2XS0A 5IEVA 4GKIA 4HVIA 2HZ0A 2ZB0A 3UC4A 1W84A 2VWVA 3V8TA 4Z3VA 4X21A 2JDRA 3FMMA 3IO7A 3VN9A 3WI6A 1ZOGA 3HMPA 3R7GA 4YJTA 1XH9A 4YLJA 4DH5A 5FXRA 4X6QC 5CU3A 5E92A 3SW4A 5E8YA 2XB7A 4GJ2A 2YIWA 3R9NA 1ZY5A 2JKMA 5CZIA 4DG3E 4D28A 5IDNA 4CZTA 4B6LA 4AZVA 2C6MA 4JR7A 4AGWA 1ZLTA 5HG8A 5FBNC 3HAMA 3L9LA 5DR6A 4ZXTA 4C4JA 5KCVA 1OECA 4ZZNA 4OGRA 4I41A 5IMXA 4WNOA 3G9NA 3FMJA 4MXAA 2PTKA 4MNEB 4XG9A 2VWYA 1W82A 3IOKA 3QKKA 4L52A 3PIXA 3AQVA 3F7WA 3HA6A 5CZHA 3R8ZA 4H05A 3PJCA 4GYGA 3AOXA 4XV3A 4FV8A 4X3FC 2H96A 3UVPA 4FV0A 3V6RA 4FSYA 5CNOA 1U54B 4BCMA 1LEWA 2ZMCA 3FZRA 4JX3A 5EM5A 5LVPA 2WTWA 4M3QA 3BWFA 4DGNA 2GS7A 2R3JA 2W1EA 1FMKA 2QO9A 2QOHA 4PRJA 5J87A 4CFVA 5HO7A 2W9FB 3QCQA 4RVMA 5ANDA 2C3LA 5AP7A 3ZH8A 4PNKA 4XG8A 4QPAA 5CU6A 2Z7LA 3HZTA 3MTLA 5D1JA 4BKZA 2ITUA 3NYXA 1ZZLA 4UMQA 5FGKA 4ANQA 2VWIA 4B99A 4ENYA 3GU8A 5CAPA 4FTRA 3WBLA 5ITAA 5M4FA 4W4YA 3WZDA 1XQZA 4WRGA 4FNWA 4FTTA 1YOJA 3DK6A 3JYAA 3QTUA 4FIFA 4JIKA 5CAVA 2J2IB 4ZY5A 3ELJA 4G5JA 4PMSA 4WHZA 2BZKB 4MF1A 3VBWA 4CEGA 4CCUA 4CQGA 4ZLZA 3U6JA 3EQRA 5HICA 4AA0A 3RAWA 1ATPE 2QLQA 4YZBA 3CY2A 2WKMA 3N51A 4EJ7A 3FY0A 3ULZA 4NTSA 2WTKB 3NNUA 2CCIA 3IQ7A 1M17A 3MV5A 4ITIA 4FKRA 4F7SA 3QYZA 4R1VA 4F7JA 5TE0A 5D7AA 5AUXA 4EK3A 2W1DA 2ONLA 4KSQA 5IQGA 4TYGA 4V0GB 5HE0A 1UV5A 1YQJA 1NT2A 4MTAA 4TWPA 1W98A 5CEKA 3DBQA 1Q8YA 1Y6AA 5K0KA 2QG7A 3DKCA 4AXAA 5KMIA 4BCJA 3RTPA 5JK3A 4AWIA 4FKSA 4K77A 2IVSA 2OKRA 2YM3A 5L8JA 2IO6A 2J0JA 3QZFA 2VTPA 1L3RE 4TWNA 3AC2A 3UYTA 2GHLA 1FOTA 4IHPA 2XRUA 3ZRMA 4PQNA 4U97A 2VX3A 3QTIA 4UXQA 5FBOA 4L01A 1IR3A 1ZYCA 2E9VA 3O17A 4JLCA 1J7IA 1KE7A 4H1JA 4MWIA 3ZFYA 3P0MA 3E62A 4JDIA 4NKSA 2WIPA 3BKBA 3LFNA 3GCPA 4NM3A 3EN9A 2WOTA 2WD1A 4ZTQA 4CTCA 4E8AA 4EH2A 5CASA 2WQOA 4ZTRA 4O7LA 1Q8ZA 4BIDA 4CKIA 3LM0A 4KA3A 3PE1A 3WZJA 4ACDA 4L43A 3CBLA 4AS0A 3ODZX 4O6LA 2WQNA 3GGFA 3RM7A 5C26A 2F7EE 5AP1A 3LE6A 1LR4A 4ORKA 4YJOA 3HA8A 2OF4A 3P79A 4PPAA 1UNGA 1W0XC 2QKRA 1JNKA 2YIRA 3PVGA 3FQSA 3QA0A 4HCUA 4OBQA 3LFEA 2WQMA 4MVFA 4ID7A 4HPUE 5FRIA 3SKCA 5GZ9A 3PY1A 5GZAA 5I0BA 2V0DA 4PTEA 4K18A 3VS1A 5F1ZA 1H8FA 3TKIA 3UVQA 5BMMA 1ZYDA 3A62A 4ALWA 5FTGA 2PUUA 1PMNA 4ZOGA 3ZCLA 3KULB 4JQ7A 1U5QA 3ZSGA 4IAYA 3ORXA 5CF4A 1JSTA 2PVKA 3FKLA 3MESA 3QRKA 2J5FA 3ANRA 1RE8A 2W1CA 2C1BA 4M84A 4GMYA 3FEGA 4HCVA 4WBOA 4BGQA 5LMKC 2F57A 2IN6A 3D83A 4BKYA 4DEBA 2E9OA 2PMIA 1P14A 3W8QA 4S34A 5CF8A 5IH4A 1IAJA 2IVVA 4QO9A 2VGOA 2XYNA 2DWBA 1IASA 3QD2B 3OFMA 3UZTA 4IAIA 4ZJIA 3GC7A 2IG7A 4FSTA 5T3QA 2OK1A 3R8PA 4FSUA 3WF9A 2C47A 4TYJA 3LHJA 2QOFA 3PXYA 3U8WA 3AC4A 3OC1A 3ODYX 2E9NA 4FIIA 5AP3A 4O7YA 4NYEA 4FICA 2H6DA 4M69B 3HDNA 2VTHA 3GC8A 4OAUC 4LRJA 1KWPA 4E5BA 3RPVA 2J51A 3QTWA 3W33A 5IEYA 3V01A 3HRBA 4CMUA 3C50A 1DAYA 4X2FA 2EXMA 4RX9A 4E6DA 3R2BA 3VS6A 4J8MA 1B39A 3SAYA 2R3FA 3NUYA 4D1XA 3BZ3A 1CTPE 1OPLA 1ERKA 4OW8A 3FLZA 4O2PA 3ORLA 3TNWA 3VIDA 2RIOA 4CFFA 2O5KA 3TZ7A 3PA3A 2RKUA 1Q24A 3TZMA 4L45A 1R1WA 4IAFA 5C4KA 2WMQA 4LGHA 4FKIA 3V5PA 4C3RA 1T46A 5CI6A 3CC6A 2XNPA 1REJA 2P33A 4BF2A 4M67A 4UB7A 4XBRA 5IF1A 4W8DA 4CTBA 4FK6A 2SRCA 2O65A 3FZPA 4FV3A 4MQ1A 4WA9A 4QYGA 3R1QA 4EEVA 4F9YA 3DXNA 4OLIA 3ZTXA 3C1XA 1JSUA 3DPKA 1PMUA 5L2QA 4GK2A 4O6EA 3Q32A 4RWLA 4OTQA 4GRBA 5DOSA 4X3FB 2C0OA 4EH3A 4UYNA 4CKRA 4OTDA 3KC3A 5HI2A 5I9YA 2QU6A 3CTJA 4ZSGA 3NCGA 5K3YA 4P5QA 2IVTA 3TNQB 4BTFA 3DKGA 3UO6A 3HV7A 3R00A 1SNUA 3EQIA 4DLJA 4EYJA 4F64A 2XIYA 2FGIA 4XV2A 2VWWA 5K4IA 4FSNA 5A4QA 1J7LA 3EQFA 4GUBA 3UIMA 3QRUA 2PSQA 5FWKK 3LXPA 3OY1A 4D4VA 2G9XA 4FV4A 5AUUA 2BTRA 4OTWA 4YO6A 4FZAB 1E9HA 3P7BA 4KRDA 3E87A 3WZEA 3VUDA 3BHYA 3MB6A 3WYYA 4FV9A 4I0RA 1FVTA 5EM7A 4QRCA 4C57A 4Y95A 4ZTLA 3I6WA 3KXMA 4D2WA 1GJOA 4AN2A 2CJMA 1ZY4A 2HWOA 5AWMA 3VBYA 3S1HA 2PZ5A 5HX8A 1BX6A 3TI1A 1OM1A 5EW3A 5LWMA 1XKKA 1FVVA 1KV2A 2P2HA 3NS9A 4JX7A 4O0WA 5CQUA 4ACGA 4YHTA 2H8HA 2YZAA 1SVEA 1Z5MA 5JT2A 3F3WA 3ZUUA 4CZYB 1O6KA 3NYVA 4FT5A 4U41A 3TJDA 1Q5KA 3UQFA 4DT8A 5HCXA 4C37A 5KKRB 4MXYA 3R7YA 3UQGA 4D2VA 2WFYA 2VWUA 2HY81 4QMMA 4IJPA 4IB0A 4XEYA 3MH0A 5J8IA 3HUCA 5ACKA 3DKOA 3FE3A 4BCQA 2YAKA 1DI8A 1PF8A 4N70A 5EKOA 3COHA 4B8MA 4DCEA 3QQLA 1PKDA 2E9UA 4D4RA 5E4HA 3Q5IA 4M66A 3A7IA 5HVKA 3L8PA 3QQFA 2UUEA 5E8ZA 3DJ5A 4EC8A 2F7ZE 4EH5A 4H1MA 4BVUA 4LUEA 4F0FA 4YPSA 4RVLA 3RCDA 5EH0A 4RRVA 4O0YA 4KABA 4FSZA 4D9UA 1IRKA 3MJ2A 5IA5A 3R1SA 2X7FA 3ALOA 5HG7A 1ZRZA 3A4PA 5BVDA 4IAZA 3U6HA 4KBAA 3R8LA 3MW1A 3PZEA 3PPZA 4XP3A 4QYEA 4O81A 4FGBA 3BCEA 2GSFA 3DB6A 4FUYA 2B54A 2CGXA 2JIUA 2ETRA 3D0EA 3PG1A 5CANA 1KUTA 4BRXA 3SXRA 2FA2A 1ZZ2A 4OT6A 4FOBA 2VTQA 5CYIA 4E6QA 2O63A 5EW9A 4EOQA 4F6SA 3ACJA 4WOVA 5AV4A 1SVGA 4JS8A 4DH3A 2WMRA 5FDXA 4IW0A 2QOKA 4FI1A 4BCKA 4MD9E 4YP8A 4D55A 2JEDA 1K3AA 3F2AA 4FIEA 4I5HA 3UZPA 1OPKA 5JFVA 4JDKA 4I22A 2C69A 3OF0A 4EK5A 4ZY4A 3CJFA 4B9DA 4CNHA 4DN5A 2R3LA 4BIBA 1XO2B 2O8YA 4S32A 2Y4PA 3GFEA 5EQEA 2XEZA 3U6IA 4WRSA 4KIPA 4FV6A 4L00A 3F82A 1M2QA 2X9EA 2X6EA 3FC1X 3FLSA 3LW0A 3QLGA 5AEPA 5BQ0A 3TDVA 3CGFA 4QP8A 4R6VA 4BDIA 2W1GA 3R8UA 4DG0E 3VS0A 3BGZA 2VWBA 5FXQA 4CG9A 3MFUA 4Y72A 3E63A 3KK8A 3QQKA 2JAMA 2C6LA 4AQCA 1VZOA 3FI4A 3KVWA 1J91A 5AIKA 4Z55A 4IM3A 3IW4A 3Q9WA 3KN6A 4NL0A 4W9XA 5C9CA 2OWBA 3DFCB 5KO1A 3SG9A 3I1AA 3G33A 3F2NA 2YISA 3E92A 5DR2A 2X4FA 4R5YA 5HU3A 4HGSA 4S33A 3HV4A 4ZZMA 3BE9A 4RZWA 5D41A 5F4NA 2JLDA 3FHIA 3TACA 4BCPA 4GCJA 4MXXA 3WE4A 2ZVAA 5CENA 2BZIB 3UOLA 4A4XA 2OW3A 3CKXA 4MKCA 4OTRA 2PVLA 4Q9ZA 5HE1A 1Q3WA 1XH5A 2OZOA 1QL6A 4I24A 4AGCA 4D58A 1ZOEA 4NM0A 4FIHA 2PVFA 4DITA 4G3CA 4DG2E 4G6OA 4B4LA 4C3FA 2B7AA 2BMCA 3EFLA 4C36A 2RFEA 2YHVA 5B0XA 3RAKA 3V8WA 2XUUA 1DI9A 3QU0A 5E90A 3O51A 4CQEA 3VF9A 5CT0A 4BWXA 4RX7A 4KIQA 4BI0A 1NA7A 4B0GA 5CEOA 1W83A 4RJ5A 4R77A 2J0MB 3VBTA 3UPXA 5E7RA 4JBVA 5GHVA 2X7GA 3ZEWA 3ZHPC 4USEA 4P4CA 5GIOE 2ZOQA 2Y0AA 3BU5A 5C4LA 3JUHA 3PYYA 4U81A 3R7EA 5CNNA 5EHYA 5LWNA 3ZSHA 4FT3A 3Q4ZA 2W5BA 3GNIB 1HOWA 4LOPA 2PMNX 3NGAA 1J1BA 1OUYA 1YWNA 2W5HA 3BLQA 3EOCA 3WOWA 4O0RA 5DLSA 1YDTE 5HTCA 1MQ4A 4O7VA 5EKNA 3MY1A 3O8PA 1BUHA 4WUNA 4USDA 5D12A 4EOIA 3H3CA 4G3GA 4JT3A 1R0EA 2ETKA 2V5QA 2E2BA 3DKFA 1NVRA 2W4KA 4IAAA 5IG1A 4QMUA 3ZONA 4MNEA 4B7TA 2ITYA 4JAJA 4PDPA 3CS9A 4AOTA 2ERZE 1IA8A 3R7VA 2PHKA 2UZDA 5CVHA 3Q2JA 4Z16A 3SG8A 1E1VA 4AW1A 4FF8A 4D9TA 3H9FA 2WB8A 2UZUE 1Y6BA 2VV9A 3IW6A 5FTOA 4GIHA 2DQ7X 1RQQA 2PE2A 3OS3A 5KHWA 4BIEA 3QC4A 4FIGA 4JDJA 5EI2A 1BI7A 4JI9A 2BRGA 2C5OA 2I0HA 3H9OA 3NAYA 3I7CA 2RF9A 3UQCA 4WNMA 2Z7SA 1WVXA 4RA4A 3HV6A 4CFWA 4RLKA 1PMVA 5L2WA 2CGVA 5DIAA 4RIXA 3H9RA 1AGWA 2Y8OA 2JC6A 4PTCA 4X2KA 4XOYA 3P7CA 5IQEA 3DAEA 1U59A 2OFUA 3EFJA 3EN7A 3PY0A 1WBOA 4XUFA 3C51A 1PYXA 1P2AA 2F9GA 2R3KA 3GEQA 5CY3A 3I0QA 4RQVA 3KMUA 4YZCA 3ZM4A 2QG5A 2YLFA 5AP5A 1Z57A 1ZYLA 3DDPA 4ANOA 2XIRA 3K2LA 3KGAA 4C59A 3PSBA 4GG5A 2WU7A 3TZ8A 4C58A 4B8LA 3IONA 2O64A 4L8MA 5J7BA 4GVJA 3H30A 4IIRA 4K8AA 3DNDA 2UW9A 2Y4IC 5I9UA 4EH4A 4E93A 4I3ZA 4ANNA 3QWJA 3IDBA 3QTZA 3ZC6A 2QOQA 4JXFA 3GFWA 2BFXA 2XBJA 4PPBA 3OWJA 1VJYA 3A60A 4QNYA 1R78A 3GENA 5EHOA 3QRIA 1YKRA 4KBKA 4O38A 2BTSA 5KZIA 2JD5A 3UMWA 4Y5QA 4QMLA 3FYJX 3NPCA 5DE2A 1J3HA 5DGZA 5E8SA 4DH1A 3VBXA 3DU8A 5FEEA 4IVCA 3NMUF 5ETAA 3IG7A 2W4JA 3AGLA 4N6ZA 3RNIA 3SXSA 2QOIA 4PL3A 3CGOA 4AT5A 4ZLYA 2HOGA 4KRCA 3AMAA 4TWCA 1O9UA 5J5TA 2GCDA 3QZGA 2R4BA 2BZJA 4LM5A 4RJ7A 2P3GX 3GC9A 2C68A 4E5WA 1LP4A 3IW5A 5EK7A 4L44A 3QAME 2JDTA 3Q53A 4GU6A 3EMGA 4Z9LA 5LOHA 2BIYA 3UP2A 3EWHA 4Y85A 3AC8A 4CFXA 2WIHA 4YJSA 3LXLA 2JGZA 4BYJA 1Q8WA 2WGJA 5E8XA 2JIIA 3DBFA 1QCFA 2ITTA 4H39A 4I6FA 5B2MA 5EOBA 3CD8A 1M14A 3II5A 3A7HA 1JKSA 2VTNA 2YM5A 5A4TA 3NRMA 4IVDA 4R1YA 2IZTA 5BVOA 2C6OA 1P4FA 4PNIA 3WF6A 4I4FA 3FZTA 2WTIA 3MBLA 3RPSA 4QYFA 3MGYA 2IVUA 1LUFA 4YJUA 4W4WA 4P5ZA 3AMBA 4C35A 2FUMA 4IMYA 4EOPA 2OG8A 1BL6A 4NW5A 2HIWA 1OL6A 2XNGA 3GCSA 4F7NA 4QTBA 3BIZA 3RVGA 3DGKA 4R8QA 5HG5A 3KA0A 4MNFA 3HMNA 4FOCA 2IPXA 4BR3A 4FNXA 2DS1A 5HVYA 3PJ1A 4C61A 4YUQA 3KF4A 4S2ZA 5L6PA 1V0PA 3R6XA 2B52A 3PY3A 5CSXA 3L8SA 4I0TA 3U55A 3CPBA 4RVTA 5CTPA 2KTYA 4IEBA 3HMMA 3TL8A 2ITWA 3NUXA 3PRFA 4RZVA 1ZXEA 1YXVA 5LVNA 4BKJA 1WBVA 2VTSA 3H4JA 4YTIA 4UZDA 5EG3A 3RP9A 2R7BA 3ZO4A 5J7HA 4A9RA 4IB3A 4OTGA 3NSZA 1SMHA 2Z7RA 2YM6A 3F3ZA 3F88A 4XHKB 5TR6A 3TIZA 4YLLA 2PZYA 3QALE 4LMUA 5IA2A 1H26A 5HKMA 3W1FA 4PUZA 4UXLA 3EN4A 1Y91A 2OIBA 4F9AA 3QQUA 5EDQA 2GS6A 1CM8A 3QTXA 3FMKA 4QT1A 4Y46A 5KBQA 3KF7A 1G5SA 4IVAA 5T6KA 3I6UA 5HIDA 5HNIX 5AUWA 4V04A 1OPJA 3PJ8A 1QPDA 2YA9A 4IACA 4K33A 4TTHB 5BNJA 1QPEA 3C4FA 4NH1A 5L6WL 4BDAA 4YHFA 4NT4A 2GNHA 5FEQA 5ETIA 4USFA 4LQMA 2ZV9A 3HNGA 4ONAA 5AM7A 4XG6A 3VUHA 2CNQA 3EJ1A 3REPA 4C4EA 2X8EA 4YTFA 3C4EA 1Y8GA 4TYHA 4APCA 4DH8A 4GH2A 5A54A 2ZM4A 3DQXA 3GU6A 4GW8A 4HZSA 4CFUA 2YM7A 3BHVA 2PY3A 3NW5A 1WBWA 4NCTC 4FEXA 4X3FA 2RSVA 2VTMA 4JAIA 3PVBA 5M57A 2EXCX 2ZDUA 4NSTA 4I1ZA 4U42A 1OKZA 2H34A 3OXZA 4F08A 4Y5HA 3AT2A 5G1XA 2CKPA 4J99A 4WSYA 4MBJA 2Q83A 1OIRA 2B9FA 3BBTB 4DEIA 5CSPA 2GU8A 2UZEA 3C0HA 4L68A 4AN9A 2QI8A 1YXXA 3FMEA 4YZ9A 2NRUA 3OXTA 5ETFA 4ZS4A 3RGFA 3DTCA 2AC5A 2HW7A 3NR9A 1OKYA 3UMXA 2W06A 3QZHA 4IB5A 3UZRA 5IA4A 2Q0BA 2ZM3A 3VS4A 3VQUA 3CR0A 5J9ZA 3AC1A 4UALA 3MYGA 4K1BA 4RWJA 3BYUA 5E1SA 2WXVA 4QMPA 5AUYA 4CT2A 3EYGA 4I4EA 4HPTE 4F0IA 3D7ZA 3TNHA 3G0FA 4FL1A 3K5VA 4QTAA 3MPTA 4C7TA 4JBPA 1FGIA 1NVQA 3EHAA 5IISA 1PXNA 3ZEPA 2UVXA 5EDPA 5IQHA 3HEGA 4ZP5A 3HRFA 4AOIA 2VD5A 3UJGA 4ZZOA 3A61A 3NEWA 3ORPA 3NUAA 3I81A 2J4ZA 5AAGA 4O0VA 2C3KA 2ZB1A 5ANGA 3GCQA 2OZAA 4ITHA 4J52A 4P90A 3SD0A 4O7NA 4RIXB 5M07A 2X9FA 5GJGA 5FG8A 3R8VA 2XK6A 3NWWA 5FXSA 1A06A 3OUNB 3PXZA 1ZAOA 3V5TA 2WU6A 4FTUA 3SRVA 4D0XA 4H58A 3ZS5A 3F9NA 4LFIA 3U4UA 4BDGA 1BL7A 4CT1A 4OTFA 4RPVA 3HMIA 4C4IA 4O91A 4QTDA 1OBGA 4DTAA 3QC9A 4U44A 5ANEA 2IW8A 3W2RA 2PMLX 3IW8A 1OB3A 5JGAA 4FKPA 4P2KA 3OCTA 3L1SA 2CN5A 2FSMX 4RJ3A 4X7QA 2WMBA 1H1SA 3GU7A 4BDEA 3NW6A 4CKJA 3PIYA 5ICPA 4C2WA 3PLSA 4KIOA 4EHZA 1SZMA 3UIUA 1PHKA 4F6WA 1OKVA 2YJSA 2ESMA 4QP1A 2PUNA 3IW7A 5CEQA 4DGLC 4R3RA 3U87A 3PDTA 2OJFE 3HVCA 4XG4A 4AN3A 4O0SA 4XRJA 2Z7QA 4F1OA 2PZIA 4L3PA 2G01A 1X8BA 2UVYA 2YCRA 2Z2WA 2YWVA 4MXOA 2F2CB 5HO8A 2OXDA 2A2AA 3NAXA 2YERA 3ALNA 4RMZA 5EYCA 5TO8A 3UE4A 2RG6A 4NFMA 1UNLA 3U4WA 4PWNA 1KOBA 4GFOA 3CPCA 1FINA 4FKUA 3LM5A 3KKVA 4FG9A 4PL5A 4RFYA 4XYFA 4HYUA 3FV8A 4HNFA 4AOJA 4YTHA 2XM8A 3QXPA 3W8LA 2PMOX 4Z7GA 2PVMA 1Q8TA 5FEDA 4ZMEA 1BKXA 5CAUA 2YIXA 3HRCA 5DR9A 3I60A 5KE0A 3R7OA 5J79A 1JOWB 3G6GA 4YZMA 2PUIA 4I20A 1KE8A 5IEXA 4N0SA 3EYHA 1Q4LA 4I23A 3KK9A 4C2VA 3LQ5A 2HK5A 2HYYA 2JDOA 5JZNA 1PKGA 3R9DA 2C5VA 2XKCA 1ZYSA 3MFRA 4F09A 4FTMA 1GOLA 4WG4A 3UGCA 5L4QA 5AUZA 2WTVA 2XK8A 3H0ZA 4A4LA 5DEYA 3R04A 1H0VA 2X2KA 4TL0A 4IH8A 5DRBA 3BPRA 4GT4A 2FH9A 3DLSA 1RJBA 2YDIA 3MN3A 2A19B 4BCNA 3R7IA 5HESA 1F0QA 2WTCA 4EKLA 4G3EA 4EQMA 3GU4A 3D7TA 4J96A 2UW8A 3QCXA 1UKIA 4NU1A 3UC3A 5AAFA 4UWCA 3BV3A 3S3IA 4UEUA 3VULA 2OJGA 3F2RA 4BDFA 3NUSA 5EW8A 4O2ZA 2BIKB 4R3PA 3RBWA 3LMIA 4KKEA 3C13A 2YZLA 4RIWA 1R3CA 1CDKA 3CQEA 3ID6C 4WG5A 3EQBA 3MVJA 2HY0A 5AR2A 3HLLA 2OGVA 1YI3A 5HOAA 3C4WA 3FKNA 3Q96A 4C38A 3TM0A 3CKWA 4O7WA 3TV6A 5IQAA 3OEFX 3MPMA 4RIOA 4CG8A 5H3QA 3OT3A 2WQBA 4H3PA 1M52A 2ZJWA 3A7JA 3LIJA 4G1WA 4P7EA 4ACHA 4EK6A 3R22A 2JFMA 2YAAA 4KSPA 4DFUA 3AG9A 5C27A 4IC8A 1VR2A 3EQCA 3TEIA 1H28A 4YJRA 2CKQA 4GK3A 4O1PA 2XIXA 3T9IA 4XLIA 2G15A 5L2IA 3D15A 3QLFA 5KMLA 4ASEA 2R64A 1I44A 3A8WA 5BPYA 1URCA 3FI3A 4NEUA 3F3VA 3EKNA 2FSLX 5IKWA 2YWPA 3GP0A 2P4IA 3TG1A 4O84A 4O0XA 4EZ3A 5DT4A 3V51A 3I79A 3DA6A 3MFSA 4DFBA 3A2CA 3UG1A 2W17A 1GAGA 3NNVA 4EOOA 1BLXA 4A9YA 4M0ZA 4BN1A 4QOXA 3UOKA 2C5YA 3KQ7A 3OWPA 2J90A 3PE2A 3RMFA 3FZSA 4IB1A 4OBOA 4RQKA 4I92A 4ZSLA 4NIFA 4FKVA 3RZBA 3FY2A 1M7NA 3G51A 4CLIA 2Y7JA 4E7WA 4O0UA 4K0YA 4FA2A 5LVMA 3K3JA 3U9CA 3LZBA 1GZ8A 2GTNA 3QRTA 5CI7A 4U79A 4M12A 3KCFA 4XCUA 2IW9A 3TWJA 3QCYA 3CLYA 3C5IA 4MQ2A 4R7IA 3BHUA 4TYHB 1FQ1B 3T3VA 2ETMA 2VO7A 4I6QA 5KZ0A 4AGUA 4G6LA 2W4OA 1H1PA 1YI4A 2VX0A 4RGJA 3K54A 5HEZA 3E5AA 3DLZA 4Q5EA 5AA9A 2ZM1A 3ENHA 3KMMA 2X7OA 4M0YA 2IW6A 3JVSA 4M14A 4IFCA 3CSVA 1PXJA 3WE8A 2WQEA 3R02A 5DEWA 5IDPA 4FK3A 3LJ2A 4KWPA 3FC2A 4QTCA 1FMOE 3BHTA 1K9AA 4QMXA 5ACBC 4KNBA 5CF5A 4Q9SA 3CJGA 4BDDA 3DQWA 4UN0C 3DBCA 3GB2A 2R0UA 2XZSA 4FEWA 3C5UA 2ZDTA 5F94A 1B6CB 4HZRA 2FVDA 4GU9A 4NKAA 4XP2A 2F49A 1JLUE 4GFGA 4BWKA 4FODA 4ACMA 3LCTA 5D7VA 4DYMA 3T3UA 2YCFA 3O0GA 1W7HA 1YRPA 1ZYJA 2Y6MA 3LJ0A 1OITA 3TNIA 4DC2A 3MTFA 1WBSA 3VBVA 4BHNA 2OXYA 3QTRA 3UOJA 3NDMA 5J5SA 3P5KA 2YCSA 2C6DA 3AT3A 1CKIA 3P23A 2ZV2A 4C4FA 4N57A 2CGUA 2XJ0A 4M8TA 3VS3A 4CVAA 4NJDA 3GOPA 5E8UA 1M2PA 5LMBA 1ND4A 1XBCA 3Q4CA 4KUJA 1UU9A 1Q99A 4D2TA 3LQ8A 3QYWA 2OZAB 2BFYA 4CZUA 3Q2MA 4LMNA 3O7LB 3Q3BA 2JKKA 3SRVB 3MB7A 2EB3A 3PWYA 4XG7A 2XNOA 3EQHA 3GXLA 4FKJA 4FIJA 5HCZA 3DAJA 2BR1A 4ERKA 3C7QA 4R78A 3ATSA 4CMTA 2OU7A 3KMWA 1YW2A 2NRYA 3LFAA 4A9TA 2R2PA 3ZLWA 4DFNA 3MJ1A 1H27A 1U46A 4PPCA 4UMTA 1YVJA 3MIAA 2QU5A 5EDRA 4BL1A 1Q97A 3EFWA 4R3CA 4UMRA 3TV7A 3BEGA 3NUUA 4AZEA 4S31A 4EOMA 3SA0A 5CSVA 4ZJVA 5M55A 3IGGA 5A46A 4DT9A 5I9XA 4MK0A 3LMGA 3OTUA 3RPYA 4FKLA 4FC0A 2XF0A 3MVMA 4FV2A 5B2KA 3JR1A 1TKIA 3R63A 3IECA 2XMYA 3NYOA 4U45A 5B7VA 4FYNA 5GNKA 2C6TA 4U43A 3UIBA 2IWIA 4NUSA 3DXQA 3VNTA 3KREA 4FT9A 3LLTA 2ITZA 2W5AA 4QP6A 2RG5A 3O2MA 2UZNA 2BUJA 3IGOA 2RFDA 4J7BA 4G31A 2W1FA 3MFTA 4QYHA 3QFVA 3FXWA 3SHEA 2CN8A 4QP4A 3ZZWA 4ASZA 3EL7A 2QNJA 5FM2A 4V01A 1H01A 4RWKA 5DNRA 4BCGA 4DE4A 4XP0A 1JSVA 5FM3A 2XNEA 4I21A 3L9PA 2R5TA 2UW3A 3KXXA 4YSMA 3F3UA 3OBJA 4IJ9A 1MRVA 3F5GA 5CU2A 5HBEA 4ITJA 5TKDA 3PP1A 4W9WA 5AP2A 5BUIA 4EOLA 3OOGA 2QC6A 4TW9A 4ZTMA 4YNEA 3LCDA 4GK4A 3MS9A 3NIZA 3R21A 2WZJA 2BPMA 4FTJA 2UW6A 4LOOA 4IQ6A 2J6MA 2ZAZA 2VTIA 4QMNA 3A7FA 3IKAA 5HQ0A 5I5ZA 5HX6A 3I0OA 4FV7A 1ZMUA 3BE2A 3W55A 4GEOA 4U7ZA 3F7ZA 5HG9A 4EQCA 3ACKA 4MX9A 4BYIA 3SLSA 2PULA 2VNYA 4YC3A 4IVBA 4C3PA 2CSNA 3BYVA 2W05A 4RX5A 5I3RA 4K2RA 1V0BA 3D7TB 3KRLA 4X3JA 5AV2A 2XJ1A 3G5DA 5CU4A 5AV1A 5AX3A 3RK7A 2V7OA 1BI8A 4XG2A 4AT4A 1KOAA 3V5WA 4CXAA 5IH5A 2WEVA 3N4TA 5BYLA 1OUKA 2QO2A 4BCIA 4D1SA 3M42A 2J9MA 4E4MA 3HL7A 4RIWB 5FTQA 4HCTA 2GPHA 5BX0A 1NVSA 3QKLA 4WO5A 3RINA 4EHEA 5K0XA 3VRYA 1GZNA 1JAMA 4E4NA 5JEBA 3BI6A 4AF3A 5JGBA 1M2RA 4M7IA 2O3PA 4WBBB 2XK9A 5H8BA 3VUGA 4DBXA 3Q52A 2R3HA 2QOLA 5G6VA 2W0JA 3GCUA 1AQ1A 4AW0A 4DA5A 3RK5A 4FTNA 4BC6A 2ZYBA 2W99B 3QWKA 5BVFA 4XV1A 1F5QA 3R1YA 4V05A 5IU2A 5HGIA 4J8NA 4ANLA 3OTVA 3CY3A 4L3JA 4RJ6A 3VW6A 3PZHA 4MH7A 5AAEA 1U5RA 2C4GA 5HCYA 4ZSJA 1IA9A 2X2LA 3MH2A 4JBQA 3WYXA 3KL8A 4F6UA 3ZLSA 1JBPE 2BCJA 5BVKA 2HXLA 3HV5A 4QPSA 4AE6A 5IUHA 4IZYA 4CMOA 4BZDA 5HTBA 5EM6A 2OH4A 3OZ6A 4FGRA 3PPJA 3VHEA 3NNXA 4TN6A 3ZMMA 5HD7A 2XEYA 4MBLA 5H9BA 5IPJA 3WF8A 5CVGA 4DFLA 2YIYA 5FD2A 3QUDA 5DPVA 2CNUA 1OL1A 4DAWA 3MSSA 4O7TA 4NIFB 1GZOA 3M11A 3FL4A 3VVHA 3U54A 2QKWB 5M08A 3MWUA 5LJJA 4RC2A 4YO4A 3IPHA 4YC8A 4U8ZA 5DWRA 1G8AA 1XH7A 3VC4A 1YDRE 2J0LA 3DV3A 5JFXA 5CAOA 3DBEA 4AAAA 2HZIA 3C4ZA 4IANA 4IWDA 4LGDA 4QQTA 4GG7A 3ZUVA 2OICA 3DAKA 3R73A 4FTOA 5HHWA 5HBHA 3D4QA 2W1IA 4D2SA 3B8QA 5DMZA 2VWZA 5DI1A 2X4ZA 4R7BA 3WIGA 1XHAA 1YOLA 3CP9A 4IWQA 3R8MA 5HLWA 3OMVA 4NK9A 4QQ5A 3FDNA 2JAVA 4Q5HA 2OI4X 2F2UA 4D2PA 4EL9A 4BY9E 4E6CA 3POZA 5I3OA 2HW6A 4QMVA 3FMLA 4KS7A 4EWQA 1YWRA 3FZ1A 4QQJA 4JVGA 3COIA 5D10A 5JGDA 1G8SA 3BLHA 2DUVA 4CFMA 4L53A 4U0IA 3F5PA 2GFSA 4A06A 1YXUA 3QKMA 1S9IA 5HU9A 5K5XA 2XCHA 3Q6WA 5GIPE 4LV5A 3BYOA 4FTAA 3U51A 2FSTX 3ORMA 4U3ZA 3MA3A 2VGPA 5CXZA 1M7QA 3DY7A 4G3FA 2W7XA 4MD8E 3ZRKA 5IZFA 3SW7A 2PUPA 3LAUA 1DAWA 4HVGA 3GUBA 4EK4A 5FLFA 2YCQA 5BUEA 3ZDUA 3ZLYA 2V22A 4HGLA 3COKA 3O96A 4NJ3A 4LOQA 2R3QA 4ACCA 1PXLA 1YHVA 2NNWB 4KKHA 4C34A 5GZ8A 4BCOA 5JRQA 3JVRA 2AC3A 2A4LA 2UZBA 5BYZA 4RWIA 5TF9A 5KHXA 2WNTA 4LL5A 4PX6A 5DRDA 3ORIA 5E1EA 2FSOX 1TQIA 1H1QA 1UU7A 2WAJA 3JS2A 4JJRA 3GQIA 4QNAA 4HGTA 5EOLA 4DGOA 3FAAA 4D1ZA 3D5WA 4O21A 4TYIA 4DGGA 5CEIA 4AW5A 5A4LA 4FZ7A 5AP6A 2WMVA 3LJ1A 2W9ZB 2WO6A 2YIQA 4FTQA 2C6EA 3LCSA 2WMUA 4DFXE 1GIJA 2LGCA 4YC6A 4C02A 2X2MA 2BAJA 3L9NA 3BEAA 3PXRA 4DFZE 4FG8A 3K3IA 3W32A 3FSFA 1T45A 3H0YA 2PWLA 4H3QA 2XK4A 3PG3A 3PVWA 2GMXA 3LFCA 4ZSEA 3RALA 3W18A 2XA4A 4MHAA 2VU3A 2QLUA 3BWJA 3G9LX 2XYUA 1TVOA 4PMMA 4EH6A 2JBPA 2RFSA 2WTKC 3DFAA 4TXCA 3EFKA 3SDJA 4JIAA 2BRMA 4XX9A 2EWAA 1IEPA 3VF8A 1CKPA 4Y73A 5HNBA 4FSQA 1Q41A 1JVPP 4FZDB 3HV3A 5IMEA 1PXIA 4PMPA 2VTJA 3D5VA 4AA5A 4GVAA 3FI8A 3LCOA 4RG0A 4FTKA 3QX2A 4PF4A 3EN5A 4E5AX 5HVJA 3P9JA 1S9JA 3ZO1A 1YXTA 3TT0A 2XBAA 2QVSE 3B8RA 3C9WA 5DH3A 4BCHA 2UW4A 2BROA 1KE5A 1REKA 4GV1A 4X0MA 4YNOA 5HO6A 3ZXZA 5KMNA 3PXFA 3BX5A 1TQPA 3LKMA 4ASDA 5J9LA 5AMNA 3ROYA 4XMOA 1OKWA 5JN2A 3RPRA 3C4XA 3S2PA 4RFMA 2I40A 4ZSAA 1RW8A 2YLEA 4KS8A 4E73A 2BDFA 2CHLA 5IUGA 3UPZA 1VYWA 4TZRA 2OF2A 4TPTA 2YJRA 3GC0A 3EKKA 2JKOA 3CQUA 4IX3A 2Z60A 4BGHA 4J53A 3C0GA 4TT7A 4YURA 3V3VA 4IADA 4M13A 5BMSA 3MPAA 2EXEA 5AV0A 2BRNA 5C8MA 3UNJA 4G5PA 4D5HA 2PU8A 4HYIA 2B9IA 4FV5A 3KXHA 2CKOA 4I0SA 4ARKA 3LLAA 4J95A 3MVLA 4RSSA 4TNBA 5EHLA 4D4SA 2OXXA 4IX4A 2PVNA 3FMDA 2ITVA 1QPCA 4G6NA 1R0PA 4LRKA 1XH4A 4IM0A 4CRSA 3O71A 4N4SA 3DB8A 4BI2A 1OZ1A 3ZDIA 2EB2A 3OBGA 4M68A 2XKDA 1IG1A 1PJKA 4HGEA 4BTKA 2GQSA 1OL7A 3PSDA 3H10A 2X8DA 4AX8A 4DEAA 4I5CA 3GOKA 2VTRA 3KRRA 5DVRA 3VS2A 3DXPA 3EZRA 4L6QA 3UBDA 3NLBA 1BMKA 3R9RA 3COMA 4XNEA 3ZU7A 1XWSA 3ANQA 3Q9ZA 4DTKA 3MVHA 4ASXA 4BDHA 3HECA 4FT0A 1JQHA 2QHMA 3E3PA 3NUPA 3OHTA 4TRLA 4EZ5A 4TY1A 2Y6OA 2UZWE 4WD5A 3QQGA 4FBXA 3ZBXA 2GS2A 4PDSA 2W1HA 4QMQA 5IQIA 3RM6A 5FP6A 5AADA 5KUPA 5F9EA 4XRLA 3QF9A 1KE9A 4NWMA 2W1ZA 5HE3A 5I9WA 2XVDA 5I4NA 4EHVA 1CKJA 1SNXA 4KB8A 4L7SA 5EI8A 3VUKA 2W96B 3R2YA 3R1NA 4RBLA 1NY3A 5IUIA 5E8WA 4ALUA 4YGAA 4LI5A 4BB4A 4O1OA 3N4VA 5IA3A 4O86A 4A9SA 4ZK5A 3QGWA 2I0VA 3DK7A 5C03A 1KE6A 4UY9A 5M53A 4HVSA 4AA4A 3NCZA 3K5UA 3OOMA 1UWHA 4R5SA 2GFCA 2R3RA 2XH5A 4L9IA 4RA5A 3UP7A 2Y4IB 5AIRA 5CX9A 3ZSIA 3SV0A 1K2PA 4PMTA 1ZARA 4EH9A 4CLJA 2PPQA 4D5KA 5A4EA 5BYYA 4UZHA 3VAPA 4K9YA 3PRIA 2Y9QA 3ZRLA 3L8XA 4QMSA 1DM2A 3RHKA 5H8EA 3FZOA 2PL0A 2GTMA 4GIIA 3BU6A 4GT3A 3BYSA 4J97A 4KINA 2QODA 4EQUA 3I5NA 4MF0A 4TWOA 5CVFA 4JBOA 4M97A 1OL2A 1SYKA 3Q9YA 4L42A 4QMZA 2XP2A 3GBZA 4U80A 2BAQA 3VS5A 4C4GA 1PXMA 2R9SA 2VZ6A 3AGMA 2VTLA 1F3MC 3UDBA 4QMOA 3TUCA 5EQYA 3FMHA 1WVYA 3BBWA 1P4OA 3RK9A 3VQHA 4E26A 4BCFA 2JBOA 3D9VA 3FQHA 5JQ5A 4YR8A 2FO0A 2CKEA 4WUAA 2A27A 3HYHA 2HXQA 4QP7A 2R7IA 2C0IA 2GNIA 3CXWA 1R39A 2YABA 2OSCA 4RFZA 5DG5A 1NW1A 1JKKA 4HOKA 4L3LA 3PIZA 2QOBA 4PTGA 3TKUA 4C62A 2OIDA 3QBNA 2I1MA 3A99A 4IZ7A 3ROCA 4L46A 1O6YA 2OIQA 3HP5A 4FX3A 3NX8A 2XNMA 2VO6A 4F63A 4IX5A 5CSHA 4ERWA 1WCCA 2V7AA 2XKFA 2C3IB 3LPBA 1TQMA 2UZTA 5AV3A 3EQDA 3LCKA 5I9ZA 3BGPA 3DDQA 4UWYA 2R3NA 4F0GA 3ZFMA 3OCSA 5M51A 3TDWA 4OR5A 4BHZA 5JSMA 4II5A 2JIVA 5DHJA 4FSRA 4ZIMA 5AUTA 2QHNA 2GHMA 4EI4A 4XV9A 2XNNA 5HLNA 2ACXA 2X81A 4PDOA 5A9UA 4EONA 4X6RA 4HJOA 4BI1A 3RAHA 3QRJA 4EUUA 5KKRC 4QTEA 3BQCA 5CS6A 4UMPA 4EK8A 3G0EA 2VAGA 4FKQA 3S95A 3PFQA 3RNYA 4YJQA 2BZHB 4U3YA 3SC1A 3BV2A 3FXXA 4E4XA 3KCKA 2CLXA 3D5XA 4G34A 2YDJA 5LMKA 4O83A 3ZBFA 5BVWA 2J0KA 2R3IA 3GU5A 1E1XA 4FL3A 2CGWA 4ALVA 3GCVA 1ZWSA 1IAHA 5IQBA 3NIEA 4BBMA 3VUIA 3R71A 4GKHA 3LFDA 4FVQA 5CEPA 2PYWA 5BVNA 2GNLA 3HGKA 3E8DA 5H8GA 4CSVA 5HBJA 2XM9A 2B1PA 2P0CA 3OUKA 4KBCA 2FYSA 4FTCA 1U4DA 2ONLC 4AZSA 4O7SA 1Z9XA 3O50A 4AFEA 4EOKA 4WKQA 3QQJA 3DJ7A 2X39A 4ENXA 2VO0A 2OLCA 4W4VA 4W8EA 5FDPA 1FBNA 4LV8A 1XH8A 3ERKA 2BDWA 2WTDA 2QURA 4XJ0A 4JG8A 2JDVA 5GINE 5EYDA 4FEUA 4C8BA 4ZAUA 5KMJA 3OEZA 3PA4A 2FB8A 4QP3A 3V5QA 4APPA 4H36A 2I6LA 4OUCA 4IM2A 1MRYA 2F7XE 3ZLXA 2A0CX 3FWQA 3DTWA 3KN5A 3PVUA 3QD0A 5EM8A 4KIKA 4HW7A 1AD5A 3IDCA 5C01A 2EUFB 4GJ3A 3S00A 3RAIA 3NW7A 4EHGA 3DJ6A 3TCPA 3NVMB 2CPKE 3AMYA 2H9VA 2V62A 2HZNA 3MI9A 1H24A 1OVEA 2AYPA 2ITOA 2YACA 3EQGA 4JQEA 5FQDC 2B53A 3JXWA 1YOMA 3AC5A 5IQDA 2A1AB 5AR3A 5CLPA 1J7UA 3VUMA 3D94A 3V04A 4EH7A 4F65A 1P5EA 4GYIA 4QPMA 1Y8YA 4X2NA 4NW6A 2UZOA 2ITPA 3A7GA 4AP7A 1QPJA 3RCJA 3I4BA 1Q3DA 3TJCA 5L2SA 3OWLA 4L7FA 2WOUA 4BDKA 4EYMA 4XOZA 5EQPA 1OI9A 1Q62A 1MUOA 2UVZA 3ORTA 3UO5A 5HD4A 3EH9A 4AGDA 5HNGA 3OW4A 3ETAA 4NFNA 2UZLA 2VUWA 2REIA 3POOA 3P4KA 4F9BA 5K5NA 5HLPA 4I94A 3TUBA 4L67A 2I0YA 1L8TA 1PRYA 5JH6A 3V5JA 5AP4A 4IWPA 3NVKI 3W2CA 2J0IA 5KNJA 5I9VA 3CE3A 4F7LA 5M06A 1SVHA 4FVRA 2CMWA 1WBPA 4D4YA 4WG3A 3PUPA 3U9NA 4FL2A 2HENA 3E3BX 1MRUA 3G6HA 3RI1A 3QUEA 4OT5A 3C4CA 3W2OA 4EBWA 3QX4A 4NZWB 4X2JA 5KMKA 3ORNA 3GVUA 4OTHA 4AE9A 5IH6A 3ZZEA 4AW2A 3V6SA 3WF7A 5HIEA 3IS5A 3MH1A 5E8TA 1SM2A 1YWVA 4O96A 2OJ9A 4BWPA 1GIHA 4RIYB 3P86A 3MY5A 3SOCA 2VN9A 5A4CA 5IQCA 4JG7A 5AX9A 4A4OA 4DGMA 2QOCA 2J7TA 3VS7A 4CV9A 3GI3A 3KXNA 2JDSA 3LFQA 3QHRA 3BELA 4QP9A 1XBAA 2I0EA 4U40A 1ZMWA 3WZKA 3R0TA 4UWBA 3KU2A 1WFCA 3BYMA 3NZ0A 5JQ8A 3KEXA 2ERKA 2XIZA 3OT8A 4YLKA 4E6AA 4GSBA 2B0QA 3ORZA 4C33A 1GY3A 4EJNA 4QYYA 4YPDA 3BQRA 1JWHA 4LUDA 1H1RA 2YM8A 2R3OA 4MXZA 2RFNA 5A3XA 3UNZA 2X6DA 5HE2A 1UA2A 4YSJA 4FE2A 2HCKA 3S0OA 3P08A 2QR7A 2OO8X 3ET7A 3R01A 4XLVA 1JPAA 4IZAA 4DCAA 5J1VA 3BLRA 1GZKA 4LL0A 2BKZA 3JY0A 4JQ8A 5DT3A 1DS5A 4GS6A 4YZDA 1HCKA 3AD6A 1UNHA 3R83A 5L3AA 5L8KA 2B4SB 3F5UA 3DBDA 1UWJA 1WVWA 3QTQA 2Z02A 2X0GA 4F9CA 1WMKA 3EL8A 5M4UA 2PVJA 2VRXA 3OCBA 4FSMA 3VBQA 3P1AA 3N9XA 2XIKA 3NNWA 2WPAA 3FHRA 2P2IA 2O0UA 1YI6A 2QO7A 5FP5A 3GT8A 4EOSA 3DT1A 3WILA 3I5ZA 3LFFA 3R30A 3ZYAA 3PJ3A 2BILB 3I7BA 3ATTA 3VWAA 1YHWA 3RWPA 3HP2A 4FVPA 4MAOA 2PVYA 1XR1A 3D2IA 2C0TA 2GHGA 2HELA 1V0OA 2R3PA 2XNBA 2ZV8A 3E7OA 4JNWA 4OTIA 1LEZA 5F20A 5J95A 1H4LA 4UX9A 4JRNA 4UV0A 4AU8A 4H3BA 5IQFA 3LXNA 3QHWA 4Q2AA 2KULA 4HVHA 2NO3A 4NM5A 4BTMA 3UVRA 5BUJA 3UYSA 2ZV7A 4FKOA 5M4CA 3TUDA 2I7QA 4Y83A 4W4XA 3E8CA 3FYKX 4ZS0A 3TN8A 4O7RA 3DZOA 3FI2A 1OBDA 1OIQA 4O27B 5CT7A 2Q0NA 3UNKA 2RL5A 3ITZA 3MIYA 3FMNA 4FNYA 4K6ZA 4RX8A 5ANOA 1A48A 4O0TA 1FGKA 2QONA 3AC3A 3EQPA 4FZFB 4J71A 5GJFA 4AACA 3ZO3A 3B2WA 4EZ7A 4F99A 3FXZA 4F4PA 2QQ7A 4RC3A 3VW8A 4RLLA 5A6NA 4IE9A 5M44A 4FYOA 4YJPA 4YMJA 3PLAE 3BU3A 3KXZA 5DFPA 3E8EA 4QQCA 3BGQA 3OP5A 4DFYA 4G17A 2WMAA 5LVLA 4DHFA 4AUAA 3AD4A 4EORA 4EWHA 2R0IA 2XCKA 3G2FA 3IK3A 3SOAA 4QMYA 4WIHA 4UBAA 4YBJA 1GNGA 3KY2A 2GNGA 4ZEGA 2C5NA 2G2HA 3PJ2A 3TXOA 1O6LA 1CSNA 2HAKA 2XK3A 5AFVA 3RJCA 2GDOA 4WSQA 2RGPA 3HX4A 4JL9A 4DEHA 4EC9A 3WARA 2WMTA 3QA8A 2YEXA 5JKGA 4TYEA 3OXIA 2V55A 4MYGA 4PL4A 4DINA 3FBVA 3A4OX 4IXPA 4IBMA 1QMZA 1YXSA 4HYSA 3ORKA 5CQWA 4DEEA 4EBVA 3EZVA 5M56A 1JKTA 2HZ4A 3DZQA 4DLIA 5JZJA 2B55A 5KX8A 5DBXA 1STCE 4UYAA 1Q61A 2IZSA 2PZPA 3Q4UA 4ZY6A 3VUTA 3FLYA 4YJVA 5LMAA 3E93A 4CFNA 3VJOA 5L2TA 4IWOA 5L6OA 1OIUA 3MDYA 5EI6A 3FUPA 4IDVA 4DEGA 1UU8A 2YFXA 1G3NA 1VYZA 2BRHA 4FUXA 3BRBA 4RJ8A 3ULIA 4A9UA 5C8KA 5TT7A 4OTPA 5A6OA 4G16A 4CCBA 3QCSA 2BAKA 4G3DA 5DYJA 3VHKA 4NM7A 1PXKA 4XG3A 4XH6A 1CMKE 2UW7A 3UTOA 2GQRA 4DTBA 3UODA 4U9AA 4KIKB 5GJDA 4OAVB 4RT7A 3AT4A 3B2TA 4FTLA 2CCHA 3KRJA 4I5MA 3PWDA 4MXCA 4IZ5A 4XBUA 2VWXA 2IZRA 3C0IA 4UMUA 3LQ3A 2WELA 3CD3A 3MA6A 2F4JA 1MP8A 4I6HA 4R7HA 3RPOA 3UO4A 3CEKA 3R7UA 3FKOA 2BHEA 5CEMA 5H2UA 3CTQA 2BDJA 2E9PA 4CV8A 2JITA 3CCNA 1MQBA 4GT5A 5AA8A 3Q5ZA 3QZIA 3T9TA 4I6BA 3SGCA 4FEQA 1H25A 4DF3A 4D2RA 3Q60A 3EB0A 3OROA 4BZOA 4CGAA 3D2KA 4F1TA 3LFSA 3MY0A 5AR5A 5JFWA 1A9UA 2GNJA 4ZTSA 5AP0A 4M15A 4MEDA 2OJJA 5IA0A 2WHBA 3R28A 4HYHA 4MBIA 4LGGA 3SXFA 4C0TA 4HVDA 2NP8A 3A8XA 4DBNA 2VTOA 3W2SA 4FG7A 4EKKA 4BZNA 5LQFA 3ZOSA 3ZM9A 2G2IA 5B2LA 2X1NA 3FQEA 4D0WA 4PP9A 4DEDA 5ANJA 4CRLA 4KD1A 3PXQA 3EN6A 3KRXA 4QD6A 5CXHA 1XBBA 3F6XA 3LOKA 4GUEA 4EOJA 2J50A 5CALA 4JDHA 5HTIA 1PY5A 2C30A 1URWA 2BVAA 5CSWA 3LMHA 3OY3A 4FKGA 4ANBA 3OG7A 4JG6A 3FLWA 4PP7A 1V1KA 5LCJA 4O82A 2O2UA 5LCKA 4FNZA 2GNFA 4WT6A 1I09A 4IC7A 2OFVA 2R3GA 2YN8A 3Q4TA 1VEBA 3FLQA 1Q8UA 5D9HA 3PTGA 3F61A 1APME 1RDQE 3HUBA 1U54A 3KB7A 3W16A 3D14A 5DT0A 4MWHA 3FPQA 4C4HA 4AG8A 1H1WA 4G9RA 4QMTA 1GIIA 2B9JA 2XJ2A 2AUHA 5T68A 5EYKA 2G1TA 4O7ZA 3P78A 3RKBA 3TIYA 2JKQA 4E4LA 5AR7A 4S30A 5D11A 4IAKA 4Y8DA 4K11A 5K4JA 2IZUA 3O8UA 1ZMVA 3JY9A 1H0WA 4RVKA 5BVEA 3FJQE 4E1ZA 4PY1A 4QMWA 4FSWA 4FMQA 3W2QA 3THBA 1UU3A 3IOPA 2YM4A 1OL5A 5AM6A 3WF5A 4I5PA 3R9OA 3ZUTA 3OCGA 4BBFA 2J5EA 4NTTA 2PVHA 1PMEA 5TOZA 4BICA 3JPVA 3TTJA 5CU0A 5EFQA 3RWQA 3CTHA 4A7CA 5DA3A 4YHJA 4HNIA 4OBPA 3SQQA 1OGUA 1PYEA 5IA1A 4EH8A 2ITQA 3E64A 4F1MA 3O8TA 4CYIA 4MCVA 1WBNA 4I93A 3R9HA 5CAQA 3G15A 1UKHA 4LG4A 4U6RA 4FEVA 2UW0A 3QXOA 2YITA 4Z7HA 4V0GA 5ANKA 1FPUA 1YHSA 3L8VA 3NYNA 4WNPA 3UG2A 4AZTA 4N6YA 4PDYA 5E91A 1OMWA 2OJIA 2NPQA 3Q9XA 5KMMA 5DN3A 3QD3A 3KFAA 3M1SA 4J1RA 3FL5A 3W2PA 1KSWA 3RHXA 1XJDA 3CIKA 1LPUA 2P55A 4FT7A 2CLQA 3ZC5A 5M4IA 3M2WA 2QOOA 4ZTHA 3OVVA 2YDKA 1OIYA 2BKKA 4FTIA 2HWPA 4BDJA 3IDPA 4IDTA 4JRVA 1B38A 3KVXA 3EIDA 3UOHA 2PE0A 2QR8A 3O23A 1W8CA 2JFLA 4E3CA
chains in the Genus database with same CATH superfamily
3BHHA 3F5XA 4YBKA 2PE1A 4JOAA 4AZFA 3F66A 4O22A 4BDBA 2BALA 5KBRA 4ZJJA 3QL8A 3RZFA 3S4QA 4ZLOA 2IJMA 4FKTA 2OBJA 4U5JA 4BGGA 4YU2A 5FUTA 2ZMDA 5K9IA 2C3JA 3AD5A 3OW3A 3ZFXA 1ZOHA 3VRZA 4O4BB 3E7VA 3LXKA 2ITXA 3PSCA 5L8LA 3QUPA 2WEIA 3DK3A 4PV0A 2WMXA 3ENMA 4LRMA 5M09A 2PVRA 4J98A 3KRWA 2XKEA 4BDCA 1H07A 4JR3A 2BRBA 3OWKA 4AFJA 3T8OA 3OD6X 1JKLA 1NXKA 2QD9A 5E9EA 3E88A 3O7LD 2G2FA 4KAOA 1BYGA 1XH6A 1WZYA 2UW5A 1J1CA 5J1WA 5HORA 1WAKA 5LARA 3WIKA 4ZTNA 3V8SA 2R3MA 2ITNA 1PXOA 4FV1A 3CQWA 2CNVA 3L9MA 5E8VA 5JRSA 5JMSA 2C1AA 2Z8CA 5C8NA 4WNKA 4A07A 3KULA 2PK9A 4AT3A 2C6KA 4BTJA 3D5UA 1FVRA 3WZUA 5A14A 2OH0E 4AZWA 3F69A 4E20A 4CD0A 4F9WA 4NCTA 4YJNA 5AUVA 3VO3A 2XAOA 1HCLA 2PZRA 2WTJA 3F3TA 3FSKA 3LVPA 5AJQA 4DH7A 1Y57A 3TZ9A 3V5LA 3N4UA 2VTAA 3SX9A 2VTTA 4TKSA 1H08A 4FR4A 4GFMA 5AR4A 4RJ4A 2XK7A 5C1QB 5CF6A 4LYNA 2X8IA 4G9CA 3VJNA 4FKWA 4FZ6A 4XS2A 2VX1A 2B9HA 3QD4A 3QGYA 3TTIA 1H00A 2UZVA 2WMWA 3FLNC 4MD7E 2LAVA 5KMOA 3P7AA 2QCSA 3G90X 4GL9A 3HAVA 3QTSA 3FPMA 4TNDA 4KKGA 2XRWA 4M69A 2EVAA 5CWZA 4F70A 2C6IA 2GQGA 4G2FA 1UVRA 2C5XA 2UV2A 2VO3A 3ZXTA 3TKHA 2VNWA 3PA5A 4X2GA 3W10A 5HZNA 3E8NA 4CYJA 3AXWA 5LVOA 3DS6A 4IX6A 4QP2A 4BBEA 2BHHA 3HMOA 3PP0A 4YTCA 5LXMA 1KV1A 3ZO2A 3LFBA 3PPKA 3Q6UA 3W0OA 3QQHA 1YDSE 3TV4A 2CDZA 3HKOA 3NUNA 3DOGA 1WBTA 3TNPC 5ETCA 5HIBA 1PW2A 3DCVA 3UIXA 2WMSA 3KXGA 2DYLA 3GQLA 5F95A 3PXKA 1EH4A 3DNEA 4BFMA 4IFGA 4YZNA 5AR8A 4ANMA 1PXPA 3HDMA 5JFSA 5ANIA 4EUTA 2X0PA 4ZMFA 3MH3A 4RIYA 4RC4A 4ANSA 5EYMA 5J9YA 3Q04A 3SVVA 2EU9A 2XS0A 5IEVA 4GKIA 4HVIA 2HZ0A 2ZB0A 3UC4A 1W84A 2VWVA 3V8TA 4Z3VA 4X21A 2JDRA 3FMMA 3IO7A 3VN9A 3WI6A 1ZOGA 3HMPA 3R7GA 4YJTA 1XH9A 4YLJA 4DH5A 5FXRA 4X6QC 5CU3A 5E92A 3SW4A 5E8YA 2XB7A 4GJ2A 2YIWA 3R9NA 1ZY5A 2JKMA 5CZIA 4DG3E 4D28A 5IDNA 4CZTA 4B6LA 4AZVA 2X0QA 2C6MA 4JR7A 4AGWA 1ZLTA 5HG8A 5FBNC 3HAMA 3L9LA 5DR6A 4ZXTA 4C4JA 5KCVA 1OECA 4ZZNA 4OGRA 4I41A 5IMXA 4WNOA 3G9NA 3FMJA 4MXAA 2PTKA 4MNEB 4XG9A 2VWYA 1W82A 3IOKA 3QKKA 4L52A 3PIXA 3AQVA 3F7WA 3HA6A 5CZHA 3R8ZA 4H05A 3PJCA 4GYGA 3AOXA 4XV3A 4FV8A 4X3FC 2H96A 3UVPA 4FV0A 3V6RA 4FSYA 5CNOA 1U54B 4BCMA 1LEWA 2ZMCA 3FZRA 4JX3A 5EM5A 5LVPA 2WTWA 4M3QA 3BWFA 4DGNA 2GS7A 2R3JA 2W1EA 1FMKA 2QO9A 2QOHA 4PRJA 5J87A 4CFVA 5HO7A 1XMLA 2W9FB 3QCQA 4RVMA 5ANDA 2C3LA 5AP7A 3ZH8A 4PNKA 4XG8A 4QPAA 5CU6A 2Z7LA 3HZTA 3MTLA 5D1JA 4BKZA 2ITUA 3NYXA 1ZZLA 4UMQA 5FGKA 4ANQA 2VWIA 4B99A 4ENYA 3GU8A 5CAPA 4FTRA 3WBLA 5ITAA 5M4FA 4W4YA 3WZDA 1XQZA 4WRGA 4FNWA 4FTTA 1YOJA 4O4CA 3DK6A 3JYAA 3QTUA 4FIFA 4JIKA 5CAVA 2J2IB 4ZY5A 3ELJA 4G5JA 4PMSA 4WHZA 2BZKB 4MF1A 3VBWA 4CEGA 4CCUA 4CQGA 4ZLZA 3U6JA 3EQRA 5HICA 4AA0A 3RAWA 1ATPE 2QLQA 4YZBA 3CY2A 2WKMA 3N51A 4EJ7A 3FY0A 3ULZA 4NTSA 2WTKB 3NNUA 2CCIA 3IQ7A 1M17A 3MV5A 4ITIA 4FKRA 4F7SA 3QYZA 4R1VA 4F7JA 5TE0A 5D7AA 5AUXA 4EK3A 2W1DA 2ONLA 4KSQA 5IQGA 4TYGA 4V0GB 5HE0A 1UV5A 1YQJA 1NT2A 4MTAA 4TWPA 1W98A 5CEKA 3DBQA 1Q8YA 1Y6AA 5K0KA 2QG7A 3DKCA 4AXAA 5KMIA 4BCJA 3RTPA 5JK3A 4AWIA 4FKSA 3W0MA 4K77A 2IVSA 2OKRA 2YM3A 5L8JA 2IO6A 2J0JA 3QZFA 2VTPA 1L3RE 4TWNA 3AC2A 3UYTA 2GHLA 1FOTA 4IHPA 2XRUA 3ZRMA 4PQNA 4U97A 2VX3A 3QTIA 4UXQA 5FBOA 4L01A 1IR3A 1ZYCA 2E9VA 3O17A 4JLCA 1J7IA 1KE7A 4H1JA 4MWIA 3ZFYA 3P0MA 3E62A 4JDIA 4NKSA 2WIPA 3BKBA 3LFNA 3GCPA 4NM3A 3EN9A 2WOTA 2WD1A 4ZTQA 4CTCA 4E8AA 4EH2A 5CASA 2WQOA 4ZTRA 4O7LA 1Q8ZA 4BIDA 4CKIA 3LM0A 4KA3A 3PE1A 3WZJA 4ACDA 4L43A 3CBLA 4AS0A 3ODZX 4O6LA 2WQNA 3GGFA 3RM7A 5C26A 2F7EE 5AP1A 3LE6A 1LR4A 4ORKA 4YJOA 3HA8A 2OF4A 3P79A 4PPAA 1UNGA 1W0XC 2QKRA 1JNKA 2YIRA 3PVGA 3FQSA 3QA0A 4HCUA 4OBQA 3LFEA 2WQMA 4MVFA 4ID7A 4HPUE 5FRIA 3SKCA 5GZ9A 3PY1A 5GZAA 5I0BA 2V0DA 4PTEA 4K18A 3VS1A 5F1ZA 1H8FA 3TKIA 3UVQA 5BMMA 1ZYDA 3A62A 4ALWA 5FTGA 2PUUA 1PMNA 4ZOGA 3ZCLA 3KULB 4JQ7A 1U5QA 3ZSGA 4IAYA 3ORXA 5CF4A 1JSTA 2PVKA 3FKLA 3MESA 3QRKA 2J5FA 3ANRA 1RE8A 2W1CA 2C1BA 4M84A 4GMYA 3FEGA 4HCVA 4WBOA 4BGQA 5LMKC 2F57A 2IN6A 3D83A 4BKYA 4DEBA 2E9OA 2PMIA 1P14A 3W8QA 4S34A 5CF8A 5IH4A 1IAJA 2IVVA 4QO9A 2VGOA 2XYNA 2DWBA 1IASA 3QD2B 3OFMA 3UZTA 4IAIA 4ZJIA 3GC7A 2IG7A 4FSTA 5T3QA 2OK1A 3R8PA 4FSUA 3WF9A 2C47A 4TYJA 3LHJA 2QOFA 3PXYA 3U8WA 3AC4A 3OC1A 3ODYX 2E9NA 4FIIA 5AP3A 4O7YA 4NYEA 2IEWA 2H6DA 4FICA 4M69B 3HDNA 2VTHA 3GC8A 4OAUC 4LRJA 1KWPA 4E5BA 3RPVA 2J51A 3QTWA 3W33A 5IEYA 3V01A 3HRBA 4CMUA 3C50A 1DAYA 4X2FA 2EXMA 4RX9A 4E6DA 3R2BA 3VS6A 4J8MA 1B39A 3SAYA 2R3FA 3NUYA 4D1XA 3BZ3A 1CTPE 1OPLA 1ERKA 4OW8A 3FLZA 4O2PA 3ORLA 3TNWA 3VIDA 2RIOA 4CFFA 2O5KA 3TZ7A 3PA3A 2RKUA 1Q24A 3TZMA 4L45A 1R1WA 4IAFA 5C4KA 2WMQA 4LGHA 4FKIA 3V5PA 4C3RA 1T46A 5CI6A 3CC6A 2XNPA 1REJA 2P33A 4BF2A 4M67A 4UB7A 4XBRA 5IF1A 4W8DA 4CTBA 4FK6A 2SRCA 2O65A 3FZPA 4FV3A 4MQ1A 4WA9A 4QYGA 3R1QA 4EEVA 4F9YA 3DXNA 4OLIA 3ZTXA 3C1XA 1JSUA 3DPKA 1PMUA 5L2QA 4GK2A 4O6EA 4LDTA 3Q32A 4RWLA 4OTQA 4GRBA 5DOSA 4X3FB 2C0OA 4EH3A 4UYNA 4CKRA 4OTDA 3KC3A 5HI2A 5I9YA 2QU6A 3CTJA 4ZSGA 3NCGA 5K3YA 4P5QA 2IVTA 3TNQB 4BTFA 1G8JA 3DKGA 3UO6A 3HV7A 3R00A 1SNUA 3EQIA 4DLJA 4EYJA 4F64A 2XIYA 2FGIA 4XV2A 2VWWA 5K4IA 4FSNA 5A4QA 1J7LA 3EQFA 4GUBA 3UIMA 5BV3A 3QRUA 2PSQA 5FWKK 3LXPA 3OY1A 4D4VA 2G9XA 4FV4A 5AUUA 2BTRA 4OTWA 4YO6A 4FZAB 1E9HA 3P7BA 4KRDA 3E87A 3WZEA 3VUDA 3BHYA 3MB6A 3WYYA 4FV9A 4I0RA 1FVTA 5EM7A 4AQKA 4QRCA 4C57A 4Y95A 4ZTLA 3I6WA 3KXMA 4D2WA 1GJOA 4AN2A 2CJMA 1ZY4A 2HWOA 5AWMA 3VBYA 3S1HA 2PZ5A 5HX8A 1BX6A 3TI1A 1OM1A 5EW3A 5LWMA 1XKKA 1FVVA 1KV2A 2P2HA 3NS9A 4JX7A 4O0WA 5CQUA 4ACGA 4YHTA 2H8HA 2YZAA 1SVEA 1Z5MA 5JT2A 3F3WA 3ZUUA 4CZYB 1O6KA 3NYVA 4FT5A 4U41A 3TJDA 1Q5KA 3UQFA 4DT8A 5HCXA 4C37A 5KKRB 4MXYA 3R7YA 3UQGA 4D2VA 2WFYA 2VWUA 2HY81 4QMMA 4IJPA 4IB0A 4XEYA 3MH0A 5J8IA 3HUCA 5ACKA 3DKOA 3FE3A 4BCQA 2YAKA 1DI8A 1PF8A 4N70A 5EKOA 3COHA 4B8MA 4DCEA 3QQLA 1PKDA 2E9UA 4D4RA 5E4HA 3Q5IA 4M66A 3A7IA 4JMQA 5HVKA 1W2DA 3L8PA 3QQFA 2UUEA 5E8ZA 3DJ5A 4EC8A 2F7ZE 4EH5A 4H1MA 4BVUA 4LUEA 4F0FA 4YPSA 4RVLA 3RCDA 5EH0A 4RRVA 4O0YA 4KABA 4FSZA 4D9UA 1IRKA 3MJ2A 5IA5A 3R1SA 2X7FA 3ALOA 5HG7A 1ZRZA 3A4PA 5BVDA 4IAZA 3U6HA 4KBAA 3R8LA 3MW1A 3PZEA 4MUQA 3PPZA 4XP3A 4QYEA 4O81A 4FGBA 3BCEA 4LV7A 2GSFA 3DB6A 4FUYA 2B54A 2CGXA 2JIUA 2ETRA 3D0EA 3PG1A 5CANA 1KUTA 4BRXA 3SXRA 2FA2A 1ZZ2A 4OT6A 4FOBA 2VTQA 5CYIA 4E6QA 2O63A 5EW9A 4EOQA 4F6SA 3ACJA 4WOVA 5AV4A 1SVGA 4JS8A 4DH3A 2WMRA 5FDXA 4IW0A 2QOKA 4FI1A 4BCKA 4MD9E 4YP8A 4D55A 2JEDA 1K3AA 3F2AA 4FIEA 4I5HA 3UZPA 1OPKA 5JFVA 4JDKA 4I22A 2C69A 3OF0A 4EK5A 4ZY4A 3CJFA 4B9DA 4CNHA 4DN5A 2R3LA 4BIBA 2XARA 1XO2B 2O8YA 4S32A 2Y4PA 3GFEA 5EQEA 2XEZA 3U6IA 4WRSA 4KIPA 4FV6A 4L00A 3F82A 1M2QA 2X9EA 2X6EA 3FC1X 3FLSA 3LW0A 3QLGA 5AEPA 5BQ0A 3AKLA 3TDVA 3CGFA 4QP8A 4R6VA 4BDIA 2W1GA 3R8UA 4DG0E 3VS0A 3BGZA 2VWBA 5FXQA 4CG9A 3MFUA 4Y72A 3E63A 3KK8A 3QQKA 2JAMA 2C6LA 4AQCA 1VZOA 3FI4A 3KVWA 1J91A 5AIKA 4Z55A 4IM3A 3IW4A 3Q9WA 3KN6A 4NL0A 4W9XA 5C9CA 2OWBA 3DFCB 5KO1A 3SG9A 3I1AA 3G33A 3F2NA 2YISA 3E92A 5DR2A 2X4FA 4R5YA 5HU3A 4HGSA 4S33A 3HV4A 4ZZMA 3BE9A 4RZWA 5D41A 5F4NA 2JLDA 3FHIA 3TACA 4BCPA 3TMOA 4GCJA 4MXXA 3WE4A 2ZVAA 5CENA 2BZIB 3UOLA 4A4XA 2OW3A 3CKXA 4MKCA 4OTRA 2PVLA 4Q9ZA 5HE1A 1Q3WA 1XH5A 2OZOA 1QL6A 4I24A 4AGCA 4D58A 1ZOEA 4NM0A 4FIHA 2PVFA 4DITA 4G3CA 4DG2E 4G6OA 4B4LA 4C3FA 2B7AA 2BMCA 3EFLA 4C36A 2RFEA 2YHVA 5B0XA 3RAKA 3V8WA 2XUUA 1DI9A 3QU0A 5E90A 3O51A 4CQEA 3VF9A 5CT0A 4BWXA 4RX7A 4KIQA 3BL9A 4BI0A 3W0NA 1NA7A 4B0GA 5CEOA 1W83A 4RJ5A 4R77A 2J0MB 3VBTA 3UPXA 5E7RA 4JBVA 5GHVA 2X7GA 3ZEWA 3ZHPC 4QDVA 4USEA 4P4CA 5GIOE 2ZOQA 2Y0AA 3BU5A 5C4LA 3JUHA 3PYYA 4U81A 3R7EA 5CNNA 5EHYA 5LWNA 3ZSHA 4FT3A 3Q4ZA 2W5BA 3GNIB 1HOWA 4LOPA 2PMNX 3NGAA 1J1BA 1OUYA 1YWNA 2W5HA 3BLQA 3EOCA 3WOWA 4O0RA 5DLSA 1YDTE 5HTCA 1MQ4A 4O7VA 5EKNA 4DHZA 3MY1A 3O8PA 1BUHA 4WUNA 4USDA 5D12A 2NYAA 4EOIA 3H3CA 4G3GA 4JT3A 1R0EA 2ETKA 2V5QA 2E2BA 3DKFA 1NVRA 2W4KA 4IAAA 5IG1A 4QMUA 3ZONA 4MNEA 4B7TA 2ITYA 4JAJA 4PDPA 3CS9A 3W0QA 4AOTA 2ERZE 1IA8A 3R7VA 2PHKA 2UZDA 3VONA 5CVHA 3Q2JA 4Z16A 3SG8A 1E1VA 4AW1A 4FF8A 4D9TA 3H9FA 2WB8A 2UZUE 1Y6BA 2VV9A 3IW6A 5FTOA 4GIHA 2DQ7X 1RQQA 2PE2A 3OS3A 5KHWA 4BIEA 3QC4A 4FIGA 4JDJA 5EI2A 1BI7A 4JI9A 2BRGA 2C5OA 2I0HA 3H9OA 3NAYA 3I7CA 2RF9A 2X0OA 3UQCA 4WNMA 2Z7SA 1WVXA 4RA4A 3HV6A 4CFWA 4RLKA 1PMVA 5L2WA 2CGVA 5DIAA 4RIXA 3H9RA 1AGWA 2Y8OA 2JC6A 4PTCA 4X2KA 4XOYA 3P7CA 5IQEA 3DAEA 1U59A 2OFUA 3EFJA 3EN7A 3PY0A 1WBOA 4XUFA 3C51A 1PYXA 1P2AA 2F9GA 2R3KA 3GEQA 5CY3A 3I0QA 4RQVA 3KMUA 4YZCA 3ZM4A 2QG5A 2ZFYA 2YLFA 5AP5A 1Z57A 1ZYLA 3DDPA 4ANOA 2XIRA 3K2LA 3KGAA 4C59A 3PSBA 4GG5A 2WU7A 3TZ8A 4C58A 4B8LA 3IONA 2O64A 4L8MA 5J7BA 4GVJA 3H30A 4IIRA 4K8AA 3DNDA 2UW9A 2Y4IC 5I9UA 4EH4A 4E93A 4I3ZA 4ANNA 2XAMA 4DHJA 3QWJA 3IDBA 3QTZA 3ZC6A 2QOQA 4JXFA 3GFWA 2BFXA 2XBJA 2A98A 4PPBA 3BLAA 3OWJA 1VJYA 3A60A 4QNYA 1R78A 3GENA 5EHOA 3QRIA 1YKRA 4KBKA 4O38A 2BTSA 5KZIA 2JD5A 3UMWA 4Y5QA 4QMLA 3FYJX 3NPCA 5DE2A 1J3HA 5DGZA 5E8SA 4DH1A 3VBXA 3DU8A 5FEEA 4IVCA 3NMUF 5ETAA 3IG7A 2W4JA 3AGLA 4N6ZA 3RNIA 3SXSA 2QOIA 4PL3A 3CGOA 4AT5A 4ZLYA 2HOGA 4KRCA 3AMAA 4TWCA 1O9UA 5J5TA 2GCDA 3QZGA 2R4BA 2BZJA 4LM5A 4RJ7A 2P3GX 3GC9A 2C68A 4E5WA 1LP4A 3IW5A 5EK7A 3KIOC 4L44A 3QAME 2JDTA 3Q53A 4GU6A 3EMGA 4Z9LA 5LOHA 2BIYA 3UP2A 3EWHA 4Y85A 3AC8A 4CFXA 2WIHA 4YJSA 2AEGA 3LXLA 2JGZA 4BYJA 1Q8WA 2WGJA 5E8XA 2JIIA 3DBFA 1QCFA 2ITTA 4H39A 4I6FA 5B2MA 5EOBA 3CD8A 1M14A 3II5A 3A7HA 1JKSA 2VTNA 2YM5A 5A4TA 3NRMA 4IVDA 4R1YA 2IZTA 5BVOA 2C6OA 1P4FA 4PNIA 3WF6A 4I4FA 3FZTA 2WTIA 3MBLA 3RPSA 4QYFA 1ST4A 3MGYA 2IVUA 1LUFA 4YJUA 4W4WA 4P5ZA 3AMBA 4C35A 2FUMA 4IMYA 4EOPA 2OG8A 1BL6A 4NW5A 2HIWA 1OL6A 2XNGA 3GCSA 4F7NA 4QTBA 3BIZA 3RVGA 3DGKA 4R8QA 5HG5A 3KA0A 4MNFA 3HMNA 4FOCA 2IPXA 4BR3A 4FNXA 2DS1A 5HVYA 3PJ1A 4C61A 4YUQA 3KF4A 4S2ZA 5L6PA 1V0PA 3R6XA 2B52A 3PY3A 5CSXA 3L8SA 4I0TA 3U55A 3CPBA 4RVTA 5CTPA 2KTYA 4IEBA 3HMMA 3TL8A 2ITWA 3NUXA 3PRFA 4RZVA 1ZXEA 1YXVA 5LVNA 4BKJA 1WBVA 2VTSA 3H4JA 4YTIA 4UZDA 5EG3A 3RP9A 2R7BA 3ZO4A 5J7HA 4A9RA 4I6LA 4IB3A 3UDZA 1W2FA 4OTGA 3NSZA 1SMHA 2Z7RA 4FJVA 2YM6A 3F3ZA 3F88A 4XHKB 5TR6A 3TIZA 4YLLA 2PZYA 3QALE 4LMUA 5IA2A 1H26A 5HKMA 3W1FA 4PUZA 4UXLA 3EN4A 1Y91A 2OIBA 4F9AA 3QQUA 5EDQA 2GS6A 1CM8A 3QTXA 3FMKA 4QT1A 4Y46A 5KBQA 3KF7A 1G5SA 4IVAA 5T6KA 3I6UA 5HIDA 5HNIX 5AUWA 4V04A 1OPJA 3PJ8A 1QPDA 2YA9A 4IACA 4K33A 4TTHB 5BNJA 1QPEA 3C4FA 4NH1A 5L6WL 4BDAA 4YHFA 4NT4A 2GNHA 5FEQA 5ETIA 4USFA 4LQMA 2ZV9A 3HNGA 4ONAA 5AM7A 4XG6A 3VUHA 2CNQA 3EJ1A 3REPA 4C4EA 2X8EA 4YTFA 3C4EA 1Y8GA 4TYHA 4APCA 4DH8A 4GH2A 5A54A 2ZM4A 3DQXA 3GU6A 4GW8A 4HZSA 4CFUA 2YM7A 3BHVA 2PY3A 3NW5A 1WBWA 4NCTC 4FEXA 4X3FA 2RSVA 2VTMA 4JAIA 3PVBA 4O4DA 5M57A 2EXCX 2ZDUA 4NSTA 3BL7A 4I1ZA 4U42A 1OKZA 2H34A 3OXZA 4F08A 4Y5HA 3AT2A 5G1XA 1OGYA 2CKPA 4J99A 4WSYA 4MBJA 2Q83A 1OIRA 2B9FA 3BBTB 4DEIA 5CSPA 2GU8A 2UZEA 3C0HA 4L68A 4AN9A 2QI8A 1YXXA 3FMEA 4YZ9A 2NRUA 3OXTA 5ETFA 4ZS4A 3RGFA 3DTCA 2AC5A 2HW7A 3NR9A 3W0SA 1OKYA 3UMXA 2W06A 3QZHA 4IB5A 3UZRA 5IA4A 2Q0BA 2ZM3A 3VS4A 3VQUA 3CR0A 5J9ZA 3AC1A 4UALA 3MYGA 4K1BA 4RWJA 3BYUA 5E1SA 2WXVA 4QMPA 5AUYA 4CT2A 3EYGA 4I4EA 4HPTE 4F0IA 3D7ZA 3TNHA 3G0FA 4FL1A 3K5VA 4QTAA 3MPTA 4C7TA 4JBPA 1FGIA 1NVQA 3EHAA 5IISA 1PXNA 3ZEPA 2UVXA 5EDPA 5IQHA 3HEGA 4ZP5A 3HRFA 4AOIA 2VD5A 3UJGA 4ZZOA 3A61A 3NEWA 3ORPA 3NUAA 3I81A 2J4ZA 5AAGA 4O0VA 2C3KA 2ZB1A 5ANGA 3GCQA 2OZAA 4ITHA 4J52A 4P90A 3SD0A 4O7NA 4RIXB 5M07A 2X9FA 5GJGA 5FG8A 3R8VA 2XK6A 3NWWA 5FXSA 1A06A 3OUNB 3PXZA 1ZAOA 3V5TA 2WU6A 4FTUA 3SRVA 4D0XA 4H58A 3ZS5A 3F9NA 4LFIA 3U4UA 4BDGA 1BL7A 4CT1A 4OTFA 4RPVA 3HMIA 4C4IA 4O91A 4QTDA 1OBGA 4DTAA 3QC9A 4U44A 5ANEA 2IW8A 3W2RA 2PMLX 3IW8A 1OB3A 5JGAA 4FKPA 2XALA 4P2KA 3OCTA 3L1SA 4AXCA 2CN5A 2FSMX 1ST0A 4RJ3A 4X7QA 2WMBA 1H1SA 3GU7A 4BDEA 3NW6A 4CKJA 3PIYA 5ICPA 4C2WA 3PUFC 3PLSA 4KIOA 4EHZA 1SZMA 3UIUA 1PHKA 4F6WA 1OKVA 2YJSA 2ESMA 4QP1A 2PUNA 3IW7A 5CEQA 4DGLC 4R3RA 3U87A 3PDTA 2OJFE 3HVCA 4XG4A 4AN3A 4O0SA 4XRJA 2Z7QA 4F1OA 2PZIA 4L3PA 2G01A 1X8BA 2UVYA 2YCRA 2Z2WA 3W0RA 2YWVA 4MXOA 2F2CB 5HO8A 2OXDA 2A2AA 3NAXA 2YERA 3ALNA 4RMZA 5EYCA 5TO8A 3UE4A 2RG6A 4NFMA 1UNLA 3U4WA 4PWNA 1KOBA 4GFOA 3CPCA 1FINA 4FKUA 3LM5A 3KKVA 4FG9A 4PL5A 4RFYA 4XYFA 4HYUA 3FV8A 4HNFA 4AOJA 4YTHA 2XM8A 3QXPA 3W8LA 2PMOX 4Z7GA 2PVMA 1Q8TA 5FEDA 4ZMEA 1BKXA 5CAUA 2YIXA 3HRCA 5DR9A 3I60A 5KE0A 3R7OA 5J79A 1JOWB 3G6GA 4YZMA 2PUIA 4I20A 1KE8A 5IEXA 4N0SA 3EYHA 1Q4LA 4I23A 3KK9A 4C2VA 3LQ5A 2HK5A 2HYYA 2JDOA 5JZNA 1PKGA 3R9DA 2C5VA 2XKCA 1ZYSA 3MFRA 4F09A 4FTMA 1GOLA 4WG4A 3UGCA 5L4QA 5AUZA 2WTVA 2XK8A 3H0ZA 4A4LA 5DEYA 3R04A 1H0VA 2X2KA 4TL0A 4IH8A 5DRBA 3BPRA 4GT4A 2FH9A 3DLSA 2YDIA 1RJBA 3MN3A 2A19B 4BCNA 3R7IA 5HESA 1F0QA 2WTCA 4EKLA 4G3EA 4EQMA 3GU4A 3D7TA 4J96A 2UW8A 3QCXA 1UKIA 4NU1A 3UC3A 5AAFA 4UWCA 3BV3A 3S3IA 4UEUA 3VULA 2OJGA 3F2RA 4BDFA 3NUSA 5EW8A 4O2ZA 2BIKB 4R3PA 3RBWA 3LMIA 4KKEA 3C13A 3TYKA 2YZLA 4RIWA 1R3CA 1CDKA 3CQEA 3ID6C 4WG5A 3EQBA 3MVJA 2HY0A 5AR2A 3HLLA 2OGVA 1YI3A 5HOAA 3C4WA 3FKNA 3Q96A 4C38A 3TM0A 3CKWA 4O7WA 3TV6A 5IQAA 3OEFX 3MPMA 4RIOA 4CG8A 5H3QA 3OT3A 2WQBA 4H3PA 1M52A 2ZJWA 3A7JA 3LIJA 4G1WA 4P7EA 4ACHA 4EK6A 3R22A 2JFMA 2YAAA 4KSPA 4DFUA 3AG9A 5C27A 4IC8A 1VR2A 3EQCA 3TEIA 1H28A 4YJRA 2CKQA 4GK3A 4O1PA 2XIXA 3T9IA 4XLIA 2G15A 5L2IA 3D15A 3QLFA 5KMLA 4ASEA 2R64A 1I44A 3A8WA 5BPYA 1URCA 3FI3A 4NEUA 3F3VA 3EKNA 2FSLX 5IKWA 2YWPA 3GP0A 2P4IA 3TG1A 4O84A 4O0XA 4EZ3A 5DT4A 3V51A 3I79A 3DA6A 3MFSA 4DFBA 3A2CA 3UG1A 2W17A 1GAGA 3NNVA 4EOOA 1BLXA 4A9YA 4M0ZA 4BN1A 4QOXA 3UOKA 2C5YA 3KQ7A 3OWPA 2J90A 3PE2A 3RMFA 3FZSA 4IB1A 4OBOA 4RQKA 4I92A 4ZSLA 4NIFA 4FKVA 3RZBA 3FY2A 1M7NA 3G51A 4CLIA 2Y7JA 4E7WA 4O0UA 4K0YA 4FA2A 5LVMA 3K3JA 3U9CA 3LZBA 1GZ8A 2GTNA 3QRTA 5CI7A