5EI2A

Rapid discovery of pyrido[3,4-d]pyrimidine inhibitors of monopolar spindle kinase 1 (mps1) using a structure-based hydridization approach
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
279
structure length
256
Chain Sequence
QSMSVKGRIYSILKQIGSGGSSKVFQVLNEKKQIYAIKYVNLEEADNQTLDSYRNEIAYLNKLQQHSDKIIRLYDYEITDQYIYMVMECGNIDLNSWLKKKKSIDPWERKSYWKNMLEAVHTIHQHGIVHSDLKPANFLIVDGMLKLIDFGIANQMQGTVNYMPPEAIKDMKISPKSDVWSLGCILYYMTYGKTPFQQIINQISKLHAIIDPNHEIEFPDIPEKDLQDVLKCCLKRDPKQRISIPELLAHPYVQIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Dual specificity protein kinase TTK
publication title Rapid Discovery of Pyrido[3,4-d]pyrimidine Inhibitors of Monopolar Spindle Kinase 1 (MPS1) Using a Structure-Based Hybridization Approach.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 74
structure length 256
sequence length 279
ec nomenclature ec 2.7.12.1: Dual-specificity kinase.
pdb deposition date 2015-10-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 5ei2A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 5ei2A01
4KRDA 3LMHA 4H3QA 4YPDA 2WMTA 1REJA 1UNGA 4XG9A 4R78A 4IW0A 4BY9E 1JSVA 5EDPA 5BVDA 2YCRA 2O3PA 2R3IA 3WZEA 3R7YA 2JC6A 3LPBA 4WD5A 3KN5A 3ZTXA 2NP8A 2X9EA 3NSZA 4EK6A 4C2WA 5KZIA 5J1WA 3BBTB 2BZKB 3QTSA 2QD9A 3TDWA 4ZTLA 4DFYA 5HTCA 4OBPA 4JG8A 4A9UA 1KE8A 4TRLA 3WE8A 3AGMA 2DWBA 4TTHB 3OT3A 4Y5QA 3NW5A 4D4RA 1ZARA 5FM3A 2PTKA 3C51A 2Z60A 3FMDA 4TT7A 5HTBA 4RJ8A 2RSVA 3D4QA 1TKIA 2C6MA 3R00A 4TWPA 5C03A 3TCPA 3VC4A 3KRJA 4L44A 2BHEA 2C5YA 3HECA 2Y6MA 1WVYA 2EXEA 4KKEA 5JFVA 4DTKA 4EC8A 1WBOA 3KVXA 1WVWA 4KSPA 4EL9A 1LP4A 1ZY5A 4NKAA 5J79A 3DKFA 3MY5A 3ORKA 4QO9A 3FUPA 2O0UA 5CEIA 3LFNA 4BZDA 4C36A 1H1RA 3S4QA 4X2KA 1LEZA 1M2QA 1YXSA 3FMJA 3PRIA 4XEYA 4BWXA 3N4VA 4Y83A 4FKTA 1U46A 4U97A 4C4FA 4O7WA 2GFSA 3W33A 4AW1A 1LUFA 4HGEA 4PV0A 3JYAA 4C02A 1J7LA 5CEPA 3ID6C 2OLCA 2GSFA 2OSCA 2XKEA 3O0GA 2PVJA 3QQHA 4FG7A 3JR1A 5KMLA 4JVGA 1WBPA 3GB2A 4RJ4A 5ETCA 5FTGA 3U87A 3QQJA 3UO6A 3R7EA 3TEIA 3WBLA 3W55A 3FZOA 5IA5A 1OUYA 5HBEA 5TOZA 4DN5A 3ATSA 3DXQA 2P0CA 4GYGA 3S2PA 5FBOA 2QOFA 3WIKA 3ZMMA 4FEUA 2JFMA 4O1OA 4QQ5A 4ZK5A 4J53A 4FT7A 4AGUA 1OKWA 3SW4A 4FG9A 4NZWB 4QP1A 4E4XA 5KKRB 3L9NA 4F6UA 4ZTQA 2CMWA 3PDTA 3P7AA 1UKIA 4FKUA 2EWAA 2LAVA 4IJ9A 3ZO1A 1ZRZA 4FGBA 1PYEA 2VTHA 4FZDB 5TF9A 3VS4A 5ANKA 4FBXA 3KCKA 4USEA 4IBMA 2PY3A 3AMYA 3VRYA 3FEGA 4O0YA 2BKKA 5JZJA 1YOJA 1RQQA 2C5XA 4FYOA 3IGOA 3UBDA 3CS9A 2YM8A 3WYYA 4Z7HA 4ZAUA 4M69A 3ENMA 3DLZA 4L3LA 4WG3A 5EHOA 4FSUA 3NNVA 3AD5A 3BGQA 5EM8A 4EOOA 4FIEA 2CDZA 2R3QA 3AQVA 4FKLA 4Q9SA 1CMKE 2VX3A 4BTFA 2QG7A 3L8PA 1FBNA 4NU1A 2UUEA 4EZ5A 2W9FB 3S95A 2JLDA 3FI4A 3GVUA 4YO4A 4RIXB 3D7TA 3QRTA 4OAUC 4TPTA 4UN0C 2PE2A 4F9WA 3G90X 4XLVA 3ZXTA 4RX7A 5JMSA 2BVAA 2WTVA 3T9TA 4O22A 2C47A 3RK7A 3ZXZA 2VO6A 4E1ZA 3GCUA 3FBVA 4YLKA 4QQJA 3E8NA 5J9LA 4LFIA 1IASA 3F6XA 5HU9A 4ANQA 1CTPE 2G01A 3VS3A 4QYYA 3A4OX 4BCFA 5HLWA 5AA8A 1J1CA 4R3PA 4Z16A 1QL6A 3O8PA 2X7GA 3R8LA 5CSWA 2YM6A 4DBXA 4C33A 5HO6A 1JKKA 2WB8A 3TT0A 4U3ZA 1E1VA 3QTXA 2Z2WA 3OWPA 3C1XA 4GG5A 1WFCA 3EN5A 2J4ZA 2VX1A 1Q61A 2B52A 2FYSA 1B6CB 3OXTA 5CVFA 5EOBA 3NNUA 5HE1A 4C4JA 1SNUA 3QHRA 2IPXA 2WOTA 3WF9A 4YSJA 5AFVA 2GTNA 2HZNA 4NM5A 2WMBA 2ITOA 3RALA 3K3JA 1NT2A 4YP8A 1XQZA 3WOWA 3TXOA 4RVLA 1OKYA 2BAJA 2QODA 3C4CA 2X6EA 4HPTE 4K6ZA 4U5JA 2RKUA 4GL9A 5ANJA 4AOTA 3KQ7A 5E1SA 2HW7A 4CQGA 4EJNA 3G15A 4R3RA 1FMOE 3EIDA 5E8ZA 4I20A 5AP1A 5E1EA 5EM6A 3D7TB 4AN9A 1KV1A 4ZTSA 1H1PA 2HOGA 4BRXA 2J0MB 4XNEA 4LMNA 5L6WL 3BBWA 4TYJA 4QT1A 4QNYA 5KMOA 2QC6A 4XP3A 4AN2A 5JFSA 5M53A 2XM9A 4FA2A 5AAFA 3QKMA 1GZKA 1IR3A 4S33A 1Y91A 2PE1A 3FPQA 4CMTA 2FSTX 4TKSA 2OWBA 4AGDA 5A6NA 5KKRC 5J7HA 4Y73A 1BL6A 4MYGA 3EOCA 4RLKA 5HIDA 4CFNA 3EQIA 4B8LA 2WIHA 4YC6A 3CPBA 3S0OA 2HW6A 2JAMA 2GMXA 4MF0A 3L8SA 3BPRA 2C6TA 2R0IA 4BIEA 4BWKA 3RKBA 4RMZA 2UW5A 4W4VA 3Q5IA 2Z8CA 3UE4A 4BHNA 4QPMA 4R1VA 2JD5A 4YJQA 1U54A 1BYGA 3UZRA 2Q0BA 2XNBA 3BYMA 3NS9A 2VN9A 4OW8A 5HBHA 2P4IA 3KVWA 4NM0A 3CKWA 1S9IA 3QALE 2V0DA 4HGTA 3SD0A 2PMOX 3O51A 2W5BA 3MSSA 3W2QA 3RCDA 2C3IB 1XH8A 3HZTA 3FLZA 4AAAA 1UVRA 4WNKA 3F5PA 4XMOA 3F3VA 3TI1A 1XH9A 4FOCA 1URCA 4N6YA 3UDBA 3L9LA 3WARA 4D4SA 5JFXA 5J1VA 4R1YA 5M51A 2W4KA 3HYHA 4UYNA 3R8UA 5C1QB 5EM5A 1YXVA 4H05A 3IECA 1WAKA 2IVUA 3V8WA 1JKTA 2XKFA 4XG7A 3D5VA 3G51A 2YM5A 4RQVA 5AP2A 4WSQA 3RTPA 4CFXA 4UMRA 4J8NA 3MH3A 2GHLA 4FKPA 4NIFA 4Y72A 4EBWA 4QMYA 1JBPE 4V01A 3W8QA 5M08A 1YOLA 3P4KA 4EHGA 2NO3A 2IJMA 5AWMA 2QOLA 5A46A 4LL0A 5CEOA 3MH1A 3OBGA 5J95A 4C8BA 3DZOA 1XJDA 3DBCA 2FVDA 5FBNC 1OPLA 4DLJA 1NVQA 4F7LA 2PULA 3DBEA 5IH6A 5CQUA 3GCSA 2UVYA 5DA3A 3R9OA 2YACA 3G5DA 4MNEA 4CLIA 1XWSA 2ETMA 2W4OA 1KOBA 3FZSA 4J71A 4D2RA 3IDBA 4K0YA 4BCNA 3H0YA 2O63A 3DKCA 4WUAA 2EUFB 1YOMA 3BELA 3LJ0A 3R2BA 2R3HA 3DFCB 2EU9A 5AADA 3QD4A 1SMHA 3R8VA 2PL0A 3EZVA 3ZLSA 4NKSA 1NA7A 3OD6X 2CKQA 4O84A 2WQOA 2W99B 1M17A 2QLQA 4DLIA 3KULB 5KMJA 3AC4A 4ZS0A 3HKOA 4FTKA 3RM6A 4KIQA 1KE6A 5DGZA 4MBLA 2QOQA 5GHVA 5BYLA 3CPCA 2XK7A 4FF8A 4AF3A 4DG2E 2OJFE 5CI6A 3FZPA 4OAVB 4AN3A 3SX9A 1PXIA 2OW3A 2F4JA 3JVSA 3EQPA 4YTHA 5HG8A 2O5KA 3V8SA 3RPSA 4EUUA 4WG4A 3SG8A 1DI9A 3G9LX 5ETIA 4CKRA 4NIFB 3R6XA 5TO8A 5I4NA 3R83A 2PVHA 3Q4TA 5CT0A 2ZB1A 4V04A 1V0OA 4OTQA 4ASEA 3K5UA 4NW6A 3MJ1A 3O23A 4E5AX 5AJQA 4NSTA 5CF5A 1YDRE 4WKQA 1OZ1A 4GVJA 4J8MA 2ITUA 2V7AA 4ANBA 5IEYA 3MJ2A 1WMKA 2VWZA 5K5XA 1SYKA 2PSQA 4HVHA 3EYGA 5BUEA 2HAKA 2Y8OA 5BYZA 1DAYA 3CBLA 4GW8A 4F64A 2QO9A 5I9XA 4PNIA 5DT3A 4FKQA 1FVVA 3DOGA 2QKRA 3L8VA 2AYPA 3U4UA 4IQ6A 4ZP5A 4OLIA 3OWLA 2BRNA 2GS2A 3SKCA 5CQWA 2JDTA 4YSMA 2H6DA 3BWJA 4FSWA 3F7WA 3GCQA 3O7LB 4OBQA 5FG8A 3MVMA 3VS1A 4K18A 4FKRA 4WHZA 3BRBA 3O71A 4KNBA 5C8MA 4EOKA 1H27A 3O8UA 4DYMA 3RINA 5L4QA 4RC4A 4AT5A 4AA0A 3PIYA 4FV1A 3ZYAA 2HYYA 2HXLA 4CTBA 4GMYA 4YHJA 3R0TA 3QLGA 3HRFA 3BE9A 4XBUA 2IZSA 3RJCA 3E8EA 4IH8A 2R4BA 3M1SA 2CGWA 3VF8A 4JDHA 2W0JA 5C8KA 1Q3DA 2PVNA 5E8XA 5BX0A 4L9IA 4P5ZA 2Z7QA 4WBOA 3G33A 4ZSJA 1OITA 3TG1A 3ZC5A 5DPVA 3DA6A 4DEIA 2JEDA 3GI3A 3W2SA 4M7IA 1GZOA 5CEKA 4DGOA 3BZ3A 3PY3A 4RZVA 5JGAA 5EQEA 3QD0A 3BHVA 3Q2MA 3MTLA 3TL8A 2HY0A 3PA5A 4AQCA 3KXNA 3CTQA 1RE8A 1H8FA 4I5MA 4UMPA 3DS6A 4CSVA 5FDXA 4RG0A 4MAOA 4YC8A 3D7ZA 4FC0A 3TN8A 2V5QA 4AU8A 5JGBA 5AM6A 4A07A 5IQIA 1V0BA 4PWNA 5CYIA 5LMBA 3OXIA 4IX5A 4D5KA 1MUOA 5I3OA 2IVSA 4YLJA 3ORPA 3QQFA 1UWJA 5M07A 4FTRA 2X8EA 4I0TA 4PX6A 2XUUA 4OTHA 2QQ7A 5E92A 3NVMB 5EG3A 3FXZA 4BFMA 4LRMA 3IG7A 4B4LA 4JG7A 4WUNA 4O83A 4HYUA 3V6RA 5A6OA 3DK3A 1APME 2J6MA 4JX7A 4UV0A 3I0QA 5DFPA 4V0GA 3BEAA 3IGGA 3K3IA 2YDJA 4EOJA 1DM2A 4BKYA 1K2PA 5J87A 1ZAOA 2B0QA 1AGWA 2RG5A 4KBCA 2VO0A 3EMGA 2NNWB 5GIPE 4FKGA 3BIZA 3S1HA 1G8SA 5H2UA 4C3RA 3KRLA 4FZFB 4TWOA 1YI3A 2WMXA 2GPHA 2UZUE 4P5QA 3QTQA 3QD3A 5CEMA 2HK5A 2XNNA 2FO0A 2QHNA 5K0XA 3V5TA 1BUHA 5CENA 2C30A 5DYJA 5DIAA 2CNQA 3MDYA 5M06A 3D5UA 4NTTA 1NVSA 4CZTA 1Q62A 3G9NA 3UVQA 4FG8A 2XP2A 4CEGA 1KE7A 4RC2A 1MRVA 3BHHA 4EH8A 3BLQA 3F66A 2ZMCA 3ZO4A 3FMLA 3QC4A 4O7TA 3LLAA 2GNFA 3C4XA 4G3FA 3C4FA 4UEUA 3PJCA 5L2SA 5KBRA 3F5XA 4N0SA 4DT9A 4G5PA 3PJ3A 4YGAA 5BPYA 4LGHA 3WZUA 2XK3A 4Q2AA 5EI2A 2XA4A 3R1NA 3FL4A 4KAOA 5HCYA 4ANOA 4FT9A 4FNXA 3UTOA 1S9JA 5GJFA 4BICA 3AC8A 3SRVA 5IPJA 3OWJA 4TYHA 3GFWA 2QOHA 3GP0A 3R21A 4TWCA 5AV3A 1H4LA 5CF8A 5HVYA 3VHKA 4G3EA 2OJ9A 2WEVA 4D5HA 5DNRA 3RAHA 3LFBA 4YJVA 3SXRA 3BYOA 5FD2A 5BVEA 3QRIA 4OTPA 4XV3A 3B8RA 5B2MA 5CALA 2DS1A 5DHJA 2Z7RA 4DG3E 1PMVA 5KE0A 1ZOEA 4II5A 2W1DA 4WRGA 5CU4A 5IQAA 3H10A 4PPCA 3WF5A 3AXWA 4ZMEA 4D4VA 3OW3A 5AAEA 3V5WA 3VQUA 3SOAA 3HAVA 5KX8A 4E6DA 1R1WA 3L9PA 2OG8A 2BRHA 2R0UA 2C68A 3F82A 3LXKA 3KB7A 1XH4A 1U59A 4OT6A 4X3JA 1YDTE 5E7RA 5E91A 4EUTA 4M13A 4EYJA 3AG9A 4CXAA 1PW2A 3QZIA 1IG1A 1AD5A 4IM2A 3RK5A 1ZMUA 3WZJA 4RIYB 5KMNA 4XV9A 4JDJA 4FOBA 4WNMA 3DAKA 3FV8A 5L2IA 3BU6A 4FTOA 4GFGA 2P3GX 3VUKA 3PWDA 2HXQA 2VNYA 2YERA 2F7EE 3ERKA 4EH4A 2YZLA 3WZKA 3OXZA 3PA3A 4YTCA 3D15A 3LCSA 4L3JA 3P7BA 5AP0A 3FXWA 4YNOA 4GUBA 1YRPA 4U45A 3QLFA 3UO4A 3FZTA 2YCSA 4HGLA 1JSUA 4QYEA 4CRLA 2XS0A 4FNZA 5DN3A 1NVRA 3KA0A 4A9SA 2OGVA 5L2WA 3I5NA 3MI9A 5JK3A 4JR7A 5BMSA 5HESA 1XBBA 2YIQA 2R9SA 2XCHA 2WGJA 1U5QA 2A27A 4DGMA 1JKLA 4E20A 3ZSGA 4E6CA 5KCVA 2OBJA 2QKWB 1PXPA 1P5EA 4ACHA 2P2IA 4W4WA 4FV3A 3V51A 4ANMA 2RG6A 5CAVA 2Q0NA 3VBYA 1MP8A 3KRWA 4J95A 3C50A 4W4XA 1ERKA 3AMBA 1ZLTA 2X4ZA 1OKVA 2UW8A 4FX3A 5DRBA 4RFYA 3VS7A 2A4LA 2WU6A 4GIIA 4Z9LA 4AA4A 3M2WA 1GIJA 2B9JA 3R1YA 4EOQA 2WHBA 4CLJA 3DNDA 2RGPA 1ZYSA 1P4OA 4TXCA 4JX3A 5HIBA 3FMKA 5K5NA 4PDSA 5KHXA 4Q5HA 4DEGA 1Q8UA 3QTZA 1FGKA 4PTGA 1Y6BA 3GT8A 4IWDA 3UYTA 4YJOA 3RPRA 5EQYA 4U43A 3ET7A 1M52A 2Y0AA 3EL8A 4IVCA 5IMXA 2BZIB 4GUEA 3HUCA 5M4CA 4KWPA 5EW8A 2PU8A 2DYLA 3PXQA 3CTJA 4IVBA 4CNHA 1IA8A 3DKOA 4W4YA 2PZRA 3ZFMA 1JWHA 4C4HA 3OG7A 4O0UA 4M0YA 1YHSA 4BDDA 4BIDA 3A2CA 5HG7A 3IQ7A 4FIHA 5B7VA 2WPAA 3NPCA 3IDCA 3U4WA 4AZVA 2CN8A 3QTWA 4U7ZA 5AIRA 4DGLC 3DAJA 2UV2A 4IAZA 4LM5A 2WZJA 3RCJA 1L8TA 3VVHA 4AS0A 1CSNA 3PA4A 3FYJX 5GZ8A 2A0CX 4ACCA 4PP7A 4QTAA 4FKSA 2B9FA 2VO7A 3ORZA 3R7IA 4DG0E 4CVAA 5IQCA 3KL8A 2CNUA 4IWOA 2I0YA 3OHTA 3V5JA 3PJ1A 4MXAA 5IG1A 4I1ZA 4I6FA 4MQ1A 4YJPA 2QR7A 5LCKA 2ZYBA 1XH6A 3GC9A 3TIZA 2UW0A 2YM3A 4MBIA 4X21A 2R3MA 4D1XA 4C38A 4HZSA 4U44A 3TUDA 2QOBA 3F2RA 4JXFA 4I0RA 5C27A 2OO8X 3T3UA 4KIKA 2BAKA 4CFMA 2XF0A 2A1AB 3AD4A 4BDGA 3MYGA 4H3PA 2BTSA 3BGPA 5EFQA 4JI9A 1F5QA 4L8MA 4FIJA 4PL4A 3KXZA 2QOKA 4NJ3A 4U79A 5CU6A 3UMWA 4CMUA 4O86A 4CG8A 1P4FA 3F5UA 4RJ5A 5FP5A 5B2KA 3TNWA 5CSPA 1WBVA 4USFA 4LYNA 2YDIA 5IQBA 4EH2A 1W82A 3FDNA 4I6HA 3ACKA 4L3PA 2FSMX 1K3AA 5CXHA 4BDAA 2P2HA 3C4WA 2PMNX 5D12A 2VTJA 2I40A 4UMQA 5AV0A 1YDSE 4C34A 3FXXA 3OUKA 4ORKA 4MF1A 4IDTA 4FSTA 3UOHA 4ZLOA 4CGAA 2PK9A 2R3FA 2XJ2A 4KIPA 4ACMA 3W2RA 5FGKA 2JIVA 2OH4A 3DZQA 2XNOA 3V5QA 2A2AA 4IC7A 4U40A 3SW7A 2VTSA 3CQWA 3ZFYA 2PHKA 5HGIA 3LFSA 1UU3A 2ZM4A 4M84A 4AGWA 4EK4A 4BI0A 4HVDA 4RT7A 4D28A 4L6QA 5AR7A 4F9BA 1W0XC 4BVUA 5EM7A 5E9EA 4C57A 3QKLA 3LCTA 1DS5A 4JJRA 3GCPA 5CU0A 3ETAA 1X8BA 2C5OA 2C0OA 5CSVA 3VWAA 3PY0A 3FLNC 4GT3A 5HLPA 4ITHA 4QYGA 3RZBA 3ZZWA 4GKIA 3NNWA 4DTAA 2RF9A 4BZOA 2VTMA 4L43A 2XMYA 4K1BA 1OL7A 4FSZA 2GU8A 1BL7A 4Q5EA 4NTSA 5HCXA 3THBA 3QTRA 4HYHA 2YIWA 4XG2A 4BYIA 3IOPA 4FGRA 4R7IA 4XV2A 4RX5A 3EYHA 2RIOA 5HO7A 2BCJA 2YWVA 2R2PA 2XCKA 4N4SA 5LCJA 3FLYA 1RJBA 2ITXA 5T3QA 3VW6A 3QWJA 4QMMA 3BQCA 4BB4A 4W8DA 4I92A 5L8LA 4O2PA 2JKMA 3FSFA 3TNQB 3TTIA 5CI7A 3ALNA 4B7TA 4R77A 2B53A 3HV3A 4FT5A 3EQDA 2J7TA 4I3ZA 5LXMA 2X2KA 3H3CA 5IA3A 3A4PA 2Y6OA 4MEDA 2OF4A 4FKJA 4FTIA 3LQ8A 4ENXA 5CF4A 5JEBA 2G2FA 3NAYA 3Q4UA 3FC2A 4QMZA 3AOXA 1YI6A 1OL6A 4KBKA 3MPAA 3HRBA 4NK9A 4WNOA 3VUTA 3O2MA 3LAUA 4FUXA 2WMUA 4ZIMA 2E2BA 1YXXA 3DJ7A 2LGCA 4CCBA 2YJSA 3QQUA 3LKMA 3G6GA 5CVGA 3PIXA 3HMNA 3QZHA 4LL5A 4EYMA 3MB7A 4KS7A 5E4HA 3I81A 3CGOA 3LXPA 3LFFA 2YEXA 3UVPA 3L9MA 1QMZA 3G6HA 4W9WA 4XUFA 3SOCA 4U41A 2R3OA 2ZDTA 4O0XA 4C3FA 2Y4IB 5FEEA 1VR2A 4ZOGA 4X3FA 4DTBA 3W18A 4EHZA 4GIHA 2OF2A 3HP2A 5EI6A 2ZV9A 4I4EA 3GOKA 3NUAA 1BLXA 2R3PA 3MIYA 3TKIA 3D0EA 4IHPA 2Z7SA 3ZFXA 4RX9A 4RWJA 4ZY4A 5ACBC 5DR6A 3TKHA 3PP1A 2GHGA 1U5RA 4XP2A 3ZRKA 1CKJA 3MB6A 2VTTA 2PUPA 3CP9A 4EKKA 4FSRA 1YI4A 4F6SA 5M4IA 4O7YA 3K5VA 4QRCA 4QQTA 3RPVA 5DRDA 4ANLA 3R73A 4HNIA 3NUNA 4MD8E 1YVJA 1Q24A 2FUMA 3PE1A 4I5HA 4YU2A 4EZ3A 1OECA 2BIYA 5HNGA 5AV1A 3U54A 4GK4A 1FMKA 3W10A 5L6OA 4D2TA 4J1RA 5A14A 5CAOA 4O7SA 3LJ1A 4H1MA 1UV5A 1XKKA 2OIBA 5ICPA 4DA5A 2ZV2A 3NGAA 2JITA 2WTWA 3TTJA 3ZZEA 2V55A 5BNJA 3RMFA 2NPQA 5HCZA 4C59A 3FKNA 2JDOA 3LCDA 3ULIA 3VRZA 3GUBA 1UA2A 4QMOA 4KKHA 3D9VA 3LM5A 3QA8A 3DBQA 4RA4A 4O7RA 4ZZNA 3RNIA 3L8XA 4C4IA 4RQKA 3HNGA 5BQ0A 1W84A 2PWLA 3KRRA 3BI6A 5KMIA 4FKWA 5GJDA 3OCBA 4YO6A 5GIOE 5FXSA 3N51A 3O50A 1Q8TA 3OEFX 3R1QA 4PPBA 4A4XA 4ZLZA 1OBDA 4RIOA 1WBWA 3FKOA 4GJ2A 5A4LA 1MRUA 3ORMA 2VX0A 5IF1A 1ND4A 5IQDA 1SVEA 3E64A 4K8AA 4TNBA 5CEQA 3QQGA 3CXWA 2XK8A 3UO5A 1BI8A 3B8QA 3OCGA 1KOAA 1O9UA 4ASXA 3DXPA 1YXTA 4M69B 4EH7A 1OIUA 1JQHA 2BR1A 3ZEPA 3R22A 4QYHA 3A61A 3Q53A 2V62A 1KSWA 3PPZA 5F4NA 4L01A 4JLCA 2PYWA 4E6AA 4HW7A 2YISA 3DDPA 1R0EA 4IJPA 1WBTA 4JIAA 3CIKA 1OKZA 2B54A 4FTJA 2CHLA 2HIWA 4F4PA 1IEPA 3MPMA 4C0TA 4HCUA 3T3VA 4WIHA 1BMKA 5KZ0A 3UNJA 4CRSA 5KMMA 4CQEA 2XBAA 2PMIA 4D2SA 2BFXA 3A8XA 3SHEA 3HV5A 3E8CA 4A4LA 3ZUVA 1H1SA 5C9CA 5L3AA 3O7LD 2Y4IC 4IACA 4I5CA 5HG9A 1QPEA 1U4DA 5CLPA 4MTAA 4NYEA 2H9VA 2J90A 5AUWA 3LOKA 4FEQA 5AUZA 3V8TA 4XCUA 3F3WA 3HA8A 2VTIA 3EB0A 3QRJA 1WBSA 4AACA 4BC6A 3HUBA 4DT8A 1JLUE 3DU8A 5IUGA 2YIYA 3A8WA 4FSYA 4MWHA 5H3QA 4PPAA 1PMUA 4XG6A 3P86A 1OVEA 4L00A 5FRIA 3ZC6A 4LQMA 5AUXA 4AE6A 2O2UA 2ITQA 4JAIA 4U81A 4IZYA 1PKDA 1YWRA 1KUTA 2DUVA 1LR4A 3EQRA 5C01A 2IG7A 2ZV8A 2WEIA 2XIKA 5CVHA 4ANNA 1QPDA 3C5UA 4BBEA 1G8AA 4RRVA 3ZHPC 4XHKB 5J8IA 3VNTA 1PXKA 4IAKA 2VWYA 3SA0A 2E9UA 3E88A 3GU6A 3O96A 4IANA 3EN4A 4QMWA 5CASA 2XJ1A 3O8TA 4MKCA 4U8ZA 4E4NA 3R9RA 4Z55A 4LUEA 4U3YA 4TZRA 2WMQA 3CC6A 3SG9A 4ZLYA 4EONA 4R5YA 1Q97A 3PRFA 3ZUTA 2RFNA 3KKVA 3CQUA 3DAEA 3CD8A 4QP7A 4AZTA 3UNKA 4CFVA 5IQEA 3DCVA 4QMLA 5CSXA 5LMKA 3FYKX 4PTEA 4ZTHA 2XYUA 4AE9A 3TM0A 1F3MC 2EXMA 4KD1A 5FTOA 3QCSA 3WI6A 3VS2A 5ANEA 4X3FC 3ZO3A 3HRCA 4PMSA 5GZ9A 2ERZE 5AP7A 2W1FA 3QBNA 4IXPA 3VBXA 4DF3A 2X39A 2V7OA 2X0GA 4OTFA 3QU0A 5CNNA 4FR4A 5LVLA 3KCFA 5KNJA 4FEWA 3S3IA 4I24A 3CTHA 4E4LA 4UWBA 2G2HA 4A7CA 3UIMA 4AA5A 4DEBA 4HVIA 2QO7A 2ZM1A 2CPKE 2ETKA 1U54B 4QQCA 5K0KA 4EH3A 4GYIA 3DT1A 3TNPC 5CZIA 3F3UA 4RJ7A 4ZTRA 4A4OA 4ASZA 3PLSA 5FEDA 3POZA 4GT4A 1A06A 5BUIA 2R3LA 4PY1A 3QX2A 4QTDA 3ENHA 4BF2A 4C35A 5B0XA 3C0GA 4H39A 4JDIA 5AEPA 1OB3A 5IISA 2UW7A 3I6WA 4IB5A 4XYFA 5KMKA 3I60A 4G3GA 4D9TA 2WTDA 2X2MA 3KXHA 3TZ7A 4NH1A 4CKIA 4DGNA 4MXYA 4WG5A 2W5AA 4M12A 3LHJA 3T9IA 4ALWA 2O8YA 3D83A 3PXKA 4DFZE 3V04A 4IM3A 4F9YA 5AAGA 1T45A 3F9NA 4MNFA 4QP9A 3KRXA 3UJGA 4DGGA 1YWVA 3FMHA 4BCKA 5HE3A 4I5PA 4OBOA 3CY2A 4NEUA 5EHLA 1Q8ZA 3H4JA 3IPHA 3JVRA 3LIJA 4HNFA 5JRSA 5LQFA 4GKHA 3A7HA 4B6LA 4ITIA 1OBGA 1J3HA 4QP3A 3ZLXA 4D9UA 4TYEA 3Q2JA 1TQMA 4IB0A 4L52A 2OK1A 5IQHA 4E6QA 3AC2A 4OGRA 2OFVA 3NIEA 1Y6AA 4IAYA 2EXCX 3NUUA 2C6IA 3DK6A 1PKGA 1M14A 3ORXA 3QWKA 4ZZMA 3DLSA 1OL1A 4MNEB 5K4JA 3PZEA 5AMNA 4MX9A 5AP4A 3BYUA 5H8EA 4N6ZA 4FV7A 2OIDA 3NWWA 3VUDA 3IW6A 4L7SA 4QTCA 4QP2A 3M42A 2OJJA 3LXNA 4DH1A 4BCGA 4EHEA 5CZHA 1XBAA 3Q60A 1PJKA 2GNLA 3TDVA 3RWPA 3VJNA 5M44A 5CAUA 5HE2A 4L67A 1SNXA 3R63A 1FVRA 3LVPA 4R7HA 2W1EA 4HPUE 3F3TA 5A3XA 3PXYA 1GY3A 3RPYA 4FV0A 4FUYA 4CYIA 3BGZA 3TJDA 2GQSA 4RIWA 3QTUA 5AR4A 2X4FA 1ZYDA 4U42A 2IZRA 4BGHA 5H8BA 5HHWA 2G2IA 3TZ8A 2QCSA 3FMEA 4IAAA 4TNDA 2W96B 2XYNA 4FTAA 2J51A 3FC1X 2C6EA 2I7QA 4OTRA 5M4FA 2F9GA 3DXNA 5HIEA 3QCQA 3LM0A 3UP2A 2ITVA 4IZ7A 2XK9A 2YLFA 2JBOA 4M8TA 1FQ1B 4EH6A 4F1MA 4XG3A 2BRMA 2YAAA 2PE0A 2VTNA 1YXUA 4BZNA 3L1SA 3PJ8A 3HV6A 4TWNA 3FQHA 1R39A 4YC3A 5LMAA 1H0WA 3KF4A 4C62A 3Q32A 5DE2A 4LMUA 3ORLA 3ZDUA 4BCMA 4F7NA 1ZOGA 3NUSA 3C0HA 4HJOA 5IEVA 4BTKA 2F7XE 3P0MA 1GNGA 4PMTA 3UQGA 4NM3A 2B55A 2GNJA 1Q4LA 5HOAA 4ONAA 3RM7A 1G5SA 4DBNA 5IA0A 3PSCA 2GCDA 4RGJA 4DH5A 4YJNA 2ESMA 3ZH8A 1RW8A 1VJYA 4QMQA 5DH3A 3F88A 4YZBA 4QP8A 3QUEA 4AUAA 3W2CA 4C37A 3R02A 4GRBA 4IX4A 5CX9A 4Z3VA 4WSYA 5AR2A 3FSKA 4LV5A 1GIHA 5GINE 2FGIA 3HVCA 3MV5A 2XK6A 4OT5A 2XNEA 3G0EA 2C6KA 5FXQA 2OFUA 4RLLA 3VS0A 4I22A 4C61A 5EDQA 3MN3A 2CCHA 4CFFA 3KMWA 3ULZA 2WKMA 4RIWB 1BKXA 3TIYA 4MXZA 2AUHA 4M97A 3QYWA 2X1NA 4F0GA 5F1ZA 3IKAA 3VS5A 4Y95A 2WMVA 2XNMA 4FSMA 4HCVA 4FT3A 1B39A 2OJGA 2UW6A 4QMUA 2C5VA 5LMKC 1PXJA 2ETRA 2XNPA 4I41A 4ARKA 3MTFA 4KB8A 2AC5A 4UXLA 1ZMWA 2BDFA 4FIIA 3QQKA 5HE0A 3I7CA 3C4ZA 5FEQA 5AR8A 4H1JA 5DWRA 3COKA 4CD0A 1ZMVA 3HA6A 3P7CA 4YJSA 4G3CA 3VBWA 5FWKK 5J9ZA 1H1WA 5ANIA 1ATPE 3JY9A 2PZPA 2YABA 3OEZA 3Q04A 2ZMDA 4IWQA 5AM7A 5EYMA 4BDBA 4DAWA 4E4MA 5EOLA 3TZMA 4MH7A 4EOPA 2JFLA 4N57A 3KU2A 2CGUA 4HGSA 2EB3A 5DLSA 5E90A 2PUIA 4ZSGA 1OM1A 1OPJA 3R7GA 5IUHA 3PXZA 3Q9ZA 3UYSA 5JSMA 4JBPA 1W98A 3EJ1A 2JKQA 3RVGA 3GQIA 3ODZX 4W9XA 1LEWA 2JGZA 4BCPA 3PLAE 4EWQA 2QONA 2J0IA 4ZTMA 4I21A 2CSNA 4JQ8A 2VWIA 4PTCA 5EHYA 4BN1A 3FLWA 2HZ0A 2ITWA 3SAYA 1SM2A 1REKA 2GQGA 4FNWA 4BDCA 3I4BA 3GOPA 4HYSA 4MWIA 5DT4A 5M09A 4IVAA 4TYGA 3HL7A 4C7TA 3E3BX 4K77A 1FPUA 3FHRA 1Z9XA 2B4SB 2I0VA 2W05A 3DBFA 4TN6A 3VHEA 5TE0A 4R5SA 4V0GB 3H9FA 1HOWA 2W5HA 1QPCA 3FQEA 3LW0A 2YDKA 1YHVA 4PRJA 3BHYA 3BLHA 1GOLA 1EH4A 4IX6A 4YBKA 3F3ZA 3NUXA 4YJUA 5B2LA 3MFTA 4YZMA 3QYZA 3WYXA 4F0IA 3FI3A 3MVLA 3GU4A 3P78A 4DFBA 4CCUA 2R3RA 2OH0E 3DB6A 3F69A 1KWPA 2YN8A 3KGAA 1IAJA 5I9UA 3P9JA 3PP0A 3E87A 3E5AA 5CU3A 3H9OA 3AC1A 3OT8A 2J9MA 3F7ZA 4I4FA 3UVRA 1XBCA 5EYKA 3VUHA 4E26A 5CF6A 2PVRA 3PPKA 4P4CA 4IEBA 3MY0A 2YZAA 3RHKA 1OL5A 2IW9A 3JUHA 4ACDA 2WTJA 1XR1A 2CJMA 2W06A 3DB8A 4QNAA 3WZDA 3V5LA 1UKHA 2IZTA 5CY3A 4XP0A 4HVGA 3OMVA 4BWPA 3LZBA 4EK8A 4YJRA 4I6BA 4B99A 2YHVA 5EYCA 3GQLA 5E8WA 5F94A 4ALVA 5JFWA 3R2YA 4OTDA 2A19B 3MW1A 3Q9YA 4G3DA 2OICA 4G9RA 2QLUA 4TYHB 3SRVB 3ZOSA 3IONA 1SVGA 2WQNA 4ZEGA 3OROA 3ZBXA 4AW5A 4PDPA 4K2RA 5FLFA 3FPMA 3FLSA 4F7JA 2RFEA 2VO3A 4G9CA 3C4EA 4DFXE 3QA0A 1ZZLA 2HWOA 3PVBA 4X2NA 4ZSLA 4EWHA 2YCQA 3PSBA 4QMSA 2ZVAA 3ZUUA 2E9VA 5JT2A 3OUNB 1SZMA 2KTYA 3NIZA 4EH9A 2UZLA 2XBJA 3A7JA 5AIKA 3ZSIA 3QF9A 4F1OA 3DY7A 4F6WA 5A54A 3ZBFA 3EKKA 3TV4A 3HX4A 1PMNA 4APPA 4EQUA 3MH0A 2B7AA 3ATTA 4MK0A 4NT4A 4CV8A 5BVFA 4FEXA 3M11A 5FM2A 4A9TA 4QOXA 2CKPA 3FI8A 3I5ZA 3A62A 4KIOA 1TQPA 4C4EA 5JN2A 5CXZA 1J1BA 3GFEA 5HI2A 1Q99A 2OKRA 4Y5HA 1ZXEA 2UZEA 3AGLA 5KHWA 1YHWA 2PZYA 4YTIA 3ITZA 3MFSA 4EK5A 3R9DA 2OZOA 4C2VA 3EZRA 2UZWE 3MFUA 1W83A 2J5EA 4G31A 4CZYB 2GS6A 3VBVA 4QYFA 4NJDA 5IUIA 3HP5A 1ZZ2A 4O6EA 2UW4A 4O1PA 3PG1A 1IA9A 5DR9A 2WXVA 5M57A 1Z57A 5IDPA 2G15A 3ORTA 5CAPA 3UC3A 4X0MA 4FZ7A 4D2VA 3LMGA 3HAMA 1PXLA 3NW7A 1FOTA 4FSNA 1L3RE 4ZTNA 3UC4A 2W4JA 5HX8A 2IN6A 1H01A 1R78A 4U80A 3QL8A 3SVVA 4QMNA 2ZAZA 2R7IA 4L42A 3UIUA 4F1TA 3U6JA 2PVMA 5L2QA 5HD4A 2XK4A 3MPTA 4FTTA 4O2ZA 2PVYA 1DI8A 3QRKA 5E8SA 2J0LA 2W1GA 4GCJA 4IB1A 4DH8A 1BI7A 4FTCA 3RWQA 4P7EA 2C1BA 4JBOA 4ZZOA 5GZAA 2VV9A 3K54A 3OY1A 5CT7A 5ITAA 1M2PA 2I0EA 2XH5A 2UZTA 5FDPA 3E3PA 3FZRA 4CKJA 5E8UA 1GZNA 2V22A 4S30A 2VTQA 5IDNA 3WIGA 4EZ7A 3OP5A 2ITTA 1Y8GA 4DEEA 4FKIA 3HMIA 4XH6A 5AV2A 4E5BA 4KKGA 5D41A 2WTCA 3PFQA 4Y8DA 3DFAA 5IZFA 4O0TA 2GNIA 2YAKA 5F20A 4XG4A 5FTQA 5I5ZA 4IB3A 2C3JA 3HLLA 3LLTA 3OFMA 3CJGA 4J99A 5EW3A 3QUDA 2BZJA 2HELA 3KK8A 3KK9A 3COIA 3LFAA 2GHMA 3N9XA 4LV8A 3POOA 5EKNA 3ANQA 3VUIA 3QRUA 1URWA 4NFMA 4YJTA 3VIDA 1PHKA 1UU8A 4PMMA 4NM7A 5AP6A 4C4GA 3CY3A 4E7WA 4U6RA 4APCA 3QC9A 4X6RA 4X2JA 4O0WA 3QZGA 1GIIA 1UWHA 5I9WA 5A4TA 1GZ8A 4YZDA 3AD6A 4MVFA 5EI8A 4DCEA 4ZY5A 4YZNA 5IA4A 2FSOX 1ZYLA 4MCVA 3IO7A 2ZOQA 2OXXA 2VTRA 4MD7E 4FV5A 2H96A 2PZ5A 1VYWA 3ACJA 4RC3A 2YCFA 4D1ZA 4F0FA 4H58A 4QD6A 3LFDA 5JQ5A 4QPAA 5EW9A 4YLLA 4L53A 4FTMA 2YA9A 4F7SA 5T68A 5I0BA 2XZSA 3GC0A 1PMEA 4F99A 2VZ6A 1KV2A 4PNKA 3EFLA 3UODA 3FE3A 4M68A 2X2LA 4GT5A 4RVKA 2Y7JA 3EQGA 3BU5A 2EVAA 3ZM4A 3FL5A 3NYXA 4JDKA 3D2KA 4AX8A 3EQBA 5E8YA 4A06A 4PUZA 5DT0A 4KIKB 4AOIA 4AZSA 3LE6A 3D5XA 4QMVA 3ODYX 3Q9XA 4O81A 1XH7A 3ROYA 4ZSEA 4AOJA 3FJQE 2UZVA 3GEQA 3R9NA 2VRXA 3OW4A 3UG1A 4CFWA 4FIGA 1OUKA 3REPA 5BUJA 4AZWA 3GU8A 4FYNA 3Q52A 3R7VA 3Q6UA 4QTEA 2YIXA 5HTIA 4GG7A 3TJCA 3VUGA 2VWWA 4CFUA 3EFJA 3QKKA 5HVJA 4LG4A 4UB7A 2UZDA 4XBRA 5JZNA 2YLEA 4FV6A 4U0IA 4PL5A 3I6UA 4DITA 2SRCA 3RPOA 3MY1A 5K3YA 3OOGA 5HD7A 4BDHA 4FV8A 4NW5A 3PWYA 2XIZA 3ROCA 2QO2A 3AT3A 4LOOA 3TKUA 3IS5A 4DC2A 4IZ5A 5HKMA 3BE2A 4AFEA 3FI2A 4WNPA 5JRQA 3NW6A 4G6OA 2XIXA 4YZCA 3E92A 4FI1A 4A9YA 5CANA 2VTPA 4WRSA 5BVOA 3UMXA 3HEGA 1H00A 1O6YA 1PY5A 4IZAA 2BDWA 3W8LA 4YMJA 3NR9A 2XEZA 3HMOA 3H0ZA 3SXFA 5J5TA 4W8EA 3C13A 4WBBB 3OZ6A 4GJ3A 4O91A 5IH4A 4BI2A 1JOWB 5DBXA 3B2WA 3PPJA 3ZU7A 1CDKA 4YTFA 2C0TA 2IVTA 3A60A 4RIXA 1CM8A 5DG5A 1H26A 5H9BA 2Q83A 1QCFA 1IRKA 3MS9A 4WO5A 4HZRA 4JG6A 4UZDA 1ZYJA 3U6HA 3NCGA 3BLRA 4X2FA 5IQFA 3E93A 3HMMA 4H3BA 4FIFA 4CG9A 4ZMFA 3DTWA 5EDRA 3QHWA 4GSBA 4AW0A 2X7OA 5LWNA 4IIRA 1Y57A 1O6LA 1Q8WA 5T6KA 5M4UA 4R8QA 3TWJA 4AXAA 4G2FA 5CAQA 3MBLA 4AW2A 5L8JA 3QXOA 1W8CA 5CS6A 4BBFA 5IEXA 2WTKB 3QQLA 5AA9A 4F65A 3KXXA 4JRNA 4KA3A 5CU2A 3LFQA 4ENYA 5I9YA 4RWKA 4U9AA 3TUBA 4TY1A 3FLQA 1UNHA 1HCKA 1OPKA 3KXGA 4K11A 3A7FA 2QOOA 4G16A 4BCJA 5K9IA 3D2IA 5ETAA 4RVTA 1YKRA 4K9YA 4EQCA 4NFNA 3FWQA 4DHFA 5HNIX 3RAIA 2UW9A 3DBDA 3BHUA 3BKBA 4QMXA 3HDNA 2JKKA 2C3LA 1ZOHA 1V1KA 2C69A 2VAGA 3PJ2A 4ERWA 3F2AA 1VEBA 3V6SA 3UOJA 2ITPA 2R3KA 3EWHA 3TNHA 5L6PA 2RFDA 4NL0A 4JBQA 5ETFA 4LOPA 2WMWA 5HLNA 1WVXA 4HCTA 3AC3A 2IW6A 4NUSA 3SC1A 1HCLA 2J5FA 4IAIA 4OUCA 4GK3A 4X3FB 4YZ9A 3NRMA 2B9IA 2ZB0A 4HVSA 4CMOA 4S2ZA 3BYVA 3OVVA 3SV0A 5LWMA 4ZS4A 4FE2A 2VTAA 3KREA 3TNIA 1K9AA 5HNBA 1KE5A 3G0FA 5EYDA 3JPVA 4BDJA 4BDIA 4R7BA 5A9UA 3DJ6A 2WMSA 3W32A 4DH3A 5JGDA 1BX6A 2XKCA 2I6LA 4EOLA 2ONLA 1A9UA 3FZ1A 3OTVA 3UGCA 3EN9A 4DFUA 3LMIA 4FTQA 4UXQA 3EN6A 3DPKA 2QR8A 3Q96A 3KMMA 2XNGA 1E9HA 2PVKA 2JIIA 4HYIA 2CLXA 4R6VA 4USDA 1WBNA 3VQHA 1PRYA 2YM7A 1MQBA 3MA6A 4IM0A 3E8DA 2VTLA 2ZM3A 2PUUA 2XM8A 4IE9A 4EK3A 4FVPA 3V5PA 3QGYA 2BIKB 3ZLYA 3LFCA 3R8PA 2PVLA 2WQEA 3BYSA 2X7FA 4EI4A 2OJIA 3W2OA 2C6LA 2WTIA 3FMMA 2YITA 1V0PA 4LGGA 2C4GA 2VNWA 2XVDA 3KMUA 4DEAA 5BVWA 3UPZA 3EH9A 4EHVA 3EQFA 5AUTA 3RK9A 4G6LA 4L7FA 4RFMA 3FQSA 2FH9A 1Z5MA 3GU7A 4FVRA 2VTOA 3OCSA 4EOSA 3MWUA 3ZDIA 3RGFA 3P5KA 1NXKA 3G2FA 5F95A 2XIRA 1P14A 2IVVA 4MQ2A 4BGQA 5BYYA 5IA2A 5HX6A 4JBVA 5HG5A 4RZWA 4ALUA 3NCZA 4D0WA 3NX8A 2XIYA 3ALOA 4MBJA 2E9OA 5D1JA 4UX9A 2WMAA 2CLQA 2XRUA 3OWKA 4ID7A 2B9HA 5CTPA 4IFCA 3PG3A 1YWNA 2WU7A 5L8KA 1J7UA 4AZEA 2WTKC 2BHHA 5C26A 5A4QA 4YUQA 4V05A 3UZTA 2GNHA 2E9PA 3LCOA 3PY1A 4FNYA 2HCKA 1H28A 3P79A 5C4LA 3TZ9A 2XKDA 5AP3A 4IC8A 2CN5A 2ITYA 4PDYA 5BMMA 3QD2B 2R3JA 5ACKA 5E8VA 5DVRA 3EFWA 2RFSA 4UYAA 2R7BA 2HZ4A 4RA5A 3HV7A 3Q4ZA 2QU5A 4O6LA 2W1HA 3IDPA 4PF4A 3T8OA 3OBJA 2G9XA 2G1TA 4D2WA 4XS2A 1OMWA 3U51A 5BVNA 3KULA 4DH7A 1JSTA 5TR6A 4EEVA 1H08A 2BRBA 2R3NA 3A7IA 3OCTA 3PTGA 2UVXA 3Q6WA 3QX4A 4FKVA 3WF8A 4E8AA 4ZJVA 3IW5A 5BVKA 2XRWA 5C8NA 3RBWA 5LVNA 4M0ZA 4H36A 3SXSA 5FXRA 3VF9A 3GU5A 4IMYA 4P2KA 3BWFA 2JDRA 1OIQA 3ZEWA 4F9CA 2W1CA 4RFZA 4BTMA 3QUPA 1I09A 4ASDA 5IQGA 2Y4PA 4JIKA 3HMPA 1IAHA 3PVGA 3GXLA 3TACA 3R7OA 3RP9A 5DI1A 4MD9E 5D7AA 3BX5A 3UPXA 5HU3A 3QTIA 4QP4A 3UG2A 4I6QA 4F08A 3Q4CA 2WQBA 3BCEA 2WD1A 4FTLA 4I93A 2X81A 3NUYA 4MXCA 5J9YA 4BBMA 5DEYA 5D7VA 5IA1A 5CWZA 4X7QA 3VO3A 3LQ3A 3PXFA 4PP9A 4X6QC 2J2IB 2X8DA 3GENA 3P1AA 4FICA 3AC5A 3NYOA 4DEHA 1J7IA 5I9ZA 3D14A 3QCYA 3SGCA 2BRGA 4Y46A 3N4UA 3OOMA 3ANRA 1OGUA 3W1FA 3UQCA 2QURA 4CT2A 3ZO2A 5AV4A 4UBAA 2BDJA 2UZBA 1KE9A 2WOUA 2CNVA 4BDEA 1UU7A 4OTGA 3H9RA 4BR3A 5IU2A 3MH2A 3VUMA 3W2PA 2WQMA 4BCIA 4ZY6A 3BQRA 3FMNA 2F49A 3LQ5A 5I3RA 4YR8A 4DEDA 2VUWA 3A7GA 3R7UA 5G1XA 4O96A 5HVKA 4FVQA 2O65A 3VN9A 4JT3A 4BCOA 2FB8A 5J7BA 5LVMA 4RWLA 3PUPA 3VBTA 5FUTA 4AFJA 3NMUF 2YIRA 2F2UA 3Q3BA 1XH5A 3F2NA 2GNGA 1PYXA 2ZJWA 4EOIA 2ONLC 4L45A 4FZAB 3O17A 4M14A 3CSVA 4UMUA 5H8GA 1MRYA 3OY3A 2IWIA 3DV3A 4G17A 3VAPA 5I9VA 1DAWA 2C3KA 3LJ2A 4IVDA 3R8MA 4FK6A 1J91A 1H07A 3R04A 4GH2A 2GS7A 3BV3A 1UNLA 4RJ6A 3PYYA 4AZFA 3HV4A 3FHIA 3ZLWA 1H1QA 4M67A 1M2RA 2BMCA 2ERKA 4MXXA 5AR5A 3V3VA 4S31A 4Q9ZA 4R3CA 4AWIA 3NUPA 3FKLA 4GK2A 3UIXA 5JQ8A 4RX8A 4B8MA 2OI4X 2OIQA 4ITJA 1OL2A 3GGFA 5D9HA 4C3PA 2RL5A 3EQCA 4IDVA 4JNWA 3PE2A 3MFRA 2B1PA 2YFXA 3U6IA 5AP5A 4O7VA 1E1XA 4C58A 1NY3A 1WZYA 3KXMA 3OS3A 2NRYA 4GEOA 4XOYA 3I7BA 3RHXA 3SDJA 3IW8A 3MESA 3ELJA 3UZPA 4KUJA 4WOVA 3RI1A 4FSQA 3SLSA 3PIZA 5F9EA 3F5GA 2WO6A 4DFLA 4O0SA 3UP7A 3IK3A 5M56A 4Z7GA 4GU9A 2ZV7A 1A48A 4FZ6A 1Q41A 2C6OA 5C4KA 4RVMA 5DOSA 2UVZA 3C7QA 4S34A 4XG8A 2REIA 5AX3A 3IW4A 1TQIA 3KY2A 3WILA 4DCAA 4FTUA 3NDMA 4RSSA 3LXLA 3I1AA 2CKEA 4FV4A 4HOKA 4BCQA 4BI1A 2Z7LA 4BDKA 4JRVA 3RAKA 3AT2A 3IOKA 3COMA 3JXWA 2O64A 4P90A 2OU7A 4QP6A 1FVTA 3ZCLA 4E3CA 1VYZA 3CCNA 3II5A 2W1IA 2XEYA 4I94A 4G6NA 5HEZA 3W16A 4S32A 4NCTA 3KN6A 3CEKA 5LVPA 1Y8YA 3E7VA 4FL1A 2XB7A 3Q9WA 3VULA 2GFCA 4BKJA 2GQRA 2FA2A 1VZOA 4FTNA 1LPUA 4O7NA 4LGDA 4YNEA 4O7LA 1PXMA 5D10A 3RZFA 3EL7A 4D1SA 3D94A 1Q5KA 2HENA 3GNIB 4QTBA 4TYIA 5JH6A 5FP6A 3NEWA 2C1AA 4BCHA 2YM4A 3GBZA 4K33A 1YQJA 4KRCA 3DDQA 3PZHA 3COHA 4XRLA 2QG5A 1OIYA 2ZDUA 4M3QA 5HORA 5M55A 4JQEA 4YPSA 3UIBA 3ZRLA 4GFOA 5DR2A 4WA9A 3QGWA 4E73A 1JAMA 4KINA 3PSDA 2BROA 3KC3A 3OF0A 2C0IA 4QMTA 5AX9A 5EK7A 4D58A 4LRJA 3U55A 3EN7A 5FQDC 2Z02A 1JKSA 2KULA 3BV2A 2CKOA 4B9DA 4O7ZA 2R64A 4PMPA 3EKNA 4G5JA 3LCKA 4E5WA 4XJ0A 2W7XA 3CR0A 1PF8A 4EOMA 2QVSE 2WMRA 2CCIA 3CKXA 1RDQE 3ORIA 4GU6A 2BZHB 3R30A 4NWMA 3ORNA 4G34A 2QNJA 1JVPP 4XRJA 3CQEA 4IADA 4F70A 3D5WA 3DNEA 3DTCA 3GC7A 2W9ZB 4UMTA 2VWXA 2VGPA 4KS8A 3VS6A 4LRKA 4OTIA 4CZUA 2QI8A 2AC3A 3ZS5A 4RPVA 2CGVA 1O6KA 4EH5A 5L2TA 4O82A 4AT3A 4RIYA 2WNTA 5TKDA 2BFYA 2X8IA 4TL0A 3R28A 4M15A 1ZY4A 4O0RA 3NYVA 4ACGA 5HQ0A 1AQ1A 5J5SA 2BTRA 3AMAA 4I0SA 3BU3A 5ANOA 4I23A 4DE4A 5GJGA 2JBPA 2WIPA 4AP7A 4EORA 1JPAA 5EQPA 3QZFA 2QU6A 1XO2B 3C9WA 1GAGA 4J97A 4UALA 4CV9A 3FY0A 4FEVA 3MVHA 2JAVA 2P33A 3RNYA 4TW9A 3GC8A 4AT4A 4CTCA 1JNKA 5CNOA 1R0PA 4FL3A 4RBLA 3I0OA 2C5NA 3MIAA 3DKGA 1H24A 1B38A 3PVWA 5IH5A 5LARA 4XV1A 3UOLA 3TV6A 3UNZA 3CE3A 4XX9A 4JAJA 1QPJA 2GTMA 2DQ7X 4YHTA 4IAFA 2HY81 4EC9A 4JL9A 4LOQA 3PVUA 3DGKA 1PXOA 1H25A 4M66A 4KBAA 4CT1A 3E63A 4BTJA 4D55A 4FK3A 2H8HA 3AT4A 4BKZA 4YHFA 2NRUA 3VJOA 4ANSA 4IFGA 4J96A 4FT0A 4JR3A 3WF6A 1TVOA 3R9HA 2OXDA 2WAJA 4RJ3A 4O21A 4ZSAA 3QCXA 3CLYA 1Q3WA 3KEXA 3NAXA 3KF7A 4X2GA 2OXYA 2VWUA 1Q8YA 4A9RA 4J52A 2BILB 4DFNA 4GFMA 3ZSHA 4G1WA 2UZNA 1ZYCA 4F09A 5LVOA 4ZJIA 4D4YA 1T46A 2IW8A 1MQ4A 4UY9A 2X9FA 2UW3A 1P2AA 4EBVA 2R3GA 2BAQA 2OZAA 1YW2A 4AG8A 5EH0A 4RWIA 4BDFA 5ANGA 4KABA 1H0VA 2VWBA 3SQQA 2C6DA 3RAWA 3ZONA 4QPSA 5GNKA 4F9AA 4BIBA 2R5TA 2VD5A 4IWPA 2E9NA 4BHZA 3LFEA 4BYJA 4XOZA 2W17A 2EB2A 1CKIA 2YWPA 3IW7A 2QOCA 2H34A 3MA3A 4Y85A 3GCVA 3DQXA 3KFAA 1I44A 4B0GA 1M7NA 4GVAA 2I1MA 3TUCA 2BALA 3NYNA 4YURA 2ITNA 3V01A 4XLIA 3HGKA 5AR3A 3NVKI 2IZUA 2UZOA 3F61A 4O38A 2PVFA 5CSHA 5HICA 3B2TA 4UWCA 3U9NA 3R01A 3ZM9A 1F0QA 3C0IA 2P55A 1UU9A 3K2LA 3JS2A 3U8WA 4JQ7A 1SVHA 3HDMA 5IMEA 5AUYA 5DMZA 1GJOA 2JDVA 3P08A 4NCTC 3FY2A 2VU3A 3DJ5A 2J0JA 3A99A 3NNXA 4KSQA 1WCCA 2Y9QA 3H30A 3Q5ZA 3WF7A 4YBJA 1OI9A 5EKOA 1M7QA 4FODA 3PXRA 4EQMA 4ZXTA 4N70A 4IX3A 4J7BA 5TT7A 4O0VA 1CKPA 3CGFA 4UZHA 2W1ZA 3NZ0A 4OTWA 5A4EA 4MXOA 2ACXA 2QOIA 5AUUA 2OZAB 2F7ZE 2PZIA 2PMLX 3NLBA 2J0KA 5HBJA 1XHAA 4L68A 2PPQA 3OTUA 4O27B 4PDOA 5DEWA 3MVJA 2HWPA 4BGGA 3N4TA 3E62A 4J98A 1FGIA 4UWYA 3P23A 3DQWA 3R71A 2VGOA 2GDOA 3CJFA 3EHAA 5HZNA 1R3CA 4E93A 2XJ0A 4ZJJA 4LI5A 2JKOA 3R1SA 5LJJA 4AGCA 5KO1A 4D2PA 5K4IA 1W7HA 3QFVA 3U9CA 4EJ7A 2J50A 3CD3A 4WT6A 2JDSA 5AUVA 2IO6A 4MHAA 4LUDA 3R8ZA 3BEGA 2FSLX 3BHTA 4FV2A 3DK7A 4EKLA 4OR5A 3I79A 5HO8A 3VBQA 5KBQA 2WELA 5KUPA 2PUNA 3QAME 4PL3A 3MGYA 4CYJA 5JKGA 4FKOA 3EQHA 2BUJA 4FL2A 4GV1A 5A4CA 1OIRA 3UQFA 3S00A 4BL1A 1STCE 2CGXA 2F2CB 4L46A 1G3NA 4DINA 4ERKA 4PQNA 3UOKA 3E7OA 2BPMA 3TV7A 2ITZA 3FAAA 4D0XA 1NW1A 2VWVA 4FMQA 2JIUA 5IKWA 2YJRA 2BKZA 4JS8A 2HZIA 5G6VA 4FV9A 4F63A 2F57A 3C5IA 1PXNA 5E8TA 5LOHA 2X6DA 3JY0A 3ZRMA 3QXPA 3WE4A 1FINA 4GS6A 1ZWSA 2WFYA 2I0HA 3EFKA 2QHMA 4JOAA 5ANDA 3OC1A 4QMPA 5D11A 3VW8A
chains in the Genus database with same CATH superfamily
4KRDA 3LMHA 4H3QA 4YPDA 2WMTA 1REJA 1UNGA 4XG9A 4R78A 4IW0A 4BY9E 1JSVA 5EDPA 5BVDA 2YCRA 2O3PA 2R3IA 3WZEA 3R7YA 4FRFA 2JC6A 3LPBA 4WD5A 3KN5A 3ZTXA 2NP8A 2X9EA 3NSZA 4EK6A 4C2WA 5KZIA 5J1WA 3BBTB 2BZKB 3QTSA 2QD9A 3TDWA 4ZTLA 4DFYA 5HTCA 4OBPA 4JG8A 4A9UA 1KE8A 4TRLA 3WE8A 3AGMA 2DWBA 4TTHB 3OT3A 4Y5QA 3NW5A 4D4RA 1ZARA 5FM3A 2PTKA 3C51A 2Z60A 3FMDA 4TT7A 5HTBA 4RJ8A 2RSVA 3D4QA 1TKIA 2C6MA 3R00A 4TWPA 5C03A 3TCPA 3VC4A 3KRJA 4L44A 2BHEA 2C5YA 3HECA 2Y6MA 1WVYA 2EXEA 4KKEA 5JFVA 4DTKA 4EC8A 1WBOA 3KVXA 1WVWA 4KSPA 4EL9A 1LP4A 1ZY5A 4NKAA 5J79A 3DKFA 3MY5A 3ORKA 4QO9A 3FUPA 2O0UA 5CEIA 3LFNA 4BZDA 4C36A 1H1RA 3S4QA 4X2KA 1LEZA 1M2QA 1YXSA 3FMJA 3PRIA 4XEYA 4BWXA 3N4VA 4Y83A 4FKTA 1U46A 4U97A 4C4FA 4O7WA 2GFSA 3W33A 4AW1A 1LUFA 4HGEA 4PV0A 3JYAA 4C02A 1J7LA 5CEPA 3ID6C 2OLCA 2GSFA 2OSCA 2XKEA 3O0GA 2PVJA 3QQHA 1W2CA 4FG7A 3JR1A 5KMLA 4JVGA 1WBPA 3GB2A 4RJ4A 5ETCA 5FTGA 3U87A 3QQJA 3UO6A 3R7EA 3TEIA 3WBLA 3W55A 3FZOA 5IA5A 1OUYA 5HBEA 5TOZA 4DN5A 3ATSA 3DXQA 2P0CA 4GYGA 3S2PA 5FBOA 2QOFA 3WIKA 3ZMMA 4FEUA 2JFMA 4O1OA 4QQ5A 4ZK5A 4J53A 4FT7A 4AGUA 1OKWA 3SW4A 4FG9A 4NZWB 4QP1A 4E4XA 5KKRB 3L9NA 4F6UA 4ZTQA 2CMWA 3PDTA 3P7AA 1UKIA 4FKUA 2EWAA 2LAVA 4IJ9A 3ZO1A 1ZRZA 4FGBA 1PYEA 2VTHA 4FZDB 5TF9A 3VS4A 5ANKA 4FBXA 3KCKA 4USEA 4IBMA 2PY3A 3AMYA 3VRYA 3FEGA 4O0YA 2BKKA 5JZJA 1YOJA 1RQQA 2C5XA 4FYOA 3IGOA 3UBDA 3CS9A 2YM8A 3WYYA 4Z7HA 4ZAUA 4M69A 3ENMA 3DLZA 4L3LA 4WG3A 5EHOA 4FSUA 3NNVA 3AD5A 3BGQA 5EM8A 4EOOA 4FIEA 4LDTA 2CDZA 2R3QA 3AQVA 4FKLA 4Q9SA 1CMKE 2VX3A 4BTFA 2QG7A 3L8PA 1FBNA 4NU1A 2UUEA 4EZ5A 2W9FB 3S95A 2JLDA 3FI4A 3GVUA 4YO4A 4RIXB 3D7TA 3QRTA 4OAUC 4TPTA 4UN0C 2PE2A 4F9WA 3G90X 4XLVA 3ZXTA 4RX7A 5JMSA 2BVAA 2WTVA 3T9TA 4O22A 2C47A 3RK7A 3ZXZA 2VO6A 4E1ZA 3GCUA 3FBVA 4YLKA 4QDEA 4QQJA 3E8NA 5J9LA 4LFIA 1IASA 3F6XA 5HU9A 4ANQA 1CTPE 2G01A 3VS3A 4QYYA 4AXFA 3A4OX 4BCFA 5HLWA 5AA8A 1J1CA 4R3PA 4Z16A 1QL6A 3O8PA 2X7GA 3R8LA 5CSWA 2YM6A 4DBXA 4C33A 5HO6A 1JKKA 2WB8A 3TT0A 4U3ZA 1E1VA 3QTXA 2Z2WA 3OWPA 3C1XA 4GG5A 1WFCA 3EN5A 2J4ZA 2VX1A 1Q61A 2B52A 2FYSA 1B6CB 3OXTA 5CVFA 5EOBA 3NNUA 5HE1A 4C4JA 1SNUA 3QHRA 2IPXA 2WOTA 3WF9A 4YSJA 5AFVA 2GTNA 2HZNA 4NM5A 2WMBA 2ITOA 3RALA 3K3JA 1NT2A 4YP8A 1XQZA 3WOWA 3TXOA 4RVLA 1OKYA 2BAJA 2QODA 3C4CA 2X6EA 4HPTE 4K6ZA 4U5JA 2RKUA 4GL9A 5ANJA 4AOTA 3KQ7A 5E1SA 2HW7A 4CQGA 4EJNA 3G15A 4R3RA 1FMOE 3EIDA 5E8ZA 2NYAA 4I20A 5AP1A 5E1EA 5EM6A 3D7TB 4AN9A 1KV1A 4ZTSA 1H1PA 2HOGA 4BRXA 2J0MB 4XNEA 4LMNA 5L6WL 3BBWA 4TYJA 4QT1A 4QNYA 5KMOA 2QC6A 4XP3A 4AN2A 5JFSA 5M53A 2XM9A 4FA2A 5AAFA 3QKMA 1GZKA 1IR3A 4S33A 1Y91A 2PE1A 3FPQA 4CMTA 2FSTX 4TKSA 2OWBA 4AGDA 5A6NA 5KKRC 5J7HA 4Y73A 1BL6A 4MYGA 3EOCA 4RLKA 5HIDA 4CFNA 3EQIA 4B8LA 2WIHA 4YC6A 3CPBA 3S0OA 2HW6A 2JAMA 2GMXA 4FJVA 4MF0A 3L8SA 3BPRA 2C6TA 2R0IA 4BIEA 4BWKA 3RKBA 4RMZA 2UW5A 4W4VA 3Q5IA 2Z8CA 3UE4A 4BHNA 4QPMA 4R1VA 2JD5A 4YJQA 1U54A 1BYGA 3UZRA 2Q0BA 2XNBA 3BYMA 3NS9A 2VN9A 4OW8A 5HBHA 2P4IA 3KVWA 4NM0A 3CKWA 1S9IA 3QALE 2V0DA 4HGTA 3SD0A 2PMOX 3O51A 2W5BA 3MSSA 3W2QA 3RCDA 2C3IB 1XH8A 3HZTA 3FLZA 4AAAA 1UVRA 4WNKA 3F5PA 4XMOA 3F3VA 3TI1A 1XH9A 4FOCA 1URCA 4N6YA 3UDBA 3L9LA 3WARA 4D4SA 5JFXA 5J1VA 4R1YA 5M51A 2W4KA 3HYHA 4UYNA 3R8UA 5C1QB 5EM5A 1YXVA 4H05A 3IECA 1WAKA 2IVUA 3V8WA 1JKTA 2XKFA 4XG7A 3D5VA 3G51A 2YM5A 4RQVA 5AP2A 4WSQA 3RTPA 4CFXA 4UMRA 4J8NA 3MH3A 2GHLA 4FKPA 4NIFA 4Y72A 4EBWA 4QMYA 1JBPE 4V01A 3W8QA 5M08A 1YOLA 3P4KA 4EHGA 2NO3A 2IJMA 5AWMA 2QOLA 5A46A 4LL0A 5CEOA 3MH1A 2IEWA 3OBGA 4JMQA 5J95A 4C8BA 3DZOA 1XJDA 3DBCA 2FVDA 5FBNC 1OPLA 4DLJA 1NVQA 4F7LA 2PULA 3DBEA 5IH6A 5CQUA 3GCSA 2UVYA 5DA3A 3O5AA 3R9OA 2YACA 3G5DA 4MNEA 4CLIA 1XWSA 2ETMA 2W4OA 1KOBA 3FZSA 4J71A 4D2RA 3IDBA 4K0YA 4BCNA 3H0YA 2O63A 3DKCA 4WUAA 2EUFB 1YOMA 3BELA 3LJ0A 3R2BA 2R3HA 3DFCB 2EU9A 5AADA 3QD4A 1SMHA 3R8VA 2PL0A 3EZVA 3ZLSA 4NKSA 1NA7A 3OD6X 2CKQA 4O84A 2WQOA 2W99B 1M17A 2QLQA 2X0OA 3KULB 4DLIA 5KMJA 3AC4A 4ZS0A 3HKOA 4FTKA 3P5JC 3RM6A 4KIQA 1KE6A 5DGZA 4MBLA 2QOQA 5GHVA 5BYLA 3CPCA 2XK7A 4FF8A 4AF3A 4DG2E 2OJFE 5CI6A 3FZPA 4OAVB 4AN3A 4MUQA 3SX9A 1PXIA 2OW3A 2F4JA 3JVSA 3EQPA 4YTHA 5HG8A 2O5KA 3V8SA 3RPSA 4EUUA 4WG4A 3SG8A 1DI9A 3G9LX 5ETIA 4CKRA 4NIFB 3R6XA 5TO8A 5I4NA 3R83A 2PVHA 3Q4TA 5CT0A 2ZB1A 4V04A 1V0OA 4OTQA 4ASEA 3K5UA 4NW6A 3MJ1A 3O23A 4E5AX 5AJQA 4NSTA 5CF5A 1YDRE 4WKQA 1OZ1A 4GVJA 4J8MA 2ITUA 2V7AA 4ANBA 5IEYA 3MJ2A 1WMKA 2VWZA 5K5XA 1SYKA 2PSQA 4HVHA 3EYGA 5BUEA 2HAKA 2Y8OA 5BYZA 1DAYA 3CBLA 4GW8A 4F64A 2QO9A 5I9XA 4PNIA 5DT3A 4FKQA 1FVVA 3DOGA 2QKRA 3L8VA 2AYPA 3U4UA 4IQ6A 4ZP5A 4OLIA 3OWLA 2BRNA 2GS2A 3SKCA 5CQWA 2JDTA 4YSMA 2H6DA 3BWJA 4FSWA 3F7WA 3GCQA 3O7LB 4OBQA 5FG8A 3MVMA 3VS1A 4K18A 4FKRA 4WHZA 3BRBA 3O71A 4KNBA 5C8MA 4EOKA 1H27A 3O8UA 4DYMA 3RINA 5L4QA 4RC4A 4AT5A 4AA0A 3PIYA 4FV1A 3ZYAA 2HYYA 2HXLA 4CTBA 4GMYA 4YHJA 3R0TA 3QLGA 3HRFA 3BE9A 4XBUA 2IZSA 3RJCA 3E8EA 4IH8A 2R4BA 3M1SA 2CGWA 3VF8A 4JDHA 2W0JA 5C8KA 1Q3DA 2PVNA 5E8XA 5BX0A 4L9IA 4P5ZA 2Z7QA 4WBOA 3G33A 4ZSJA 1OITA 3TG1A 3ZC5A 5DPVA 3DA6A 4DEIA 2JEDA 3GI3A 3W2SA 4M7IA 1GZOA 5CEKA 4DGOA 3BZ3A 3PY3A 4RZVA 5JGAA 5EQEA 3QD0A 3BHVA 3Q2MA 3MTLA 3TL8A 2HY0A 3PA5A 4AQCA 3KXNA 3CTQA 1RE8A 1H8FA 4I5MA 4UMPA 3DS6A 4CSVA 5FDXA 4RG0A 4MAOA 4YC8A 3D7ZA 4FC0A 3TN8A 2V5QA 4AU8A 5JGBA 5AM6A 4A07A 5IQIA 1V0BA 4PWNA 5CYIA 5LMBA 3OXIA 4IX5A 4D5KA 1MUOA 5I3OA 2IVSA 4YLJA 3ORPA 3QQFA 1UWJA 5M07A 4FTRA 2X8EA 4I0TA 4PX6A 2XUUA 4OTHA 2QQ7A 5E92A 3NVMB 5EG3A 3FXZA 4BFMA 4LRMA 3IG7A 4B4LA 4JG7A 4WUNA 4O83A 4HYUA 3V6RA 5A6OA 3DK3A 1APME 2J6MA 4JX7A 4DDIA 4UV0A 3I0QA 5DFPA 4V0GA 3BEAA 3IGGA 3K3IA 2YDJA 4EOJA 1DM2A 1W2DA 4BKYA 1K2PA 5J87A 1ZAOA 2B0QA 1AGWA 2RG5A 4KBCA 2VO0A 3EMGA 2NNWB 5GIPE 4FKGA 3BIZA 3S1HA 1G8SA 5H2UA 4C3RA 3KRLA 4FZFB 4TWOA 1YI3A 2WMXA 2GPHA 2UZUE 4P5QA 3QTQA 3QD3A 5CEMA 2HK5A 2XNNA 2FO0A 2QHNA 5K0XA 3V5TA 1BUHA 5CENA 2C30A 5DYJA 5DIAA 2CNQA 3MDYA 5M06A 3D5UA 4NTTA 1NVSA 3BL9A 4CZTA 1Q62A 3G9NA 3UVQA 4FG8A 2XP2A 4CEGA 1KE7A 4RC2A 1MRVA 3BHHA 4EH8A 3BLQA 3F66A 2ZMCA 3ZO4A 3FMLA 3QC4A 4O7TA 3LLAA 2GNFA 3C4XA 4G3FA 3C4FA 4UEUA 3PJCA 5L2SA 5KBRA 3F5XA 4N0SA 4DT9A 4G5PA 3PJ3A 4YGAA 5BPYA 4LGHA 3WZUA 2XK3A 4Q2AA 5EI2A 2XA4A 3R1NA 3FL4A 4KAOA 5HCYA 4ANOA 4FT9A 4FNXA 3UTOA 1S9JA 5GJFA 4BICA 3AC8A 3SRVA 5IPJA 3OWJA 4TYHA 3GFWA 2QOHA 3GP0A 3R21A 4TWCA 5AV3A 1H4LA 5CF8A 4O4CA 5HVYA 3VHKA 4G3EA 2OJ9A 2WEVA 4D5HA 5DNRA 3RAHA 2X0PA 3LFBA 4YJVA 3SXRA 3W0NA 3BYOA 5FD2A 5BVEA 3QRIA 4OTPA 4XV3A 3B8RA 5B2MA 5CALA 2DS1A 5DHJA 2Z7RA 4DG3E 1PMVA 5KE0A 1ZOEA 4II5A 2W1DA 4WRGA 5CU4A 5IQAA 3H10A 3BL7A 4PPCA 3WF5A 3AXWA 4ZMEA 4D4VA 3OW3A 5AAEA 3V5WA 3VQUA 3SOAA 3HAVA 5KX8A 4E6DA 1R1WA 3L9PA 2OG8A 2BRHA 2R0UA 2C68A 3F82A 3LXKA 3KB7A 1XH4A 1U59A 4OT6A 4X3JA 1YDTE 5E7RA 5E91A 4EUTA 4M13A 4EYJA 3AG9A 4CXAA 1PW2A 3QZIA 1IG1A 1AD5A 4IM2A 3RK5A 1ZMUA 3WZJA 4RIYB 5KMNA 4XV9A 4JDJA 4FOBA 4WNMA 3DAKA 3FV8A 5L2IA 3BU6A 4FTOA 4GFGA 2P3GX 3VUKA 3PWDA 2HXQA 2VNYA 2YERA 2F7EE 3ERKA 4EH4A 2YZLA 3WZKA 3OXZA 3PA3A 4YTCA 3D15A 3LCSA 4L3JA 3P7BA 5AP0A 3FXWA 4YNOA 4GUBA 1YRPA 4U45A 3QLFA 3UO4A 3FZTA 2YCSA 4HGLA 1JSUA 4QYEA 4CRLA 2XS0A 4FNZA 5DN3A 1NVRA 3KA0A 4A9SA 2OGVA 5L2WA 3AKJA 3I5NA 3MI9A 5JK3A 4JR7A 5BMSA 5HESA 1XBBA 2YIQA 2R9SA 2XCHA 2WGJA 1U5QA 2A27A 4DGMA 1JKLA 4E20A 3ZSGA 4E6CA 5KCVA 2OBJA 2QKWB 1PXPA 1P5EA 4ACHA 2P2IA 4W4WA 4FV3A 3V51A 4ANMA 2RG6A 5CAVA 2Q0NA 3VBYA 1MP8A 3KRWA 4J95A 3C50A 4W4XA 1ERKA 3AMBA 1ZLTA 2X4ZA 3KIOC 1OKVA 2UW8A 4FX3A 5DRBA 4RFYA 3VS7A 2A4LA 2WU6A 4GIIA 4Z9LA 4AA4A 3M2WA 1GIJA 2B9JA 3R1YA 4EOQA 2WHBA 4CLJA 3DNDA 2RGPA 1ZYSA 1P4OA 4TXCA 4JX3A 5HIBA 3FMKA 5K5NA 4PDSA 5KHXA 4Q5HA 4DEGA 1Q8UA 3QTZA 1FGKA 4PTGA 1Y6BA 3GT8A 4IWDA 3UYTA 4YJOA 3RPRA 5EQYA 4U43A 3ET7A 1M52A 2Y0AA 3EL8A 4IVCA 5IMXA 2BZIB 4GUEA 3HUCA 5M4CA 4KWPA 5EW8A 2PU8A 2DYLA 3PXQA 3CTJA 4IVBA 4CNHA 1IA8A 3DKOA 4W4YA 2PZRA 3ZFMA 1JWHA 4C4HA 3OG7A 4O0UA 4M0YA 3W0QA 1YHSA 4BDDA 4BIDA 3A2CA 5HG7A 3IQ7A 4FIHA 5B7VA 2WPAA 3NPCA 3IDCA 3U4WA 4AZVA 2CN8A 3QTWA 4U7ZA 5AIRA 4DGLC 3DAJA 2UV2A 4IAZA 4LM5A 2WZJA 3RCJA 1L8TA 3VVHA 4AS0A 1CSNA 3PA4A 3FYJX 5GZ8A 2A0CX 4ACCA 4PP7A 4QTAA 4FKSA 2B9FA 2VO7A 3ORZA 3R7IA 4DG0E 4CVAA 5IQCA 3KL8A 2CNUA 4IWOA 2I0YA 3OHTA 3V5JA 3PJ1A 4MXAA 5IG1A 4I1ZA 4I6FA 4MQ1A 4YJPA 2QR7A 4I6LA 5LCKA 2ZYBA 1XH6A 3GC9A 3TIZA 2UW0A 2YM3A 4MBIA 4X21A 2R3MA 4D1XA 4C38A 4HZSA 4U44A 3TUDA 2QOBA 3F2RA 4JXFA 4I0RA 5C27A 2OO8X 3T3UA 4KIKA 2BAKA 4CFMA 2XF0A 2A1AB 3AD4A 4BDGA 3MYGA 4H3PA 2BTSA 3BGPA 5EFQA 4JI9A 1F5QA 4L8MA 4FIJA 4PL4A 3KXZA 2QOKA 4NJ3A 4U79A 5CU6A 3UMWA 4CMUA 4O86A 4CG8A 1P4FA 3F5UA 4RJ5A 5FP5A 5B2KA 3TNWA 5CSPA 1WBVA 4USFA 4LYNA 2YDIA 5IQBA 4EH2A 1W82A 3FDNA 4I6HA 3ACKA 4L3PA 2FSMX 1K3AA 5CXHA 4BDAA 2P2HA 3C4WA 2PMNX 5D12A 2VTJA 2I40A 4UMQA 5AV0A 1YDSE 4C34A 3FXXA 3OUKA 4ORKA 4MF1A 4IDTA 4FSTA 3UOHA 4ZLOA 4CGAA 2PK9A 2R3FA 2XJ2A 4KIPA 4ACMA 3W2RA 5FGKA 2JIVA 2OH4A 3DZQA 2XNOA 3V5QA 2A2AA 4IC7A 4U40A 3SW7A 2VTSA 3CQWA 3ZFYA 2PHKA 5HGIA 3LFSA 1UU3A 2ZM4A 4M84A 4AGWA 4EK4A 4BI0A 4HVDA 4RT7A 4D28A 4L6QA 5AR7A 4F9BA 1W0XC 4BVUA 5EM7A 5E9EA 4C57A 3QKLA 3LCTA 1DS5A 4JJRA 3GCPA 5CU0A 3ETAA 1X8BA 2C5OA 2C0OA 5CSVA 3VWAA 3PY0A 3FLNC 4GT3A 5HLPA 4ITHA 4QYGA 3RZBA 3ZZWA 4GKIA 3NNWA 4DTAA 2RF9A 4BZOA 2VTMA 4L43A 2XMYA 4K1BA 1OL7A 4FSZA 2GU8A 1BL7A 4Q5EA 4NTSA 5HCXA 3THBA 3QTRA 4HYHA 2YIWA 4XG2A 4BYIA 3IOPA 4FGRA 4R7IA 4XV2A 4RX5A 3EYHA 2RIOA 5HO7A 2BCJA 2YWVA 2R2PA 2XCKA 4N4SA 5LCJA 3FLYA 1RJBA 2ITXA 5T3QA 3VW6A 3QWJA 4QMMA 3BQCA 4BB4A 4W8DA 4I92A 5L8LA 4O2PA 2JKMA 3FSFA 3TNQB 3TTIA 5CI7A 3ALNA 4B7TA 4R77A 2B53A 3HV3A 4FT5A 3EQDA 2J7TA 4I3ZA 5LXMA 2X2KA 3H3CA 5IA3A 3A4PA 2Y6OA 4MEDA 2OF4A 4FKJA 4FTIA 3LQ8A 4ENXA 5CF4A 5JEBA 2G2FA 3NAYA 3Q4UA 3FC2A 4QMZA 3AOXA 1YI6A 1OL6A 4KBKA 3MPAA 3HRBA 4NK9A 4WNOA 3VUTA 3O2MA 3LAUA 4FUXA 2WMUA 4ZIMA 2E2BA 1YXXA 3DJ7A 2LGCA 4CCBA 2YJSA 3QQUA 3LKMA 3G6GA 5CVGA 3PIXA 3HMNA 3QZHA 4LL5A 4EYMA 3MB7A 4KS7A 5E4HA 3I81A 3CGOA 3LXPA 3LFFA 2YEXA 3UVPA 3L9MA 1QMZA 3G6HA 4W9WA 4XUFA 3SOCA 4U41A 2R3OA 2ZDTA 4O0XA 4C3FA 2Y4IB 5FEEA 1VR2A 4ZOGA 4X3FA 4DTBA 3W18A 4EHZA 4GIHA 2OF2A 2A98A 3HP2A 5EI6A 2ZV9A 4I4EA 3GOKA 3NUAA 1BLXA 2R3PA 3MIYA 3TKIA 3D0EA 4IHPA 2Z7SA 3ZFXA 4RX9A 4RWJA 4ZY4A 5ACBC 5DR6A 3TKHA 3PP1A 2GHGA 1U5RA 4XP2A 3ZRKA 1ST0A 1CKJA 3MB6A 2VTTA 2PUPA 3CP9A 4EKKA 4FSRA 1YI4A 4F6SA 5M4IA 4O7YA 3K5VA 4QRCA 4QQTA 3RPVA 5DRDA 4ANLA 3R73A 4HNIA 3NUNA 4MD8E 1YVJA 1Q24A 2FUMA 3PE1A 4I5HA 4YU2A 4EZ3A 1OECA 2BIYA 5HNGA 5AV1A 3U54A 4GK4A 1FMKA 3W10A 5L6OA 4D2TA 4J1RA 5A14A 5CAOA 4O7SA 3LJ1A 4H1MA 1UV5A 1XKKA 2OIBA 5ICPA 4DA5A 3AKLA 2ZV2A 3NGAA 2JITA 2WTWA 3TTJA 3ZZEA 2V55A 5BNJA 3RMFA 2NPQA 5HCZA 2AEGA 4C59A 3FKNA 2JDOA 3LCDA 3ULIA 3VRZA 3GUBA 1UA2A 4QMOA 3W0SA 4KKHA 3D9VA 3LM5A 3QA8A 3DBQA 4RA4A 4O7RA 4ZZNA 3RNIA 3L8XA 4C4IA 4RQKA 3HNGA 4QEBA 5BQ0A 1W84A 2PWLA 3KRRA 3BI6A 5KMIA 4FKWA 5GJDA 3OCBA 4YO6A 5GIOE 5FXSA 3N51A 3O50A 1Q8TA 3OEFX 3R1QA 4PPBA 4A4XA 4ZLZA 1OBDA 4RIOA 1WBWA 3FKOA 4GJ2A 5A4LA 1MRUA 3ORMA 2VX0A 5IF1A 1ND4A 5IQDA 1SVEA 3E64A 4K8AA 4TNBA 5CEQA 3QQGA 3CXWA 2XK8A 3UO5A 1BI8A 3B8QA 3OCGA 1KOAA 1O9UA 4ASXA 3DXPA 1YXTA 4M69B 4EH7A 1OIUA 1JQHA 2BR1A 3ZEPA 3R22A 4QYHA 3A61A 3Q53A 2V62A 1KSWA 3PPZA 5F4NA 4L01A 4JLCA 2PYWA 2AQXA 4E6AA 4HW7A 2YISA 3DDPA 1R0EA 4IJPA 1WBTA 4JIAA 3CIKA 1OKZA 2B54A 4FTJA 2CHLA 2HIWA 4F4PA 1IEPA 3MPMA 4C0TA 4HCUA 3T3VA 4WIHA 1BMKA 5KZ0A 3UNJA 4CRSA 5KMMA 4CQEA 2XBAA 2PMIA 4D2SA 2BFXA 3A8XA 3SHEA 3HV5A 3E8CA 4A4LA 3ZUVA 1TFFA 1H1SA 5C9CA 5L3AA 3O7LD 2Y4IC 4IACA 4I5CA 5HG9A 1QPEA 1U4DA 5CLPA 4MTAA 4NYEA 2H9VA 2J90A 5AUWA 3LOKA 4FEQA 5AUZA 3V8TA 4XCUA 3F3WA 3HA8A 2VTIA 3EB0A 3QRJA 1WBSA 4AACA 4BC6A 3HUBA 4DT8A 1JLUE 3DU8A 5IUGA 2YIYA 3A8WA 4FSYA 4MWHA 5H3QA 4PPAA 1PMUA 4XG6A 3P86A 1OVEA 4L00A 5FRIA 3ZC6A 4LQMA 5AUXA 4AE6A 2O2UA 2ITQA 4JAIA 4U81A 4IZYA 1PKDA 1YWRA 1KUTA 2DUVA 1LR4A 3TMOA 3EQRA 5C01A 2IG7A 2ZV8A 2WEIA 2XIKA 5CVHA 4ANNA 1QPDA 3C5UA 4BBEA 1G8AA 4RRVA 3ZHPC 4XHKB 5J8IA 3VNTA 1PXKA 4IAKA 2VWYA 3SA0A 2E9UA 3E88A 3GU6A 3O96A 4IANA 3EN4A 4QMWA 5CASA 2XJ1A 3O8TA 4MKCA 4U8ZA 4E4NA 3R9RA 4Z55A 4LUEA 4U3YA 4TZRA 2WMQA 3CC6A 3SG9A 4ZLYA 4AXDA 4EONA 4R5YA 1Q97A 3PRFA 3ZUTA 2RFNA 3KKVA 3CQUA 3DAEA 3CD8A 4QP7A 4AZTA 3UNKA 4CFVA 5IQEA 3DCVA 4QMLA 5CSXA 5LMKA 3FYKX 3BLAA 4PTEA 4ZTHA 2XYUA 4AE9A 3TM0A 1F3MC 2EXMA 3W0RA 4KD1A 5FTOA 3QCSA 3WI6A 3VS2A 5ANEA 4X3FC 3ZO3A 3HRCA 4PMSA 5GZ9A 5BV3A 2ERZE 5AP7A 2W1FA 3QBNA 4IXPA 3VBXA 4DF3A 2X39A 2V7OA 2X0GA 4OTFA 3QU0A 5CNNA 4FR4A 5LVLA 3KCFA 5KNJA 4FEWA 3S3IA 4O4DA 4I24A 3CTHA 4E4LA 4UWBA 2G2HA 4A7CA 3UIMA 4AA5A 4DEBA 4HVIA 2QO7A 2ZM1A 2CPKE 2ETKA 1U54B 4QQCA 5K0KA 4EH3A 4GYIA 3DT1A 3TNPC 5CZIA 4O4FA 3F3UA 4RJ7A 4ZTRA 4A4OA 4ASZA 3PLSA 5FEDA 3POZA 4GT4A 1A06A 5BUIA 2R3LA 4PY1A 3QX2A 4QTDA 3ENHA 4BF2A 4C35A 5B0XA 3C0GA 4H39A 4JDIA 5AEPA 1OB3A 5IISA 2UW7A 3I6WA 4IB5A 4XYFA 5KMKA 3I60A 4G3GA 4D9TA 2WTDA 2X2MA 3KXHA 3TZ7A 4NH1A 4CKIA 4DGNA 4MXYA 4WG5A 2W5AA 4M12A 3LHJA 3T9IA 4ALWA 2O8YA 3D83A 3PXKA 4DFZE 3V04A 4IM3A 4F9YA 5AAGA 1T45A 3F9NA 4MNFA 4QP9A 3KRXA 3UJGA 4DGGA 1YWVA 3FMHA 4BCKA 5HE3A 4I5PA 4OBOA 3CY2A 4NEUA 5EHLA 1Q8ZA 3H4JA 3IPHA 3JVRA 3LIJA 4HNFA 5JRSA 5LQFA 4GKHA 3A7HA 4B6LA 4ITIA 1OBGA 1J3HA 4QP3A 3ZLXA 4D9UA 4TYEA 3Q2JA 1TQMA 4IB0A 4L52A 2OK1A 5IQHA 4E6QA 3AC2A 4OGRA 2OFVA 3NIEA 1Y6AA 4IAYA 2EXCX 3NUUA 4DHJA 2C6IA 3DK6A 1PKGA 1M14A 3ORXA 3QWKA 4ZZMA 3DLSA 1OL1A 4QDVA 4MNEB 5K4JA 3PZEA 5AMNA 4MX9A 5AP4A 3BYUA 5H8EA 4N6ZA 4FV7A 2OIDA 3NWWA 3VUDA 3IW6A 4L7SA 4QTCA 4QP2A 3M42A 2OJJA 3LXNA 4DH1A 4BCGA 4EHEA 5CZHA 1XBAA 3Q60A 1PJKA 2GNLA 3TDVA 3RWPA 3VJNA 5M44A 5CAUA 5HE2A 4L67A 1SNXA 3R63A 1FVRA 3LVPA 4R7HA 2W1EA 4HPUE 3F3TA 5A3XA 3PXYA 1GY3A 3RPYA 4FV0A 4FUYA 4CYIA 3BGZA 3TJDA</