5EI2A

Rapid discovery of pyrido[3,4-d]pyrimidine inhibitors of monopolar spindle kinase 1 (mps1) using a structure-based hydridization approach
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
279
structure length
256
Chain Sequence
b'QSMSVKGRIYSILKQIGSGGSSKVFQVLNEKKQIYAIKYVNLEEADNQTLDSYRNEIAYLNKLQQHSDKIIRLYDYEITDQYIYMVMECGNIDLNSWLKKKKSIDPWERKSYWKNMLEAVHTIHQHGIVHSDLKPANFLIVDGMLKLIDFGIANQMQGTVNYMPPEAIKDMKISPKSDVWSLGCILYYMTYGKTPFQQIINQISKLHAIIDPNHEIEFPDIPEKDLQDVLKCCLKRDPKQRISIPELLAHPYVQIQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Dual specificity protein kinase TTK
publication title Rapid Discovery of Pyrido[3,4-d]pyrimidine Inhibitors of Monopolar Spindle Kinase 1 (MPS1) Using a Structure-Based Hybridization Approach.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 74
structure length 256
sequence length 279
ec nomenclature ec 2.7.12.1: Dual-specificity kinase.
pdb deposition date 2015-10-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 5ei2A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 5ei2A01
5CAPA 2BIYA 2XKEA 3HP2A 2OXYA 2PUIA 4IZ5A 2R3LA 2WTVA 3PVBA 3FKLA 4QO9A 4MXYA 4EK6A 5EOBA 5AEPA 2QOHA 3AOXA 2YCFA 2B9HA 5DG5A 1HCKA 4L44A 1XO2B 4O6EA 4IC7A 3F5PA 3WZDA 5FTOA 4I94A 4DGMA 4NYEA 2R5TA 4FZFB 1W7HA 4FA2A 3OTVA 4W4VA 2W1EA 2W4OA 3NEWA 3QL8A 3MS9A 4KSQA 4RIOA 4BGQA 4QTEA 5AUXA 1UNHA 3Q4UA 4BC6A 3V5PA 3UIMA 3KMWA 2XKDA 2XEZA 2FSMX 3ZHPC 1CTPE 5LWMA 5M53A 2OW3A 3DOGA 3FWQA 2F2UA 2WQMA 3HGKA 4PDSA 3FQHA 5J9ZA 4BZOA 1F5QA 3CIKA 4CSVA 3BHHA 4ZJIA 3OCGA 3EQRA 3FUPA 4LL5A 5AV2A 1AQ1A 3LIJA 2CGXA 4RWLA 3VS3A 2CKPA 1VJYA 1OPLA 3PJCA 3U9NA 5AWMA 2WIHA 3QD0A 4CD0A 5EHOA 3CJFA 5E8SA 2XA4A 3IQ7A 4PMSA 4IAKA 4O1PA 4G1WA 3RZFA 3ZOSA 5AUWA 4FYNA 5M4UA 4ID7A 1M7NA 2FO0A 2OBJA 4L01A 3QTXA 5BVKA 1PXMA 3EL7A 4AT5A 4DFBA 5FM2A 4V01A 1LP4A 2CLXA 3A7GA 4UB7A 5I5ZA 1P4FA 5IA4A 4UWCA 5KCVA 1GZ8A 2VWUA 3N51A 5F95A 5DT3A 5GIPE 3QKMA 4FYOA 3L9PA 3FXXA 1PYXA 1H1QA 4GSBA 4IM0A 2JFLA 3EYGA 3HV3A 3KRRA 3GENA 4WNOA 4DLJA 3E3PA 3C51A 2ZM1A 3HEGA 4G16A 4MD7E 4EBVA 2J7TA 4M14A 3KF4A 3Q5IA 4J96A 4IX3A 4O0WA 5IDPA 5H9BA 3LM0A 4ALUA 2CNQA 5EI2A 4NKSA 3LFQA 3PE1A 4LGGA 4I1ZA 3C50A 3DKGA 3VIDA 2YLEA 4D28A 5DE2A 4N6YA 3A8WA 4EJ7A 5CU4A 1SM2A 5L2WA 4A9YA 3ID6C 3WF9A 4N6ZA 2O64A 1UU7A 2Z7QA 1GNGA 4P5ZA 3W2PA 4FZ6A 4UZDA 3F69A 5D1JA 3L9LA 3H0YA 2W99B 3OCTA 4EH6A 2QO9A 4RIWB 2R7BA 2OK1A 2WU6A 1CKJA 3DXNA 4F65A 5AA9A 4KB8A 3IONA 3U6JA 3RAIA 3ZO1A 2EUFB 5BQ0A 2BAQA 4EZ5A 5CSPA 2KULA 3QYWA 2OJIA 4RJ8A 3TZ9A 1Q3DA 4K9YA 4J8NA 3ERKA 3QGYA 3R7VA 3FMNA 3RHXA 4UXLA 2XZSA 4FT9A 3CPBA 5ANDA 5LVPA 1XBAA 5HKMA 4CMTA 3ALOA 2ZYBA 5A6OA 1ZAOA 3KKVA 2W1ZA 4UZHA 1R3CA 1QPDA 2CHLA 3QC9A 4GG7A 4AF3A 4G3EA 4I5HA 4QTAA 2AUHA 4WUNA 4EI4A 5J9LA 4ENXA 5DEWA 3Q9WA 4CFUA 2R3RA 3FKOA 3CQWA 1Q99A 4ASXA 2QOBA 3CKWA 3I0QA 3LKMA 5E91A 1KSWA 5IG1A 1T46A 3WZKA 1VZOA 3ORNA 1IRKA 3DCVA 3DKCA 3QTSA 2VWBA 1YHSA 2WOTA 4KKGA 3NYXA 3R63A 5H8GA 5DH3A 3ZSHA 1URWA 5E8YA 4DEEA 2WTDA 3AC4A 4KSPA 4OT5A 3D94A 3LW0A 4IZ7A 4HCTA 1OUKA 2WO6A 4FEQA 3P79A 4L3LA 3RKBA 5HIEA 5FEQA 4AQCA 3TDWA 4N70A 4X6QC 3VBTA 1A9UA 1KE5A 1GJOA 4Q9ZA 4L42A 1P4OA 3QKKA 3MA3A 4FGBA 4E93A 5BYZA 1WCCA 4UXQA 3JR1A 5HG5A 4O83A 1H1WA 3L9NA 3QD2B 4MYGA 3TTIA 2ZOQA 2GNFA 3KXXA 4JX7A 3UODA 3NYVA 3VBWA 4E73A 4F7LA 4F7NA 3SXFA 5CEPA 3DS6A 4QMSA 4TNBA 4CG8A 3VBVA 4PF4A 3VWAA 2BZKB 2O8YA 2RFNA 4G6NA 3V8SA 4BDAA 4KKEA 3QCQA 4OTFA 5IUGA 3SDJA 1FMKA 2VTLA 3P7BA 4JQ8A 3SQQA 4XBUA 4QYYA 4HYUA 4M66A 4Z9LA 3SV0A 3TIYA 3V04A 4R5YA 3EN9A 3FQEA 4UMUA 3MH3A 5HHWA 1OPJA 4EK3A 3QCXA 4BTFA 3PVGA 5KHWA 4R3PA 3KVXA 1SYKA 4RWKA 4X7QA 5A3XA 4ACMA 4AGCA 3VO3A 3DJ5A 4RRVA 3RVGA 4WHZA 3R7YA 3E8DA 2HW6A 1FINA 3VUGA 3W1FA 1W0XC 4TNDA 3POOA 5DBXA 3HRBA 3MY5A 1PMNA 5AM7A 4ANMA 4UWBA 2GNLA 4L43A 4FIJA 4A9RA 3LXNA 5FP5A 3S00A 2C6KA 3EQBA 4Z55A 1PXLA 3NUYA 3V5QA 4H1MA 4WRSA 5G1XA 5HBJA 2W1FA 3A99A 2UZLA 2E2BA 1GY3A 2X2LA 3QHWA 4M0YA 3H9FA 4DH3A 5M56A 2ZAZA 4V0GB 4CFMA 3RMFA 3CY3A 4J99A 4FNXA 3FXZA 4EOSA 4EOKA 4PPCA 4R77A 3PA5A 4RX7A 4ZS0A 3HMMA 4CT2A 5CSVA 2E9PA 1KE7A 3WE4A 2X81A 2I0HA 4K33A 3MY0A 4YHJA 3G15A 3KB7A 2WMSA 3TZMA 2ZMCA 4C3RA 3LFDA 4FTLA 4C58A 3NR9A 3OXIA 5HTIA 2V7AA 3U54A 3CGOA 4C7TA 3OFMA 4U80A 4ZEGA 3ORLA 3C0GA 3R1NA 5C8NA 5CSWA 5E8XA 5BUJA 2B4SB 4CTBA 4XP0A 3C1XA 5L8KA 4Y95A 2HENA 2W1IA 4O0UA 4UYAA 4O86A 3O8TA 4RA4A 5IH4A 2JDRA 3LVPA 1SMHA 4ERKA 4YO4A 2JD5A 4GIHA 4IDVA 5IA0A 2C69A 1U54A 5ANGA 3FBVA 5K0XA 3R9DA 2XYNA 3ORZA 1AD5A 4FKIA 4YNEA 5HU9A 3SC1A 3BRBA 2QONA 2WKMA 3GT8A 2PWLA 3N4UA 3R00A 2QOKA 2W7XA 3H9OA 5CF4A 2PVJA 3I5ZA 5CT7A 3ITZA 1IA8A 2QVSE 2C0IA 2X9EA 4FIHA 3LZBA 4D55A 3DBQA 2J4ZA 5KMOA 3OBJA 2B9FA 4O0SA 1P2AA 3B8RA 2ITYA 3L1SA 1IG1A 2C3LA 3FL4A 4K1BA 4LUDA 4ANBA 3MDYA 3D2IA 3P08A 3QF9A 2R7IA 4ITHA 5EG3A 3V01A 4KBCA 3WOWA 1SVEA 2X8IA 4M3QA 3ORTA 3NYOA 3DB6A 3O51A 2VGOA 5DR2A 1ERKA 5EW3A 5HGIA 3UO4A 1YDSE 4QP7A 4GK4A 4FTJA 4XJ0A 2UW9A 5KMNA 4LYNA 2IVTA 2OJ9A 2HAKA 3E92A 4CLIA 4JDIA 5HE2A 1PXJA 1ZMVA 3C0IA 1ZMWA 3F9NA 3MPMA 5AADA 4O7RA 2A19B 3PIYA 2Y0AA 2LAVA 3AD5A 5J79A 3ZUUA 2CJMA 2X6EA 4CQGA 3MW1A 5AR2A 4GUBA 1QL6A 4FV5A 4Y46A 4QRCA 5AIKA 1LPUA 3SX9A 4I0TA 4KWPA 2IZTA 3VF9A 5BPYA 3GGFA 4JS8A 1KV1A 3RAKA 1IAJA 5AAGA 1K3AA 4TYEA 4FKJA 3DQWA 2OJJA 3UIBA 5GZAA 5AFVA 1REKA 3QWJA 4EQMA 3RK7A 4QYGA 4XG6A 1RW8A 3HECA 1IEPA 2HIWA 4RFMA 5J8IA 4IAYA 5EW9A 2GFSA 4YZBA 3ZM4A 4ZSLA 4ZJVA 5AP5A 4B4LA 3FC1X 2YCRA 3WZUA 3NLBA 4Z7HA 3RI1A 3W18A 4AOJA 3JVSA 3EFJA 2O5KA 2W05A 4HZRA 2JDOA 3IOPA 4K77A 4PDPA 3ETAA 4WG5A 4IWPA 3GC8A 3QA8A 4C4EA 4TYHB 4YUQA 1O6KA 3FHRA 3CD8A 4L68A 5BVFA 3CEKA 3UMWA 2YA9A 3CLYA 2BTRA 3I6WA 1VYZA 3FLYA 4EUTA 3NMUF 2QG7A 4X2FA 3G9NA 4EH4A 2BKKA 4ORKA 3EWHA 4U41A 5KMKA 3FAAA 3V8TA 2VO3A 4YNOA 1UKIA 5JZNA 3UG2A 2BR1A 3DJ6A 1S9IA 2YFXA 3BE9A 4XV9A 4O0XA 5D10A 1WBTA 3FC2A 3NNWA 3OWPA 4FEUA 4ITJA 4QMXA 5C27A 4BKYA 1WBSA 3DAJA 4YLJA 2Y6OA 3M1SA 5DHJA 4Y5HA 5AM6A 2G2FA 4BB4A 4R78A 3CTHA 3NIZA 3NZ0A 2HZNA 4IFGA 2YIRA 4QMUA 2OXDA 4DFNA 5I9YA 2P0CA 4TWOA 5CTPA 3NUAA 4AN3A 4E4LA 1TKIA 3A8XA 3AMAA 3GU5A 4CXAA 1O9UA 1OKVA 2ITTA 3PY1A 1G8AA 2QHNA 4BWPA 2Y4IB 3VHEA 3ZZEA 4J8MA 4E7WA 4FODA 3PZEA 4NCTC 4HVDA 3G5DA 1OGUA 4IX4A 5CXHA 4DINA 3FLZA 3FI3A 5D7VA 3ORXA 2WQBA 5M07A 3F61A 5IQFA 4MD8E 4M8TA 3Q96A 4FTCA 3FE3A 3OXTA 3MY1A 1RDQE 3A60A 4QYHA 4ZTMA 1G5SA 3Q04A 4FV9A 4FG9A 1ZYCA 3DNDA 4G31A 2UVXA 4ACGA 4DFLA 1IAHA 1PJKA 3HL7A 4FIEA 2PE0A 4FT5A 5HE0A 4KRCA 2XNGA 4DG3E 1Q3WA 3SW7A 3DAKA 4IADA 4IFCA 4YBKA 2JITA 2VZ6A 5J5TA 5AUVA 4O0YA 4O7SA 4F9AA 4Q9SA 2OJGA 2R3NA 4I92A 5AR4A 4R1YA 4C4IA 3TIZA 4N57A 3QRJA 3KN6A 2JIUA 3BV2A 5CENA 3DNEA 4QYFA 2B55A 4YC3A 4JIAA 2BFYA 2GNJA 3CPCA 5EYMA 4EH5A 2PUNA 3IW7A 3ZUTA 3D9VA 2WMXA 2BZIB 3ELJA 2JKOA 3FL5A 3KN5A 4TYIA 5LVLA 4ZTLA 3TEIA 4ZS4A 2EXEA 4TYGA 2J0JA 1PXKA 3GOPA 1YI6A 5DT4A 3E8CA 3MFUA 4XMOA 4YTCA 2QHMA 1XH6A 2X4ZA 4QMLA 3FSFA 2W5BA 4I24A 5AA8A 3BKBA 3NX8A 1OECA 3ACJA 3QTIA 3RK9A 3MB7A 3V5WA 2GS6A 2XUUA 2QU5A 4M67A 5AX9A 5IA1A 5AAEA 2ZJWA 2R0IA 5ANKA 2UZTA 3CGFA 3SGCA 4RX9A 1PMUA 4RIYA 4JAJA 2RL5A 3TN8A 3PIXA 4AA4A 4G6LA 1NVQA 1YI4A 4IVDA 5K0KA 3T9IA 4FUYA 2YIXA 3F66A 5HICA 3PSDA 5I9ZA 4JQ7A 2EVAA 3E7OA 3BLRA 3FMDA 4MAOA 4Q2AA 2VO0A 1Y6AA 5DRDA 4BDGA 4RGJA 3WYYA 2YLFA 1V0OA 3B8QA 3BYUA 2WMWA 4HNFA 5M51A 4DGGA 3OS3A 2XF0A 3FMLA 2CMWA 4RIXA 5A4LA 2PVFA 5IH5A 5ACKA 1OIRA 4BCHA 3QA0A 3ZBXA 4FNWA 4NT4A 4QMQA 5A9UA 3S4QA 3NUUA 4HYHA 4IZYA 4XBRA 4C34A 3L9MA 1PXNA 5LMAA 3DTCA 1BYGA 4F1OA 5IQHA 5GINE 1BL7A 4KS7A 4JG7A 2ETKA 3QXOA 2BDFA 4FKTA 3IECA 2VWZA 5JMSA 4RWJA 2JIVA 4MXZA 3DXQA 4MXXA 1NY3A 2CCIA 4ZXTA 4QMYA 4I5MA 2GTNA 4NEUA 3KK9A 5B2LA 3W2QA 1GIIA 3PWDA 4U44A 2QKRA 4C35A 3BELA 4MNEA 4W8EA 4ONAA 4WNKA 4I0SA 4XG8A 2VU3A 3U51A 3PVWA 4EOLA 2CNVA 2JAMA 3UIXA 3QX2A 4OAUC 4AGUA 3TI1A 1YW2A 2HW7A 1SNXA 1BLXA 4NCTA 3EZVA 2F9GA 4RC3A 3U87A 5AP2A 3VW6A 3COKA 2Q0NA 4U81A 5FDXA 5LOHA 2YABA 2GDOA 1XH4A 4QPAA 5T3QA 3KMUA 1YXSA 5AP4A 3FZRA 1U54B 5BYLA 3BI6A 4PNKA 4USFA 5JQ5A 4I41A 4DH1A 2E9OA 2OH0E 4O21A 3HRFA 2R3IA 4KIPA 3WIKA 3TV6A 5CNOA 4XLVA 5EM7A 1Y57A 3RAWA 3PY3A 1OZ1A 3O71A 4PDOA 4O22A 4WSYA 4ZOGA 4A4XA 1GZOA 4O7LA 2FVDA 2Y9QA 2C6EA 2XK4A 4UMRA 3PTGA 4KS8A 1MRVA 2C0OA 3MVJA 3R1SA 2EXMA 1JKTA 3P0MA 4IVAA 4A4OA 3E5AA 3GU4A 3UMXA 5AUZA 2PVLA 4I5PA 4H05A 4F7SA 2IG7A 1LEZA 3WILA 2IZUA 3ALNA 3M42A 1APME 5DN3A 4QP9A 4U79A 4ZTNA 2DWBA 1K2PA 2PK9A 3S2PA 5CF8A 3BWJA 4LUEA 2PYWA 2C5VA 4FR4A 3ZFYA 4ANQA 3C0HA 5I9VA 4WA9A 5BVWA 3R7EA 4AWIA 5CANA 3O8UA 4F0GA 1SVHA 3QX4A 3UYSA 4E4NA 4F9YA 2XBJA 2ZV2A 3LQ3A 2QD9A 5JFWA 1JKKA 4FVRA 2XH5A 4EUUA 4UV0A 4DT8A 2WTIA 4FUXA 4ACHA 4ZK5A 2I6LA 5HE1A 1PMVA 1M52A 2WEVA 5M09A 2VTNA 5IQBA 2VTJA 3ZTXA 1XQZA 2X1NA 1H8FA 2QOFA 4PNIA 3LJ2A 4F6SA 4KA3A 5IQEA 4ZMFA 3UYTA 4RWIA 3D83A 4C61A 2OGVA 3F7ZA 4ITIA 5HOAA 1PKGA 4MNFA 4MXAA 5E1SA 3SXRA 3LFEA 1OM1A 1TVOA 3OEZA 4WD5A 4EK5A 2G2HA 3R22A 2YCQA 3LMHA 4FV8A 3ODZX 4IANA 3UP2A 5B7VA 3TM0A 5I3RA 3FKNA 1LUFA 5HG8A 4U9AA 1SNUA 1V0BA 2JBOA 5A6NA 1Q8UA 2WPAA 3UZPA 4QP1A 3CTJA 2UW6A 3ZEPA 4EORA 3LFCA 3SOCA 2WOUA 3JVRA 5ITAA 4IAIA 5ETIA 4UWYA 5L2TA 2JDVA 5EM6A 3UE4A 3U4UA 4BDIA 4H36A 3RNYA 3LFFA 1KE6A 3SG8A 4D4YA 4BDJA 5LXMA 3IDCA 3D7TB 3KU2A 3IW4A 3KVWA 4RVMA 3D15A 4TW9A 2XIRA 4NWMA 4TWPA 2OI4X 3U9CA 2JDSA 3A4OX 4X3JA 3GEQA 3THBA 4F63A 2R3GA 5HU3A 3D7ZA 2RGPA 4ASZA 3VBXA 4FMQA 4YC8A 5HX8A 4TXCA 3H0ZA 3R7UA 3ZXZA 5HO7A 2O3PA 3PDTA 3FMKA 4HGSA 4JOAA 4KKHA 3ZBFA 4EKKA 4DEBA 2YISA 3QALE 5GJFA 1UKHA 5E90A 5AV3A 5GZ9A 5FLFA 4QYEA 2QU6A 2G2IA 3DT1A 4OTQA 4XOYA 1M17A 1YHVA 2O63A 4BY9E 4EJNA 5JN2A 2C6MA 2XK6A 2BTSA 4FV3A 3NUSA 4EH8A 3UPXA 3GCSA 4FKGA 4S30A 2QOLA 3CXWA 5ANEA 5LQFA 5M57A 4G3DA 3DK6A 2WTCA 4O91A 4WRGA 2YCSA 2B0QA 3QU0A 5C03A 2EWAA 2OZAA 3IGOA 5HO6A 3EN5A 5AJQA 2BFXA 3LXKA 5HCYA 3UC4A 2ITVA 3E64A 5DR6A 3VQHA 4DHFA 5HNIX 4EH9A 3QKLA 5EH0A 2P2HA 4IQ6A 3UBDA 3K3IA 4MKCA 4GL9A 3FQSA 4DH7A 3PG3A 1ATPE 1BUHA 3LMGA 4LQMA 5BMSA 4BBEA 5FEEA 4FZAB 2PMNX 4BDHA 2GU8A 5LJJA 1WBPA 3VN9A 3EKNA 3FMMA 3D5UA 4EWHA 3VJOA 5K4JA 2H34A 5LVOA 2R3OA 4F64A 5DOSA 1JNKA 2J5FA 4E6DA 3VRZA 1RJBA 1WMKA 5G6VA 3ZMMA 2E9UA 4KAOA 4K11A 5ANJA 2IJMA 4NL0A 3FLWA 4DBXA 2V55A 4IIRA 5EYCA 4AW0A 3OEFX 3ZDIA 1YOMA 3IW6A 5CEOA 1ZZ2A 2FSOX 1YDTE 2VD5A 4CV8A 3AT3A 3C4XA 4H1JA 3QQFA 4IH8A 4WNMA 5JKGA 3TDVA 1Y8YA 3S95A 4D0WA 4Y73A 5AR8A 2WTWA 5DYJA 1ZOGA 5IQGA 3O96A 3F82A 4DE4A 4YHTA 3I5NA 1H0WA 4OGRA 5CQUA 5DVRA 2CSNA 4BCOA 4F7JA 1J7UA 4YZDA 4NW6A 2OO8X 4IACA 3BBWA 3JYAA 1XBCA 3MH0A 1I44A 4RZWA 5DA3A 4BDBA 4ZSEA 3AC8A 3GQLA 1DAYA 3GB2A 3EL8A 3GC7A 5EHLA 4YR8A 4BIEA 2HXQA 4FKPA 4I20A 4YP8A 4GS6A 5ETCA 3RM7A 2QOQA 4IXPA 3BHYA 3KEXA 4BCKA 2BALA 2ZB1A 4AP7A 3OT8A 4AGDA 4AE9A 3HV4A 4YJNA 3AXWA 3JY0A 5IA2A 4M15A 4RIYB 2XM8A 3TUDA 5M06A 4BTJA 1F0QA 2QQ7A 2W1CA 3Q32A 5ETAA 1WBWA 3FDNA 4JBQA 3ZSGA 1O6LA 3VAPA 3ZO3A 1Q97A 1OI9A 5DPVA 4U6RA 4XV1A 3QYZA 4JNWA 4N4SA 2FSTX 3IK3A 3KFAA 5FDPA 4KNBA 2O2UA 3UGCA 4NJ3A 5E4HA 4DH8A 4A9TA 3DXPA 1LR4A 4GEOA 3KCFA 2C1AA 1Q8YA 1PKDA 3NW7A 5IDNA 3R8PA 1IR3A 4ZIMA 2FA2A 4GW8A 2PVNA 1H08A 2ONLC 4ANNA 3GVUA 3IW8A 3LCDA 2VN9A 3MPTA 3UOHA 5F9EA 2WMAA 5ICPA 4C36A 4TWCA 2WMUA 1O6YA 3GP0A 3L8VA 5FGKA 3TL8A 4FK3A 1YXUA 3KY2A 4LOPA 3UZTA 3HAMA 3QZHA 1E1VA 4FVPA 5JGBA 4DCEA 2WMVA 3CE3A 3FI8A 2OFUA 3IS5A 3HVCA 4IVCA 3R8VA 4A07A 4KD1A 3PXYA 2AC3A 4LM5A 2ITZA 4O38A 5AP6A 2IN6A 4BWKA 3W16A 1Q5KA 4RX5A 3UVPA 3BIZA 5EM8A 2RFEA 3G51A 3EQCA 3RPOA 4BF2A 4J97A 5J95A 4Z16A 4NFNA 5B2MA 4OW8A 2WD1A 1ZYSA 4AA0A 2VTTA 4JG6A 4UY9A 4Y8DA 5C9CA 4DFYA 3GU8A 4W4WA 4MTAA 2VX3A 3PJ2A 3NUNA 2P33A 3HV6A 4HGLA 3V6SA 4U3YA 4JR7A 3C5UA 2OXXA 3SVVA 2GQRA 3HA6A 1AGWA 1CKPA 2BRBA 2GQGA 4FKOA 4WO5A 2W96B 4ZP5A 5TE0A 4PMTA 1JKLA 4G9RA 1W82A 3OW4A 3Q60A 4FSZA 2W9ZB 5D41A 2I0YA 3LFSA 4QP6A 3VUIA 3FHIA 3QWKA 3BLQA 3BV3A 5CSXA 3COHA 5EQYA 4PV0A 2HZ0A 4IX5A 4QTBA 2LGCA 4B8LA 3R8ZA 2VTOA 2XKFA 3IOKA 4C8BA 2X6DA 4K8AA 4AU8A 3SHEA 3EOCA 1GIHA 3SOAA 1LEWA 2NRUA 1W83A 2NPQA 3FPMA 3H30A 4U0IA 5CAVA 4FG8A 3AC3A 4U40A 5CX9A 1Q8WA 4BKJA 3PJ8A 1U5RA 4E26A 3O17A 3JS2A 5EQPA 2O0UA 3KRWA 1BI8A 4NK9A 2OU7A 3MSSA 4K18A 2F7ZE 4NH1A 4X3FB 2IVVA 4RPVA 3B2TA 4RJ3A 4CFNA 3BEAA 2PMLX 2ZDUA 4KINA 3K5UA 5B0XA 3PYYA 4UX9A 2A0CX 3AT2A 4H3PA 4C4FA 4U42A 5DEYA 3T3VA 3OOGA 2XIYA 1CMKE 2XCHA 3R01A 4MVFA 4GIIA 3ULZA 4JVGA 2B9IA 4ZSJA 3QRKA 1I09A 3BYSA 4FZ7A 4RJ5A 4EOOA 3ORPA 3LLAA 3BPRA 3AD4A 4IWDA 4NZWB 3AMYA 3Q2MA 4FK6A 1MQBA 5ETFA 3KA0A 4CFFA 4DH5A 3R71A 4WUAA 2VWXA 2WB8A 4H3BA 4P90A 3OCBA 4QMZA 3W2SA 4BZDA 3OVVA 2ONLA 4LFIA 3RJCA 2YITA 2GSFA 4E4MA 3FJQE 5F20A 4QQ5A 5GHVA 3PIZA 4LRMA 3W10A 4FBXA 1Z5MA 4HPTE 1FBNA 4PL3A 5E8ZA 3PE2A 1T45A 3OCSA 3ZC5A 2IW9A 4E1ZA 4IWQA 4RC2A 2IVUA 3IDBA 4GT4A 2V7OA 4GK3A 4ZTSA 3VS6A 4W4XA 1PHKA 1W8CA 4IE9A 1YOJA 3KRLA 5L2IA 4L7FA 3QXPA 4EEVA 4ANOA 1ZMUA 1H26A 5AV1A 3E8NA 2QOOA 2VX0A 3MH2A 3ODYX 5EI8A 4DGOA 3LMIA 3P5KA 3P86A 5CEKA 3C4WA 3AT4A 3DPKA 3UTOA 4ACCA 5GZ8A 5LVMA 4BDDA 1OITA 1WFCA 4IB0A 3T3UA 5H8EA 5E8VA 4WSQA 4G9CA 2YAAA 3KXHA 3F3ZA 2EB3A 2ITUA 1L3RE 2QI8A 2REIA 3FZOA 1M14A 3HV5A 4EH2A 4U43A 5HVKA 2QC6A 3T9TA 5E8TA 2PZ5A 5CQWA 5CWZA 1Q8ZA 2GQSA 2QO7A 5M44A 5IKWA 2OJFE 4S2ZA 2G9XA 3KULA 3BYMA 3U6IA 3P4KA 2G15A 3KGAA 4QP2A 4F08A 4L7SA 4IJ9A 5JEBA 3R2YA 4U45A 4D1XA 4JT3A 5KKRC 5A46A 4O7ZA 4C57A 4NSTA 4MD9E 1OIQA 2Z7RA 3HYHA 1UU3A 3QCYA 3QUEA 4L3JA 2UZOA 4GJ2A 4OTWA 3WYXA 4BGGA 3UG1A 4BL1A 5FM3A 2BRHA 3BHVA 2H8HA 4AFEA 4GT3A 5JK3A 3QTWA 3QD4A 2J50A 4YBJA 4UN0C 3PSCA 2XIZA 5L2QA 2WU7A 4NM5A 4CZYB 3Q53A 2VTPA 4M97A 4U8ZA 4FKLA 2C0TA 1J3HA 3M11A 2UW0A 4GVJA 4AZTA 4Z3VA 4CG9A 4EZ7A 3EQGA 2F4JA 4LG4A 4AZFA 3WE8A 2XK3A 4J98A 4GYGA 4JX3A 4BDFA 4D4RA 4W9WA 3TJDA 5EM5A 3M2WA 5T68A 4DEIA 4O0VA 3GCQA 2XRWA 2B52A 2R3MA 4FI1A 4FTUA 5CU3A 4ZTRA 2J6MA 3D5VA 3HMPA 3IKAA 2XJ1A 3C4EA 4ZLOA 4APPA 3U55A 2NNWB 3P7AA 3NUPA 1J91A 1XH9A 2BVAA 2XNPA 2A1AB 3PPJA 3H3CA 4L67A 2RSVA 4DEGA 4QMMA 1H4LA 3IGGA 3LOKA 3EMGA 3N4VA 5A4TA 4DEDA 5HLPA 3BHTA 4NJDA 5GIOE 4V05A 5CLPA 3FMHA 3NSZA 3LFAA 3V5LA 2UZNA 4DGNA 4B7TA 3RWPA 3HRCA 4FIGA 5GNKA 1UWHA 1PMEA 3UPZA 1TQMA 5HE3A 4YTIA 5EW8A 5CAUA 2I0VA 2P2IA 4ARKA 5HG9A 3JXWA 3E88A 1JSUA 4J95A 2UZUE 5J87A 2HWOA 3RCDA 3ULIA 3FLNC 4XG4A 4EONA 4O7VA 3FI2A 4FV1A 1H01A 1OL6A 1U5QA 3MB6A 3RINA 4IAFA 4FSRA 3SAYA 4FKUA 3WF8A 1ZOEA 1NW1A 5CVFA 4TKSA 3R7OA 3CBLA 3BQRA 3NRMA 3BBTB 4YPSA 4FV0A 2IO6A 1W84A 4GYIA 4R7IA 1M2QA 5AP7A 2ITNA 2VGPA 4W8DA 4BCJA 1PXOA 5LWNA 3OG7A 5TOZA 4FF8A 4XS2A 4QPSA 1URCA 3P1AA 3FPQA 2PULA 3K54A 5HZNA 1RQQA 2ACXA 4F9CA 4IEBA 5IZFA 4HPUE 2GS2A 1QPEA 4DYMA 3ET7A 5HTCA 3V3VA 4FG7A 4CYIA 3DFAA 4FEXA 2VTMA 4FL3A 3F5XA 1QPJA 5IA5A 2UZEA 1PXIA 4GV1A 2WTKC 3KXGA 4II5A 5IF1A 2JDTA 2BKZA 4XP2A 3LFNA 4BZNA 2AYPA 4K6ZA 4BCMA 1JQHA 5M4CA 5J1WA 4YJOA 5C4LA 4OTRA 3CC6A 3QUPA 3VS2A 4GFMA 2XK9A 4APCA 5CF5A 2IVSA 2UZWE 4GG5A 3FYJX 4YO6A 3HP5A 1MQ4A 2QO2A 5DLSA 3KCKA 1R0PA 2RF9A 4O1OA 3LCOA 4I6FA 4NKAA 5CT0A 1JAMA 5C01A 5J7BA 1U4DA 2F2CB 2FSLX 4PL5A 3RWQA 2XNOA 4A9UA 1NA7A 3UJGA 3QD3A 4Q5EA 5IMXA 5JQ8A 2OICA 5E8WA 1MRYA 4HCUA 4XEYA 3PFQA 5FD2A 3VUTA 4V04A 1YXVA 4O0TA 2ITWA 2PU8A 4HGEA 1SZMA 3DLSA 3VULA 2UV2A 3NPCA 2C3JA 1Y8GA 4FTNA 2OSCA 4DTBA 5TO8A 4O7YA 1B38A 3DU8A 4U5JA 3UO5A 3UNKA 2YDKA 3ORIA 4BCNA 4H39A 4JDHA 4PMMA 4JAIA 2C3IB 4FSUA 2VX1A 4NM3A 4FZDB 2ZV8A 4XX9A 3K3JA 3UQGA 4D2RA 4RBLA 4WOVA 3TJCA 1OL5A 4NTSA 4XG3A 2VO7A 4FKSA 3DFCB 5LMKC 2PMIA 3KXNA 4IM3A 3KXZA 4AACA 2QKWB 2HY0A 2OLCA 4BI0A 5BVEA 4AGWA 4GKIA 3BU3A 3RPRA 4PL4A 3MA6A 2WHBA 4AAAA 4FT0A 4BCIA 2C3KA 3R7IA 4ZAUA 5KBQA 2V5QA 4B6LA 3DJ7A 4KBKA 2QLQA 3GI3A 3D4QA 3SA0A 5TR6A 1A06A 3MVLA 3Q9XA 4ACDA 5BUEA 2C6LA 5IUIA 3ORKA 4IAAA 4IB3A 2OIBA 2YWPA 4JRNA 4MBLA 3FLQA 3QFVA 2HK5A 3OMVA 5IEXA 5JFXA 3C4FA 4HVGA 4M12A 1GZNA 3QRIA 3QTRA 3P7CA 2PZIA 3VJNA 4CFVA 3RBWA 2GS7A 5C8MA 5I9XA 5DI1A 3II5A 4QQTA 4AG8A 4G6OA 3W2OA 3RGFA 2YDIA 5CU2A 4AZWA 4G3CA 4BIBA 4CV9A 4ASEA 2IPXA 5IQIA 5J1VA 3EFKA 3MN3A 3A2CA 5HD4A 1YVJA 4GK2A 3OF0A 4EHEA 4A9SA 3BE2A 1WVXA 2GFCA 3QHRA 5AAFA 4BFMA 3PA4A 1Q8TA 5CI6A 5HEZA 3ENHA 4CCUA 2ZV9A 4LRJA 3VW8A 4YZ9A 4K0YA 1Q4LA 1U46A 3CCNA 2XJ0A 4QTDA 1OL7A 4BCPA 2VTHA 3I0OA 2J0MB 5CVHA 3PXZA 3VBQA 4YTFA 5BYYA 4JR3A 2ZVAA 2PMOX 4YPDA 3ZSIA 4FKWA 4HNIA 3EB0A 3G0EA 4FTOA 1QMZA 3R9OA 3TUCA 2XNEA 5DIAA 3FZSA 4RQVA 2PTKA 4R1VA 4CRSA 3ORMA 2JBPA 5C8KA 4E6QA 3FYKX 4D9UA 3O7LD 1FVRA 2Z8CA 4PRJA 4CQEA 4DFUA 3CKXA 1R1WA 5KHXA 2DYLA 3NNXA 5HTBA 4XG7A 1ZY4A 3TNPC 2IZSA 3ZFXA 2Z2WA 5AP1A 4AS0A 5FUTA 5H8BA 3F2NA 4X2NA 4BCGA 3ZM9A 2XP2A 2QODA 4L53A 3UOKA 2PUPA 4IWOA 2EXCX 3MH1A 2C1BA 3QTUA 4IMYA 3ZRKA 4O27B 4YHFA 4FX3A 4JJRA 4EHVA 5D9HA 3OW3A 3D0EA 4DITA 3FXWA 2JAVA 5A4QA 3CQEA 2WEIA 3DBEA 1ZYDA 3FLSA 5EDQA 3ZZWA 5E7RA 4L9IA 3WBLA 1S9JA 2ITQA 3F5UA 3G0FA 3R2BA 3VNTA 1ZOHA 2C4GA 1DI8A 3LXLA 3PJ3A 2X7FA 4F09A 1JPAA 4OR5A 2C5XA 4BDCA 2BILB 4I6BA 3PA3A 3ZXTA 2JLDA 4MXCA 4ZSGA 3UQFA 4D2SA 1WBOA 1XH8A 4AZEA 3DA6A 4CRLA 4HOKA 4ZTQA 5CNNA 5CASA 5CYIA 4FV7A 4NW5A 4JBVA 4EK4A 5LMKA 4XHKB 4BWXA 1BI7A 1Z57A 3ZUVA 3QZFA 4OT6A 4EOJA 3UC3A 1H0VA 3PG1A 4TPTA 3P9JA 2PUUA 4EC8A 3RPYA 4USEA 3I6UA 4NM7A 3PUPA 5HQ0A 2VTIA 1YRPA 2Q0BA 3MBLA 5H3QA 3VF8A 2V62A 3RP9A 3ZLWA 4D1SA 5K4IA 3GCUA 4YMJA 2GHLA 2Y8OA 4LL0A 2R9SA 3KXMA 3U4WA 3GC0A 1YOLA 2XK7A 1G8SA 1XH7A 4GVAA 4I6QA 3OP5A 4PPAA 3BHUA 3TNHA 2HOGA 1ZYLA 2BDWA 3KL8A 3HLLA 1JBPE 3QRTA 4RQKA 4R3CA 3KREA 3JPVA 3G6HA 4RX8A 3DV3A 1OIUA 1ZY5A 2P55A 5FWKK 2VWYA 3G90X 4NU1A 2OZOA 3LE6A 1YWVA 5IUHA 4I21A 4F4PA 3Q5ZA 3QQUA 4TTHB 4C02A 2ZV7A 1J7LA 3MFTA 3KC3A 4PTCA 2A4LA 4FV2A 2HY81 3GOKA 2B9JA 5KZIA 4DT9A 5C26A 2WZJA 3R1YA 3T8OA 2V0DA 4EOIA 2YIQA 3BGQA 2P4IA 3R8MA 4BCQA 3HUBA 4IVBA 2R64A 3PJ1A 4B9DA 4RFZA 4MXOA 4JDJA 1REJA 2GNGA 3Q3BA 2JEDA 3A7IA 3ROCA 3A7FA 3KRJA 2QOCA 2GHGA 3BEGA 4UEUA 3LCSA 2JKQA 4H58A 4JBPA 3MTLA 1R78A 5J9YA 2W9FB 3O2MA 4FTIA 4M84A 3RK5A 4AOTA 1IA9A 4V0GA 1CM8A 1H1PA 2NO3A 2RKUA 1DI9A 5EYKA 4YLKA 4JIKA 3PP0A 5I3OA 4DN5A 1VYWA 4CYJA 4EYMA 4C59A 4P5QA 5JSMA 2H6DA 2CN8A 3QC4A 5FXQA 3EN7A 4WG3A 4BYIA 4AN9A 1XH5A 5GJDA 3DLZA 3R0TA 5KBRA 4OLIA 4J52A 2XNNA 3TCPA 2VO6A 3E7VA 1CDKA 1HOWA 1QPCA 3HMIA 5F1ZA 3OWKA 2W1DA 3SD0A 5CU0A 3EQDA 4C4HA 4WBBB 4PY1A 4MBJA 3FZPA 3QCSA 2R4BA 4YJQA 4YJVA 1H25A 2WAJA 4MX9A 3UIUA 1PF8A 3UVRA 3BZ3A 4AE6A 4AT3A 2QG5A 5I0BA 4C37A 2ZM3A 4X6RA 1BX6A 4B8MA 3MJ1A 3AD6A 4CZTA 5L3AA 4BHZA 4WIHA 2R3QA 4HVIA 3BYOA 5AUUA 2PSQA 4FIIA 1BL6A 4IX6A 2FH9A 4U7ZA 4WBOA 2IWIA 3S0OA 4DG2E 2BRGA 2RG6A 5LMBA 1YXXA 4LGDA 4UMPA 3HA8A 4KBAA 4QT1A 2W06A 3V8WA 4GU9A 2YEXA 5CZIA 3TKHA 1JWHA 2YM8A 4FSNA 4RJ4A 2X7GA 3HAVA 4G2FA 2PVMA 2VWVA 2X8EA 4XLIA 4QP8A 1X8BA 3R6XA 4YJUA 3V5TA 5EOLA 5ACBC 4KABA 4HW7A 5D7AA 4XNEA 2Y4IC 1Q62A 2CCHA 1OVEA 3AMBA 4IB1A 4BCFA 4W9XA 4FTKA 3KK8A 4LMNA 5AMNA 4CZUA 4J53A 4LOQA 4IDTA 2ETRA 5CI7A 4PWNA 3H9RA 4UMTA 2X8DA 5CF6A 5IQAA 2XKCA 4DG0E 3GBZA 4PMPA 2J2IB 1M2RA 3PLAE 4RVKA 4G5PA 5E9EA 5HI2A 3H10A 3KQ7A 3VS5A 3FEGA 5JFVA 3LHJA 4OUCA 4RFYA 1Q61A 2CPKE 5CS6A 3F2RA 4XYFA 4FVQA 4F70A 5K5NA 4Y85A 2YDJA 3LLTA 3PWYA 3QBNA 4P2KA 4EL9A 2OIQA 4EHGA 4DBNA 1J1BA 4C2WA 1R39A 4RMZA 2HWPA 1XBBA 5HIDA 4RZVA 5CAOA 2BMCA 4LI5A 1OKWA 1OKYA 2B1PA 5FQDC 4EKLA 4CMUA 3FI4A 3MFRA 2C6IA 4ZZMA 3FZ1A 2C6OA 3R28A 1ZXEA 3Q9ZA 5HO8A 3BLHA 4QP3A 5EHYA 5F94A 4CMOA 4D5KA 2BHHA 1NXKA 2XS0A 3CD3A 5IQDA 2CLQA 2UZBA 5AIRA 2IW6A 2W17A 2PZRA 1CKIA 2XK8A 3F88A 3FMJA 1V1KA 2W0JA 4FV6A 4GMYA 3DBCA 4QMVA 4FL2A 4CCBA 2BAJA 4RIXB 5KMLA 3QLFA 3R7GA 4KRDA 1B39A 3R30A 1UVRA 4G17A 2SRCA 3EFLA 5FEDA 4PPBA 3PXQA 3ZONA 2Z02A 2OH4A 3C4CA 4PTGA 4C4JA 5JGDA 3SG9A 4EZ3A 3E87A 3I1AA 3Q6WA 2R2PA 4IB5A 4MQ1A 3PY0A 4IHPA 4QNAA 3OY3A 4TYHA 3VVHA 3NNUA 2R3PA 3Q6UA 3CTQA 2XIKA 3I79A 4OTPA 3RNIA 4BYJA 5A4EA 2F7EE 2OKRA 4RLKA 2ITOA 4OBOA 3SW4A 3W32A 4O6LA 2PVHA 4GH2A 5TF9A 3FMEA 4C0TA 4FE2A 4D2VA 3PXFA 4NIFA 2WTKB 4IZAA 4MNEB 3EKKA 4XV2A 5A4CA 2Y4PA 4M13A 5JGAA 3ZS5A 2W1GA 4LRKA 3EQFA 3DBFA 2OF2A 2QNJA 4HCVA 4QP4A 4Y5QA 4QNYA 2XJ2A 5LVNA 3BCEA 4E4XA 2PZYA 3OUKA 4MEDA 5E1EA 2VWIA 4U97A 3ZC6A 4FTMA 1KOAA 4AW1A 5KX8A 3LJ1A 4ZLZA 4FTTA 3WF7A 3OWLA 4F1MA 2CKOA 2E9VA 3GFEA 1OUYA 1FQ1B 2VTRA 3RM6A 3VUDA 5F4NA 4D5HA 3VS0A 1NVRA 4DTKA 3MGYA 3BU5A 4D4SA 4E8AA 3LPBA 4DC2A 4CFWA 2Z7LA 4F6UA 3Q2JA 2C30A 4QMPA 1WAKA 4BTKA 1L8TA 1GIJA 4J7BA 4C3FA 2XNBA 4PP9A 1FGKA 4XP3A 2R3JA 4BVUA 5BUIA 3CS9A 3NIEA 4QTCA 1ZZLA 1K9AA 3DQXA 3G9LX 4LMUA 4YJSA 3HDMA 4PQNA 3Q4CA 3HX4A 4BRXA 2RFSA 2CN5A 2VWWA 2H96A 1TQPA 4E5AX 3TUBA 1KE8A 2QR8A 3GQIA 3P78A 4BI2A 5IPJA 5FTQA 1ZRZA 4XOZA 3TNIA 3R8UA 4HVSA 3R9RA 5KE0A 1JOWB 3HMOA 3QQKA 4X21A 4CTCA 5BNJA 4IJPA 3BWFA 3HMNA 3UZRA 4F6WA 1NT2A 4FEWA 4CKJA 2JFMA 4GUEA 3QLGA 2ITPA 4HZSA 2QOIA 3OUNB 4S33A 4E3CA 3VC4A 1DS5A 1KWPA 5HLWA 3F3VA 3GUBA 1KOBA 4FT3A 5A54A 4QMNA 3PPKA 1H1RA 1J7IA 2C6TA 1STCE 4AN2A 3MTFA 2B54A 4UBAA 4KUJA 2J9MA 4A4LA 3B2WA 4O82A 2W4JA 2CNUA 3LAUA 1UA2A 3DZOA 4S32A 2WMRA 2X2MA 4QMWA 4UMQA 4OTIA 4EBWA 2XB7A 3VUKA 4ZZNA 4JXFA 4FKVA 4BI1A 4DLIA 4DFZE 2X2KA 4ZY5A 3NVMB 5CEMA 2C68A 4XCUA 4YGAA 3TTJA 2ZM4A 1BKXA 4TZRA 4XH6A 4YC6A 3ZO2A 2VUWA 4F9WA 1XKKA 1KE9A 3DGKA 2YIYA 3ZU7A 4EH3A 2QCSA 4I5CA 3TWJA 2PE1A 5CY3A 5HIBA 4D2WA 3UNJA 2UVYA 5DMZA 3R02A 4LV5A 3Q52A 4OAVB 4DFXE 4J1RA 4M69A 3RCJA 4EK8A 4J71A 3NAYA 3CP9A 2CKEA 5KO1A 4CNHA 5IA3A 4AFJA 4FT7A 4MK0A 2QURA 2RIOA 5DNRA 4IBMA 4EQCA 4OTHA 3LFBA 2UW7A 2PHKA 4TL0A 2XCKA 4WG4A 4D2TA 3S1HA 3QQHA 4YJRA 1W98A 3RALA 4AW5A 4L6QA 5CU6A 5M4IA 3NYNA 2GNHA 4F99A 1XJDA 3HKOA 3QGWA 2C6DA 4L45A 3GCVA 1QCFA 4P4CA 2Z7SA 3W2CA 2ETMA 4IW0A 1DAWA 4PP7A 5CXZA 1H07A 2X39A 3NDMA 4YZMA 4XRJA 2JC6A 2AC5A 4C38A 2B53A 4X2GA 3VRYA 4C3PA 4Y83A 2QLUA 1YXTA 3DTWA 4BN1A 4ZY4A 2YWVA 2B7AA 3PXRA 2ITXA 2CGUA 4M68A 2UZDA 4S34A 4ZY6A 5AR5A 4AT4A 2XNMA 4RVLA 4EHZA 2R3KA 2HZIA 2WNTA 4CT1A 1KUTA 4O2PA 1UWJA 1NVSA 3LM5A 3U8WA 3MWUA 3EQPA 3IPHA 1WVWA 2OZAB 2IZRA 4FKQA 5AUYA 3ZFMA 4ZZOA 1M7QA 5FBNC 4N0SA 3UVQA 2UW3A 2VNWA 3SKCA 4O0RA 4ERWA 3AC1A 4E5BA 5HESA 3ZEWA 1PW2A 2YM7A 1PRYA 4KIKA 5B2KA 4ANSA 3E63A 3NWWA 4D9TA 4GFGA 3R9HA 2ERZE 1H28A 1EH4A 3LJ0A 3CR0A 3P23A 2GPHA 3TV7A 2XBAA 3HDNA 2GNIA 1Q24A 4O84A 5DRBA 3R9NA 3MI9A 3VS7A 4ENYA 4KIQA 4G3FA 5KUPA 3ANRA 4QQJA 3F3UA 1YQJA 3QTQA 2X0GA 3BQCA 3COIA 3QTZA 3GCPA 3NCGA 3ZRMA 1JSVA 4PTEA 4PX6A 2G1TA 4BGHA 3DKFA 3EH9A 5HORA 3NUXA 5I9WA 1TQIA 3JY9A 4MHAA 3K2LA 1F3MC 3MYGA 1MP8A 4F1TA 2W5AA 5HVJA 3W2RA 3IG7A 4D58A 4R6VA 2VV9A 2J51A 3OOMA 4I4EA 3WF6A 4DEHA 5ANOA 2ZB0A 4XG9A 2C5YA 5BX0A 1DM2A 3ZLSA 4O7NA 5EI6A 4DCAA 4YJTA 3C9WA 2UVZA 3OROA 1OBGA 3GU6A 4U3ZA 1XWSA 2YM4A 2JIIA 2VRXA 4FTRA 2HELA 4USDA 3TNQB 3DKOA 3VUMA 3F3TA 2XM9A 2QR7A 3OXZA 4F0FA 4E5WA 4JBOA 2E9NA 3KF7A 4XUFA 5AV4A 3QUDA 2VTAA 3QZGA 2WQOA 5CZHA 4E6CA 1WBVA 3EZRA 3I81A 1OIYA 2YACA 2C5NA 3VBYA 3OWJA 3EJ1A 4OTGA 4CLJA 4ZLYA 4B0GA 4YSJA 3C13A 4FL1A 2YERA 5E8UA 3SRVA 4BR3A 4OTDA 3VHKA 4FSTA 3V51A 4C33A 3EHAA 2G01A 4GCJA 5LCKA 3R8LA 3WI6A 1H1SA 2BZJA 2I0EA 3FSKA 4NM0A 3TACA 3OT3A 4Q5HA 4ANLA 3W8QA 2RG5A 3NW5A 3C7QA 5K5XA 1WZYA 3PP1A 4BBMA 4O7TA 2BPMA 4TN6A 3NAXA 5KMMA 4IC8A 1BMKA 1H00A 2YAKA 3FY2A 4FC0A 2V22A 5CVGA 4C62A 3K5VA 4I93A 3G6GA 3UOJA 4DTAA 4WNPA 1ZYJA 5DT0A 5L6WL 4C2VA 5LARA 5JH6A 5EQEA 3AQVA 3D7TA 3I7CA 4FNZA 2UW5A 4HVHA 5IEYA 2YM3A 3MPAA 4RJ6A 3TV4A 1UNLA 2FUMA 4FOCA 3FY0A 4E20A 3EN4A 3CSVA 5J5SA 4YSMA 1ND4A 5EKOA 1ZLTA 5CAQA 2YHVA 4PDYA 4LV8A 4Z7GA 3R21A 2PPQA 2WFYA 5CEQA 2WQEA 4IM2A 3VS4A 3W55A 3QRUA 2BAKA 3D5WA 3AGLA 3OZ6A 3PPZA 4NIFB 4AW2A 2YZAA 5FBOA 3UP7A 4DAWA 5DGZA 4QMTA 3ZYAA 3ATTA 4RJ7A 4FGRA 3BYVA 3Q4ZA 5E92A 3ATSA 3E8EA 3OHTA 4O96A 5KMIA 5IISA 4BBFA 3FZTA 4BICA 5EFQA 3ENMA 1FPUA 3BGPA 2XEYA 4FSYA 3OY1A 5C4KA 5BVDA 5H2UA 2VAGA 4O2ZA 1FOTA 3A61A 1HCLA 4M0ZA 1WBNA 4RVTA 5BVNA 4WT6A 3G2FA 3Q4TA 4BHNA 2PVKA 1H24A 5EDRA 3H4JA 4CKRA 2WELA 4RG0A 3PVUA 5JRSA 4HJOA 4BDEA 2W4KA 3DAEA 3LQ8A 4O7WA 4I3ZA 1FVTA 3UQCA 3A7JA 4AXAA 4GRBA 3RAHA 5IEVA 1CSNA 4XV3A 3COMA 3UDBA 2CKQA 2EU9A 1OKZA 4GKHA 4A7CA 2OG8A 3AG9A 2ZMDA 3G33A 5CEIA 2YJSA 3W33A 1KV2A 4AZVA 4DF3A 4G3GA 2CGWA 4JG8A 3N4TA 1OL1A 1Y91A 4I4FA 4DEAA 3ZH8A 2YM5A 3MESA 4HYSA 5HVYA 2GCDA 4BDKA 5EK7A 2F49A 4K2RA 4AZSA 1YI3A 2WIPA 3CY2A 1E9HA 5IMEA 3IO7A 4L00A 4EOPA 3I4BA 2DUVA 1XHAA 3DY7A 3ZRLA 1U59A 2YJRA 3EQHA 3POZA 1ZWSA 4ZTHA 4R7HA 3TG1A 5L6OA 3DB8A 2BRNA 2WXVA 4OBQA 5HCZA 4A06A 3V5JA 2C5OA 5FG8A 4C4GA 2YZLA 1IASA 5A14A 2XMYA 5AR7A 2GTMA 3CJGA 5J7HA 2XIXA 2BIKB 5AUTA 5FXSA 1VEBA 2GMXA 3TNWA 2XYUA 3QAME 4P7EA 1GOLA 1RE8A 4OBPA 4UALA 3AGMA 3DZQA 5EYDA 4NTTA 3HV7A 4W4YA 4FTQA 3ZO4A 2O65A 4TYJA 4E6AA 2C47A 4NUSA 1MUOA 4QOXA 5AX3A 2R0UA 3LXPA 4MQ2A 3TZ8A 4YURA 2PE2A 4B99A 4F9BA 4I0RA 1G3NA 1OMWA 4MF1A 3BX5A 4QPMA 4R8QA 4XRLA 4X3FC 2F57A 3PRFA 4CFXA 3BGZA 1VR2A 2JKMA 4CVAA 4HYIA 5IQCA 4QD6A 3RPSA 3UO6A 3MV5A 4YLLA 5M08A 4M69B 4AOIA 3HZTA 4FOBA 2Y6MA 4RT7A 3VS1A 5EKNA 3C4ZA 3PRIA 3TKIA 1OBDA 3LQ5A 5M4FA 3EFWA 5L8JA 3MVHA 4FICA 4FSWA 2RFDA 3F3WA 5CALA 5DFPA 1JLUE 3QQJA 3GC9A 4QQCA 4ALVA 3R04A 3OC1A 4EWQA 4YJPA 1UV5A 2BHEA 2Z60A 5HG7A 4GT5A 2P3GX 4FNYA 3ZLYA 2WMTA 4M7IA 4D0XA 3HUCA 3GFWA 3LCTA 4MF0A 2H9VA 3WF5A 3AC2A 4FSMA 4RA5A 2HXLA 2HZ4A 3O0GA 1FVVA 3D5XA 1WVYA 2YN8A 1P5EA 2CGVA 1PY5A 4YTHA 3PXKA 3REPA 3W8LA 2UZVA 3I7BA 5K9IA 1V0PA 5K3YA 3TZ7A 2UUEA 1ZARA 5IH6A 2ESMA 3V6RA 3QQLA 3VUHA 5FP6A 4BIDA 2I1MA 3ROYA 4ZJJA 3NVKI 1E1XA 3ANQA 3ACKA 4XG2A 2FYSA 4EOMA 2UW4A 1R0EA 2A27A 2PL0A 4TY1A 2BDJA 4G34A 5D11A 5IU2A 4RIWA 3KULB 2BRMA 2J90A 3RPVA 3LCKA 4L3PA 4GFOA 3WIGA 1B6CB 2IW8A 2BROA 2PY3A 4UYNA 3PZHA 4FIFA 5HCXA 4TT7A 1FMOE 3RHKA 2W5HA 3GNIB 1OL2A 2I40A 4KIKB 2KTYA 4Y72A 3I60A 4FKRA 5D12A 2PZPA 3BU6A 1PYEA 5M55A 4ALWA 3S3IA 5JZJA 1J1CA 5EDPA 2I7QA 3D2KA 3U6HA 3DDPA 3R1QA 5AP0A 3AC5A 3MIYA 3TXOA 3O7LB 4FTAA 3A7HA 5T6KA 3IW5A 4I22A 3FV8A 3QQGA 5ANIA 4L8MA 1P14A 2WMQA 1FGIA 2OWBA 4DGLC 4PUZA 2HCKA 1OB3A 3ZDUA 1XR1A 3JUHA 3F7WA 4AA5A 3MIAA 4AUAA 3D14A 1A48A 1GZKA 2JGZA 3F2AA 2NP8A 1UNGA 4ZMEA 3EQIA 3DBDA 4YZNA 3N9XA 4MCVA 3EN6A 2GHMA 4DA5A 2X7OA 3O8PA 3TKUA 3OTUA 3SLSA 2YM6A 3R83A 5HD7A 4LGHA 4S31A 4BKZA 3NGAA 3O50A 4O81A 5I4NA 2J5EA 4I23A 2JKKA 4JI9A 3VQUA 3F5GA 1SVGA 2F7XE 3DDQA 3DK3A 4NFMA 4X2JA 4EQUA 5HLNA 4X3FA 5CSHA 3MJ2A 5JFSA 4R7BA 5L2SA 4D1ZA 1Z9XA 4H3QA 3C5IA 3IDPA 4TRLA 2A2AA 5FTGA 4AX8A 2NRYA 4L52A 3NS9A 3PSBA 4JL9A 1YDRE 4D4VA 3SRVB 3OBGA 5KMJA 2X9FA 2YIWA 2DQ7X 4JRVA 4I6HA 2WGJA 3TT0A 3RZBA 3WZJA 3NNVA 4EH7A 5BVOA 3NW6A 4BTMA 2VTQA 4GJ3A 3EIDA 4JDKA 3ZCLA 1JKSA 2J0KA 3MFSA 1Y6BA 3E62A 2XVDA 4MBIA 4QMOA 5HNGA 4D2PA 4EC9A 5L4QA 1PXPA 2OF4A 1JVPP 1GAGA 2DS1A 3KMMA 5KZ0A 3E93A 3GU7A 2Q83A 3WZEA 4RC4A 4KIOA 5L6PA 4CGAA 2WMBA 1M2PA 4FEVA 4MH7A 3GXLA 3Q9YA 5JT2A 2OIDA 1YWNA 1Q41A 1MRUA 3L8PA 4X2KA 4TWNA 2BUJA 3DK7A 3KRXA 1UU9A 2VNYA 2Y7JA 4FSQA 3SXSA 4ASDA 5AP3A 3L8SA 4MWIA 5HX6A 4ZSAA 4IAZA 2PVRA 4HGTA 3CQUA 2ERKA 2X4FA 2ZDTA 4WKQA 3RTPA 4F0IA 2W1HA 4R3RA 3UOLA 4X0MA 2XRUA 3WARA 4EYJA 3NCZA 5FRIA 2R3HA 3A4PA 4RLLA 5TT7A 4CKIA 4YU2A 2J0IA 3E3BX 3OD6X 3F6XA 5JRQA 2EB2A 5TKDA 3UNZA 5AR3A 1JSTA 3L8XA 5KKRB 3MVMA 1H27A 2HYYA 2WTJA 5DR9A 1YWRA 4FV4A 4RSSA 4EOQA 4JQEA 4YZCA 2BCJA 2WQNA 5I9UA 4MWHA 5DWRA 1YKRA 2FGIA 4CEGA 5HBEA 3O23A 5AV0A 4LOOA 4JLCA 2OFVA 1OPKA 2UW8A 1YHWA 2CDZA 4R5SA 5KNJA 5L8LA 4GU6A 2FB8A 2PVYA 2VTSA 3QZIA 5LCJA 3R73A 2R3FA 5FXRA 2J0LA 3HNGA 4G5JA 5BMMA 5HNBA 5C1QB 3PLSA 3EYHA 2BZHB 3ZLXA 1UU8A 5HBHA 4L46A 3A62A 5GJGA
chains in the Genus database with same CATH superfamily
5CAPA 2BIYA 2XKEA 3HP2A 2OXYA 2PUIA 4IZ5A 2R3LA 2WTVA 3PVBA 3FKLA 4QO9A 4MXYA 4EK6A 5EOBA 5AEPA 2QOHA 3AOXA 2YCFA 2B9HA 5DG5A 1HCKA 4L44A 1XO2B 4O6EA 4IC7A 3PFYA 3F5PA 3WZDA 5FTOA 4I94A 4DGMA 4NYEA 2R5TA 4FZFB 1W7HA 2XANA 4FA2A 3OTVA 4W4VA 2W1EA 2W4OA 3NEWA 3QL8A 3MS9A 4KSQA 4RIOA 4BGQA 4QTEA 5AUXA 1UNHA 3Q4UA 4BC6A 3V5PA 3UIMA 3KMWA 2XKDA 2XEZA 2FSMX 3ZHPC 1CTPE 5LWMA 5M53A 2OW3A 3DOGA 3FWQA 2F2UA 2WQMA 3HGKA 4PDSA 3FQHA 5J9ZA 4BZOA 1F5QA 3CIKA 4CSVA 3BHHA 4ZJIA 3OCGA 3EQRA 3FUPA 4LL5A 5AV2A 1AQ1A 3LIJA 2CGXA 4RWLA 3VS3A 2CKPA 1VJYA 1OPLA 3PJCA 3U9NA 5AWMA 2WIHA 3QD0A 4CD0A 5EHOA 3CJFA 5E8SA 2XA4A 3IQ7A 4PMSA 4IAKA 4O1PA 4G1WA 3RZFA 3ZOSA 5AUWA 4FYNA 5M4UA 4ID7A 1M7NA 2FO0A 2OBJA 4L01A 3QTXA 5BVKA 1PXMA 3EL7A 4AT5A 4DFBA 5FM2A 4V01A 1LP4A 2CLXA 3A7GA 4UB7A 5I5ZA 1P4FA 5IA4A 2NYAA 4UWCA 5KCVA 1GZ8A 2VWUA 3N51A 5F95A 5DT3A 5GIPE 3QKMA 4FYOA 3L9PA 3FXXA 1PYXA 1H1QA 4GSBA 4IM0A 4FJVA 2JFLA 3EYGA 3HV3A 3KRRA 3GENA 4WNOA 4DLJA 3E3PA 3C51A 2ZM1A 3HEGA 4G16A 4MD7E 4EBVA 2J7TA 4M14A 3KF4A 3Q5IA 4J96A 4IX3A 4O0WA 5IDPA 5H9BA 3LM0A 4ALUA 2CNQA 5EI2A 4NKSA 1ST4A 3LFQA 3PE1A 4LGGA 4I1ZA 3C50A 3DKGA 3VIDA 2YLEA 4D28A 5DE2A 4N6YA 3A8WA 4QDEA 4EJ7A 5CU4A 1SM2A 5L2WA 4A9YA 3ID6C 3WF9A 4N6ZA 2O64A 1UU7A 2Z7QA 1GNGA 4P5ZA 3W2PA 4FZ6A 4UZDA 2AQXA 3F69A 5D1JA 3L9LA 3H0YA 2W99B 3OCTA 4EH6A 2QO9A 4RIWB 2R7BA 2OK1A 2WU6A 1CKJA 3DXNA 4F65A 5AA9A 4KB8A 3IONA 3U6JA 3RAIA 3ZO1A 2EUFB 5BQ0A 2BAQA 4EZ5A 5CSPA 2KULA 3QYWA 2OJIA 4RJ8A 3TZ9A 1Q3DA 4K9YA 4J8NA 3ERKA 3QGYA 3R7VA 3FMNA 3RHXA 4UXLA 2XZSA 4FT9A 3CPBA 5ANDA 5LVPA 1XBAA 5HKMA 4CMTA 3ALOA 2ZYBA 5A6OA 1ZAOA 3KKVA 2W1ZA 4UZHA 1R3CA 1QPDA 2CHLA 3QC9A 4GG7A 4AF3A 4G3EA 4I5HA 4QTAA 2AUHA 4WUNA 4EI4A 5J9LA 4ENXA 5DEWA 3Q9WA 4CFUA 2R3RA 3FKOA 3CQWA 1Q99A 4ASXA 2QOBA 3CKWA 3I0QA 3LKMA 5E91A 1KSWA 5IG1A 1T46A 3WZKA 1VZOA 3ORNA 1IRKA 3DCVA 3DKCA 3QTSA 2VWBA 1YHSA 2WOTA 4KKGA 3NYXA 3R63A 5H8GA 5DH3A 3ZSHA 1URWA 5E8YA 4DEEA 2WTDA 3AC4A 4KSPA 4OT5A 3D94A 3LW0A 4IZ7A 4HCTA 1OUKA 2WO6A 4FEQA 3P79A 4L3LA 3RKBA 5HIEA 5FEQA 4AQCA 3TDWA 4N70A 4X6QC 3VBTA 1A9UA 1KE5A 1GJOA 4Q9ZA 4L42A 1P4OA 3QKKA 3MA3A 4FGBA 4E93A 5BYZA 1WCCA 4UXQA 3JR1A 5HG5A 4O83A 1H1WA 3L9NA 3QD2B 4MYGA 3TTIA 2ZOQA 2GNFA 3KXXA 4JX7A 3UODA 3NYVA 3VBWA 4E73A 4F7LA 4F7NA 3SXFA 5CEPA 3DS6A 4QMSA 4TNBA 4CG8A 3VBVA 4PF4A 3VWAA 2BZKB 2O8YA 2RFNA 4G6NA 3V8SA 4BDAA 4KKEA 3QCQA 4OTFA 5IUGA 3SDJA 1FMKA 2VTLA 3P7BA 4JQ8A 3SQQA 4XBUA 4QYYA 4HYUA 4M66A 4Z9LA 3SV0A 3TIYA 3V04A 4R5YA 3EN9A 3FQEA 3AKJA 4UMUA 3MH3A 5HHWA 1OPJA 4EK3A 3QCXA 4BTFA 3PVGA 5KHWA 4R3PA 3KVXA 1SYKA 4RWKA 4X7QA 5A3XA 4ACMA 4AGCA 3VO3A 3DJ5A 4RRVA 3RVGA 4WHZA 3R7YA 3E8DA 2HW6A 1FINA 3VUGA 4DHJA 3W1FA 1W0XC 4TNDA 3POOA 5DBXA 3HRBA 3MY5A 1PMNA 5AM7A 4ANMA 4UWBA 2GNLA 4L43A 5BV3A 4FIJA 4A9RA 3LXNA 5FP5A 3S00A 2C6KA 3EQBA 4Z55A 1PXLA 3NUYA 3V5QA 4H1MA 4WRSA 5G1XA 5HBJA 2W1FA 3A99A 2UZLA 2E2BA 1GY3A 2X2LA 3QHWA 4M0YA 3H9FA 4DH3A 5M56A 3BLAA 2ZAZA 1G8KA 4V0GB 4CFMA 3RMFA 3CY3A 4J99A 4FNXA 3FXZA 4EOSA 4EOKA 4PPCA 4R77A 3PA5A 4RX7A 4ZS0A 3HMMA 4CT2A 5CSVA 2E9PA 1KE7A 3WE4A 2X81A 2I0HA 4K33A 3MY0A 4YHJA 3G15A 3KB7A 2WMSA 3TZMA 2ZMCA 4C3RA 3LFDA 4FTLA 4C58A 3NR9A 3OXIA 5HTIA 2V7AA 3U54A 3CGOA 4C7TA 3OFMA 4U80A 4ZEGA 3ORLA 3C0GA 3R1NA 5C8NA 5CSWA 5E8XA 5BUJA 2B4SB 4CTBA 4XP0A 3C1XA 4O4EA 5L8KA 4Y95A 2HENA 2W1IA 4AXCA 4O0UA 4UYAA 4O86A 3O8TA 4RA4A 5IH4A 2JDRA 3LVPA 1SMHA 4ERKA 4YO4A 2JD5A 4GIHA 4IDVA 5IA0A 2C69A 1U54A 5ANGA 3FBVA 5K0XA 3R9DA 2XYNA 3ORZA 1AD5A 4FKIA 4YNEA 5HU9A 3SC1A 3BRBA 2QONA 2WKMA 3GT8A 2PWLA 3N4UA 4AQKA 3R00A 2QOKA 2W7XA 3H9OA 5CF4A 2PVJA 3I5ZA 5CT7A 3ITZA 1IA8A 2QVSE 2C0IA 2X9EA 4FIHA 3LZBA 4D55A 3DBQA 2J4ZA 5KMOA 3OBJA 2B9FA 4O0SA 1P2AA 3B8RA 2ITYA 3L1SA 1IG1A 2C3LA 3FL4A 4K1BA 4LUDA 4ANBA 3MDYA 3D2IA 3P08A 3QF9A 2R7IA 4ITHA 5EG3A 3V01A 4KBCA 3WOWA 1SVEA 2X8IA 4M3QA 3ORTA 3NYOA 3DB6A 3O51A 2VGOA 5DR2A 1ERKA 5EW3A 5HGIA 3UO4A 1YDSE 4QP7A 4GK4A 4FTJA 4XJ0A 2UW9A 5KMNA 4LYNA 2IVTA 2OJ9A 2HAKA 3E92A 4CLIA 4JDIA 5HE2A 1PXJA 1ZMVA 3C0IA 1ZMWA 3F9NA 3MPMA 5AADA 4O7RA 2A19B 3PIYA 2Y0AA 2LAVA 3AD5A 5J79A 3ZUUA 2CJMA 2X6EA 4CQGA 3MW1A 5AR2A 4GUBA 1QL6A 4FV5A 4Y46A 4QRCA 5AIKA 1LPUA 3SX9A 4I0TA 4KWPA 2IZTA 3VF9A 5BPYA 3GGFA 4JS8A 1KV1A 3RAKA 1IAJA 5AAGA 1K3AA 4TYEA 4FKJA 3DQWA 2OJJA 3UIBA 5GZAA 5AFVA 1REKA 3QWJA 4EQMA 3RK7A 1ST0A 3W0NA 4QYGA 4XG6A 1RW8A 3HECA 1IEPA 2HIWA 4RFMA 5J8IA 4IAYA 5EW9A 2GFSA 4YZBA 3ZM4A 4ZSLA 4ZJVA 5AP5A 4B4LA 3FC1X 2YCRA 3WZUA 3NLBA 4Z7HA 3RI1A 3W18A 4AOJA 3JVSA 3EFJA 2O5KA 2W05A 4HZRA 2JDOA 3IOPA 4K77A 4PDPA 3ETAA 4WG5A 4IWPA 3GC8A 3QA8A 4C4EA 4TYHB 4YUQA 1O6KA 3FHRA 3CD8A 4L68A 5BVFA 3CEKA 3UMWA 2YA9A 3CLYA 2BTRA 3I6WA 1VYZA 3FLYA 4EUTA 3NMUF 2QG7A 4X2FA 3G9NA 4EH4A 2BKKA 4ORKA 3W0SA 3EWHA 4U41A 5KMKA 3FAAA 3V8TA 2VO3A 4YNOA 1UKIA 5JZNA 3UG2A 2BR1A 3DJ6A 1S9IA 2YFXA 4O4FA 3BE9A 4XV9A 4O0XA 5D10A 1WBTA 3FC2A 3NNWA 3OWPA 4FEUA 4ITJA 4QMXA 5C27A 4BKYA 1WBSA 3DAJA 4YLJA 2Y6OA 3M1SA 5DHJA 4Y5HA 5AM6A 2G2FA 4BB4A 4R78A 3CTHA 3NIZA 3NZ0A 2HZNA 4IFGA 2YIRA 4QMUA 2OXDA 4DFNA 5I9YA 3VONA 2P0CA 4TWOA 5CTPA 3NUAA 4AN3A 4E4LA 1TKIA 3A8XA 3AMAA 3GU5A 4CXAA 1O9UA 1OKVA 2ITTA 3PY1A 1G8AA 2QHNA 4BWPA 2Y4IB 3VHEA 3ZZEA 4J8MA 4E7WA 4FODA 3PZEA 4NCTC 4HVDA 3G5DA 1OGUA 4IX4A 5CXHA 4DINA 3FLZA 3FI3A 5D7VA 3ORXA 2WQBA 5M07A 3F61A 5IQFA 4MD8E 4M8TA 3Q96A 4FTCA 3FE3A 3OXTA 3MY1A 1RDQE 3A60A 4QYHA 4ZTMA 1G5SA 3Q04A 4FV9A 4FG9A 1ZYCA 3DNDA 4G31A 2UVXA 4ACGA 4DFLA 1IAHA 1PJKA 3HL7A 4FIEA 2PE0A 4FT5A 5HE0A 4KRCA 2XNGA 4DG3E 1Q3WA 3SW7A 3DAKA 4IADA 4IFCA 4YBKA 2JITA 2VZ6A 5J5TA 5AUVA 4O0YA 4O7SA 4F9AA 4Q9SA 2OJGA 2R3NA 4I92A 5AR4A 4R1YA 4C4IA 3TIZA 4N57A 3QRJA 3KN6A 2JIUA 3BV2A 5CENA 3DNEA 4QYFA 2B55A 4YC3A 4JIAA 2BFYA 2GNJA 3CPCA 5EYMA 4EH5A 2PUNA 3IW7A 3ZUTA 3D9VA 2WMXA 2BZIB 3ELJA 2JKOA 3FL5A 3KN5A 4TYIA 5LVLA 4ZTLA 3TEIA 4ZS4A 2EXEA 4TYGA 2J0JA 1PXKA 3GOPA 1YI6A 5DT4A 3E8CA 3MFUA 4XMOA 4YTCA 2QHMA 1XH6A 2X4ZA 4QMLA 3FSFA 2W5BA 4I24A 5AA8A 3BKBA 3NX8A 1OECA 3ACJA 3QTIA 3RK9A 3MB7A 3V5WA 2GS6A 2XUUA 2QU5A 4M67A 5AX9A 5IA1A 5AAEA 2ZJWA 2R0IA 5ANKA 2UZTA 3CGFA 3SGCA 4RX9A 1PMUA 3KIOC 4RIYA 4JAJA 2RL5A 3TN8A 3PIXA 4AA4A 4G6LA 1NVQA 1YI4A 4IVDA 5K0KA 3T9IA 4FUYA 2YIXA 3F66A 5HICA 3PSDA 5I9ZA 4JQ7A 2EVAA 3E7OA 3BLRA 3FMDA 4MAOA 4Q2AA 2VO0A 1Y6AA 5DRDA 4BDGA 4RGJA 3WYYA 3BYUA 2YLFA 1V0OA 3B8QA 2WMWA 1W2FA 4HNFA 5M51A 4DGGA 3OS3A 2XF0A 3FMLA 2CMWA 4RIXA 5A4LA 2PVFA 5IH5A 5ACKA 1OIRA 4BCHA 3QA0A 3ZBXA 4FNWA 4NT4A 4QMQA 5A9UA 3S4QA 3NUUA 4HYHA 4IZYA 4XBRA 4C34A 3L9MA 1PXNA 5LMAA 3DTCA 1BYGA 4F1OA 5IQHA 5GINE 1BL7A 4KS7A 4JG7A 2ETKA 3QXOA 2BDFA 4FKTA 3IECA 2VWZA 5JMSA 4RWJA 2JIVA 4MXZA 3DXQA 4MXXA 1NY3A 2CCIA 4ZXTA 4QMYA 4I5MA 2GTNA 4NEUA 3KK9A 5B2LA 2X0QA 3W2QA 1GIIA 3PWDA 4U44A 2QKRA 4C35A 3BELA 4MNEA 4W8EA 4ONAA 4WNKA 4I0SA 4XG8A 2VU3A 3U51A 3PVWA 4EOLA 2CNVA 2JAMA 3UIXA 3QX2A 4OAUC 4AGUA 3TI1A 1YW2A 2HW7A 1SNXA 1BLXA 4NCTA 3EZVA 2F9GA 4RC3A 3U87A 5AP2A 3VW6A 3COKA 2Q0NA 4U81A 5FDXA 5LOHA 2YABA 2GDOA 1XH4A 4QPAA 5T3QA 3KMUA 1YXSA 5AP4A 3FZRA 1U54B 5BYLA 3BI6A 4PNKA 4USFA 5JQ5A 4I41A 4DH1A 2E9OA 2OH0E 4O21A 3HRFA 2R3IA 4KIPA 3WIKA 3TV6A 5CNOA 4XLVA 5EM7A 1Y57A 3RAWA 3PY3A 1OZ1A 3O71A 4PDOA 4O22A 4WSYA 4ZOGA 4A4XA 1GZOA 4O7LA 2FVDA 2Y9QA 2C6EA 2XK4A 4UMRA 3PTGA 4KS8A 1MRVA 2C0OA 3MVJA 3R1SA 2EXMA 1JKTA 3P0MA 4IVAA 4A4OA 3E5AA 3GU4A 3UMXA 5AUZA 2PVLA 4I5PA 4H05A 4F7SA 2IG7A 1LEZA 3WILA 2IZUA 3ALNA 3M42A 1APME 5DN3A 4QP9A 4U79A 4ZTNA 2DWBA 1K2PA 2PK9A 3S2PA 5CF8A 3BWJA 4O4DA 4LUEA 2PYWA 2C5VA 4FR4A 3ZFYA 4ANQA 3C0HA 5I9VA 4WA9A 5BVWA 3R7EA 4AWIA 5CANA 3O8UA 4F0GA 1SVHA 3QX4A 3UYSA 4E4NA 4F9YA 2XBJA 2ZV2A 3LQ3A 2QD9A 5JFWA 1JKKA 4FVRA 2XH5A 4EUUA 4UV0A 4DT8A 2WTIA 4FUXA 4ACHA 4ZK5A 2I6LA 5HE1A 1PMVA 1M52A 2WEVA 5M09A 2VTNA 5IQBA 2VTJA 3ZTXA 1XQZA 2X1NA 1H8FA 2QOFA 4PNIA 3LJ2A 4F6SA 4KA3A 5IQEA 4ZMFA 3UYTA 4RWIA 3D83A 4C61A 2OGVA 3F7ZA 4ITIA 5HOAA 3TYKA 1PKGA 4MNFA 4MXAA 5E1SA 3SXRA 3LFEA 1OM1A 1TVOA 3OEZA 4WD5A 4EK5A 2G2HA 3R22A 2YCQA 3LMHA 4FV8A 3ODZX 4IANA 3UP2A 5B7VA 3TM0A 5I3RA 3FKNA 1LUFA 5HG8A 4U9AA 1SNUA 1V0BA 2JBOA 5A6NA 1Q8UA 2WPAA 3UZPA 4QP1A 3CTJA 2UW6A 3ZEPA 4EORA 3LFCA 3SOCA 2WOUA 3JVRA 5ITAA 4IAIA 5ETIA 4UWYA 5L2TA 2JDVA 5EM6A 3UE4A 3U4UA 4BDIA 4H36A 3RNYA 3LFFA 1KE6A 3SG8A 4D4YA 4BDJA 5LXMA 3IDCA 3D7TB 3KU2A 3IW4A 3KVWA 4RVMA 3D15A 4TW9A 2XIRA 4NWMA 4TWPA 2OI4X 3U9CA 2JDSA 3A4OX 4X3JA 4BJJA 3GEQA 3THBA 4F63A 2R3GA 5HU3A 3D7ZA 2RGPA 4ASZA 3VBXA 4FMQA 4YC8A 5HX8A 4TXCA 3H0ZA 3R7UA 3ZXZA 5HO7A 2O3PA 3PDTA 3FMKA 4HGSA 4JOAA 4KKHA 3ZBFA 4EKKA 4DEBA 2YISA 3QALE 5GJFA 1UKHA 5E90A 5AV3A 5GZ9A 5FLFA 4QYEA 2QU6A 2G2IA 3DT1A 4OTQA 4XOYA 1M17A 1YHVA 2O63A 4BY9E 4EJNA 5JN2A 2C6MA 2XK6A 2BTSA 4FV3A 3NUSA 4EH8A 3UPXA 3GCSA 4FKGA 4S30A 2QOLA 3CXWA 5ANEA 5LQFA 5M57A 4G3DA 3DK6A 2WTCA 4O91A 4WRGA 2YCSA 2B0QA 3QU0A 5C03A 2EWAA 2OZAA 3IGOA 5HO6A 3EN5A 5AJQA 2BFXA 3LXKA 5HCYA 3UC4A 2ITVA 3E64A 5DR6A 3VQHA 4DHFA 5HNIX 4EH9A 3QKLA 5EH0A 2P2HA 4IQ6A 3UBDA 3K3IA 4MKCA 4GL9A 3FQSA 4DH7A 3PG3A 1ATPE 3ML1A 1BUHA 3LMGA 4LQMA 5BMSA 4BBEA 5FEEA 4FZAB 2PMNX 4BDHA 2GU8A 5LJJA 1WBPA 3VN9A 3EKNA 3FMMA 3D5UA 4EWHA 3VJOA 5K4JA 2H34A 5LVOA 2R3OA 4F64A 5DOSA 1JNKA 2J5FA 4E6DA 3VRZA 1RJBA 1WMKA 5G6VA 3ZMMA 2E9UA 4KAOA 4K11A 5ANJA 2IJMA 4NL0A 3FLWA 4DBXA 2V55A 4IIRA 5EYCA 4AW0A 3OEFX 3ZDIA 1YOMA 3IW6A 5CEOA 1ZZ2A 2FSOX 1YDTE 2VD5A 4CV8A 3AT3A 3C4XA 4H1JA 3QQFA 4IH8A 4WNMA 5JKGA 3TDVA 1Y8YA 3S95A 4D0WA 4Y73A 5AR8A 2WTWA 5DYJA 1ZOGA 5IQGA 3O96A 3F82A 4DE4A 4YHTA 3I5NA 1H0WA 4OGRA 5CQUA 5DVRA 2CSNA 4BCOA 4F7JA 1J7UA 4YZDA 4NW6A 2OO8X 4IACA 3BBWA 3JYAA 1XBCA 3MH0A 1I44A 4RZWA 5DA3A 4BDBA 4ZSEA 3AC8A 3GQLA 1DAYA 3GB2A 3EL8A 3GC7A 5EHLA 4YR8A 4BIEA 2HXQA 4FKPA 4I20A 4YP8A 4GS6A 5ETCA 3RM7A 2QOQA 4IXPA 3BHYA 3KEXA 4BCKA 2BALA 2ZB1A 4AP7A 3OT8A 4AGDA 4AE9A 3HV4A 4YJNA 3AXWA 3JY0A 5IA2A 4M15A 4RIYB 2XM8A 3TUDA 5M06A 4BTJA 1F0QA 2QQ7A 2W1CA 3Q32A 5ETAA 1WBWA 3FDNA 4JBQA 3ZSGA 1O6LA 3VAPA 3ZO3A 1Q97A 1OI9A 5DPVA 4U6RA 4XV1A 3QYZA 4JNWA 4N4SA 2FSTX 3IK3A 3KFAA 5FDPA 4KNBA 2O2UA 3UGCA 4NJ3A 4QEBA 4DH8A 5E4HA 4A9TA 3DXPA 1LR4A 4GEOA 3KCFA 2C1AA 1Q8YA 1PKDA 3NW7A 5IDNA 3R8PA 1IR3A 4ZIMA 2FA2A 4GW8A 2PVNA 1H08A 2ONLC 4ANNA 3GVUA 3IW8A 3LCDA 2VN9A 3MPTA 3UOHA 5F9EA 2WMAA 5ICPA 4C36A 4TWCA 2WMUA 1O6YA 3GP0A 3L8VA 5FGKA 3TL8A 4FK3A 1YXUA 3KY2A 4LOPA 3UZTA 3HAMA 3QZHA 1E1VA 4FVPA 5JGBA 4DCEA 2WMVA 3CE3A 3FI8A 2OFUA 3IS5A 3HVCA 4IVCA 3R8VA 4A07A 4KD1A 3PXYA 2AC3A 4LM5A 2ITZA 4O38A 5AP6A 2IN6A 4BWKA 4O4CA 1Q5KA 3W16A 4RX5A 3UVPA 3BIZA 5EM8A 2RFEA 3G51A 3EQCA 3RPOA 4BF2A 4J97A 5J95A 4Z16A 4NFNA 5B2MA 4OW8A 2WD1A 1ZYSA 4AA0A 2VTTA 4JG6A 4UY9A 4Y8DA 5C9CA 4DFYA 3GU8A 4W4WA 4MTAA 2VX3A 3PJ2A 3NUNA 2P33A 3HV6A 4HGLA 3V6SA 4U3YA 4JR7A 3C5UA 2OXXA 3SVVA 2GQRA 3HA6A 1AGWA 1CKPA 2BRBA 2GQGA 4FKOA 4WO5A 2W96B 4ZP5A 5TE0A 4PMTA 1JKLA 4G9RA 1W82A 3OW4A 3Q60A 3W0MA 4FSZA 2W9ZB 5D41A 2I0YA 3LFSA 4QP6A 3VUIA 3FHIA 3QWKA 3BLQA 3BV3A 5CSXA 3COHA 5EQYA 4PV0A 2HZ0A 4IX5A 4QTBA 2LGCA 4B8LA 3R8ZA 2VTOA 2XKFA 3IOKA 4C8BA 2X6DA 4K8AA 4AU8A 1XMLA 3SHEA 3EOCA 1GIHA 3SOAA 1LEWA 2NRUA 1W83A 2NPQA 3FPMA 3H30A 4U0IA 5CAVA 4FG8A 3AC3A 4U40A 5CX9A 1Q8WA 4BKJA 3PJ8A 1U5RA 4E26A 3O17A 3JS2A 5EQPA 2O0UA 3KRWA 1BI8A 4NK9A 2OU7A 3MSSA 4K18A 2F7ZE 4NH1A 4X3FB 2IVVA 4RPVA 3B2TA 4RJ3A 4CFNA 3BEAA 2PMLX 2ZDUA 4KINA 3K5UA 5B0XA 3PYYA 4UX9A 2A0CX 3AT2A 4H3PA 4C4FA 4U42A 5DEYA 3T3VA 3OOGA 2XIYA 1CMKE 2XCHA 3R01A 4MVFA 4GIIA 3ULZA 4JVGA 2B9IA 4ZSJA 3QRKA 1I09A 3BYSA 4FZ7A 4RJ5A 4EOOA 3ORPA 3LLAA 3BPRA 3AD4A 4IWDA 4NZWB 3AMYA 3Q2MA 4FK6A 1MQBA 5ETFA 3KA0A 4CFFA 4DH5A 3R71A 4WUAA 2VWXA 2WB8A 4H3BA 4P90A 3OCBA 4QMZA 3W2SA 4BZDA 3W0OA 3OVVA 2ONLA 4LFIA 3RJCA 2YITA 2GSFA 4E4MA 3FJQE 5F20A 4QQ5A 5GHVA 1OGYA 3PIZA 4LRMA 3W10A 4FBXA 1Z5MA 4HPTE 1FBNA 4PL3A 5E8ZA 3PE2A 1T45A 3OCSA 3ZC5A 2IW9A 4E1ZA 4IWQA 4RC2A 2IVUA 3IDBA 4GT4A 2V7OA 4GK3A 4ZTSA 3VS6A 4W4XA 1PHKA 1W8CA 3W0PA 4IE9A 1YOJA 3KRLA 5L2IA 4L7FA 3QXPA 4EEVA 4ANOA 1ZMUA 1H26A 5AV1A 3E8NA 2QOOA 2VX0A 3MH2A 3ODYX 5EI8A 4DGOA 3LMIA 3P5KA 3P86A 5CEKA 3C4WA 3AT4A 3DPKA 3UTOA 4ACCA 5GZ8A 5LVMA 4BDDA 1OITA 1WFCA 4IB0A 3T3UA 5H8EA 5E8VA 4WSQA 4G9CA 2YAAA 3KXHA 3F3ZA 2EB3A 2ITUA 1L3RE 2QI8A 2REIA 3FZOA 1M14A 3HV5A 4EH2A 4U43A 5HVKA 2QC6A 3T9TA 5E8TA 2PZ5A 5CQWA 5CWZA 1Q8ZA 2GQSA 2QO7A 5M44A 3BL9A 5IKWA 2OJFE 4S2ZA 2G9XA 3KULA 3BYMA 3U6IA 3P4KA 2G15A 3KGAA 4QP2A 4F08A 4L7SA 4IJ9A 5JEBA 3R2YA 4U45A 4D1XA 4JT3A 5KKRC 5A46A 4O7ZA 4C57A 4NSTA 4MD9E 1OIQA 2Z7RA 3HYHA 1UU3A 3QCYA 3QUEA 4L3JA 2UZOA 4GJ2A 4OTWA 3WYXA 4BGGA 3UG1A 4BL1A 5FM3A 2BRHA 3BHVA 4JMQA 2H8HA 4AFEA 4GT3A 5JK3A 3QTWA 3QD4A 2J50A 4YBJA 4UN0C 3PSCA 2XIZA 5L2QA 2WU7A 4NM5A 4CZYB 3Q53A 2VTPA 4M97A 4U8ZA 4FKLA 2C0TA 1J3HA 3M11A 2UW0A 4GVJA 4AZTA 4Z3VA 4CG9A 4EZ7A 3EQGA 2F4JA 4LG4A 4AZFA 3WE8A 2XK3A 4J98A 4GYGA 4JX3A 4BDFA 4D4RA 4W9WA 3TJDA 5EM5A 3M2WA 5T68A 4DEIA 4O0VA 3GCQA 2XRWA 2B52A 2R3MA 4FI1A 4FTUA 5CU3A 4ZTRA 2J6MA 3D5VA 3HMPA 3IKAA 2XJ1A 3C4EA 4ZLOA 4APPA 3U55A 2NNWB 3P7AA 3NUPA 1J91A 1XH9A 2BVAA 2XNPA 2A1AB 3PPJA 3H3CA 4L67A 2RSVA 4DEGA 4QMMA 1H4LA 3IGGA 3LOKA 3EMGA 3N4VA 5A4TA 4DEDA 5HLPA 3BHTA 4NJDA 5GIOE 4V05A 5CLPA 3FMHA 3NSZA 3LFAA 3V5LA 2UZNA 4DGNA 4B7TA 3RWPA 3HRCA 4FIGA 5GNKA 1UWHA 1PMEA 3UPZA 1TQMA 5HE3A 4YTIA 5EW8A 5CAUA 2I0VA 2P2IA 4ARKA 5HG9A 3JXWA 3E88A 1JSUA 4J95A 2UZUE 5J87A 2HWOA 3RCDA 3ULIA 3FLNC 4XG4A 4EONA 4O7VA 3FI2A 4FV1A 3BL7A 1H01A 1OL6A 1U5QA 3MB6A 3RINA 4IAFA 4FSRA 3SAYA 4FKUA 3WF8A 1ZOEA 1NW1A 5CVFA 4TKSA 3R7OA 3CBLA 3BQRA 3NRMA 3BBTB 4YPSA 4FV0A 2IO6A 1W84A 4GYIA 4R7IA 1M2QA 5AP7A 2ITNA 2VGPA 4W8DA 4BCJA 1XMMA 1PXOA 5LWNA 3OG7A 5TOZA 2X0PA 4FF8A 4XS2A 4QPSA 1URCA 3P1AA 3FPQA 2PULA 3K54A 5HZNA 1RQQA 2ACXA 3NFGB 4F9CA 4IEB