1Q4LA

Gsk-3 beta complexed with inhibitor i-5
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
352
structure length
342
Chain Sequence
SKVTTVVATPGQGPDRPQEVSYTDTKVIGNGSFGVVYQAKLCDSGELVAIKKVLQDKRFKNRELQIMRKLDHCNIVRLRYFFYSSGDEVYLNLVLDYVPETVYRVARHYSRAKQTLPVIYVKLYMYQLFRSLAYIHSFGICHRDIKPQNLLLDPDTAVLKLCDFGSAKQLVRGEPNVSYICSRYYRAPELIFGATDYTSSIDVWSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQIREMNFPQIKAHPWTKVFRPRTPPEAIALCSRLLEYTPTARLTPLEACAHSFFDELRDPNVKLPNGRDTPALFNFTTQELSSNPPLATILIPPHARIQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Characterization of the Gsk-3Beta Active Site Using Selective and Non-selective ATP-Mimetic Inhibitors
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords GLYCOGEN SYNTHASE KINASE-3 BETA
total genus 99
structure length 342
sequence length 352
chains with identical sequence B
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2003-08-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 1q4lA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 1q4lA01
5LQFA 3RNIA 4R77A 2R3KA 4ENXA 1NVSA 4LRMA 4YP8A 1OIRA 5C1QB 5G6VA 1Q8WA 4TYHB 3LKMA 4F0FA 1IASA 4EK4A 4HNFA 5DVRA 4BDGA 3RNYA 4I6HA 1FGIA 2HXQA 5AR2A 4I5PA 3VIDA 4CD0A 4F0IA 2WXVA 4KS8A 4RMZA 4BCPA 4CZTA 1BL6A 5FBOA 4U45A 4W8EA 1H00A 3O8TA 5LXMA 3MTFA 3BU5A 4FSZA 3CS9A 4TRLA 2B1PA 4AUAA 4FTRA 3L9NA 4FI1A 3U4UA 2ITWA 2VTLA 2X81A 2VWVA 4BIDA 4O0SA 4D28A 3FLQA 3NIEA 5KO1A 3KRLA 1FMKA 3IONA 5HCYA 5D9HA 3HECA 5E92A 5L6PA 5HI2A 4O83A 3JUHA 2VTMA 2RSVA 5JKGA 3QX2A 4QP7A 3ZXZA 4C3PA 2OSCA 4CYIA 1UU8A 5DNRA 2ZAZA 4M15A 3VBXA 1YXSA 4FSTA 5ANOA 2W4JA 4QMQA 5CSHA 3QD4A 2R3JA 3NLBA 1W84A 2PVNA 1KWPA 4QTAA 1PXLA 4IW0A 4NJDA 4F63A 2WU7A 3AT4A 4QYEA 2R3QA 3CQEA 3R83A 1GIIA 3FKLA 5FDXA 5IMEA 2Z2WA 3FPMA 4PMMA 4MAOA 3SV0A 4M3QA 5M4UA 2BAQA 5JFVA 2C6KA 2IZSA 4Y5QA 5JT2A 2ETRA 3U4WA 4FZ6A 3A2CA 4I93A 5KE0A 4EQUA 3KMUA 4J95A 4WSYA 3GEQA 4QP3A 2WU6A 3O7LD 1DM2A 4Y85A 4AS0A 4NL0A 4AZFA 4FE2A 4U3YA 4CFMA 4KUJA 3EQPA 2VO6A 2VX1A 4YJPA 5FP6A 3WARA 1W82A 3LVPA 3FHIA 3F6XA 1KOBA 3NAXA 4PMPA 5CANA 2Q83A 1MRVA 3QKMA 4CMUA 3MH2A 5HIDA 5M57A 3H10A 4ZJJA 3W2OA 2XNBA 3WZDA 4DEGA 3FXWA 5LARA 2B7AA 3VBYA 3QHWA 1MRUA 3H0YA 3DQWA 3F3ZA 2C5XA 4KBKA 4WNKA 1ZMWA 2HYYA 4MXCA 4GW8A 5CQUA 5HX8A 1NW1A 2YZLA 1OMWA 3FLZA 5IPJA 2DYLA 4PNIA 4TNBA 4DT9A 5EYMA 3VUHA 4O1PA 3G0FA 3RPYA 3QZHA 4GK3A 4I41A 4BZDA 4TYIA 2VO3A 4XCUA 3BE9A 3E88A 3GCVA 4GYIA 1WMKA 2XBAA 3HGKA 2WTWA 4AT5A 4G1WA 5KMMA 4TNDA 5IISA 2XCHA 4S34A 4F4PA 2BRNA 4IBMA 5M08A 3BQCA 1H8FA 3CKXA 3ZUTA 2Y0AA 5CVHA 4BZNA 3ZSIA 4C8BA 4GG5A 4QTEA 1YRPA 2HWOA 3R1NA 4OGRA 3ENHA 4E4MA 4FIJA 4H3BA 4IC7A 3DY7A 3JPVA 5IEXA 4OTRA 3IW5A 1S9IA 3C7QA 2VAGA 3C9WA 4KIKA 3QQGA 4G9CA 4BF2A 4AZSA 4FTNA 4M68A 5AFVA 4FIEA 5I9XA 2ZV8A 1OVEA 3SC1A 3BV2A 1T46A 4B4LA 3BELA 3WZJA 4QT1A 4DBNA 3P7CA 4CKIA 1IR3A 3RWQA 3Q4CA 3UYSA 3E62A 2WMSA 3MH0A 4HCTA 5ETCA 1P5EA 4ZOGA 3WILA 2CSNA 4BICA 4WO5A 1H4LA 3E93A 3TWJA 5C27A 4AWIA 3R8UA 4ZSAA 2ZOQA 4ID7A 2YIQA 3W8LA 4WBOA 1H25A 4F9BA 3KK9A 4CMTA 5IQHA 1PYXA 5AUVA 2XVDA 2I0YA 4YU2A 4JDJA 4QP8A 5C4KA 3C4EA 3RK7A 2VTRA 5AUTA 3LJ1A 5FEQA 5KMOA 4FNWA 1PKGA 3COHA 5CSXA 3Q4ZA 2W4OA 4C4IA 5K0XA 5L2TA 3PPKA 2CNQA 3LLAA 3NYVA 3BLRA 4QP9A 4FNXA 4W4YA 4BKJA 5AAGA 2YM7A 5J7BA 3OCBA 4O6LA 3DBEA 4WA9A 4FSUA 4LMNA 1R78A 3I79A 4AOTA 2YZAA 3K3JA 4MEDA 4C57A 5GZAA 4CFUA 3HAVA 4G34A 3PY3A 4JQEA 3ORLA 4FICA 3U6JA 3GBZA 2J2IB 3OWKA 2HK5A 4FF8A 4DEBA 2JKKA 3RZBA 3GU6A 4XG3A 4DH3A 2UZLA 5ANIA 1UA2A 4FR4A 4Z3VA 4YJUA 5IA4A 4O0VA 2OH0E 5FG8A 5A6NA 3KXZA 3M42A 3NX8A 2BCJA 2JAMA 2Z7QA 5DEWA 3VC4A 5J1WA 2UW4A 4D1ZA 4O7NA 2GNLA 3BYVA 3LFAA 3S2PA 2B54A 3NYNA 2VTOA 5J5TA 2P2IA 2OXXA 1Y6BA 4TN6A 4O7VA 1JAMA 5IG1A 5K5XA 4E73A 4YTFA 4YSMA 4FKJA 2YCSA 4S2ZA 4N6ZA 2PZRA 3BYSA 3PXFA 2HW6A 3A4OX 3MSSA 4C4JA 3QZGA 3OXZA 4DITA 5TR6A 1UV5A 4I22A 3T3VA 2RFSA 4E6DA 3NUAA 2R3IA 3ZLYA 5BUIA 1PMUA 3PJ8A 3FDNA 3FYKX 4UYAA 3VS2A 3C51A 5E8ZA 3F3WA 3BBTB 5HNBA 5LCKA 2XYNA 4C4HA 3VF8A 4UMUA 4Y46A 2C6MA 4ZTNA 2W05A 4BFMA 3FPQA 5HNIX 4DCAA 2XK8A 4YTCA 5IQAA 2GNJA 2H8HA 2CN8A 3KRRA 3HNGA 3E87A 5DR9A 3R9HA 1M14A 2WTDA 4IWOA 5KMNA 5FEEA 4DFUA 3MFRA 4RIXB 4B99A 5CSWA 2R0UA 1YXTA 4YPSA 4WUNA 4BI2A 5JFXA 3DCVA 2VTIA 5ITAA 4AQCA 3RK5A 3TNIA 4MD8E 4MXOA 3PJ3A 4NH1A 2OIQA 2OLCA 5EM7A 4LOPA 4PL5A 3RPOA 2HZNA 1OL7A 1H1RA 2HOGA 3EYHA 5EM8A 4KKEA 3LCKA 4GG7A 2PK9A 5EM6A 4D2PA 4M13A 4RBLA 3T9TA 4U9AA 3OC1A 5B2LA 1Q4LA 3QGWA 3BBWA 3CTQA 4YLKA 4DG2E 3BLQA 3NUXA 4TZRA 2W5AA 3QKKA 3MH3A 3RZFA 3ZO2A 5IQCA 1ZY5A 3KL8A 3ORTA 3UIMA 1Q8TA 5DT0A 5A4CA 4RJ5A 4E5WA 5FTGA 3GU5A 5EQPA 4IACA 2G01A 2W9ZB 3R1QA 5KNJA 2VWUA 3TTIA 3HVCA 4RWLA 3ZO3A 5BYZA 3TM0A 4L44A 2PULA 4AN9A 3UOJA 3K3IA 4B8LA 4XJ0A 2GNHA 4KKGA 1G8SA 5AM6A 1DS5A 1ND4A 3EL7A 5KZIA 5DI1A 3V5TA 2QOKA 3N51A 5CEKA 1G8AA 2F9GA 3HV6A 3BYUA 2B53A 3CBLA 4TYGA 4XP0A 4HYHA 5AX9A 3ZFYA 1G3NA 2C6LA 5B2KA 3V6SA 4EH5A 4ASDA 4FIIA 5DN3A 2RFNA 3ITZA 4RFMA 4LL5A 4PDSA 1QPCA 2Z60A 2J4ZA 3EKNA 4JRVA 3VWAA 3GOKA 4U5JA 5FBNC 5HVKA 4I1ZA 3WIKA 3I0OA 5E8WA 2XNMA 3JYAA 3PVWA 4MTAA 3HA8A 3BEAA 2WMBA 5CQWA 1WVWA 1Y91A 3WYXA 2C6DA 5EHLA 3BHTA 1M7NA 3FMJA 5FRIA 1XWSA 4L8MA 4FTAA 3MPAA 4PMTA 4EZ3A 2JIUA 4LQMA 3P79A 3W2SA 3EZVA 2FUMA 2PMOX 3UP2A 4OTWA 4KAOA 1ZMVA 4APPA 3A7GA 4ALUA 1O6LA 2BDFA 3EN7A 5HG8A 3NEWA 4P90A 5CEOA 4GKHA 2UZWE 2Z7LA 3QCYA 4E6AA 4QOXA 3KN6A 4GMYA 2YM4A 4RC4A 4BGHA 4CQEA 1R3CA 3S3IA 1GIHA 4EZ5A 4NUSA 2VRXA 3LFEA 5ANEA 5KMLA 3H4JA 4E4NA 4KKHA 2E9NA 4L46A 3KVXA 4K2RA 3LCTA 4HYUA 4XG8A 5JSMA 2WIHA 4Y8DA 4ZP5A 1YOJA 1OUKA 3UJGA 4BGQA 2C3JA 3FSKA 4RVMA 4ZAUA 2XA4A 2WTJA 3CQUA 2XM8A 3QF9A 5B7VA 3KFAA 3EOCA 5EKOA 4JJRA 1I44A 5LOHA 3BIZA 4KD1A 2E9PA 3AMAA 5FGKA 5DT3A 3G9LX 5KZ0A 1XQZA 4WG4A 3HMOA 5IUHA 4KABA 4OAUC 4IAZA 2WMVA 4W4XA 3O23A 4RIYA 3VHKA 3ZHPC 2BVAA 2VO7A 1Q5KA 4IH8A 4FTQA 3U9NA 5CS6A 5IQFA 4OBOA 2C6TA 3GC7A 2C6OA 3QZFA 5A14A 1YW2A 4XOZA 1JKTA 4AA0A 1F3MC 4MWHA 4NIFB 5E8SA 5LWNA 5GIPE 2DS1A 2FGIA 3QD0A 1ZLTA 5I9ZA 3B2TA 3OMVA 3UOKA 4PRJA 1JSTA 2IW9A 2X1NA 2I0VA 3G51A 1XR1A 3DLZA 4GT5A 4FMQA 4E6QA 3EQDA 4JVGA 3OP5A 3O2MA 3PTGA 1ZOEA 4TWOA 4PDYA 3LM5A 4GUEA 3F7ZA 4NT4A 4PPBA 5AP1A 4BCHA 2UW6A 2OI4X 3QRUA 4JR3A 1PHKA 3LZBA 5BQ0A 3QAME 5L8JA 2GQGA 4E5AX 3MYGA 4EOJA 2XK6A 5FQDC 3QTUA 4U3ZA 3A99A 4DTKA 3V51A 4F08A 3DK7A 3TZ7A 5KMJA 3U55A 4MK0A 3PXKA 3WIGA 2BKZA 2JFMA 4IDVA 3OCTA 3VS0A 2ITUA 5EHYA 2GTMA 1ZYSA 4L6QA 1DI8A 5AMNA 4F6SA 1H1SA 3D9VA 3R02A 1Z9XA 3U54A 4DH5A 4QP6A 3AXWA 1UU9A 5ANJA 5BVOA 3ZS5A 2JEDA 4QYYA 1BYGA 3FI3A 3UQGA 3ZO4A 3DJ7A 4XG7A 2CGWA 3SD0A 2Y4PA 1CMKE 2RGPA 2QONA 5T6KA 5FEDA 3FZRA 4TWCA 4R5SA 1HCLA 4G3EA 2W5HA 3DA6A 3KCFA 3QZIA 4F7LA 1CKJA 2XNPA 5EI8A 2OJIA 2C3KA 1RQQA 4U43A 4D2TA 3UNKA 4EOSA 3E7VA 4AGUA 4FNYA 3KREA 3A61A 3G2FA 2FSTX 3OZ6A 3QALE 2C30A 5IQDA 1J1BA 3M2WA 3PSBA 5HBJA 1M2QA 4X21A 5E8TA 3MVHA 3IW6A 3QKLA 4HPTE 3L9MA 2P0CA 3SW4A 5K9IA 3R7OA 2CKOA 3NNXA 5HVYA 1UNHA 1XBBA 2XK9A 3MGYA 4BKYA 3BRBA 3CXWA 3G6GA 3PLAE 4BCGA 5IA3A 1TQIA 5JQ8A 5DGZA 3UG1A 3TN8A 1GJOA 1YWNA 2HELA 4RC3A 2EVAA 2NO3A 3ZMMA 3VS3A 3QHRA 3POZA 3P7BA 4J7BA 4J8MA 4RJ4A 5AA9A 3DFCB 5AR4A 3A8WA 4FG7A 2XP2A 4BDBA 3EMGA 3NCZA 5FDPA 1SNXA 1TKIA 2J9MA 2EU9A 2E9UA 4MH7A 4PQNA 4AACA 2I1MA 4BCFA 4OTGA 3TZMA 3G9NA 2C69A 5AV2A 3GFEA 3SHEA 4U6RA 4XHKB 4OUCA 1Y6AA 2ZDUA 3TKUA 1J91A 2ERZE 2X2LA 1WVXA 3NNWA 5I9VA 3DNEA 5AP3A 2ITVA 4PTCA 4QPSA 3R2YA 1BI7A 5CAVA 4MBIA 3QLFA 5EDQA 3RTPA 3E8NA 2BTRA 2Q0NA 3R6XA 4KNBA 3DBCA 5GJGA 3RK9A 3TKHA 2YLFA 5LWMA 2R3OA 2YM5A 4AG8A 4IAKA 5JZNA 3C4CA 3FZTA 5L2IA 1JLUE 5CVFA 1JVPP 4N0SA 2WQEA 3LXPA 3TNPC 2QC6A 3QTIA 5DIAA 4A9RA 2GFSA 1F5QA 4K0YA 3B8RA 4FBXA 2J0KA 4L42A 2BRMA 4ALVA 5AUXA 5J5SA 4FTUA 2R3GA 3PA3A 3UMWA 3ZC6A 3C5IA 1YWRA 4YC3A 3LXKA 2W5BA 5EQEA 4J52A 3TUCA 2F2UA 3EN5A 5A54A 2O5KA 3FKOA 3NMUF 3DPKA 4IM2A 4F1TA 4ZSLA 5HTBA 3Q9YA 1OPLA 3H3CA 4KIOA 4A9TA 4YTHA 3EQBA 2W9FB 3LXLA 4GV1A 3EB0A 5AADA 3QQKA 1V0OA 1B38A 1SMHA 3ZFXA 3B2WA 2VTNA 5D41A 2HIWA 4QP1A 5L2SA 2ZMDA 4GJ3A 3TV4A 3G15A 3GCPA 4V01A 3S4QA 1Q99A 4ZJVA 1XBAA 3EJ1A 4YTIA 4MKCA 3R7GA 2J0JA 3P23A 3IK3A 4M12A 5GHVA 2VWYA 1W8CA 4AE9A 2W1IA 2PZYA 4M69B 1H27A 3O51A 3E63A 4EH7A 5HU3A 1XBCA 3PG1A 2VTTA 2F4JA 4EONA 3Q9ZA 4QP4A 2C5VA 2WFYA 3H0ZA 4CFVA 3DTCA 3N9XA 5H9BA 4D58A 2OZAB 4AA5A 3LIJA 5EOBA 4ZSEA 3ROCA 3WE8A 3BU3A 5J9YA 2ZYBA 4DFLA 2IW8A 4CSVA 4DTAA 1KE8A 4GU6A 1LEWA 2W1HA 4PUZA 3ZONA 5IU2A 4BGGA 2VTJA 1UU7A 4BR3A 1PJKA 5HIEA 5FM2A 2ITPA 3S0OA 3D7TB 3E8DA 3TNWA 4F70A 5T68A 1WAKA 4M84A 3EQFA 4YC6A 4DTBA 1KV1A 4EHGA 3O17A 3Q60A 3FMEA 4EBWA 1FVRA 3DBDA 4IADA 3UTOA 1KOAA 5EI6A 3SG9A 4G3CA 1U46A 3NPCA 3FI4A 3ALNA 2O64A 2E9VA 4BCIA 4EH6A 5JGBA 2C3LA 3EWHA 5LJJA 5HTCA 3UZTA 1J7UA 1R0PA 3UZPA 5CEMA 5D7AA 3ORPA 3RINA 4K11A 4XUFA 3P86A 4R7IA 5BUEA 4E1ZA 4O7LA 4Q5HA 2C5OA 3VHEA 2AUHA 3I5NA 1FQ1B 5FXSA 4DFXE 4APCA 4KBCA 3GB2A 3G6HA 1QMZA 3AC1A 3VS7A 3CGOA 4BDEA 3C4WA 4DLIA 4I0TA 4WIHA 3TNQB 3ERKA 1ZAOA 4W4VA 4C3FA 5TE0A 3M1SA 3MY5A 3L9LA 4S32A 4ZZOA 2YHVA 3FSFA 3PXQA 5HX6A 1ZXEA 3WF9A 4YNEA 1GOLA 4IX4A 3ZEPA 2IZRA 1FBNA 3TG1A 3DZQA 4FKTA 2YJSA 4FV4A 4HVSA 2V22A 4KB8A 5E90A 2WGJA 2XNEA 5K5NA 4QMTA 3GU8A 1XH6A 2XUUA 4MD7E 3W2QA 4N4SA 4FKRA 5AM7A 3IGGA 3KEXA 4USFA 5B2MA 4R7HA 4KIPA 4QMNA 4BL1A 4XP2A 3UBDA 1J1CA 4CRSA 4FZAB 4O7TA 2VV9A 4L7SA 3NS9A 3HEGA 3GQLA 4TWPA 3MIYA 3P08A 3LOKA 1R0EA 3QTZA 3AMYA 3E3BX 2ZV2A 4FOCA 3QYWA 2X6EA 4JG8A 4P4CA 3DAKA 4CXAA 3LHJA 4Z16A 4A07A 2I6LA 2H34A 3OW3A 5HIBA 4AFEA 2GMXA 1GZ8A 5EYDA 4XV9A 3CCNA 1P4OA 3FI8A 4GH2A 1A48A 3GOPA 4JX7A 4F6WA 1V0PA 3GUBA 3QTSA 1PXKA 4R3RA 3GT8A 2LAVA 3SRVB 5A6OA 4L3PA 1K9AA 3MESA 4I21A 4Q5EA 3GCQA 3HDMA 4EH9A 4C36A 4UY9A 4ITHA 5HO7A 3ORNA 4MBJA 3ZCLA 2YN8A 4GIIA 4GYGA 4O91A 4IX6A 3UNZA 2VNWA 2BDWA 4ACCA 4EHZA 2W1DA 3R28A 5M51A 4I6QA 2G2HA 4MBLA 3SDJA 2QHNA 2GHGA 4D0WA 4ZLZA 2RFEA 4U44A 5KKRB 3R63A 2C3IB 2WMTA 3D2KA 3P78A 4Z9LA 3PVUA 3VJOA 2WQNA 4O96A 5H8BA 5A9UA 1UVRA 1PXIA 2YIRA 3CE3A 2PU8A 4CZYB 5M44A 2VTAA 4FSRA 3D5XA 4FV8A 4GFMA 2WTKB 3MPMA 1FOTA 2WKMA 4PL3A 3I6WA 5EOLA 3VF9A 3FZ1A 5IDNA 5J1VA 3AGLA 4FTTA 4FGRA 3Q96A 3O0GA 4DH1A 5CXHA 2EUFB 3MY0A 3CEKA 2CLXA 5CEQA 1LPUA 4AOIA 4E7WA 2HXLA 3SQQA 2ITOA 4UMPA 4IJ9A 2YISA 1SVHA 3ULIA 4AN2A 2XBJA 3UPZA 3U87A 4ASEA 4KA3A 3UDBA 2RF9A 1AQ1A 2UZUE 2IVVA 2QR8A 4A4XA 5E9EA 5KX8A 4FYNA 3OXTA 4FZ7A 3NW6A 2GNFA 3FY2A 3MI9A 4DN5A 4NYEA 3QU0A 1MQ4A 3G33A 3NRMA 5A46A 3TV7A 2PE2A 5M09A 2BALA 3FV8A 2VTQA 4FUXA 4PTEA 5HE1A 4FEQA 4JNWA 1X8BA 3QQHA 4I4FA 4I24A 4MXYA 4KSPA 4FKQA 4NEUA 4IQ6A 3TT0A 5AIRA 4NWMA 3KXNA 3Q32A 2NNWB 3QC4A 4RJ8A 3Q9XA 1YHVA 5DE2A 2I0EA 4EZ7A 4ZLYA 2JDTA 4OTFA 2YACA 4B8MA 3RBWA 2JLDA 2XKEA 3RALA 2C0IA 2A19B 3OUKA 5B0XA 1WFCA 4PP7A 4P5ZA 4HGSA 5E7RA 5EI2A 4I5HA 3H30A 4IWQA 4QMXA 5HCZA 4YUQA 3R9OA 4FSMA 4O0RA 3UYTA 3HMPA 1PXPA 2YIYA 2OZAA 3PSCA 4NTTA 5FTQA 3QXOA 5L2WA 2C5YA 3NUUA 5KBRA 5AIKA 2GFCA 3DQXA 4XH6A 5J9ZA 2B4SB 1NA7A 4TWNA 4XV2A 5HKMA 2UW9A 3HMNA 3UE4A 3FZOA 4H3QA 3V5JA 4BCNA 1U54B 3GFWA 1OUYA 5JEBA 2UVZA 1YQJA 5IKWA 4NFNA 3ALOA 4XEYA 3Q5ZA 4IXPA 4A4OA 5CXZA 1YWVA 4DFBA 3IDCA 1TQPA 3AD4A 5A4LA 2UZTA 3AC2A 4P7EA 4FSQA 3VQUA 3R8ZA 3KF7A 1W83A 4UALA 2J90A 4BTJA 4LOQA 4XLVA 3OOGA 1UKIA 5F95A 3AC5A 5CASA 2F2CB 1FGKA 3D5WA 2PMIA 4MNEA 3BYMA 4XBRA 3Q6UA 5IQIA 1BMKA 5IQBA 3NW7A 2PPQA 1YOLA 3FMNA 1H1WA 2XIRA 5ETAA 4RX8A 2WMRA 5EK7A 2UW8A 3PDTA 2XEYA 2VX3A 3KXHA 3MS9A 3L8PA 3ZTXA 2H9VA 2QKWB 2QOIA 3SXRA 1H07A 3AC8A 1IA8A 3MFSA 2PHKA 4FG9A 4QQJA 4WD5A 3UVRA 4U97A 3CP9A 2ITQA 1SZMA 4OTIA 5CNOA 4XG2A 2LGCA 1XH7A 2OIDA 4C38A 5EG3A 4HYSA 3PXRA 2A1AB 3U8WA 1BLXA 2A2AA 3DXNA 5ACKA 4MD9E 1Q3DA 4QMVA 3QD3A 4IB1A 1OKVA 2UW5A 3PSDA 5EDPA 2B9IA 3ORXA 4IAFA 4UV0A 3NNVA 3F88A 1R1WA 2Z8CA 3I1AA 3JS2A 4OTHA 4BYJA 2O0UA 3IS5A 4YHTA 3FXXA 5DG5A 3C4ZA 4B7TA 3ANQA 4QPMA 3KXGA 3R8MA 4ANBA 2UZNA 4D4YA 2YM8A 4C0TA 2NRYA 4EUUA 2X0GA 1XO2B 2QOLA 4JQ8A 4TY1A 3EFLA 5HOAA 3SXSA 4H39A 4LOOA 4H05A 2OIBA 3AOXA 2UVYA 3RCDA 3RKBA 4EOQA 3I4BA 5DRBA 2WTVA 2GS6A 4J53A 3KRWA 4BDKA 5BNJA 4G3DA 4IHPA 5L8KA 4ZJIA 4RVTA 2GHLA 5KHXA 1L3RE 3O50A 5IH4A 1NY3A 3THBA 3DKCA 2CJMA 4YJQA 5LMKA 3TXOA 4IX5A 2OXDA 1S9JA 4PWNA 2PYWA 3VULA 3U6IA 4RIWB 3PWYA 2VGPA 3HP2A 2YDIA 3QA8A 4KRDA 5LCJA 4QRCA 4I5MA 2O2UA 3HV4A 2I0HA 4YJRA 2JKQA 3ORMA 3HRBA 4IMYA 4BCMA 1K2PA 4OTQA 3FMMA 1VEBA 3NSZA 2OH4A 2YWVA 4G5PA 1Q8YA 5EYKA 3PP1A 4MHAA 4KIKB 4U79A 3BHYA 3FI2A 3WE4A 1SM2A 2VZ6A 5AV1A 1XHAA 4FIFA 4AT4A 3FHRA 4H1MA 4F9YA 3HUBA 1LP4A 3NR9A 3BHVA 4UBAA 5AP7A 2IZUA 4HGTA 3TDWA 2B9FA 1FVTA 4D4SA 3ZEWA 3QTXA 5AP2A 2W06A 1QCFA 3L8XA 3ZM4A 3GXLA 4CV8A 5CF8A 2B52A 2C1AA 5CF5A 4R7BA 2P3GX 1REKA 3OWJA 3W2RA 2VWWA 2VTPA 2R3PA 4XOYA 2XJ0A 3DFAA 1KE6A 4H58A 4LL0A 2C0TA 1J7LA 4NZWB 4RZVA 2EXEA 1FINA 3VJNA 2E2BA 2QI8A 4BTMA 3V5QA 2BZJA 3ZO1A 4A7CA 2GSFA 4CKJA 3E5AA 3LQ8A 4L45A 3KQ7A 4UXQA 4O6EA 4A06A 5A4EA 4O27B 4RJ3A 3R21A 4C37A 2BPMA 3QTWA 3ORIA 5HNGA 4FKLA 1H1QA 3MB6A 3ZH8A 4W9XA 1PMNA 3HV5A 4MNFA 2OWBA 3IG7A 2JKMA 3QBNA 4FTIA 2UW7A 2B0QA 3ID6C 4E4LA 2G15A 4YZNA 1V1KA 2WOTA 2RFDA 4EUTA 4AGCA 4J98A 3NUSA 5BUJA 2I7QA 4XP3A 5HBEA 5BYYA 2W1FA 5C8MA 4CG9A 2Y6MA 4D2RA 3OROA 5LMAA 2R0IA 4JBQA 1CSNA 3RM7A 1YOMA 4L00A 4BBMA 4QTDA 3VQHA 4G6LA 4MVFA 5CSPA 4C3RA 4F99A 3HRCA 3F2NA 2UV2A 1VR2A 3Q04A 5EFQA 3FZSA 2R9SA 2OGVA 2YWPA 3OCSA 3A60A 4AZVA 1BUHA 5HGIA 2IZTA 3QQUA 1M17A 2ITXA 4IAYA 4DGOA 1PXOA 2R3LA 2W99B 4PDPA 4E20A 4X2KA 5JGAA 2A4LA 5CSVA 5KKRC 5CU3A 1YI6A 3COMA 1W0XC 4CT1A 4FT3A 4U80A 5CAOA 1HCKA 4RLLA 3DB6A 2OJGA 3TCPA 3CY3A 3CGFA 1UNGA 2JBPA 2OFVA 3ORKA 4RX9A 4XS2A 3TIYA 3VRYA 2P2HA 5AP5A 3TZ8A 2VD5A 3GCUA 2ZV9A 2IW6A 2AC3A 3QC9A 4MNEB 2CGUA 4YC8A 5CYIA 4G3FA 3I6UA 4QQ5A 4NFMA 2PVYA 3MN3A 4WRGA 4DHFA 3UIBA 3DTWA 3KK8A 4QQCA 3ZDIA 2QOHA 4R1VA 3POOA 5G1XA 5HE2A 4BWKA 5JQ5A 1CM8A 3C13A 1GZNA 5M4FA 3BHUA 1UKHA 2XJ1A 3GI3A 3KULB 5AWMA 5LVLA 4K9YA 3DNDA 2IPXA 3BI6A 3RVGA 2X6DA 3OWPA 4PDOA 5AP0A 2G2IA 3W2CA 2QG5A 2UZDA 3IW7A 5AAFA 2CNUA 1JBPE 3ZRKA 3Q3BA 4IFGA 3DXPA 1VJYA 4BDCA 5I3RA 5E8UA 1IAJA 3P1AA 4BBEA 4D4VA 3F5GA 4L68A 2JDRA 3BZ3A 1WBPA 4BDIA 4S33A 4D2SA 4FYOA 4HOKA 3FKNA 3F3TA 4GKIA 1A9UA 3R30A 4D4RA 2A27A 5M4IA 2R3FA 1LR4A 2AC5A 3G0EA 5AR3A 1Z5MA 4U0IA 4FC0A 4FK6A 3ORZA 3VUTA 3B8QA 1JPAA 4JOAA 4NW6A 2YERA 4RX5A 3S1HA 4YO4A 2GNGA 3JY9A 4I0RA 4JR7A 3DAEA 3ET7A 3MV5A 1M2PA 4JT3A 4MQ2A 4I6FA 3V04A 2QLUA 5C26A 3NUPA 3UVPA 5M07A 3KXXA 4UEUA 1OL5A 3UZRA 4IX3A 2V5QA 4IZ5A 2JC6A 2H96A 1E1VA 2VWZA 4FKPA 4FTKA 4ZSJA 4F64A 4FTCA 5T3QA 4NSTA 3QFVA 3VS1A 2RG5A 3N4TA 2RL5A 1Q8ZA 3RPSA 5DPVA 5E91A 2XYUA 4FZDB 5AJQA 4AX8A 4X6RA 3SLSA 4O0WA 4F09A 1O6KA 4Y95A 1OL2A 5L4QA 3WF8A 3E3PA 3ULZA 4DFYA 3AG9A 3W33A 1ZYLA 4J8NA 4X2NA 2J6MA 5CX9A 4NTSA 4XG9A 2O8YA 4CLJA 5IEVA 3H9RA 2C6EA 2QD9A 3VS6A 4EEVA 4GIHA 2BTSA 3QLGA 3OF0A 2ONLA 4M67A 4ZTHA 1MRYA 4ERWA 3PE1A 3PWDA 2C4GA 3ZDUA 2UZBA 1OIUA 5I4NA 4NCTA 4TYHA 4O2PA 2ZB1A 4TW9A 3OBJA 4J71A 3I81A 3EH9A 4RQKA 1YI4A 2XCKA 3BX5A 5L8LA 5CALA 3F82A 4OR5A 4WUAA 4EHEA 4G17A 1OI9A 3KU2A 4ZS0A 1SVGA 5KBQA 1MP8A 4QPAA 5K0KA 3VUKA 3I7CA 4R5YA 3IOPA 4L01A 2V7AA 1PXNA 2EB3A 2R64A 4FNZA 1PKDA 1R39A 4L7FA 3T8OA 2J0IA 5CEPA 4YGAA 2PVFA 4AAAA 5CU6A 5CENA 4RC2A 4DF3A 1H28A 2W4KA 2VWBA 2YIXA 1B39A 3NZ0A 2BRHA 2E9OA 4OLIA 2BIYA 4BKZA 1M7QA 2IO6A 4L43A 3HDNA 5HD4A 4LGDA 4O82A 4NJ3A 1U4DA 3DK3A 3DS6A 1ZOGA 3W10A 2NP8A 4S30A 4ANOA 2WEIA 4DINA 2CMWA 5IUIA 4I94A 4YHJA 5KUPA 3GP0A 5DEYA 3QUDA 5GJDA 4JXFA 3RJCA 4CNHA 4WBBB 2ITZA 4E93A 3LW0A 4P5QA 3A4PA 4O22A 5BMMA 4UB7A 4GFOA 3PXZA 2QO9A 4RA5A 4Z55A 3S00A 5FUTA 4RPVA 4CLIA 4FKWA 1QPDA 2DQ7X 4CKRA 3BQRA 5I9WA 4PTGA 5J87A 5BVDA 3ATTA 1WBSA 4TYJA 1DAWA 2CHLA 5GZ9A 3DXQA 2VN9A 4A9YA 1H08A 1WVYA 2QOFA 2VTSA 4RLKA 3GC9A 4BBFA 3LFFA 2BIKB 3U51A 5CAUA 4ACDA 3OY3A 1WBOA 3OG7A 4OW8A 3V6RA 3WOWA 4I23A 1H0WA 4BCOA 4FT0A 4QYFA 4L3LA 2BR1A 4K18A 5H2UA 4BCJA 4YSJA 1B6CB 1TQMA 1YDSE 3OD6X 3OUNB 2A0CX 4G6NA 4YLLA 4QMUA 3SKCA 4U42A 1YI3A 4EKLA 3MJ1A 4FX3A 5C03A 4EWQA 5DA3A 3PJCA 5J79A 3FZPA 3QL8A 1ZOHA 2CN5A 4OT6A 4OTPA 5ETIA 4DGNA 4H3PA 5CF4A 3AMBA 3AQVA 3C1XA 4K1BA 4AFJA 2VWXA 2W7XA 4YO6A 4AW5A 2BHEA 4QNAA 1JSUA 4QMOA 4RVKA 2XEZA 4BCQA 4YZCA 3BHHA 4AA4A 4JX3A 1BX6A 5H8EA 3QXPA 2RIOA 4YJOA 5A3XA 3LMIA 1IRKA 3D4QA 2GHMA 5HHWA 3Q53A 5E8VA 3ANRA 3ACJA 3MIAA 5HE3A 5E8XA 5HG9A 4F1OA 4FKIA 5JZJA 4ARKA 1JKSA 3CSVA 3WZKA 4E8AA 3OOMA 2R3RA 1L8TA 5LMBA 5L2QA 4C4GA 3EQHA 4FV7A 5F1ZA 4BB4A 4F9CA 2BFYA 3D2IA 4O7WA 3IGOA 4WT6A 5M53A 3BGZA 5BX0A 5CT7A 4IZYA 4PY1A 3DDQA 3QGYA 3N4VA 5AR7A 3UP7A 2YDKA 5H3QA 2PVLA 3KMMA 1Q24A 4FG8A 2WZJA 3PYYA 3EN6A 4BDDA 2H6DA 5AV4A 3DKOA 4I3ZA 3A8XA 4WNMA 5CT0A 3IECA 5D7VA 1KE5A 3TEIA 4ZTMA 1QL6A 3C0IA 3HUCA 3TUDA 1KE7A 3VBVA 1A06A 5M56A 4QO9A 2WMXA 2WTIA 3QQJA 4EH4A 4GU9A 3W32A 4WNPA 4M0ZA 5TO8A 3KRJA 4IIRA 4CGAA 4FEVA 2BRBA 4YBKA 4V04A 3LCSA 5EHOA 2BFXA 4FV6A 1KUTA 2Y9QA 3OT8A 3HLLA 3QRTA 2X4FA 5GNKA 3NW5A 4O7ZA 3ACKA 3RWPA 4OT5A 4O38A 4J96A 4M0YA 2ACXA 2YJRA 4EH3A 3E7OA 1ZZLA 4B0GA 3JVSA 4MF1A 2B55A 2W1ZA 3P7AA 4FKUA 4FOBA 3LMGA 5HD7A 3ZSGA 3QWJA 2J51A 5KCVA 4QD6A 2BZHB 4FTOA 4RRVA 4QQTA 3D7TA 3Q6WA 4L53A 1XH4A 4E4XA 2XK4A 3W55A 2ETKA 1JNKA 2WMUA 3L8VA 3RCJA 3D15A 3PLSA 3PPJA 4Y83A 5CNNA 4CVAA 1PRYA 4YJNA 2BZKB 4BZOA 1Q3WA 4GFGA 4R3CA 2J50A 5HLNA 4HZSA 3VS4A 1PW2A 3HP5A 3BV3A 5CZHA 3LMHA 4O7SA 1U54A 3OTVA 1NXKA 3IOKA 3QUPA 3T3UA 4IB5A 4PL4A 2YAAA 4ZIMA 4GUBA 5EH0A 4FTJA 5BMSA 4LFIA 3H9OA 2GTNA 4UYNA 4MF0A 3SG8A 1WBWA 2X9EA 1Y8GA 2F7EE 4UWCA 3PXYA 2ZV7A 3SGCA 2OJ9A 4D9TA 4FL3A 3NVKI 3A7FA 5AP6A 3D0EA 3OFMA 3QTQA 3PZEA 4JI9A 5JN2A 3AT2A 4K8AA 4X3FA 3LFDA 4HW7A 2XIKA 4C62A 5JGDA 4A9SA 2G9XA 2YM6A 4QMPA 3GNIB 3LM0A 4AF3A 4I5CA 3PA5A 3RAIA 1KV2A 3GCSA 3QD2B 2RG6A 4YZ9A 2WTKC 3C50A 5AV0A 3IW8A 1OKZA 1SVEA 3VN9A 5FP5A 3COIA 3Q52A 3RHXA 2QKRA 3Q4TA 5EM5A 3TKIA 4DE4A 4RWKA 2ZM1A 3D5UA 3R73A 4X6QC 3CIKA 3I0QA 3IQ7A 1J7IA 5K4JA 3R7UA 5D11A 5IH6A 4I20A 1YXUA 3HYHA 2FSMX 3LCDA 5IUGA 3OWLA 4UMTA 4FTLA 4L3JA 1QPEA 2XH5A 3EIDA 4EQCA 2P33A 4RIXA 2IVTA 2J0MB 3BWFA 1CDKA 4CV9A 2WAJA 4L67A 4HPUE 2XM9A 4TKSA 3CJFA 3VBQA 1T45A 2GS7A 5HO8A 4MXXA 4BYIA 3R0TA 3VW6A 1UNLA 4J97A 3SRVA 4DG3E 3Q2JA 1CTPE 4M14A 3DBQA 1FVVA 4XLIA 2HW7A 3DAJA 4FSYA 4R6VA 4WRSA 4YJTA 4DC2A 1GNGA 4NM3A 5IA0A 2QU5A 5HE0A 2XIXA 2ZVAA 3MVLA 5I9YA 2PZIA 3PFQA 4R1YA 3VW8A 4DGGA 3R71A 3F5XA 2IJMA 3UIUA 1BL7A 2C1BA 2IVUA 3QYZA 5TOZA 4FA2A 1RE8A 4X3FC 4ZZMA 5IMXA 1YHSA 2KTYA 3T9IA 1OIQA 2W1GA 2J5EA 3RAWA 5J7HA 2QQ7A 4YMJA 4JDKA 2P4IA 5BVFA 4K33A 2CKQA 3DJ6A 4V0GB 4YR8A 2G1TA 3DT1A 4BDAA 3BKBA 1LEZA 1YDTE 3FMLA 3F2AA 3ZZEA 5HTIA 3R00A 4EK6A 4DA5A 3K5VA 4JQ7A 3PPZA 4G5JA 4C2WA 4FT7A 3R7EA 1VYZA 1YXXA 4BRXA 4X2FA 3D94A 4Q9SA 2YCQA 3EKKA 3VO3A 3O71A 4CYJA 3WZUA 3PVBA 3SOCA 2X8EA 1JQHA 3R1SA 2Y8OA 4AOJA 1SNUA 4UN0C 2BAKA 2QO7A 5AUUA 2X7OA 2FB8A 1JSVA 2W96B 2Z7RA 4FODA 1ERKA 4I4EA 4X2GA 3ZU7A 4A9UA 3MDYA 2XKDA 5IQGA 2IWIA 2JGZA 2REIA 4EOLA 5EQYA 1PF8A 3ELJA 4O7YA 5HZNA 3DZOA 3QRKA 4C33A 4D1SA 2GNIA 2IG7A 5DOSA 2SRCA 2JBOA 2ZMCA 1J3HA 4EOIA 2R5TA 4RWIA 1JWHA 3V8TA 4YZDA 1ZY4A 4DCEA 4IZ7A 4OBPA 5DHJA 5GJFA 5JRSA 4JAJA 4EQMA 4RWJA 3LQ5A 4QMSA 3Q5IA 4CMOA 2PE0A 4C61A 2I40A 3DKFA 4NCTC 5I9UA 4OBQA 4O81A 3MFUA 4IE9A 4Q2AA 2R3MA 4LMUA 1ATPE 3TZ9A 4EOMA 5IQEA 4ZY4A 2W1EA 4AXAA 4DYMA 3LE6A 3OEFX 3REPA 5CI6A 3F3UA 4LRJA 1WZYA 3AC3A 1W7HA 2CGXA 5DR6A 5FWKK 5IF1A 4AGDA 3RPRA 3RPVA 1I09A 2XK3A 1BI8A 2Y6OA 4IWDA 4RJ7A 4E26A 4USEA 4BCKA 2XJ2A 4FV3A 4G2FA 2YLEA 5JFSA 3K54A 4AN3A 4PPAA 5DRDA 3EZRA 3MB7A 4Q9ZA 1XJDA 1OL1A 3GGFA 4N6YA 4PPCA 2QG7A 4DAWA 1IA9A 2FO0A 4D55A 2R7BA 5E1SA 3FC1X 5C8KA 2ONLC 4IEBA 4JRNA 4GEOA 1GZOA 3A7JA 3MA3A 4GVJA 4CTBA 1YXVA 2NPQA 3BE2A 1ZZ2A 4IANA 4BDFA 5F4NA 3W1FA 4TL0A 5DBXA 4ZZNA 3AT3A 3F9NA 4EORA 4G16A 4XRJA 3FYJX 3EFWA 2V0DA 4QMZA 1Q41A 1OB3A 3OT3A 2PMLX 4ZEGA 5FXRA 2EB2A 4D5HA 4AZTA 5IEYA 3DV3A 2PVMA 5D12A 3FC2A 2ZJWA 4O1OA 3LLTA 1K3AA 2J7TA 2BUJA 3O8PA 4GL9A 4BC6A 5KHWA 1WBNA 1H0VA 4V05A 3FEGA 2CCIA 2QCSA 4BN1A 2F7ZE 3EN9A 1DAYA 4QTCA 2JIIA 1PXJA 4FT5A 3ATSA 3PRIA 3PP0A 3GC0A 3DBFA 2CNVA 1URCA 3NAYA 5L6WL 3Q2MA 5EDRA 5BPYA 2WB8A 2VNYA 4C59A 3OHTA 5C8NA 4UX9A 2WQOA 3O7LB 2JFLA 2P55A 3ODYX 3EQGA 4JIKA 5CAQA 2HZ4A 2C6IA 4FL2A 3UPXA 4IVDA 5EKNA 4LYNA 4ALWA 4JBOA 4BTKA 3R2BA 4UMRA 4GK4A 2CKEA 4IAIA 2X7FA 1O6YA 1UU3A 2FSOX 3HKOA 4FK3A 4FZFB 1ZYJA 3EN4A 4RT7A 4U40A 4X2JA 4HVGA 4O0UA 1WCCA 4NM7A 3ZXTA 4JS8A 1P4FA 1OPJA 2UZEA 4O21A 5AUYA 3E92A 3FMDA 4RA4A 3L9PA 4MWIA 1QPJA 1KSWA 2R3HA 2YITA 3UVQA 3F7WA 3R7VA 3ROYA 4HVDA 4IAAA 2PVHA 3VUGA 2WIPA 5HORA 5HESA 3FAAA 4RIWA 4FVRA 2ESMA 4EJ7A 4V0GA 4UZHA 4DH8A 1XH5A 3U6HA 4ERKA 4ANQA 3GU4A 3C4FA 3FY0A 3SXFA 2PSQA 3BU6A 3PUPA 4ENYA 2CCHA 3OBGA 3EHAA 4C34A 4GVAA 5JMSA 4O7RA 4H1JA 1OBDA 3QWKA 2GCDA 3HRFA 3MPTA 4QMLA 4S31A 4DFNA 4RVLA 4EL9A 3JXWA 4M69A 4IM0A 3DOGA 4LI5A 3AD6A 1HOWA 1M2RA 2UW3A 2VO0A 3BCEA 2CKPA 3PY0A 4YZBA 3CD8A 3CTJA 3G5DA 4JG7A 4ZMEA 3MW1A 3CQWA 4XV3A 2IVSA 4LM5A 1F0QA 3BPRA 4FTMA 3ZRMA 3LQ3A 3UODA 1OZ1A 1BKXA 3E8CA 3D5VA 3HV7A 2WMWA 4Y5HA 4RZWA 4WSQA 4D0XA 5BVEA 3MY1A 2FH9A 2WHBA 4CFXA 2X4ZA 3R9RA 2OFUA 5FLFA 4BIEA 4FKGA 3FLWA 3COKA 5ICPA 4ZY5A 5A4QA 3EQCA 3QA0A 4EOKA 4PNKA 3LAUA 4ZTRA 1P14A 5E1EA 3II5A 3W18A 4ACHA 4AP7A 4HVHA 5LVPA 3W2PA 2C68A 3GVUA 4FGBA 5KMKA 3TUBA 4DT8A 3PE2A 2BMCA 4LRKA 4IVAA 2QOCA 1PYEA 3LJ2A 3OCGA 2JDVA 5FTOA 3FBVA 4EBVA 3BYOA 3I60A 1WBVA 3IPHA 3TL8A 3UOHA 4O0YA 2CLQA 5HU9A 3CC6A 3V01A 1P2AA 4CCBA 4EC8A 4FEWA 4N57A 2OW3A 3FQHA 1NVQA 4D5KA 4PF4A 1KE9A 4JDHA 5CEIA 4AW0A 3QQFA 2WTCA 4IJPA 2X39A 4KWPA 3N4UA 4EHVA 4XX9A 3VUIA 4F65A 2PZPA 3TNHA 4RG0A 4II5A 3UO6A 4O86A 2V7OA 4FV2A 2G2FA 4YZMA 3UC4A 4TPTA 4D9UA 4EWHA 5I5ZA 3KA0A 4HNIA 2Y4IB 3PRFA 4A4LA 4XV1A 2HZIA 2YABA 2QU6A 3QCSA 3MVJA 1UWHA 4RX7A 2V55A 5HO6A 3IDPA 3VS5A 1Q61A 3W8QA 4BI0A 2Z02A 5AR8A 5M55A 4FSNA 4CRLA 1OGUA 3ZM9A 2OG8A 3KRXA 4QP2A 4CEGA 4HVIA 2HCKA 3UNJA 3C4XA 4H36A 3TACA 4UWBA 4FEUA 2JD5A 4C02A 4EK8A 2PUPA 4ZTQA 4F9WA 1RDQE 2EWAA 4AGWA 3L8SA 3PIXA 2Y7JA 3Q4UA 3K2LA 3QRIA 5ETFA 5LVMA 2QHMA 5M06A 2OK1A 2YEXA 3FL4A 4E6CA 1U5QA 2X9FA 1OPKA 5IA1A 3ZLXA 3NYOA 4WG3A 3HA6A 3DU8A 3QRJA 2DWBA 3NDMA 5EW9A 4RSSA 2OZOA 3CTHA 4ZK5A 3W16A 5IDPA 1U59A 2WD1A 3PG3A 4W4WA 5AAEA 3RM6A 2UVXA 3UO4A 5L6OA 2QOBA 4TTHB 3U9CA 4EK5A 3DKGA 3HV3A 5TKDA 2OJJA 4XNEA 3TIZA 2ITNA 2QO2A 4TXCA 3KULA 2PL0A 4QMYA 3R1YA 3EQRA 1OIYA 2PUIA 1Y8YA 2CDZA 3LFBA 5D10A 1E1XA 4I6BA 4WNOA 3FQEA 4KINA 4P2KA 4FV9A 5ANDA 3LCOA 3BGPA 1DI9A 2WMQA 5DT4A 3I5ZA 3D14A 1OL6A 4YJSA 3PA4A 5AEPA 5DYJA 2HY0A 5CU4A 4AE6A 5BVNA 3PY1A 4M8TA 3C0GA 3BEGA 1ZYDA 2JIVA 4DFZE 4EH8A 2QOOA 3VVHA 4DG0E 3CPBA 4FIHA 1ZWSA 3LFQA 1U5RA 2XIZA 5LMKC 4QMWA 2QVSE 4ITJA 4ASXA 3I7BA 3DB8A 5DLSA 3CR0A 4B9DA 4NIFA 4ASZA 2PE1A 5JH6A 3H9FA 4BHZA 3MWUA 3R7YA 1VYWA 3QUEA 2QNJA 2C47A 4DEAA 2JDSA 2Y4IC 3KCKA 4CFWA 2X2KA 2QODA 3P9JA 3F69A 5DMZA 5CTPA 2VGOA 3GQIA 5CZIA 4B6LA 5AA8A 5DR2A 2GQRA 4FKSA 1G5SA 4X7QA 1JKKA 3UOLA 4BWPA 1APME 2QR7A 3OTUA 2F7XE 3UIXA 2XNNA 1OKWA 1YVJA 2OXYA 3QQLA 4GS6A 4M66A 5DWRA 3K5UA 3NVMB 3R04A 5C4LA 1OM1A 3OEZA 5GINE 5BYLA 5KMIA 2XIYA 5GIOE 5H8GA 3RAHA 3QCQA 3PIZA 3ENMA 4EH2A 4G6OA 4ONAA 3L1SA 4FVPA 3DGKA 4NW5A 2XRUA 3MA6A 3MFTA 4U7ZA 3OW4A 4JAIA 4NKAA 4QMMA 4FSWA 4JBPA 3OS3A 4RGJA 4QTBA 4NKSA 4FKOA 4F0GA 2BROA 5HICA 1ZRZA 2OO8X 4CQGA 4Z7GA 4RFZA 2X8IA 4UZDA 4ANNA 5M4CA 3RI1A 3P4KA 2OKRA 1ZARA 2QURA 2ERKA 3NWWA 4MXZA 4MX9A 3V8SA 5BVKA 1O9UA 2JKOA 2DUVA 2W0JA 3KC3A 4FKVA 4L9IA 4EYMA 4F1MA 4UMQA 5FD2A 3OY1A 3PZHA 5AUWA 4WOVA 3MVMA 4DH7A 3KF4A 3BLHA 2ZDTA 2ZM3A 1RJBA 3EFKA 5ANGA 3C0HA 3LPBA 3D83A 3FMHA 3VNTA 1JKLA 4LGHA 1GY3A 2GQSA 3WF6A 4USDA 3IKAA 3ZBXA 4CFNA 1XH8A 3AGMA 4XYFA 5C01A 4ZMFA 5CF6A 3E64A 3HZTA 2GDOA 3NYXA 4JG6A 4DGLC 4E3CA 3HAMA 3M11A 3GENA 4XRLA 2VWIA 3V3VA 3SA0A 5HQ0A 3IW4A 3JY0A 4U41A 3CJGA 5F94A 4TT7A 3FQSA 5DH3A 2HY81 4F7NA 4M97A 5EW3A 2B9HA 4X3JA 4IM3A 1IAHA 2Q0BA 4U8ZA 4J99A 5HVJA 2XRWA 4BI1A 4OTDA 2W17A 4C7TA 4YPDA 4G31A 2OICA 4DEDA 4DLJA 2KULA 2PVRA 3SW7A 4R3PA 4LG4A 3F3VA 3R7IA 2J5FA 4ANSA 4CZUA 2XF0A 5K3YA 2FVDA 2R3NA 4LGGA 2UZVA 2FYSA 5ACBC 1V0BA 5LVOA 4GCJA 3GU7A 4ZTSA 4CG8A 4FVQA 4UXLA 4XG6A 1RW8A 2O65A 3LFCA 3PIYA 3TV6A 4BIBA 1ZMUA 2YDJA 3S95A 1OKYA 4CCUA 1NT2A 3UMXA 4C2VA 3TDVA 3TTJA 1CKIA 1Z57A 4NM0A 4ANMA 2VTHA 4O0XA 5HEZA 4NM5A 3F66A 4AU8A 2PY3A 3SVVA 3F61A 2R2PA 5CY3A 2GU8A 3FLNC 5AR5A 2FSLX 2PVKA 3WF5A 1FMOE 1FPUA 2PZ5A 4HZRA 4I0SA 2QOQA 5TT7A 4AT3A 2QLQA 5IZFA 4IB0A 4ORKA 4FIGA 2ZM4A 3LFSA 3MTLA 5AV3A 3VUDA 1ZYCA 3NCGA 5EW8A 2VX0A 2BRGA 4YURA 4IVCA 3ZZWA 2OJFE 3G90X 4F7SA 1REJA 4AZWA 2BHHA 2BZIB 1YKRA 5EYCA 3SOAA 3TI1A 2XNGA 3WI6A 4Z7HA 2XS0A 4XMOA 4L52A 2AYPA 5J95A 3BGQA 4AZEA 3KN5A 3DDPA 4HCUA 4MXAA 4E5BA 2ETMA 4HJOA 5CU0A 5GZ8A 3EQIA 5DFPA 3V8WA 4EOPA 4JIAA 4CTCA 4ZLOA 3BWJA 4BTFA 2IN6A 4DEHA 5J9LA 5FXQA 2JAVA 2BILB 1CKPA 5CAPA 2C0OA 2R7IA 3D7ZA 4FV0A 3KGAA 4GT3A 5FM3A 4FUYA 3PJ2A 5JK3A 5CU2A 4EOOA 2X2MA 4UWYA 2BDJA 4RIOA 4PP9A 3ZUVA 3DK6A 3VBWA 3MH1A 3OXIA 3LJ0A 3PVGA 2OU7A 4LUDA 3V5PA 4ANLA 3VRZA 4C4EA 3GC8A 1EH4A 1H24A 3KY2A 2GS2A 3CD3A 3IDBA 3R22A 4FV1A 5E8YA 3ZRLA 3HMMA 4R78A 3PJ1A 4IC8A 3R8PA 3WYYA 3DJ5A 4EJNA 2WQBA 2ZB0A 4KSQA 2HAKA 4KRCA 5AX3A 3ZOSA 4MCVA 4BY9E 4KIQA 5AP4A 3RGFA 4WHZA 3KXMA 2YCFA 4ZXTA 4C58A 2ITTA 4KBAA 5HG7A 3R9NA 5JFWA 4WKQA 3WBLA 1PMEA 5BVWA 2HENA 3KVWA 1H26A 4IWPA 3VUMA 4ACMA 3RHKA 5LVNA 3ETAA 3MBLA 4JDIA 2CPKE 2YM3A 4HGLA 4BWXA 2WNTA 3KMWA 4D1XA 2WQMA 2F49A 2UZOA 5CLPA 4FEXA 3LXNA 1PMVA 1Q62A 3QTRA 2Z7SA 4JLCA 4QYGA 3UQFA 3FMKA 1YDRE 3DLSA 1STCE 2HZ0A 4IB3A 3R9DA 3RAKA 2WOUA 2WO6A 1PY5A 2BAJA 3FXZA 3JR1A 4GK2A 3AC4A 4HGEA 4FT9A 3NUYA 2OF4A 1GZKA 4GRBA 1AD5A 4BVUA 2XMYA 4PMSA 4DGMA 4ZS4A 4KS7A 3ZUUA 2XZSA 2YAKA 4EK3A 3F2RA 1MQBA 4J1RA 5F20A 3IO7A 5HBHA 5I3OA 1NVRA 2CGVA 3Q9WA 2XNOA 4LUEA 4BDHA 1OECA 3TJDA 3F5UA 4IZAA 4BHNA 1OBGA 4ZY6A 1UWJA 3R8LA 4ZSGA 3FWQA 4U81A 3R8VA 2PTKA 4TYEA 4NK9A 4NU1A 3EYGA 5CVGA 3TJCA 4X0MA 4K77A 2XB7A 1YHWA 2XK7A 2YA9A 5HLWA 3VAPA 2WMAA 3RMFA 4X3FB 4AW1A 4W8DA 2NRUA 4QYHA 3CPCA 4C35A 4MYGA 5TF9A 2VU3A 4Y72A 4YBJA 3FL5A 5F9EA 1Q97A 1XH9A 2UW0A 4D2VA 3RP9A 4YLJA 3QX4A 3F5PA 1JOWB 1GAGA 1IEPA 3E8EA 3NNUA 1H1PA 4HCVA 4RIYB 2W1CA 5I0BA 2B9JA 4F9AA 3CY2A 2FA2A 5CWZA 3R01A 3P0MA 2O3PA 3SAYA 4XG4A 5ANKA 4XBUA 3C5UA 4PX6A 3V5WA 4C4FA 1VZOA 3HMIA 1SYKA 1Y57A 3HL7A 5J8IA 4N70A 2EXMA 3UGCA 2WPAA 1XKKA 4O2ZA 2O63A 5AUZA 4DEEA 4F7JA 4LV8A 4EYJA 2EXCX 2V62A 4YJVA 5A4TA 4CFFA 4Y73A 3JVRA 5D1JA 3FLSA 2WELA 2PUNA 2YCRA 1PXMA 4DEIA 3UQCA 3V5LA 2R4BA 3ZLSA 1URWA 4JL9A 3NIZA 3SX9A 5C9CA 4YHFA 3LFNA 5HLPA 1H01A 3QCXA 4GT4A 2GPHA 3OVVA 4WG5A 5HG5A 4EC9A 5L3AA 4FL1A 2XKCA 4I92A 3NGAA 2OF2A 2X7GA 3KKVA 3HX4A 2VUWA 2F57A 2ITYA 3FE3A 3MJ2A 4DBXA 4RFYA 4O84A 5HCXA 2YFXA 3ZYAA 2HWPA 4AW2A 2XKFA 4IFCA 3UG2A 3FUPA 4FV5A 1TVOA 2X8DA 4JBVA 2JDOA 4MQ1A 4RJ6A 5IA2A 4RQVA 1Q8UA 5IA5A 3CLYA 3UC3A 3WF7A 3EFJA 3A62A 4M7IA 1MUOA 4EI4A 1E9HA 4ACGA 3AD5A 1WBTA 5K4IA 3O96A 4BDJA 1AGWA 2JITA 3P5KA 4K6ZA 3ZC5A 4ZTLA 3UO5A 1M52A 4W9WA 5IH5A 3FJQE 3ZBFA 4EKKA 2YIWA 3O8UA 4GJ2A 5JRQA 4YNOA 4G3GA 2WEVA 3A7IA 4ITIA 3NUNA 4GSBA 4IVBA 4PV0A 2RKUA 1LUFA 2PWLA 4LV5A 4O0TA 2PMNX 3VBTA 2PUUA 5CI7A 4F6UA 4OAVB 5E4HA 3EL8A 3ODZX 4G9RA 2UUEA 1W98A 4IDTA 2OBJA 2C5NA 4QNYA 4HYIA 4R8QA 3ZFMA 4D2WA 3ZSHA 3FLYA 2J0LA 2PVJA 3KB7A 1OITA 2BKKA 4CT2A 3WZEA 1IG1A 1GIJA 3ZLWA 3A7HA 3CKWA
chains in the Genus database with same CATH superfamily
5LQFA 3RNIA 4R77A 2R3KA 4ENXA 1NVSA 4LRMA 4YP8A 1OIRA 5C1QB 5G6VA 1Q8WA 4TYHB 3LKMA 4F0FA 4BJJB 1IASA 4EK4A 4HNFA 5DVRA 4BDGA 3RNYA 4I6HA 1FGIA 2HXQA 5AR2A 4I5PA 3VIDA 4CD0A 4F0IA 2WXVA 4KS8A 4RMZA 4BCPA 4CZTA 1BL6A 5FBOA 4U45A 4W8EA 1H00A 3O8TA 5LXMA 3MTFA 3BU5A 4FSZA 3CS9A 4TRLA 2B1PA 4AUAA 4FTRA 3L9NA 4FI1A 3U4UA 2ITWA 2VTLA 2X81A 2VWVA 4BIDA 4O0SA 4D28A 4BY9E 3FLQA 3NIEA 5KO1A 3KRLA 1FMKA 3IONA 5HCYA 5D9HA 3HECA 5E92A 5L6PA 5HI2A 4O83A 3JUHA 2VTMA 2RSVA 5JKGA 3QX2A 4QP7A 3ZXZA 4C3PA 2OSCA 4O4FA 4CYIA 1UU8A 4O4DA 2ZAZA 4M15A 5DNRA 3VBXA 1YXSA 4FSTA 5ANOA 2W4JA 4QMQA 5CSHA 3QD4A 2R3JA 3NLBA 1W84A 2PVNA 1KWPA 4QTAA 1PXLA 4IW0A 4NJDA 4F63A 2WU7A 3AT4A 4QYEA 2R3QA 3CQEA 3R83A 1GIIA 3FKLA 5FDXA 5IMEA 2Z2WA 3FPMA 4PMMA 4MAOA 3SV0A 4M3QA 5M4UA 2BAQA 5JFVA 2C6KA 2IZSA 4Y5QA 5JT2A 2ETRA 3U4WA 4FZ6A 3A2CA 4I93A 5KE0A 2XAMA 4EQUA 3KMUA 4J95A 4WSYA 3GEQA 4QP3A 2WU6A 3O7LD 1DM2A 4Y85A 4AS0A 4NL0A 4AZFA 4FE2A 4U3YA 4I6LA 4CFMA 4KUJA 3EQPA 2VO6A 2VX1A 4YJPA 5FP6A 3WARA 1W82A 3LVPA 3FHIA 3F6XA 1KOBA 3NAXA 4PMPA 5CANA 2Q83A 1MRVA 3QKMA 4CMUA 3MH2A 5HIDA 5M57A 3H10A 4ZJJA 3W2OA 2XNBA 3WZDA 4DEGA 3FXWA 5LARA 2B7AA 3VBYA 3QHWA 1MRUA 3H0YA 3DQWA 3F3ZA 2C5XA 4KBKA 4WNKA 1ZMWA 2HYYA 4MXCA 1ST4A 4GW8A 5CQUA 5HX8A 1NW1A 2YZLA 1OMWA 3FLZA 5IPJA 2DYLA 4PNIA 4TNBA 4DT9A 5EYMA 3VUHA 4O1PA 3G0FA 3RPYA 3QZHA 4GK3A 4I41A 4BZDA 4TYIA 2VO3A 4XCUA 3BE9A 3E88A 3GCVA 4GYIA 1WMKA 2XBAA 3HGKA 2WTWA 4AT5A 4G1WA 5KMMA 4TNDA 5IISA 2XCHA 4S34A 4F4PA 2BRNA 4IBMA 5M08A 3BQCA 1H8FA 3CKXA 3ZUTA 2Y0AA 5CVHA 4BZNA 3ZSIA 4C8BA 4GG5A 4QTEA 1YRPA 2HWOA 3R1NA 4OGRA 3ENHA 4E4MA 4FIJA 4H3BA 4IC7A 3DY7A 3JPVA 5IEXA 4OTRA 3IW5A 1S9IA 3C7QA 3VONA 2VAGA 3C9WA 4KIKA 3QQGA 4G9CA 2ZFYA 4BF2A 4AZSA 4FTNA 4M68A 5AFVA 4FIEA 5I9XA 2ZV8A 1OVEA 3SC1A 2A98A 3BV2A 1T46A 4B4LA 3BELA 3WZJA 4QT1A 4DBNA 3P7CA 4CKIA 1IR3A 3RWQA 4QDEA 3Q4CA 3UYSA 3E62A 2WMSA 3MH0A 4HCTA 5ETCA 1P5EA 4ZOGA 4O4EA 3WILA 3PUFC 2CSNA 4BICA 4WO5A 1H4LA 3E93A 3TWJA 5C27A 4AWIA 3R8UA 4ZSAA 2ZOQA 4ID7A 2YIQA 3W8LA 4WBOA 1H25A 3NFFB 4F9BA 3KK9A 4CMTA 5IQHA 1PYXA 5AUVA 2XVDA 2I0YA 4YU2A 4JDJA 4QP8A 5C4KA 3C4EA 3RK7A 2VTRA 5AUTA 3LJ1A 5FEQA 5KMOA 4FNWA 1PKGA 3COHA 5CSXA 3Q4ZA 2W4OA 4C4IA 5K0XA 5L2TA 3PPKA 2CNQA 3LLAA 3NYVA 3BLRA 4QP9A 4FNXA 4W4YA 4BKJA 5AAGA 2YM7A 5J7BA 3OCBA 4O6LA 3DBEA 4WA9A 4FSUA 4LMNA 1R78A 3I79A 4AOTA 2YZAA 3K3JA 4MEDA 4C57A 5GZAA 4CFUA 3HAVA 4G34A 3PY3A 4JQEA 3ORLA 4FICA 3U6JA 3GBZA 2J2IB 3OWKA 2HK5A 4FF8A 4DEBA 2JKKA 3RZBA 3GU6A 4XG3A 4DH3A 3NFGB 2UZLA 5ANIA 1UA2A 4FR4A 4Z3VA 4YJUA 5IA4A 4O0VA 2OH0E 5FG8A 5A6NA 3KXZA 3M42A 3NX8A 2BCJA 2JAMA 2Z7QA 5DEWA 3VC4A 5J1WA 2UW4A 4D1ZA 4O7NA 2GNLA 3BYVA 3LFAA 3S2PA 2B54A 3NYNA 2VTOA 5J5TA 2P2IA 2OXXA 1Y6BA 4TN6A 4O7VA 1JAMA 5IG1A 5K5XA 4E73A 4YTFA 4YSMA 4FKJA 2YCSA 4S2ZA 4N6ZA 2PZRA 3BYSA 3PXFA 2HW6A 3A4OX 3MSSA 4C4JA 3QZGA 3OXZA 4DITA 5TR6A 4LV7A 1UV5A 4I22A 3T3VA 2RFSA 4E6DA 3NUAA 2R3IA 3ZLYA 5BUIA 1PMUA 3PJ8A 3FDNA 3FYKX 4UYAA 3VS2A 3C51A 5E8ZA 3F3WA 3BBTB 5HNBA 5LCKA 2XYNA 4C4HA 3VF8A 4UMUA 4Y46A 2C6MA 4ZTNA 2W05A 4BFMA 3FPQA 5HNIX 4DCAA 2XK8A 4YTCA 5IQAA 2GNJA 2H8HA 2CN8A 3KRRA 3HNGA 3E87A 5DR9A 3R9HA 1M14A 2WTDA 4IWOA 5KMNA 5FEEA 4DFUA 3MFRA 4RIXB 4B99A 5CSWA 2R0UA 1YXTA 4YPSA 4WUNA 4BI2A 5JFXA 3DCVA 4O4CA 4FRFA 2VTIA 5ITAA 4AQCA 3RK5A 3TNIA 4MD8E 4MXOA 3PJ3A 4NH1A 2OIQA 2OLCA 5EM7A 4LOPA 4PL5A 3RPOA 2HZNA 1OL7A 1H1RA 2HOGA 3EYHA 5EM8A 4KKEA 3LCKA 4GG7A 2PK9A 5EM6A 4D2PA 4M13A 4RBLA 3T9TA 4U9AA 3OC1A 5B2LA 1Q4LA 3QGWA 3BBWA 3CTQA 4YLKA 4DG2E 3BLQA 3NUXA 4TZRA 2W5AA 3QKKA 3MH3A 3RZFA 3ZO2A 5IQCA 1ZY5A 3KL8A 3ORTA 3UIMA 1Q8TA 5DT0A 5A4CA 4RJ5A 4E5WA 5FTGA 3GU5A 5EQPA 4IACA 2G01A 2W9ZB 3R1QA 5KNJA 2VWUA 3TTIA 3HVCA 4RWLA 3ZO3A 5BYZA 3TM0A 4L44A 2PULA 4AN9A 3UOJA 3K3IA 4B8LA 4XJ0A 2GNHA 4KKGA 1G8SA 5AM6A 1DS5A 1ND4A 3EL7A 2XARA 5KZIA 5DI1A 3V5TA 2QOKA 3N51A 5CEKA 1G8AA 2F9GA 3HV6A 3BYUA 2B53A 3CBLA 4TYGA 4XP0A 4HYHA 5AX9A 3ZFYA 1G3NA 2C6LA 5B2KA 3V6SA 4EH5A 4ASDA 4FIIA 5DN3A 2RFNA 3ITZA 4RFMA 4LL5A 4PDSA 1QPCA 2Z60A 2J4ZA 3EKNA 4JRVA 3VWAA 3GOKA 4U5JA 5FBNC 5HVKA 4I1ZA 3WIKA 3I0OA 5E8WA 2XNMA 3JYAA 3PVWA 4MTAA 3HA8A 3BEAA 2WMBA 5CQWA 1WVWA 1Y91A 2AQXA 3WYXA 2C6DA 5EHLA 3BHTA 1M7NA 3FMJA 5FRIA 1XWSA 4L8MA 4FTAA 3MPAA 4PMTA 4EZ3A 2JIUA 4LQMA 3P79A 3W2SA 3EZVA 2FUMA 2PMOX 3UP2A 4OTWA 4KAOA 1ZMVA 4APPA 3A7GA 4ALUA 1O6LA 2BDFA 3EN7A 5HG8A 3NEWA 4P90A 5CEOA 4GKHA 2UZWE 2Z7LA 4MUQA 3QCYA 4E6AA 4QOXA 3KN6A 4GMYA 2YM4A 4RC4A 4BGHA 4CQEA 1R3CA 3S3IA 1GIHA 4EZ5A 4NUSA 2VRXA 3LFEA 5ANEA 5KMLA 3H4JA 4E4NA 4KKHA 2E9NA 4L46A 3KVXA 4K2RA 3LCTA 4HYUA 4XG8A 5JSMA 2WIHA 4Y8DA 4ZP5A 1YOJA 1OUKA 3UJGA 4BGQA 2C3JA 3FSKA 4RVMA 4ZAUA 2XA4A 2WTJA 3CQUA 2XM8A 3QF9A 5B7VA 3KFAA 3EOCA 5EKOA 4JJRA 1I44A 5LOHA 3BIZA 4KD1A 2E9PA 3AMAA 5FGKA 5DT3A 3G9LX 5KZ0A 1XQZA 4WG4A 3HMOA 5IUHA 4KABA 4OAUC 4IAZA 2WMVA 4W4XA 3O23A 4RIYA 3VHKA 3ZHPC 2BVAA 2VO7A 1Q5KA 4IH8A 4FTQA 3U9NA 5CS6A 5IQFA 4OBOA 2C6TA 3GC7A 2C6OA 3QZFA 5A14A 1YW2A 4XOZA 1JKTA 4AA0A 1F3MC 4MWHA 4NIFB 5E8SA 5LWNA 5GIPE 2DS1A 2FGIA 3QD0A 1ZLTA 5I9ZA 3B2TA 3OMVA 3UOKA 4PRJA 1JSTA 2IW9A 2X1NA 2I0VA 3G51A 1XR1A 3DLZA 4GT5A 4FMQA 4E6QA 3EQDA 4JVGA 3OP5A 3O2MA 3PTGA 1ZOEA 4TWOA 4PDYA 3LM5A 4GUEA 3F7ZA 4NT4A 4PPBA 5AP1A 4BCHA 2UW6A 2OI4X 3QRUA 4JR3A 1PHKA 3LZBA 5BQ0A 3QAME 5L8JA 2GQGA 4E5AX 3MYGA 4EOJA 2XK6A 5FQDC 3QTUA 4U3ZA 3A99A 4DTKA 3V51A 4F08A 3DK7A 3TZ7A 5KMJA 3U55A 4MK0A 3PXKA 3WIGA 2BKZA 2JFMA 4IDVA 3OCTA 3VS0A 2ITUA 5EHYA 2GTMA 1ZYSA 4L6QA 1DI8A 5AMNA 4F6SA 1H1SA 3D9VA 3R02A 1Z9XA 3U54A 4DH5A 4QP6A 3AXWA 1UU9A 5ANJA 5BVOA 3ZS5A 2JEDA 4QYYA 1BYGA 3FI3A 3UQGA 3ZO4A 3DJ7A 4XG7A 2CGWA 3SD0A 2Y4PA 1CMKE 2RGPA 2QONA 5T6KA 5FEDA 3FZRA 4TWCA 4R5SA 1HCLA 4G3EA 2W5HA 3DA6A 3KCFA 3QZIA 4F7LA 1CKJA 2XNPA 5EI8A 2OJIA 2C3KA 1RQQA 4U43A 4D2TA 3UNKA 4EOSA 3E7VA 1G8JA 4AGUA 4FNYA 3KREA 3A61A 3G2FA 2FSTX 3OZ6A 3QALE 4LDTA 2C30A 5IQDA 1J1BA 3M2WA 3PSBA 5HBJA 1M2QA 4X21A 5E8TA 3MVHA 3IW6A 3QKLA 4HPTE 3L9MA 2P0CA 3SW4A 5K9IA 3R7OA 2CKOA 3NNXA 5HVYA 1UNHA 1XBBA 2XK9A 3MGYA 4BKYA 3BRBA 3CXWA 3G6GA 3PLAE 4BCGA 5IA3A 1TQIA 5JQ8A 5DGZA 3UG1A 3TN8A 1GJOA 1YWNA 2HELA 4RC3A 2EVAA 2NO3A 3ZMMA 3VS3A 3QHRA 3POZA 3P7BA 4J7BA 4J8MA 4RJ4A 5AA9A 3DFCB 5AR4A 3A8WA 4FG7A 2XP2A 4BDBA 3EMGA 3NCZA 5FDPA 1SNXA 1TKIA 2J9MA 2EU9A 2E9UA 4MH7A 4PQNA 4AACA 2I1MA 4BCFA 4OTGA 3TZMA 3G9NA 2C69A 5AV2A 3GFEA 3SHEA 4U6RA 4XHKB 4OUCA 1Y6AA 2ZDUA 3TKUA 1J91A 2ERZE 2X2LA 1WVXA 3NNWA 5I9VA 3DNEA 5AP3A 2ITVA 4PTCA 4QPSA 3R2YA 1BI7A 5CAVA 4MBIA 3QLFA 5EDQA 3RTPA 3E8NA 2BTRA 2Q0NA 3R6XA 4KNBA 3DBCA 5GJGA 3RK9A 3TKHA 2YLFA 5LWMA 2R3OA 2YM5A 4AG8A 4IAKA 5JZNA 3C4CA 3FZTA 5L2IA 1JLUE 5CVFA 1JVPP 4N0SA 2WQEA 3LXPA 3TNPC 2QC6A 3QTIA 5DIAA 4A9RA 2GFSA 1F5QA 4K0YA 3B8RA 4FBXA 2J0KA 4L42A 2BRMA 4ALVA 5AUXA 5J5SA 4FTUA 2R3GA 3PA3A 3UMWA 3ZC6A 3C5IA 1YWRA 4YC3A 3LXKA 2W5BA 5EQEA 4J52A 3TUCA 2F2UA 3EN5A 5A54A 2O5KA 3FKOA 3NMUF 3DPKA 4IM2A 3PFYA 4F1TA 4ZSLA 5HTBA 3Q9YA 1OPLA 3H3CA 4KIOA 4A9TA 4YTHA 3EQBA 2W9FB 3LXLA 4GV1A 3EB0A 5AADA 3QQKA 1V0OA 1B38A 1SMHA 3ZFXA 3B2WA 2VTNA 5D41A 2HIWA 4QP1A 5L2SA 2IEWA 2ZMDA 4GJ3A 3TV4A 3G15A 3GCPA 4V01A 3S4QA 1Q99A 4ZJVA 1XBAA 3EJ1A 4YTIA 4MKCA 3R7GA 2J0JA 3P23A 3IK3A 4M12A 5GHVA 2VWYA 1W8CA 4AE9A 2W1IA 2PZYA 4M69B 1H27A 3O51A 3E63A 4EH7A 5HU3A 1XBCA 3PG1A 2VTTA 2F4JA 4EONA 3Q9ZA 4QP4A 2C5VA 2WFYA 3H0ZA 4CFVA 3DTCA 3N9XA 5H9BA 4D58A 2OZAB 4AA5A 3LIJA 5EOBA 4ZSEA 3ROCA 3WE8A 3BU3A 5J9YA 2ZYBA 4DFLA 2IW8A 4CSVA 4DTAA 1KE8A 4GU6A 1LEWA 2W1HA 4PUZA 3ZONA 5IU2A 4JMQA 4BGGA 2VTJA 1UU7A 4BR3A 1PJKA 5HIEA 5FM2A 2ITPA 3S0OA 3D7TB 3E8DA 3TNWA 4F70A 5T68A 1WAKA 4M84A 3EQFA 4YC6A 4DTBA 1KV1A 4EHGA 3O17A 3Q60A 3FMEA 4EBWA 1FVRA 3DBDA 4IADA 3UTOA 1KOAA 5EI6A 3SG9A 4G3CA 1U46A 3NPCA 3FI4A 3ALNA 2O64A 2E9VA 4BCIA 4EH6A 5JGBA 2C3LA 3EWHA 5LJJA 5HTCA 3UZTA 1J7UA 1R0PA 3UZPA 5CEMA 5D7AA 3ORPA 3RINA 4K11A 4XUFA 3P86A 4R7IA 5BUEA 4E1ZA 4O7LA 4Q5HA 2C5OA 3VHEA 2AUHA 3I5NA 1FQ1B 5FXSA 4DFXE 4APCA 4KBCA 3GB2A 3G6HA 1QMZA 3AC1A 3VS7A 3CGOA 4BDEA 3C4WA 4DLIA 4I0TA 4WIHA 3TNQB 3ERKA 1ZAOA 4W4VA 4C3FA 5TE0A 3M1SA 3MY5A 3L9LA 4S32A 4ZZOA 2YHVA 3FSFA 3PXQA 5HX6A 1ZXEA 3WF9A 4YNEA 1GOLA 4IX4A 3ZEPA 2IZRA 1FBNA 3TG1A 3DZQA 4FKTA 2YJSA 4FV4A 4HVSA 2V22A 4KB8A 5E90A 2WGJA 2XNEA 5K5NA 4QMTA 3ML1A 3GU8A 1XH6A 2XUUA 4MD7E 3W2QA 4N4SA 4FKRA 5AM7A 3IGGA 3KEXA 4USFA 5B2MA 4R7HA 4KIPA 4QMNA 4BL1A 4XP2A 3UBDA 1J1CA 4CRSA 4FZAB 4O7TA 2VV9A 4L7SA 3NS9A 3HEGA 3GQLA 4TWPA 3MIYA 3P08A 3LOKA 1R0EA 3QTZA 3AMYA 3E3BX 2ZV2A 4FOCA 3QYWA 2X6EA 4JG8A 4P4CA 3DAKA 4CXAA 3LHJA 4Z16A 4A07A 2I6LA 2H34A 3OW3A 5HIBA 4AFEA 2GMXA 1GZ8A 5EYDA 4XV9A 3CCNA 1P4OA 3FI8A 4GH2A 1A48A 3GOPA 4JX7A 4F6WA 1VLRA 1V0PA 3GUBA 3QTSA 1PXKA 4R3RA 3GT8A 2LAVA 3SRVB 5A6OA 4L3PA 1K9AA 3MESA 4I21A 4Q5EA 3GCQA 3HDMA 4EH9A 4C36A 4UY9A 4ITHA 5HO7A 3ORNA 4MBJA 3ZCLA 2YN8A 4GIIA 4GYGA 4O91A 4IX6A 3UNZA 2VNWA 2BDWA 4ACCA 4EHZA 2W1DA 3R28A 5M51A 4I6QA 2G2HA 4MBLA 3SDJA 2QHNA 2GHGA 4D0WA 4ZLZA 2RFEA 4U44A 5KKRB 3R63A 2C3IB 2WMTA 3D2KA 3P78A 4Z9LA 3PVUA 3VJOA 2WQNA 4O96A 5H8BA 5A9UA 1UVRA 1PXIA 2YIRA 3CE3A 2PU8A 4CZYB 5M44A 2VTAA 4FSRA 3D5XA 4FV8A 4GFMA 2WTKB 3MPMA 1FOTA 2WKMA 4PL3A 3I6WA 5EOLA 3VF9A 3FZ1A 5IDNA 5J1VA 3AGLA 4FTTA 4FGRA 3Q96A 3O0GA 4DH1A 5CXHA 2EUFB 3MY0A 3CEKA 2CLXA 5CEQA 1LPUA 4AOIA 4E7WA 3AKLA 2HXLA 3SQQA 2ITOA 4UMPA 4IJ9A 2YISA 1SVHA 3ULIA 4AN2A 2XBJA 3UPZA 3U87A 4ASEA 4KA3A 3UDBA 2RF9A 1AQ1A 2UZUE 2IVVA 2QR8A 4A4XA 5E9EA 5KX8A 4FYNA 3OXTA 4FZ7A 3NW6A 2GNFA 3FY2A 3MI9A 4DN5A 4NYEA 3QU0A 1MQ4A 3G33A 3NRMA 5A46A 3TV7A 2PE2A 5M09A 2BALA 3FV8A 2VTQA 4FUXA 4PTEA 5HE1A 4FEQA 4JNWA 1X8BA 3QQHA 4I4FA 4I24A 4DHJA 4MXYA 4KSPA 4FKQA 4NEUA 4IQ6A 3TT0A 5AIRA 4NWMA 3KXNA 3Q32A 2NNWB 3QC4A 4RJ8A 3Q9XA 1YHVA 5DE2A 2I0EA 4EZ7A 4ZLYA 2JDTA 4OTFA 2YACA 4B8MA 3RBWA 2JLDA 2XKEA 3RALA 2C0IA 2A19B 3W0RA 3OUKA 5B0XA 1WFCA 4PP7A 4P5ZA 4HGSA 5E7RA 5EI2A 4I5HA 3H30A 4IWQA 4QMXA 5HCZA 4YUQA 3R9OA 4FSMA 4O0RA 3UYTA 3HMPA 1PXPA 2YIYA 2OZAA 3PSCA 4NTTA 5FTQA 3QXOA 5L2WA 2C5YA 3NUUA 5KBRA 5AIKA 2GFCA 3DQXA 4XH6A 5J9ZA 2B4SB 1NA7A 4TWNA 4XV2A 4AXEA 5HKMA 2UW9A 3HMNA 3UE4A 3FZOA 4H3QA 3V5JA 4BCNA 1U54B 3GFWA 1OUYA 5JEBA 2UVZA 1YQJA 5IKWA 4NFNA 3ALOA 4XEYA 3Q5ZA 4IXPA 4A4OA 5CXZA 1YWVA 4DFBA 3IDCA 1TQPA 3AD4A 5A4LA 2UZTA 3AC2A 4P7EA 4FSQA 3VQUA 3R8ZA 3KF7A 1W83A 4UALA 2J90A 4BTJA 4LOQA 4XLVA 3OOGA 1UKIA 5F95A 3AC5A 5CASA 2F2CB 1FGKA 3D5WA 2PMIA 4MNEA 3BYMA 4XBRA 3Q6UA 5IQIA 1BMKA 5IQBA 3NW7A 2PPQA 1YOLA 3FMNA 1H1WA 2XIRA 5ETAA 4RX8A 2WMRA 5EK7A 2UW8A 3PDTA 2XEYA 2VX3A 3KXHA 3MS9A 3L8PA 3ZTXA 2H9VA 2QKWB 2QOIA 3SXRA 1H07A 3AC8A 1IA8A 3MFSA 2PHKA 4FG9A 4QQJA 4WD5A 3UVRA 4U97A 3CP9A 2ITQA 1SZMA 4OTIA 5CNOA 4XG2A 2LGCA 1XH7A 2OIDA 4C38A 5EG3A 4HYSA 3PXRA 2A1AB 4AAYA 3U8WA 1BLXA 2A2AA 3DXNA 5ACKA 4MD9E 1Q3DA 4QMVA 3QD3A 4IB1A 1OKVA 2UW5A 3PSDA 5EDPA 2B9IA 3ORXA 4IAFA 4UV0A 3NNVA 3F88A 1R1WA 2Z8CA 3I1AA 3JS2A 4OTHA 4BYJA 2O0UA 3IS5A 4YHTA 3FXXA 5DG5A 3C4ZA 4B7TA 3ANQA 4QPMA 3KXGA 3R8MA 4ANBA 2UZNA 4D4YA 2YM8A 4C0TA 2NRYA 4EUUA 2X0GA 1XO2B 2QOLA 4JQ8A 4TY1A 3EFLA 5HOAA 3SXSA 4H39A 4LOOA 4H05A 2OIBA 3AOXA 2UVYA 3RCDA 3RKBA 4EOQA 3I4BA 5DRBA 2WTVA 2GS6A 4J53A 3KRWA 4BDKA 5BNJA 4G3DA 4IHPA 5L8KA 3KIOC 4ZJIA 4RVTA 2GHLA 5KHXA 1L3RE 3O50A 5IH4A 1NY3A 3THBA 3DKCA 2CJMA 4YJQA 5LMKA 3TXOA 4IX5A 2OXDA 1S9JA 4PWNA 2PYWA 3VULA 3U6IA 4RIWB 3PWYA 2VGPA 3HP2A 2YDIA 3QA8A 4KRDA 5LCJA 4QRCA 4I5MA 2O2UA 5BV3A 3HV4A 2I0HA 4YJRA 2JKQA 3ORMA 3HRBA 4IMYA 4BCMA 1K2PA 4OTQA 3FMMA 1VEBA 3NSZA 2OH4A 2YWVA 4G5PA 1Q8YA 5EYKA 3PP1A 4MHAA 4KIKB 4U79A 3BHYA 3FI2A 3WE4A 1SM2A 2VZ6A 5AV1A 1XHAA 4FIFA 4AT4A 3FHRA 4H1MA 4F9YA 3HUBA 1LP4A 3NR9A 3BHVA 4UBAA 5AP7A 2IZUA 4HGTA 3TDWA 2B9FA 1FVTA 4D4SA 3ZEWA 3QTXA 5AP2A 2W06A 1QCFA 3L8XA 3ZM4A 3GXLA 4CV8A 5CF8A 2B52A 2C1AA 5CF5A 4R7BA 2P3GX 1REKA 3OWJA 3W2RA 2VWWA 2VTPA 2R3PA 4XOYA 2XJ0A 4DDIA 3DFAA 1KE6A 4H58A 4LL0A 2C0TA 1J7LA 4NZWB 4RZVA 2EXEA 1FINA 3VJNA 2E2BA 2QI8A 4BTMA 3V5QA 2BZJA 3ZO1A 4A7CA 2GSFA 4CKJA 3E5AA 3LQ8A 4L45A 3KQ7A 4UXQA 4O6EA 4A06A 5A4EA 4O27B 4RJ3A 3R21A 4C37A 2BPMA 3QTWA 3ORIA 5HNGA 4FKLA 1H1QA 3MB6A 3ZH8A 4W9XA 1PMNA 3HV5A 4MNFA 2OWBA 3IG7A 2JKMA 3QBNA 4FTIA 2UW7A 2B0QA 3ID6C 4E4LA 2G15A 4YZNA 1V1KA 2WOTA 2RFDA 4EUTA 4AGCA 4J98A 3NUSA 5BUJA 2I7QA 4XP3A 5HBEA 5BYYA 2W1FA 5C8MA 4CG9A 2Y6MA 4D2RA 3OROA 5LMAA 2R0IA 4JBQA 1CSNA 3RM7A 1YOMA 4L00A 4BBMA 4QTDA 3VQHA 4G6LA 4MVFA 5CSPA 4C3RA 4F99A 3HRCA 3F2NA 2UV2A 1VR2A 3Q04A 5EFQA 3FZSA 2R9SA 2OGVA 2YWPA 3OCSA 3A60A 4AZVA 1BUHA 5HGIA 2IZTA 3QQUA 1M17A 3BL7A 4AQKA 2ITXA 4IAYA 4DGOA 1PXOA 2R3LA 2W99B 4PDPA 4E20A 4X2KA 5JGAA 2A4LA 5CSVA 5KKRC 5CU3A 1YI6A 3COMA 1W0XC 4CT1A 4FT3A 4U80A 5CAOA 1HCKA 4RLLA 3DB6A 2OJGA 3TCPA 3CY3A 3CGFA 1UNGA 2JBPA 2OFVA 3ORKA 4RX9A 4XS2A 3TIYA 3VRYA 2P2HA 5AP5A 3TZ8A 2VD5A 3GCUA 2ZV9A 2IW6A 3UDSA 2AC3A 3QC9A 4MNEB 2CGUA 4YC8A 5CYIA 4G3FA 3I6UA 4QQ5A 4NFMA 2PVYA 3MN3A 4WRGA 4DHFA 3UIBA 3DTWA 3KK8A 4QQCA 3ZDIA 2QOHA 4R1VA 3POOA 5G1XA 5HE2A 4BWKA 5JQ5A 1CM8A 3C13A 1GZNA 5M4FA 3BHUA 1UKHA 2XJ1A 3GI3A 3KULB 5AWMA 5LVLA 4K9YA 3DNDA 2IPXA 3BI6A 3RVGA 2X6DA 3OWPA 4PDOA 5AP0A 2G2IA 3W2CA 3TYKA 2QG5A 2UZDA 3IW7A 5AAFA 2CNUA 1JBPE 3ZRKA 3Q3BA 4IFGA 3DXPA 1VJYA 4BDCA 5I3RA 5E8UA 1IAJA 3P1AA 4BBEA 4D4VA 3F5GA 4L68A 2JDRA 3BZ3A 1WBPA 4BDIA 4S33A 4D2SA 4FYOA 4HOKA 3FKNA 3F3TA 4GKIA 1A9UA 3R30A 4D4RA 2A27A 5M4IA 2R3FA 1LR4A 2AC5A 3G0EA 3UDZA 5AR3A 1Z5MA 4U0IA 4FC0A 4FK6A 3ORZA 3VUTA 3B8QA 1JPAA 4JOAA 4NW6A 2YERA 4RX5A 3S1HA 4YO4A 2GNGA 3JY9A 4I0RA 4JR7A 3DAEA 3ET7A 3MV5A 1M2PA 4JT3A 4MQ2A 4I6FA 3V04A 2QLUA 5C26A 2X0QA 3NUPA 3UVPA 3KXXA 5M07A 4UEUA 1OL5A 3UZRA