1Q4LA

Gsk-3 beta complexed with inhibitor i-5
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
352
structure length
342
Chain Sequence
b'SKVTTVVATPGQGPDRPQEVSYTDTKVIGNGSFGVVYQAKLCDSGELVAIKKVLQDKRFKNRELQIMRKLDHCNIVRLRYFFYSSGDEVYLNLVLDYVPETVYRVARHYSRAKQTLPVIYVKLYMYQLFRSLAYIHSFGICHRDIKPQNLLLDPDTAVLKLCDFGSAKQLVRGEPNVSYICSRYYRAPELIFGATDYTSSIDVWSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQIREMNFPQIKAHPWTKVFRPRTPPEAIALCSRLLEYTPTARLTPLEACAHSFFDELRDPNVKLPNGRDTPALFNFTTQELSSNPPLATILIPPHARIQA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLYCOGEN SYNTHASE KINASE-3 BETA
publication title Structural Characterization of the Gsk-3Beta Active Site Using Selective and Non-selective ATP-Mimetic Inhibitors
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 99
structure length 342
sequence length 352
chains with identical sequence B
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2003-08-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 1q4lA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 1q4lA01
2I0EA 4EOKA 3NYOA 1XH7A 4HGEA 4I92A 5A54A 2WOUA 4G34A 4CV9A 3ZFYA 2V7OA 3PJ8A 1OITA 1CKIA 4FOBA 4AFJA 2Y0AA 5H2UA 4OTGA 5L3AA 3U4WA 4OTIA 3CSVA 2C0IA 3DB6A 4O1OA 3UBDA 4GK2A 3LMIA 4NW5A 1ERKA 4FIJA 2BROA 4NCTA 4BZOA 2OJ9A 3Q9ZA 4MHAA 3T3UA 3BX5A 4H05A 4PL4A 4GU9A 4HYHA 4S30A 4QO9A 5DI1A 5AR2A 5CEPA 1WBWA 2PVMA 3QRIA 5EKOA 1YDSE 1IAJA 3R1QA 3K5UA 1CSNA 3H9OA 2LGCA 3T9IA 4CT2A 5HO6A 5JRQA 4LI5A 3LXKA 4NZWB 3TM0A 5CI6A 4BDGA 4K2RA 4Z55A 3IKAA 1OPJA 2B9HA 5H8EA 3CJGA 2R2PA 3DV3A 4YJNA 3HV7A 2C68A 5KCVA 1FINA 1DAWA 3BV2A 2GDOA 4RJ4A 4JDHA 4ALVA 3E87A 3B8RA 3LJ2A 2BRNA 4EOJA 1J1CA 2GPHA 2BTSA 2YERA 4AWIA 4ZZNA 3PVUA 3MPMA 3P7BA 4BKZA 4D4RA 4YMJA 2XIXA 2ITUA 1RW8A 2YDJA 5CEKA 5M4FA 1WBSA 1TKIA 5TO8A 3KF4A 1Z5MA 1MRVA 1XBBA 4IBMA 4V05A 5IQHA 2EUFB 4BY9E 3HDMA 3G6HA 3VUGA 4II5A 1DI8A 2CLXA 1M7NA 1QPCA 3QX4A 5J79A 1H08A 5EFQA 3W2QA 4CRSA 4M0ZA 5A14A 4M15A 4FTMA 4I4FA 3EN5A 2WXVA 5HU3A 3E8CA 4O0RA 2A1AB 4X3JA 5AFVA 4IC7A 4N6ZA 4ERWA 2VU3A 3T9TA 4D2WA 3O17A 2OZOA 4Y5HA 4CMOA 3KF7A 4DGNA 5DT4A 3JVSA 4CLJA 2ZDTA 4JT3A 2XA4A 1B6CB 3I6WA 4W8DA 3RVGA 2WIHA 3R0TA 4KIQA 4ENXA 5M51A 3AT3A 2JIUA 2X7OA 3VF8A 4RSSA 3UOHA 3F5XA 3OEFX 2F2UA 4NJ3A 4RJ6A 3U6JA 3MIAA 3L9MA 3FZPA 4JQEA 1DI9A 1KOBA 3OVVA 4JX7A 3QLFA 4UWCA 4TNBA 2WMQA 4QYYA 1URWA 2W4OA 5H9BA 4JS8A 5HLWA 4M12A 2W17A 5AR3A 4BDEA 4RZVA 5ETAA 3QCXA 4C4GA 5HO7A 5FM3A 5HLNA 1FVTA 2JBOA 4B7TA 2H6DA 3WYYA 4AA5A 1OIUA 2G15A 4XG7A 4QP4A 1WBTA 3H9RA 4X2JA 1VYWA 3PLSA 5EYCA 3RALA 3RCDA 3W18A 4ARKA 4MXAA 4AZFA 3EWHA 2OKRA 5GJGA 1YDTE 5BUEA 1J91A 3RBWA 2Q83A 3R00A 5L8JA 3TWJA 1PW2A 2WHBA 5FQDC 3QLGA 4ZAUA 2WZJA 3ULZA 2XBAA 3F66A 2HOGA 4RBLA 5FP6A 4M0YA 3RP9A 4QPMA 4BIBA 4DLIA 5AP5A 4Y5QA 3FV8A 4S31A 5HESA 3RAKA 4MH7A 4NM3A 5DMZA 4YJRA 2YM4A 5CEQA 3FXXA 5CT7A 5AX9A 3DU8A 2ONLA 4AACA 3QTXA 2QLUA 3CE3A 3SDJA 4FSZA 3MH0A 3R02A 2VTNA 2EXMA 5EHLA 3ZUUA 2R3QA 3NUSA 2VGOA 3NW6A 4U43A 3ZZWA 3C0IA 2P33A 4GG7A 3UIXA 2C69A 5CY3A 4BTFA 4F08A 3N4UA 1SVGA 3D94A 3HA8A 3R2YA 3CGFA 4Y73A 1DS5A 1H28A 3GC8A 4C37A 4ANOA 3IK3A 4IH8A 2W06A 4XG2A 3PXQA 3CJFA 4QMZA 2BKKA 2XK4A 5CF4A 4GVJA 4QMWA 2H8HA 4U97A 3BYOA 4FTNA 2VTIA 3DBEA 3F9NA 2YEXA 4R1YA 1XH9A 3FXWA 2R0IA 4UXLA 1R3CA 3WIGA 4ACMA 4YZMA 5ACKA 3WF8A 3DBFA 4E6AA 4KBKA 3NNWA 5JQ8A 3TACA 3ZLWA 2W1IA 1UU3A 3C4WA 3QRKA 4RMZA 3WIKA 5K0XA 4FKVA 5T3QA 3T3VA 4AE6A 2WOTA 1ZMUA 4F1TA 3OY3A 1KV2A 4LGGA 3W8QA 3ACKA 5M55A 1M2RA 3C7QA 4Y8DA 3QTUA 3N9XA 3V5LA 3GT8A 5KMJA 1LEWA 2AUHA 4YLKA 4J8NA 4XOZA 1MRYA 4YPSA 5A4QA 1JKSA 3QU0A 4IAKA 5EM7A 4CG8A 4FUYA 4C62A 2WQMA 2BIYA 2CDZA 2X0GA 3GCUA 3WZKA 4F63A 4C2VA 3F2AA 3Q5IA 4U9AA 4XG6A 1B38A 2FO0A 5GZ8A 2V0DA 4DH3A 3BHTA 4E6QA 2BHHA 4JBPA 2XVDA 4RIWB 4D5HA 3GXLA 3HMIA 3PXKA 1M52A 5DE2A 4FNYA 2OJGA 2XNNA 3PYYA 5DHJA 3FI2A 1PXKA 1Q99A 4M97A 2VX0A 4IVCA 4QMNA 5EOLA 3O23A 3TDVA 2PMIA 2PPQA 4XS2A 2FH9A 4FL2A 4F9AA 2CKOA 5ETCA 4QTBA 2Y6MA 3EQBA 4PDPA 3SRVA 2GNGA 1Q8ZA 4QYEA 3HV5A 5HHWA 3KMWA 4L53A 5M09A 2XKFA 5IDNA 2C3JA 2BDJA 3F5UA 3ZYAA 2WMVA 3BU6A 1GIHA 1Q41A 2W5BA 3IGGA 4BIDA 4DBNA 2XYUA 4KIPA 2RFSA 4XG3A 3L9NA 4DH7A 3QKKA 2X81A 4WT6A 4WSQA 5D41A 3SG9A 4AGDA 4RWJA 4UALA 1JKKA 1Q8UA 4GT4A 5AV0A 3BWFA 2ZM4A 1ZYLA 3B2WA 4PDSA 3U4UA 5CAOA 4MWHA 1NW1A 5EHYA 2FB8A 1KE8A 4FKWA 2CN8A 4FKRA 4QYGA 3UYSA 2VTAA 2C6DA 2UW7A 1Y91A 3QCYA 4S34A 1ZZ2A 4BDBA 3MN3A 3HAMA 2VO7A 3JS2A 3QHRA 4FKOA 4YJPA 5EOBA 4BL1A 2YIQA 4MXOA 5CAVA 4BCHA 5GHVA 3OBJA 4M68A 3D5WA 2QOIA 2V22A 3NNVA 4H1MA 4AN3A 3HV4A 4EHVA 4B0GA 5AAFA 1TQMA 3ORZA 4ZZOA 2QOBA 2JIVA 3VUIA 4U81A 1G5SA 3EKKA 3P86A 3W33A 3VS3A 1JBPE 3Q9YA 5J7BA 1IEPA 3SOAA 4Z7HA 1CKPA 2FGIA 4DEHA 2YIRA 3DK3A 1XKKA 2HXQA 4OBOA 1K2PA 4O96A 2UW5A 3E92A 3NNUA 2V55A 1W7HA 3QKLA 4KS7A 5HKMA 4YC6A 3RHKA 5IDPA 1PYXA 5M53A 3U6IA 2CNUA 4O7RA 3VNTA 3A99A 3QHWA 2XIYA 3LFAA 3KRRA 4IDVA 4KKEA 4USFA 1HCKA 2WEVA 4D9UA 1OUKA 2C0TA 2XYNA 2YCFA 2C4GA 3LXNA 3ULIA 4X0MA 4YZBA 5HBEA 1FGKA 2BIKB 2JKKA 4ZIMA 3ORXA 5E8TA 3O7LB 4FSUA 3PSDA 1WBPA 4RFYA 5J87A 2VRXA 3VS4A 2XNEA 3OWKA 2HZIA 4PPCA 4QNYA 3G6GA 4RIYB 4X2GA 4C3PA 4HCUA 4CG9A 3DKGA 1REJA 4I93A 5B2KA 4GT5A 3V51A 3FXZA 1GZOA 5FRIA 3R8VA 2W96B 4W4WA 2H96A 4F0GA 3R9DA 2QVSE 2X39A 5FD2A 3LFDA 5CAUA 5CU0A 3GU8A 4I6FA 4MAOA 5GIPE 3QWKA 3CEKA 3TTJA 4CFFA 1FVVA 3IO7A 4XV9A 4W8EA 3FMLA 4FKJA 1BI8A 4ASZA 3QKMA 5K4IA 4W4YA 4ITJA 4BYIA 3R22A 2CNQA 4OTWA 2QQ7A 2R3RA 3FZSA 4HYUA 4JG8A 1ZXEA 3QGYA 2OBJA 2WMBA 4U3ZA 3FQSA 4LQMA 3BQCA 1H8FA 1XH8A 3R73A 4RC3A 3R6XA 2G2IA 2X8IA 4DFBA 1SZMA 3PVWA 2QU6A 4EWQA 4FSQA 2PK9A 3LFEA 3U54A 4H58A 4FZFB 4N4SA 4D2TA 1WZYA 3CKWA 1PY5A 3ORIA 2Y7JA 1QCFA 3ZM9A 4IAZA 4IFCA 3FLQA 3VBWA 3E64A 3HX4A 2YACA 1AGWA 4YHTA 4MD8E 3DJ7A 3BYMA 2E9OA 2VWZA 3AC5A 3ALOA 4IHPA 4RJ3A 1P5EA 3VF9A 2HY0A 1RDQE 1Y57A 3MJ1A 2X1NA 3QTRA 5TR6A 4TWOA 5K5XA 3V5PA 3PA3A 3NCZA 4GRBA 2OFUA 4OUCA 5HVKA 1SVHA 4GS6A 3O71A 4XX9A 3VS7A 1YRPA 2PSQA 3WZUA 2J50A 4ZLYA 4N70A 2QURA 3COKA 5HTBA 4FIIA 4KUJA 2GNHA 4QT1A 3A8XA 4EJ7A 3C0HA 4OAVB 5IQEA 3FDNA 3ZRLA 4V04A 2X2KA 4NKAA 5AEPA 2YDKA 4X6QC 4IX3A 3W2SA 5I4NA 4AF3A 4FTJA 2XB7A 2OJIA 3FAAA 4QP6A 4H3QA 3IDBA 3LIJA 1JKTA 4I6BA 3K2LA 3KN6A 5HNBA 3V5JA 5F95A 3K3JA 5KMLA 4E6CA 4OTQA 3MVJA 3F3WA 3NAYA 3MWUA 3NWWA 4C4FA 4YJUA 3H4JA 3BGPA 2YJSA 1EH4A 4I4EA 2Z60A 4A07A 4NFMA 5IQDA 5DT0A 2R3KA 4AA0A 4J99A 4ZLOA 4O7TA 1UU8A 3FSFA 3MA3A 2IW6A 4GYIA 2BZIB 4LUDA 3PVBA 4J71A 2J9MA 2PZIA 5BPYA 3DTCA 2IG7A 3R7YA 4C8BA 4DEEA 3P23A 5AP3A 1H4LA 4M66A 4O0XA 3GC7A 4I0TA 3D2IA 3BU3A 3VN9A 2F57A 3FLSA 3QC4A 1R39A 4RVMA 4F1MA 5C1QB 3OWPA 2IVSA 2HYYA 4UZHA 3OROA 1GY3A 1T46A 4QQ5A 4ZJJA 3FMNA 3FL4A 2YCQA 3GU7A 3LOKA 3QQGA 3NEWA 2VTQA 2GNFA 1AQ1A 4S33A 1TQPA 1JNKA 1ZZLA 2VO6A 4FNWA 5EM8A 3SC1A 3QRTA 5IUGA 5AR5A 4U79A 1QPDA 3FZRA 5C9CA 5CENA 3TKHA 3VBYA 2B9JA 3LM0A 3KVXA 4IZ5A 5J7HA 4FKQA 4TYGA 2QHNA 3RGFA 3UODA 4YURA 1Z57A 4KA3A 4L6QA 2PE2A 4C7TA 3CTJA 4ZXTA 3AC8A 3I79A 5K4JA 2F2CB 5GNKA 3FL5A 3WZEA 4YGAA 2Z7QA 2C5NA 4EQCA 4DGOA 4G3FA 4K11A 3PPZA 4WNMA 1OL6A 2C6LA 3DKCA 4FBXA 4BB4A 4C33A 2Y9QA 3EQRA 2ITTA 4Q2AA 5IMEA 1ZAOA 2G1TA 2PVRA 4X2FA 4PQNA 1UA2A 4ZTNA 4DCAA 3R04A 4MXCA 4O0YA 5KMKA 4LYNA 4RIWA 2C30A 5DYJA 4FT3A 4CFWA 4OLIA 2CKEA 2WU6A 3U9CA 3ODYX 4QMSA 5E7RA 2V5QA 4ACDA 1BLXA 4CRLA 3TUBA 4FV1A 3DNDA 1L3RE 5IQGA 2CPKE 1NVQA 3WILA 3UC3A 3KA0A 2R64A 3F7WA 4FC0A 3R7IA 4O7VA 4BKYA 4QTDA 4NT4A 4EL9A 4L43A 3HRBA 4EK5A 3RM6A 4XG9A 3ACJA 4BCJA 3NW7A 4EK4A 2QOFA 3RZBA 1H1RA 5CXHA 4ANMA 3VQUA 4ZMEA 1JOWB 4HVDA 4NW6A 1YI6A 2BPMA 3KQ7A 4FEWA 1F5QA 4ZS0A 4L8MA 4XUFA 5EW3A 3SKCA 5DG5A 3S1HA 3SXFA 5LMAA 4GK4A 2YFXA 1WVWA 4U0IA 4EOQA 3F82A 1DM2A 3PJ1A 4RWLA 4XH6A 4QQTA 4D1ZA 2XJ0A 4FG7A 2B52A 5K9IA 4Z9LA 4YPDA 1OIYA 3MVMA 3O7LD 4ZSGA 4LOOA 1PJKA 4GFGA 3CD8A 3QD4A 3C51A 3TJDA 3UGCA 4IDTA 4ZTLA 3CR0A 3H30A 1SMHA 1PF8A 2UZLA 4UYAA 3P0MA 5AP7A 1UNLA 2ZV2A 4RWKA 3UJGA 5I0BA 4LOPA 5HNIX 3WZDA 1V0PA 3IDCA 5DT3A 3PSCA 3NX8A 4JDKA 2G01A 3RM7A 3MTFA 5F20A 4DEGA 1RE8A 5IPJA 3F3VA 4FTKA 5C27A 3ZBFA 3NCGA 2J4ZA 3OTVA 4BYJA 2VTRA 3IONA 4UBAA 4TPTA 1WMKA 3FY2A 4UZDA 5EQEA 3HUCA 3PG1A 5D9HA 4F65A 4M7IA 3RK7A 4BDFA 1O9UA 2QCSA 3FMJA 3HNGA 4FL1A 5EYKA 4HYIA 2REIA 4LV8A 4AOTA 3VUTA 3DBCA 4HYSA 3ID6C 2PVYA 2JC6A 3PXZA 3VS5A 4CKIA 4E4MA 5CU4A 2PU8A 3VC4A 3FPQA 3ZC5A 1H01A 4HZSA 4KINA 3NYXA 3LVPA 4YTFA 3ENHA 3SXSA 3UO4A 4O22A 3DOGA 4DFUA 2W1GA 3L8PA 4ASDA 3UP2A 3DNEA 4L44A 4V0GB 3S0OA 5KMNA 2HCKA 3IW4A 4IACA 4KB8A 1ZLTA 5GIOE 4I21A 2JIIA 2ITOA 3K3IA 1OKYA 4E7WA 4HW7A 2Z8CA 5EYMA 5E1EA 4PMSA 3ZU7A 3DPKA 2J0IA 3V6SA 5LMKA 1IAHA 3Q5ZA 4YLLA 5J1VA 1XO2B 4I23A 1Y8YA 4ONAA 2C47A 4PV0A 2F49A 4H39A 4QTEA 4XOYA 3B8QA 3MI9A 1YHVA 3EFLA 3FC2A 3M11A 2YWVA 4MVFA 4ZLZA 4NYEA 5J1WA 3QD2B 1WBVA 4I5HA 2UW0A 1KOAA 4O81A 4EK8A 5I3OA 4PTEA 4R7HA 4RIYA 2OU7A 2PZYA 3WF5A 3DFCB 1JSTA 3AC2A 2W9ZB 2UZOA 4CVAA 3FMHA 4IM0A 2OH4A 4DFYA 5BQ0A 3SD0A 3ZRKA 4NCTC 4EWHA 2YM5A 5AP2A 1XBCA 3OT3A 3HLLA 2CGXA 4KD1A 5CF6A 3PIYA 3TNWA 2WD1A 3AC1A 2ZV9A 3A60A 3VUKA 2H9VA 1Q8YA 4FX3A 4EUUA 2YM7A 4R77A 5HIBA 4IAFA 1GJOA 1H27A 3UTOA 4RG0A 4IX5A 4TN6A 2WMSA 5CU2A 4ALWA 1GZNA 4FTUA 2JDOA 3QA0A 4MKCA 4CFMA 3OZ6A 2GCDA 3HVCA 5M4UA 1G8SA 4JRVA 2ITYA 2ZVAA 2KULA 5BYYA 1ZYSA 3BRBA 4GJ3A 4APCA 5D12A 4IWOA 1GZ8A 2XJ2A 4EBWA 5JEBA 3BQRA 3NNXA 3P7CA 2WTVA 3FZOA 3L9LA 4NWMA 5AP0A 4ANSA 1J7LA 2YIYA 3NYNA 2C1AA 5AP4A 3UZPA 3ZEWA 5CALA 2BDWA 5CSWA 1XWSA 3C50A 3SA0A 5LVMA 1LUFA 3FMMA 3PXRA 3AMYA 1PKGA 4FSTA 2FSOX 4IQ6A 3D4QA 5FEEA 5AUXA 3NDMA 2R7IA 1B39A 3R7EA 3L8XA 5CF8A 5FDPA 2YISA 3NSZA 1ZY5A 3Q9XA 5L6PA 1KE9A 1PXPA 1Q62A 3FLYA 3FZTA 4ZSAA 3SG8A 3LCDA 3QYZA 4PL5A 1IRKA 1P14A 4AE9A 2QOHA 3A4OX 5FG8A 4X2NA 3NPCA 5AAGA 1TQIA 4M69B 2Z02A 3V04A 3ERKA 4UYNA 2PVKA 4CMUA 1NVRA 2IJMA 4K1BA 4O91A 3ATTA 5CYIA 4A9TA 3BHHA 4U6RA 5LARA 5HE2A 5BVFA 2R3OA 2UZBA 3O0GA 5EW8A 5TF9A 3TI1A 4F99A 4JXFA 2GTNA 4G9RA 3SVVA 3C9WA 3TKUA 5AA9A 2ACXA 4MNEB 5IA5A 2CCIA 4YJOA 4BC6A 1URCA 5M06A 4FKIA 4MBIA 3ATSA 3I60A 2B9IA 4R5YA 1YWVA 2WQBA 4E4XA 2XNBA 3DGKA 4FEXA 3LLTA 2C6EA 1VYZA 1ZOEA 2W0JA 5A4EA 3ZMMA 4XG4A 3FYJX 4WNKA 5IQIA 4ZZMA 4BR3A 2BFYA 2QLQA 2VN9A 3LFBA 4NIFB 4HVGA 4YC8A 3HECA 2GMXA 1Q3DA 1IR3A 5CSXA 4I6QA 2PTKA 3KRWA 3CC6A 3D5XA 2C1BA 3COHA 4D9TA 2OK1A 5KHWA 4MQ2A 4FSYA 1KE6A 2WB8A 4TWPA 4Z16A 4ZY4A 2WQOA 3ORLA 2R0UA 3CS9A 3QQUA 3AGMA 2UZTA 2OWBA 1OB3A 2ZM1A 3RTPA 1IASA 2OH0E 4MCVA 4TRLA 5AIKA 4F9WA 4UXQA 2HZ0A 2QR7A 2ZM3A 3NUUA 3TNQB 3LFQA 4IB1A 2Z7RA 3CXWA 4C61A 1H00A 4CZUA 3VS6A 2ONLC 1PRYA 3Q96A 3UPXA 2JGZA 4U41A 1CKJA 2BMCA 5HX8A 3R9OA 1M17A 4FNZA 2XNPA 2QOCA 2VD5A 1YWNA 3MFRA 3PJ2A 3BLQA 4EC9A 2WTKB 1IG1A 5HNGA 5M4CA 3PPKA 4FTRA 3QALE 1H25A 3BLHA 4R3RA 1FMOE 1R0EA 3ZHPC 4K18A 4TWNA 3TCPA 3BE2A 1CM8A 4QQJA 1SNXA 3FLNC 4BWPA 4D4SA 4JBVA 1O6LA 3NAXA 3GFWA 5CSVA 3R71A 5F1ZA 4WG3A 1OI9A 5L6WL 4ZSEA 1ZARA 3VBTA 2O0UA 4ANBA 2FA2A 4M8TA 3WF7A 4EOSA 3VS0A 4ZY5A 4DBXA 3BELA 2GS2A 3JY0A 2X4FA 3O96A 2P55A 3H10A 3PFQA 3O2MA 4GFOA 4PDOA 5DNRA 5H8GA 2PE0A 2PVJA 4ACHA 3OWLA 1FOTA 1FVRA 4O0UA 3Q32A 1PYEA 1TVOA 4D0XA 3A7HA 3DQWA 4NH1A 1OPLA 4U7ZA 2I1MA 2UZWE 4X7QA 3F2NA 2YM8A 3O8UA 3PUPA 3UDBA 4FKSA 2PUPA 4PPAA 4U40A 4FK3A 3GENA 4OTHA 2BRGA 3CY2A 4DFNA 3CIKA 2XEYA 3WF6A 2FVDA 2Z7LA 1APME 3AQVA 4K6ZA 2OF2A 2DQ7X 5FEDA 5IZFA 1H1SA 4ZJIA 4N57A 3WARA 4DG3E 4F9BA 4FIHA 3VRYA 3JYAA 4TYEA 5BVDA 2E9PA 5AWMA 5E1SA 4JLCA 1QL6A 1YXUA 3ORPA 2QU5A 1UVRA 4QD6A 5CEOA 4L3JA 1YI4A 4DH8A 4CKRA 5L8LA 3QXPA 4GMYA 3LCKA 1PHKA 4PMMA 2RG5A 3U8WA 3Q52A 1BL7A 5AP1A 1R78A 2HXLA 3RK9A 4BICA 2FSMX 3DDQA 4NK9A 5IUIA 5LVOA 3G5DA 3NUAA 4IVBA 3FC1X 3EOCA 1Y6AA 4BVUA 3UQFA 2C3IB 4I5MA 5BVNA 5HLPA 1YVJA 2B54A 2BUJA 3CKXA 4HOKA 3HUBA 5EI8A 2W9FB 2X8EA 4HGLA 4WG5A 3EFJA 4I0RA 3CTHA 5AUYA 3TJCA 3TL8A 4B8LA 3OEZA 3BKBA 5FGKA 3R30A 4GUBA 4AUAA 2UZEA 4ZK5A 4C4HA 3FI4A 4E8AA 3OFMA 3FY0A 4HZRA 5BVKA 2LAVA 4KBAA 3RPOA 3VS2A 4CCUA 1WVXA 5E4HA 4D4VA 3EYGA 5E8YA 2O2UA 3OCBA 4L3LA 5D11A 4AW1A 3DQXA 3GQIA 3OY1A 4GG5A 4GFMA 4PMTA 3UIBA 5IG1A 5ANOA 3UOLA 3NUXA 3BYVA 4V0GA 4YNOA 2IW8A 3EZRA 2A0CX 3PY0A 3DFAA 3GUBA 3KXNA 2R3MA 3UQGA 4PNIA 3CD3A 4GV1A 3W2OA 3TZ7A 2NPQA 1JQHA 2OI4X 3P7AA 5CU6A 4E5BA 2OLCA 3BE9A 3BPRA 5CEIA 5IQFA 2PWLA 4PRJA 3OXIA 3FHIA 2I40A 2PY3A 3FLWA 3GU6A 4HNFA 4WNOA 2IZRA 2WMRA 2BAQA 2Y4IB 1KV1A 4JAJA 5JSMA 4HGTA 4O0TA 3UNKA 3QZHA 3KXHA 1OZ1A 3QFVA 4R78A 3HRCA 2WO6A 4AX8A 4JBOA 2PYWA 4QMXA 3G51A 3HMPA 4HPTE 3PXFA 2VTMA 3E88A 3BEGA 2O63A 4CLIA 4CNHA 3UIUA 4CTBA 2YM6A 3LCTA 4FKLA 3ZM4A 4BDAA 1XBAA 4JQ7A 5KBRA 3D14A 4AZTA 4J98A 4OGRA 4D2VA 1M2PA 2XNGA 5KE0A 3TNHA 4QRCA 3GCPA 4BCQA 1U5QA 3CGOA 4HGSA 4Y72A 3ORKA 2HELA 2RGPA 1GOLA 5EDRA 3QUPA 4MX9A 3QUEA 4BCFA 2WTJA 3F88A 4I41A 4QTAA 5I9VA 2BDFA 4EBVA 4Q9SA 1HOWA 2G2HA 3EQDA 5ITAA 4C59A 3E8EA 4ENYA 3LQ5A 5B0XA 5ANEA 3VBXA 4R3PA 3QTWA 3I0OA 1NVSA 3NIZA 3QWJA 4GSBA 3GQLA 3TNPC 4DC2A 2A2AA 3QL8A 2BFXA 4LV5A 4MNFA 3TUCA 2PHKA 4GKIA 4DTBA 1S9IA 2BAKA 2V62A 1P4FA 3MFSA 5M44A 3OMVA 1YXTA 5FBOA 2BR1A 5K0KA 4NL0A 3P1AA 3QTSA 2R3JA 4P7EA 3UE4A 3R1YA 3OCGA 4MBLA 3MESA 2XK7A 4ASEA 3MB7A 1A9UA 1P4OA 2CGUA 5L2TA 1ZOHA 3DA6A 4F70A 1W84A 4IW0A 4DG2E 3I7BA 2JD5A 3RINA 3NMUF 2FSLX 3UVPA 4R3CA 4BTKA 3K5VA 4J95A 3QZFA 4ZTRA 4FGBA 1OKWA 4MXXA 2WMWA 2W05A 2O8YA 4KNBA 2H34A 1YOLA 3EQGA 4GYGA 2ZYBA 5DOSA 3FZ1A 3OC1A 4ACGA 2A4LA 3BBWA 4EH3A 3C5IA 4GU6A 2DWBA 3ZS5A 1YXVA 2AC5A 2HZ4A 2JFMA 4AN9A 2I0HA 3ORTA 2GQGA 2BZKB 2ITXA 4FMQA 4L42A 3CCNA 4DYMA 2ITNA 2C6IA 5GINE 3KXXA 2JLDA 3REPA 5L2IA 4A4OA 4PNKA 2XH5A 1I44A 2A27A 1R1WA 4P2KA 1WFCA 4ERKA 5DA3A 3PG3A 3OBGA 5IA0A 2I0VA 4IAIA 4MNEA 4FL3A 3OWJA 5HO8A 5LMBA 3PWDA 2F9GA 2HENA 2JDTA 2YAKA 3THBA 4AT4A 3VJOA 5AM6A 2QG7A 3CBLA 3FWQA 4KRCA 5KMMA 3N4TA 4BDJA 1GIJA 2JDRA 4FG8A 4APPA 3BI6A 3RHXA 2QOOA 3WBLA 3KGAA 4YHJA 5A46A 3CP9A 3C4EA 5LVNA 2RG6A 3EFWA 4NIFA 4ZOGA 2ITWA 3V8SA 5IQCA 5J9YA 2C3LA 2EVAA 3BHUA 4DH1A 4RA4A 5E8WA 4MXYA 5JFVA 3RAHA 3HZTA 4K9YA 2VWUA 3PRFA 4ALUA 2VWWA 4RIXB 4UN0C 2QO2A 4JDJA 5AR4A 4F1OA 3TXOA 3I1AA 4FZ7A 4RQKA 1DAYA 2GHLA 2UUEA 4TXCA 5LWMA 5AMNA 3Q2MA 1BYGA 4L9IA 3MFUA 3QTIA 4QMVA 1RJBA 4OW8A 4EH2A 4IAYA 4BIEA 2CN5A 5KMOA 4I24A 5CS6A 4O7LA 4HVHA 3OOMA 4O7NA 2UV2A 2UW8A 3LKMA 4GL9A 1GIIA 4YBJA 3UYTA 1CDKA 5KZIA 3GFEA 4OTRA 2OG8A 3BGQA 4CV8A 5HICA 4B9DA 4UWBA 3OHTA 3EN6A 3SOCA 3ZONA 3I0QA 4JQ8A 4NM7A 4I0SA 4PL3A 3RI1A 2OGVA 2HAKA 4O1PA 4DEIA 5IMXA 2WU7A 3VW6A 3WI6A 4YO4A 4QMTA 1J7IA 3MJ2A 4QYHA 3DB8A 4GIIA 5DWRA 4FGRA 3N4VA 3ANQA 1PXLA 2C5YA 3NUYA 4CFUA 5KNJA 4CZTA 2VGPA 1BX6A 1BL6A 2J0LA 4GVAA 4U5JA 5HVYA 4KAOA 3A7IA 3DK7A 4EK3A 4D0WA 4CFVA 2UZVA 4C2WA 3KRXA 3II5A 4G3GA 3W1FA 5C8NA 2ZB0A 5HTIA 4G1WA 4GT3A 3ZO2A 4BCNA 3U6HA 2PMOX 3F6XA 3WYXA 1OM1A 4DN5A 3E93A 5HE3A 3HYHA 4WNPA 3DBDA 3C4ZA 3DZOA 4U45A 1FMKA 2DYLA 3R63A 2WTIA 4C4IA 4C57A 4M3QA 2PVNA 4K0YA 4UMTA 2PVHA 3EN7A 4ZJVA 1PXOA 4FT7A 3LMHA 4XBRA 4I5PA 3UIMA 4C3RA 3DT1A 2OICA 5CANA 3SHEA 4BDDA 3DCVA 4LL5A 1W82A 5JFXA 4FG9A 1U5RA 3Q4TA 3ZXZA 3EH9A 4U8ZA 5I9UA 4F9YA 4I20A 3JPVA 4HJOA 4RA5A 3BIZA 4XV3A 2ZOQA 2C6KA 3G0EA 3IW8A 4RT7A 3QTQA 3ZO3A 4S32A 4FSNA 5AJQA 4P5QA 3RJCA 4EI4A 5GZ9A 3BGZA 1MP8A 1M14A 3VUMA 3R8PA 4AZSA 5E8SA 2E9VA 4MK0A 4JIKA 2OZAB 3TUDA 2JDVA 5DEWA 4PTCA 4F6UA 4HVIA 4BDIA 2W1EA 3TNIA 5LXMA 3Q4UA 3VUHA 5LCKA 3R7UA 3LJ0A 5ETIA 5JFWA 3FEGA 5L8KA 1OKVA 4FZAB 2F7ZE 2YM3A 3DK6A 3MV5A 1BI7A 4XMOA 2WTCA 5CX9A 2VWVA 4QQCA 4A7CA 5L4QA 4KIKB 4RIOA 3EL8A 4Q5EA 4I3ZA 3POOA 5J5SA 4X3FB 2VWIA 3C5UA 5C26A 3R8LA 4UV0A 3V01A 3EQFA 5IA2A 5B2MA 4CD0A 4PPBA 3A62A 3TV4A 1ZYDA 2IVTA 5AA8A 2J51A 4R7BA 2OJFE 4ZEGA 1ZOGA 1KWPA 2C3KA 4CZYB 5KKRB 1ZWSA 2X7GA 3LQ8A 4CQEA 4IB5A 4OT5A 1E1VA 1YW2A 4LOQA 1JVPP 3OUNB 5JKGA 5AUVA 3ZSHA 2XK8A 3LFNA 3R7VA 3EN4A 1FPUA 3MIYA 3L8VA 5T6KA 1PMEA 5EW9A 3PPJA 1YOMA 2X2MA 4CT1A 3JVRA 4AAAA 2J6MA 3G90X 5KO1A 2C5VA 3BBTB 4QMMA 5A6OA 3ORNA 4MTAA 1KE7A 4BTMA 4WSYA 4CKJA 2O5KA 2XBJA 1U4DA 3GB2A 2NRUA 4L46A 2ETRA 2ITVA 4QP9A 5CI7A 3P79A 3LFSA 4IEBA 3VO3A 1LP4A 4USDA 1I09A 2C0OA 5M4IA 3EIDA 5F9EA 3HMNA 3KB7A 4F64A 5A4CA 3QUDA 3C1XA 3UOJA 2ITQA 5FP5A 3GI3A 3C4CA 2X7FA 2HWOA 3HMOA 3PJ3A 3QQJA 4ZTQA 4ZSJA 3AT2A 2HIWA 2OO8X 5DLSA 3W10A 3ZFMA 3S4QA 4B99A 2DUVA 2WTDA 3HDNA 3OS3A 5ANDA 4DT8A 1UKIA 5D1JA 4EKKA 2R3NA 5LMKC 5KUPA 4FV8A 4EH4A 1Y6BA 4F4PA 3P5KA 3QRJA 2VAGA 2YIWA 5LOHA 1PMNA 3ODZX 4DLJA 3WOWA 3P08A 3R9NA 2XS0A 3QD0A 3LW0A 4RVLA 4XEYA 1OUYA 5CWZA 3RPVA 2PULA 4WO5A 3FKLA 3R1SA 5C01A 2XEZA 3GP0A 5JFSA 4RLLA 4EZ7A 2BKZA 4FV5A 3G2FA 4YLJA 1Q5KA 5CSHA 3UVQA 1YKRA 3IW6A 3RMFA 4LM5A 4ZSLA 3TV7A 2ETKA 2VWXA 3PE1A 2RFEA 1GZKA 2CMWA 4LG4A 4DAWA 2YN8A 3PIZA 2PL0A 3VIDA 2XNMA 1Q4LA 5FXRA 4PP7A 5HEZA 3ZC6A 3KC3A 2J5EA 5I3RA 1JWHA 3D15A 4PUZA 1JPAA 4MWIA 3FHRA 3BWJA 1R0PA 2OXXA 3KK8A 4FEQA 3PE2A 3LHJA 2P0CA 3I81A 4JAIA 3V3VA 3SGCA 4IADA 4CMTA 3FMKA 4PP9A 4FT0A 5BVWA 4JRNA 3HP2A 2WMXA 5AUZA 4BKJA 4I5CA 1ZY4A 3FI3A 4M14A 3LCSA 1PMUA 2B9FA 3R21A 3B2TA 4WBOA 3VAPA 4XCUA 2XMYA 3V5QA 1OBGA 4MBJA 2QC6A 3TN8A 5JQ5A 2NNWB 1F3MC 4L3PA 4XRLA 1JSUA 4BBEA 3PP1A 4FNXA 2EXCX 4FUXA 3KREA 3MY5A 3K54A 4FODA 4AOJA 3LMGA 4JDIA 2UW6A 3JUHA 4N6YA 3PTGA 3ZUTA 3NUPA 5C4LA 1J1BA 2VO3A 3DLSA 4F6WA 4RC2A 3UZTA 4AA4A 3R2BA 2F7EE 3COIA 5F94A 2JITA 3BEAA 4RX8A 5A9UA 1OIRA 2I7QA 2CSNA 3VUDA 1GAGA 4HCVA 4GW8A 2X6DA 3ZSGA 4AZVA 3DDPA 3LJ1A 3W55A 4ZMFA 1WCCA 3FLZA 3VBVA 5DR6A 2VWBA 3AC4A 1FBNA 3MY0A 2GTMA 4P5ZA 2BTRA 4O83A 1YHWA 3V5TA 3DJ6A 2PMLX 2KTYA 2ZMDA 4ZY6A 1P2AA 4ANQA 4FIEA 1K3AA 3BZ3A 4RFZA 3KULB 3I4BA 3RPSA 5HBJA 4C4JA 1J7UA 2W4JA 3AT4A 3I6UA 3MH3A 2W4KA 5IA3A 2AC3A 3KY2A 4DITA 4EYJA 2WFYA 4NM0A 2EB2A 5EYDA 5HG8A 5JZNA 3R9HA 5CNNA 2YZLA 4G5PA 3R83A 3UC4A 5EG3A 4A9SA 4FI1A 4D2PA 2R3LA 4C35A 4R8QA 1IA8A 2CGVA 3KEXA 2WQNA 1Q97A 3QZIA 3OCTA 2R3HA 4D28A 1J3HA 1CTPE 3MVHA 4CFXA 4UMQA 4J52A 4OBPA 3H0YA 3FKOA 5IEVA 3O51A 1M2QA 4YTHA 4EHEA 4FYOA 2JKMA 3PA4A 4IWQA 1W98A 4TY1A 4ZTMA 4RQVA 3ZCLA 3R28A 4BCIA 5IEYA 2WIPA 3ZBXA 2JEDA 3GCQA 2OXDA 3NRMA 2VTJA 2VWYA 4G6LA 4O21A 4YZDA 4AW2A 3OW3A 5HE0A 3ENMA 3QX2A 3UNZA 5D7VA 4R6VA 2OFVA 1PXJA 4XJ0A 2VTSA 5CZIA 5AUWA 4NFNA 4MD9E 5G1XA 3GU4A 3MY1A 4Q9ZA 1VJYA 4F9CA 3SW7A 4H3BA 2OXYA 2GQRA 1OL5A 5E8VA 4E5AX 4K77A 1H1WA 4L67A 1Q24A 3RWQA 3UO6A 4AW5A 4G3EA 3OT8A 4F7SA 5ANJA 1OL2A 4O2ZA 2IO6A 3UZRA 4YTCA 2VTTA 3EQCA 2VX3A 1W0XC 2C5OA 4J7BA 1UWHA 3Q3BA 3PDTA 4YJQA 4LL0A 4C36A 4BI0A 1U46A 3HMMA 4XLIA 4UMRA 1YWRA 2QI8A 3OW4A 5CQWA 3S3IA 5E8ZA 5A4TA 4E73A 4FV3A 2XRUA 2YCSA 3MGYA 4BRXA 1JLUE 2RL5A 2OZAA 3DKFA 4I94A 3U87A 4FKGA 4EH5A 1LEZA 3QRUA 4GUEA 4BCOA 4ANNA 4WHZA 3MPTA 2I0YA 2QKRA 3O50A 2GNIA 4TKSA 2W1ZA 5AX3A 4CXAA 2PUIA 4FZ6A 3A7FA 5IU2A 4FE2A 3V6RA 5DFPA 5HOAA 4BZDA 1PXNA 2R3PA 2WTWA 4O2PA 4GEOA 2XK6A 1Q8WA 4H3PA 4JL9A 4KIKA 1SNUA 3ZLYA 2E9UA 2J0JA 5EM6A 4KIOA 3S95A 4C0TA 5IH4A 4E93A 3RPRA 3POZA 3PRIA 4EOLA 4X3FA 4EH8A 4M13A 3TKIA 4PTGA 4HPUE 1FQ1B 4IJ9A 3IECA 4U44A 5CNOA 3VBQA 3SW4A 1OL1A 3MB6A 4AG8A 3U9NA 5HX6A 2Q0NA 4E5WA 4BFMA 2EB3A 4O7WA 4BZNA 3CPBA 3I7CA 2R9SA 3V8TA 1OMWA 4YP8A 4F0IA 2Y8OA 4FA2A 2XP2A 3QA8A 3CQWA 4FTTA 5E9EA 4DEDA 3JXWA 3P4KA 4HNIA 2B53A 2J0MB 3IQ7A 1V0OA 4O27B 4AS0A 2CLQA 2XM9A 4RLKA 2W99B 4NU1A 4A9RA 4OBQA 4GCJA 2J2IB 5EDQA 5LQFA 4FV0A 4G9CA 2YABA 1PXMA 3GEQA 1U59A 2FSTX 4EOPA 3TIZA 3D7TB 2W7XA 1A06A 4G16A 2GS7A 4UY9A 5LVPA 5J8IA 4TYJA 5J5TA 5DN3A 2ZB1A 4JNWA 3HP5A 3SLSA 4YR8A 2C6OA 4EKLA 3TZ8A 3QAME 4DINA 4DFXE 4JI9A 4FTOA 3CPCA 4YNEA 4BWXA 4FV4A 5J9LA 3F3TA 2PUNA 4F0FA 1RQQA 5EH0A 5AV2A 5FDXA 2VTHA 4CEGA 3MW1A 2XKEA 4O84A 2NO3A 2BILB 2YIXA 3DXNA 2IW9A 2XJ1A 2GNJA 2OIBA 5HTCA 4EH6A 3GU5A 1LR4A 3E63A 1YHSA 5HI2A 2YDIA 4DCEA 1CMKE 2XIRA 1JSVA 3GGFA 3QCSA 2UW9A 1F0QA 3OUKA 5FXQA 4L00A 4AN2A 5IA4A 3DAKA 5M08A 1PKDA 4FKPA 5FTGA 5ANIA 3PZEA 2XZSA 2IN6A 4IWPA 3UPZA 3G9LX 3EYHA 3ROCA 1IA9A 2YHVA 4FZDB 3PWYA 4XP3A 3UNJA 3TT0A 4YUQA 4YJTA 5CASA 1ZMVA 3F5GA 1OL7A 3QYWA 4I22A 5CU3A 4G2FA 3SAYA 4CQGA 2CCHA 3D5VA 4I1ZA 4RC4A 5BVOA 2W1DA 1XH5A 2C6TA 4XNEA 1OGUA 3Q53A 2IZSA 3LZBA 4FKTA 5C03A 3RZFA 1G3NA 3UMXA 4YSJA 4O6LA 2DS1A 4KKHA 4RJ5A 3UQCA 1PMVA 2ESMA 2IZTA 3DJ5A 4U80A 4FV7A 3TZ9A 2WKMA 3ZSIA 1ND4A 1UU9A 5HG5A 5LVLA 3PZHA 4FR4A 1XQZA 4IIRA 3IOPA 3ZDIA 5CZHA 1W8CA 3VJNA 2W1HA 3FKNA 3GVUA 4A06A 4BHZA 2VUWA 4K8AA 2GQSA 4AP7A 4FKUA 2XM8A 2X2LA 1H24A 2WEIA 2OIDA 2XIZA 5CLPA 4RJ7A 5KZ0A 4G3CA 4TYHB 3KU2A 1MQBA 4F7NA 4EZ3A 3HGKA 3G15A 5AR8A 2B0QA 3ZO4A 4LMNA 2V7AA 2QKWB 4EOMA 4OR5A 4ZTSA 4BGGA 1SYKA 3AD4A 4PWNA 2UZUE 4ANLA 4EHZA 3M2WA 3W32A 4XRJA 4WA9A 3GCSA 4BF2A 3QTZA 4XBUA 4DE4A 2R3GA 1JKLA 4WIHA 2JAVA 1STCE 4KKGA 4AQCA 4MEDA 4TT7A 4L68A 4QMPA 4FTCA 3JY9A 2BAJA 2ZJWA 3Q60A 4BDKA 4DFZE 2YWPA 1T45A 5EM5A 5HVJA 1KE5A 3MVLA 4FF8A 3RNIA 3LFCA 4NSTA 5BNJA 5CVHA 4JIAA 5JN2A 5M57A 3OXTA 5AP6A 4O82A 3IDPA 3DTWA 5DIAA 3VVHA 3F61A 3ZXTA 2JFLA 4EORA 3O8TA 5C8KA 3V5WA 2HW7A 2HK5A 4M84A 5LJJA 5GZAA 3KRLA 4CCBA 4JR7A 4PDYA 4L01A 2SRCA 3HL7A 2ITPA 1UU7A 2XNOA 2VV9A 3UMWA 3ZZEA 1LPUA 4DH5A 4EOIA 2CKPA 1WAKA 5EI2A 3ZLSA 4AT3A 3KULA 3WZJA 4C3FA 4X21A 4N0SA 5CTPA 3HV6A 4UWYA 5EQYA 1S9JA 3DY7A 3FQHA 4FVRA 5JT2A 2YJRA 4KWPA 2BALA 2BRMA 3KXMA 5ANKA 3ZFXA 4BBMA 3F3ZA 5FXSA 3RAIA 4MYGA 3PA5A 5E92A 4E4NA 4W9WA 1ZYCA 4LRMA 4OTFA 1Z9XA 5DR2A 4E20A 3E8DA 1E1XA 2OW3A 2VTLA 3H9FA 3E5AA 2BRHA 4X2KA 3A7JA 5AV4A 4E4LA 3FMEA 3R7OA 3HA6A 3W8LA 5D10A 1XH6A 2GS6A 4YBKA 1U54B 4BGQA 4UMUA 2WPAA 2VZ6A 3W2CA 2Y6OA 3ZUVA 1OPKA 5HBHA 2YLEA 1KSWA 3N51A 5BMSA 5I9XA 2ZMCA 3FBVA 4BCPA 3D9VA 3D83A 5CSPA 4QYFA 4WD5A 3I5ZA 2FUMA 4QPSA 2HW6A 4DHFA 2ZAZA 3GOKA 3OOGA 4EK6A 4WRSA 4EQMA 4GKHA 4EH9A 3QBNA 4QMYA 5DH3A 4DTKA 1GNGA 2PVFA 3E62A 3DBQA 3DS6A 3IW7A 4FTAA 5A3XA 3ZRMA 5IH5A 2E9NA 2CNVA 3U55A 3U51A 3QXOA 1PXIA 2QONA 1K9AA 4MD7E 5ICPA 2WTKC 3LFFA 3MBLA 3COMA 4O0SA 5HCXA 4WG4A 3TV6A 3OP5A 4FTLA 4OT6A 5BVEA 2EWAA 5HCZA 5CAQA 1ATPE 4FICA 1JAMA 2J0KA 2R5TA 3RCJA 3UG2A 5KBQA 2I6LA 4M69A 4P90A 4WUNA 4C4EA 3PP0A 4IVAA 2UVXA 4UX9A 3IW5A 5JGAA 4B8MA 3SX9A 2PZRA 5FTQA 3KMMA 5DGZA 5KMIA 4IVDA 2JKOA 3PSBA 3LQ3A 4FK6A 3C4XA 4FIFA 4ID7A 5JK3A 1UWJA 1X8BA 3IS5A 3ZLXA 4AGWA 3PJCA 4KRDA 2P2IA 3FQEA 4OAUC 3H0ZA 3QQLA 3DXPA 4GK3A 4TTHB 2A19B 5E91A 1MRUA 5EQPA 4DTAA 4UB7A 4C02A 3VQHA 2XKDA 3P78A 3MYGA 3QC9A 4NTSA 1YDRE 3MH1A 3PXYA 5HGIA 4XP2A 2O64A 4YJSA 3A8WA 3NR9A 4OTDA 2EXEA 4JBQA 4QMOA 2RFNA 4FT5A 4I6HA 4JG6A 4XLVA 3UOKA 4JX3A 2IVUA 4YO6A 4FSWA 2R3IA 2B1PA 3HKOA 4IFGA 4BN1A 3HV3A 5DVRA 4A9UA 2CGWA 3QD3A 3QZGA 3OF0A 1YI3A 3R1NA 4LRKA 5L2QA 2Z7SA 3KXZA 2F7XE 2GFSA 3ET7A 4QMQA 2VO0A 1XHAA 3UO5A 3KXGA 2IPXA 1UKHA 5HG7A 4DFLA 3E3PA 2W5HA 4YTIA 4E6DA 3KVWA 4H36A 3PY3A 4HVSA 5CEMA 4IE9A 3EQIA 3KN5A 1OBDA 3EL7A 3G9NA 3FUPA 5JGBA 1WBNA 3VRZA 4G31A 5J9ZA 4QP7A 3F69A 4QP1A 4WKQA 3M42A 1Q3WA 2PZ5A 2ZV7A 3H3CA 3MA6A 5EI6A 5M56A 2XRWA 2XK3A 5HIDA 4XHKB 4YHFA 4BCKA 3CQEA 4QPAA 4RJ8A 3D7TA 3ZDUA 2PMNX 3IG7A 2X9EA 4ORKA 3QGWA 3MDYA 2JKQA 4IM3A 4LMUA 3P9JA 4ZP5A 3O8PA 3FMDA 3F2RA 3ANRA 4LGDA 5E8UA 4O7SA 5LCJA 5BX0A 3MH2A 3BHYA 4JG7A 1SM2A 2WQEA 5AUUA 4R5SA 4F7LA 4MF1A 4OTPA 4AT5A 4A9YA 5FLFA 4NEUA 3WE8A 1NT2A 4IAAA 2UZNA 3L1SA 3ORMA 3PLAE 1YXSA 4BI1A 4O7YA 3ZTXA 1VR2A 4PF4A 2RF9A 3ALNA 4QTCA 5FTOA 4LUEA 4CYJA 3TEIA 3GCVA 3E3BX 3RWPA 3FYKX 3C4FA 3Q9WA 2WMAA 2QR8A 4O6EA 2GNLA 3IGOA 3TIYA 5IQAA 2Y4IC 4W9XA 4EZ5A 4G3DA 4ITIA 3WE4A 2PVLA 4JVGA 4AFEA 3PY1A 1OVEA 3AGLA 2BHEA 4FOCA 4IB0A 4JOAA 3ZOSA 3GC9A 3IOKA 2UZDA 3CQUA 4EJNA 3DZQA 3FJQE 4EOOA 4DGGA 5HU9A 2R4BA 4Y95A 3RKBA 1ZMWA 3E7VA 4QNAA 3MFTA 4RRVA 4YZCA 4RPVA 3AC3A 2PZPA 4LRJA 1H07A 2JAMA 2BZJA 2WELA 1M7QA 3AD6A 4YU2A 3W16A 3LPBA 4L7FA 4GIHA 5AV1A 4XYFA 4D1SA 4PMPA 5T68A 4BHNA 4FIGA 2OF4A 1YXXA 3NYVA 3R8ZA 3ROYA 1SVEA 4TZRA 5DEYA 5BMMA 2C6MA 2VTOA 2X8DA 1HCLA 2GU8A 4IANA 4TYHA 5B2LA 4NM5A 3S00A 3OCSA 4AGCA 5DRDA 5C8MA 4AZWA 5DR9A 1ZRZA 4LFIA 3TZMA 2BVAA 1OKZA 4FEUA 1O6YA 4K33A 5K3YA 4H1JA 5JGDA 1XH4A 3EB0A 2E2BA 4PY1A 4AGUA 5BUIA 3DXQA 5BYZA 2XK9A 3BCEA 4YC3A 1WBOA 2AYPA 2XUUA 3A4PA 3A61A 4TW9A 5H3QA 4E3CA 3C13A 1NXKA 3NVKI 1AD5A 3NS9A 5CF5A 4J97A 3OG7A 5J95A 5HQ0A 2IZUA 4NUSA 4RVTA 2P4IA 4IZYA 2ZDUA 4QP3A 2GFCA 3G33A 4D5KA 5BUJA 2W5AA 4CSVA 4F09A 4TL0A 5CVGA 4KABA 3ZEPA 4J96A 4YSMA 3KK9A 4QP8A 3KMUA 3OD6X 4G6OA 4LGHA 1V1KA 2W1FA 4F6SA 2X9FA 4O0WA 1Q61A 5CT0A 5FEQA 4WBBB 1BKXA 4ITHA 3M1SA 3MPAA 2QOLA 3LLAA 3Q4CA 4DEBA 1E9HA 3KCKA 5HIEA 1YOJA 3D2KA 3HAVA 5EHOA 4EH7A 3RPYA 3VHKA 4G17A 5ANGA 2RIOA 2F4JA 3DLZA 2XKCA 3EHAA 3F5PA 3G0FA 3KKVA 4O38A 1FGIA 3DAEA 2FYSA 2ERKA 4YZNA 4B6LA 4KSQA 3Q6UA 4DGLC 3BU5A 3QF9A 3FSKA 4MQ1A 1XR1A 2JDSA 4IX4A 5IEXA 5L6OA 4XV2A 2BZHB 5KHXA 3CTQA 3EMGA 1QMZA 3V8WA 4B4LA 4C38A 3KCFA 2UVYA 2WMTA 3DAJA 3LXLA 2W1CA 4L7SA 4R1VA 5TKDA 3GBZA 3W2PA 4BDCA 5K5NA 5FUTA 5L2WA 5ACBC 2XCHA 5EDPA 3S2PA 4Y83A 3Q2JA 4EEVA 1V0BA 2YA9A 4MF0A 1OIQA 5FBNC 4C58A 3GC0A 4PX6A 5TE0A 2BCJA 4ACCA 2VTPA 2YCRA 4CYIA 4DF3A 2J7TA 3VW8A 3GOPA 5A4LA 1U54A 5IUHA 1H26A 3C0GA 4AZEA 5AM7A 3A2CA 3VWAA 4RWIA 2OIQA 5B7VA 4W4VA 2QODA 2G2FA 3NVMB 4D55A 5KX8A 1VZOA 3L8SA 2YLFA 4RVKA 2UVZA 4KBCA 3L9PA 4JJRA 4NJDA 4DT9A 2Q0BA 4IWDA 4V01A 5EKNA 2VNYA 4JR3A 2J90A 2QD9A 2B55A 1Q8TA 1H1QA 4RX7A 3WF9A 4NTTA 5HD4A 4CFNA 5TT7A 4EC8A 5IH6A 5BYLA 1H0WA 4J8MA 4S2ZA 2P3GX 4QOXA 5HCYA 3RAWA 4AOIA 5TOZA 4FV2A 4ASXA 3VULA 1KUTA 3AOXA 3QQKA 3RNYA 2RKUA 3LM5A 3Q6WA 3FI8A 3KRJA 2XCKA 3OTUA 4UEUA 3TDWA 4D2SA 5JRSA 2QO7A 4NKSA 3RK5A 4ZTHA 3AMAA 3HRFA 4R7IA 2PE1A 4WRGA 2EU9A 4QMLA 1H1PA 3SXRA 3T8OA 3PIXA 4M67A 3UG1A 4L45A 1XJDA 2X6EA 2HY81 2QOQA 3ETAA 4FVQA 4G6NA 3MSSA 1H0VA 5L2SA 3EN9A 2GSFA 2QO9A 4ZS4A 2RFDA 2NP8A 3AMBA 4O7ZA 5JZJA 4XP0A 5AIRA 3CLYA 2ETMA 5H8BA 1YQJA 5CXZA 4D4YA 4FSRA 3DKOA 3IPHA 4RZWA 4BBFA 5AADA 2CKQA 4GJ2A 2VX1A 3EQHA 4FYNA 5AR7A 3KL8A 2ZV8A 1BUHA 3EZVA 3ZO1A 1WVYA 4IMYA 5DBXA 2Z2WA 2O3PA 1W83A 2GHGA 4O0VA 3R8UA 3EJ1A 4IX6A 4TWCA 4DGMA 4L52A 4D1XA 4IM2A 4FVPA 3D7ZA 4X6RA 5HORA 4RIXA 5GJDA 5I9WA 5IA1A 2YZAA 3EQPA 5I9YA 1BMKA 2B7AA 1L8TA 4J1RA 2YAAA 3F7ZA 3R7GA 2HWPA 5HG9A 5M07A 2ITZA 5CQUA 5E8XA 4A4XA 2NRYA 3LXPA 4BGHA 4E1ZA 3QQFA 3A7GA 3F3UA 3QQHA 4FT9A 1UNHA 4QMUA 5FM2A 2PUUA 5D7AA 4KSPA 5DRBA 3BYUA 2P2HA 4IZAA 4AXAA 3FE3A 4U42A 3UVRA 2R7BA 4E26A 5FWKK 3BYSA 5GJFA 4O86A 2J5FA 5ETFA 2WGJA 3KFAA 4EYMA 2OJJA 2XF0A 5IISA 3SV0A 3AD5A 4D2RA 2IWIA 4FV6A 4Z7GA 3ITZA 3Q4ZA 4FSMA 2WNTA 3AXWA 3LAUA 2QG5A 3NW5A 4DG0E 1VEBA 3R9RA 4RX9A 4TNDA 4BTJA 3R8MA 4P4CA 2CJMA 4GH2A 2O65A 2JBPA 4YJVA 3LE6A 5E90A 3BLRA 5F4NA 5LWNA 3QCQA 2UW4A 2GHMA 4X3FC 4FV9A 3BHVA 3NUNA 2IVVA 3MTLA 3OXZA 3Q04A 3I5NA 4IJPA 3LCOA 4KS8A 5EK7A 4WUAA 2C5XA 3FPMA 3EKNA 5G6VA 2QOKA 4QP2A 3NZ0A 4IXPA 2VNWA 1MUOA 5IKWA 4BCMA 2UW3A 4W4XA 1NA7A 3SQQA 2WMUA 1QPEA 2HZNA 4BI2A 4EQUA 5KKRC 5DPVA 4DA5A 3PVGA 1O6KA 3VS1A 1NY3A 4XG8A 5IF1A 2OSCA 5I5ZA 2RSVA 4FEVA 3VHEA 3ZH8A 3NIEA 4TYIA 4XV1A 3UP7A 4HCTA 3SRVB 4MXZA 1Y8GA 4D58A 5JH6A 3TG1A 4RFMA 4AU8A 5HD7A 3GNIB 1OECA 2QNJA 3TTIA 4Y85A 2R3FA 4RX5A 4BCGA 4RGJA 1QPJA 2XIKA 2Y4PA 4WOVA 4BDHA 3MS9A 3CY3A 1MQ4A 3R01A 4USEA 1G8AA 3W2RA 4YZ9A 4EONA 4G5JA 4UMPA 5AUTA 4IC8A 3E7OA 1REKA 4FTQA 4AW0A 2CHLA 5I9ZA 4EUTA 5C4KA 2G9XA 3D0EA 5CAPA 1UV5A 4BWKA 4F7JA 4U3YA 2WAJA 5AV3A 4IB3A 4Q5HA 2B4SB 5IQBA 5CVFA 4J53A 2BRBA 5HZNA 4IZ7A 3AG9A 3ELJA 2QHMA 3HEGA 5HE1A 1ZYJA 2YITA 5AAEA 1UNGA 4Y46A 4Z3VA 5JMSA 3JR1A 3E8NA 1A48A 3EFKA 4CGAA 4FTIA 4C34A 4DEAA 4CTCA 3BV3A 2X4ZA 3NGAA 2ERZE 4EHGA 4A4LA 5A6NA 3NLBA 3D5UA
chains in the Genus database with same CATH superfamily
2I0EA 4EOKA 3NYOA 1XH7A 4HGEA 4I92A 5A54A 2WOUA 4G34A 4CV9A 3ZFYA 2V7OA 3PJ8A 1OITA 1CKIA 4FOBA 4AFJA 2Y0AA 5H2UA 4OTGA 5L3AA 3U4WA 4OTIA 3CSVA 2C0IA 3DB6A 4O1OA 3UBDA 4GK2A 3LMIA 4NW5A 1ERKA 4FIJA 2BROA 4NCTA 4BZOA 2OJ9A 3Q9ZA 4MHAA 3T3UA 3BX5A 4H05A 4PL4A 4GU9A 4HYHA 4S30A 4QO9A 5DI1A 5AR2A 5CEPA 1WBWA 2PVMA 1VLRA 3QRIA 5EKOA 1YDSE 1IAJA 3R1QA 3K5UA 1CSNA 3H9OA 2LGCA 3T9IA 4CT2A 5HO6A 5JRQA 4LI5A 3LXKA 4NZWB 3TM0A 5CI6A 4BDGA 4K2RA 4Z55A 3IKAA 1OPJA 2B9HA 5H8EA 3CJGA 2R2PA 3DV3A 4YJNA 3HV7A 2C68A 5KCVA 1FINA 1DAWA 3BV2A 2GDOA 4RJ4A 4JDHA 4ALVA 3E87A 3B8RA 3LJ2A 2BRNA 4EOJA 1J1CA 2GPHA 2BTSA 2YERA 4AWIA 4ZZNA 3PVUA 3MPMA 3P7BA 4BKZA 4D4RA 4YMJA 2XIXA 2ITUA 1RW8A 2YDJA 5CEKA 5M4FA 1WBSA 1TKIA 5TO8A 3KF4A 1Z5MA 1MRVA 1XBBA 4IBMA 4V05A 5IQHA 2EUFB 4BY9E 3HDMA 3G6HA 3VUGA 4II5A 1DI8A 2CLXA 1M7NA 1QPCA 3QX4A 5J79A 1H08A 5EFQA 3W2QA 4CRSA 4M0ZA 5A14A 4M15A 4FTMA 4I4FA 3EN5A 2WXVA 5HU3A 3E8CA 4O0RA 2A1AB 4X3JA 5AFVA 4IC7A 4N6ZA 4ERWA 2VU3A 3T9TA 4D2WA 3O17A 2OZOA 1ST0A 4Y5HA 4CMOA 3KF7A 4DGNA 5DT4A 3JVSA 4CLJA 2ZDTA 4JT3A 2XA4A 1B6CB 1W2FA 3I6WA 4W8DA 3RVGA 3NFGB 2WIHA 3R0TA 4KIQA 4ENXA 5M51A 3AT3A 2JIUA 2X7OA 3VF8A 4RSSA 3UOHA 3F5XA 3OEFX 2F2UA 4NJ3A 4RJ6A 3U6JA 3MIAA 3L9MA 3FZPA 4JQEA 1DI9A 1KOBA 3OVVA 4JX7A 3QLFA 4UWCA 4TNBA 2WMQA 4QYYA 1URWA 2W4OA 5H9BA 4JS8A 5HLWA 4M12A 2W17A 5AR3A 4BDEA 4RZVA 5ETAA 3QCXA 4C4GA 5HO7A 5FM3A 5HLNA 1FVTA 2JBOA 4B7TA 2H6DA 3WYYA 4AA5A 1OIUA 2G15A 4XG7A 4QP4A 1WBTA 3H9RA 4AXEA 4X2JA 1VYWA 3PLSA 5EYCA 3RALA 3RCDA 3W18A 4ARKA 4MXAA 4AZFA 4AXDA 3EWHA 2OKRA 5GJGA 1YDTE 5BUEA 1J91A 3RBWA 2Q83A 3R00A 5L8JA 3TWJA 2AQXA 1PW2A 2WHBA 5FQDC 3QLGA 4ZAUA 2WZJA 3ULZA 2XBAA 3F66A 2HOGA 4RBLA 5FP6A 4M0YA 3RP9A 4QPMA 4BIBA 4DLIA 5AP5A 4Y5QA 3FV8A 4S31A 3UDTA 5HESA 3RAKA 4MH7A 4NM3A 5DMZA 4YJRA 2YM4A 5CEQA 3FXXA 5CT7A 5AX9A 3DU8A 2ONLA 4AACA 3QTXA 2QLUA 3CE3A 3SDJA 4FSZA 3MH0A 3R02A 2VTNA 2EXMA 5EHLA 3ZUUA 2R3QA 3NUSA 2VGOA 3NW6A 4U43A 3ZZWA 3C0IA 2P33A 4GG7A 3UIXA 2C69A 5CY3A 4BTFA 4F08A 3N4UA 1SVGA 3D94A 3HA8A 3R2YA 3CGFA 4Y73A 1DS5A 1H28A 3GC8A 4C37A 4ANOA 3IK3A 4IH8A 2W06A 4XG2A 3PXQA 3CJFA 4QMZA 2BKKA 2XK4A 5CF4A 4GVJA 4QMWA 2H8HA 4U97A 3BYOA 4FTNA 2VTIA 3DBEA 3F9NA 2YEXA 4R1YA 1XH9A 3FXWA 2R0IA 4UXLA 1R3CA 3WIGA 4ACMA 4YZMA 5ACKA 3WF8A 3DBFA 4E6AA 4KBKA 3NNWA 5JQ8A 3TACA 3ZLWA 2W1IA 1UU3A 3C4WA 3QRKA 4RMZA 3WIKA 5K0XA 4FKVA 5T3QA 3T3VA 4AE6A 2WOTA 1ZMUA 4F1TA 3OY3A 3W0MA 1KV2A 4LGGA 3W8QA 3ACKA 5M55A 3NFFB 1M2RA 3C7QA 4Y8DA 3QTUA 3N9XA 3V5LA 3GT8A 5KMJA 1LEWA 2AUHA 4YLKA 4J8NA 4XOZA 1MRYA 4YPSA 5A4QA 1JKSA 3QU0A 4IAKA 5EM7A 4CG8A 4FUYA 4C62A 2WQMA 2BIYA 2CDZA 2X0GA 3GCUA 3WZKA 4F63A 4C2VA 3F2AA 3Q5IA 4U9AA 4XG6A 1B38A 2FO0A 5GZ8A 2V0DA 4DH3A 3BHTA 4E6QA 2BHHA 4JBPA 2XVDA 4RIWB 4D5HA 3GXLA 3HMIA 3PXKA 1M52A 5DE2A 4FNYA 2OJGA 2XNNA 3PYYA 5DHJA 3FI2A 1PXKA 4AXCA 1Q99A 4FRFA 4M97A 2VX0A 4IVCA 4QMNA 5EOLA 3O23A 3TDVA 2PMIA 1ST4A 2PPQA 4XS2A 2FH9A 4FL2A 4F9AA 2CKOA 5ETCA 4QTBA 2Y6MA 3EQBA 4PDPA 3SRVA 2GNGA 1Q8ZA 4QYEA 3HV5A 5HHWA 3KMWA 4L53A 5M09A 2XKFA 5IDNA 2C3JA 2BDJA 3F5UA 3ZYAA 2WMVA 3BU6A 1GIHA 1Q41A 2W5BA 3IGGA 4BIDA 4DBNA 2XYUA 4KIPA 2RFSA 4XG3A 3L9NA 4DH7A 3QKKA 2X81A 4WT6A 4WSQA 5D41A 3SG9A 4AGDA 4RWJA 4UALA 1JKKA 1Q8UA 4GT4A 5AV0A 3BWFA 2ZM4A 1ZYLA 3B2WA 4PDSA 3U4UA 5CAOA 4MWHA 1NW1A 5EHYA 2FB8A 4DHZA 1KE8A 4FKWA 2CN8A 4FKRA 4QYGA 3UYSA 2VTAA 2C6DA 2UW7A 1Y91A 3QCYA 4S34A 1ZZ2A 4BDBA 3MN3A 3HAMA 2VO7A 3JS2A 3QHRA 4FKOA 4YJPA 5EOBA 4BL1A 2YIQA 4MXOA 5CAVA 4BCHA 5GHVA 3OBJA 4M68A 3D5WA 2QOIA 2V22A 3NNVA 4H1MA 4AN3A 3HV4A 4EHVA 4B0GA 5AAFA 1TQMA 3ORZA 4ZZOA 2QOBA 4O4CA 2JIVA 3VUIA 4U81A 3PUFC 1G5SA 3EKKA 3P86A 3W33A 3VS3A 1JBPE 3Q9YA 5J7BA 1IEPA 3SOAA 4Z7HA 1CKPA 2FGIA 4DEHA 2YIRA 3DK3A 1XKKA 2HXQA 4OBOA 1K2PA 4O96A 2UW5A 3E92A 3NNUA 2V55A 1W7HA 3QKLA 4KS7A 5HKMA 4YC6A 3RHKA 5IDPA 1PYXA 5M53A 3U6IA 2CNUA 3PFYA 4O7RA 3VNTA 3A99A 3QHWA 2XIYA 3LFAA 3KRRA 4IDVA 4KKEA 4USFA 1HCKA 2WEVA 4D9UA 1OUKA 2C0TA 2XYNA 2YCFA 2C4GA 3LXNA 3ULIA 4X0MA 4YZBA 5HBEA 1FGKA 2BIKB 2JKKA 4ZIMA 3ORXA 5E8TA 3O7LB 4FSUA 3PSDA 1WBPA 4RFYA 5J87A 2VRXA 3VS4A 2XNEA 3OWKA 2HZIA 4PPCA 4QNYA 3G6GA 4RIYB 4X2GA 4C3PA 4HCUA 4CG9A 3DKGA 1REJA 4I93A 5B2KA 4GT5A 3V51A 3FXZA 1GZOA 5FRIA 3R8VA 2W96B 4W4WA 4DDGA 2H96A 4F0GA 3R9DA 2QVSE 2X39A 5FD2A 3LFDA 5CAUA 5CU0A 3GU8A 4I6FA 4MAOA 5GIPE 3QWKA 3CEKA 3TTJA 4CFFA 1FVVA 3AKKA 3IO7A 4XV9A 4W8EA 3FMLA 4FKJA 1BI8A 4ASZA 3QKMA 5K4IA 4W4YA 4ITJA 4O4EA 3R22A 4BYIA 4OTWA 2CNQA 2QQ7A 2R3RA 3FZSA 4HYUA 4JG8A 1ZXEA 3QGYA 2OBJA 2WMBA 4U3ZA 3FQSA 4LQMA 3BQCA 1H8FA 1XH8A 3R73A 4RC3A 3R6XA 2G2IA 2X8IA 4DFBA 1SZMA 3PVWA 2QU6A 4EWQA 4FSQA 2PK9A 3LFEA 3U54A 4H58A 4FZFB 4N4SA 4D2TA 1WZYA 3CKWA 1PY5A 3ORIA 2Y7JA 3ML1A 1QCFA 3ZM9A 4IAZA 4IFCA 3FLQA 3VBWA 3E64A 3HX4A 2YACA 1AGWA 4YHTA 4MD8E 3DJ7A 3BYMA 2E9OA 2VWZA 3AC5A 3ALOA 4IHPA 4RJ3A 1P5EA 3VF9A 2HY0A 1RDQE 1Y57A 3MJ1A 2X1NA 3QTRA 5TR6A 4TWOA 5K5XA 3V5PA 3PA3A 3NCZA 4GRBA 2OFUA 4OUCA 5HVKA 1SVHA 4GS6A 3O71A 4XX9A 2A98A 1YRPA 2PSQA 3VS7A 2J50A 3WZUA 4N70A 2QURA 3COKA 4ZLYA 5HTBA 4FIIA 4KUJA 2GNHA 4QT1A 3A8XA 4EJ7A 3C0HA 4OAVB 5IQEA 3FDNA 3ZRLA 4V04A 2X2KA 4NKAA 5AEPA 2YDKA 4X6QC 4IX3A 3W2SA 4LV7A 5I4NA 4AF3A 4FTJA 2XB7A 2OJIA 3FAAA 4QP6A 4H3QA 3IDBA 3LIJA 1JKTA 4I6BA 3K2LA 3KN6A 5HNBA 3V5JA 5F95A 3K3JA 5KMLA 4E6CA 4OTQA 3MVJA 3F3WA 3NAYA 3MWUA 3NWWA 4C4FA 4YJUA 3H4JA 3BGPA 2YJSA 1EH4A 4I4EA 2Z60A 4A07A 4NFMA 5IQDA 5DT0A 2R3KA 4AA0A 4J99A 4ZLOA 4O7TA 1UU8A 3FSFA 3MA3A 2IW6A 4GYIA 2BZIB 4LUDA 3PVBA 4J71A 2J9MA 2PZIA 5BPYA 3DTCA 2IG7A 3R7YA 4C8BA 4DEEA 3P23A 5AP3A 1H4LA 4M66A 4O0XA 3GC7A 4I0TA 3D2IA 3BU3A 3VN9A 2F57A 3FLSA 3QC4A 1R39A 4RVMA 4F1MA 5C1QB 3OWPA 2IVSA 2HYYA 4UZHA 3OROA 1GY3A 1T46A 4QQ5A 4ZJJA 3FMNA 3FL4A 2YCQA 3GU7A 3LOKA 3QQGA 3NEWA 2VTQA 2GNFA 1AQ1A 4S33A 1TQPA 1JNKA 1ZZLA 2VO6A 4FNWA 5EM8A 3SC1A 3QRTA 5IUGA 5AR5A 4U79A 1QPDA 3FZRA 5C9CA 5CENA 3TKHA 3VBYA 2B9JA 3LM0A 3KVXA 4IZ5A 5J7HA 4FKQA 4TYGA 2QHNA 3RGFA 3UODA 3P5JC 4YURA 1Z57A 4KA3A 4L6QA 2PE2A 4C7TA 3CTJA 4ZXTA 3AC8A 3I79A 5K4JA 2F2CB 5GNKA 3FL5A 3WZEA 4YGAA 2Z7QA 2C5NA 4EQCA 4DGOA 4G3FA 4K11A 3W0SA 3PPZA 4WNMA 1OL6A 2C6LA 3DKCA 4FBXA 4BB4A 4C33A 2Y9QA 3EQRA 2ITTA 4Q2AA 5IMEA 1ZAOA 2G1TA 2PVRA 4X2FA 4PQNA 1UA2A 4ZTNA 4DCAA 3R04A 4MXCA 4O0YA 5KMKA 4LYNA 4RIWA 2C30A 5DYJA 4FT3A 4CFWA 4OLIA 2CKEA 2WU6A 3U9CA 3ODYX 4QMSA 5E7RA 2V5QA 4ACDA 1BLXA 4CRLA 3TUBA 4FV1A 3DNDA 4DHJA 3BL7A 1L3RE 5IQGA 2CPKE 1NVQA 3WILA 3UC3A 3KA0A 2R64A 3F7WA 4FC0A 3R7IA 4O7VA 4BKYA 4QTDA 4NT4A 4EL9A 4L43A 3HRBA 4EK5A 3RM6A 4XG9A 3ACJA 4BCJA 3NW7A 4EK4A 2QOFA 3RZBA 1H1RA 5CXHA 4ANMA 3VQUA 4ZMEA 1JOWB 4HVDA 4NW6A 1YI6A 2BPMA 3KQ7A 4AQKA 4FEWA 1F5QA 4ZS0A 4L8MA 4XUFA 5EW3A 3SKCA 5DG5A 3S1HA 3SXFA 5LMAA 4GK4A 2YFXA 1WVWA 4U0IA 4EOQA 3F82A 1DM2A 3PJ1A 4RWLA 4XH6A 4QQTA 4D1ZA 2XJ0A 4FG7A 2B52A 5K9IA 4Z9LA 4YPDA 1OIYA 3MVMA 3O7LD 4ZSGA 4LOOA 1PJKA 4GFGA 3CD8A 3QD4A 3C51A 3TJDA 3UGCA 4IDTA 4ZTLA 3CR0A 3H30A 1SMHA 1PF8A 2UZLA 4UYAA 3P0MA 5AP7A 1UNLA 2ZV2A 4RWKA 3UJGA 5I0BA 4LOPA 5HNIX 3WZDA 1V0PA 3IDCA 5DT3A 3PSCA 3NX8A 4JDKA 2G01A 3RM7A 3MTFA 5F20A 4DEGA 1RE8A 5IPJA 3F3VA 4FTKA 5C27A 3ZBFA 3NCGA 2J4ZA 3OTVA 4BYJA 2IF8A 2VTRA 3IONA 4TPTA 1WMKA 3FY2A 4UBAA 4UZDA 3HUCA 3PG1A 5D9HA 4F65A 4M7IA 3RK7A 4BDFA 1O9UA 2QCSA 3FMJA 3HNGA 4FL1A 5EYKA 4HYIA 2REIA 4LV8A 4AOTA 3VUTA 3DBCA 4HYSA 3ID6C 2PVYA 2JC6A 3PXZA 3VS5A 4CKIA 4E4MA 5CU4A 2PU8A 3VC4A 3FPQA 3ZC5A 1H01A 4HZSA 4KINA 3NYXA 3LVPA 4YTFA 3ENHA 3SXSA 3UO4A 4O22A 3DOGA 4DFUA 2W1GA 3L8PA 4ASDA 3UP2A 3DNEA 4L44A 4V0GB 3S0OA 5KMNA 2HCKA 3IW4A 4IACA 4KB8A 1ZLTA 5GIOE 4I21A 2JIIA 2ITOA 3K3IA 1OKYA 4E7WA 4HW7A 2Z8CA 5EYMA 5E1EA 4PMSA 3ZU7A 3DPKA 2J0IA 3V6SA 5LMKA 4MUQA 1IAHA 3Q5ZA 4YLLA 5J1VA 1XO2B 4I23A 1Y8YA 4ONAA 2C47A 4PV0A 2F49A 4H39A 4QTEA 4XOYA 3B8QA 3MI9A 1YHVA 3EFLA 3FC2A 3M11A 2YWVA 4MVFA 4ZLZA 4NYEA 5J1WA 3QD2B 3W0QA 1WBVA 4I5HA 2UW0A 1KOAA 4O81A 4EK8A 5I3OA 4PTEA 4R7HA 4RIYA 2OU7A 2PZYA 3WF5A 3DFCB 1JSTA 3AC2A 2W9ZB 2UZOA 4CVAA 3FMHA 4IM0A 2OH4A 4DFYA 5BQ0A 3SD0A 3ZRKA 4NCTC 4EWHA 2YM5A 5AP2A 1XBCA 3OT3A 3HLLA 2CGXA 4KD1A 5CF6A 3PIYA 3TNWA 2WD1A 3AC1A 2ZV9A 3A60A 3VUKA 2H9VA 1Q8YA 4FX3A 4EUUA 2YM7A 4R77A 5HIBA 4IAFA 1GJOA 1H27A 3UTOA 4RG0A 4IX5A 4TN6A 2WMSA 5CU2A 4ALWA 1GZNA 4FTUA 2JDOA 4O4BB 4I6LA 3QA0A 4MKCA 4CFMA 3OZ6A 2GCDA 3HVCA 5M4UA 4F78A 1G8SA 4JRVA 2ITYA 2ZVAA 2KULA 5BYYA 1ZYSA 3BRBA 4GJ3A 4APCA 5D12A 4IWOA 1GZ8A 2XJ2A 4EBWA 5JEBA 3BQRA 3NNXA 3P7CA 2WTVA 3FZOA 3L9LA 4NWMA 5AP0A 4ANSA 1J7LA 1G8JA 2YIYA 3NYNA 2C1AA 5AP4A 3UZPA 3ZEWA 5CALA 2BDWA 5CSWA 1XWSA 3C50A 3SA0A 5LVMA 1LUFA 3FMMA 3PXRA 3AMYA 1PKGA 4FSTA 2FSOX 4IQ6A 3D4QA 5FEEA 5AUXA 3NDMA 2R7IA 1B39A 3R7EA 3L8XA 5CF8A 5FDPA 2YISA 3NSZA 1ZY5A 3Q9XA 5L6PA 1KE9A 1PXPA 1Q62A 3FLYA 3FZTA 4ZSAA 3SG8A 3LCDA 3QYZA 4PL5A 1IRKA 1P14A 4AE9A 2QOHA 3A4OX 5FG8A 4X2NA 3NPCA 5AAGA 1TQIA 4M69B 2Z02A 3V04A 3ERKA 4UYNA 2PVKA 4CMUA 1NVRA 2IJMA 4K1BA 4O91A 3ATTA 5CYIA 4A9TA 3BHHA 4U6RA 5LARA 3W0PA 5HE2A 5BVFA 2R3OA 2UZBA 3O0GA 5EW8A 5TF9A 3TI1A 4F99A 4JXFA 2GTNA 4G9RA 3SVVA 3C9WA 3TKUA 5AA9A 2ACXA 4MNEB 5IA5A 2CCIA 4YJOA 4BC6A 1URCA 5M06A 4FKIA 4MBIA 3ATSA 3I60A 2B9IA 4R5YA 1YWVA 2WQBA 4E4XA 2XNBA 3DGKA 4FEXA 3LLTA 2C6EA 1VYZA 1ZOEA 2W0JA 5A4EA 3ZMMA 1W2DA 3FYJX 4WNKA 4XG4A 4ZZMA 5IQIA 4BR3A 2BFYA 2QLQA 2VN9A 3LFBA 4NIFB 4HVGA 4YC8A 3HECA 2GMXA 1Q3DA 1IR3A 5CSXA 4I6QA 2PTKA 3KRWA 3CC6A 3D5XA 2C1BA 3COHA 4D9TA 2OK1A 5KHWA 4MQ2A 4FSYA 1KE6A 2WB8A 4TWPA 4Z16A 4ZY4A 3BL9A 2WQOA 3ORLA 2R0UA 3CS9A 3QQUA 3AGMA 2UZTA 2OWBA 1OB3A 2ZM1A 3RTPA 1IASA 2OH0E 4MCVA 4TRLA 5AIKA 4F9WA 4UXQA 2HZ0A 2QR7A 2ZM3A 3NUUA 3TNQB 3LFQA 4IB1A 2Z7RA 3CXWA 4C61A 1H00A 4CZUA 3VS6A 2ONLC 1PRYA 3Q96A 3UPXA 2JGZA 4U41A 1CKJA 2BMCA 5HX8A 3R9OA 1M17A 4FNZA 2XNPA 2QOCA 2VD5A 1YWNA 3MFRA 3PJ2A 3BLQA 4EC9A 2WTKB 1IG1A 5HNGA 5M4CA 3PPKA 4FTRA 3QALE 1H25A 3BLHA 4R3RA 1FMOE 1R0EA 3ZHPC 4K18A 4TWNA 3TCPA 3BE2A 1CM8A 4QQJA 1SNXA 3FLNC 4BWPA 4D4SA 4JBVA 1O6LA 3NAXA 3GFWA 5CSVA 3R71A 5F1ZA 4WG3A 1OI9A 5L6WL 1TZDA 4ZSEA 1ZARA 3VBTA 2O0UA 4ANBA 2FA2A 4M8TA 3WF7A 4EOSA 3VS0A 4ZY5A 4DBXA 3BELA 2GS2A 3JY0A 2X4FA 3O96A 2P55A 3H10A 3PFQA 3O2MA 4GFOA 4PDOA 5DNRA 5H8GA 2PE0A 2PVJA 4ACHA 3OWLA 1FOTA 1FVRA 4O0UA 3Q32A 1PYEA 1TVOA 4D0XA 3A7HA 3DQWA 4NH1A 1OPLA 4U7ZA 2I1MA 2UZWE 4X7QA 3F2NA 2YM8A 3O8UA 3PUPA 3UDBA 4FKSA 2PUPA 4PPAA 4U40A 4FK3A 3GENA 4OTHA 1XMLA 2BRGA 3CY2A 4DFNA 3CIKA 2XEYA 3WF6A 2FVDA 2Z7LA 1APME 3AQVA 4K6ZA 2OF2A 2DQ7X 5FEDA 5IZFA 1H1SA 4ZJIA 4N57A 3WARA 4DG3E 4F9BA 4FIHA 3VRYA 3JYAA 4TYEA 5BVDA 2E9PA 5AWMA 5E1SA 4JLCA 1QL6A 1YXUA 3ORPA 2QU5A 1UVRA 4QD6A 5CEOA 4L3JA 1YI4A 4DH8A 4CKRA 5L8LA 3QXPA 4GMYA 3LCKA 1PHKA 4PMMA 2RG5A 3U8WA 3Q52A 1BL7A 5AP1A 1R78A 2HXLA 3RK9A 4BICA 2FSMX 3DDQA 4NK9A 5IUIA 5LVOA 3G5DA 3NUAA 4IVBA 3FC1X 3EOCA 1Y6AA 4BVUA 3UQFA 2C3IB 4I5MA 5BVNA 5HLPA 1YVJA 2B54A 2BUJA 3CKXA 4HOKA 3HUBA 5EI8A 2W9FB 2X8EA 4HGLA 4WG5A 3EFJA 4I0RA 3CTHA 5AUYA 3TJCA 3TL8A 4B8LA 3OEZA 3BKBA 5FGKA 3R30A 4GUBA 4AUAA 2UZEA 4ZK5A 4C4HA 3FI4A 4E8AA 3OFMA 3FY0A 4HZRA 5BVKA 2LAVA 4KBAA 3RPOA 3VS2A 4CCUA 1WVXA 5E4HA 4D4VA 3EYGA 5E8YA 2O2UA 3OCBA 4L3LA 5D11A 4AW1A 3DQXA 3GQIA 3OY1A 4GG5A 4GFMA 4PMTA 3UIBA 5IG1A 5ANOA 3UOLA 3NUXA 3BYVA 4V0GA 4YNOA 2IW8A 3EZRA 2A0CX 3PY0A 3DFAA 3GUBA 3KXNA 2R3MA 3UQGA 4PNIA 3CD3A 4GV1A 3W2OA 3TZ7A 2NPQA 1JQHA 2OI4X 3P7AA 5CU6A 4E5BA 2OLCA 3BE9A 3BPRA 5CEIA 5IQFA 2PWLA 4PRJA 3OXIA 3FHIA 2I40A 2PY3A 3FLWA 3GU6A 4HNFA 4WNOA 4QDVA 2IZRA 2WMRA 2BAQA 2Y4IB 1KV1A 4JAJA 5JSMA 4HGTA 4O0TA 3UNKA 3QZHA 3KXHA 1OZ1A 3QFVA 4R78A 3HRCA 2WO6A 4AX8A 4JBOA 2PYWA 4QMXA 3G51A 3HMPA 4HPTE 3PXFA 2VTMA 3E88A 3BEGA 2O63A 4CLIA 4CNHA 3UIUA 4CTBA 2YM6A 3LCTA 4FKLA 3ZM4A 4BDAA 1XBAA 4JQ7A 5KBRA 3D14A 4AZTA 4J98A 4OGRA 4D2VA 1M2PA 2XNGA 5KE0A 3TNHA 3AKLA 4QRCA 3GCPA 4BCQA 1U5QA 3CGOA 4HGSA 4Y72A 3ORKA 2HELA 2RGPA 1GOLA 5EDRA 3QUPA 4MX9A 3QUEA 4BCFA 2WTJA 3F88A 4I41A 4QTAA 5I9VA 2BDFA 4EBVA 4Q9SA 1HOWA 2G2HA 3EQDA 5ITAA 4C59A 3E8EA 4ENYA 3LQ5A 5B0XA 5ANEA 3VBXA 4R3PA 3QTWA 3I0OA 1NVSA 3NIZA 3QWJA 4GSBA 3GQLA 3TNPC 4DC2A 2A2AA 3QL8A 2BFXA 4LV5A 4MNFA 3TUCA 2PHKA 2NYAA 4GKIA 1S9IA 2BAKA 2V62A 1P4FA 3MFSA 5M44A 3OMVA 1YXTA 5FBOA 2BR1A 5K0KA 4NL0A 3P1AA 3QTSA 2R3JA 4P7EA 3UE4A 3R1YA 3OCGA 4MBLA 3MESA 2XK7A 4ASEA 3MB7A 1A9UA 1P4OA 2CGUA 5L2TA 1ZOHA 3DA6A 4F70A 1W84A 4IW0A 4DG2E 3I7BA 2JD5A 3RINA 3NMUF 2FSLX 3UVPA 4R3CA 4BTKA 3K5VA 4J95A 3QZFA 4ZTRA 4FGBA 1OKWA 4MXXA 2WMWA 2W05A 2O8YA 4KNBA 2H34A 1YOLA 3EQGA 4GYGA 2ZYBA 5DOSA 3FZ1A 3OC1A 4ACGA 2A4LA 3BBWA 4EH3A 3C5IA 4GU6A 2DWBA 3ZS5A 1YXVA 2AC5A 2HZ4A 2JFMA 4AN9A 2I0HA 3ORTA 2GQGA 2BZKB 2ITXA 4FMQA 4L42A 3CCNA 4DYMA 2ITNA 2C6IA 5GINE 3KXXA 2JLDA 3REPA 5L2IA 4A4OA 4PNKA 2XH5A 1I44A 2A27A 1R1WA 4P2KA 1WFCA 4ERKA 5DA3A 3PG3A 3OBGA 5IA0A 2I0VA 4IAIA 4MNEA 4FL3A 3OWJA 5HO8A 5LMBA 3PWDA 2F9GA 2HENA 2JDTA 2YAKA 3THBA 4AT4A 3VJOA 5AM6A 2QG7A 3CBLA 3FWQA 4KRCA 5KMMA 3N4TA 4BDJA 1GIJA 2JDRA 4FG8A 4APPA 3BI6A 3RHXA 2QOOA 3WBLA 3KGAA 4YHJA 5A46A 3CP9A 3C4EA 5LVNA 3UDSA 2RG6A 3EFWA 4NIFA 4ZOGA 2ITWA 3V8SA 5IQCA 5J9YA 2C3LA 2EVAA 3BHUA 4DH1A 4RA4A 5E8WA 4MXYA 5JFVA 3RAHA 3HZTA 4K9YA 2VWUA 3PRFA 4ALUA 2VWWA 4RIXB 4UN0C 2QO2A 4JDJA 5AR4A 4F1OA 3TXOA 3I1AA 4FZ7A 4RQKA 1DAYA 2GHLA 2UUEA 4TXCA 5LWMA 5AMNA 3Q2MA 1BYGA 4L9IA 3MFUA 3QTIA 4QMVA 1RJBA 4OW8A 4EH2A 4IAYA 4BIEA 2CN5A 5KMOA 4I24A 5CS6A 4O7LA 4HVHA 3OOMA 4O7NA 2UV2A 2UW8A 3LKMA 4GL9A 1GIIA 4YBJA 3UYTA 1CDKA 5KZIA 3GFEA 4OTRA 2OG8A 3BGQA 4CV8A 5HICA 4B9DA 4UWBA 3OHTA 3EN6A 3SOCA 3ZONA 3I0QA 4JQ8A 4NM7A 4I0SA 4PL3A 3RI1A 2OGVA 2HAKA 4O1PA 4DEIA 5IMXA 2WU7A 3VW6A 3WI6A 4YO4A