5EI2A

Rapid discovery of pyrido[3,4-d]pyrimidine inhibitors of monopolar spindle kinase 1 (mps1) using a structure-based hydridization approach
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
279
structure length
256
Chain Sequence
QSMSVKGRIYSILKQIGSGGSSKVFQVLNEKKQIYAIKYVNLEEADNQTLDSYRNEIAYLNKLQQHSDKIIRLYDYEITDQYIYMVMECGNIDLNSWLKKKKSIDPWERKSYWKNMLEAVHTIHQHGIVHSDLKPANFLIVDGMLKLIDFGIANQMQGTVNYMPPEAIKDMKISPKSDVWSLGCILYYMTYGKTPFQQIINQISKLHAIIDPNHEIEFPDIPEKDLQDVLKCCLKRDPKQRISIPELLAHPYVQIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Dual specificity protein kinase TTK
publication title Rapid Discovery of Pyrido[3,4-d]pyrimidine Inhibitors of Monopolar Spindle Kinase 1 (MPS1) Using a Structure-Based Hybridization Approach.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 74
structure length 256
sequence length 279
ec nomenclature ec 2.7.12.1: Dual-specificity kinase.
pdb deposition date 2015-10-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 5ei2A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 5ei2A01
1NA7A 3NUNA 1H1PA 2HAKA 1XH9A 3ERKA 3KGAA 3NIEA 2XIKA 2JGZA 4FL1A 4JBPA 4RG0A 4YGAA 3BGPA 4CMTA 4RFYA 4U80A 4RGJA 3GVUA 3RI1A 5JFWA 2RL5A 2W0JA 3ELJA 5HE3A 3VIDA 1A9UA 4K33A 3HYHA 5KMLA 4YBKA 3T9IA 4RIYB 3ZDUA 3TACA 4HNFA 2JC6A 2QLUA 3GCQA 4DEIA 3QUDA 4LV8A 2Z02A 1XKKA 2VTJA 1M7NA 4FGRA 4WUNA 2R3IA 3H3CA 3Q4UA 3VBQA 5L3AA 5HBEA 1AQ1A 4FKPA 2JEDA 2XKFA 4TYHB 3N9XA 4IADA 5CT7A 4YO6A 4F70A 3U9CA 2Y8OA 1ZOHA 3QUPA 5GJDA 3DTWA 4CZTA 2HWOA 3R7YA 4CYIA 3NZ0A 4K2RA 4PP9A 3W16A 2C3LA 5IQGA 3CY3A 4FI1A 4BGGA 3TDWA 4RWKA 3FKOA 3RPYA 3TIZA 3FKLA 4BTKA 3DQXA 1KE6A 3BZ3A 1Q8UA 3AMAA 4XLVA 3ZLSA 5JH6A 2VX0A 3MY0A 2BTSA 2P4IA 1RW8A 4ZLOA 3LFNA 4AZSA 4DEEA 1RQQA 1JAMA 4IXPA 2OZAB 5M4UA 4FEWA 5G6VA 4EQCA 4KSPA 2UVXA 3C4ZA 4EK6A 3PA5A 5JGAA 4TYIA 4AN2A 4BTMA 4RIYA 2X39A 2OH0E 5K4IA 2IPXA 2E2BA 3GQIA 2W05A 4MTAA 5IUIA 4YJOA 3WZUA 4E6DA 4CGAA 4DEAA 5HCZA 3QA0A 1KE9A 5EYKA 3ZLWA 1J7IA 3W33A 4TYHA 2JIIA 1XHAA 2A27A 4IB5A 3BHTA 3R9HA 2BUJA 4DEBA 2QG7A 2VTTA 5IQDA 1O6KA 4D5KA 2H96A 3QD3A 4AW1A 5CEQA 5KNJA 3GP0A 2C1BA 4EC9A 4DFZE 1GJOA 4E3CA 5JSMA 5KMJA 4B99A 5EOBA 2O65A 1UVRA 3ZFMA 4BHZA 3NLBA 1Y91A 1IR3A 5GNKA 3A61A 4PDOA 3R7IA 3K3JA 2BAJA 4XRLA 2FSMX 4FTMA 4X21A 2JLDA 3V5LA 4F1TA 3QF9A 4RQKA 4O0WA 2WMSA 4ANBA 4BCIA 2WTJA 2X81A 2X9EA 3HMIA 4O2PA 5CYIA 4K1BA 2B9IA 3ZONA 4O81A 2OZAA 3ETAA 2BPMA 3PJ3A 5AV2A 3AD5A 4EH2A 3DXQA 4XOYA 3UVQA 4JDIA 3RCDA 3R30A 4G1WA 4AP7A 2VTRA 3O0GA 3OW3A 3FHRA 4RPVA 3LFDA 3WILA 3HA6A 4JDKA 1YWVA 1MQ4A 4OTIA 4FYOA 4P5ZA 3PXQA 4DA5A 2VV9A 4PMMA 4WBOA 3COMA 3D5WA 3NUAA 3R02A 4XG7A 3F61A 1P2AA 2IVSA 1M52A 4G9RA 3SQQA 2YAKA 4HVSA 5BNJA 5LVMA 2RG6A 4FK3A 2C3IB 1WBVA 2C5XA 1BYGA 4GUEA 4MCVA 4OBPA 2VWVA 4Z3VA 3UO5A 4MBIA 5KBQA 3HRFA 4CFXA 4WKQA 4EHEA 4CKRA 3F3UA 3MESA 3E88A 1FVRA 2JFMA 3ANQA 4MH7A 4BCNA 2YIRA 3HX4A 4BDBA 2DS1A 4EOPA 3G33A 4S31A 5HIDA 2OW3A 3VUTA 1OZ1A 4Q5HA 3ACJA 2OLCA 5GIOE 3HMNA 4YNOA 5A6OA 3TWJA 2C6MA 2FYSA 3PXRA 4DFLA 3F5PA 4CFFA 5CU3A 1KOAA 4HGSA 4H39A 2GDOA 3IDBA 2XS0A 4EUUA 2XH5A 5CF5A 3FLSA 5D41A 3KRWA 1YI4A 2JAVA 3O8UA 4ARKA 1O6LA 3PSCA 3GNIB 3BHHA 2ERZE 2REIA 2WTIA 2YDIA 3F66A 3I0QA 3II5A 3MW1A 3QRIA 2JKQA 4KIOA 4YZCA 1HCLA 4U6RA 4I93A 5AIKA 4CMOA 1W83A 4DEHA 1Q3DA 5AUZA 4K77A 5BQ0A 2VZ6A 3IDCA 4RJ6A 4RLLA 3ZXTA 3LPBA 2WTVA 4FV4A 5J95A 4IWQA 5H8EA 3OZ6A 4LOPA 5HCYA 4MQ2A 3FZPA 4BWPA 3LQ8A 3ATSA 4X2JA 4YHTA 2CKOA 4IX4A 1OPJA 2GSFA 4E6QA 4E4XA 4YSJA 3P78A 4NWMA 3H0YA 4TL0A 4JRNA 5IEXA 2OJJA 5C01A 5M07A 2BRNA 4CRSA 4IX5A 4OT5A 4QMPA 4A9SA 4ACDA 4GU6A 3D83A 2UW5A 3QQKA 2V62A 1K2PA 3EQDA 4PPAA 3UP2A 4YO4A 1U5RA 2W1GA 3DPKA 4L68A 4N0SA 1H1WA 4BWKA 4C36A 3RZBA 4ASZA 3IONA 5CSXA 5D9HA 4BL1A 3KL8A 2BHHA 5C8NA 3ORLA 5E90A 3KXMA 4CMUA 2UW7A 3FKNA 4L3LA 3A60A 5J87A 4A06A 3FWQA 4UYAA 3NUPA 5CQUA 4DEGA 2OF4A 2WMXA 3NW7A 4E20A 3EFLA 4X6QC 5LJJA 2QLQA 4NM3A 2WU7A 4NM5A 3UO4A 4RJ4A 2R3JA 1PXKA 5I3OA 5T68A 4C37A 1ZY4A 4C7TA 4DFUA 2I0HA 4J8MA 4WO5A 2ZV7A 4ZJJA 1BKXA 2XM8A 2X4FA 4CZUA 3M11A 5J1VA 4IC7A 2G2IA 4GKIA 4JNWA 3RGFA 4DH8A 3AC5A 4F9YA 1JPAA 3UG1A 1YXSA 4YJNA 1M2PA 1H1SA 2YM8A 3WZJA 3PYYA 3A7HA 4KA3A 3PG3A 3IG7A 2W5AA 3PXKA 2UW3A 4AT5A 4A9YA 3BELA 2XMYA 3FLNC 3QZGA 3Q32A 5JGBA 2OH4A 4MNFA 3MIYA 3FPQA 4P7EA 5KX8A 5E8UA 2R7BA 5IA1A 1ZMVA 3GU4A 3MFUA 3ITZA 4GK3A 3ZU7A 4YP8A 3OCGA 1YDSE 2FH9A 2WQOA 4OTGA 4BCFA 4FF8A 4RFZA 4UMTA 4O82A 4F9WA 2G2FA 4FV2A 4L42A 4UZHA 1UNLA 3MTLA 2CLQA 2VUWA 4FTUA 2F4JA 5L6WL 4IZAA 3IKAA 4D2WA 5IMXA 2QU6A 3DT1A 5KMIA 3KULB 4EK4A 2VWUA 2B9JA 1Y8YA 5AUUA 3A7GA 3QX4A 4BCJA 2CKEA 4M12A 2CCHA 4U81A 2YACA 5AUYA 4AU8A 4BDHA 1MRVA 3CBLA 4KKEA 1OPKA 3PXFA 3ZO2A 3C0IA 2R3FA 3U87A 4DCEA 5BX0A 3ACKA 3Q9WA 2UZDA 3ZCLA 2C5YA 3OFMA 4BHNA 4O38A 3C0HA 2PE0A 1IASA 3VC4A 4EZ7A 5F9EA 5DYJA 4WOVA 4X0MA 4X6RA 2CNVA 2J0MB 4DCAA 1OKYA 4YZMA 5L8JA 3MWUA 2BRBA 2GFSA 3P08A 5LVLA 3R7VA 3DB6A 1CKJA 4OTWA 4EH5A 4RX8A 3CPCA 5IQEA 4B6LA 5JFVA 2W4KA 1JKLA 4FE2A 5A6NA 4H58A 2Y4IC 2P2HA 3ZYAA 4AGUA 4O7LA 3BV2A 3S4QA 4MHAA 3OT3A 4MXAA 2J0JA 1P14A 4F9AA 3FDNA 1GZNA 4Y8DA 5CF8A 3R9NA 1K3AA 1OL6A 4R1VA 4YPDA 5CEPA 4XG2A 1FINA 5B0XA 3ORNA 2YCRA 3QCSA 4FIJA 4QTBA 1BX6A 2JDVA 3TTIA 3EFWA 1H27A 3V5JA 3CJGA 3RBWA 3IO7A 4AXAA 3G0EA 4AFJA 4UMRA 2BZHB 3P4KA 3BE9A 4K11A 4FVQA 3P0MA 3ZUTA 5JFSA 5FDPA 3M42A 2ESMA 2VTAA 1XH4A 4ZS4A 5F94A 3KU2A 3H9OA 2WMAA 4D0XA 1YXUA 4IDTA 4BI1A 4DHFA 3QQGA 4C58A 3F88A 4C3RA 4HOKA 3QWKA 3TI1A 2JIVA 2ITOA 3MH0A 4I6QA 2A0CX 5IA5A 4C4JA 1H25A 5E91A 2W17A 4FSUA 3ET7A 2GS6A 3PDTA 4JJRA 3OUKA 3TV4A 4BKYA 3KKVA 3DK3A 4L3PA 3GCPA 3QXPA 3BYOA 3PUPA 5AM6A 4D2SA 1IA8A 1H01A 3I7CA 2Q0BA 3BHYA 4QQ5A 4U45A 3OWLA 2VWBA 3AD4A 1NVQA 2BRMA 2PZPA 3FYKX 4JBVA 3NRMA 5EM7A 2AUHA 3WARA 4G3EA 3F2NA 4YJQA 5EHOA 3SAYA 5A4CA 5CSWA 3W2OA 5AAFA 2GS7A 3UNKA 2RFEA 1G5SA 5I5ZA 4F9CA 2PUPA 4FR4A 5EFQA 4IZ5A 4QMMA 3RAHA 2YIYA 4F0GA 3R01A 3ID6C 4UXLA 3VBVA 1OKWA 2VTLA 3TCPA 1L8TA 1FGKA 1UWHA 3FMHA 1Q97A 1SYKA 4E7WA 4DYMA 4I5CA 4BIEA 4FV7A 4I3ZA 4FSQA 4WG3A 1GZ8A 5E8XA 3ZLYA 4WD5A 3K5VA 3VVHA 3HV7A 1OMWA 1UWJA 2RF9A 4YC6A 5CWZA 4EBVA 3KQ7A 5A14A 2WIHA 3EYGA 2J5EA 2VU3A 3I7BA 5EOLA 3V5WA 3ALNA 5I4NA 1F0QA 4MEDA 4XNEA 3GCVA 3PLAE 3Q52A 3RWPA 2JDTA 4J97A 5K5NA 4FNWA 1F5QA 2YA9A 4AT4A 3AD6A 4AOTA 4C61A 2ITUA 4CFNA 5IH6A 3DNEA 1REJA 3QRKA 4U7ZA 1ZWSA 4JLCA 3S95A 3HDMA 1PMEA 4IX6A 4A7CA 1AGWA 4DTKA 3T3VA 1Q8ZA 4XP0A 3FMDA 3P5KA 2YLEA 4AGDA 4CTCA 3VS2A 5TT7A 3HMOA 4FKJA 3UYTA 4BCHA 3EQFA 4EOLA 5L6OA 4RFMA 1YW2A 4OTQA 4X3FC 2W1DA 3SOCA 4BDFA 2GNFA 2BZJA 4A4XA 2O5KA 2ZMCA 2WB8A 4QMUA 5EQYA 4LGGA 5I3RA 1PKGA 2I7QA 2PY3A 3DK6A 5M53A 3GU6A 4MF0A 4E4NA 2UZVA 2XNOA 3O7LB 4R3PA 4YURA 5LWMA 5IA0A 4F09A 2JBOA 2I0YA 1PMVA 5DNRA 3WI6A 3BU3A 3TT0A 3MY5A 4P5QA 2W1IA 4IX3A 3IW8A 2QOIA 4R7IA 5GJFA 3WBLA 4EC8A 3HGKA 3TZ7A 3D5VA 4G17A 4QPMA 3C5IA 3L8PA 3OTUA 3PXZA 4KS7A 2QO7A 4D4VA 4FOBA 4FKGA 4LUEA 4I92A 5C26A 3E3PA 4ZZOA 1M17A 4KKHA 3AC4A 1Y57A 4YZBA 3KXNA 2X6EA 4IIRA 3Q9XA 3ZXZA 3KRRA 5FG8A 5CEKA 2CKQA 2WTKB 3CJFA 3MPAA 3DJ5A 4JDHA 5HTCA 3KFAA 1UNHA 3Q3BA 4AA0A 3G2FA 1BMKA 2F9GA 3DZOA 4FEVA 3RINA 4O7WA 2XBJA 2GMXA 4DBNA 3H9FA 5CU6A 2ZYBA 5J5SA 4RJ8A 4BZOA 5FWKK 5CZIA 5FEEA 2BDJA 4BTFA 1UU7A 3R8UA 2YISA 2PE2A 2W96B 4WRSA 4IVAA 4D2VA 3W32A 4NFNA 5HX6A 2X0GA 3M1SA 4CG8A 3FMEA 3DKGA 2JKKA 4QYYA 4UEUA 4YTIA 5EI2A 2YWPA 1CSNA 3I6UA 4GJ2A 5AP2A 4M3QA 2JD5A 2QCSA 5L4QA 3TTJA 1P5EA 3GC8A 3O51A 5AP1A 4TTHB 1H00A 4ANLA 1GIIA 4GK4A 3C1XA 4TKSA 5GHVA 4IH8A 4B9DA 1J1BA 4FKQA 4ACGA 5C9CA 5CF6A 2PUIA 2YM4A 2JFLA 3A7JA 1IAJA 5DBXA 3QU0A 1L3RE 2WD1A 2XZSA 3UC4A 5CAQA 3UQCA 3HAVA 4FC0A 3CEKA 4YJTA 4BN1A 2ZAZA 3W18A 4PX6A 5L8KA 2OWBA 3RK5A 3QD0A 4GYIA 4F7NA 5AR2A 4PNKA 3QZFA 3DKFA 3FQEA 4RVMA 5L2QA 4MK0A 4BZNA 1T45A 2ZV8A 3D2IA 3F3VA 3F9NA 4WNMA 4RIWB 2P0CA 4FKVA 3NNXA 3QQJA 4L7FA 4TW9A 1ERKA 5EYMA 1FGIA 4X3JA 5HE0A 2BHEA 3OUNB 2OFVA 5M44A 4ANQA 3FLYA 3QWJA 4QMTA 3O17A 1STCE 5GZAA 4YU2A 4FV1A 5HLWA 1FQ1B 3H9RA 4IWOA 4U9AA 4XEYA 3ZRKA 3KRLA 5IPJA 1M14A 3R63A 5FM3A 3VF9A 4FSMA 4CFUA 4PMPA 2GS2A 3LCOA 5G1XA 3FC2A 2R3HA 2XEZA 5IUGA 5CVHA 5KO1A 3K5UA 3U55A 2Q0NA 4TZRA 1ZRZA 2F2UA 3EKNA 4GIIA 2PZRA 3QCXA 5C27A 3P79A 2BFXA 4U97A 3VWAA 4JBOA 4BYIA 2ZV9A 2Z2WA 3QX2A 4FGBA 4C4GA 4II5A 4JVGA 3D7ZA 2GHGA 2W06A 3MVMA 2PVFA 4WNPA 4BCKA 3DBQA 2OJ9A 5TR6A 4TWOA 3VRYA 3OXTA 2VGOA 3FLZA 2WQBA 3CD3A 2FO0A 4FT7A 2PMLX 2VNWA 3HMMA 4ACMA 5A46A 5AADA 4R78A 5CQWA 3RPOA 5ACBC 1CMKE 3S00A 3FE3A 3AC1A 3Q04A 3QTRA 3R22A 3CCNA 4FVPA 4BWXA 4MXCA 5BUIA 4NZWB 3RTPA 5KKRB 4U5JA 2O8YA 1ZXEA 5FXRA 4BGQA 3EQCA 3OP5A 4JI9A 2W99B 3QAME 2FUMA 2YCSA 3WZDA 3BHUA 4KWPA 3I4BA 1H0WA 5HG7A 4YZDA 1RJBA 4IWPA 4ZLYA 2XK9A 1SNUA 5CI7A 3DCVA 3ORMA 4ZSAA 4JRVA 3TL8A 4EH9A 3GCSA 3MA3A 4W9XA 4PNIA 2PSQA 4DITA 2YEXA 5EM5A 2WEVA 5DRDA 1NVSA 4V0GB 4ZSGA 3WZEA 3L8VA 2CKPA 4MX9A 4ZSLA 2YN8A 4FV9A 4IM2A 5ANDA 4C34A 5AUTA 2FGIA 3R73A 2W1FA 4UY9A 4EHGA 1Y6BA 2IN6A 1WVXA 2QOBA 2OBJA 5AJQA 4ANSA 3O2MA 3LE6A 4DEDA 4PPBA 2BCJA 5DN3A 4AUAA 1U4DA 3L1SA 5DGZA 4FTOA 4TNBA 5EQEA 1KE8A 5LOHA 3DAEA 3DDQA 2ETMA 2W9ZB 3D5XA 3TJDA 3OBGA 2IG7A 1SM2A 2P33A 5DIAA 3R1SA 3R8MA 4LQMA 1ZZLA 3T8OA 4NKSA 4ZY4A 3VAPA 4EEVA 2R3RA 4JL9A 3E93A 4KINA 3FZ1A 2A4LA 4JG6A 5HVYA 5IA3A 4FBXA 3DAKA 3DXPA 5M4IA 3G51A 2VRXA 2WAJA 4FV0A 2CLXA 3DXNA 4C38A 3HNGA 4RT7A 5DPVA 2J0KA 1NXKA 3MY1A 3ZS5A 4L01A 2WGJA 4F9BA 4V0GA 4NH1A 4O7ZA 3NEWA 2R3QA 4YPSA 5I9UA 3VS4A 3PWDA 4D1SA 2QHNA 3PTGA 5B2KA 1WBNA 3FXWA 2CDZA 3NWWA 3QYWA 5IDPA 4NEUA 4RWJA 1YOMA 1U59A 5HTBA 2ZM1A 3BI6A 5DI1A 4ENXA 5J79A 3BCEA 5GJGA 2Z7SA 3EQBA 2CSNA 4O6EA 4QP7A 3PJ1A 4J53A 1S9JA 4U43A 2PVRA 5FP5A 4BDEA 1DM2A 1URCA 4O22A 2VD5A 3EKKA 4IAZA 4IVDA 2DYLA 4W4XA 3UBDA 3SW4A 4NSTA 1W0XC 4Y95A 4C02A 5LCJA 3W2SA 2PMIA 3DGKA 3KCKA 2XCHA 4R7HA 5KZIA 5BPYA 4QRCA 4HYSA 2WTCA 3FZRA 1GOLA 5E8VA 3IW5A 4FNXA 2V22A 5CVFA 3TV6A 3W2RA 4L53A 3MJ1A 3NYNA 1XBBA 4ZTLA 2V7AA 3RHKA 3PLSA 4HJOA 3WIGA 4KRCA 2YZAA 3TNQB 3Q9YA 1HCKA 3K54A 2C3JA 2EVAA 1R39A 2Y7JA 3MV5A 2PPQA 3PZEA 3FQSA 4FL2A 3RHXA 1SNXA 4EHZA 3TUDA 4J1RA 2GFCA 2X2KA 4WIHA 3QTQA 5ETCA 5BYZA 4AZEA 2YLFA 5E8SA 5E4HA 2EXCX 4PMTA 3PVGA 4MWIA 2J50A 5E9EA 2PVYA 5DHJA 3VHEA 4EONA 2W5BA 3BYUA 3MYGA 4IW0A 2R3OA 2GU8A 3LOKA 2Y6OA 2IZTA 5KE0A 4EK5A 1G8AA 3CTHA 3WIKA 4EZ3A 2YITA 4D0WA 3E64A 4R7BA 2WZJA 3OD6X 4JDJA 4R8QA 2J0IA 2CGVA 4PY1A 4C4IA 2OICA 2WQMA 3FMNA 3SVVA 5GINE 4LI5A 4FOCA 2HXQA 4BF2A 3COHA 3ROYA 3RNIA 3ATTA 3DBDA 4I21A 4RIOA 2FSTX 4FVRA 3NS9A 3ANRA 4FSYA 3EN5A 2XK4A 4YC3A 4BDCA 4I0RA 3MH3A 3HUCA 4OTFA 4LOOA 4RVKA 4NYEA 4FTTA 4C4EA 3A7FA 2BROA 3W2QA 1LUFA 1UU8A 4JR7A 3ZEWA 4FIGA 2OIQA 1Q4LA 4CV8A 4EJNA 3VS1A 4PF4A 3UOLA 4ZZMA 3MIAA 5D7AA 4AE6A 2ITQA 1PXLA 3I0OA 2GNHA 5JZJA 3MTFA 3QTUA 5C4LA 2HK5A 4ZSEA 2VO0A 5DR2A 4TNDA 5HG9A 3SLSA 3RPSA 4EKKA 3R1YA 3UIMA 3UOHA 1ZAOA 1PRYA 3CQUA 2XB7A 5A4QA 4ZMEA 3OG7A 1H07A 4BIBA 3E87A 2IVVA 2I40A 3KC3A 4L00A 3FPMA 5IQCA 3CR0A 5HBJA 4NW5A 4S32A 3QCQA 4HNIA 5EH0A 1H8FA 2IZUA 3ENHA 4ZIMA 4QD6A 1JKTA 4GIHA 1O6YA 4PMSA 4XHKB 4LRMA 4O27B 3GENA 3W55A 4D2RA 3ZBFA 5CI6A 4NTTA 1KE7A 1PXJA 1YHWA 3NNUA 4B4LA 4XH6A 3EMGA 2QOLA 4DGOA 4QMNA 4FSZA 5M08A 3TNPC 4ZEGA 4HVHA 4KBAA 3F3TA 4H3BA 2HW6A 2OXXA 5FRIA 4BGHA 1KUTA 4X3FB 1ATPE 4LG4A 1G8SA 2VX1A 4CG9A 3BX5A 5K9IA 4S33A 1YKRA 3PG1A 4IAYA 4NW6A 4QNYA 4FT9A 1H1RA 3HKOA 2VTSA 5CAPA 3R7GA 4Z55A 5FP6A 3PY3A 3ZZEA 4RIXA 4FTAA 2XRWA 4ZJVA 2B4SB 4MKCA 2ONLC 4UWYA 5CF4A 5AIRA 3TDVA 5C1QB 5EDPA 3MGYA 1VYWA 3FLWA 4YJSA 5E8ZA 2XNPA 2NP8A 3LXLA 2BIKB 4FYNA 4DT9A 4O83A 4NM0A 4BDJA 4O2ZA 3IW6A 4EYJA 1UU9A 2XA4A 4QMYA 2G1TA 1YHSA 4TWNA 5ETAA 4C0TA 4KIKA 3QTWA 3KY2A 4FKRA 5HTIA 2C6TA 4QP4A 3E92A 3N51A 1ZYLA 4E5BA 2EU9A 2OIDA 3OOGA 4M66A 1NVRA 2C5NA 2V55A 3GQLA 3WE8A 3DAJA 1ND4A 5DEWA 3UZRA 4HCUA 5H8BA 3PE1A 4FZ7A 4BI2A 5EHLA 3ZBXA 5KCVA 4W8EA 3D14A 5D1JA 4X3FA 1KOBA 1UA2A 4TRLA 2C69A 3F3ZA 3UO6A 4DTBA 1R78A 5BUJA 4D58A 4RA5A 2E9UA 4PL4A 3SV0A 2WPAA 3DBEA 4ENYA 1REKA 2BAKA 4G5JA 2HWPA 2R64A 4A4LA 5DR9A 4MQ1A 4CV9A 3FLQA 5DA3A 4CFVA 2GHLA 3QHWA 2OFUA 3E3BX 2PZYA 4BICA 3DTCA 3G9NA 2X7OA 4H36A 2C68A 5AFVA 3NW5A 4FSWA 5J8IA 4I6FA 5DT0A 1ZMUA 3OWPA 1KE5A 4KBKA 4YJRA 4ZTRA 3P86A 3PWYA 1W7HA 3FUPA 1J1CA 3IS5A 4GKHA 2C5VA 3VF8A 2YCQA 3TZ8A 2WQNA 3UQFA 3CSVA 3FSKA 4IZ7A 4R3RA 3PVUA 2J7TA 4FNYA 3BYVA 4GU9A 2Z60A 1H26A 5C8KA 2R7IA 1VEBA 1FMKA 4YTFA 4NL0A 2G9XA 4MBLA 1VYZA 5IF1A 3DY7A 3BYMA 2UW6A 4IB1A 4ZY6A 1TQMA 3MFSA 3VHKA 3JR1A 3EL7A 2HW7A 4QMZA 5FBOA 2IW8A 5A54A 2EXMA 4RC4A 2WOUA 4UYNA 1GY3A 4LUDA 3OTVA 4U0IA 1JBPE 2UW4A 3ZTXA 2QR7A 4L7SA 4AS0A 3MVHA 4P90A 4FIIA 4IWDA 5CSHA 4MNEB 1U5QA 3WF7A 3H30A 3W8LA 4R3CA 2ETKA 3AC2A 3VJOA 5CXZA 4MXOA 2B1PA 4OUCA 3LMIA 3GC7A 2GNGA 2ITNA 2J6MA 2KULA 4IAKA 4IMYA 3VS7A 2HZ0A 4BTJA 4EWHA 3H10A 4BDDA 2XNBA 4H3PA 3WYYA 4G9CA 4ITIA 4NCTC 3CTQA 2B55A 3EHAA 3BE2A 1T46A 5LMKA 3D4QA 2W4OA 4FT3A 3O8TA 1VJYA 1R0EA 2E9OA 2QG5A 4I0TA 3PIYA 1QL6A 2CNUA 3PIXA 4JBQA 4EWQA 3LFSA 4J98A 2QOQA 2I6LA 2XVDA 3DZQA 2IO6A 2JKMA 2R3NA 4U40A 3R7UA 3W1FA 2BRGA 2UZWE 3RNYA 4GT5A 4LV5A 4CD0A 5CAUA 4BI0A 4YTHA 4M0YA 4LMNA 2QKWB 4EUTA 5AAEA 4I41A 4KBCA 1KV2A 3WF9A 3PA3A 4BBMA 2IVTA 4MNEA 3BU5A 3TXOA 3WZKA 5BVDA 3QD4A 2WFYA 2X4ZA 3QXOA 2VTIA 3I6WA 3OT8A 3LMHA 3DDPA 4JT3A 5HU9A 4CKJA 3N4VA 2FB8A 4FMQA 5JZNA 3SXSA 4ZZNA 4KS8A 4RQVA 4OAUC 3C13A 4U41A 3ZDIA 3FV8A 1XBAA 1PXPA 4IZYA 3WYXA 2O2UA 3LQ3A 3I60A 3HRBA 5AX3A 4FV6A 4XP3A 1ZYDA 5KZ0A 4PL5A 5AR8A 4ACHA 3LFFA 1JKKA 2LAVA 2X9FA 3PXYA 3C0GA 2YIQA 3BU6A 5F4NA 2QO9A 4C35A 2GQGA 5HVKA 4J8NA 4AWIA 4GEOA 3BPRA 3BGZA 3BWJA 1SVEA 5D10A 4LGHA 4FTIA 4HGEA 2UW8A 1FOTA 5L6PA 1YRPA 5HEZA 4F6SA 3KVXA 4EKLA 2C30A 3CP9A 3LHJA 3EWHA 3EFKA 5CX9A 1PKDA 1AD5A 4J96A 4K18A 3PJ8A 2C0OA 3CQWA 4JX7A 3OVVA 5M56A 4F65A 4GV1A 1Z57A 2VO7A 3ODYX 3UTOA 4UZDA 3EJ1A 1WBOA 1QPEA 4RWIA 3LM5A 4S30A 4GRBA 3CXWA 3NCGA 4CVAA 5HKMA 3TIYA 2B54A 3TZ9A 2R5TA 3ZSGA 3DOGA 5HE1A 2XK3A 4CCBA 4NUSA 5JQ8A 2HZ4A 1PXIA 4Q5EA 3K2LA 2R2PA 3P23A 4TWCA 2CN5A 3KMWA 4DLJA 3FZTA 5EDRA 3R2BA 4DH5A 4EQMA 3E8CA 5JRQA 4GUBA 4JXFA 3CE3A 1UKIA 3MPTA 5AUWA 3W2CA 4O0YA 3ODZX 4QQJA 5J7BA 5HNIX 2UW9A 3QTZA 2A1AB 4OBQA 3AT2A 4UMUA 4UWCA 5AAGA 4QTAA 2JDSA 3EYHA 1PXNA 5KBRA 2J4ZA 5BVFA 5TOZA 1CDKA 4PDYA 3RAKA 1Q99A 1Z5MA 4AA4A 1Q3WA 4XLIA 1NY3A 3WF6A 2B0QA 3FZSA 3GGFA 4YZ9A 3W10A 3PJCA 2GTNA 1MRYA 4BC6A 1HOWA 3EQGA 5FTQA 3C9WA 2V5QA 1LP4A 3OWKA 4RA4A 5HD7A 3IDPA 2GTMA 4IB3A 3V5TA 2F7XE 2ZVAA 3QBNA 3L9PA 4WUAA 4AFEA 3SC1A 4C4FA 3LVPA 2R9SA 4G3GA 4C57A 2SRCA 4EH4A 4KABA 3CPBA 4PDSA 4JR3A 2GNLA 3ZM4A 4O0UA 2DQ7X 3DKOA 3ZC5A 4F0IA 2XNMA 4FV3A 4JAJA 2C6KA 4I5MA 4NM7A 2R3MA 4O96A 4V04A 2VN9A 5HG5A 3EZVA 1Q61A 3ZRMA 3U4UA 3FI2A 4BIDA 3MA6A 2UV2A 5LXMA 4QMVA 3L8XA 3Q53A 1SVHA 3C4EA 3QLGA 4FT0A 3FL4A 4BDAA 3DK7A 4CLIA 4E93A 4G3CA 4MXXA 3EQIA 2YERA 2PVKA 4R5YA 4EOIA 4IB0A 4NU1A 4D4YA 2C6EA 5KMNA 4FKOA 1PMUA 5D12A 4E5WA 2BALA 4ZAUA 4WRGA 5BVKA 3EIDA 3VS6A 5LARA 3A4PA 3E8EA 3FAAA 5HQ0A 4ZTSA 2QKRA 4ORKA 3B8RA 4BDGA 5EYDA 2GQSA 4G3DA 5CS6A 4CT2A 1JNKA 5C8MA 3TN8A 4E6AA 5CSVA 4XG3A 4BBFA 1V0OA 2BDFA 3QTIA 4I6BA 4N70A 4Y72A 2FA2A 5F95A 3QUEA 3SHEA 3LW0A 2VGPA 5CEMA 1ZYJA 3VULA 4UMPA 3ENMA 1LR4A 3UOKA 5HGIA 4DFYA 3PA4A 2O63A 4DGNA 5EW3A 1YVJA 1U46A 3P7CA 4LOQA 5CENA 5KMMA 3KXHA 4ZK5A 4YMJA 2XJ0A 4X2KA 1OUKA 1URWA 2HIWA 3GFEA 3CD8A 3AC8A 3F5GA 3HDNA 4K6ZA 4UALA 4XS2A 3U51A 4DC2A 4ERKA 2J2IB 4AA5A 1WVWA 2X7GA 3AGLA 3MSSA 3RZFA 2PZIA 3R1QA 4YJVA 2OZOA 2OIBA 5GZ9A 3B8QA 4WSYA 3TKIA 3ORKA 4R6VA 3HEGA 3ZC6A 5K5XA 4HYUA 4DT8A 3GI3A 2WMVA 2C47A 4ALUA 3I5NA 4FZFB 4WHZA 4W4YA 1GAGA 2LGCA 4O1PA 4RX9A 4MBJA 5HICA 1J7LA 2OKRA 4USEA 2FSOX 5EQPA 4DFNA 3G6GA 3DFCB 4FTCA 4FSRA 4RVLA 4F08A 2UZOA 1VR2A 4F6WA 1OL7A 1JSVA 3ZH8A 3NYOA 3V6SA 5AA9A 5CNNA 5H9BA 3KN5A 3RMFA 3GC9A 2PYWA 3T3UA 4O84A 2C4GA 2X8DA 3TV7A 4D5HA 4F1OA 5JQ5A 2HY81 2UZBA 1JLUE 4PQNA 5KHXA 1NW1A 2IZRA 2EXEA 5IQFA 3DJ7A 3WE4A 1RDQE 4JX3A 3RJCA 1OBDA 2ITXA 2QOKA 4CSVA 4DN5A 5H8GA 3GC0A 4LGDA 5IUHA 1WMKA 3LCDA 5HORA 3JVRA 2QR8A 3MS9A 3OY1A 3DBFA 5CEOA 1JQHA 3REPA 3R21A 4L45A 3RM7A 5LMBA 2PMNX 2PVJA 2C5OA 4DLIA 4IAAA 5CU4A 2ZB0A 3E8NA 4ANNA 3SW7A 2NPQA 3D15A 2RSVA 3KXGA 2X1NA 3C4CA 3GEQA 3RP9A 4C59A 4QTEA 5DVRA 1XO2B 1FVVA 3UP7A 3WF8A 4HW7A 4J71A 3O8PA 2J0LA 1OKZA 5IQIA 4H3QA 4F4PA 2PTKA 3HZTA 2CN8A 1I44A 2ITTA 1WCCA 3KXZA 3QQFA 4F0FA 5J5TA 3GU7A 4IBMA 3T9TA 4QQTA 1PHKA 5AA8A 5IQHA 4QP2A 4O0VA 1KWPA 3QC4A 1YQJA 2ITVA 2W1ZA 3FBVA 2CHLA 1ZYCA 3EQRA 1GIJA 5C03A 4AAAA 3N4UA 3HMPA 2BMCA 5FLFA 4RVTA 1PMNA 1GZKA 2XYNA 2ONLA 4OGRA 4IEBA 3NVKI 4USDA 3QFVA 4G2FA 4CXAA 4Y5QA 3VJNA 5IA2A 4LL0A 3JY0A 5JRSA 4QOXA 4EBWA 2WEIA 4LMUA 3LZBA 4QPAA 4TT7A 4EH7A 3L9NA 4FK6A 3VQHA 2X2LA 3U6IA 4RJ5A 3FEGA 4EJ7A 4FIFA 4N57A 3GU8A 3PPZA 3R71A 3TG1A 5LQFA 2ZDTA 3ZM9A 3JYAA 4OTHA 3Q4TA 1WZYA 4TYJA 3V5PA 2PULA 4USFA 2Y0AA 4IFCA 3SX9A 4Q9ZA 3ORXA 4G5PA 5A9UA 3MN3A 3GB2A 4E8AA 3P7BA 2O64A 1H1QA 3UODA 2Y4PA 4M69A 4EYMA 1J91A 3GOKA 5EM8A 4XYFA 4HVGA 1PXOA 1QPDA 2ACXA 4I5PA 4IANA 1PJKA 3QA8A 3NNVA 5BUEA 4M7IA 3P7AA 5FEDA 1X8BA 4BDKA 2Y9QA 3F5XA 4W4WA 2BFYA 3VQUA 3I79A 4KIQA 3OEFX 3HP2A 1YDRE 3EB0A 4MD7E 3FI3A 3VUMA 4HYIA 4CLJA 3LJ1A 3ORPA 4D4RA 1R3CA 4TY1A 5HNBA 3FJQE 1WBPA 1XH7A 5M57A 4BKJA 4O86A 3KF7A 3HVCA 3V01A 4G3FA 2VTQA 3BWFA 4LM5A 3QC9A 5CAOA 3ZFYA 4DH1A 2YJSA 4ASEA 3ZMMA 2GPHA 2CGUA 4U79A 5DFPA 5AR7A 4C4HA 4MAOA 3IW4A 2YABA 4JOAA 4MXZA 4ZSJA 2JDOA 4LFIA 2W5HA 3KA0A 4ZY5A 5M4CA 5HVJA 4EQUA 2C0TA 3FMMA 3I1AA 5ETFA 2P2IA 4X2FA 4ZTNA 4FKIA 3NAYA 2A2AA 4MXYA 4PL3A 4ONAA 4EL9A 1PXMA 3PP0A 4BDIA 1FPUA 3PY1A 4WNOA 3R00A 5CZHA 1ZOEA 4IDVA 3D7TB 3RK7A 4NTSA 3QZHA 3IQ7A 1PW2A 3AQVA 2WNTA 5E1SA 3P9JA 5EG3A 2QO2A 4F1MA 2WMQA 4Q2AA 1CKIA 3DBCA 3FY2A 4ZLZA 3GOPA 4FG7A 4XRJA 5DEYA 5BMMA 1LPUA 3CS9A 4YLKA 5AP3A 4ALVA 5CALA 4DF3A 3U8WA 3UJGA 1GIHA 2WO6A 3LFEA 3QRTA 5EDQA 2R3KA 3ZO4A 3IOKA 5HIBA 2XK8A 3OCBA 4GS6A 2C3KA 5CTPA 4XJ0A 4NCTA 3IPHA 4ASXA 2CJMA 2VWXA 5IMEA 4GT4A 3OOMA 3PVBA 4BYJA 1OGUA 5LVOA 4TN6A 5I9WA 2QOHA 2Y4IB 4GMYA 4YBJA 4KKGA 5L2WA 1SVGA 3ZOSA 3HV3A 4MF1A 2XIYA 3DB8A 5ETIA 3W8QA 3NDMA 3F3WA 3F2AA 2OJIA 4GK2A 4QP9A 5DOSA 1B39A 3SA0A 2WMBA 3DNDA 3R28A 3FSFA 3MJ2A 3NNWA 3OXIA 4HCTA 3RVGA 5FM2A 4L67A 1BI7A 2OJGA 3BBTB 4F7SA 4L8MA 3C4WA 3D7TA 5ANIA 4UB7A 2HOGA 4FSNA 4S2ZA 3RPRA 1OPLA 5E7RA 2V0DA 1Q24A 3R9DA 3N4TA 2P55A 3IK3A 3H0ZA 3KVWA 2JITA 2PVLA 3O71A 2IVUA 3QKMA 4FSTA 4UBAA 4Y85A 2PWLA 4FKSA 4RJ3A 3TM0A 3JS2A 2W1CA 2WELA 3BHVA 2CGWA 3OW4A 2F2CB 4RLKA 3M2WA 2E9PA 1E9HA 3A2CA 3R8PA 1XH6A 4BCOA 2CMWA 1JSTA 2GHMA 1Q8WA 4RZVA 2H9VA 4Z7GA 3SXFA 5I9YA 2JAMA 2RGPA 3F6XA 4O1OA 3ULZA 5AM7A 1ZY5A 3PIZA 2WXVA 4JIKA 4HVDA 3UMWA 5HHWA 3BLQA 2J5FA 4EOOA 3DJ6A 5DG5A 4Q9SA 5AX9A 2X2MA 3Q6UA 2VNYA 5HBHA 3CGOA 4RWLA 3LFAA 3VUHA 5HLPA 2RFNA 4KB8A 3D2KA 4FEUA 1SZMA 5BYLA 4AW5A 2JDRA 2RFSA 3HL7A 1JWHA 5FEQA 2AC5A 2QNJA 1J7UA 1Q62A 4FX3A 3R83A 4FKWA 5AP4A 5AP7A 2QU5A 3UE4A 1R1WA 3HUBA 4JS8A 1OIQA 4IAIA 1GNGA 3V04A 2NO3A 3F5UA 4DG3E 5J9YA 3EN6A 4D1XA 4C3PA 4OW8A 5LMAA 4G6LA 4JG8A 4E4LA 4QT1A 3TNIA 3KK9A 4YHFA 1K9AA 3A4OX 3MBLA 4L3JA 4RIXB 3QYZA 4ZOGA 4EOMA 5BVOA 4NIFB 2AYPA 3GBZA 3TKUA 5CU0A 1Z9XA 5LVPA 3HAMA 4AZVA 4R5SA 4D2PA 4GFGA 3GUBA 3PVWA 3MPMA 4IC8A 4XBRA 5FTOA 3RPVA 1PYEA 2OXYA 3VN9A 4AW2A 5KUPA 2BKKA 3OCTA 5H2UA 3QLFA 4RJ7A 3NUXA 2OO8X 4HZRA 4D2TA 5HX8A 2UZLA 4CKIA 4ZMFA 4IJPA 1JVPP 4B8LA 3CKXA 3Q6WA 3COIA 3TJCA 1V1KA 1OIRA 5DE2A 2ZM3A 2ZDUA 4KIKB 4DH7A 5EHYA 4CYJA 4EK8A 2WTKC 5CT0A 5C4KA 3LFQA 5E8WA 4CQEA 2XNGA 3G6HA 4GT3A 3K3IA 3OXZA 4DFXE 3QKLA 3ZHPC 1IRKA 4FTLA 3DU8A 5A3XA 3RKBA 5JK3A 3JY9A 3BKBA 3UC3A 4I23A 1EH4A 3QRJA 4BY9E 3EN4A 5K4JA 4QTCA 2ZB1A 3BBWA 2CCIA 1XH8A 5BVNA 1UNGA 2I0EA 4LL5A 3A99A 2BTRA 3OCSA 4K8AA 3TNWA 2J51A 4EOJA 5JGDA 2WQEA 4NIFA 4FKUA 5HZNA 3NYXA 4FODA 4QP3A 2HCKA 3FI8A 5A4TA 3UGCA 2VAGA 3W2PA 4APCA 4RSSA 5ANJA 4JQ8A 2HZNA 4QYGA 4EORA 3AMYA 3V3VA 3NPCA 4QYFA 4FEXA 4FTNA 3NX8A 2W7XA 4RZWA 3MI9A 3NUYA 2YFXA 3O96A 1U54B 3UIXA 3S2PA 4QYEA 2PUUA 5D11A 4C62A 4Z16A 4YTCA 2PE1A 3UOJA 4H05A 3ZSHA 4CCUA 4FIHA 4EHVA 4FTQA 2ETRA 2YCFA 2JBPA 5J9LA 4C33A 3IGGA 3MB7A 4OTRA 3QKKA 2QOOA 4QPSA 4ITJA 4BBEA 3OWJA 2XF0A 3ZLXA 4DAWA 4DGGA 4FA2A 2G2HA 1W98A 3UDBA 4AQCA 4XP2A 3VBYA 4MD8E 2BR1A 2X7FA 4XG8A 3S0OA 5JMSA 3ORZA 4M84A 3S1HA 4UWBA 3QD2B 2HELA 2XK6A 4QP1A 3GFWA 3FYJX 4GG5A 3QQHA 2UZEA 2Q83A 4FG9A 4MWHA 5IU2A 4QNAA 2XKDA 5CXHA 4F64A 1QCFA 3NUUA 4GL9A 5D7VA 2B7AA 2QVSE 2PVHA 3V5QA 3UZTA 4FL3A 3R0TA 2VWYA 1P4OA 4CRLA 2Y6MA 5AP5A 1Q8TA 2HXLA 1H24A 4B7TA 3L9MA 5CNOA 1ZMWA 5M4FA 3QZIA 4H1JA 4E6CA 1ZYSA 2HENA 4ZJIA 2B9FA 1J3HA 3FI4A 4M68A 1U54A 4OLIA 4ZTQA 2YIWA 4U8ZA 3ZO3A 1ZARA 4CFMA 2YM7A 5AEPA 2XCKA 3NYVA 4IACA 4AOIA 5EM6A 4DH3A 4FUXA 4B0GA 3EL8A 4N4SA 1ZZ2A 4C2WA 4ALWA 2YAAA 4BCGA 2Z7LA 4ASDA 2F57A 2F49A 2ITYA 3B2TA 2XNNA 4L46A 5EKOA 1PY5A 3TZMA 2J90A 2RKUA 1XH5A 2WMUA 4O6LA 5ANEA 5EK7A 2YZLA 5IDNA 1B38A 3BEAA 3KXXA 3G90X 3E62A 4QMOA 4Y5HA 5GZ8A 3TEIA 4IE9A 1Y6AA 2J9MA 5JKGA 4FTRA 3DV3A 4EZ5A 1E1XA 3EH9A 4HYHA 3ROCA 5AUVA 4O7YA 4J95A 5T6KA 5KKRC 2OSCA 4GYGA 4AZWA 4FKLA 4GFMA 2FSLX 2XP2A 2C6IA 2VTMA 5LVNA 5DT4A 2XIRA 3BEGA 2WHBA 3QL8A 4YHJA 3BGQA 3LCSA 4LRJA 5AR4A 4EI4A 5M09A 4GVJA 2QONA 2EB2A 3QTSA 2HZIA 4RRVA 4AF3A 2PHKA 2QHMA 2W1HA 3PFQA 4CNHA 4D1ZA 1OIYA 2RIOA 5HI2A 4U3YA 3Q2MA 4TYGA 4RX7A 4A9TA 1W82A 3COKA 4HGTA 2X8EA 4WG5A 3ZUUA 5ANGA 3VBTA 2QURA 2HYYA 5TF9A 2Z7RA 4LYNA 3G15A 3IOPA 3A8WA 1BI8A 3QQLA 4E26A 5HIEA 4AGCA 2XJ2A 2ZM4A 3I81A 1DAYA 4QMQA 2YIXA 2QQ7A 5J9ZA 5BVEA 4XG9A 5K0KA 1WFCA 2QOCA 3G5DA 3OS3A 4XV2A 4NK9A 5E92A 3UVPA 2PMOX 3VBXA 2BKZA 1FBNA 3TNHA 3BV3A 3F69A 1TKIA 4PPCA 4N6YA 2R0UA 5M55A 1OUYA 1DI8A 4BZDA 3E8DA 5AV0A 2OF2A 4O7VA 4FKTA 4IQ6A 5I9ZA 5IEVA 3FMJA 5FDXA 2C6OA 3MDYA 4QP8A 5DMZA 2BIYA 4W8DA 4PP7A 4OT6A 5CVGA 1V0BA 4O21A 3NSZA 3ZZWA 4PTEA 4PTCA 1YXVA 5F20A 1O9UA 4QP6A 1DAWA 5B7VA 4J7BA 4AOJA 4XG4A 5EKNA 5JN2A 4UX9A 4GH2A 2QOFA 3LCTA 4TYEA 3UZPA 3VRZA 4NT4A 1YHVA 2JKOA 2WTDA 2B52A 3RALA 4YC8A 4G16A 3H4JA 1R0PA 4K0YA 4P4CA 1S9IA 4O91A 1H08A 1LEWA 3R6XA 4WG4A 4GFOA 3R9OA 4YJUA 4BCPA 4I4EA 4L43A 4MD9E 3S3IA 3FZOA 2ZMDA 3FMLA 4Y73A 3RAIA 1TQIA 3V51A 1V0PA 4DINA 4CEGA 4XX9A 4IM0A 2PVNA 3CTJA 3C4FA 4OTDA 4QMWA 3ZO1A 5ANOA 2CGXA 3F82A 3AC3A 1OITA 4M8TA 5L2TA 4K9YA 2H8HA 4RC3A 4FICA 1FVTA 2P3GX 4UMQA 4OR5A 2RG5A 4HPUE 4E73A 5L2IA 2AC3A 2PK9A 4IFGA 4O0XA 4OAVB 4U42A 3KMMA 1YOLA 1OL5A 4FEQA 3R1NA 4F99A 5KMOA 3FC1X 5FUTA 3KREA 3PZHA 3CGFA 2NRUA 2PZ5A 4RBLA 3ZEPA 2W4JA 3POOA 2WMRA 3LFBA 3EQPA 4L52A 4I0SA 5TE0A 3SRVB 3FL5A 4AN9A 4I94A 3U54A 4LRKA 1NT2A 4HPTE 3MVJA 4R77A 1H0VA 1KV1A 5JT2A 5E8YA 3E63A 3KULA 3R9RA 3MH1A 4ACCA 4ID7A 1BLXA 3R8VA 1SMHA 2XBAA 5BMSA 4BFMA 2XIXA 3G9LX 3OROA 2JIUA 1KSWA 4KIPA 5ACKA 3RK9A 4XOZA 5ICPA 4TWPA 3PJ2A 4NJDA 4HGLA 4CZYB 4IVCA 3VS3A 4BCMA 3RWQA 2EUFB 5LWNA 1TVOA 4G34A 2OU7A 4KAOA 4WA9A 3UMXA 2GQRA 5JEBA 3PE2A 4J52A 4YUQA 1Q5KA 4FNZA 4KD1A 2QI8A 3DLZA 3LJ0A 1JSUA 3DFAA 4R1YA 4RMZA 1P4FA 3UYSA 3CC6A 3F7ZA 2GNJA 3O23A 3LIJA 5HU3A 4C8BA 3NAXA 2IWIA 3NCZA 4GJ3A 4I20A 4DBXA 2UVYA 2NRYA 5J7HA 3TUBA 4D9UA 2NNWB 3NW6A 2XNEA 5DH3A 5IG1A 3D0EA 5L8LA 2VO6A 3SRVA 2PUNA 3OMVA 3V8SA 2YDJA 3MFTA 3QTXA 1MUOA 3EFJA 2YJRA 1BL7A 2DWBA 3VW8A 2R3GA 3RM6A 4GG7A 1IEPA 3HECA 4XCUA 4RC2A 2ZJWA 4WBBB 4QMSA 1XJDA 4Y46A 2UVZA 4XBUA 3Q2JA 3AT3A 3POZA 2HY0A 2BZIB 1OI9A 4CTBA 3CY2A 1YDTE 3NVMB 3QGYA 4FIEA 4DGLC 2BVAA 4XMOA 2VTNA 4AGWA 3VS0A 5AWMA 5K0XA 1DI9A 3Q60A 4N6ZA 2ZV2A 1XR1A 4O0RA 4FV8A 3ZUVA 3QQUA 3BIZA 2OXDA 2VTPA 3P1AA 4YJPA 5CU2A 4A4OA 3LMGA 5M51A 4Z9LA 1E1VA 2I0VA 3LLTA 2X8IA 4PDPA 5HCXA 4S34A 2CPKE 4UV0A 2BRHA 3SKCA 5L2SA 5AV1A 4DFBA 4BB4A 4O0TA 5E1EA 3ZFXA 5AP0A 4O7RA 3A7IA 4F7JA 4BRXA 4FTKA 1Y8GA 4QMXA 4Z7HA 1F3MC 1JOWB 3D94A 3I5ZA 3OF0A 3UPXA 2BILB 1JKSA 1W8CA 4AG8A 3O7LD 2H6DA 4D55A 4X7QA 3F2RA 4ZP5A 1UKHA 3R7EA 5IEYA 3OC1A 1OB3A 3LCKA 2X6DA 3NR9A 4P2KA 2W1EA 4XV9A 3ZSIA 2BZKB 5I9VA 2E9NA 2CNQA 2EB3A 4WT6A 4U44A 4BR3A 5DLSA 3OBJA 5AV3A 2VTHA 3QGWA 2VO3A 1FMOE 3U6JA 3C4XA 4IM3A 4JQEA 4QYHA 3GCUA 3L9LA 1MP8A 3GU5A 3HP5A 4ZTHA 3DQWA 2R0IA 4TXCA 3UQGA 3IECA 3EN9A 3LM0A 2G15A 2Z7QA 3VNTA 4HVIA 5FGKA 4W9WA 3HV5A 5IH4A 5IKWA 4APPA 4ERWA 5KMKA 4EH8A 3LXKA 4NJ3A 2C6DA 4YR8A 1WAKA 2R3LA 2YM6A 1VZOA 1PYXA 4XG6A 1IA9A 3BRBA 4A9RA 4ANMA 3LAUA 2WIPA 3B2WA 4H1MA 5EYCA 4G6OA 4DG2E 2R3PA 1YI6A 3C7QA 3RAWA 3VS5A 4B8MA 4D28A 1OVEA 5DWRA 4EOKA 3WOWA 3KRJA 4QTDA 4AX8A 2YDKA 3SGCA 4TPTA 2VTOA 2WKMA 3V6RA 3JUHA 4I22A 3KCFA 4M13A 1UU3A 4DTAA 1WBSA 1YXXA 2UZNA 2XJ1A 1XWSA 3U9NA 5HO7A 2I1MA 4PWNA 4EOQA 4F63A 4E4MA 4G31A 4X2GA 3FY0A 3PRFA 3SD0A 2VWWA 3E7VA 2XRUA 4I4FA 4NFMA 5FXSA 3HLLA 4KNBA 2C1AA 3Q4ZA 1IG1A 4KRDA 4JQ7A 2DUVA 4U3ZA 4NKAA 4UXQA 2B9HA 2BDWA 3NUSA 5IZFA 5DT3A 3QHRA 3AXWA 3VUKA 1XQZA 4AZTA 2OK1A 1OECA 1H28A 3NIZA 1M7QA 2O3PA 4DGMA 4QQCA 3DKCA 2ITPA 5DRBA 3CLYA 2C0IA 2XIZA 3JPVA 4IHPA 2YHVA 3AG9A 5HD4A 2PU8A 5GIPE 2F7EE 3SOAA 4ANOA 2UUEA 3VO3A 5LMKC 5I9XA 4E5AX 3DLSA 5CEIA 1WVYA 3A62A 4AN3A 2YWVA 4HZSA 2UZUE 3LKMA 2PVMA 3SXRA 2ZOQA 4F6UA 2XEYA 2XM9A 4CFWA 4BKZA 3PSBA 3ORIA 4L9IA 2E9VA 2GCDA 5BYYA 5AP6A 5HLNA 1LEZA 4RX5A 3KK8A 3QALE 5EW9A 4UN0C 1RE8A 3THBA 3EOCA 5HG8A 3U4WA 3V8TA 5CASA 4M69B 2BAQA 3AOXA 1QPJA 2WU6A 4YSMA 4GSBA 3U6HA 1ZLTA 2VX3A 3A8XA 3FHIA 5FBNC 4A9UA 4AACA 3R8LA 2Z8CA 4AW0A 4CQGA 2UZTA 4O0SA 4AZFA 1XBCA 5EI6A 5BVWA 4CT1A 1TQPA 2FVDA 2KTYA 2WMWA 3KB7A 5AMNA 4WNKA 2W9FB 1BL6A 3MH2A 4AT3A 5IH5A 3PPKA 4PTGA 3V8WA 2PL0A 3EZRA 3HRCA 3BQCA 1YXTA 3D5UA 4YLLA 4BCQA 4DG0E 1H4LA 1I09A 2IW6A 2O0UA 4M67A 4PRJA 4X2NA 5HO8A 4O7SA 3TUCA 3ALOA 4FT5A 3DA6A 3AMBA 2XK7A 5K3YA 3QRUA 2A19B 5CY3A 2ERKA 3IGOA 3GXLA 5B2MA 3UPZA 3RCJA 4FUYA 3CIKA 5F1ZA 4DE4A 3JVSA 3FQHA 4D4SA 1Q41A 3AGMA 4I24A 2QC6A 5KHWA 3OY3A 4FZAB 2H34A 3KMUA 4AE9A 3F7WA 3Q9ZA 4L6QA 1QPCA 4XV3A 2WMTA 5IA4A 3UIBA 4C3FA 4RIWA 3O50A 1CM8A 2VWZA 2RFDA 4BVUA 3BLHA 5CSPA 3EQHA 3PSDA 3HA8A 2YM5A 1B6CB 2ITZA 4MYGA 3WF5A 1DS5A 3VUIA 3LLAA 3UNZA 4M14A 4HCVA 4M15A 4OTPA 1BUHA 4V01A 5HE2A 1APME 3C50A 3HV4A 3R7OA 3C51A 3HV6A 2IW9A 3R04A 4PUZA 5HO6A 4O7NA 3KN6A 5HOAA 3NGAA 3UIUA 1OL2A 1YOJA 5TO8A 3EN7A 3G0FA 1M2RA 3R2YA 3R8ZA 1QMZA 4PV0A 4F7LA 5CLPA 3OHTA 4ITHA 2G01A 3GT8A 1CKPA 5HNGA 4FG8A 3ZRLA 2ITWA 3PY0A 4W4VA 4XV1A 5AV4A 4J99A 1OL1A 2QD9A 2C6LA 4GCJA 4KSQA 2QODA 1MQBA 3PPJA 5EW8A 5A4LA 1G3NA 1M2QA 1OM1A 3D9VA 1OIUA 2XUUA 5CANA 5FD2A 4QMLA 3Q5IA 2IJMA 3PRIA 3UNJA 2GNIA 4I6HA 4YLJA 5ITAA 1IAHA 3FXXA 5AUXA 1Q8YA 4M0ZA 4GVAA 3QCYA 5LCKA 2F7ZE 3PP1A 2WOTA 3Q96A 1ZOGA 4I5HA 3CKWA 1CTPE 4EOSA 5B2LA 4V05A 3SG9A 3MFRA 5JFXA 5M06A 4A07A 3NMUF 3VUDA 3UG2A 5I0BA 2IZSA 4ZXTA 1PF8A 4L44A 3L8SA 2V7OA 4Y83A 4M97A 3KF4A 5IQBA 3CQEA 1A06A 3Q5ZA 4WSQA 5A4EA 5J1WA 1MRUA 3UVRA 4ZS0A 5HESA 3C5UA 4ZTMA 5IQAA 1YWNA 4IAFA 2WTWA 3E7OA 5EI8A 1OKVA 4O7TA 4C2VA 5CAVA 1WBTA 4KUJA 2VWIA 2YM3A 4OBOA 5AR3A 3FMKA 3SG8A 2EWAA 4I1ZA 3ORTA 4MVFA 2R4BA 3MB6A 4EK3A 5ANKA 5TKDA 1YWRA 4XUFA 2XKCA 5AR5A 3KEXA 4YZNA 5IISA 3TKHA 2OJFE 2OG8A 2B53A 3E5AA 3IW7A 3LFCA 4FV5A 3BLRA 3DS6A 4JAIA 5FXQA 4YNEA 1W84A 2OI4X 3JXWA 3AT4A 1GZOA 4JG7A 3LQ5A 4E1ZA 1OBGA 2XYUA 3FXZA 1A48A 2UW0A 3SDJA 3BYSA 4FZDB 1UV5A 3OEZA 1YI3A 3VBWA 3BQRA 3Q4CA 3LXNA 4IJ9A 3VUGA 4EH3A 3LXPA 4IVBA 5E8TA 3LJ2A 5H3QA 4GW8A 3ULIA 4D9TA 2XKEA 4FTJA 3MVLA 4G6NA 4FZ6A 1WBWA 3KRXA 4JIAA 2OGVA 5DR6A 5FQDC 4EH6A 5FTGA 3VW6A 5T3QA 4QO9A
chains in the Genus database with same CATH superfamily
1NA7A 3NUNA 1H1PA 2HAKA 1XH9A 3ERKA 3KGAA 3NIEA 2XIKA 2JGZA 4FL1A 4JBPA 4RG0A 4YGAA 3BGPA 4CMTA 4RFYA 4U80A 4RGJA 3GVUA 3RI1A 5JFWA 2RL5A 2W0JA 3ELJA 5HE3A 3VIDA 1A9UA 4K33A 3HYHA 5KMLA 4YBKA 3T9IA 4RIYB 3ZDUA 3TACA 4HNFA 2JC6A 2QLUA 3GCQA 4DEIA 3QUDA 4LV8A 2Z02A 1XKKA 2VTJA 1M7NA 4FGRA 4WUNA 2R3IA 3H3CA 3Q4UA 3VBQA 5L3AA 5HBEA 1AQ1A 4FKPA 2JEDA 2XKFA 4TYHB 3N9XA 4IADA 5CT7A 4YO6A 4F70A 3U9CA 2Y8OA 1ZOHA 3QUPA 5GJDA 3DTWA 4CZTA 2HWOA 3R7YA 4CYIA 3NZ0A 4K2RA 4PP9A 3W16A 2C3LA 5IQGA 3CY3A 4FI1A 4BGGA 3TDWA 4RWKA 3FKOA 3RPYA 3TIZA 3FKLA 4BTKA 3DQXA 1KE6A 3BZ3A 1Q8UA 3AMAA 4XLVA 3ZLSA 5JH6A 2VX0A 3MY0A 2BTSA 2P4IA 1RW8A 4ZLOA 3LFNA 4AZSA 4DEEA 1RQQA 1JAMA 4IXPA 2OZAB 5M4UA 4FEWA 5G6VA 4EQCA 4KSPA 2UVXA 3C4ZA 4EK6A 3PA5A 5JGAA 4TYIA 4AN2A 4BTMA 4RIYA 2X39A 2OH0E 5K4IA 2IPXA 2E2BA 3GQIA 2W05A 4MTAA 5IUIA 4YJOA 3WZUA 4E6DA 4CGAA 4DEAA 5HCZA 3QA0A 1KE9A 5EYKA 3ZLWA 1J7IA 3W33A 4TYHA 2JIIA 1XHAA 2A27A 4IB5A 3BHTA 3R9HA 2BUJA 4DEBA 2QG7A 2VTTA 5IQDA 1O6KA 4D5KA 2H96A 3QD3A 4AW1A 5CEQA 5KNJA 3GP0A 2C1BA 4EC9A 4DFZE 1GJOA 4E3CA 5JSMA 5KMJA 4B99A 5EOBA 2O65A 1UVRA 3ZFMA 4BHZA 3NLBA 1Y91A 1IR3A 5GNKA 3A61A 4PDOA 3R7IA 3K3JA 2BAJA 4XRLA 2FSMX 4FTMA 4X21A 2JLDA 3V5LA 4F1TA 3QF9A 4RQKA 4O0WA 2WMSA 4ANBA 4BCIA 2WTJA 2X81A 2X9EA 3HMIA 4O2PA 5CYIA 4K1BA 2B9IA 3ZONA 4O81A 2OZAA 3ETAA 2BPMA 3PJ3A 5AV2A 3AD5A 4EH2A 3DXQA 4XOYA 3UVQA 4JDIA 3RCDA 3R30A 4G1WA 4AP7A 2VTRA 3O0GA 3OW3A 3FHRA 4RPVA 3LFDA 3WILA 3HA6A 4JDKA 1YWVA 1MQ4A 4OTIA 4FYOA 4P5ZA 3PXQA 4DA5A 2VV9A 4PMMA 4WBOA 3COMA 3D5WA 3NUAA 3R02A 4XG7A 3F61A 1P2AA 2IVSA 1M52A 4G9RA 3SQQA 2YAKA 4HVSA 5BNJA 5LVMA 2RG6A 4FK3A 2C3IB 1WBVA 2C5XA 1BYGA 4GUEA 4MCVA 4OBPA 2VWVA 4Z3VA 3UO5A 4MBIA 5KBQA 3HRFA 4CFXA 4WKQA 4EHEA 4CKRA 3F3UA 3MESA 3E88A 1FVRA 2JFMA 3ANQA 4MH7A 4BCNA 2YIRA 3HX4A 4BDBA 2DS1A 4EOPA 3G33A 4S31A 5HIDA 2OW3A 3VUTA 1OZ1A 4Q5HA 3ACJA 2OLCA 5GIOE 3HMNA 4YNOA 5A6OA 3TWJA 2C6MA 2FYSA 3PXRA 4DFLA 3F5PA 4CFFA 5CU3A 1KOAA 4HGSA 4H39A 2GDOA 3IDBA 2XS0A 4EUUA 2XH5A 5CF5A 3FLSA 5D41A 3KRWA 1YI4A 2JAVA 3O8UA 4ARKA 1O6LA 3PSCA 3GNIB 3BHHA 2ERZE 2REIA 2WTIA 2X0QA 2YDIA 3F66A 3I0QA 3II5A 3QRIA 2JKQA 4KIOA 4YZCA 1HCLA 4U6RA 4I93A 5AIKA 4CMOA 1W83A 4DEHA 3NFGB 1Q3DA 5AUZA 4K77A 5BQ0A 2VZ6A 3IDCA 4RJ6A 4RLLA 3W0OA 3ZXTA 3LPBA 2WTVA 4FV4A 4O4EA 5J95A 4IWQA 5H8EA 3OZ6A 4LOPA 5HCYA 4MQ2A 3FZPA 4BWPA 3LQ8A 3W0MA 3ATSA 4X2JA 4YHTA 2CKOA 4IX4A 1OPJA 2GSFA 4E6QA 4E4XA 4YSJA 2IF8A 3P78A 4NWMA 3UDTA 3H0YA 4TL0A 4JRNA 5IEXA 2X0OA 2OJJA 5C01A 5M07A 2BRNA 4CRSA 4IX5A 4OT5A 4QMPA 4A9SA 4ACDA 4GU6A 3D83A 2UW5A 3QQKA 2V62A 1K2PA 3EQDA 4PPAA 3UP2A 4YO4A 1U5RA 2W1GA 3DPKA 4L68A 4N0SA 4AXDA 1H1WA 4BWKA 4C36A 3RZBA 4ASZA 3IONA 5CSXA 5D9HA 4BL1A 3KL8A 2BHHA 5C8NA 3ORLA 5E90A 3KXMA 4CMUA 2UW7A 3FKNA 4L3LA 3A60A 5J87A 4A06A 3FWQA 4UYAA 3NUPA 5CQUA 4DEGA 2OF4A 2WMXA 3NW7A 4E20A 3EFLA 4X6QC 5LJJA 2QLQA 4NM3A 2WU7A 4NM5A 3UO4A 4RJ4A 2R3JA 1PXKA 5I3OA 5T68A 4C37A 1ZY4A 4C7TA 4DFUA 2I0HA 4J8MA 4WO5A 2ZV7A 4ZJJA 1BKXA 2XM8A 2X4FA 4CZUA 3M11A 5J1VA 4IC7A 2G2IA 4GKIA 4JNWA 3RGFA 4DH8A 3AC5A 4F9YA 1JPAA 3UG1A 1YXSA 4YJNA 1M2PA 1H1SA 2YM8A 3WZJA 3PYYA 3A7HA 4KA3A 3PG3A 3IG7A 2W5AA 3PXKA 2UW3A 4AT5A 4A9YA 3BELA 2XMYA 3FLNC 3QZGA 3Q32A 5JGBA 2OH4A 4MNFA 3MIYA 3FPQA 3KIOC 4P7EA 5KX8A 5E8UA 2R7BA 5IA1A 1ZMVA 3GU4A 3MFUA 3ITZA 4GK3A 3ZU7A 4YP8A 3OCGA 1YDSE 2FH9A 2WQOA 4OTGA 4BCFA 4FF8A 4RFZA 4UMTA 4O82A 4F9WA 2G2FA 4FV2A 4L42A 4UZHA 1UNLA 3MTLA 2CLQA 2VUWA 4FTUA 2F4JA 5L6WL 4IZAA 3IKAA 4D2WA 5IMXA 2QU6A 3DT1A 5KMIA 3KULB 4EK4A 2VWUA 2B9JA 1Y8YA 5AUUA 2A98A 3A7GA 3QX4A 4BCJA 4I6LA 2CKEA 4M12A 2CCHA 4U81A 2YACA 5AUYA 4AU8A 4BDHA 1MRVA 3CBLA 4KKEA 1OPKA 4LDTA 3PXFA 3ZO2A 4LV7A 3C0IA 2R3FA 3U87A 4DCEA 5BX0A 3ACKA 3Q9WA 2UZDA 3ZCLA 2C5YA 3OFMA 4BHNA 4O38A 3C0HA 2PE0A 1IASA 3VC4A 4EZ7A 5F9EA 5DYJA 4WOVA 4X0MA 4X6RA 2CNVA 2J0MB 4DCAA 1OKYA 1W2FA 4YZMA 5L8JA 3MWUA 2BRBA 2GFSA 3P08A 5LVLA 3R7VA 3DB6A 1CKJA 4OTWA 4EH5A 4RX8A 3CPCA 3ML1A 5IQEA 4B6LA 1XMLA 5JFVA 2W4KA 1JKLA 4FE2A 5A6NA 4H58A 2Y4IC 2P2HA 3ZYAA 4AGUA 4O7LA 3O5AA 3BV2A 3S4QA 4MHAA 3OT3A 4MXAA 2J0JA 1P14A 4F9AA 3FDNA 1GZNA 4Y8DA 5CF8A 3R9NA 1K3AA 1OL6A 4R1VA 4YPDA 5CEPA 4XG2A 1W2CA 1FINA 5B0XA 3ORNA 2YCRA 3QCSA 4FIJA 4QTBA 1BX6A 2JDVA 3TTIA 3EFWA 1H27A 3V5JA 3CJGA 3RBWA 3IO7A 4AXAA 3G0EA 4AFJA 4UMRA 2BZHB 3P4KA 3BE9A 4K11A 4FVQA 3P0MA 3ZUTA 5JFSA 5FDPA 3M42A 2ESMA 2VTAA 1TFFA 1XH4A 4ZS4A 5F94A 3KU2A 3H9OA 2WMAA 4D0XA 1YXUA 4IDTA 4BI1A 4DHFA 3QQGA 4C58A 3F88A 4C3RA 4HOKA 3QWKA 3TI1A 2JIVA 2ITOA 3MH0A 4I6QA 2A0CX 5IA5A 4C4JA 1H25A 5E91A 2W17A 4FSUA 3ET7A 2GS6A 3PDTA 4JJRA 3OUKA 3TV4A 4BKYA 3KKVA 3DK3A 4L3PA 3GCPA 3QXPA 3BYOA 3PUPA 5AM6A 4D2SA 1IA8A 1H01A 3I7CA 2Q0BA 3BHYA 4QQ5A 4U45A 3OWLA 2VWBA 3AD4A 1NVQA 2BRMA 2PZPA 3FYKX 4JBVA 3NRMA 5EM7A 2AUHA 3WARA 4G3EA 3F2NA 4YJQA 5EHOA 3SAYA 5A4CA 5CSWA 3W2OA 5AAFA 2GS7A 3UNKA 2RFEA 1G5SA 5I5ZA 4F9CA 2PUPA 4FR4A 5EFQA 4IZ5A 4QMMA 3RAHA 1TZDA 2YIYA 4F0GA 3R01A 3ID6C 4UXLA 3VBVA 1OKWA 2VTLA 3TCPA 1L8TA 1FGKA 1UWHA 3FMHA 1Q97A 1SYKA 4E7WA 4DYMA 4I5CA 4BIEA 4FV7A 4I3ZA 4FSQA 4WG3A 1GZ8A 5E8XA 3ZLYA 4WD5A 3K5VA 3VVHA 3HV7A 1OMWA 1UWJA 2RF9A 4YC6A 5CWZA 4EBVA 3KQ7A 5A14A 2WIHA 3EYGA 2J5EA 2VU3A 3I7BA 5EOLA 3V5WA 3ALNA 5I4NA 1F0QA 4MEDA 4XNEA 3GCVA 3PLAE 3Q52A 3RWPA 2JDTA 4J97A 5K5NA 4FNWA 1F5QA 2YA9A 4AT4A 3AD6A 4AOTA 4C61A 2ITUA 4CFNA 5IH6A 3DNEA 1REJA 3QRKA 4U7ZA 1ZWSA 4JLCA 3S95A 3HDMA 1PMEA 4IX6A 4A7CA 1AGWA 4DTKA 3T3VA 1Q8ZA 4XP0A 3FMDA 3P5KA 2YLEA 4AGDA 4CTCA 3VS2A 5TT7A 3HMOA 4FKJA 3UYTA 4BCHA 3EQFA 4EOLA 5L6OA 4RFMA 1YW2A 4OTQA 4X3FC 2W1DA 3SOCA 4BDFA 2GNFA 2BZJA 4A4XA 2O5KA 2ZMCA 2WB8A 4QMUA 5EQYA 4LGGA 5I3RA 1PKGA 2I7QA 2PY3A 3DK6A 5M53A 3GU6A 4MF0A 4E4NA 2UZVA 2XNOA 3O7LB 4R3PA 4YURA 5LWMA 5IA0A 4F09A 2JBOA 2I0YA 4O4DA 1PMVA 5DNRA 3WI6A 3BU3A 3TT0A 3MY5A 4P5QA 2W1IA 4IX3A 3IW8A 2QOIA 4R7IA 5GJFA 3WBLA 4EC8A 3HGKA 3TZ7A 3D5VA 4G17A 4QPMA 3C5IA 3L8PA 3OTUA 3PXZA 4KS7A 2QO7A 4D4VA 4FOBA 4FKGA 4LUEA 4I92A 5C26A 3E3PA 4ZZOA 1M17A 4KKHA 3AC4A 1Y57A 4YZBA 3KXNA 2X6EA 4IIRA 3Q9XA 2AEGA 3ZXZA 3KRRA 5FG8A 5CEKA 2CKQA 2WTKB 3CJFA 3MPAA 3DJ5A 4JDHA 5HTCA 3KFAA 1UNHA 3Q3BA 4AA0A 3G2FA 1BMKA 2F9GA 3DZOA 1VLRA 4FEVA 3RINA 4O7WA 2XBJA 2GMXA 4DBNA 3H9FA 5CU6A 2ZYBA 5J5SA 4RJ8A 4BZOA 5FWKK 5CZIA 5FEEA 2BDJA 4BTFA 1UU7A 3R8UA 2YISA 2PE2A 2W96B 4WRSA 4IVAA 4D2VA 3W32A 4NFNA 5HX6A 2X0GA 3M1SA 4CG8A 3FMEA 3DKGA 2JKKA 4QYYA 4UEUA 4YTIA 5EI2A 2YWPA 1CSNA 3I6UA 4GJ2A 5AP2A 4M3QA 2JD5A 2QCSA 5L4QA 3TTJA 1P5EA 3GC8A 3O51A 5AP1A 4TTHB 1H00A 4ANLA 1GIIA 3MW1A 4GK4A 3C1XA 4TKSA 5GHVA 4IH8A 4B9DA 1J1BA 4FKQA 4ACGA 5C9CA 5CF6A 2PUIA 2YM4A 2JFLA 3A7JA 1IAJA 5DBXA 3QU0A 1L3RE 2WD1A 2XZSA 3UC4A 5CAQA 3UQCA 3HAVA 4FC0A 3CEKA 4YJTA 4BN1A 2ZAZA 3W18A 4PX6A 5L8KA 2OWBA 3RK5A 3QD0A 4GYIA 4F7NA 5AR2A 4PNKA 3QZFA 3DKFA 3FQEA 4RVMA 5L2QA 4MK0A 4BZNA 1T45A 2ZV8A 3D2IA 3F3VA 3F9NA 4WNMA 5BV3A 4RIWB 2P0CA 4FKVA 3NNXA 3QQJA 4L7FA 4TW9A 1ERKA 5EYMA 1FGIA 4X3JA 5HE0A 2BHEA 3OUNB 2OFVA 5M44A 4ANQA 3FLYA 3QWJA 4QMTA 3O17A 1STCE 5GZAA 4YU2A 4FV1A 5HLWA 1FQ1B 3H9RA 4IWOA 4U9AA 4XEYA 3ZRKA 3KRLA 5IPJA 1M14A 3R63A 5FM3A 3VF9A 4FSMA 4CFUA 4PMPA 2GS2A 3LCOA 5G1XA 3FC2A 2R3HA 2XEZA 5IUGA 5CVHA 5KO1A 3K5UA 3U55A 2Q0NA 4TZRA 3BLAA 1ZRZA 2F2UA 3EKNA 4GIIA 2PZRA 3QCXA 5C27A 3P79A 2BFXA 4U97A 3VWAA 4JBOA 4BYIA 2ZV9A 2Z2WA 3QX2A 4FGBA 4C4GA 4II5A 4JVGA 3D7ZA 2GHGA 2W06A 3MVMA 2PVFA 4WNPA 4BCKA 3DBQA 2OJ9A 5TR6A 4TWOA 3VRYA 3OXTA 2VGOA 3FLZA 2WQBA 3CD3A 2FO0A 4FT7A 2PMLX 2VNWA 3HMMA 4ACMA 5A46A 5AADA 4R78A 5CQWA 3RPOA 5ACBC 1CMKE 3S00A 3FE3A 3AC1A 3Q04A 3QTRA 3R22A 3CCNA 4FVPA 4BWXA 4MXCA 5BUIA 4NZWB 3RTPA 5KKRB 4U5JA 2O8YA 1ZXEA 5FXRA 4BGQA 3EQCA 3OP5A 4BJJB 4JI9A 2W99B 3QAME 2FUMA 2YCSA 3WZDA 3BHUA 4KWPA 3I4BA 1H0WA 5HG7A 4YZDA 1RJBA 4IWPA 4ZLYA 2XK9A 1SNUA 5CI7A 3DCVA 3ORMA 4ZSAA 4JRVA 3TL8A 4EH9A 3GCSA 3MA3A 4W9XA 4PNIA 2PSQA 4DITA 2YEXA 5EM5A 2WEVA 5DRDA 1NVSA 4V0GB 4ZSGA 3WZEA 3L8VA 2CKPA 4MX9A 4ZSLA 2YN8A 4FV9A 4IM2A 5ANDA 4C34A 5AUTA 2FGIA 3R73A 2W1FA 4UY9A 4EHGA 1Y6BA 2IN6A 1WVXA 2QOBA 2OBJA 5AJQA 4ANSA 3O2MA 3LE6A 4DEDA 4PPBA 2BCJA 5DN3A 4AUAA 1U4DA 3L1SA 5DGZA 4FTOA 4TNBA 5EQEA 1KE8A 5LOHA 3DAEA 3DDQA 2ETMA 2W9ZB 3D5XA 3TJDA 3W0SA 3OBGA 2IG7A 1SM2A 2P33A 5DIAA 3R1SA 3R8MA 4LQMA 1ZZLA 3T8OA 4NKSA 4ZY4A 3VAPA 4EEVA 2R3RA 4JL9A 3E93A 4KINA 3PFYA 3FZ1A 2A4LA 4JG6A 5HVYA 5IA3A 4FBXA 3DAKA 3DXPA 5M4IA 3G51A 2VRXA 2WAJA 4FV0A 2CLXA 3DXNA 4C38A 3HNGA 4RT7A 5DPVA 2J0KA 1NXKA 3MY1A 3ZS5A 4L01A 2WGJA 4F9BA 4V0GA 4NH1A 4O7ZA 3NEWA 2R3QA 4YPSA 5I9UA 3VS4A 3PWDA 4D1SA 2QHNA 3PTGA 5B2KA 1WBNA 3FXWA 2CDZA 3NWWA 3QYWA 5IDPA 4NEUA 4RWJA 1YOMA 1U59A 5HTBA 2ZM1A 3BI6A 5DI1A 4ENXA 5J79A 3BCEA 5GJGA 2Z7SA 3EQBA 2CSNA 4O6EA 4QP7A 3PJ1A 4J53A 1S9JA 4U43A 2PVRA 5FP5A 4BDEA 1DM2A 1URCA 4O22A 2VD5A 3EKKA 4IAZA 4IVDA 2DYLA 4W4XA 3UBDA 3SW4A 4NSTA 1W0XC 4Y95A 4C02A 5LCJA 3W2SA 2PMIA 3DGKA 3KCKA 2XCHA 4R7HA 5KZIA 5BPYA 4QRCA 4HYSA 2WTCA 3FZRA 1GOLA 5E8VA 3IW5A 4FNXA 2V22A 5CVFA 3TV6A 3W2RA 4L53A 3MJ1A 3NYNA 1XBBA 4ZTLA 2V7AA 3RHKA 3PLSA 4HJOA 3WIGA 4KRCA 2YZAA 4JMQA 3TNQB 3Q9YA 1HCKA 3K54A 2C3JA 2EVAA 1R39A 2Y7JA 1G8JA 3MV5A 2PPQA 3PZEA 3FQSA 4FL2A 3RHXA 1SNXA 4EHZA 3TUDA 4J1RA 2GFCA 2X2KA 4WIHA 3QTQA 5ETCA 5BYZA 4AZEA 2YLFA 5E8SA 5E4HA 2EXCX 4QEBA 4PMTA 3PVGA 4MWIA 2J50A 5E9EA 2PVYA 5DHJA 3VHEA 4EONA 2W5BA 3BYUA 3MYGA 4IW0A 2R3OA 2GU8A 3LOKA 2Y6OA 2IZTA 5KE0A 4EK5A 1G8AA 3CTHA 3WIKA 4EZ3A 2YITA 4D0WA 3E64A 4R7BA 2WZJA 3OD6X 4JDJA 4R8QA 2J0IA 2CGVA 4PY1A 2XARA 4C4IA 2OICA 2WQMA 3FMNA 3SVVA 5GINE 4LI5A 4FOCA 2HXQA 4BF2A 3COHA 3ROYA 3RNIA 3ATTA 3DBDA 4I21A 4RIOA 2FSTX 4FVRA 3NS9A 3ANRA 4FSYA 3EN5A 2XK4A 4YC3A 4BDCA 4I0RA 3MH3A 3HUCA 4OTFA 4LOOA 4RVKA 4NYEA 4FTTA 4C4EA 3A7FA 2BROA 3W2QA 1LUFA 1UU8A 4JR7A 3ZEWA 4FIGA 2OIQA 1Q4LA 4CV8A 4EJNA 3VS1A 4PF4A 3UOLA 4ZZMA 3MIAA 5D7AA 4AE6A 2ITQA 1PXLA 3I0OA 2GNHA 5JZJA 3MTFA 3QTUA 5C4LA 2HK5A 4ZSEA 2VO0A 5DR2A 4TNDA 5HG9A 3SLSA 3RPSA 4EKKA 3R1YA 3UIMA 3UOHA 1ZAOA 1PRYA 3CQUA 2XB7A 5A4QA 4ZMEA 3OG7A 1H07A 4BIBA 1XMMA 3E87A 2IVVA 2I40A 3KC3A 4L00A 3FPMA 5IQCA 3CR0A 5HBJA 4NW5A 4S32A 3QCQA 4HNIA 5EH0A 1H8FA 2IZUA 3ENHA 4ZIMA 4QD6A 1JKTA 4GIHA 1O6YA 4PMSA 4XHKB 4LRMA 4O27B 3GENA 3W55A 4D2RA 3ZBFA 5CI6A 4NTTA 1KE7A 1PXJA 1YHWA 3NNUA 4B4LA 4XH6A 3EMGA 2QOLA 4DGOA 4QMNA 4FSZA 5M08A 3TNPC 4ZEGA 4HVHA 4KBAA 3F3TA 4H3BA 2HW6A 2OXXA 5FRIA 4BGHA 1KUTA 4X3FB 1ATPE 4LG4A 1G8SA 2VX1A 4CG9A 3BX5A 5K9IA 4S33A 1YKRA 3PG1A 4IAYA 4NW6A 4QNYA 4FT9A 1H1RA 3HKOA 2VTSA 5CAPA 3R7GA 4Z55A 5FP6A 3PY3A 3ZZEA 4RIXA 4FTAA 2XRWA 4ZJVA 2B4SB 4MKCA 2ONLC 4UWYA 5CF4A 5AIRA 3TDVA 5C1QB 5EDPA 3MGYA 1VYWA 3FLWA 4YJSA 5E8ZA 2XNPA 2NP8A 3LXLA 2BIKB 4FYNA 4DT9A 4O83A 4NM0A 4BDJA 4O2ZA 3IW6A 4EYJA 1UU9A 2XA4A 4QMYA 2G1TA 1YHSA 4TWNA 5ETAA 4C0TA 4KIKA 3QTWA 3KY2A 4FKRA 5HTIA 2C6TA 4QP4A 3E92A 3N51A 1ZYLA 4E5BA 2EU9A 2OIDA 3OOGA 4M66A 1NVRA 2C5NA 2V55A 3GQLA 3WE8A 3DAJA 1ND4A 5DEWA 3UZRA 4HCUA 5H8BA 3PE1A 4FZ7A 4BI2A 5EHLA 3ZBXA 5KCVA 4W8EA 4DDGA 3D14A 5D1JA 4X3FA 1KOBA 1UA2A 4TRLA 2C69A 3F3ZA 3UO6A 4DTBA 1R78A 5BUJA 4D58A 4RA5A 2E9UA 4PL4A 3SV0A 2WPAA 3DBEA 4ENYA 1REKA 2BAKA 4G5JA 2HWPA 2R64A 4A4LA 5DR9A 4MQ1A 4CV9A 3FLQA 5DA3A 4CFVA 2GHLA 3QHWA 2OFUA 3E3BX 2PZYA 4BICA 3P5JC 3DTCA 3G9NA 2X7OA 4H36A 2C68A 5AFVA 3NW5A 4FSWA 5J8IA 4I6FA 5DT0A 1ZMUA 3OWPA 1KE5A 4KBKA 4YJRA 4ZTRA 3P86A 3PWYA 1W7HA 3FUPA 1J1CA 3IS5A 4GKHA 2C5VA 3VF8A 2YCQA 3TZ8A 2WQNA 3UQFA 3CSVA 3FSKA 4IZ7A 4R3RA 3PVUA 2J7TA 4FNYA 3BYVA 4GU9A 2Z60A 1H26A 5C8KA 2R7IA 1VEBA 1FMKA 4YTFA 4NL0A 2G9XA 4MBLA 1VYZA 5IF1A 3DY7A 3BYMA 2UW6A 4IB1A 4ZY6A 1TQMA 3MFSA 3VHKA 3JR1A 3EL7A 2HW7A 4QMZA 5FBOA 2IW8A 5A54A 2EXMA 4RC4A 2WOUA 4UYNA 1GY3A 4LUDA 3OTVA 4U0IA 1JBPE 2UW4A 3ZTXA 2QR7A 4L7SA 4AS0A 3MVHA 4P90A 4FIIA 4IWDA 5CSHA 4MNEB 1U5QA 3WF7A 3H30A 3W8LA 4R3CA 2ETKA 3AC2A 3VJOA 5CXZA 4MXOA 2B1PA 4OUCA 3LMIA 3GC7A 2GNGA 2ITNA 2J6MA 2KULA 4IAKA 4IMYA 3VS7A 2HZ0A 4BTJA 4EWHA 3H10A 4BDDA 2XNBA 4H3PA 3WYYA 4G9CA 4ITIA 4NCTC 3CTQA 2B55A 3EHAA 3BE2A 1T46A 5LMKA 3D4QA 2W4OA 4FT3A 3BL7A 3O8TA 1VJYA 1R0EA 2E9OA 2QG5A 4I0TA 3PIYA 1QL6A 2CNUA 3PIXA 4JBQA 4EWQA 3LFSA 4J98A 2QOQA 2I6LA 2XVDA 3DZQA 2IO6A 2JKMA 2R3NA 4U40A 3R7UA 3W1FA 2BRGA 2UZWE 3RNYA 4GT5A 4LV5A 4CD0A 5CAUA 4BI0A 4YTHA 4M0YA 4LMNA 2QKWB 4EUTA 5AAEA 4I41A 4KBCA 1KV2A 3WF9A 3PA3A 4BBMA 2IVTA 4MNEA 3BU5A 3TXOA 3WZKA 3W0QA 5BVDA 3QD4A 2WFYA 2X4ZA 3QXOA 2VTIA 3I6WA 3OT8A 3LMHA 3DDPA 4JT3A 5HU9A 4CKJA 3N4VA 2FB8A 4FMQA 5JZNA 3SXSA 4ZZNA 4KS8A 4RQVA 4OAUC 2ZFYA 3C13A 4U41A 3ZDIA 3FV8A 1XBAA 1PXPA 4IZYA 3WYXA 2O2UA 3LQ3A 3I60A 3HRBA 5AX3A 4FV6A 4XP3A 1ZYDA 5KZ0A 3TYKA 4PL5A 5AR8A 4ACHA 3LFFA 1JKKA 2LAVA 2X9FA 3PXYA 3C0GA 2YIQA 3BU6A 5F4NA 2QO9A 4C35A 2GQGA 5HVKA 4J8NA 4AWIA 4GEOA 3BPRA 3BGZA 3BWJA 1SVEA 5D10A 4LGHA 4FTIA 4HGEA 2UW8A 1FOTA 5L6PA 1YRPA 5HEZA 4F6SA 3KVXA 4EKLA 2C30A 3CP9A 3LHJA 3EWHA 3EFKA 5CX9A 1PKDA 1AD5A 4J96A 4K18A 3PJ8A 2C0OA 3CQWA 4JX7A 3OVVA 5M56A 4F65A 4GV1A 1Z57A 2VO7A 3ODYX 3UTOA 4UZDA 3EJ1A 1WBOA 1QPEA 4RWIA 3LM5A 4S30A 4GRBA 3CXWA 3NCGA 4CVAA 5HKMA 3TIYA 2B54A 3TZ9A 2R5TA 3ZSGA 3DOGA 5HE1A 2XK3A 4CCBA 4NUSA 5JQ8A 2HZ4A 1PXIA 4Q5EA 3K2LA 2R2PA 3P23A 4TWCA 2CN5A 3KMWA 4DLJA 3FZTA 5EDRA 3R2BA 4DH5A 4EQMA 3E8CA 5JRQA 4GUBA 4JXFA 3CE3A 1UKIA 3MPTA 5AUWA 3W2CA 4O0YA 3ODZX 4QQJA 5J7BA 5HNIX 2UW9A 3QTZA 2A1AB 4OBQA 3AT2A 4UMUA 4UWCA 5AAGA 4QTAA 2JDSA 3EYHA 1PXNA 5KBRA 2J4ZA 5BVFA 5TOZA 1CDKA 4PDYA 3RAKA 1Q99A 1Z5MA 4AA4A 1Q3WA 4XLIA 1NY3A 3WF6A 2B0QA 3FZSA 3GGFA 4YZ9A 3W10A 3PJCA 2GTNA 1MRYA 4BC6A 1HOWA 3EQGA 5FTQA 3C9WA 2V5QA 1LP4A 3OWKA 4RA4A 5HD7A 3IDPA 2GTMA 4IB3A 3V5TA 2F7XE 2ZVAA 3QBNA 3L9PA 4WUAA 4AFEA 3SC1A 4C4FA 3LVPA 2R9SA 4G3GA 4C57A 2SRCA 4EH4A 4KABA 3CPBA 4PDSA</