5EI2A

Rapid discovery of pyrido[3,4-d]pyrimidine inhibitors of monopolar spindle kinase 1 (mps1) using a structure-based hydridization approach
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
279
structure length
256
Chain Sequence
QSMSVKGRIYSILKQIGSGGSSKVFQVLNEKKQIYAIKYVNLEEADNQTLDSYRNEIAYLNKLQQHSDKIIRLYDYEITDQYIYMVMECGNIDLNSWLKKKKSIDPWERKSYWKNMLEAVHTIHQHGIVHSDLKPANFLIVDGMLKLIDFGIANQMQGTVNYMPPEAIKDMKISPKSDVWSLGCILYYMTYGKTPFQQIINQISKLHAIIDPNHEIEFPDIPEKDLQDVLKCCLKRDPKQRISIPELLAHPYVQIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords Dual specificity protein kinase TTK
publication title Rapid Discovery of Pyrido[3,4-d]pyrimidine Inhibitors of Monopolar Spindle Kinase 1 (MPS1) Using a Structure-Based Hybridization Approach.
pubmed doi rcsb
source organism Homo sapiens
total genus 74
structure length 256
sequence length 279
ec nomenclature ec 2.7.12.1: Dual-specificity kinase.
pdb deposition date 2015-10-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 5ei2A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 5ei2A01
3E93A 5HTBA 5CS6A 5J5TA 3PY3A 4QP1A 5L6OA 1URWA 4IX5A 4F0FA 4YTCA 4MXYA 3WZJA 2FA2A 4JJRA 4F9CA 2WTJA 3PJCA 3MFRA 3UIXA 4FKQA 3NUAA 1WBNA 4IVDA 1H25A 2X4FA 3QCYA 3UDBA 3QC9A 3PXFA 1M52A 3KCFA 4EJ7A 3FPMA 2HELA 5FM2A 2YCFA 2JDTA 1PXKA 3BX5A 3FMLA 3F88A 2GQGA 2OXDA 4NTSA 2BZKB 3KXNA 3F61A 3MH0A 3F3TA 3Q9YA 3MVJA 3ZYAA 1KV2A 2R3KA 4JXFA 3LZBA 4PY1A 5T68A 2ONLC 1BKXA 1ZXEA 2ZAZA 5AV2A 3EN6A 5AADA 1OVEA 2QODA 2W5AA 3ZZWA 5EK7A 4S32A 4CYJA 2BROA 5CTPA 3F6XA 4AE9A 3AG9A 4IDVA 2QVSE 3VO3A 4XUFA 3U87A 3NPCA 2O8YA 3TWJA 3UOLA 1HOWA 3FV8A 1QMZA 1VYZA 3IOKA 3ZLSA 4B0GA 4E6QA 3DAEA 2WXVA 3L8VA 4ZJIA 3V8SA 4C37A 1XH4A 4EK4A 5I9YA 2C5VA 3R7UA 3ZOSA 4C58A 4U41A 4ZTRA 1YOMA 4L68A 2ZB1A 3GU6A 5CZIA 4MXXA 4I92A 5AV3A 2A2AA 2C3IB 4PF4A 2VWUA 4UBAA 3RAWA 3AMYA 4FG7A 4UMQA 3WOWA 2PUUA 4QPSA 3VBXA 4APCA 5EOLA 1R3CA 3EYGA 4IFGA 5TF9A 5DE2A 1GIHA 5CY3A 3HMPA 5KZIA 3C4WA 1JWHA 3R7IA 5DFPA 5KKRC 1QPDA 5GHVA 3DQXA 3MS9A 5IQBA 1JSVA 2J0MB 2OLCA 3JXWA 3TJCA 4DFUA 4WBBB 1XR1A 3QUEA 4GFMA 3U51A 4ZXTA 5AV4A 4FVPA 5ICPA 5AUYA 4BF2A 4ZZNA 5CF6A 5GIOE 3C7QA 1OMWA 3TNIA 4I0TA 3A99A 3T9TA 4YHTA 2B9FA 2IO6A 4MEDA 5CAOA 2YJRA 4F4PA 4CT2A 5DT4A 1J91A 2XKFA 3M2WA 4A06A 2XS0A 3ETAA 4WNPA 4E4MA 5CF8A 5HKMA 4X21A 4ZLOA 5CI7A 4R5SA 3RPRA 1UNGA 4CRLA 4CFVA 3WZDA 2XJ1A 4EUTA 1PYEA 3DBEA 2XEYA 1Q8ZA 3QWKA 4JQ8A 5AP5A 4DCAA 2YIXA 1NT2A 3R8UA 1LP4A 4W4VA 5J7BA 1IAHA 4DHFA 4EZ5A 2QQ7A 3I5ZA 1R78A 3Q4CA 4OTIA 2CKQA 3BGPA 3KKVA 2KULA 2YCQA 3E7OA 3NUSA 5KMKA 4IM2A 4IAAA 1H1PA 2W0JA 3NR9A 5E8WA 3KXGA 2PE1A 2W1DA 2ETRA 4GT3A 3NMUF 3UVQA 5C8MA 2BDFA 2XA4A 4EH2A 3P86A 3HGKA 4H1MA 3DPKA 3QGYA 3VF8A 4BTKA 4YZDA 4FL1A 4NSTA 4LOPA 4R7BA 4Y85A 3UMWA 1J7UA 3FHIA 1TQPA 2YDIA 3E64A 2W9FB 4ZY4A 3ORZA 3QCSA 3T9IA 3Q9ZA 1PYXA 4JBVA 4EK3A 1PXMA 5A9UA 5CEIA 2FGIA 4HZSA 4K0YA 2P33A 4QTEA 3TZ7A 4NJ3A 5EW8A 3O96A 3UTOA 3AC2A 3I0OA 3VWAA 4I0RA 3QYZA 3O8PA 2YAAA 3G90X 1K9AA 1BMKA 2WEVA 4C02A 3W2CA 1J7LA 2PULA 1Q99A 3VS1A 3DB6A 5KZ0A 1YI6A 1YDSE 2RG5A 3W55A 1H4LA 4KAOA 2H96A 3O17A 4JBQA 4FV3A 4G17A 5JFVA 4LGHA 3ENMA 3EN5A 2BRMA 4G9RA 4IWPA 3L8PA 4MWHA 4PTEA 2J0JA 4BCFA 2CMWA 5BMSA 1U5QA 5LJJA 4ZSJA 4BDAA 2ITVA 2WHBA 3R9RA 4CG8A 3MSSA 4ERKA 2ERKA 4EOPA 3H9FA 4O38A 3MPAA 4D9TA 1TQMA 2Y0AA 4F99A 4TZRA 4Y5HA 4DEHA 1U4DA 4WNMA 4D4YA 4FEVA 3FL4A 4XRLA 1BYGA 3V5WA 3OMVA 4CEGA 2UZWE 3GC9A 5IUGA 1B6CB 2VO7A 4FTLA 3R0TA 4IWOA 3EFJA 5AWMA 4IADA 4DEDA 3IONA 2XNOA 3KMUA 1Q61A 3C4EA 1PKDA 2HK5A 4O83A 4WT6A 5DEYA 3HV4A 4C33A 4WSYA 5DWRA 3DKCA 3QRTA 2C6OA 4YHJA 1LPUA 1REJA 2XK6A 3P23A 3PPJA 3VUKA 4AW5A 4DT8A 2HZIA 3OUKA 4R77A 2JFMA 5HIDA 4FA2A 2Y6MA 4UZHA 2PVHA 3VBVA 3JR1A 4TYHB 4PP9A 1JPAA 3OXIA 4ZTSA 4QTAA 5AIKA 2C0OA 3E87A 1XHAA 1PMUA 3VBWA 3W2RA 3HVCA 4BZDA 4CLJA 3QA0A 4O2PA 1ZY4A 3VRYA 2PVLA 2QO7A 3R8VA 2W1GA 2O63A 1P4OA 3H3CA 2ZV7A 3MW1A 4USEA 2PVMA 4RQKA 3DDQA 4JX3A 4DH1A 4YTFA 5HO8A 2WMUA 5DHJA 4D4SA 2DS1A 3UOHA 4FC0A 4MK0A 5IMXA 4GKIA 5A4LA 2UW5A 4YU2A 4DAWA 4NIFB 2R7BA 1YOLA 3DA6A 5A6OA 4BDIA 4XP3A 3HV3A 5HIBA 5GIPE 3NGAA 4TRLA 1OGUA 2G01A 2YISA 3NLBA 3Q60A 3SXSA 4E5BA 3UQGA 4O7LA 2JAMA 2C6DA 2OJIA 4FIEA 3LCTA 3K5UA 5GZ9A 2OH0E 4O86A 5AFVA 5I0BA 4TL0A 4W9XA 1CKJA 4ANQA 4BZOA 1MRVA 4CZYB 2BZIB 1ZOHA 2J7TA 3DBCA 5ACBC 5CENA 3KL8A 3Q2MA 5AP4A 4ZTMA 3F7WA 2W05A 2G1TA 5L8KA 3E62A 1W84A 1WVYA 2WTWA 4L53A 5FEDA 2IW8A 2VWXA 1LR4A 3FKLA 4QYEA 5BVEA 2YIWA 3DAJA 3TG1A 4YSMA 4AAAA 5BUIA 3CJGA 3LE6A 2A4LA 2W1CA 3M42A 3NYXA 3QTSA 4XG8A 3ZO1A 4HVDA 5J5SA 5E4HA 4QO9A 1WZYA 4FOCA 1YWRA 2HZNA 3E7VA 3MY5A 5FG8A 3V04A 4HYSA 2BHHA 2OIQA 2BFXA 2UW4A 4LL0A 3LFSA 3QTIA 2JITA 3KRJA 3QKMA 5CT7A 5DIAA 2WMVA 1GOLA 4YZBA 4FIFA 3UNJA 1JVPP 2QC6A 4NFNA 4W4XA 5FGKA 3QTXA 4FV5A 4A9TA 4M69A 4EKLA 2JC6A 2VWIA 3DLZA 5EYMA 3ROCA 4ACDA 2B53A 5HG7A 4DLJA 2GQSA 3QTUA 4FTKA 4MH7A 2FSLX 2P2HA 1FGKA 5JRQA 5ANJA 5B2KA 1PXOA 2G2IA 3UG2A 2V22A 1OKYA 4DG0E 2QHMA 4BGGA 1OI9A 4IAZA 3PXZA 3WF7A 1YHSA 4GH2A 5EI8A 5TE0A 4BCQA 2IZSA 3U9CA 4RFZA 4J53A 4WRSA 1H1SA 4HYIA 5AA9A 3MGYA 5ETAA 1YI3A 5H8BA 3LMIA 2FUMA 5IEYA 2YM3A 4JVGA 3BHYA 1BL7A 3FLZA 1PXLA 4OGRA 3DZQA 2VUWA 1IR3A 2PHKA 2VTMA 2B9JA 3G2FA 1YXUA 1SNXA 3G5DA 3GC8A 4QTDA 2VD5A 5HHWA 5FXRA 3MPTA 5J79A 1ZYDA 2C6MA 2W1ZA 4GJ3A 3ORLA 4L3PA 3RK5A 3WF5A 4OR5A 3BU3A 3R30A 3WZKA 5J9ZA 3P7AA 2Z8CA 3BPRA 5M44A 1RJBA 1UNLA 3HYHA 4XG6A 4EHZA 3OXZA 1BL6A 4E73A 4JRNA 2CHLA 4QMMA 2RIOA 3VUMA 5IPJA 4U44A 4X2KA 1DAWA 3ZUUA 4Q9ZA 3F2RA 2Y4PA 4D1SA 5DLSA 4MTAA 3IG7A 4XOZA 4I6FA 3FC1X 1H1WA 5DPVA 4EH8A 4ID7A 2ETKA 1H00A 1F3MC 3TN8A 5DR6A 5C1QB 3H0ZA 4AXAA 3NX8A 5HBEA 4ASXA 4Y83A 3L8XA 4O81A 3VHKA 3FXXA 4OTDA 2YDKA 3FMJA 2X6EA 1JAMA 1YDTE 2OXXA 4X6RA 1H27A 4TKSA 4DG2E 4I5PA 4DFYA 5I9VA 5HX8A 2IW6A 3EB0A 4LI5A 4JT3A 2PZPA 4JG8A 5J95A 1H1RA 2CJMA 2X8IA 4X3FA 3MY1A 2C4GA 2BRHA 4GYIA 5HICA 2VO3A 2ZM4A 3NNVA 3QD3A 3GOPA 4IE9A 4NUSA 4XG3A 1Q3WA 4NTTA 3W10A 3SAYA 4FNWA 4C3RA 5JEBA 3ZRMA 4RQVA 3RK7A 5HTIA 1NA7A 3VHEA 4D2TA 5HZNA 3AC8A 2RGPA 4KKHA 2W06A 4IZ5A 4QMVA 2YM5A 3OW3A 3TEIA 2VTNA 4YJSA 3HP5A 3PIZA 3FI3A 4XRJA 4N6YA 4Z7GA 3IDPA 4BRXA 3EYHA 5AUUA 3MPMA 3FZTA 5FWKK 1ERKA 1ZY5A 4ITJA 2JIIA 2ZDUA 4Y5QA 3N9XA 2R5TA 5F1ZA 1UVRA 3TDVA 5L2TA 2BAJA 2BAKA 1JBPE 2VAGA 3CQEA 4I93A 4U6RA 3RWQA 3UZPA 4DFLA 5FDPA 5ITAA 4D2SA 1J1BA 4ANBA 4BKJA 2O5KA 2VWYA 4XNEA 1H0WA 4CT1A 4EOQA 2JBPA 2HIWA 2J0IA 3B8QA 3NAYA 2GNIA 3LAUA 3FLYA 2W9ZB 4F1OA 2RKUA 4EHEA 4GG7A 4G34A 3BYUA 3O50A 3I6WA 3WF9A 4AN9A 4G16A 5JQ5A 4QMOA 4DITA 3G6HA 2WTKC 1OL7A 2UVYA 4XX9A 4EK6A 4ALWA 5E8TA 2XBJA 4ACMA 4J8MA 5K9IA 5JFSA 4FSQA 3MDYA 3LJ1A 4OUCA 3I7BA 3ZO4A 1T45A 2WQEA 1ZRZA 4KSPA 2VTSA 3UO4A 3L1SA 4RMZA 1DM2A 2GDOA 4TYIA 4AP7A 3TUDA 2BMCA 3ZRLA 2QG7A 1VEBA 5EYCA 4LGDA 5FBNC 3H9OA 3U6JA 4G3CA 4GU9A 4WBOA 2JDVA 3D2IA 1UU9A 2W1EA 4W8DA 4RFYA 2UZTA 2A1AB 4RIOA 4WKQA 4YC3A 1UKIA 4ZOGA 1M14A 3FMKA 4LGGA 3WF8A 3EQRA 1GZKA 4CGAA 1O6YA 4E5AX 4ENXA 2BRNA 2C5YA 2BKZA 3IO7A 3PJ8A 4J7BA 3R63A 5FLFA 2X8EA 3VNTA 4BN1A 4UZDA 1H07A 4IXPA 1S9JA 3QLGA 4NK9A 5CVHA 4DLIA 3TV7A 4FSRA 1URCA 2JKMA 5CT0A 5CSPA 1ATPE 2V55A 2QO9A 4QT1A 3RJCA 4O6EA 4A9RA 3FAAA 3RHKA 4CKJA 3IQ7A 4GG5A 5FEQA 3PZEA 4AGCA 4S34A 4MNEB 2ITYA 1XKKA 1AQ1A 1UWHA 2JKOA 3MB6A 5CEMA 3T3VA 4RJ3A 1W98A 1FVRA 3JS2A 1U46A 3ZS5A 2WOTA 3ANRA 4IWQA 4JX7A 4Y8DA 3C4ZA 3HECA 1MQ4A 4D2VA 5AP0A 2GS2A 2XIYA 3FZ1A 3P08A 3V6RA 2UW9A 1K2PA 1QL6A 3ACKA 1CM8A 1Z9XA 4D5HA 4XBRA 3KEXA 2QOBA 5E91A 2XNPA 4AOTA 4AN2A 5FUTA 4BC6A 4HVSA 2WU7A 1QPEA 3FYJX 4HYUA 2PZRA 3W1FA 2Q0BA 3FI4A 5JFXA 5IA5A 4ANLA 4QMSA 4FKOA 1BI8A 4IC7A 3R1QA 3NYVA 4LFIA 2PMOX 4QMXA 5IQDA 4BDEA 4I20A 3DXNA 1KSWA 4II5A 5IKWA 2I40A 3N51A 3BQRA 3PIXA 3QRIA 3O7LB 3JVSA 4KIKA 4NWMA 4EH6A 4QQTA 1QPJA 4G5PA 3Q4TA 4N70A 4BCMA 1RQQA 2OIDA 4BIEA 2RFNA 3QD4A 2VN9A 2XK9A 3I7CA 1Y8GA 3D0EA 4TYGA 4I6BA 3KN5A 3RMFA 3PY1A 3AGMA 5BQ0A 3A61A 3EHAA 4LMNA 3VUTA 3FHRA 5FP5A 1T46A 4CFFA 3U4WA 4FG8A 1TKIA 3A62A 4FVRA 4K6ZA 3QRJA 1JKTA 5AP2A 2W4KA 3JUHA 4QMYA 4KS8A 4DTKA 1F5QA 4X3FC 4FF8A 2HWPA 4JDIA 1ZARA 3LM5A 3GQLA 1VYWA 3R71A 1OL1A 2NPQA 4JLCA 3W2SA 5HO6A 4QQ5A 4RJ8A 4EOMA 4XG9A 2ONLA 4UEUA 2YWVA 4QMZA 4AT4A 3LFNA 4HCVA 3EQBA 4DEAA 4NFMA 3ZDIA 1KOAA 4PX6A 4IWDA 5CF4A 3JYAA 5D10A 4F0GA 4AN3A 4D28A 5HQ0A 4DF3A 3KF4A 3A7HA 5KMOA 3EMGA 3ORPA 3P5KA 5IA1A 5M4CA 3IGOA 1GAGA 2VO6A 4BGQA 4U42A 5LVPA 3PWYA 4BCGA 2PZIA 2R0IA 3Q53A 3VN9A 4ACHA 4CQGA 3E8DA 4RA5A 4L67A 1BLXA 3SG9A 1WBPA 4X3JA 1P2AA 3SOAA 2GS7A 4UXQA 1PXPA 3QAME 3DK6A 3NW6A 2JGZA 5ETIA 4F6SA 3FWQA 2GHMA 2X8DA 3IECA 2YM8A 5M55A 2A27A 1KUTA 4JBPA 3EN9A 4O7RA 3SW7A 4G5JA 3V6SA 4FGRA 3KA0A 4O2ZA 3GBZA 3FXWA 4RIYB 4BBMA 3QCQA 4EJNA 1LEZA 3CTJA 3DJ7A 4I94A 2XNBA 3P9JA 3DXPA 1PY5A 2I0YA 3BI6A 4HPUE 5J1VA 3LCSA 4AT3A 5EKOA 1YXXA 5M09A 1YXTA 3R28A 2Y4IC 4TT7A 2QOKA 2ZDTA 4AW0A 4JR3A 2Q83A 5AIRA 4XLVA 5E8XA 1ZWSA 3LJ2A 4KBAA 4M84A 5HE1A 4UN0C 3MFSA 1Q8TA 5CEKA 2C30A 3R8MA 2CLXA 4FUYA 1OM1A 3RAKA 2VGOA 2IWIA 1WFCA 4I21A 5GZ8A 4O91A 2E2BA 3QCXA 5AP3A 4BDHA 4RWKA 4A4OA 4D1XA 1W7HA 2WMQA 3N4UA 4B8MA 2XUUA 5IMEA 2PVJA 2VNYA 4NCTC 2Z02A 5EI6A 4RIWB 1PJKA 5AAEA 4HNFA 3QTRA 3GENA 4LRMA 3WILA 2R3PA 3POOA 4QYYA 3ZM4A 3F2AA 3HUBA 1Q8WA 4KINA 2QKRA 4NEUA 4QYHA 4D5KA 3ZXZA 4CD0A 2WIPA 3E5AA 4I23A 4U43A 2OK1A 2X9FA 3MBLA 1ZMWA 4NH1A 4D0XA 4PL5A 4DEGA 3WI6A 3R02A 1WBOA 1B38A 3SRVB 1AGWA 2GCDA 2JDSA 2CSNA 2IVVA 2WQMA 3OF0A 4U45A 2O65A 5E7RA 4ANMA 4R5YA 4M15A 2GS6A 2HY81 3KULA 1ZYLA 4LV5A 4FKPA 2JIVA 4FUXA 2BTRA 3VAPA 3EQDA 2VWBA 2Y9QA 3C51A 4NZWB 4FKSA 2UZUE 1L3RE 3GXLA 4FNYA 4FEUA 4QMUA 1KE7A 3B2TA 4J1RA 2CDZA 4RZWA 3GB2A 2P2IA 3IW6A 3IW4A 5DH3A 3RCJA 4BDCA 5CSVA 4QP3A 3VQUA 4IMYA 1MRYA 3OY1A 1P14A 2XCKA 3CD8A 3AT3A 2IVTA 2BZJA 3KQ7A 3FYKX 3KN6A 4N4SA 1CDKA 3LFQA 5JKGA 3EL8A 4CCBA 1PMVA 4ZS0A 4QPAA 4BIDA 4O82A 4F7NA 1PXNA 4L3JA 3L9NA 5L6WL 3TNPC 3GC7A 4TN6A 3SGCA 3SD0A 1S9IA 3I1AA 4NM0A 2X2KA 2ZJWA 3OWPA 4IB1A 4QRCA 4F65A 4HVGA 2F2UA 4FTQA 2GPHA 4U97A 3UC4A 4H39A 5ETCA 4GVAA 3V8WA 3ORKA 3UG1A 4BYJA 3ENHA 1FPUA 4MF0A 4P5ZA 3ZEWA 3QZGA 1H8FA 4RIXB 1R0EA 5EQYA 3FY2A 3IGGA 3NWWA 3PG3A 4L3LA 3NCZA 4CMTA 5K5XA 2NP8A 4BY9E 2WTIA 2BRGA 2VTJA 4OBPA 4RG0A 4USDA 4L6QA 1IA9A 4CV8A 3OT8A 2BRBA 2JBOA 3DFAA 5HI2A 2V7OA 2C5OA 2QG5A 2ESMA 2R3LA 5TKDA 4OW8A 4BCNA 1SMHA 3QFVA 4WG3A 2P3GX 4Y95A 3SDJA 3OY3A 5HLPA 3KRWA 4B8LA 4FK3A 4G6NA 1YQJA 5EM6A 3LFBA 4G2FA 1KE8A 2YERA 3QX2A 1HCKA 2JDRA 4J95A 2XEZA 3ROYA 3QWJA 1FVTA 4DH3A 4ZTHA 4O0UA 3TZ8A 3PRIA 5A4CA 3HLLA 3TZMA 3O23A 4IZAA 5AR8A 3REPA 3UE4A 4BTJA 3QD0A 4PMMA 3COMA 3FZOA 3PXRA 4E3CA 5AR2A 1H24A 1VJYA 3HEGA 3NNXA 4ALVA 3UO5A 4TWOA 4N57A 5EYDA 4O21A 4FGBA 3KRLA 1P5EA 3CCNA 4J71A 4PRJA 2BFYA 2XM9A 3H0YA 4IAKA 2X7OA 2UV2A 4FZ7A 4OAVB 4FL2A 3SVVA 4MXOA 4LV8A 4KABA 3DDPA 4XG4A 4AU8A 4IQ6A 4EI4A 4BDBA 4RZVA 2J0KA 4C4JA 4QPMA 3U4UA 5AUXA 1JKSA 3BHVA 3HL7A 1OITA 4JQ7A 5AAFA 3ALNA 3UVRA 3BEGA 4BL1A 1WBTA 4FKJA 3BYSA 5IQIA 1QCFA 1DS5A 3KK8A 3V5PA 4F6WA 2CNVA 3PXQA 3S0OA 4ZEGA 2ZV9A 5CAPA 3BEAA 1SZMA 2J5FA 5BYYA 4V0GA 2WMXA 4CFNA 1KE6A 3NNUA 3FMNA 4LOQA 4JRVA 3SXFA 2ZV8A 4EQCA 3I5NA 2BHEA 3ULIA 4EC9A 2X2MA 4BIBA 3SXRA 4BFMA 2YITA 2W17A 3C5UA 3VVHA 3KC3A 2VNWA 5JGDA 2OF2A 5H8GA 5EI2A 4PTGA 1OUKA 4BDFA 3Q96A 3PG1A 4ZS4A 3QALE 4IAYA 3UIBA 2JAVA 4J52A 4PL3A 5HESA 4RBLA 1KOBA 4OAUC 2DUVA 2OJ9A 3GEQA 1VR2A 3D5VA 2OZAA 5K3YA 3DNDA 3OVVA 2E9PA 3SHEA 5JH6A 3G33A 1BX6A 2C3LA 5E8VA 2VU3A 3BQCA 1WCCA 1U54A 3ZLXA 5I3RA 2KTYA 2PUPA 3LFCA 1MUOA 2W4JA 3HMIA 4DFNA 5KKRB 4HW7A 4YO4A 3R1YA 2OIBA 3HRCA 4XEYA 5BVOA 3R22A 1APME 4QTCA 4R6VA 2E9UA 2EXMA 3VUGA 1GIJA 3L9LA 3ERKA 2BIKB 2XJ0A 4QMPA 2F4JA 4MXZA 4EBVA 4F1MA 3IW8A 4QYFA 4C8BA 4R3RA 4DG3E 4XOYA 5CF5A 4UWCA 4TY1A 3VC4A 5JK3A 2VTOA 2R3NA 3QRKA 3R9HA 5E8ZA 5A4EA 5HNIX 5AMNA 4E93A 5HCYA 3RALA 4I5MA 4LUDA 4G9CA 2VTTA 4L46A 1QPCA 4C35A 2DWBA 3KMMA 5TOZA 1FMKA 5LMAA 2OBJA 3F3VA 5M4UA 4EZ3A 2G15A 3ANQA 4U5JA 3MESA 5A6NA 3HMMA 3DTWA 4CCUA 1BI7A 4JDJA 4MAOA 2WMTA 3HA8A 2Y7JA 2RG6A 5C8NA 4E4NA 4NM3A 2VX1A 3CSVA 1W82A 5IEVA 5CSWA 2VTHA 3T3UA 3RZFA 4DCEA 3NVKI 4ERWA 2NNWB 3W2PA 5D1JA 5LMKA 3O51A 4PTCA 2YLEA 3RWPA 4L9IA 1Q97A 4K1BA 4AG8A 2HZ4A 3ZFMA 3UZTA 3IDCA 5HCXA 4RRVA 3M1SA 4OTQA 3PSCA 1ND4A 4IVAA 3COIA 4YZ9A 5TR6A 5BVDA 1NY3A 5CYIA 4I6HA 4MD9E 1ZYJA 4BWXA 3PUPA 5AR5A 4IB3A 1SVGA 4Z9LA 2BCJA 5FXSA 3BLQA 2QNJA 4F7LA 3MVLA 5DBXA 5AA8A 5EDQA 3F7ZA 3RINA 2PMNX 2XNEA 3E3PA 3PP0A 3FL5A 4E6CA 4NL0A 4U80A 2AC5A 4EC8A 3VQHA 4MBIA 4QMNA 5IA0A 2IVUA 4MHAA 4CYIA 2F9GA 4O0RA 2YJSA 3F5UA 5EKNA 3IS5A 2FSTX 2IZRA 3TJDA 5KNJA 4FNZA 1OB3A 2R0UA 1R39A 4L8MA 3EOCA 2PSQA 3EFKA 4UALA 4AZTA 3HMNA 3R6XA 1IASA 4XG7A 3IPHA 5F20A 3LM0A 5FXQA 2B52A 5EG3A 3S3IA 2JIUA 2WO6A 4QNAA 1R0PA 3C13A 3VBTA 1XH5A 5CLPA 3ZU7A 5TT7A 4K9YA 3WF6A 4FSYA 2UZNA 3UOJA 1Q5KA 4X0MA 3DBQA 3PSDA 3TNHA 5KHXA 4EHGA 4YLLA 1UWJA 5H8EA 1XJDA 5IH6A 4IM3A 3FQHA 4QD6A 4S30A 4CG9A 1OKVA 2ZYBA 4APPA 3BV3A 4IC8A 1WBWA 4AGWA 3RAIA 3CE3A 4EORA 2WB8A 3A7JA 4M97A 3B2WA 3QZHA 4I24A 4Z16A 5L2SA 3EKKA 2QHNA 4WD5A 3CGOA 3BWJA 4O7YA 3KGAA 5F94A 2CLQA 1XBBA 3BLHA 4RX9A 1FINA 1JQHA 4YNOA 3LLTA 3ZM9A 3NDMA 3PXYA 2HXLA 1YW2A 3P78A 4I6QA 3D7TA 3NW7A 4NM7A 4XV9A 1CSNA 4GIHA 3R8LA 1SNUA 4EH3A 3IK3A 3CPBA 4QMTA 5JZJA 3DS6A 4AA5A 3PE2A 3FI2A 3D14A 4CFUA 5FDXA 2W4OA 3RPYA 3CY2A 4EOIA 3P7BA 5J87A 3K2LA 5AV1A 4WRGA 1I09A 4F7SA 4RFMA 5CNNA 4H58A 3ZBFA 4O96A 4CKIA 4ZY5A 4FT0A 3VS4A 1YHVA 4EOLA 3TUBA 4FSTA 5AUZA 4AFJA 4FI1A 5DA3A 4AZWA 4XMOA 3BGQA 3P79A 4ANOA 5LWNA 5IZFA 1Q3DA 2IVSA 3LMGA 3Q5ZA 4UMPA 3TUCA 4L45A 4ZY6A 3RGFA 2IZUA 4C34A 4E7WA 3KU2A 2HCKA 5HG5A 4W9WA 3TIZA 4MXAA 2V7AA 3HRFA 5K4IA 1G8AA 1J7IA 2C5NA 1OL5A 3U8WA 4ENYA 4K2RA 3G15A 3ZBXA 4H05A 1Q4LA 2XKEA 3OXTA 3D5UA 3QQFA 4XV3A 3EN7A 3QXOA 3BV2A 4I4FA 4HVIA 4BYIA 5A4QA 2IZTA 3BCEA 5ANIA 4BDDA 1GZNA 4M12A 5IA4A 1PRYA 4TWCA 5AP1A 1NVQA 4B7TA 4F6UA 2BPMA 3K54A 5IDPA 3Q3BA 1WAKA 3RPSA 2OZOA 3GU5A 4ASZA 2SRCA 5AR7A 4FTIA 4KRDA 4V05A 4EKKA 2J4ZA 4BVUA 2W7XA 3ZLWA 4PMSA 3DK3A 3KCKA 1XQZA 2VO0A 3RI1A 4BI0A 5LQFA 2C6LA 4JI9A 4WUAA 4H3BA 1OKZA 5CQWA 1LEWA 4YO6A 2B4SB 3F9NA 2OF4A 5IA2A 1IRKA 1UV5A 2RFSA 2XYUA 4FIGA 3NW5A 2Z2WA 3QHWA 1Q8YA 3SX9A 1YDRE 5LMKC 1NW1A 3BYOA 1VZOA 4J98A 4ZJVA 4MBJA 5ETFA 1GJOA 4L44A 4M14A 4QMWA 1UNHA 2H34A 3TI1A 4AZVA 4BCPA 4O7ZA 5C4KA 1OBDA 2PVNA 4H3PA 4GUBA 4CFWA 4L00A 5CAUA 3HRBA 4FTMA 3NS9A 4JG6A 3AGLA 4F9AA 2FSOX 4EBWA 2EB3A 5EOBA 2R7IA 3TIYA 4D58A 3V5TA 3AT4A 3PVGA 5A14A 1ZMVA 4FSWA 2ZVAA 1RW8A 2PVKA 3F5GA 2NRUA 4LL5A 4FT9A 4C38A 3Q5IA 4CLIA 4IVBA 4YJVA 3DKOA 4KD1A 1YXVA 1M2QA 2BVAA 4PDSA 3ELJA 5C4LA 3VS7A 1W0XC 2ITXA 4S2ZA 1Z57A 4AOJA 4FOBA 2B9IA 3COHA 3HA6A 4RX5A 5LXMA 2PZ5A 2VTRA 3QD2B 4QP7A 1B39A 1WVWA 3ORNA 2YCSA 3TDWA 4FTJA 1CKPA 3EWHA 4FKIA 4X7QA 3QUPA 3LFDA 4YBKA 5EDPA 4EHVA 1PXIA 3QKKA 3CXWA 5HNBA 4FV0A 2GQRA 4IX6A 4O22A 2XIKA 3OZ6A 4U7ZA 2W1FA 3GU7A 3ZTXA 5IQAA 4PV0A 2QCSA 4M0YA 1REKA 4E20A 3LKMA 3ORMA 3LQ3A 2ITQA 3RM6A 4EYMA 4ORKA 1Q41A 5M06A 4EH7A 1U5RA 3CJFA 4EOJA 4BWKA 2UZOA 4RC2A 5KMMA 3VS5A 4N0SA 3FKOA 4D2WA 4YZNA 4EUUA 3FE3A 4RLLA 3OG7A 5D41A 4KA3A 2NO3A 3QHRA 4X2JA 3QTQA 4KSQA 1YKRA 2C6KA 2WNTA 1KWPA 4BCHA 1WVXA 2XJ2A 2YCRA 1E1XA 3G0FA 4HGEA 4MBLA 3RAHA 3RZBA 2HOGA 3FQEA 3FZSA 3OP5A 4IX4A 4KNBA 4BB4A 4EQMA 2CGUA 4OTWA 1H0VA 4WHZA 1WBVA 4WIHA 3ORXA 3AXWA 3GCQA 3R7GA 2G2HA 3O0GA 4A9SA 4DFBA 4V01A 4C2VA 1SYKA 4FR4A 2WMRA 2ZV2A 2XZSA 4F70A 2ITOA 3OROA 4Q9SA 4IVCA 4X2GA 1V1KA 5AUTA 1A9UA 3TACA 5L2IA 5CX9A 5LVNA 4DEIA 2OW3A 2R3IA 3LQ5A 4M13A 2PL0A 3GFWA 2VTQA 2OJJA 4DFZE 3DTCA 2C3KA 4YZMA 3LXPA 4IACA 4OBQA 3FY0A 3G0EA 2F49A 1HCLA 5E8SA 2R3OA 3SKCA 3CKWA 3ZONA 4GK2A 4NCTA 2C6TA 3V5LA 4B9DA 3PWDA 4YJOA 4MWIA 4FV1A 4YJNA 4C59A 4FKUA 3V5QA 4K33A 5EM7A 4BWPA 3OW4A 4BCKA 4XG2A 2PVRA 2YAKA 5EW3A 4F64A 4O6LA 1ZLTA 5HE3A 2UW0A 2VX3A 4Y73A 4F9WA 1E1VA 3IW7A 1BUHA 4Y46A 3BE9A 4CQEA 3BYVA 3H9RA 2IN6A 3QQLA 4MNFA 4AFEA 3U54A 4A9UA 2EXEA 3KVXA 4AW2A 3R1NA 3BE2A 5FD2A 2QOFA 2CGVA 1XBAA 4DN5A 1ZAOA 2WTKB 5EQPA 3PY0A 5D7VA 4BCJA 3SG8A 4YJTA 4D4VA 4ZSAA 3QXPA 4TXCA 4XYFA 1H08A 4DEBA 1UU3A 2R3RA 1O6KA 2NRYA 5DMZA 5BVNA 3C1XA 2R3FA 5IDNA 1IG1A 2XMYA 4JIAA 4CXAA 4R7HA 4YPSA 3DV3A 3OCTA 4FEQA 4FKTA 5ANGA 3Q04A 3BRBA 4ZZMA 4QQJA 2W5HA 3ACJA 3ZC5A 3LOKA 4M66A 2C6IA 3KF7A 5IH5A 4FZDB 3EN4A 4BCOA 3UPZA 1JSUA 5ACKA 5HE0A 2BALA 2GHLA 3S4QA 3H10A 1H28A 4BHZA 2I0EA 4KKGA 2E9VA 3OEFX 4DBNA 1OPJA 3FXZA 3ZUTA 5HLNA 3BHHA 3HDMA 2X6DA 2E9NA 3HP2A 4IHPA 5IQGA 3CQUA 3HUCA 2XK4A 2GNLA 4ZMFA 4M69B 4PNKA 2JDOA 3DXQA 4XJ0A 2JEDA 2W1IA 4JS8A 4TYJA 5HVYA 5LCKA 4MX9A 4LRKA 3BWFA 4IIRA 5EDRA 1ZZLA 5E8YA 4RJ7A 1PHKA 4E26A 4MYGA 4C62A 4AWIA 3KXZA 3A60A 4EYJA 3ATSA 3TM0A 2XYNA 5C01A 2ITUA 3D5WA 3EKNA 3MWUA 1Q62A 4NT4A 4QMLA 4F9YA 2WKMA 3F3WA 4RJ6A 4PDPA 2H8HA 3ZFYA 4B6LA 3R7VA 5LOHA 3AMBA 4C0TA 5A54A 3ZO3A 3PP1A 2J51A 4DGOA 2GNFA 4RA4A 3C0IA 2C69A 4YLKA 4AX8A 1Y6BA 2O64A 4IB5A 3LFAA 4O7VA 3NSZA 2CNQA 5HD4A 4P7EA 2WU6A 4A07A 3OTVA 3HDNA 4FTRA 5DI1A 5HEZA 4FV2A 1YVJA 3TV4A 2X7GA 1CMKE 4H1JA 2QOIA 4X6QC 4YJQA 2XIRA 4Z7HA 3CQWA 4JIKA 3AC5A 3E3BX 2GNJA 2PVYA 4XV2A 3OWJA 4E6AA 4IM0A 5M53A 5DR2A 3FMHA 4LOOA 2IJMA 3AOXA 4GT5A 3CR0A 2XP2A 4ASDA 4E5WA 3GGFA 3NUYA 5DGZA 3C5IA 4LYNA 1M2RA 3FMDA 4P2KA 4YUQA 3GP0A 3GT8A 4P5QA 3O71A 4GUEA 3L9MA 1PXJA 2XM8A 2CN5A 5CNOA 3W2QA 5AUVA 5M51A 3GUBA 3MIAA 5I9WA 2BKKA 3FLSA 1J3HA 1DI8A 3QZIA 4ITIA 1WBSA 4BI1A 4YGAA 3IDBA 3W16A 2VWZA 3AQVA 1IEPA 4FTAA 4X3FB 3UC3A 3OCSA 4CMUA 3MH1A 4FYNA 3CLYA 1XH9A 2YWPA 3FLNC 2R3JA 3R73A 4TTHB 4AZEA 3R04A 3OS3A 3R9OA 4BZNA 2CGWA 2B54A 4E4LA 2HYYA 1H1QA 3AD5A 3II5A 4O1OA 2XNMA 3BIZA 3I4BA 4YJUA 4M7IA 4UMRA 3NRMA 4P90A 1K3AA 1OIQA 1JNKA 1OZ1A 3R7EA 2PPQA 3DLSA 4FZFB 3NVMB 3CBLA 3S1HA 3KY2A 4GL9A 5DR9A 5L8JA 3W8LA 5FTGA 5C27A 3D15A 2OICA 2P55A 5IF1A 5M56A 3OT3A 2GHGA 2QU6A 5M07A 5BVWA 4NW5A 4A7CA 3C0HA 3AT2A 3DZOA 4PPAA 3EJ1A 3FLQA 2VZ6A 4JBOA 3VULA 5CEPA 3KMWA 4M8TA 3HV6A 4ZAUA 3OBJA 3PFQA 3D94A 5BX0A 5J9LA 3R9DA 3UNKA 4GVJA 4FK6A 4RT7A 2VWVA 3QX4A 2C1AA 4QQCA 4HOKA 3VF9A 5F95A 3PIYA 4BDGA 3TNWA 2O2UA 4I3ZA 4UMTA 3NIZA 3DU8A 4I5CA 2W96B 2YM4A 1G5SA 3GU4A 2ITZA 3CGFA 4GJ2A 4BHNA 4JL9A 4GV1A 4ITHA 3CD3A 4YLJA 1NVSA 4ZSGA 5K0KA 2OI4X 1TVOA 2WGJA 3PJ2A 4YTHA 1Q24A 4ALUA 1MP8A 3C50A 2Y4IB 2ITNA 4IBMA 3RCDA 5D12A 3QLFA 3PZHA 2Z7QA 3LCOA 4UY9A 4AGUA 3EQIA 3JY0A 4OTRA 1Y91A 3P7CA 5IH4A 2JKKA 2R9SA 3VJNA 4W4WA 2R64A 2ZOQA 5HU3A 2RFEA 2YA9A 4FV7A 4PNIA 4EOKA 1V0PA 3TNQB 5JQ8A 4GSBA 2RSVA 3COKA 5KE0A 2ITPA 4M0ZA 3OEZA 4MQ2A 4YBJA 5T6KA 2H6DA 5A46A 5HLWA 3N4TA 4TYHA 3K5VA 5IQEA 3A7IA 2UW3A 1XO2B 2X1NA 2UZDA 2XNNA 3D9VA 4FICA 4FNXA 1FQ1B 2HENA 4QP4A 4EQUA 1IAJA 5AP6A 4QP2A 4Q5HA 3ZDUA 4QMQA 5LVOA 2XKCA 2VTPA 3D5XA 3R8ZA 1EH4A 2YM7A 3HZTA 4PDYA 2OJFE 4UX9A 4OT6A 1KE5A 4HCTA 3GCSA 4RC4A 1U59A 2Q0NA 4NIFA 5AR4A 2WTVA 4BBEA 1G8SA 2VRXA 3I81A 3PJ1A 3EQCA 4H3QA 4WNOA 4YR8A 3PYYA 3D4QA 5IISA 4KBCA 2OXYA 4DH7A 4E8AA 2YN8A 3TZ9A 3CP9A 1PKGA 3GVUA 3CS9A 4WOVA 3UYSA 4C4HA 4D2RA 2IW9A 2WTDA 2G2FA 4RWIA 4ANNA 4MCVA 2YLFA 4IW0A 4U0IA 4HVHA 4I41A 2OU7A 3NUXA 3BU5A 3LXKA 3UGCA 1OPKA 2UZBA 4GEOA 3F69A 5T3QA 2GTMA 2I0VA 4KIKB 1J1CA 2C0IA 2ZMCA 3BLRA 4TPTA 5HIEA 1UU8A 4RJ4A 3PPZA 1OECA 4FTOA 3UQCA 2C1BA 4UYNA 3DB8A 5CSHA 4NKSA 5AV0A 3ET7A 5HU9A 2OGVA 1XH6A 5IG1A 4AA4A 5FQDC 4PPCA 4KIQA 3UVPA 2CPKE 2ZMDA 3VS2A 4FX3A 5KBRA 3RM7A 1FMOE 4GT4A 4GFOA 5DNRA 5J8IA 3CEKA 4TWPA 3VJOA 3G9NA 3UBDA 4O84A 3E88A 3LHJA 3R01A 2QKWB 4GYGA 4HYHA 2W1HA 4LG4A 4V04A 3VW6A 3F5PA 3RVGA 2XIZA 2J5EA 4CTBA 1GZOA 4YZCA 3DJ6A 4AOIA 3MYGA 3FJQE 4I1ZA 4R7IA 3ZO2A 3PVWA 2X9EA 4R8QA 5CU2A 2EU9A 2QOCA 4Q5EA 5TO8A 2YABA 2GTNA 2F7ZE 5HD7A 3VIDA 3GFEA 1M2PA 1YOJA 3IW5A 5BYZA 2YEXA 3HMOA 2WQNA 3FMEA 4PQNA 3NEWA 3QQKA 3VW8A 2JD5A 5EH0A 2VV9A 3ODZX 4J97A 4TNDA 5KO1A 2PTKA 2X39A 2QONA 4L7SA 4GKHA 4D2PA 1SVEA 2YM6A 3MJ1A 3DT1A 4BBFA 4AACA 2XNGA 3PJ3A 4OBOA 3DY7A 2OFUA 5L8LA 4C2WA 5HNGA 4FSZA 2EB2A 2UW6A 2BAQA 5CSXA 4JNWA 4O0XA 4A4LA 5KMLA 2A0CX 5B0XA 4G3EA 3FDNA 2QR7A 3WZUA 3GCPA 1OIRA 2ETMA 2WTCA 3JPVA 2BUJA 3I0QA 4L42A 3QTZA 4DTAA 2V62A 3GI3A 4FTNA 4FV4A 3CTHA 4G6OA 5IQFA 4EH5A 4NU1A 5E1EA 1Q8UA 3GNIB 3SLSA 4ZLYA 4NKAA 4RWLA 3FPQA 5GJGA 3TKIA 3MI9A 4GW8A 4GU6A 2XRWA 4B4LA 2WEIA 5J9YA 5FTQA 4A9YA 2OKRA 4L01A 1AD5A 1YWNA 5GNKA 5A3XA 3WE8A 3ITZA 3W18A 4JQEA 4O0YA 4XH6A 2JKQA 1SVHA 3I60A 3KVWA 3MTFA 4D9UA 3R9NA 2H9VA 5D9HA 2AYPA 5GINE 4O7TA 3LXLA 4NYEA 1DAYA 4FVQA 4QP8A 4CRSA 2PWLA 4XBUA 2XH5A 4UB7A 3SV0A 3LCKA 3Q6WA 3UYTA 4FL3A 2B55A 3OUNB 5AX3A 4RLKA 4E4XA 2Z7SA 4AGDA 2J2IB 5JRSA 2X7FA 5EHOA 1A48A 4ZK5A 4W4YA 3TKHA 1XWSA 2PUIA 3FSKA 2CKEA 2QOOA 1E9HA 2PK9A 3E92A 5HTCA 4I4EA 4JDKA 3KRXA 1CKIA 3QTWA 4KIOA 5HGIA 2HAKA 2QI8A 4FZ6A 4IAIA 5LARA 3JVRA 4FEWA 2WFYA 3A8XA 3E8NA 2JFLA 4IJ9A 3EFLA 3FLWA 4FKLA 3DFCB 5CZHA 2ACXA 2X2LA 4GFGA 4MD7E 3R2BA 4J8NA 1YXSA 3F5XA 5H3QA 3TKUA 3RPOA 4MVFA 4U9AA 2XBAA 4DGMA 2GFCA 4FTTA 2R2PA 1ZZ2A 3HX4A 3MH2A 1ZOGA 4EWQA 3Q6UA 4F09A 5BVFA 5KCVA 2FVDA 1NVRA 4K11A 1P4FA 4R3PA 3H4JA 3GCVA 4EH9A 5FP6A 4I0SA 4KS7A 4E1ZA 4O0WA 3FQSA 2J0LA 3KULB 5JSMA 2BIYA 4R78A 3NYNA 5EFQA 2PZYA 2UZEA 4CZUA 5HBHA 2BILB 3OBGA 1OUYA 4XV1A 4C4GA 3RK9A 3AD6A 5ANKA 1IA8A 3MH3A 3K3IA 4KRCA 3VS6A 4B99A 3I6UA 4MXCA 3DCVA 4AW1A 3C4FA 2B0QA 4C3FA 2ITTA 4AQCA 5HOAA 5L2WA 3ZLYA 1PMEA 2QOQA 4FT5A 4RVMA 3TCPA 3EQHA 2EWAA 4BCIA 3LW0A 4IH8A 4C7TA 5K0XA 4U81A 3TV6A 2X81A 3QZFA 1GY3A 3ORIA 3TTIA 2UW7A 2OO8X 3FBVA 2EVAA 5M4FA 2Z7LA 1FBNA 2HW7A 1GZ8A 4UXLA 3HV7A 4YPDA 2QLUA 3PPKA 2PVFA 2FH9A 2GMXA 2VTAA 5E90A 3SC1A 4L52A 4ZIMA 2QU5A 3QRUA 4FKGA 5M57A 3ORTA 1STCE 2WMWA 2G9XA 5AX9A 3NUPA 5JN2A 4K8AA 2EUFB 4C61A 4F63A 4AE6A 2I0HA 5E1SA 1G3NA 2F7EE 1TQIA 3ZFXA 4C4IA 1MQBA 4GK3A 1YWVA 1LUFA 3OC1A 4L7FA 5E92A 5F4NA 1SM2A 2JLDA 5C03A 3R8PA 4XCUA 2I1MA 5EHLA 5AAGA 3T8OA 5JGBA 4KKEA 5ANEA 4QTBA 4IDTA 3TT0A 3C9WA 4MNEA 1XBCA 2CGXA 2E9OA 4FV6A 1RE8A 2WAJA 3NNWA 5L2QA 4ACCA 4I22A 5DEWA 2B7AA 2UVZA 4TYEA 2YIQA 3WZEA 2XKDA 5AUWA 5M4IA 2XIXA 5B2LA 3WARA 5C8KA 4YJRA 3PVBA 5ANOA 2DQ7X 2RFDA 4FT3A 3V8TA 3HAVA 3D83A 3BKBA 3OOGA 3SW4A 3C4XA 3QC4A 3AC4A 5H2UA 3WE4A 2XB7A 2F7XE 2R4BA 2YDJA 3FZPA 3PA3A 3R21A 4XS2A 3G51A 2VGPA 2OWBA 2QOHA 2F2CB 2RF9A 4ONAA 4EH4A 5G1XA 3PA5A 3WBLA 4IFCA 1YI4A 3BBWA 4OTHA 4CTCA 5JMSA 4FIHA 4JAIA 3DGKA 5JZNA 4OTPA 3AD4A 1UU7A 3FKNA 2C47A 2YZLA 4QP9A 3F66A 3C0GA 3DQWA 1JLUE 2VX0A 2BDJA 3DKGA 3A4PA 3W32A 2Y6OA 3PLAE 3DBFA 3LXNA 5B7VA 3LVPA 1OL6A 4F1TA 4HGSA 3U6IA 1CTPE 3VS3A 4DGNA 3ULZA 3A7GA 4HGLA 3KXHA 3W8QA 4DTBA 2UW8A 5EW9A 4WUNA 3R7OA 1W8CA 4OT5A 1M7NA 5GZAA 5DYJA 4DE4A 1OBGA 3IKAA 4V0GB 4NJDA 1W83A 3EQFA 4BGHA 2V5QA 3BELA 4YP8A 2ZB0A 4H36A 4ZMEA 3MIYA 4CNHA 4FSUA 3ODYX 2OSCA 4EOOA 5FTOA 4Y72A 4BKYA 2B9HA 1NXKA 4TW9A 5J7HA 4G31A 5BNJA 3UODA 2QOLA 4AS0A 3DKFA 4DGGA 2J9MA 4K18A 4PPBA 3RNIA 3MY0A 2P4IA 4JR7A 3EZVA 4FYOA 5B2MA 3ID6C 4O7NA 3MA3A 2C68A 1JKKA 5CU3A 2CCHA 4R1VA 1OL2A 5CQUA 4RWJA 2OZAB 5CWZA 5DN3A 5IQHA 3GU8A 4CVAA 3KXMA 2UVXA 4RVLA 3LIJA 4RX7A 3GCUA 1U54B 4C4FA 1YRPA 3LLAA 3FSFA 3UMXA 4XP2A 3MB7A 3RP9A 4USFA 4N6ZA 3BBTB 4A4XA 4W8EA 5CU4A 4RJ5A 2HZ0A 4PP7A 3O8TA 1KV1A 3DOGA 3SOCA 3CKXA 3FEGA 4BDKA 4YNEA 3IOPA 2HY0A 3RPVA 4EZ7A 2O0UA 1ZYCA 1X8BA 5EYKA 5LMBA 4K77A 3Q4ZA 2XK7A 5KX8A 4RIYA 1Y6AA 3SQQA 5F9EA 4BKZA 4F08A 3F82A 2YZAA 4KWPA 4O0SA 4BTMA 3UQFA 4EK5A 3OWKA 3NUNA 5GJFA 3UIUA 5I5ZA 3OHTA 4CZTA 4C57A 5H9BA 2RL5A 2R3MA 2J50A 2LAVA 1JSTA 4XLIA 5E9EA 2PMIA 3UO6A 4U3YA 3TTJA 4WG5A 3A2CA 3A4OX 3AC1A 2J90A 3D2KA 4WSQA 4ZSEA 1F0QA 2WZJA 3THBA 2UUEA 3BHTA 5DRBA 2PU8A 4F9BA 2HXQA 3NUUA 4DEEA 4O7WA 2UZLA 2XK3A 4P4CA 5FRIA 4G3DA 1UKHA 4BTFA 4WO5A 4IJPA 2Y8OA 3DAKA 4E6DA 2OFVA 2YACA 3P4KA 3E8EA 3QKLA 4ZTQA 3ZCLA 5FM3A 4KB8A 4U8ZA 4X2FA 3AC3A 4RIWA 4MQ1A 4ARKA 4FEXA 1OKWA 3UOKA 2QURA 4LMUA 5LWMA 2F57A 5AM7A 2ITWA 3OD6X 2CKOA 5KHWA 3KFAA 4JDHA 2XF0A 3E8CA 4GRBA 4PUZA 3ZXTA 4MKCA 2WPAA 3KRRA 4YTIA 3QA8A 5I4NA 4FV9A 4IAFA 4FKVA 4O7SA 3CPCA 3NYOA 4L43A 4CMOA 4GS6A 4R1YA 4JG7A 3Q4UA 3EL7A 4GCJA 5DT0A 3O7LD 4IZ7A 5I3OA 3CTQA 3SRVA 3SA0A 2PE0A 4C3PA 4D1ZA 4EOSA 4QYGA 5L4QA 3QQGA 3MVHA 4HJOA 4OLIA 3ZSHA 2VTIA 3U6HA 5K4JA 3PRFA 2CNUA 3V5JA 3MA6A 4HNIA 3Q32A 4O27B 3I79A 4O0TA 4AT5A 3KK9A 1RDQE 5K5NA 4FIJA 4O0VA 4G6LA 1FGIA 2PYWA 2ZM3A 4LM5A 4RC3A 5HVJA 4BR3A 2WMAA 3ALOA 3CC6A 3TL8A 4AZFA 1A06A 2WD1A 5EQEA 4AUAA 1Y57A 5CVFA 4YJPA 3QUDA 3A7FA 4FE2A 4ZSLA 5AP7A 1XH8A 3G6GA 2A19B 5DVRA 3ZSGA 3KXXA 4AZSA 4ZTLA 1PMNA 5HG9A 4YHFA 4JOAA 5EM8A 2V0DA 3OOMA 5HCZA 4UWYA 3WYYA 3QGWA 4HPTE 5KMNA 4EWHA 3P0MA 5CVGA 3VUHA 5AEPA 2PMLX 2VWWA 4QOXA 2W5BA 5KMIA 3FI8A 1OIUA 4WA9A 5FBOA 3BYMA 1MRUA 4G1WA 3V01A 5D11A 5I9XA 1FOTA 3OTUA 4RIXA 5KBQA 2C0TA 3ZEPA 3S2PA 2IG7A 2P0CA 3NCGA 4BI2A 4KIPA 3ZC6A 1PW2A 4DH8A 4EONA 3V51A 3OFMA 3LCDA 4D55A 4ZZOA 3MJ2A 3ZRKA 3D7TB 3WIGA 4HCUA 3PDTA 3R2YA 4GIIA 3MFTA 4RPVA 3PSBA 5DOSA 3VRZA 4AA0A 4D0WA 5L6PA 5LVMA 3HKOA 4U40A 2OG8A 1ZYSA 2WMSA 5AJQA 1R1WA 3LPBA 3UP2A 3DBDA 2CKPA 4UMUA 4MF1A 4GK4A 3ZUVA 3G9LX 5L3AA 5AR3A 4F7JA 5HX6A 4FKWA 5C26A 2Z7RA 3D7ZA 3QBNA 4U79A 2BZHB 4IB0A 3U55A 1DI9A 4S31A 3RNYA 1KE9A 3KB7A 3JY9A 3FUPA 4RVTA 5DRDA 4IZYA 4ACGA 3W2OA 2PY3A 3F3ZA 4DGLC 3DNEA 5BMMA 5C9CA 1L8TA 3HAMA 3S95A 3ZMMA 3P1AA 4DBXA 3C4CA 3EFWA 3QQJA 2GFSA 4S33A 2WIHA 3UJGA 3W33A 3PA4A 2GNHA 2FYSA 3LQ8A 4FTCA 3WYXA 4ZP5A 5DG5A 1V0BA 1JOWB 2O3PA 4GMYA 5CU6A 4C4EA 3QQHA 4LQMA 2OH4A 2FB8A 3GC0A 4RVKA 4XP0A 4EL9A 5CEOA 4HZRA 5CU0A 4M68A 3R7YA 5A4TA 3R00A 4KBKA 4BDJA 1GNGA 1XH7A 2BR1A 3NIEA 4DC2A 3RBWA 3BHUA 3R1SA 2Z60A 3BGZA 3FC2A 3NZ0A 5AM6A 5BYLA 1Y8YA 3UNZA 5IUHA 5D7AA 5HORA 1OPLA 4RSSA 4JAJA 4FODA 3ZHPC 2CCIA 3MN3A 4PMTA 2IPXA 4WNKA 4FBXA 4FT7A 3UPXA 5CEQA 4DH5A 3VUIA 1PF8A 4DYMA 2EXCX 3MFUA 5GJDA 2XVDA 2YIRA 5CXZA 4FMQA 4FSMA 2GNGA 3O8UA 2C5XA 3Q9XA 2GSFA 3F2NA 3QYWA 4I5HA 4NM5A 4UYAA 4UV0A 5EM5A 4KUJA 4YMJA 5HBJA 1UA2A 5CXHA 2QD9A 5BUJA 3EQPA 3AMAA 3VBQA 3GOKA 5CALA 4J99A 5CAVA 3Q2JA 3DK7A 4X2NA 4CSVA 3CY3A 2OJGA 1JKLA 3FZRA 2XCHA 4EEVA 5KUPA 2C3JA 4J96A 2BTSA 2XK8A 3F3UA 3L8SA 2YFXA 1V0OA 3N4VA 4MD8E 4U3ZA 2X4ZA 4IANA 3VBYA 4FKRA 4DA5A 4ANSA 3HNGA 5FEEA 4YC6A 3PLSA 2DYLA 4FSNA 2R3GA 4ASEA 4CKRA 2WQBA 5IUIA 3H30A 1Z5MA 3DJ5A 3A8WA 3ZH8A 3LMHA 1WMKA 3VUDA 4PDOA 2AC3A 4G3FA 3QL8A 5BPYA 4RX8A 2HWOA 5HE2A 5LCJA 1I44A 3OWLA 5CI6A 2WOUA 2UZVA 4FG9A 4LRJA 5JGAA 2WELA 3BZ3A 2AUHA 5EHYA 4FIIA 4PWNA 4C36A 2W99B 4XHKB 4IX3A 5IQCA 3S00A 4Q2AA 5HVKA 3CIKA 2WQOA 1H01A 2QO2A 3O2MA 3POZA 2QLQA 3Q52A 5CASA 3M11A 2XRUA 2GU8A 3MV5A 5ANDA 4RGJA 5IEXA 1O6LA 2LGCA 4M3QA 2BDWA 4BICA 5J1WA 5LVLA 4DFXE 5IU2A 4ZJJA 5CANA 5M08A 3ATTA 4M67A 4G3GA 3Q9WA 4D4RA 1M7QA 5I9ZA 3KREA 3ZZEA 4ZTNA 4OTGA 3EZRA 3LFEA 2HW6A 5I9UA 2R3QA 5G6VA 5JT2A 3PE1A 2YIYA 4DINA 4R3CA 3LFFA 2PUNA 3QF9A 4YSJA 4O1PA 2X0GA 2REIA 4TNBA 4TWNA 3L9PA 1M17A 4HGTA 4CFXA 4UWBA 5HG8A 5HO7A 4PMPA 5BUEA 3BU6A 4FZAB 3EIDA 5BVKA 3NAXA 4QNYA 4FTUA 4LUEA 2PE2A 3LJ0A 3B8RA 4WG4A 5DT3A 1OIYA 3MVMA 3UP7A 4DT9A 3EH9A 5CAQA 2VTLA 2FSMX 3MTLA 5IA3A 3GQIA 2B1PA 1YHWA 2ZM1A 2QR8A 3OCBA 3VS0A 4Z3VA 5JFWA 4FV8A 3TXOA 2WMBA 3RKBA 4CFMA 3FMMA 2ERZE 5E8UA 3V3VA 4PL4A 3WIKA 4YC8A 3ZSIA 3PVUA 3RTPA 3U9NA 1ZOEA 4OTFA 2CN8A 2YHVA 4AF3A 4CV9A 3HV5A 4F0IA 3UZRA 3E63A 4IEBA 3PTGA 2I6LA 1GIIA 1O9UA 3QQUA 2R3HA 4YURA 3PXKA 2I7QA 1FVVA 3UIMA 4Z55A 3K3JA 2FO0A 1H26A 3R83A 3OCGA 4EK8A 4ZLZA 2C6EA 1ZMUA 4QP6A 3EQGA 3QU0A 4NW6A 3RHXA 5KMJA 2J6MA
chains in the Genus database with same CATH superfamily
3E93A 5HTBA 2IEWA 5CS6A 5J5TA 3PY3A 4QP1A 5L6OA 1URWA 4IX5A 4F0FA 4YTCA 4MXYA 3WZJA 2FA2A 4JJRA 4F9CA 2WTJA 3PJCA 3MFRA 3UIXA 4FKQA 3NUAA 1WBNA 4IVDA 1H25A 2X4FA 3QCYA 3UDBA 3QC9A 3PXFA 1M52A 3KCFA 4EJ7A 3FPMA 2HELA 5FM2A 2YCFA 2JDTA 1PXKA 3BX5A 3FMLA 3F88A 2GQGA 2OXDA 4NTSA 2BZKB 3KXNA 3F61A 3MH0A 3F3TA 3Q9YA 3MVJA 3ZYAA 1KV2A 2R3KA 4JXFA 3LZBA 4PY1A 5T68A 2ONLC 1BKXA 1ZXEA 2ZAZA 5AV2A 3EN6A 5AADA 1OVEA 2QODA 2W5AA 3ZZWA 5EK7A 4S32A 4CYJA 2BROA 5CTPA 3F6XA 4AE9A 3AG9A 4IDVA 2QVSE 3VO3A 4XUFA 3U87A 3NPCA 2O8YA 3TWJA 3UOLA 1HOWA 3FV8A 1QMZA 1VYZA 3IOKA 3ZLSA 4B0GA 4E6QA 3DAEA 2WXVA 3L8VA 4ZJIA 3V8SA 4C37A 1XH4A 4EK4A 5I9YA 2C5VA 3R7UA 3ZOSA 4C58A 4U41A 4ZTRA 1YOMA 4L68A 2ZB1A 3GU6A 5CZIA 4MXXA 4I92A 5AV3A 2A2AA 2C3IB 4PF4A 2VWUA 4UBAA 3RAWA 3AMYA 4FG7A 4UMQA 3WOWA 2PUUA 4QPSA 3VBXA 4APCA 5EOLA 1R3CA 3EYGA 4IFGA 5TF9A 5DE2A 1GIHA 5CY3A 3HMPA 5KZIA 3C4WA 1JWHA 3R7IA 5DFPA 5KKRC 1QPDA 5GHVA 3DQXA 3MS9A 5IQBA 1JSVA 2J0MB 2OLCA 3JXWA 3TJCA 4DFUA 4WBBB 1XR1A 3QUEA 4GFMA 3U51A 4ZXTA 5AV4A 2X0OA 4FVPA 5ICPA 5AUYA 4BF2A 4ZZNA 5CF6A 5GIOE 3C7QA 1OMWA 3TNIA 4I0TA 3A99A 3T9TA 4YHTA 2B9FA 2IO6A 4MEDA 5CAOA 2YJRA 4F4PA 4CT2A 5DT4A 1J91A 2XKFA 3M2WA 4A06A 2XS0A 3ETAA 4WNPA 4E4MA 5CF8A 5HKMA 4X21A 4ZLOA 5CI7A 4R5SA 3RPRA 1UNGA 4CRLA 4CFVA 3WZDA 2XJ1A 4EUTA 1PYEA 3DBEA 2XEYA 1Q8ZA 3QWKA 4JQ8A 5AP5A 4DCAA 2YIXA 1NT2A 3R8UA 1LP4A 4W4VA 5J7BA 1IAHA 4DHFA 4EZ5A 2QQ7A 3I5ZA 1R78A 3Q4CA 4OTIA 2CKQA 3BGPA 3KKVA 2KULA 2YCQA 3E7OA 3NUSA 5KMKA 4IM2A 4IAAA 1H1PA 2W0JA 3NR9A 5E8WA 3KXGA 2PE1A 2W1DA 2ETRA 4GT3A 3NMUF 3UVQA 3W0SA 5C8MA 2BDFA 2XA4A 4EH2A 3P86A 3HGKA 4H1MA 3DPKA 3QGYA 3VF8A 4BTKA 4YZDA 4FL1A 4NSTA 4LOPA 4R7BA 4Y85A 3UMWA 1J7UA 3FHIA 1TQPA 2YDIA 3E64A 2W9FB 4ZY4A 3ORZA 3QCSA 3T9IA 3Q9ZA 1PYXA 4JBVA 4EK3A 1PXMA 5A9UA 5CEIA 2FGIA 4HZSA 4K0YA 2P33A 4QTEA 3TZ7A 4NJ3A 5EW8A 3O96A 3UTOA 3AC2A 3I0OA 3VWAA 4I0RA 3QYZA 3O8PA 2YAAA 3G90X 1K9AA 1BMKA 2WEVA 4C02A 3W2CA 1J7LA 2PULA 3AKKA 1Q99A 3VS1A 3DB6A 5KZ0A 1YI6A 1YDSE 2RG5A 3W55A 1H4LA 4KAOA 2H96A 3O17A 4JBQA 4FV3A 4G17A 5JFVA 4LGHA 3ENMA 3EN5A 2BRMA 4G9RA 4IWPA 3L8PA 4MWHA 4PTEA 2J0JA 4BCFA 2CMWA 5BMSA 1U5QA 5LJJA 4ZSJA 4BDAA 2ITVA 2WHBA 3R9RA 4CG8A 3MSSA 4ERKA 2ERKA 4EOPA 3H9FA 4O38A 3MPAA 4D9TA 1TQMA 2Y0AA 4F99A 4TZRA 4Y5HA 4DEHA 1U4DA 4WNMA 4D4YA 4FEVA 3FL4A 4XRLA 1BYGA 3V5WA 3OMVA 4CEGA 2UZWE 3GC9A 5IUGA 1B6CB 2VO7A 4FTLA 3R0TA 4IWOA 3EFJA 5AWMA 4IADA 4DEDA 3IONA 2XNOA 3KMUA 1Q61A 3C4EA 1PKDA 2HK5A 4O83A 4WT6A 5DEYA 3HV4A 4C33A 4WSYA 5DWRA 3DKCA 3QRTA 2C6OA 4YHJA 1LPUA 1REJA 2XK6A 3P23A 3PPJA 3VUKA 4AW5A 2XANA 4DT8A 2HZIA 3OUKA 4R77A 2JFMA 5HIDA 4FA2A 2Y6MA 4UZHA 2PVHA 3VBVA 3JR1A 4TYHB 4PP9A 1JPAA 3OXIA 4ZTSA 4QTAA 5AIKA 1TFFA 2C0OA 3E87A 1XHAA 1PMUA 3VBWA 3W2RA 3HVCA 4BZDA 4CLJA 3QA0A 4O2PA 1ZY4A 3VRYA 2PVLA 4AXEA 2QO7A 3R8VA 2W1GA 2O63A 1P4OA 3H3CA 2ZV7A 3MW1A 4USEA 2PVMA 4RQKA 3DDQA 4JX3A 4DH1A 4YTFA 5HO8A 2WMUA 5DHJA 4D4SA 2DS1A 3UOHA 4FC0A 4MK0A 5IMXA 4GKIA 5A4LA 2XAOA 2UW5A 4YU2A 4DAWA 4NIFB 2R7BA 1YOLA 3DA6A 5A6OA 4BDIA 4XP3A 3HV3A 5HIBA 5GIPE 3NGAA 4TRLA 1OGUA 2G01A 2YISA 3NLBA 3PFYA 3Q60A 2A98A 3SXSA 4E5BA 3UQGA 4O7LA 2JAMA 2C6DA 2OJIA 4FIEA 3LCTA 3K5UA 5GZ9A 2OH0E 4O86A 5AFVA 5I0BA 4TL0A 4W9XA 1CKJA 4ANQA 4BZOA 1MRVA 4CZYB 2BZIB 1ZOHA 2J7TA 3DBCA 5ACBC 5CENA 3KL8A 3Q2MA 5AP4A 4ZTMA 3F7WA 2W05A 2G1TA 5L8KA 3E62A 1W84A 1WVYA 2WTWA 4L53A 5FEDA 2IW8A 2VWXA 1LR4A 3FKLA 4QYEA 5BVEA 2YIWA 3DAJA 3TG1A 4YSMA 4AAAA 5BUIA 3CJGA 3LE6A 2A4LA 2W1CA 3M42A 3NYXA 3QTSA 4XG8A 3ZO1A 4HVDA 5J5SA 5E4HA 4QO9A 1WZYA 4FOCA 1YWRA 2HZNA 3E7VA 3MY5A 5FG8A 3V04A 4HYSA 2BHHA 1TZDA 2BFXA 2OIQA 2UW4A 3LFSA 4LL0A 3QTIA 2JITA 3KRJA 3QKMA 5CT7A 5DIAA 2WMVA 1GOLA 4YZBA 4FIFA 3UNJA 1JVPP 2QC6A 4NFNA 4W4XA 5FGKA 3QTXA 4FV5A 4A9TA 4M69A 4EKLA 2JC6A 2VWIA 3DLZA 5EYMA 3ROCA 4ACDA 2B53A 5HG7A 4DLJA 2GQSA 3QTUA 4FTKA 4MH7A 2FSLX 2P2HA 1FGKA 5JRQA 5ANJA 5B2KA 1PXOA 2G2IA 3UG2A 2V22A 1OKYA 4DG0E 2QHMA 4BGGA 1OI9A 4IAZA 3PXZA 3WF7A 1YHSA 4GH2A 5EI8A 5TE0A 4BCQA 2IZSA 3U9CA 4RFZA 4J53A 4WRSA 1H1SA 4HYIA 5AA9A 3MGYA 5ETAA 1YI3A 5H8BA 3LMIA 2FUMA 5IEYA 2YM3A 4JVGA 3BHYA 1BL7A 3FLZA 1PXLA 4OGRA 3DZQA 2VUWA 1IR3A 2PHKA 2VTMA 2B9JA 3G2FA 1YXUA 1SNXA 3G5DA 3GC8A 4QTDA 2VD5A 5HHWA 5FXRA 3MPTA 5J79A 1ZYDA 2C6MA 2W1ZA 4GJ3A 3ORLA 4L3PA 3RK5A 3WF5A 4OR5A 3BU3A 3R30A 3WZKA 5J9ZA 3P7AA 2Z8CA 3BPRA 5M44A 1RJBA 1UNLA 4LDTA 3HYHA 4XG6A 4EHZA 3OXZA 1BL6A 4E73A 4JRNA 2CHLA 4QMMA 2RIOA 3VUMA 5IPJA 4U44A 4X2KA 1DAWA 3ZUUA 4Q9ZA 3F2RA 2Y4PA 4D1SA 5DLSA 4MTAA 3IG7A 4XOZA 4I6FA 3FC1X 1H1WA 5DPVA 4EH8A 4ID7A 1VLRA 2ETKA 3ML1A 1H00A 1F3MC 3TN8A 5DR6A 5C1QB 3H0ZA 4AXAA 3NX8A 5HBEA 4ASXA 4Y83A 3L8XA 4O81A 3VHKA 3FXXA 4OTDA 2YDKA 3FMJA 2IF8A 2X6EA 1JAMA 1YDTE 2OXXA 4X6RA 1H27A 4TKSA 4DG2E 4I5PA 4DFYA 5I9VA 5HX8A 2IW6A 3EB0A 4LI5A 4JT3A 2PZPA 4JG8A 5J95A 1H1RA 2CJMA 2X8IA 4X3FA 3MY1A 2C4GA 2BRHA 4GYIA 5HICA 4O4CA 2VO3A 2ZM4A 3NNVA 3QD3A 3GOPA 4IE9A 4NUSA 4XG3A 1Q3WA 4NTTA 3W10A 3SAYA 4FNWA 4C3RA 5JEBA 3ZRMA 4RQVA 3RK7A 5HTIA 1NA7A 3VHEA 4D2TA 5HZNA 3AC8A 3PUFC 2RGPA 4KKHA 2W06A 4IZ5A 4QMVA 2YM5A 3OW3A 3TEIA 2VTNA 4YJSA 3HP5A 3PIZA 3FI3A 4XRJA 4N6YA 4Z7GA 3IDPA 4BRXA 3EYHA 5AUUA 3MPMA 3FZTA 5FWKK 1ERKA 1ZY5A 4ITJA 2JIIA 2ZDUA 4Y5QA 3N9XA 2R5TA 5F1ZA 1UVRA 3TDVA 5L2TA 4AQKA 2BAJA 2BAKA 1JBPE 2VAGA 3CQEA 4I93A 4U6RA 3RWQA 3UZPA 4DFLA 5FDPA 5ITAA 4D2SA 1J1BA 4ANBA 4BKJA 2O5KA 2VWYA 4XNEA 1H0WA 4CT1A 4EOQA 2JBPA 2HIWA 2J0IA 3B8QA 3NAYA 2GNIA 3LAUA 3FLYA 2W9ZB 4F1OA 2RKUA 4EHEA 4GG7A 4G34A 4F78A 3BYUA 3O50A 3I6WA 3WF9A 4AN9A 4G16A 5JQ5A 4QMOA 4DITA 3G6HA 2WTKC 1OL7A 2UVYA 4XX9A 4EK6A 4ALWA 5E8TA 2XBJA 4ACMA 4J8MA 5K9IA 5JFSA 4FSQA 3MDYA 3LJ1A 4OUCA 3I7BA 3ZO4A 1T45A 2WQEA 1ZRZA 4KSPA 2VTSA 3UO4A 4LV7A 3L1SA 4RMZA 1DM2A 2GDOA 4TYIA 4AP7A 3TUDA 2BMCA 3ZRLA 2QG7A 1VEBA 5EYCA 4LGDA 5FBNC 3H9OA 3U6JA 4G3CA 4GU9A 4WBOA 2JDVA 3D2IA 1UU9A 2W1EA 4W8DA 4RFYA 2UZTA 2A1AB 4RIOA 4WKQA 4YC3A 1UKIA 4ZOGA 1M14A 3FMKA 4LGGA 3WF8A 3EQRA 1GZKA 4CGAA 1O6YA 3KIOC 4E5AX 4ENXA 2BRNA 2C5YA 2BKZA 3IO7A 3PJ8A 4J7BA 3R63A 5FLFA 2X8EA 3VNTA 4BN1A 4UZDA 1H07A 4IXPA 1S9JA 3QLGA 4NK9A 5CVHA 4DLIA 3TV7A 4FSRA 1URCA 2JKMA 5CT0A 5CSPA 1ATPE 2V55A 2QO9A 4QT1A 3RJCA 3W0MA 4O6EA 4A9RA 3FAAA 3RHKA 4CKJA 3IQ7A 4GG5A 5FEQA 3PZEA 4AGCA 4S34A 4MNEB 2ITYA 1XKKA 1AQ1A 1UWHA 2JKOA 3MB6A 5CEMA 3T3VA 4RJ3A 1W98A 1FVRA 3JS2A 1U46A 3ZS5A 2WOTA 3ANRA 4IWQA 4JX7A 4Y8DA 3C4ZA 3HECA 1MQ4A 4D2VA 5AP0A 2GS2A 4QDVA 2XIYA 3FZ1A 3P08A 3V6RA 2UW9A 1K2PA 3UDZA 1QL6A 3ACKA 1CM8A 1Z9XA 4D5HA 4XBRA 3KEXA 2QOBA 5E91A 2XNPA 4AOTA 4AN2A 5FUTA 4BC6A 4HVSA 2WU7A 1QPEA 3FYJX 4HYUA 2PZRA 3W1FA 2Q0BA 3FI4A 5JFXA 5IA5A 4ANLA 4QMSA 4FKOA 1BI8A 4IC7A 3R1QA 3NYVA 4LFIA 2PMOX 4QMXA 5IQDA 4BDEA 4I20A 3DXNA 1KSWA 4II5A 5IKWA 2I40A 3N51A 3BQRA 3PIXA 3QRIA 3O7LB 3JVSA 4KIKA 4NWMA 4EH6A 4QQTA 1QPJA 4G5PA 3Q4TA 4N70A 4BCMA 1RQQA 2OIDA 4BIEA 2RFNA 3QD4A 2VN9A 2XK9A 3I7CA 1Y8GA 3D0EA 4TYGA 4I6BA 3KN5A 3RMFA 3PY1A 3AGMA 5BQ0A 3A61A 3EHAA 4LMNA 3VUTA 3FHRA 5FP5A 1T46A 4CFFA 3U4WA 4FG8A 1TKIA 3A62A 2X0QA 4FVRA 4K6ZA 3QRJA 1JKTA 5AP2A 2W4KA 3JUHA 4QMYA 4KS8A 4DTKA 1F5QA 4X3FC 4FF8A 2HWPA 4JDIA 1ZARA 3LM5A 3GQLA 1VYWA 3R71A 1OL1A 2NPQA 4JLCA 3W2SA 5HO6A 4QQ5A 4RJ8A 4EOMA 4XG9A 2ONLA 4UEUA 2YWVA 4QMZA 4AT4A 3LFNA 4HCVA 3EQBA 4DEAA 4NFMA 3ZDIA 1KOAA 4PX6A 4IWDA 5CF4A 3JYAA 5D10A 4F0GA 4AN3A 4D28A 5HQ0A 4DF3A 3KF4A 3A7HA 5KMOA 3EMGA 3ORPA 3P5KA 5IA1A 5M4CA 3IGOA 1GAGA 2VO6A 3W0NA 4BGQA 4U42A 5LVPA 3PWYA 4BCGA 2PZIA 2R0IA 3Q53A 3VN9A 4ACHA 4CQGA 3E8DA 4RA5A 4L67A 1BLXA 3SG9A 1WBPA 4X3JA 1P2AA 3SOAA 2GS7A 4UXQA 1PXPA 3QAME 3DK6A 3NW6A 2JGZA 5ETIA 4F6SA 3FWQA 2GHMA 2X8DA 3IECA 2YM8A 5M55A 2A27A 1ST4A 1KUTA 4JBPA 3EN9A 4O7RA 3SW7A 4G5JA 3V6SA 4FGRA 3KA0A 4O2ZA 3GBZA 3FXWA 4RIYB 4BBMA 3QCQA 4EJNA 1LEZA 3CTJA 3DJ7A 4I94A 2XNBA 3P9JA 3DXPA 1PY5A 2I0YA 3BI6A 4HPUE 5J1VA 3LCSA 4AT3A 5EKOA 1YXXA 5M09A 1YXTA 3R28A 2Y4IC 4TT7A 2QOKA 2ZDTA 4AW0A 4JR3A 2Q83A 5AIRA 4XLVA 5E8XA 1ZWSA 3LJ2A 4KBAA 4M84A 5HE1A 4UN0C 3MFSA 1Q8TA 5CEKA 2C30A 3R8MA 4AAYA 2CLXA 4FUYA 1OM1A 3RAKA 2VGOA 2IWIA 1WFCA 4I21A 5GZ8A 4O91A 2E2BA 3QCXA 5AP3A 4BDHA 4RWKA 4A4OA 4D1XA 1W7HA 2WMQA 3N4UA 4B8MA 2XUUA 5IMEA 2PVJA 2VNYA 4NCTC 2Z02A 5EI6A 4RIWB 1PJKA 5AAEA 4HNFA 3QTRA 3GENA 1OGYA 4LRMA 3WILA 2R3PA 3POOA 4QYYA 3ZM4A 3F2AA 3HUBA 1Q8WA 4KINA 2QKRA 4NEUA 4QYHA 4D5KA 3ZXZA 4CD0A 2WIPA 3E5AA 4I23A 4U43A 2OK1A 2X9FA 3MBLA 1ZMWA 4NH1A 4D0XA 4PL5A 4DEGA 3WI6A 3R02A 1WBOA 1B38A 3SRVB 1AGWA 2GCDA 2JDSA 2CSNA 2IVVA 2WQMA 3OF0A 4U45A 2O65A 5E7RA 4ANMA 3TMOA 4R5YA 4M15A 2GS6A 2HY81 3KULA 1ZYLA 4LV5A 4FKPA 2JIVA 4FUXA 2BTRA 3VAPA 3EQDA 2VWBA 2Y9QA 3C51A 4NZWB 4FKSA 2UZUE 1L3RE 3GXLA 4FNYA 4FEUA 4QMUA 1KE7A 3B2TA 4J1RA 2CDZA 4RZWA 3GB2A 2P2IA 3IW6A 3IW4A 5DH3A 3RCJA 4BDCA 3AKJA 5CSVA 4DDGA 4QP3A 3VQUA 4IMYA 1MRYA 3OY1A 1P14A 2XCKA 3CD8A 3AT3A 2IVTA 2BZJA 3KQ7A 3FYKX 3KN6A 4N4SA 1CDKA 3LFQA 5JKGA 3EL8A 4CCBA 1PMVA 4ZS0A 4QPAA 4BIDA 4O82A 4F7NA 1PXNA 4L3JA 3L9NA 5L6WL 3TNPC 3GC7A 4TN6A 3SGCA 3SD0A 1S9IA 3I1AA 4NM0A 2X2KA 2ZJWA 3OWPA 4IB1A 4QRCA 4F65A 4HVGA 2F2UA 4FTQA 2GPHA 4U97A 3UC4A 4H39A 5ETCA 4GVAA 3V8WA 3ORKA 3UG1A 4BYJA 3ENHA 1FPUA 4MF0A 4P5ZA 3ZEWA 3QZGA 1H8FA 4RIXB 1R0EA 5EQYA 3FY2A 3IGGA 3NWWA 3PG3A 4L3LA 3NCZA 4CMTA 5K5XA 2NP8A 4BY9E 2WTIA 2BRGA 2VTJA 4OBPA 4RG0A 4USDA 4L6QA 1IA9A 4CV8A 3OT8A 2BRBA 2JBOA 3DFAA 5HI2A 2V7OA 2C5OA 2QG5A 2ESMA 2R3LA 5TKDA 4OW8A 4BCNA 1SMHA 3QFVA 4WG3A 2P3GX 4Y95A 3SDJA 3OY3A 5HLPA 3KRWA 4B8LA 4FK3A 4G6NA 1YQJA 5EM6A 3LFBA 4G2FA 1KE8A 4DDIA 2YERA 3QX2A 1HCKA 2JDRA 4J95A 2XEZA 3ROYA 3QWJA 1FVTA 4DH3A 4ZTHA 4O0UA 3TZ8A 3PRIA 5A4CA 3HLLA 3TZMA 3O23A 4IZAA 5AR8A 3REPA 3UE4A 4BTJA 3QD0A 4PMMA 3COMA 3FZOA 3PXRA 4E3CA 5AR2A 1H24A 1VJYA 3HEGA 3NNXA 4ALVA 3UO5A 4TWOA 4N57A 5EYDA 4O21A 4FGBA 3KRLA 1P5EA 3CCNA 4J71A 4PRJA 2BFYA 2XM9A 3H0YA 4IAKA 2X7OA 2UV2A 4FZ7A 4OAVB 4FL2A 3SVVA 4MXOA 4LV8A 4KABA 3DDPA 4XG4A 4AU8A 4IQ6A 4EI4A 4BDBA 4RZVA 2J0KA 4C4JA 4QPMA 3U4UA 5AUXA 1JKSA 3BHVA 3HL7A 1OITA 4JQ7A 5AAFA 3ALNA 3UVRA 3BEGA 4BL1A 4AXFA 1WBTA 4FKJA 3BL9A 3BYSA 5IQIA 1QCFA 1DS5A 3W0PA 3KK8A 3V5PA 4F6WA 1XMMA 2CNVA 3PXQA 3S0OA 4ZEGA 2ZV9A 5CAPA 3W0QA 3BEAA 1SZMA 2J5FA 5BYYA 4V0GA 2WMXA 4CFNA 1KE6A 3NNUA 3FMNA 4LOQA 4JRVA 3SXFA 2ZV8A 4EQCA 3I5NA 2BHEA 3ULIA 4EC9A 2X2MA 4BIBA 3SXRA 4BFMA 2YITA 2W17A 3C5UA 3VVHA 3KC3A 2VNWA 5JGDA 2OF2A 5H8GA 5EI2A 4PTGA 1OUKA 4BDFA 3Q96A 3PG1A 4ZS4A 3QALE 4IAYA 3UIBA 2JAVA 4J52A 4PL3A 5HESA 4RBLA 1KOBA 4OAUC 2DUVA 2OJ9A 3GEQA 1VR2A 3D5VA 2OZAA 5K3YA 3DNDA 3OVVA 2E9PA 3SHEA 5JH6A 3G33A 1BX6A 2C3LA 5E8VA 2VU3A 3BQCA 1WCCA 1U54A 3ZLXA 5I3RA 2KTYA 2PUPA 3LFCA 1MUOA 2W4JA 3HMIA 4DFNA 5KKRB 4HW7A 4YO4A 3R1YA 2OIBA 3HRCA 4XEYA 5BVOA 3R22A 1APME 4QTCA 4R6VA 2E9UA 2EXMA 3VUGA 1GIJA 3L9LA 3ERKA 2BIKB 2XJ0A 4QMPA 2F4JA 4MXZA 4EBVA 4F1MA 3IW8A 4QYFA 4C8BA 4R3RA 4DG3E 4XOYA 5CF5A 4UWCA 4TY1A 3VC4A 5JK3A 2VTOA 2R3NA 3QRKA 3R9HA 5E8ZA 5A4EA 5HNIX 5AMNA 4E93A 5HCYA 3RALA 4I5MA 4LUDA 4G9CA 2VTTA 4L46A 1QPCA 4C35A 2DWBA 3KMMA 5TOZA 1FMKA 5LMAA 2OBJA 3F3VA 5M4UA 4EZ3A 2G15A 3ANQA 4U5JA 3MESA 5A6NA 3HMMA 3DTWA 4CCUA 1BI7A 4JDJA 4MAOA 4O4EA 2WMTA 3HA8A 2Y7JA 2RG6A 5C8NA 4E4NA 4NM3A 2VX1A 3CSVA 1W82A 5IEVA 5CSWA 2VTHA 3T3UA 3RZFA 4DCEA 3NVKI 4ERWA 2NNWB 3W2PA 5D1JA 5LMKA 3O51A 4PTCA 2YLEA 3RWPA 4L9IA 1Q97A 4K1BA 4AG8A 2HZ4A 3ZFMA 3UZTA 3IDCA 5HCXA 4RRVA 3M1SA 4OTQA 3PSCA 1ND4A 4IVAA 3COIA 4YZ9A 5TR6A 5BVDA 1NY3A 5CYIA 4I6HA 4MD9E 1ZYJA 4BWXA 3PUPA 5AR5A 3W0RA 4IB3A 1SVGA 4Z9LA 2BCJA 5FXSA 3BLQA 2QNJA 4F7LA 3MVLA 5DBXA 5AA8A 5EDQA 3F7ZA 3RINA 2XAMA 2PMNX 2XNEA 3E3PA 3PP0A 3FL5A 4E6CA 4NL0A 4U80A 2AC5A 4EC8A 3VQHA 4MBIA 4QMNA 5IA0A 2IVUA 4MHAA 4CYIA 2F9GA 4O0RA 2YJSA 3F5UA 5EKNA 3IS5A 2FSTX 2IZRA 3TJDA 5KNJA 4FNZA 1OB3A 2R0UA 1R39A 4L8MA 3EOCA 2PSQA 3EFKA 4UALA 4AZTA 3HMNA 3R6XA 1IASA 4XG7A 3IPHA 5F20A 3LM0A 5FXQA 2B52A 5EG3A 3S3IA 2JIUA 2WO6A 4QNAA 1R0PA 3C13A 3VBTA 1XH5A 5CLPA 3ZU7A 5TT7A 4K9YA 3WF6A 4FSYA 2UZNA 3UOJA 1Q5KA 4X0MA 3DBQA 3PSDA 3TNHA 5KHXA 4EHGA 4YLLA 1UWJA 5H8EA 1XJDA 5IH6A 4IM3A 3FQHA 4QD6A 4S30A 4CG9A 1OKVA 2ZYBA 4APPA 3BV3A 4IC8A 1WBWA 4AGWA 3RAIA 3CE3A 4EORA 2WB8A 3A7JA 4M97A 3B2WA 3QZHA 4I24A 4Z16A 5L2SA 3EKKA 2QHNA 2X0PA 3CGOA 3BWJA 4WD5A 4O7YA 3KGAA 5F94A 2CLQA 1XBBA 3BLHA 4RX9A 1FINA 1JQHA 4YNOA 3LLTA 3ZM9A 3NDMA 3PXYA 2HXLA 1YW2A 3P78A 4I6QA 3D7TA 3NW7A 4NM7A 4XV9A 1CSNA 4GIHA 3R8LA 1SNUA 4EH3A 3IK3A 3CPBA 4QMTA 5JZJA 3DS6A 4AA5A 3PE2A 3FI2A 3D14A 4CFUA 5FDXA 2W4OA 3RPYA 3CY2A 3UDSA 4EOIA 3P7BA 5J87A 3K2LA 5AV1A 4WRGA 1I09A 4F7SA 4RFMA 5CNNA 4H58A 3ZBFA 4O96A 4CKIA 4ZY5A 4FT0A 3VS4A 1YHVA 4EOLA 3TUBA 4FSTA 5AUZA 4AFJA 4FI1A 5DA3A 4AZWA 4XMOA 3BGQA 3P79A 4ANOA 5LWNA 5IZFA 1Q3DA 2IVSA 3LMGA 3Q5ZA 4UMPA 3TUCA 4L45A 4ZY6A 3RGFA 2IZUA 4C34A 4E7WA 3KU2A 2HCKA 5HG5A 4W9WA 3TIZA 4MXAA 2V7AA 3HRFA 5K4IA 1G8AA 1J7IA 2NYAA 2C5NA 1OL5A 3U8WA 4ENYA 4K2RA 3G15A 3ZBXA 1W2DA 1Q4LA 2XKEA 4H05A 3OXTA 3D5UA 3QQFA 4XV3A 3EN7A 3QXOA 3BV2A 4I4FA 4HVIA 4BYIA 5A4QA 4QEBA 2IZTA 3BCEA 5ANIA 4BDDA 1GZNA 4M12A 5IA4A 1PRYA 4TWCA 5AP1A 1NVQA 4B7TA 4F6UA 2BPMA 3K54A 5IDPA 3Q3BA 1WAKA 3RPSA 2OZOA 3GU5A 4ASZA 2SRCA 5AR7A 4FTIA 4KRDA 4V05A 4EKKA 2J4ZA 4BVUA 2W7XA 3ZLWA 4PMSA 3DK3A 3KCKA 1XQZA 2VO0A 3RI1A 4BI0A 5LQFA 2C6LA 4JI9A 4WUAA 4H3BA 1OKZA 5CQWA 1LEWA 4YO6A 2B4SB 3F9NA 2OF4A 5IA2A 1IRKA 1UV5A 2RFSA 2XYUA 4FIGA 3NW5A 2Z2WA 3QHWA 1Q8YA 3SX9A 1YDRE 5LMKC 1NW1A 3BYOA 1VZOA 4J98A 4ZJVA 4MBJA 5ETFA 1GJOA 4L44A 4M14A 4QMWA 1UNHA 2H34A 3TI1A 4AZVA 4BCPA 4O7ZA 5C4KA 1OBDA 2PVNA 4H3PA 4GUBA 4CFWA 4L00A 5CAUA 3HRBA 4FTMA 3NS9A 4JG6A 3AGLA 4F9AA 2FSOX 4EBWA 2EB3A 5EOBA 2R7IA 3TIYA 4D58A 3V5TA 3AT4A 3PVGA 5A14A 1ZMVA 4FSWA 2ZVAA 1RW8A 2PVKA 3F5GA 2NRUA 4LL5