1Q4LA

Gsk-3 beta complexed with inhibitor i-5
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
352
structure length
342
Chain Sequence
SKVTTVVATPGQGPDRPQEVSYTDTKVIGNGSFGVVYQAKLCDSGELVAIKKVLQDKRFKNRELQIMRKLDHCNIVRLRYFFYSSGDEVYLNLVLDYVPETVYRVARHYSRAKQTLPVIYVKLYMYQLFRSLAYIHSFGICHRDIKPQNLLLDPDTAVLKLCDFGSAKQLVRGEPNVSYICSRYYRAPELIFGATDYTSSIDVWSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQIREMNFPQIKAHPWTKVFRPRTPPEAIALCSRLLEYTPTARLTPLEACAHSFFDELRDPNVKLPNGRDTPALFNFTTQELSSNPPLATILIPPHARIQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords GLYCOGEN SYNTHASE KINASE-3 BETA
publication title Structural Characterization of the Gsk-3Beta Active Site Using Selective and Non-selective ATP-Mimetic Inhibitors
pubmed doi rcsb
source organism Homo sapiens
total genus 99
structure length 342
sequence length 352
chains with identical sequence B
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2003-08-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 1q4lA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 1q4lA01
5LQFA 4IQ6A 1YOJA 2QOBA 2OK1A 4DTKA 4L7SA 5M51A 3SOCA 5GZ8A 2X8EA 3RTPA 3CSVA 4DTAA 2G15A 4D4VA 3L9LA 4GKIA 3UG1A 3MW1A 3RPYA 4PV0A 4E3CA 4K8AA 2ZMCA 4MD8E 3I1AA 3Q6WA 4K6ZA 1G5SA 4RLLA 3QQLA 1FGKA 1OKVA 1OUKA 4BCNA 4D28A 1PYEA 4CTBA 3SV0A 4I41A 5IA0A 5TO8A 4CD0A 4E6AA 1GIHA 4CFWA 3UOHA 2CKQA 4PDYA 2OJJA 2VTTA 3F2NA 3SW7A 2O65A 2JDVA 2W1FA 5FP6A 2W1ZA 3LJ1A 4C61A 3NPCA 5EW9A 3LXLA 4GEOA 4EH4A 2PU8A 3AG9A 3OWKA 4RLKA 2I1MA 4TYHA 1E9HA 3EFKA 2VWVA 3G0FA 2B53A 2YA9A 3DA6A 3SX9A 4FTTA 3ZRKA 5CT0A 5DOSA 4WHZA 4EJNA 3I7CA 5K4IA 2IG7A 1A9UA 4G31A 2PZYA 4FT7A 1H1PA 2OFUA 3KK8A 4XNEA 5L8JA 1Q8UA 1Q8YA 2E9NA 3QD2B 4FT0A 2ZMDA 1MP8A 2XB7A 1JAMA 3ORLA 4UY9A 2BRBA 5HE3A 5HCYA 5AAFA 4M69A 4IB1A 4B8MA 4DH8A 3MGYA 2JC6A 3MWUA 5D1JA 2GQRA 3QZHA 4ZZOA 3HMMA 3PJ1A 5HG5A 3PXZA 2P2HA 1BUHA 1WBTA 4FKSA 5J1WA 4UYNA 3QAME 5EH0A 2KULA 4LV8A 4FV5A 4V0GB 4ANNA 5HG7A 4DH7A 4TWPA 4QQTA 5J5TA 2V55A 2IW8A 3RWPA 4NUSA 1KE9A 4RX7A 4IFCA 3EHAA 4RVKA 4WRGA 5HOAA 5JRQA 4TL0A 2GCDA 4KA3A 4MXYA 3FPQA 5HE1A 5HNBA 4IWQA 4GYIA 3OFMA 2XNOA 2H6DA 4EONA 2VTMA 3CXWA 2BDWA 4EC9A 3UQCA 3C4WA 3NCZA 4RZVA 4WOVA 3N4UA 4QMLA 3VVHA 1U54A 3MFUA 2C5YA 3R28A 4KIKA 3F6XA 3LQ5A 1FVRA 2OG8A 4EWHA 2WIPA 4HOKA 4GUEA 5LVOA 2C5OA 2WEIA 4FGBA 2OZAA 2C68A 4USDA 2PVLA 5CLPA 5LXMA 2CN5A 3F5XA 4U0IA 2FYSA 5LJJA 3JYAA 4FEXA 4FKGA 4KIKB 3ZDUA 4YZ9A 1E1VA 3TEIA 4ASXA 3O0GA 1EH4A 4Y5HA 4R7IA 2VO6A 2W06A 4RWJA 4FYOA 5M44A 3BX5A 2YLFA 3JUHA 1OI9A 3KF7A 5M55A 3UQGA 2HZIA 3D2KA 5HO7A 4YU2A 3ZM9A 3ZXTA 4FEUA 2J0KA 3PSBA 2OZAB 2QO7A 4CEGA 4RFMA 3TIYA 4AG8A 2BKZA 1XH9A 2HCKA 4FTJA 4YP8A 4EOJA 4NM5A 4TW9A 5D41A 4LRMA 3P08A 2R3OA 5IQIA 3ZCLA 4HYUA 3U4WA 5DR9A 4F9CA 3W2PA 4NW6A 3ACJA 3KKVA 2WTWA 4FICA 5L2IA 3KMMA 4FVQA 4FEQA 4R77A 2VD5A 4RIXB 1JOWB 2UW5A 3SDJA 3VJOA 4OTIA 4QTCA 4BGQA 5EYDA 1PMUA 4P5QA 4W4VA 4OW8A 3NVMB 4N57A 4A4OA 4RVTA 1QL6A 3R9HA 4EH8A 3Q4UA 1H1WA 3IS5A 3CCNA 3R7YA 3PXKA 4I5HA 4Z16A 2QOHA 2RKUA 4H1MA 4M68A 4FOBA 4O0WA 5DIAA 3RAHA 5L6PA 4IWDA 3HV4A 2HYYA 3QC9A 4LOOA 2W1IA 3N4TA 3CQEA 5M4FA 4FVPA 1NA7A 4GVJA 2WMXA 2FVDA 4L67A 4RC4A 2BROA 4O86A 3A7FA 3PLSA 4L6QA 4LG4A 4M84A 5BNJA 3KREA 3M2WA 4FSYA 4P2KA 2HXLA 3B8QA 1DS5A 2QOCA 1YWVA 4DG3E 3FJQE 1BL6A 2FSOX 1B38A 2YERA 4I6HA 5AV1A 3TZ7A 5LMKC 4R3RA 3C4ZA 1Y6AA 3A8WA 2GNIA 4GT5A 5CU3A 4CMTA 3WI6A 4KRDA 4ZTLA 3SKCA 3V8SA 4KIOA 4QYYA 2G9XA 2P33A 2OH0E 4JBPA 4Q5HA 3ZSIA 2IVTA 4M97A 3AMYA 4AXAA 4XOYA 5A4CA 3EQGA 4EH7A 3OT8A 1JWHA 3PJ8A 3V51A 2RFSA 5CSXA 3OP5A 2HIWA 4FL2A 5LVMA 3R1YA 4RT7A 1P5EA 1PKDA 4ZXTA 5HESA 5IG1A 4KBKA 2WTJA 4B99A 4GMYA 3TM0A 4MBIA 2VAGA 3HV3A 3KULB 5EYMA 4EOMA 1J1BA 4L42A 4XMOA 2ACXA 4NKSA 3D7TB 5JT2A 1VZOA 4IDTA 5D7AA 1IR3A 5HD4A 4BCJA 1UV5A 2R3LA 2UZWE 3UDBA 5CEQA 2ERKA 3GCSA 1J91A 2Z02A 3PZHA 2UZUE 3K2LA 4BIDA 2GDOA 4PDOA 5ETFA 5IA1A 3MH2A 1VR2A 2Y6MA 3HRCA 3P0MA 4FV3A 4ZLYA 5GIOE 4FV8A 4E5WA 1T46A 2B4SB 3GUBA 2HZNA 3UZPA 5DMZA 5HLWA 2Y7JA 2PVJA 4HCTA 5KMLA 2XNBA 5CNNA 3BHUA 1OBGA 3NMUF 3O2MA 3CKXA 4D1SA 4XP0A 3JVRA 2R3GA 3LFQA 5L6OA 4EH2A 4F1OA 5I9YA 4AS0A 3FI8A 3VBXA 3O7LB 2B1PA 4N0SA 3CJGA 2VNYA 4UV0A 4CTCA 4RPVA 4OBPA 3RK7A 1XR1A 4Y95A 5KCVA 3VBTA 4A9SA 5EQEA 4YSJA 4M14A 2GFCA 3UVPA 4FSUA 5D10A 2V62A 4M12A 1P4FA 4FKRA 5J95A 1S9JA 1TKIA 3W16A 3BYUA 4FK3A 2QI8A 3UO6A 4JRNA 1PXMA 3KRJA 4AT3A 1KUTA 2GS7A 1YDTE 4NM3A 3E3PA 1AGWA 2XA4A 4D55A 1W0XC 3O51A 4JI9A 3D5VA 4IVDA 4PX6A 4YPSA 4BYIA 4F7LA 4MXXA 4EI4A 2PZRA 3PXRA 4LMUA 5AUVA 4BF2A 3HP5A 4CMUA 5TKDA 1CM8A 4GG5A 4IC7A 5A4EA 1BI7A 3V8WA 4C4JA 2RFDA 2VRXA 4J53A 2CGXA 2O64A 3BKBA 4XV9A 4DYMA 5BX0A 5HVKA 2W0JA 3EN6A 5BVWA 3KRLA 4F9AA 3LXNA 3QRUA 2XBAA 4IE9A 3CLYA 4CFUA 4MQ1A 2C6MA 2OFVA 4F63A 1RW8A 1MRVA 4A9YA 3EZVA 3QQHA 3C50A 5IUGA 5C9CA 1W7HA 2CKPA 4UWBA 5AR7A 4BVUA 3IQ7A 2R3KA 1ERKA 2QKWB 3PJCA 4R7HA 3Q9YA 3ZFMA 3PIZA 5HBJA 5JFXA 1JVPP 2B52A 4Y8DA 2Y6OA 4J1RA 4D5KA 3R01A 3NW7A 4C57A 3NNWA 2CSNA 3SG8A 4WO5A 2EWAA 4PRJA 3GCQA 3WILA 3QRTA 3MVLA 1PXKA 2R3IA 5EW3A 3VAPA 5JGDA 4UMQA 4O22A 3IDPA 4YSMA 5FEQA 4U80A 4F6SA 5L2WA 5IQDA 2GFSA 2JAMA 2ZDUA 5FQDC 4EYMA 3TACA 4YJRA 2BIKB 1YXUA 3O8PA 2OH4A 3ZO2A 3VUIA 5IQGA 4O7ZA 1KE6A 3SXSA 4LL0A 3LFDA 3VS7A 3FL4A 2GPHA 3IGGA 2RF9A 2BUJA 3B2TA 3QHWA 4JG7A 1MUOA 4NM0A 1Q8TA 4QOXA 4HVSA 4QMTA 3C0HA 3CS9A 3V04A 4EQMA 3LQ3A 5IEVA 2GSFA 2VWXA 5IH4A 2LGCA 3NZ0A 4KSPA 3OD6X 3GI3A 4RX5A 2B9FA 4EH9A 3NW6A 2ZYBA 3WIKA 5CAPA 4CV8A 4OGRA 3RK5A 4HPTE 4KNBA 3KEXA 4RWLA 3EQFA 4CRLA 4O7RA 4PPCA 3G9NA 3QA8A 2IZUA 3MN3A 4F0IA 3ZEWA 3C51A 3NUSA 4TWOA 4HVGA 3NYVA 4XG4A 5CSVA 1IRKA 4ANLA 1UU3A 4AN2A 4CKIA 2XBJA 4ANMA 4FEWA 3QKMA 5AIKA 4RJ4A 2X6DA 4WBBB 4C2WA 2C1BA 2HW7A 4X2NA 4F9YA 1FOTA 4JVGA 3UO4A 2WQNA 3R8ZA 3PE1A 4JAIA 4I94A 2A27A 3I5NA 4TT7A 1QMZA 3DB6A 4FKPA 3R7OA 4NEUA 4MXAA 3WIGA 2ZJWA 1JQHA 3WZUA 4C2VA 3DBFA 3S00A 4LRJA 3GFEA 1YI4A 3FUPA 3RMFA 1YXTA 3BBTB 4WA9A 5A3XA 3R22A 4IZYA 4IMYA 3ZM4A 3TDWA 1M7NA 4Q2AA 4IFGA 3NUXA 4P90A 2XJ1A 2AYPA 2VTOA 2XKEA 4PP9A 3QX2A 1MRYA 4CKJA 3Q53A 3OTUA 4IJ9A 4XEYA 4U8ZA 4AGDA 1MQBA 4ZLOA 4IB3A 3ZDIA 3VBYA 4Z7GA 3S1HA 3ZLWA 4IAIA 4GU9A 3DXQA 4O21A 4ORKA 4H05A 4W9XA 4MWHA 1G3NA 2GTMA 4F6UA 4LL5A 4MF0A 2BRHA 4S2ZA 4D2VA 4QMSA 2IO6A 4EOLA 2NNWB 3WF8A 4G5JA 1J7IA 2I0YA 4LOQA 3ZFXA 1K3AA 4CFMA 3NUAA 5BVFA 4PQNA 5M4IA 3FLZA 1WBNA 4K0YA 5HO6A 3FC2A 4IAKA 2Z8CA 4EEVA 1OPKA 3A99A 5CT7A 3FZPA 3PIYA 5AP5A 3R9DA 2EB2A 4EKKA 4MTAA 1X8BA 4FV9A 5F94A 5JRSA 4ZJIA 3U87A 3UNKA 2R3PA 3FZRA 3VS5A 2HW6A 3NIZA 4FZ6A 3N51A 4NK9A 4PL3A 4M13A 5EDPA 4DT8A 1JNKA 2VWIA 4BB4A 1RE8A 2GQGA 4G5PA 4V01A 2SRCA 4YGAA 2RFNA 3K5UA 4IC8A 4KD1A 3ZEPA 4HYHA 4PWNA 5AM6A 3FXWA 3KN6A 3BZ3A 4ZOGA 4E7WA 2PPQA 3I0QA 3QUDA 5HBHA 5AA8A 1UWJA 1BX6A 4WUNA 3OUKA 4ALWA 4BTMA 4YJUA 3P78A 1OIYA 1NVRA 2J4ZA 4O38A 2WHBA 3QTZA 1VEBA 3P1AA 5HI2A 5JZJA 2X7OA 2BRMA 1PW2A 1GZOA 2YEXA 4JDHA 4M3QA 3U6HA 3NVKI 3GC0A 5E92A 4FSNA 4BHZA 1HCKA 1IASA 2Y4IB 5HE2A 5IUIA 4LRKA 3P7BA 5FGKA 5HU3A 4FTRA 3KXZA 4C3FA 3E92A 3ENMA 2O0UA 2Y0AA 1ND4A 3PA3A 1YKRA 5CI7A 3UPXA 3ERKA 4FT3A 1YOLA 2PL0A 5D12A 1XBBA 5ANJA 3WF5A 1PMNA 3PIXA 4IX3A 4ZJVA 1M52A 4B8LA 5JEBA 4JRVA 2XM9A 2GHMA 4FSWA 4BZDA 3D94A 3G51A 5K9IA 2ZV2A 4FF8A 4DGNA 2QOKA 3LCSA 3O71A 4DG0E 4QTEA 5EOLA 4E8AA 3COIA 4C37A 4YMJA 4ZY4A 3QTXA 1UNHA 2PVFA 3QXOA 4JX3A 4DEDA 5HX6A 5K0XA 2CLXA 3C9WA 2QG5A 3BIZA 2F7EE 4IANA 5LOHA 5E8ZA 2C5NA 2WO6A 4IB5A 1U59A 2ITUA 3NNVA 1VJYA 3E8CA 3KU2A 2XP2A 4FC0A 3FHIA 4UWCA 2VX3A 3DJ5A 4RVLA 3FQEA 4AQCA 1GIIA 3KMWA 3PWYA 3SW4A 4FIIA 4TZRA 5CQWA 2XK4A 5T68A 2R2PA 3BGQA 2C5XA 1OB3A 3GXLA 4GL9A 4USEA 5A6OA 3OXTA 1M14A 4J96A 5J7HA 5IQFA 2XM8A 3R2BA 3HGKA 2B7AA 2BFXA 1UVRA 2NPQA 5CI6A 4CYJA 4UMTA 3TKHA 3UGCA 4FYNA 2Z7RA 3FMHA 4I20A 4RC2A 4JBQA 3DXPA 4ZS4A 5BUJA 4A9RA 1Q41A 2PUUA 3KXHA 3TUCA 3TZ9A 3W2CA 4U44A 4C4FA 2EXMA 3OEZA 4LUEA 1Q99A 4CYIA 4YPDA 3QCXA 1YDSE 5DEWA 4D58A 5CASA 2OJGA 4WRSA 4BDFA 5M4UA 4MBJA 5EM8A 4ZZNA 4O27B 3WZJA 5AUTA 3OOGA 5H8BA 5CEPA 4EOKA 3FEGA 4IHPA 5AMNA 5AUUA 3P23A 3NNXA 4OR5A 4XLIA 2BHHA 2JBOA 4AGWA 5CAQA 2WTKB 3G6GA 3E8EA 3KB7A 3SXRA 1ZYDA 2B9IA 4PMPA 5BYLA 3LPBA 4LYNA 3RZBA 3TNWA 2PTKA 4ZJJA 4O2PA 1NVQA 3COHA 3K54A 4K2RA 2WB8A 3KCFA 3SA0A 3PVUA 4FTOA 3F82A 1H08A 1XWSA 5I9WA 1IG1A 3IW6A 5KBQA 2FA2A 5C27A 4FGRA 5HU9A 3HRFA 3DNEA 4XUFA 2BRGA 2UZOA 4CQEA 3LIJA 4IACA 3MPTA 3UNJA 2CHLA 4BCFA 4RC3A 2FSTX 4L00A 3EN7A 3GU4A 2J0JA 5E1SA 2B9JA 1DM2A 5BVOA 2QO9A 4ZAUA 2YJSA 3L9MA 5HIDA 3DLSA 4QTDA 5EK7A 4ZTMA 4FG9A 3QA0A 1U4DA 3F5GA 3R8VA 3FLQA 5FM2A 2RSVA 1OIUA 3PY1A 3F2RA 2JKQA 4FTLA 5C8MA 3VF9A 2W7XA 2J5EA 3FPMA 3LHJA 4AN3A 3DBCA 2B55A 3FZTA 1Q8ZA 4U42A 5AR3A 5HIBA 2UZNA 4L3JA 1PKGA 5D7VA 5IA3A 4Q9SA 2GNLA 4GK4A 4D2WA 4O7WA 3LFAA 2PZPA 5G6VA 5DN3A 3FY2A 3FV8A 4C02A 2W1HA 1M2PA 2E9PA 3FLNC 5JFWA 4C34A 2X1NA 2PZ5A 3O7LD 2ZB0A 5GJDA 2XEYA 5LWNA 1V0OA 1OKWA 1V1KA 3QZGA 4HGTA 4N6YA 3OXIA 3GC8A 2PVRA 4U97A 3A8XA 1WBPA 2HZ4A 2XK8A 3BU3A 3G6HA 3R8PA 4L46A 3VC4A 3ENHA 2ITPA 2WNTA 5DHJA 3F3ZA 4U40A 3RVGA 2UW7A 4NM7A 3A7JA 4EHEA 2WTVA 5EW8A 3HEGA 3RM6A 5L4QA 2J6MA 4GSBA 3KC3A 3WOWA 5CF8A 1BYGA 3LFSA 4MH7A 4PL5A 3UO5A 4FTAA 5HZNA 3VBWA 3OCGA 1BLXA 4RQVA 1OITA 5IEXA 4OTRA 3MPAA 1OIQA 3HA6A 5A6NA 4EHGA 2QD9A 2O5KA 3CC6A 3OOMA 5AR5A 5E8XA 2C4GA 5EM5A 5KKRB 1SVEA 4XG7A 3QALE 5AP0A 4MAOA 3ZYAA 3PVWA 3AC2A 4BTJA 3I60A 1KE8A 2PMLX 4XG8A 3DY7A 1NW1A 4HNFA 5CXZA 3T3UA 2Q83A 4BDAA 3LFFA 5FXSA 3AOXA 3NUPA 4ACCA 4O2ZA 4MEDA 5KMOA 3NSZA 3CKWA 3DNDA 5JQ5A 3GCUA 1FVTA 5KMNA 2XYUA 3CD3A 3U6IA 4FE2A 3WYXA 4DCAA 5DNRA 3MA6A 3CEKA 1XKKA 3GENA 5F9EA 5K4JA 3A7GA 3DKCA 3EN4A 4IX6A 2CMWA 3IO7A 3R9NA 1KE5A 3NYXA 4QMUA 4L43A 4WIHA 4AUAA 3QGYA 3CTJA 4NJDA 4IJPA 2R3MA 3LLAA 5C8NA 3HV7A 5H3QA 3HDNA 5ANIA 2QQ7A 4LM5A 2YCFA 3O50A 3U9CA 3S3IA 2OZOA 2AUHA 3QXPA 3R7EA 3ORTA 2OBJA 2XJ0A 3RZFA 2BAKA 3HX4A 3D2IA 3O17A 3BEAA 5I3RA 1OMWA 2BHEA 3FKNA 5AX3A 4NW5A 3CGOA 3BU5A 3ZO1A 5KX8A 2OO8X 4RIOA 4FTMA 3CQWA 4H1JA 3QCSA 4DH5A 1H01A 5EFQA 1XJDA 4JDKA 4GH2A 2JITA 4RX9A 1FMOE 4QNYA 4QQ5A 2BZIB 2ERZE 2JKOA 3PLAE 1XO2B 2DYLA 3TNIA 4TKSA 3R7UA 4BWXA 4I6FA 2ONLA 3DTCA 3F69A 3FZSA 2ZVAA 3CJFA 4AT4A 4H3BA 4BWKA 3OXZA 4BHNA 4LMNA 2WFYA 3TKIA 2Z7SA 1B39A 3KXGA 3UC3A 3ZUTA 3VJNA 2UZTA 2YIQA 3DB8A 3L8XA 4FKJA 2YLEA 4B9DA 4BI1A 3Q2MA 4H3QA 4ZZMA 5DE2A 3ID6C 3OS3A 2F2UA 5C1QB 4FMQA 5HCZA 4F09A 3PJ3A 4DA5A 3VW8A 4E6DA 2BFYA 2PE2A 5GNKA 5B0XA 4D2TA 1PY5A 1U46A 4UWYA 2C0OA 3THBA 3E87A 3BWJA 3FKOA 3H4JA 4TYHB 5GZ9A 3ZUVA 5HICA 2OJFE 3FSFA 3WE8A 4KSQA 5D9HA 4NTSA 4NJ3A 4DEEA 3TUBA 2HENA 4FUYA 3TNPC 4DFLA 3KF4A 4M7IA 5CENA 2XNNA 2XZSA 3D7ZA 5HNGA 2HOGA 3WZKA 3MA3A 1LEWA 4MYGA 3D5UA 4F70A 3PPZA 4M69B 3BYVA 4ASZA 3W32A 4Z7HA 2O3PA 1YI6A 3DJ6A 5B7VA 4W8DA 4FV4A 3ETAA 2OICA 4I24A 3D4QA 3O8UA 1QPCA 4LV5A 3LFNA 4C38A 4QMMA 2YDJA 3IW8A 2EU9A 4UZDA 3AC4A 4O0TA 4E26A 3NNUA 5CEOA 2ITNA 4AU8A 3LMGA 3R1NA 1A48A 1IAHA 1R0PA 4XG9A 3ATSA 2UZEA 3WF6A 5L3AA 2QONA 3ALNA 2I0HA 2Z2WA 3ZC6A 2YIXA 4MXZA 2QG7A 4K11A 2W9ZB 3GC9A 3B2WA 3QYWA 3PRIA 1ZLTA 2A2AA 3AD6A 5DBXA 1KE7A 4ZTSA 2CPKE 3EMGA 4FIHA 4BDCA 5IMXA 1Z9XA 1JPAA 3KL8A 4YZMA 3GOPA 1YVJA 3KMUA 4ZY5A 4KBAA 5M53A 5DR2A 1U54B 5AIRA 5E8SA 1OPJA 2ZV9A 3GT8A 2R0UA 3C1XA 4U45A 4AW0A 4KB8A 4FKTA 4WG5A 3UMXA 4ZMEA 4ACMA 1R3CA 3MESA 3QRKA 4RJ3A 2W5HA 5ANDA 3PP1A 4AZVA 4HJOA 3EYHA 2PVNA 4UMRA 2C6DA 2XVDA 3AC8A 5CEKA 3RGFA 1ZYCA 3R63A 4O0XA 1DAWA 3FZ1A 3OC1A 5CWZA 5K3YA 3AMBA 3OWLA 4L9IA 5FUTA 3NUUA 2X2LA 4OT5A 4X6QC 3DGKA 3TCPA 4QYFA 3ELJA 3UOLA 2XCHA 3UVRA 2P3GX 3IONA 4TTHB 4C7TA 1JSTA 3V8TA 2ETRA 2XIYA 3NAYA 2VTQA 3EQPA 4ENYA 4M0ZA 4C62A 4TYEA 2GS2A 4AGCA 4DGMA 2BZJA 2DQ7X 2JDRA 2ZM3A 2VTHA 5AP2A 3T8OA 2B9HA 2W1CA 1K9AA 5CALA 3UP7A 5DH3A 4D9UA 2UUEA 3HZTA 4X3FA 3IDBA 3TZ8A 4YO6A 2ETMA 4FODA 3VW6A 4WSQA 4CG9A 1HCLA 3QC4A 4O91A 3BYSA 2XUUA 5FRIA 1JSUA 4GG7A 4OTHA 3QQJA 4K18A 4WD5A 2WXVA 3W2RA 4W8EA 1K2PA 5F20A 4BDDA 3S95A 1VYWA 4O7LA 3BQCA 1ZOGA 3HUBA 5LVPA 2VTJA 4TNBA 3QQGA 2VTNA 3Q6UA 4W4WA 4G3GA 1P4OA 3R02A 4S33A 1ZMVA 4X3FB 3T9IA 3MFRA 3EJ1A 4DE4A 1JBPE 4HYSA 2C3IB 3ZBXA 3MBLA 4Y5QA 5AWMA 3MDYA 2JIVA 1TQIA 3MTLA 1YRPA 4FL3A 4WT6A 3A4PA 2XS0A 4IM3A 3T3VA 4A07A 3MVHA 3FXZA 1Q61A 3OBGA 3EL8A 3MTFA 4FSMA 1PXOA 5DT4A 3SVVA 4D2SA 1YHVA 3DDQA 3MY0A 3Q52A 5JKGA 4BI2A 4X0MA 1M2QA 5B2LA 2FUMA 3DJ7A 1JKTA 4BCOA 2E9VA 4X2KA 3GFWA 3RJCA 1B6CB 3HMNA 2PK9A 2VUWA 4Y72A 4IIRA 2I7QA 3NWWA 2PHKA 4LGDA 3NUYA 4CXAA 3L8SA 5HG8A 1XH8A 4EK3A 4FNWA 5ETCA 5HD7A 3OBJA 5AV3A 3IK3A 1J3HA 4B4LA 3OTVA 4A06A 3NAXA 1I44A 2E9OA 4IBMA 4IH8A 2AC5A 2ITVA 2IW9A 5JMSA 5E8WA 2R0IA 3DKFA 4S30A 5BVNA 1Y8YA 2YCQA 2E2BA 2VGPA 4IX5A 1FPUA 4QP7A 3GU5A 4YC6A 3LAUA 3QUEA 4BBFA 5M07A 2XKCA 3DTWA 1M7QA 4BKYA 5BYYA 4GFMA 3QTWA 5LCKA 1GZKA 3DBQA 5AR4A 1Q97A 4J7BA 5AR2A 3ZH8A 4MKCA 5KMIA 2YAAA 3QTSA 5H8GA 4EQCA 3FMEA 4EBWA 1FQ1B 3MH0A 1QPDA 2ETKA 4KKGA 5F4NA 3V3VA 4BZNA 4BTFA 5J9ZA 4OAVB 2C47A 4I1ZA 2BKKA 2W5AA 1ZRZA 4E5AX 5AP1A 2X9EA 3MI9A 2VO7A 3EKNA 5FP5A 2X0GA 3ZFYA 1UU7A 4YNEA 4YBKA 1IA8A 2R64A 1NVSA 3FQSA 4E4LA 3UZRA 3LKMA 3HLLA 4DTBA 3MJ1A 3RWQA 3CTHA 3QFVA 4QP1A 1Q24A 4AAAA 2BTRA 4AZFA 3I6WA 3HA8A 4GS6A 2PWLA 3LJ0A 4F1MA 3K3JA 1KOAA 5C4KA 3DK3A 4UXLA 3BEGA 5E90A 3KCKA 4ZSEA 4PDSA 5B2MA 4GIIA 3NRMA 3C4FA 3OWJA 2NO3A 3ZMMA 4EZ3A 4NFNA 4BL1A 5KZ0A 2GNFA 3OUNB 1ZOHA 3II5A 4DAWA 2R9SA 4QP3A 5DVRA 4RGJA 4FTCA 4B7TA 2QLUA 3F3UA 2ITQA 1OUYA 2JBPA 2YM8A 3PRFA 2VO0A 3H3CA 3W2QA 4ZMFA 4HVDA 4RA5A 1OL7A 4E6QA 3PPKA 4O6EA 4ANSA 1KV2A 2F57A 4MX9A 4TYIA 3SXFA 3GCVA 2GQSA 4JR7A 3MY1A 5AP4A 3E3BX 5HO8A 2A19B 2QKRA 3A7HA 1ZMWA 3DZOA 4F7SA 3TV6A 3U9NA 5AP7A 3GU8A 4Z3VA 3MVJA 2JGZA 3VUTA 3KRRA 5I5ZA 3FC1X 4UB7A 4JL9A 4ACDA 2VTRA 1PXNA 4AZSA 3W10A 4MD9E 4XV1A 2WQMA 4FKOA 3VQUA 4JBVA 1APME 5EDQA 4EUUA 2R3HA 3JY0A 3SD0A 2OJIA 3RM7A 2JEDA 4YTCA 4XX9A 3PXQA 4RIWA 3DT1A 2QLQA 4FV7A 2VTPA 3SGCA 2VZ6A 1A06A 1BMKA 2Y4IC 5HG9A 1F0QA 3UYSA 2IZRA 4CZUA 3HRBA 4CFNA 2YM4A 3NYNA 4F9BA 3FHRA 3Q4ZA 4NKAA 4TWNA 5AV4A 3RKBA 3H9RA 3TT0A 2C0IA 5M08A 2C6EA 2JKMA 3R7GA 4K33A 4R6VA 3BLQA 2Y8OA 2ZV7A 5AFVA 2REIA 3JS2A 5C8KA 5L2TA 5LVNA 3FL5A 4KIPA 2VX1A 3KVXA 4F08A 3VS1A 2CGVA 3CY3A 5BVEA 1IA9A 3EH9A 3Q60A 4FUXA 2OU7A 4DFYA 1TVOA 4YR8A 3PFQA 2YIYA 4DEIA 3QD4A 4L01A 3ZLYA 1WVXA 4D4RA 4KKEA 4MHAA 3RPRA 2ITYA 2OXXA 2C69A 3GCPA 2RG6A 4O6LA 4MF1A 1XQZA 4YJOA 2UZVA 4PP7A 2QR7A 4LI5A 4EZ5A 2VGOA 2XNMA 3Q9WA 4I21A 4F6WA 5CU0A 3JY9A 1H26A 2UVXA 2X39A 3BQRA 3F3VA 3I81A 4C36A 3F61A 4DEGA 1ZARA 4FT5A 1PMEA 2YIRA 3PTGA 4YHFA 4BKZA 4J8MA 2UZDA 4NSTA 4XRJA 4R78A 3QZFA 4AACA 3JXWA 2VTSA 5E9EA 5E8VA 3ZZWA 3RP9A 3QBNA 1WBVA 3ORZA 4EH3A 4BIBA 1FGIA 3L8PA 5K5XA 3CBLA 3FI3A 4DH3A 4JAJA 3W2OA 1RDQE 2W5BA 5ANGA 2J0MB 1F5QA 2XIZA 3MFTA 3OROA 4QMQA 5M56A 4UMUA 4M66A 3V6RA 4R8QA 3UOKA 4GU6A 4EOPA 2PVMA 4G1WA 4J98A 4O96A 4ONAA 3RINA 5HVYA 3GEQA 1LEZA 4EOQA 3FMJA 2WPAA 4WNMA 2QOQA 3DFCB 3DK6A 3E62A 4ZP5A 5AUZA 4DEAA 2Z7LA 2J0LA 2R5TA 2VTLA 4YJPA 2G2HA 4K77A 3ZHPC 3EIDA 3BRBA 1UNLA 4N70A 5E8YA 4NU1A 4AZTA 5IZFA 5JGBA 3ZC5A 4CCUA 3FBVA 4NCTA 2VU3A 2WTKC 3BHVA 3QKKA 4ZSLA 3D5WA 3P7AA 2OF4A 3MB6A 3C0GA 4GJ2A 4XP2A 5LWMA 1SNXA 3KVWA 4J71A 3V5LA 5I3OA 3EFLA 2VX0A 4L45A 3SQQA 2E9UA 3BBWA 4UZHA 1OKZA 3ORXA 5CF4A 2ESMA 4PUZA 4YZBA 3ZRLA 2CCHA 5FBNC 1E1XA 1XH6A 1H00A 4S34A 4QMVA 3QYZA 4D0XA 4DINA 3IGOA 5CS6A 1JLUE 4EKLA 4FZ7A 2J5FA 4GCJA 3ZONA 2Y4PA 5A4QA 4Y46A 2QO2A 4E4MA 3RPVA 4XG6A 1LUFA 2UVZA 2IN6A 3R1QA 2ZM1A 3RPOA 3SAYA 3MH3A 5HE0A 3EYGA 3QQUA 4GFOA 4O1OA 5F1ZA 3HAMA 4QMZA 2EUFB 5TT7A 4G2FA 4YTIA 1T45A 4DC2A 3U54A 4X21A 2V7OA 3NS9A 4YC3A 5JK3A 2QU6A 3R6XA 4O7VA 4USFA 2OJ9A 3AGMA 1V0PA 4O0UA 1ZY4A 3AXWA 4JIAA 5E8TA 5EQPA 4XLVA 5FG8A 4PNKA 2X9FA 2YZAA 3DZQA 4C0TA 2X4FA 3LCOA 4FIGA 3QTRA 3TTJA 3OMVA 4RFZA 5EM6A 3LVPA 4E6CA 3UNZA 1LPUA 2P2IA 1YQJA 3R04A 4KS7A 2GNJA 4GJ3A 3MV5A 4XOZA 2OWBA 4Y85A 4XG3A 4FSTA 3IOPA 3PVBA 5AUWA 3ODYX 2GS6A 3O23A 3AC5A 3BYOA 4JS8A 3BE9A 2HY81 3DBDA 4O7TA 1W8CA 2FH9A 2IVVA 3PDTA 2QHMA 4LGHA 3TNHA 2F7XE 4I22A 3IKAA 1ZOEA 5BUIA 4JT3A 3I7BA 4X3JA 4JR3A 5ETIA 4L8MA 2WAJA 3HDMA 4QNAA 3E7OA 3EN5A 5IA4A 4H3PA 3OY3A 4E20A 5EI6A 2Q0BA 2IVUA 4RQKA 1R78A 3DCVA 2QHNA 4F7JA 1Y6BA 2O63A 3EQCA 2GHLA 3KN5A 4MNEA 3RAKA 4JJRA 4EYJA 4D1ZA 5I9ZA 4FIFA 5KKRC 4MCVA 3V5QA 3VQHA 4AT5A 5KNJA 4FKUA 3RCJA 1BI8A 2C3KA 2J51A 2J50A 3A7IA 4PTCA 5CANA 3ORKA 3BE2A 4JQEA 2O8YA 5LCJA 2WMQA 5M4CA 2PE0A 4FTQA 1KV1A 4G3DA 5K0KA 4DH1A 3I4BA 3QLGA 3OCBA 3NDMA 4H58A 4I4FA 4LUDA 4Z9LA 1R0EA 3RALA 3TDVA 2WTDA 4MNEB 5BMMA 4XH6A 3SOAA 3OT3A 3CR0A 4HVHA 4FTKA 5IKWA 1OGUA 3H9OA 2VN9A 2NRYA 3JPVA 3KK9A 3EQHA 4BGHA 4JG8A 5FDPA 4DLIA 2OKRA 4O83A 5JN2A 4GUBA 5JZNA 1P14A 5EDRA 5CVGA 2W4JA 1CSNA 3QTIA 2DUVA 4O84A 1H28A 3ANQA 3QX4A 5AM7A 4XBRA 3G90X 4ZTHA 5FBOA 3UPZA 1U5QA 4R1YA 4EUTA 2V7AA 4FKVA 4X7QA 3M1SA 1Q4LA 1OL1A 4G3CA 2C30A 1W83A 2XKFA 3NUNA 4FR4A 2PMOX 3DAJA 3P86A 5A14A 5IQHA 4RFYA 4IXPA 3BYMA 3POOA 2OI4X 4IZ5A 3HMIA 2YM7A 3IPHA 3QWKA 4WG3A 3Q04A 3QRJA 2YDIA 3V5JA 3EQIA 5DG5A 3UIMA 4KKHA 5A4TA 3ORMA 4KINA 4QT1A 4FV2A 5AAEA 4FSZA 2F2CB 3HUCA 3M11A 2BZHB 2OSCA 4CV9A 1YHWA 5FXRA 4B0GA 3ORIA 5DT3A 3VRZA 4ENXA 4YHJA 5L6WL 3R7IA 4IM2A 2P4IA 1SZMA 4JBOA 5CU4A 4I6QA 3WF7A 4BCIA 2PVKA 5I9VA 4IDVA 3E7VA 5BYZA 2XK3A 2X2MA 2UZLA 4YJSA 3W8LA 4BCPA 5IF1A 4ASDA 3CP9A 2I6LA 5JFVA 1GZNA 2G2IA 4GFGA 2IZSA 3PJ2A 5A9UA 3WYYA 1ZAOA 4ACGA 2Q0NA 4I5CA 2PE1A 3A4OX 3SRVA 5TR6A 3HKOA 2VV9A 4BDBA 2ZM4A 3W33A 2XKDA 2YFXA 2C6OA 1QCFA 4MQ2A 3M42A 2XYNA 2PY3A 3FI4A 4AW5A 1MQ4A 2ITXA 2RIOA 5DFPA 4HZRA 5EYCA 1YDRE 5IQAA 1YW2A 4FIJA 4AWIA 2HY0A 2BDJA 4MD7E 4NWMA 4X2FA 4XCUA 2J0IA 5AEPA 4P7EA 5J9LA 1Y91A 3DXNA 3CPCA 4G16A 4AZEA 2P55A 4CZTA 2WMVA 4IAZA 4QQCA 4XG2A 5DR6A 2X8DA 4JDJA 2EB3A 4GYGA 4H39A 4QP2A 4ITJA 3P5KA 5BUEA 3C4XA 2HWOA 3HV5A 4RMZA 5EQYA 2ZV8A 1PF8A 2QOFA 4FSQA 4AOIA 1J7LA 4CLJA 4YNOA 5KE0A 5TOZA 5DI1A 2W1EA 2O2UA 3MVMA 4LFIA 2C1AA 4ZIMA 3DK7A 3TG1A 3V6SA 2H96A 1CKIA 3R9RA 1W84A 2QC6A 3L9PA 3KA0A 4ANOA 1Y57A 2B54A 4AE6A 5FTOA 4FT9A 3KXMA 4BFMA 1YWNA 5FEDA 2A4LA 3DDPA 3EB0A 1H27A 2YWPA 4QRCA 1GNGA 1UKIA 3UG2A 5H9BA 3ROCA 3T9TA 5L8LA 3BV2A 4FKLA 4WG4A 4S32A 3VS4A 5ANEA 2UV2A 4U5JA 3FKLA 3N9XA 2XJ2A 4RJ8A 4Q5EA 3O8TA 3KGAA 4YJQA 4RWKA 4F4PA 4C33A 4CVAA 4IVCA 3PUPA 1WFCA 4AW2A 5HNIX 4I92A 1S9IA 3E93A 5ITAA 3I5ZA 5ANOA 4O0SA 2OXYA 4PMMA 5BMSA 4BC6A 3VBVA 1H07A 3AT4A 3P7CA 2I0VA 4BCMA 4EK4A 3K3IA 1H1RA 3UIBA 3ET7A 5C26A 5FTGA 3W18A 2BMCA 3ZOSA 4EC8A 3R8UA 4FV0A 2H34A 2WOTA 2XNEA 4TY1A 1L8TA 2VWBA 1FVVA 2X81A 2R3NA 3ULIA 4F1TA 4D9TA 4DGLC 3KXXA 4E93A 1Q62A 4AFEA 1PXIA 4XHKB 3Q96A 5ETAA 4NZWB 3U55A 2WMAA 4GT3A 2GU8A 3RHXA 3ANRA 3GOKA 1PJKA 3OG7A 4FVRA 4JIKA 2PMNX 1RJBA 2QOOA 1WZYA 3HAVA 3UZTA 2YACA 2PVYA 3QF9A 3BGZA 5FDXA 2FSMX 3KRWA 4FKIA 5J8IA 3G9LX 4ALVA 2X7GA 3TUDA 3ACKA 5HGIA 4ITHA 5H2UA 3VS0A 3ODZX 2A1AB 3Q9ZA 4RX8A 5TF9A 5GIPE 5EG3A 4IB0A 3UP2A 2XK9A 1GAGA 4KAOA 3AMAA 1UKHA 3NX8A 3H30A 3OY1A 2ZB1A 4G3EA 4I0SA 2W99B 4W4YA 3FMLA 4DFNA 3I0OA 3F5UA 4BKJA 4XYFA 1GIJA 4W4XA 5HBEA 4IAYA 1SVHA 3BCEA 5HKMA 3PP0A 4X3FC 3VUGA 4BIEA 3COMA 5HQ0A 5FWKK 4P5ZA 1NY3A 1Y8GA 1WAKA 3ZTXA 3EFJA 3GC7A 4RBLA 5L2QA 4OAUC 1SM2A 3H0YA 2RG5A 3C7QA 4QP9A 2WTIA 3EKKA 2IZTA 4FTIA 4FV6A 5FEEA 2IW6A 3FMKA 3JVSA 4TXCA 3VUKA 5C4LA 4ZEGA 1CMKE 2WGJA 2OIQA 5DA3A 3DU8A 4ZTQA 3UBDA 4W9WA 2R7BA 2R3FA 1PRYA 5AAGA 3EQBA 4V0GA 3ORNA 3SG9A 4P4CA 3FLSA 4BBEA 4TNDA 5HTCA 1OECA 3LZBA 1KOBA 1H1SA 3FQHA 5IH5A 3DPKA 1JKSA 4AP7A 4WNKA 4V04A 2YN8A 5DGZA 3ROYA 5IEYA 3UOJA 1R1WA 4FNYA 1O6KA 3R1SA 3ZBFA 1PMVA 4AE9A 3QWJA 3DAKA 4J52A 4KUJA 3PXYA 4JQ8A 3F88A 4AX8A 2ITWA 1WBOA 4R3CA 5H8EA 4PTEA 4PPBA 4XBUA 1U5RA 2F49A 4MXOA 5HEZA 2DS1A 1REKA 3UYTA 4QMNA 5IDPA 3GVUA 4YURA 3AGLA 5A4LA 3OCTA 3ZLSA 3TJDA 3BGPA 4R7BA 3NEWA 1YI3A 4EZ7A 3Q4TA 5DRDA 3TL8A 4EH6A 2W96B 5CQUA 3FSKA 4EK6A 2XNGA 3QCYA 5CSPA 3PE2A 4IADA 4EOSA 1XBCA 4AA0A 5IA2A 4XJ0A 3BPRA 2F7ZE 3AQVA 2XF0A 4OTWA 5BVKA 4OLIA 5BPYA 1GJOA 3I79A 1VYZA 3V5WA 3G33A 3QLFA 2ZOQA 5AUXA 4DEHA 4EOOA 3U6JA 1IAJA 5EI8A 1PYXA 1Q5KA 4PF4A 4JDIA 5DEYA 3CQUA 1ZZ2A 3Q9XA 1SNUA 4PL4A 1PXPA 2WMRA 4LGGA 3W8QA 2UW9A 1I09A 3TI1A 4EL9A 4IZ7A 1W82A 4L3PA 3E5AA 4DFXE 3ULZA 4O1PA 4DF3A 2GMXA 3BU6A 4FI1A 4CFFA 3DOGA 3L8VA 3A61A 3LFBA 3OF0A 5J1VA 2QU5A 4IWOA 2WMBA 3RBWA 2BPMA 3NIEA 3I6UA 1J1CA 1UA2A 3RPSA 3VO3A 4YTFA 5BVDA 2WIHA 2GTNA 1CKJA 2X8IA 2W4KA 5LVLA 3Q5ZA 2FGIA 4RJ7A 4QPAA 1ZYLA 3NGAA 4BDJA 2DWBA 4F0GA 4EWQA 1XH4A 3EL7A 3ORPA 4G6OA 2V5QA 4BDKA 1OPLA 4RIXA 4I4EA 3F2AA 4ARKA 1YXVA 3EN9A 5ICPA 4JOAA 1YOMA 2JIIA 4O0RA 3BHTA 2YM3A 4L52A 4XV3A 4AFJA 4R5YA 5IPJA 1FINA 3TNQB 4E1ZA 4F0FA 4FL1A 3U4UA 4IZAA 4YHTA 2KTYA 5EKOA 4C59A 5CAVA 4A9UA 2WD1A 3KFAA 3OEFX 3TN8A 1OKYA 4BWPA 2PUIA 4NL0A 2QVSE 4ZTRA 3GGFA 4FZFB 3IW5A 4CFVA 4V05A 2QCSA 2YJRA 1PXJA 4FOCA 1GZ8A 2J9MA 3S0OA 2PUPA 3AD5A 3VUMA 2HZ0A 3PY0A 1JKKA 3R8MA 5JQ8A 4FNZA 3DLZA 1P2AA 1CDKA 2C3JA 2HK5A 1OL2A 3LM0A 2VO3A 2XCKA 2UW0A 4FNXA 3CD8A 3GQIA 4BI0A 2C5VA 2YISA 3N4VA 4YJNA 3QRIA 5M06A 3F7ZA 2WQOA 3A60A 5J87A 2NRUA 4K9YA 4IM0A 5F95A 1CKPA 4G3FA 4C4HA 1OBDA 2C0TA 3QGWA 4CQGA 3VBQA 2V22A 4DBNA 2UVYA 2YITA 1CTPE 3KULA 3F3WA 1L3RE 1GOLA 3D7TA 4WBOA 5E8UA 2QNJA 2FSLX 4WSYA 3VNTA 3E88A 2W4OA 2I0EA 4FG7A 4I5MA 4RSSA 4EHVA 4EK5A 4ERWA 5KUPA 2WEVA 5AR8A 4AA4A 4D5HA 3OVVA 5CTPA 3C5IA 1H24A 5ACKA 3OCSA 2I40A 3PWDA 5JH6A 4BCQA 5GHVA 1Q3WA 4R5SA 5E91A 1WMKA 4RWIA 4BRXA 2BDFA 2YHVA 3PA4A 4WNOA 4HPUE 3ZSGA 4RVMA 2H8HA 2C6LA 3B8RA 3MYGA 4BDEA 3CGFA 5T3QA 1IEPA 3ZSHA 3TJCA 4RRVA 4IAAA 3G2FA 2ITZA 2Z7QA 4YBJA 2WQBA 3CIKA 4AN9A 5CXHA 2WMWA 4FTNA 4PTGA 5AV2A 5CVHA 2BIYA 5LARA 3E8DA 1R39A 4OTGA 5EHOA 3SHEA 1W98A 1O9UA 1LP4A 1OL5A 5LMAA 4APPA 5GJGA 3RI1A 5J79A 2OXDA 3FYKX 4JX7A 1O6YA 3U8WA 3S2PA 3VS3A 4IX4A 2QURA 3RCDA 1M17A 4EH5A 2WQEA 2JDTA 4HCVA 3UTOA 4AOJA 1WBWA 2CLQA 4G6LA 5FM3A 4PDPA 3MSSA 1Q3DA 4F9WA 4M8TA 4BTKA 1XHAA 1SMHA 4BICA 4CMOA 2HWPA 1ZYSA 2XK7A 3Q2JA 2YABA 2W1GA 5CSWA 3D5XA 5C03A 2JFMA 3LE6A 2R3QA 3QKLA 2PZIA 1WBSA 3PG3A 4A9TA 4XRLA 2UW4A 4BGGA 4G9CA 4MK0A 4QMXA 4AZWA 4B6LA 4BZOA 4D2PA 3AC3A 3C0IA 5KHWA 3FMMA 2F4JA 2XEZA 1WVWA 3E64A 1OVEA 2QODA 4QTAA 4ZK5A 4ITIA 4IAFA 4O82A 3A62A 3DFAA 3ZS5A 4GVAA 1QPEA 2PUNA 3C4EA 3NR9A 4AOTA 1URCA 2X7FA 3GBZA 3SLSA 5IQCA 4FK6A 4I0TA 4UMPA 3H10A 3RNYA 5AUYA 4F64A 2HXQA 4F99A 5CF6A 4N6ZA 4HYIA 4NCTC 2YM6A 4QYGA 3VF8A 4AA5A 2JKKA 2QOLA 2XH5A 3WARA 4KBCA 5J7BA 2EXEA 3DKOA 5A54A 4U43A 4CLIA 4BCKA 3QU0A 2XRUA 1F3MC 2BILB 1GY3A 1V0BA 2JLDA 2CNUA 3KQ7A 5C01A 5LMKA 2JDOA 3P79A 4L68A 4X6RA 4ASEA 5I4NA 3TV7A 5E7RA 5EM7A 2HAKA 2J2IB 4MWIA 3D83A 4WNPA 3U51A 4ANQA 4WKQA 4DHFA 1UU9A 2IVSA 1AQ1A 4H36A 3GNIB 5I9UA 4F65A 4MBLA 3L9NA 1WCCA 4FV1A 4GKHA 4FIEA 4AW1A 3QCQA 4J95A 4OBQA 5HVJA 1Z57A 2WU6A 3F9NA 3LCDA 4G6NA 5B2KA 3SC1A 5HIEA 5AP3A 4CG8A 3WZDA 3VHKA 2A0CX 4FBXA 5CU2A 3HP2A 4APCA 2GHGA 3IW4A 2XK6A 4FG8A 5CEIA 3UIXA 2VWZA 4NYEA 4J97A 2YCSA 3LMIA 3VRYA 2F9GA 4RIWB 3R7VA 4C58A 3PVGA 2G2FA 2Y9QA 4GRBA 3R83A 4OUCA 2J7TA 3PSDA 4RJ6A 3NLBA 3LQ8A 4HVIA 4UX9A 4U9AA 4U81A 3IOKA 3MFSA 3E8NA 4UALA 1H0VA 4LOPA 2WKMA 3RAWA 3IW7A 2VWYA 4M67A 4PMTA 1AD5A 3W1FA 2C6TA 2CKEA 3GU6A 2G1TA 3O96A 4QP6A 2XIRA 4CT1A 2WMTA 2CJMA 3V01A 4DFBA 3FDNA 5KMJA 3C13A 4QMPA 3LMHA 4TN6A 3D9VA 4RA4A 5M09A 4BDIA 4EQUA 4BDHA 4YUQA 1H0WA 4QTBA 2WMUA 4ZSGA 3LOKA 4MVFA 4QYEA 1FMKA 2YIWA 5T6KA 4DN5A 4YZNA 4C4IA 3GQLA 5AX9A 2QOIA 3OW4A 5E1EA 4X2JA 1H1QA 3POZA 5JFSA 3HYHA 4E5BA 3LM5A 3IDCA 2ITOA 1H25A 3FE3A 3ZLXA 1BL7A 4UBAA 4FA2A 3REPA 4DT9A 3S4QA 4FTUA 4DLJA 3NYOA 1OL6A 1OM1A 2G01A 2IJMA 2JIUA 3A2CA 3D0EA 3E63A 3EWHA 4UN0C 4U41A 1DI8A 1LR4A 2R4BA 3MS9A 1JKLA 4U6RA 5HHWA 2YM5A 5FTQA 1ZMUA 4HNIA 4CRSA 4CGAA 1YWRA 2R3JA 3BI6A 3PSCA 1ZXEA 4NT4A 4U79A 3CY2A 2OF2A 2W9FB 3HVCA 4OBOA 4YLLA 4AGUA 2CDZA 3QD3A 3W55A 3ITZA 4C35A 3UMWA 3P4KA 4IW0A 4AF3A 2RGPA 2V0DA 4EBVA 2WZJA 5BQ0A 5FD2A 4BBMA 4HGLA 2IWIA 2UW6A 1URWA 2VTAA 2X4ZA 5GJFA 4KS8A 5FXQA 1UWHA 4ALUA 3R2YA 2IPXA 2PMIA 3DV3A 3RAIA 5CF5A 4ZLZA 2FB8A 3C5UA 3BWFA 3TTIA 2EVAA 4O81A 2YDKA 5CZHA 3PY3A 2ITTA 5K5NA 2CCIA 4HGEA 3LLTA 1OIRA 4XS2A 4I23A 3FWQA 3PA5A 1ZWSA 2WTCA 3NCGA 3QD0A 4D4SA 3QQFA 3EQDA 4R1VA 4OTFA 2JDSA 3MH1A 1TQMA 4YO4A 3BELA 3KY2A 4I6BA 2CKOA 3IECA 4YLKA 4EHZA 4FKWA 4ANBA 1DI9A 2YCRA 3EOCA 3TZMA 5I0BA 5CU6A 4D4YA 2VWWA 3R73A 4OTPA 3AD4A 3QTQA 4QPSA 5CSHA 4DGGA 4YLJA 3MY5A 1MRUA 4C3PA 1NXKA 3WE4A 3HL7A 3OWPA 4IVAA 4Z55A 2X6EA 3F5PA 3V5PA 4D1XA 3RNIA 1TQPA 3MIAA 4DEBA 1OZ1A 4R3PA 2PVHA 4YJTA 2CNVA 3ZU7A 2OLCA 3PZEA 3VHEA 4BCHA 5CNOA 1BKXA 2R7IA 4WUAA 3UC4A 5IU2A 2UZBA 4Q9ZA 1H4LA 3BLHA 4U3YA 3RK9A 4NTTA 3ZUUA 3FZOA 4CCBA 3R21A 4QMWA 2EXCX 3G5DA 4GT4A 4I93A 3MJ2A 5IA5A 1ZZLA 4A4LA 3G15A 4CSVA 4S31A 2X2KA 2J90A 3UODA 4D2RA 4BDGA 4DITA 4QO9A 5CEMA 4E4XA 2W17A 5EYKA 2WMSA 4JG6A 4HGSA 1J7UA 2BZKB 4FEVA 2BTSA 3BHYA 1YHSA 4RJ5A 3ZO3A 4EK8A 3LFCA 5IMEA 3JR1A 3R71A 2YZLA 5EKNA 3FXXA 1NT2A 2WOUA 3FYJX 4GW8A 4QMYA 5HTBA 4TYGA 4XV2A 3ZO4A 3CE3A 4BCGA 4O7YA 3DQWA 4JNWA 5EHLA 4PMSA 4M0YA 3K5VA 2XIXA 3VN9A 3HMOA 2RFEA 3PYYA 3R9OA 5IISA 4DBXA 4GK3A 2OIDA 3CPBA 3MPMA 4RZWA 3UJGA 1ATPE 3GB2A 1UNGA 5KHXA 4RG0A 4F7NA 3WF9A 5KMMA 3TXOA 4YTHA 5CVFA 3W2SA 5IUHA 5GINE 4HCUA 4YJVA 5DYJA 1YXSA 4E4NA 2UW8A 5HLPA 3UIUA 4BN1A 5JSMA 3AC1A 1G8AA 3QTUA 4QP8A 4JXFA 4KRCA 5GZAA 4L53A 5M57A 4A4XA 4ZY6A 2VWUA 3D14A 3OHTA 3P9JA 5IQEA 3FI2A 2BRNA 4OTDA 4C4EA 2CGUA 4GK2A 4ZS0A 4G17A 3UVQA 4FX3A 3VWAA 4FZAB 5I9XA 4MNFA 4QMOA 4U7ZA 5HORA 1PHKA 3DBEA 4IWPA 3V5TA 5HCXA 5EHYA 1JSVA 2FO0A 5AP6A 1UU8A 3ALOA 4ERKA 3WZEA 4II5A 1XH5A 4BYJA 5AJQA 3R30A 1Q8WA 4QP4A 2XRWA 4YZCA 5DPVA 1FBNA 3MB7A 3NW5A 5KZIA 2XNPA 3HECA 4PNIA 4DCEA 5CZIA 5DWRA 3HNGA 4PPAA 2JFLA 4ZSJA 4TWCA 3UQFA 4QYHA 5J5SA 4NH1A 4TYJA 3F3TA 3PG1A 4ZTNA 3LXKA 1DAYA 5EOBA 3VS6A 5E4HA 2UW3A 4GIHA 2AC3A 3PPJA 3QZIA 5DT0A 4DG2E 2BCJA 2XIKA 4CKRA 4O7NA 2QR8A 4YZDA 4IEBA 3VULA 1HOWA 4OTQA 4DFUA 2Z60A 4I5PA 4PY1A 3VIDA 4J8NA 2PYWA 3LFEA 3H9FA 3HMPA 4XP3A 4E73A 3WBLA 3C4CA 4HZSA 3Q32A 3EQRA 2YAKA 4JLCA 5L8KA 3FAAA 5CX9A 4FKQA 3QL8A 3Q3BA 3LW0A 5CY3A 2ZDTA 3UE4A 2C6KA 3R00A 3KXNA 3TKUA 5HTIA 5KO1A 3HV6A 4LQMA 4U3ZA 1M2RA 1RQQA 4ZSAA 4G34A 2XMYA 4UXQA 1STCE 4Y83A 2ZAZA 3TWJA 3KRXA 2ONLC 4A7CA 3GU7A 3GP0A 5LMBA 4NFMA 3R0TA 3BLRA 5CYIA 3VS2A 3ZRMA 2P0CA 1QPJA 4CNHA 2BAJA 2BVAA 2JAVA 1XH7A 2W05A 2W1DA 2BR1A 4EJ7A 4YC8A 2R3RA 1H8FA 5JGAA 3DKGA 2NP8A 5CAOA 3OZ6A 3ZXZA 3SRVB 1REJA 3LXPA 3RHKA 4X2GA 4D0WA 3VUDA 3DAEA 2JD5A 4J99A 4KIQA 4EORA 2B0QA 3FLWA 4BY9E 1PXLA 3LCKA 5KMKA 1G8SA 3CTQA 5D11A 1KSWA 2PULA 3COKA 3DQXA 3L1SA 3IG7A 3F7WA 4CZYB 5FLFA 4NIFA 3EFWA 4O0VA 5A46A 2CNQA 3Q5IA 4C8BA 5HX8A 3R8LA 5TE0A 4M15A 3FY0A 5AA9A 3H0ZA 4DGOA 4IVBA 5IQBA 3F66A 4FSRA 5DLSA 3ZZEA 3FLYA 4CT2A 3LJ2A 4K1BA 4FZDB 5EI2A 2YWVA 2VNWA 2GNGA 4C3RA 3AT3A 5ACBC 1ZY5A 3DS6A 3QHRA 4QD6A 4L44A 4NIFB 3EZRA 4RIYA 4QQJA 4QPMA 4Y73A 1YXXA 2WU7A 4GV1A 1SVGA 4C4GA 3FMDA 2H9VA 2BALA 1WVYA 1KWPA 4I3ZA 2OIBA 4UEUA 3QQKA 5AV0A 3BV3A 4DFZE 4EOIA 3MIYA 4OT6A 5AADA 4ID7A 2OW3A 2BAQA 3LCTA 3Q4CA 5CAUA 4TPTA 3BHHA 3AT2A 1ZYJA 2LAVA 4BR3A 4G9RA 4JQ7A 3TIZA 3VUHA 5L2SA 2PSQA 4RIYB 5ANKA 5J9YA 4HW7A 5IDNA 3FMNA 5HLNA 2RL5A 4TRLA 4UYAA 2VTIA 4MXCA 3TV4A 2C3LA 4O0YA 2WELA 5KBRA 3D15A 1SYKA 3QUPA 2HELA 4L3LA 3ATTA 3OW3A 4CFXA 2CGWA 1XBAA 2OGVA 4KWPA 5IH6A 5G1XA 4L7FA 2C6IA 4N4SA 1Z5MA 1O6LA 3G0EA 3PXFA 4ACHA 4KABA 2GNHA 2CN8A 5DRBA 4I0RA 4O7SA
chains in the Genus database with same CATH superfamily
5LQFA 4IQ6A 1YOJA 2QOBA 2OK1A 4DTKA 4L7SA 5M51A 3SOCA 5GZ8A 2X8EA 3RTPA 2AEGA 3CSVA 4DTAA 2G15A 4D4VA 3L9LA 4GKIA 3UG1A 3MW1A 3RPYA 4PV0A 4E3CA 4K8AA 2ZMCA 4MD8E 3I1AA 3Q6WA 4K6ZA 1G5SA 4RLLA 3QQLA 1FGKA 1OKVA 1OUKA 4BCNA 4D28A 3W0MA 1PYEA 4CTBA 3SV0A 1G8KA 4I41A 5IA0A 5TO8A 4CD0A 4E6AA 1GIHA 4CFWA 3UOHA 2CKQA 4PDYA 2OJJA 2VTTA 3F2NA 3SW7A 2O65A 2JDVA 2W1FA 5FP6A 2W1ZA 3LJ1A 4C61A 3NPCA 5BV3A 5EW9A 3LXLA 4GEOA 4EH4A 2PU8A 3AG9A 3OWKA 4RLKA 2I1MA 4TYHA 1E9HA 3EFKA 2VWVA 3G0FA 2B53A 2YA9A 3DA6A 3SX9A 4FTTA 3ZRKA 5CT0A 5DOSA 4WHZA 4EJNA 3I7CA 5K4IA 2IG7A 1A9UA 4G31A 2PZYA 4FT7A 1H1PA 2OFUA 3KK8A 4XNEA 5L8JA 1Q8UA 1Q8YA 2E9NA 3QD2B 4FT0A 2ZMDA 1MP8A 2XB7A 1JAMA 3ORLA 4UY9A 2BRBA 5HE3A 5HCYA 5AAFA 4M69A 4IB1A 4B8MA 4DH8A 3MGYA 2JC6A 3MWUA 5D1JA 2GQRA 3QZHA 4ZZOA 3HMMA 3PJ1A 5HG5A 3PXZA 2P2HA 1BUHA 1WBTA 4FKSA 5J1WA 4UYNA 3QAME 5EH0A 2KULA 4LV8A 4FV5A 4V0GB 4ANNA 5HG7A 4DH7A 4TWPA 4QQTA 5J5TA 2V55A 2IW8A 3RWPA 4AXCA 4NUSA 1KE9A 4RX7A 4IFCA 3EHAA 4RVKA 4WRGA 5HOAA 5JRQA 1XMMA 4TL0A 2GCDA 4KA3A 4MXYA 3FPQA 5HE1A 5HNBA 4IWQA 4GYIA 3OFMA 2XNOA 2H6DA 4EONA 2VTMA 3CXWA 2BDWA 4EC9A 3UQCA 3C4WA 3NCZA 4RZVA 4WOVA 3N4UA 4QMLA 3VVHA 1U54A 3MFUA 2C5YA 3R28A 4KIKA 3F6XA 3LQ5A 1FVRA 2OG8A 4EWHA 2WIPA 4HOKA 4GUEA 5LVOA 2C5OA 2WEIA 4FGBA 2OZAA 2C68A 4USDA 2PVLA 5CLPA 5LXMA 2CN5A 3F5XA 4U0IA 2FYSA 5LJJA 3JYAA 4FEXA 4FKGA 4KIKB 3ZDUA 4YZ9A 1E1VA 3TEIA 4ASXA 3O0GA 1EH4A 4Y5HA 4R7IA 2VO6A 2W06A 4RWJA 4FYOA 5M44A 3BX5A 2YLFA 3JUHA 1OI9A 3KF7A 5M55A 3UQGA 2HZIA 3D2KA 5HO7A 4YU2A 3ZM9A 3ZXTA 4FEUA 2J0KA 3PSBA 2OZAB 2QO7A 4CEGA 4RFMA 3TIYA 4AG8A 2BKZA 1XH9A 2HCKA 4FTJA 4YP8A 4EOJA 4NM5A 4TW9A 5D41A 4LRMA 3P08A 2R3OA 5IQIA 3ZCLA 4HYUA 3U4WA 5DR9A 4F9CA 3W2PA 4NW6A 3ACJA 3KKVA 2WTWA 4FICA 5L2IA 4DHZA 3KMMA 4FVQA 4FEQA 4R77A 2VD5A 4RIXB 1JOWB 2UW5A 3SDJA 3VJOA 4OTIA 4QTCA 4BGQA 4O4BB 5EYDA 1PMUA 4P5QA 4W4VA 4OW8A 3NVMB 4N57A 4A4OA 4RVTA 1QL6A 3R9HA 4EH8A 3Q4UA 1H1WA 3IS5A 3CCNA 3R7YA 3PXKA 4I5HA 4Z16A 2QOHA 2RKUA 4H1MA 4M68A 4FOBA 4O0WA 5DIAA 3RAHA 5L6PA 4IWDA 3HV4A 2HYYA 3QC9A 4LOOA 2W1IA 3N4TA 3CQEA 5M4FA 4FVPA 1NA7A 4GVJA 2WMXA 2FVDA 4L67A 4RC4A 2BROA 4O86A 3A7FA 3PLSA 4L6QA 4LG4A 4M84A 5BNJA 3KREA 3M2WA 4FSYA 4P2KA 2HXLA 3B8QA 1DS5A 2QOCA 1YWVA 4DG3E 3FJQE 1BL6A 2FSOX 1B38A 2YERA 4I6HA 5AV1A 3TZ7A 5LMKC 4R3RA 3C4ZA 1Y6AA 3A8WA 2GNIA 4GT5A 5CU3A 4CMTA 3WI6A 4KRDA 4ZTLA 3SKCA 3V8SA 4KIOA 4QYYA 2G9XA 2P33A 2OH0E 4JBPA 4Q5HA 3ZSIA 2IVTA 4M97A 3AMYA 4AXAA 4XOYA 5A4CA 3EQGA 4EH7A 3OT8A 1JWHA 3PJ8A 3V51A 2RFSA 5CSXA 3OP5A 2HIWA 4FL2A 5LVMA 3R1YA 4RT7A 1P5EA 1PKDA 4ZXTA 5HESA 5IG1A 4KBKA 2WTJA 4B99A 4GMYA 3TM0A 4MBIA 2VAGA 3HV3A 3KULB 5EYMA 4EOMA 1J1BA 4L42A 4XMOA 2ACXA 4NKSA 3D7TB 5JT2A 1VZOA 4IDTA 5D7AA 1IR3A 5HD4A 4BCJA 1UV5A 2R3LA 2UZWE 3UDBA 5CEQA 2ERKA 3GCSA 1J91A 2Z02A 3PZHA 2UZUE 3K2LA 4BIDA 2GDOA 4PDOA 5ETFA 5IA1A 3MH2A 1VR2A 2Y6MA 3HRCA 3P0MA 4FV3A 4ZLYA 5GIOE 4FV8A 4E5WA 1T46A 2B4SB 3GUBA 2HZNA 3UZPA 5DMZA 5HLWA 2Y7JA 2PVJA 4HCTA 4DDGA 5KMLA 2XNBA 5CNNA 3BHUA 1OBGA 3NMUF 3O2MA 3CKXA 4D1SA 4XP0A 3JVRA 2R3GA 3LFQA 5L6OA 4EH2A 4F1OA 5I9YA 4AS0A 3FI8A 3VBXA 3O7LB 2B1PA 4N0SA 3CJGA 2VNYA 4UV0A 4CTCA 4RPVA 4OBPA 3RK7A 1XR1A 4Y95A 5KCVA 3VBTA 4A9SA 5EQEA 4YSJA 2AQXA 4M14A 2GFCA 3UVPA 4FSUA 5D10A 2V62A 4M12A 1P4FA 4FKRA 5J95A 1S9JA 1TKIA 3W16A 3BYUA 4FK3A 2QI8A 3UO6A 4JRNA 1PXMA 3KRJA 4AT3A 1KUTA 2GS7A 1YDTE 4NM3A 3E3PA 1AGWA 2XA4A 4D55A 1W0XC 3O51A 4JI9A 3D5VA 4IVDA 4PX6A 4YPSA 4BYIA 4F7LA 4MXXA 4EI4A 2PZRA 3PXRA 4LMUA 5AUVA 4BF2A 3HP5A 4CMUA 5TKDA 1CM8A 4GG5A 4IC7A 5A4EA 1BI7A 3V8WA 4C4JA 2RFDA 2VRXA 4J53A 2CGXA 2O64A 3BKBA 4XV9A 4DYMA 5BX0A 5HVKA 2W0JA 3EN6A 5BVWA 3KRLA 4F9AA 3LXNA 3QRUA 4LDTA 2XBAA 4IE9A 3CLYA 4CFUA 4MQ1A 2C6MA 2OFVA 4F63A 1RW8A 1MRVA 4A9YA 3EZVA 3QQHA 3C50A 5IUGA 5C9CA 1W7HA 2CKPA 4UWBA 5AR7A 4BVUA 3IQ7A 2R3KA 1ERKA 2QKWB 3PJCA 4R7HA 3Q9YA 3ZFMA 3PIZA 5HBJA 5JFXA 1JVPP 2B52A 4Y8DA 2Y6OA 4J1RA 4D5KA 3R01A 3NW7A 4C57A 3NNWA 2CSNA 3SG8A 4WO5A 2EWAA 4PRJA 3GCQA 3WILA 3QRTA 3MVLA 1PXKA 2R3IA 5EW3A 3VAPA 5JGDA 4UMQA 4O22A 3IDPA 4YSMA 5FEQA 4U80A 4F6SA 5L2WA 5IQDA 2GFSA 2JAMA 2ZDUA 5FQDC 4EYMA 3TACA 4YJRA 2XAOA 2BIKB 1YXUA 3O8PA 2OH4A 3ZO2A 3VUIA 5IQGA 4O7ZA 1KE6A 3SXSA 4LL0A 3LFDA 3VS7A 3FL4A 2GPHA 3IGGA 2RF9A 2BUJA 3B2TA 3QHWA 4JG7A 1MUOA 4NM0A 1Q8TA 4QOXA 4HVSA 4QMTA 3C0HA 3CS9A 3V04A 4EQMA 3LQ3A 5IEVA 2GSFA 2VWXA 5IH4A 2LGCA 3NZ0A 4KSPA 3OD6X 3GI3A 4RX5A 2B9FA 4EH9A 3NW6A 2ZYBA 3WIKA 5CAPA 3W0PA 4CV8A 4OGRA 3RK5A 4HPTE 4KNBA 3KEXA 4RWLA 3EQFA 4CRLA 4O7RA 4PPCA 3G9NA 3QA8A 2IZUA 3MN3A 4F0IA 3ZEWA 3C51A 3NUSA 4TWOA 4HVGA 3NYVA 4XG4A 5CSVA 1IRKA 4ANLA 1UU3A 4AN2A 4CKIA 2XBJA 4ANMA 4FEWA 3QKMA 5AIKA 4RJ4A 2X6DA 4WBBB 4C2WA 2C1BA 2HW7A 4X2NA 4F9YA 1FOTA 4JVGA 3UO4A 2WQNA 3R8ZA 3PE1A 4JAIA 4I94A 2A27A 3I5NA 4TT7A 1QMZA 3DB6A 4FKPA 3R7OA 4NEUA 4MXAA 3WIGA 2ZJWA 1JQHA 3WZUA 4C2VA 3DBFA 3S00A 4LRJA 3GFEA 1YI4A 3FUPA 3RMFA 1YXTA 3BBTB 4WA9A 5A3XA 3R22A 4IZYA 4IMYA 3ZM4A 3TDWA 1M7NA 4Q2AA 4IFGA 3NUXA 4P90A 2XJ1A 2AYPA 2VTOA 2XKEA 4PP9A 3QX2A 1MRYA 4CKJA 3Q53A 3OTUA 4IJ9A 4XEYA 4U8ZA 4AGDA 1MQBA 4ZLOA 4IB3A 1W2FA 3VBYA 3ZDIA 4Z7GA 3ZLWA 3S1HA 4IAIA 4GU9A 3DXQA 4O21A 4ORKA 4H05A 4W9XA 4MWHA 1G3NA 2GTMA 4F6UA 4LL5A 4MF0A 2BRHA 4S2ZA 4D2VA 4QMSA 2IO6A 4EOLA 2NNWB 3WF8A 4G5JA 1J7IA 2I0YA 4LOQA 3ZFXA 1K3AA 4CFMA 3NUAA 5BVFA 4PQNA 5M4IA 3FLZA 1WBNA 4K0YA 5HO6A 3FC2A 4IAKA 2Z8CA 4EEVA 1OPKA 3A99A 5CT7A 3FZPA 3PIYA 5AP5A 3R9DA 2XARA 2EB2A 4EKKA 4MTAA 3W0OA 1X8BA 4FV9A 5F94A 5JRSA 4ZJIA 3U87A 3UNKA 2R3PA 1ST4A 3FZRA 3VS5A 2HW6A 3NIZA 4FZ6A 3N51A 4NK9A 4PL3A 4M13A 5EDPA 4DT8A 1JNKA 2VWIA 4BB4A 1RE8A 2GQGA 4G5PA 4V01A 2SRCA 4YGAA 2RFNA 3K5UA 4IC8A 4KD1A 3ZEPA 4HYHA 4PWNA 5AM6A 3FXWA 3KN6A 3BZ3A 4ZOGA 4E7WA 2PPQA 3I0QA 3QUDA 5HBHA 5AA8A 1UWJA 1BX6A 4WUNA 3OUKA 4ALWA 4BTMA 4YJUA 3P78A 1OIYA 1NVRA 2J4ZA 4O38A 2WHBA 3QTZA 1VEBA 3P1AA 5HI2A 5JZJA 2X7OA 2BRMA 1PW2A 1GZOA 2YEXA 4JDHA 4M3QA 3U6HA 3NVKI 3GC0A 4AXEA 5E92A 4FSNA 4BHZA 1HCKA 1IASA 2Y4IB 5HE2A 5IUIA 4LRKA 3P7BA 5FGKA 5HU3A 4FTRA 3KXZA 4C3FA 3E92A 3ENMA 2O0UA 2Y0AA 1ND4A 3PA3A 1YKRA 5CI7A 3UPXA 3ERKA 4FT3A 1YOLA 2PL0A 5D12A 1XBBA 3W0RA 5ANJA 3WF5A 1PMNA 3PIXA 4IX3A 4ZJVA 1M52A 4B8LA 5JEBA 4JRVA 2XM9A 2GHMA 4FSWA 4BZDA 3D94A 3G51A 5K9IA 3AKJA 2ZV2A 4FF8A 4DGNA 2QOKA 3LCSA 3O71A 4DG0E 4QTEA 5EOLA 4E8AA 3COIA 4C37A 4YMJA 4ZY4A 3QTXA 1UNHA 2PVFA 3QXOA 4JX3A 4DEDA 5HX6A 5K0XA 2CLXA 3C9WA 2QG5A 3BIZA 2F7EE 4IANA 5LOHA 5E8ZA 2C5NA 2WO6A 4IB5A 1U59A 2ITUA 3NNVA 1VJYA 3E8CA 3KU2A 3PFYA 2XP2A 4FC0A 3FHIA 4UWCA 2VX3A 3DJ5A 4RVLA 3FQEA 4AQCA 1GIIA 3KMWA 3PWYA 3SW4A 4FIIA 4TZRA 5CQWA 2XK4A 5T68A 2R2PA 3BGQA 2C5XA 1OB3A 3GXLA 4GL9A 4USEA 5A6OA 3OXTA 1M14A 4J96A 5J7HA 5IQFA 2XM8A 3R2BA 3HGKA 2B7AA 2BFXA 1UVRA 2NPQA 5CI6A 4CYJA 4UMTA 3TKHA 3UGCA 4FYNA 2Z7RA 3FMHA 4I20A 4RC2A 4JBQA 3DXPA 4ZS4A 5BUJA 4A9RA 1Q41A 2PUUA 3KXHA 3TUCA 3TZ9A 3W2CA 4U44A 4C4FA 2EXMA 3OEZA 4LUEA 1Q99A 4CYIA 4YPDA 3QCXA 1YDSE 5DEWA 4JMQA 4D58A 5CASA 2OJGA 4WRSA 4BDFA 5M4UA 4MBJA 5EM8A 4ZZNA 4O27B 3WZJA 5AUTA 3OOGA 5H8BA 5CEPA 4EOKA 3FEGA 4IHPA 5AMNA 5AUUA 3P23A 3NNXA 4OR5A 4XLIA 2BHHA 2JBOA 4AGWA 5CAQA 2WTKB 3G6GA 3E8EA 3KB7A 3SXRA 1ZYDA 2B9IA 4PMPA 5BYLA 3LPBA 4LYNA 3RZBA 3TNWA 4BJJA 2PTKA 4ZJJA 4O2PA 1NVQA 3COHA 3K54A 4K2RA 2WB8A 3KCFA 3SA0A 3PVUA 4FTOA 3F82A 1H08A 1XWSA 5I9WA 1IG1A 3IW6A 5KBQA 2FA2A 5C27A 4FGRA 5HU9A 3HRFA 3DNEA 4XUFA 2BRGA 2UZOA 4CQEA 3LIJA 4IACA 3MPTA 3UNJA 2CHLA 4BCFA 4RC3A 2FSTX 4L00A 3EN7A 4BJJB 3GU4A 2J0JA 5E1SA 2B9JA 1DM2A 5BVOA 2QO9A 4ZAUA 2YJSA 3L9MA 5HIDA 3DLSA 4QTDA 5EK7A 4ZTMA 4FG9A 3QA0A 1U4DA 3F5GA 3R8VA 3FLQA 5FM2A 2RSVA 1OIUA 3PY1A 3F2RA 2JKQA 4FTLA 5C8MA 3VF9A 4MUQA 2W7XA 2J5EA 3FPMA 3LHJA 3NFGB 4AN3A 3DBCA 2B55A 3FZTA 1Q8ZA 4U42A 5AR3A 5HIBA 2UZNA 4L3JA 1PKGA 5D7VA 5IA3A 4Q9SA 2GNLA 4GK4A 4D2WA 4O7WA 3LFAA 2PZPA 5G6VA 5DN3A 3FY2A 3FV8A 4C02A 2W1HA 1M2PA 2E9PA 3FLNC 5JFWA 4C34A 2X1NA 2PZ5A 4I6LA 3O7LD 2ZB0A 5GJDA 2XEYA 5LWNA 1V0OA 1OKWA 1V1KA 3QZGA 4HGTA 4N6YA 3OXIA 3GC8A 2PVRA 4U97A 3A8XA 1WBPA 2HZ4A 2XK8A 3BU3A 3G6HA 3R8PA 4L46A 3VC4A 3ENHA 2ITPA 2WNTA 5DHJA 3F3ZA 4U40A 3RVGA 2UW7A 4NM7A 3A7JA 4EHEA 2WTVA 5EW8A 3HEGA 3RM6A 5L4QA 2J6MA 4GSBA 3KC3A 3WOWA 5CF8A 1BYGA 3LFSA 4MH7A 4PL5A 3UO5A 4FTAA 5HZNA 3VBWA 3OCGA 1BLXA 4RQVA 1OITA 5IEXA 4OTRA 3MPAA 1OIQA 3HA6A 5A6NA 4EHGA 2QD9A 2O5KA 3CC6A 3OOMA 5AR5A 5E8XA 2C4GA 5EM5A 5KKRB 1SVEA 4XG7A 3QALE 5AP0A 4MAOA 3ZYAA 3PVWA 3AC2A 4BTJA 3I60A 1KE8A 2PMLX 4XG8A 3DY7A 1NW1A 4HNFA 5CXZA 3T3UA 2Q83A 4BDAA 3LFFA 5FXSA 3AOXA 3NUPA 4ACCA 4O2ZA 4MEDA 5KMOA 3NSZA 3CKWA 3DNDA 5JQ5A 3GCUA 1FVTA 5KMNA 2XYUA 3CD3A 3U6IA 4FE2A 3WYXA 4DCAA 5DNRA 3MA6A 3CEKA 1XKKA 3GENA 5F9EA 4AAYA 5K4JA 3A7GA 3DKCA 3EN4A 4IX6A 2CMWA 3IO7A 3R9NA 1KE5A 3NYXA 4QMUA 4L43A 4WIHA 4AUAA 3QGYA 3CTJA 4NJDA 4IJPA 2R3MA 3LLAA 4FRFA 5C8NA 3HV7A 5H3QA 3HDNA 5ANIA 2QQ7A 4LM5A 2YCFA 3O50A 3U9CA 3S3IA 2OZOA 2AUHA 3QXPA 3R7EA 3ORTA 2OBJA 2XJ0A 3RZFA 2BAKA 3HX4A 3D2IA 3O17A 3BEAA 5I3RA 1OMWA 2BHEA 3FKNA 5AX3A 4NW5A 3CGOA 3BU5A 3ZO1A 5KX8A 2OO8X 4RIOA 4FTMA 3CQWA 4H1JA 3QCSA 4DH5A 1H01A 5EFQA 1XJDA 4JDKA 4GH2A 2JITA 4RX9A 1FMOE 4QNYA 4QQ5A 2BZIB 2ERZE 2JKOA 3PLAE 1XO2B 2DYLA 3TNIA 4TKSA 3R7UA 4BWXA 4I6FA 2ONLA 3DTCA 3F69A 3FZSA 2ZVAA 3CJFA 4AT4A 4H3BA 4BWKA 3OXZA 4BHNA 4LMNA 2WFYA 3TKIA 2Z7SA 1B39A 3KXGA 3UC3A 3ZUTA 3VJNA 2UZTA 2YIQA 3DB8A 3L8XA 4FKJA 2YLEA 4B9DA 4BI1A 3Q2MA 4H3QA 4ZZMA 5DE2A 3ID6C 3OS3A 2F2UA 5C1QB 4FMQA 5HCZA 4F09A 3PJ3A 4DA5A 3VW8A 4E6DA 2BFYA 2PE2A 5GNKA 1OGYA 5B0XA 4D2TA 1PY5A 1U46A 4UWYA 2C0OA 3THBA 3E87A 3BWJA 3FKOA 3H4JA 4TYHB 5GZ9A 3ZUVA 5HICA 2OJFE 3FSFA 3WE8A 4KSQA 5D9HA 4NTSA 4NJ3A 4DEEA 3TUBA 2HENA 4FUYA 3TNPC 4DFLA 3KF4A 4M7IA 5CENA 2XNNA 2XZSA 3D7ZA 5HNGA 3TYKA 2HOGA 3WZKA 3MA3A 1LEWA 4MYGA 3D5UA 4F70A 3PPZA 4M69B 3BYVA 4ASZA 3W32A 4Z7HA 2O3PA 1YI6A 3DJ6A 5B7VA 4W8DA 4FV4A 3ETAA 2OICA 4I24A 3D4QA 3O8UA 1QPCA 4LV5A 3LFNA 4C38A 4QMMA 2YDJA 3IW8A 2EU9A 4UZDA 3AC4A 4O0TA 4E26A 3NNUA 5CEOA 2ITNA 4AU8A 3LMGA 3R1NA 1A48A 1IAHA 1R0PA 4XG9A 2ZFYA 3ATSA 2UZEA 3WF6A 5L3AA 2QONA 3ALNA 4QDVA 2I0HA 2Z2WA 3ZC6A 2YIXA 4MXZA 2QG7A 4K11A 2W9ZB 3GC9A 3B2WA 3QYWA 3PRIA 1ZLTA 2A2AA 3AD6A 5DBXA 1KE7A 4ZTSA 2CPKE 3EMGA 4FIHA 4BDCA 5IMXA 1Z9XA 1JPAA 3KL8A 4YZMA 3GOPA 1YVJA 3KMUA 4ZY5A 4KBAA 5M53A 5DR2A 1U54B 5AIRA 5E8SA 1OPJA 2ZV9A 3GT8A 2R0UA 3C1XA 4U45A 4AW0A 4KB8A 4FKTA 4WG5A 3UMXA 4ZMEA 4ACMA 1R3CA 3MESA 3QRKA 4RJ3A 2W5HA 5ANDA 3PP1A 4AZVA 4HJOA 3EYHA 2PVNA 4UMRA 2C6DA 2XVDA 3AC8A 5CEKA 3RGFA 1ZYCA 3R63A 4O0XA 1DAWA 3FZ1A 3OC1A 5CWZA 5K3YA 3AMBA 3OWLA 4L9IA 5FUTA 3NUUA 2X2LA 4OT5A 4X6QC 3DGKA 3TCPA 4QYFA 3ELJA 3UOLA 2XCHA 3UVRA 2P3GX 3IONA 4TTHB 4C7TA 1JSTA 3V8TA 2ETRA 2XIYA 3NAYA 2VTQA 3EQPA 4ENYA 4M0ZA 4C62A 4TYEA 2GS2A 4AGCA 4DGMA 2BZJA 2DQ7X 2JDRA 2ZM3A 2VTHA 5AP2A 3T8OA 2B9HA 2W1CA 1K9AA 5CALA 3UP7A 5DH3A 4D9UA 2UUEA 3HZTA 4X3FA 3IDBA 3TZ8A 4YO6A 2ETMA 4FODA 3VW6A 4WSQA 4CG9A 1HCLA 3QC4A 4O91A 3BYSA 2XUUA 5FRIA 1JSUA 4GG7A 4OTHA 3QQJA 4K18A 4WD5A 2WXVA 3W2RA 4W8EA 1K2PA 5F20A 4BDDA 3S95A 1VYWA 2X0PA 4O7LA 3BQCA 1ZOGA 3HUBA 5LVPA 2VTJA 4TNBA 3QQGA 2VTNA 3Q6UA 4W4WA 4G3GA 1P4OA 3R02A 4S33A 1ZMVA 4X3FB 3T9IA 3MFRA 3EJ1A 4DE4A 1JBPE 4HYSA 2C3IB 3ZBXA 3MBLA 4Y5QA 5AWMA 3MDYA 2JIVA 1TQIA 3MTLA 1YRPA 4FL3A 4WT6A 3A4PA 2XS0A 4IM3A 3T3VA 4A07A 3MVHA 3FXZA 1Q61A 3OBGA 3EL8A 3MTFA 4FSMA 1PXOA 5DT4A 3SVVA 4D2SA 1YHVA 3DDQA 3MY0A 3Q52A 5JKGA 4BI2A 4X0MA 1M2QA 5B2LA 2FUMA 3DJ7A 1JKTA 4BCOA 2E9VA 4X2KA 3GFWA 3RJCA 1B6CB 3HMNA 2PK9A 2VUWA 4Y72A 4IIRA 2I7QA 3NWWA 2PHKA 4LGDA 3NUYA 4CXAA 3L8SA 5HG8A 1XH8A 4EK3A 4FNWA 5ETCA 5HD7A 3OBJA 5AV3A 3IK3A 1J3HA 4B4LA 3OTVA 4A06A 3NAXA 1I44A 2E9OA 4IBMA 4IH8A 2AC5A 2ITVA 2IW9A 5JMSA 5E8WA 2R0IA 3DKFA 4S30A 5BVNA 1Y8YA 2YCQA 2E2BA 2VGPA 4IX5A 1FPUA 4QP7A 3GU5A 4YC6A 4F78A 3LAUA 3QUEA 4BBFA 5M07A 2XKCA 3DTWA 1M7QA 4BKYA 5BYYA 1W2CA 3QTWA 4GFMA 1GZKA 5LCKA 3DBQA 5AR4A 1Q97A 4J7BA 5AR2A 3ZH8A 4MKCA 3W0QA 5KMIA 2YAAA 3QTSA 5H8GA 4EQCA 3FMEA 4EBWA 1FQ1B 3MH0A 1QPDA 2ETKA 4KKGA 5F4NA 3V3VA 4BZNA 4BTFA 5J9ZA 4OAVB 2C47A 4I1ZA 2BKKA 2W5AA 1ZRZA 4E5AX 5AP1A 2X9EA 3MI9A 2VO7A 3EKNA 5FP5A 2X0GA 3ZFYA 1UU7A 4YNEA 4YBKA 1IA8A 2R64A 1NVSA 3FQSA 4E4LA 3UZRA 3LKMA 3HLLA 4DTBA 3MJ1A 3RWQA 3CTHA 3QFVA 4QP1A 1Q24A 4AAAA 2BTRA 4AZFA 3I6WA 3HA8A 4GS6A 2PWLA 3LJ0A 4F1MA 3K3JA 1KOAA 5C4KA 3DK3A 4UXLA 3BEGA 5E90A 3KCKA 4ZSEA 4PDSA 5B2MA 4GIIA 3NRMA 3C4FA 3OWJA 2NO3A 3ZMMA 4EZ3A 4NFNA 4BL1A 5KZ0A 2GNFA 3OUNB 1ZOHA 3II5A 4DAWA 2R9SA 4QP3A 5DVRA 4RGJA 4FTCA 4B7TA 3TMOA 2QLUA 3F3UA 2ITQA 1OUYA 2JBPA 2YM8A 3PRFA 2VO0A 3H3CA 3W2QA 4ZMFA 4HVDA 4RA5A 1OL7A 4E6QA 3PPKA 4O6EA 4ANSA 1KV2A 2F57A 4MX9A 4TYIA 3SXFA 3GCVA 2GQSA 4JR7A 3MY1A 5AP4A 3E3BX 5HO8A 2A19B 2QKRA 3A7HA 1ZMWA 3DZOA 4F7SA 3TV6A 3U9NA 5AP7A 3GU8A 4Z3VA 3MVJA 2JGZA 3VUTA 3KRRA 5I5ZA 3FC1X 4UB7A 4JL9A 4ACDA 2VTRA 1PXNA 4AZSA 3W10A 4MD9E 2A98A 4XV1A 2WQMA 4FKOA 3VQUA 4JBVA 1APME 5EDQA 4EUUA 2R3HA 3JY0A 3SD0A 2OJIA 3RM7A 2JEDA 4YTCA 4XX9A 3PXQA 4RIWA 3DT1A 2QLQA 4FV7A 2VTPA 3SGCA 2VZ6A 1A06A 1BMKA 2Y4IC 5HG9A 1F0QA 3UYSA 2IZRA 4CZUA 3HRBA 4CFNA 2YM4A 3NYNA 4F9BA 3FHRA 3Q4ZA 4NKAA 4TWNA 5AV4A 3RKBA 3H9RA 3TT0A 2C0IA 5M08A 2C6EA 2JKMA 3R7GA 4K33A 4R6VA 3BLQA 2Y8OA 2ZV7A 5AFVA 2REIA 3JS2A 5C8KA 5L2TA 5LVNA 3FL5A 4KIPA 2VX1A 3KVXA 4F08A 3VS1A 2CGVA 3CY3A 5BVEA 1IA9A 3EH9A 3Q60A 4FUXA 2OU7A 4DFYA 1TVOA 4YR8A 3PFQA 2YIYA 4DEIA 2IF8A 3QD4A 4L01A 3ZLYA 1WVXA 4D4RA 4KKEA 4MHAA 3RPRA 2ITYA 2OXXA 2C69A 3GCPA 2RG6A 4O6LA 4MF1A 1XQZA 4YJOA 2UZVA 4PP7A 2QR7A 4LI5A 4EZ5A 2VGOA 2XNMA 3Q9WA 4I21A 4F6WA 5CU0A 3JY9A 1H26A 2UVXA 2X39A 3BQRA