4D4SA

Focal adhesion kinase catalytic domain
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
272
structure length
255
Chain Sequence
YEIQRERIELGRCIGEGQFGDVHQGIYMSPENPAMAVAIKTCKNCTSDSVREKFLQEALTMRQFDHPHIVKLIGVITENPVWIIMELCTLGELRSFLQVRKFSLDLASLILYAYQLSTALAYLESKRFVHRDIAARNVLVSATDCVKLGDFKLPIKWMAPESINFRRFTSASDVWMFGVCMWEILMHGVKPFQGVKNNDVIGRIENGERLPMPPNCPPTLYSLMTKCWAYDPSRRPRFTELKAQLSTILEEEKLQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords FOCAL ADHESION KINASE 1
publication title Allosteric Regulation of Focal Adhesion Kinase by Pip2 and ATP.
pubmed doi rcsb
source organism Gallus gallus
total genus 79
structure length 255
sequence length 272
chains with identical sequence B
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2014-10-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4d4sA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4d4sA01
3LCKA 4IM0A 4EZ5A 4NK9A 5KUPA 4I5MA 4DFNA 3QCXA 3UQFA 3QC9A 4DFZE 2VTAA 2CLXA 5D7AA 3W2QA 3R9RA 3RKBA 4KKGA 2WOUA 4K0YA 5AR2A 3RHXA 4GFMA 4DLIA 4E4NA 3L9MA 2GTMA 4ZZNA 4DT9A 3PRIA 4QMPA 4NSTA 4GCJA 4ANSA 4GT4A 2OXYA 3ZLSA 2DQ7X 3HV3A 3BKBA 5I0BA 5TR6A 4IZ5A 4BDDA 2X2LA 4CCUA 4U5JA 3F5PA 4YP8A 5HE2A 5IQGA 4G9RA 2IN6A 5IQIA 4NCTA 3GCPA 4FNYA 5CZIA 4FNZA 5KZIA 4S33A 4ANNA 4G3EA 4C59A 3JR1A 1WBPA 4C4HA 4C33A 4U43A 3AC3A 4RFMA 3AD4A 4JL9A 5L2QA 2BTSA 4CRSA 1YOJA 3FDNA 4D4RA 5AUZA 4CLIA 4CVAA 3M1SA 4BCOA 2ZV2A 3EN7A 4TWNA 5IQCA 2AC3A 3QL8A 1JBPE 4I93A 5J9LA 2GNIA 3AT3A 3RNIA 5BYYA 4EOQA 4QTAA 1Y6AA 1YXSA 4QQ5A 4NT4A 2B9HA 3CR0A 4EOLA 3D5UA 3QZHA 4L8MA 4C3RA 2YAAA 4CMOA 4FYOA 3AXWA 2JKOA 4LM5A 2V7OA 4FG7A 1KE5A 4UMTA 1IRKA 4JQEA 3TNHA 1QPEA 3DDQA 3I4BA 2ZVAA 1WMKA 3G33A 3VBYA 2C1BA 3R7EA 3R04A 4KIKB 5DT0A 4BIBA 4KIPA 5ANGA 5G1XA 3LFFA 4PUZA 3FMLA 4BB4A 4FV9A 1R3CA 5HU9A 1ZOHA 5IH4A 4LL5A 4WG5A 3ETAA 5DFPA 3OTUA 5K4IA 4Y73A 1UNHA 4GU6A 2XK6A 3QD2B 1UU7A 1PW2A 4NW6A 3CSVA 2BALA 2BROA 2ITZA 4KKEA 3G5DA 3MWUA 4M15A 3LMHA 5FBNC 4S30A 1ZAOA 2IZSA 4ANQA 4L67A 4IVBA 5ACBC 2WPAA 4G17A 2QO2A 3DZQA 4Y8DA 5CYIA 4F09A 2VTHA 3DXPA 1K3AA 4XH6A 5DE2A 2GNJA 4G5JA 4FV0A 3W8LA 4WNOA 4YJOA 4QYYA 4R7HA 3V5QA 3BBWA 5E91A 3MVJA 1U46A 4ACMA 2AYPA 4BC6A 2BZKB 4RRVA 4MNFA 3FUPA 2JBPA 3JY0A 3MV5A 3EFLA 4U9AA 4A4OA 5CS6A 4X2KA 3ZC6A 2WTWA 3E8DA 4FVRA 3EZVA 2BRMA 2JIUA 3PY1A 4AGWA 3NUAA 5D41A 3UMXA 4AS0A 5IQHA 1CMKE 2FVDA 2QD9A 2W5HA 2WTVA 3Q9WA 4FA2A 2CGVA 2RFDA 4BZOA 4D5KA 4PP7A 2BIYA 3FKLA 3MW1A 4USDA 2BFYA 4BZNA 3TDWA 3O2MA 2VWYA 3BHUA 4ZAUA 3QQLA 3GBZA 4X3FA 4XUFA 3WIKA 4CMTA 4GT5A 5FM3A 2OZAB 4YBJA 3JVRA 4FV8A 2CSNA 4U3ZA 4TKSA 4D2WA 4OT6A 3ZLWA 1MQ4A 4EBVA 3POZA 2X1NA 5IA2A 3PA4A 4BI1A 3NNWA 4MBJA 3V8WA 3FMMA 3A8WA 3OBGA 4MQ2A 4QP9A 3ZONA 2G2HA 3LCDA 3RWQA 3ZSHA 1OL2A 2CNQA 1FGKA 3Q52A 3SG8A 3QTUA 3P1AA 3TKHA 2B53A 3DAJA 4C02A 5EM6A 3OFMA 3PP1A 4GK4A 3I60A 4KSQA 4QTCA 2J0JA 3FMNA 4CT2A 4BGGA 2XIYA 2ZV8A 2ETMA 3IECA 3LXNA 4GEOA 4L43A 4UMUA 5IH5A 3JS2A 3HMOA 3IO7A 3RAKA 3ZRMA 3GGFA 4RIXA 2F7ZE 4AOTA 4X21A 3AGLA 1OZ1A 4KD1A 4AGDA 2J90A 4P5ZA 4DH3A 2IW6A 3I81A 3R83A 2W06A 4FSMA 2VO6A 5E8TA 2W5AA 2WIHA 2RFNA 3PP0A 4RFYA 4YPSA 3QA0A 3U55A 2VTJA 2XP2A 4GK3A 3PPKA 5BVOA 3LHJA 1JVPP 2UVZA 3CTJA 4E1ZA 2V22A 3DBDA 2I0EA 3QD4A 4QYEA 5CF4A 3MY1A 3VC4A 3R30A 3EQHA 3FZSA 2WTKB 2B9FA 3PIZA 1MRVA 3P79A 1FMOE 4C4GA 4M69A 5L8JA 3FPMA 3W18A 3FYJX 3BZ3A 3U6JA 4CRLA 2BCJA 1YDTE 2YWPA 2CNVA 4C2VA 2WMVA 3SXRA 4AN3A 2XA4A 4A7CA 4YZCA 2WZJA 4J1RA 1H27A 1QPDA 2F7EE 1GZKA 4YSMA 5EOBA 5K0XA 3EL8A 1UKIA 4O0TA 5E8ZA 2JITA 4KBCA 5B2MA 5IEYA 2JKMA 3GI3A 4ANLA 2R3LA 2CHLA 4RA5A 4F08A 4IAKA 3UC3A 2QKWB 2UZOA 2VX3A 3S1HA 3NZ0A 4ZTSA 4KSPA 4I1ZA 3ZSGA 5CSWA 5CEIA 3Q5ZA 4M12A 5EYDA 3PVBA 4KRDA 4YJVA 3LFDA 4HYSA 3KL8A 3H4JA 3L9NA 3UZRA 1YXUA 4P4CA 3WE4A 1GY3A 3F66A 4RLKA 4CG9A 1CTPE 3PY0A 4O7YA 4FKSA 3FI2A 5LWMA 5FTGA 3A62A 3L8XA 3FXXA 3QCYA 1FOTA 2OICA 2UW4A 3MA3A 4L45A 2R7IA 3UOKA 1BI8A 3MH3A 5A46A 4PDOA 5LVMA 1ZMUA 4JDKA 4ZJJA 5D9HA 4GRBA 3S4QA 3QZGA 1R0EA 3NW7A 4KWPA 4QRCA 4ZJIA 3RMFA 4AAAA 5JQ5A 3QBNA 2OG8A 4K6ZA 3D5XA 3E64A 5JGBA 5I9XA 2UZDA 3P7BA 2OFVA 5T68A 3RK5A 3BQRA 4MWHA 4JR3A 3MVMA 4H39A 3OG7A 3W32A 3ANRA 2Z7RA 4BDKA 5EKOA 3DBQA 3HEGA 1RE8A 3KULB 4XBUA 2J5EA 4G6OA 4GUBA 4OTFA 5IDPA 2YIXA 3RNYA 5L2IA 3F3ZA 4N6ZA 3U9NA 3SD0A 3IGGA 5AP4A 2RSVA 3KXNA 3HYHA 4U6RA 2FSOX 4L52A 4IX4A 5HGIA 3VN9A 4CXAA 2KTYA 2W1GA 2YZLA 5J5SA 2FSLX 2Y4PA 3MBLA 5CF6A 4BWXA 3OC1A 3DQWA 4WUNA 4G6NA 1JLUE 4I0TA 5IUIA 4S2ZA 4QYGA 2I1MA 3GOKA 3UOHA 3VHEA 4Z55A 5CSXA 1H00A 2C6KA 2XMYA 5A4LA 5BNJA 5LMKC 5AV0A 3NUXA 2XS0A 3GFWA 2H6DA 5GJFA 5CI7A 2C6IA 5DRBA 5FWKK 4E6CA 1DAYA 4FKTA 2XIZA 3HAVA 2JC6A 3F88A 3IDPA 3KA0A 3VW6A 3A7GA 2OBJA 4FNWA 5CF8A 3EQBA 3BLHA 4G6LA 5HO6A 4OTHA 4LV5A 4A06A 4FIIA 4FEQA 4X2GA 2UVXA 4V0GB 4Y83A 2XK7A 4KKHA 4APCA 5AP7A 2P2HA 4YO6A 4KUJA 2W4OA 1Q61A 3W8QA 3VUMA 4IIRA 4JBOA 3OCTA 3OVVA 3RVGA 2JLDA 4HCTA 4Z7HA 4DINA 2WTDA 3DKCA 3HRCA 4Z9LA 4UYNA 4KIKA 5LQFA 1Q8TA 3QWKA 2HY81 3ZDUA 1V0PA 2H34A 3BEAA 3B2TA 3IONA 4QNYA 5L6WL 5AUTA 1GIHA 3RZBA 3SX9A 4DGGA 3R8UA 4V01A 2F2UA 2VTLA 4WNPA 5E8WA 3BIZA 4IE9A 1JKSA 2X4FA 3C0HA 3P86A 1GIJA 3MDYA 2VNWA 4PRJA 3MVHA 4R78A 1XKKA 2CKQA 1DAWA 4J52A 2GCDA 4UXLA 3W2OA 5JMSA 1MQBA 4RJ3A 4HVGA 3DAEA 4G9CA 5GZAA 4BDHA 3R1QA 3LQ3A 4YNOA 4BDEA 4RA4A 3E3PA 3TNWA 5E1SA 3C4EA 4UV0A 3SGCA 1BL7A 2PVHA 4H36A 2C5NA 5ETAA 3D7TB 2VTTA 2W4JA 3OT3A 5AIRA 3FZ1A 2YDKA 5I9UA 3RPRA 5HCZA 3S2PA 5CXZA 3GQIA 4L9IA 3L9PA 4B99A 5I3OA 5A14A 5JFVA 3A4OX 4A9RA 3ORNA 5HVKA 3TZ9A 4FBXA 5HE0A 4C37A 1YOMA 3UIMA 4G34A 1QL6A 4HCVA 4E5BA 4FC0A 4XG3A 3FLNC 3OCSA 1VYZA 4XG2A 1LEZA 2G2IA 4B8MA 3TUCA 2Y9QA 4JIKA 5EQPA 3QD0A 1BKXA 4FL2A 4TT7A 3LXLA 4MXCA 4KAOA 4O2PA 4FK3A 2OZAA 1SZMA 4FMQA 4HNFA 3QHRA 4O0WA 5JZNA 2RG5A 4B4LA 2PMOX 5AAGA 2C30A 2CDZA 2F7XE 5ANIA 4BI0A 1JOWB 3AQVA 3KGAA 3NYXA 2YCSA 3UNZA 3NUPA 2XKCA 2VWBA 3WIGA 3R1YA 2NRYA 3COKA 3CQWA 3DXNA 3FY2A 4ID7A 4MF1A 4QMZA 4LV8A 5I9YA 1XJDA 1XBBA 3GQLA 3OD6X 4KINA 3R9DA 4BICA 3NSZA 3P0MA 4GIIA 3R2YA 3TUBA 3Q6WA 3MPMA 3PG3A 4OLIA 1PXIA 4FTNA 3QZFA 4O1PA 1TQIA 4PL3A 3VS2A 3VWAA 3OTVA 3NPCA 4F9AA 2VTNA 2JAVA 2OK1A 2W1FA 1B39A 2VTQA 2WQNA 3QZIA 1J7LA 4RJ6A 3CGOA 1JWHA 1PMEA 2VWZA 3R7YA 4R5SA 5H8EA 2CKOA 2B4SB 5L4QA 4L53A 1YHWA 4MBLA 4E7WA 2HZ4A 3IOPA 3A60A 3UGCA 4F63A 4DCEA 1G8SA 2O2UA 4MXZA 1OECA 3HMPA 2WMTA 4LGGA 1L8TA 1OPKA 2A4LA 2R3MA 4MAOA 5CENA 3RJCA 5JKGA 4BYIA 4J99A 1OPJA 1I09A 3FZOA 3IW7A 1YHSA 4FSRA 4IZAA 3K5UA 3V5JA 2XKEA 5AV4A 5JFSA 2VRXA 3C4FA 3R8PA 4FYNA 4OGRA 4I3ZA 3ZO1A 5J95A 3ULIA 3ORPA 5H8GA 3SXFA 3FJQE 4EOMA 5AADA 1OB3A 4QOXA 4IVDA 4NYEA 3VUDA 5M57A 3QTWA 2XM9A 2YERA 4R3CA 4LRJA 1KE9A 1KWPA 3CS9A 3JY9A 4LMNA 5AM6A 4DEDA 5A4EA 1OL5A 3NAXA 4Q9ZA 3K2LA 1JAMA 2CN8A 3MH2A 4XBRA 4RIYA 5IEVA 1NVSA 2W5BA 3POOA 4AOIA 4DN5A 3HA6A 2J9MA 3O7LD 4WG3A 3ZZWA 4AA5A 2LGCA 1XH4A 3O17A 5EQEA 5FG8A 4MWIA 3ORIA 3FC1X 4FV1A 5KBRA 4O82A 2C3IB 3EL7A 1NVQA 2UUEA 4YPDA 4BCKA 4D1XA 2R4BA 5EHYA 2VTOA 2XBAA 4P5QA 1SVGA 2JDSA 3BU6A 4AU8A 1Z9XA 3VBQA 5KMOA 2CN5A 3H3CA 4QMXA 2JKQA 3CBLA 4EQCA 5DN3A 2W17A 3LFCA 4RWIA 3ROYA 4C3FA 4DH1A 4PDYA 3UP7A 1XBAA 3KK8A 4NM0A 5KO1A 5F4NA 2OU7A 5DEWA 1JQHA 2W0JA 4WA9A 3D0EA 4IVAA 3UG2A 3F3TA 4G3GA 3MS9A 3ZU7A 4QMNA 5E7RA 5KE0A 5D12A 5C8KA 3S95A 4HGEA 4A4XA 4AGUA 4X3JA 4ZSAA 1I44A 2QLUA 3GNIB 3LJ2A 3KF4A 4XV3A 4UEUA 4RX5A 4GFOA 2Y4IC 2ZDTA 2XNBA 3VIDA 2W7XA 4KABA 3OY3A 5K5NA 3F9NA 3CKWA 5HG8A 4YO4A 4QPSA 5DT3A 4IZ7A 5A9UA 4YBKA 5LMBA 3BYMA 3PE2A 4A07A 3KULA 1H4LA 4N70A 3NRMA 4K1BA 5ETCA 4AF3A 1SNUA 4JBQA 5K4JA 3KVXA 4R6VA 4FKQA 4TY1A 4IFGA 3WYYA 2BHHA 1OIUA 5IEXA 3PY3A 1A48A 3ORLA 3OCBA 3NNUA 1TVOA 4RVKA 3BHTA 4MHAA 4FZ6A 4NM7A 5ANJA 3UIXA 2ZV9A 3FKNA 3Q4TA 3V6SA 3MH1A 5CY3A 2F4JA 4A9YA 1Z57A 3EFWA 3V3VA 5AFVA 2VNYA 3W1FA 4AOJA 4FKVA 4AA0A 4MXYA 2ITNA 3RTPA 4PMSA 2QQ7A 3D2KA 3UODA 2PMIA 4DGOA 3LXPA 5E92A 3QGWA 4IB0A 3PLAE 2C69A 4NFNA 1XH7A 4FZFB 4DH7A 3KCKA 3KQ7A 3NWWA 3R00A 2IWIA 4O1OA 4X6RA 3JPVA 1B6CB 1NA7A 3BGZA 4JG8A 1ZMVA 4H1JA 4HNIA 5ANEA 4PMTA 2YHVA 2Z7SA 3EQFA 3KU2A 4NM5A 4IFCA 1XO2B 4O0SA 4V0GA 4D9UA 4FT7A 5BX0A 5C26A 5HD4A 4FEWA 5IMEA 4K33A 3BGPA 1Q24A 4Q5EA 4CKIA 3OXZA 4FTOA 4JQ7A 1ZWSA 2UZNA 4PL4A 3BE9A 3LJ0A 4MD7E 4QQJA 3TJDA 3UO6A 1VYWA 4I41A 5E8SA 3TIZA 4DT8A 2WELA 2ZM4A 2OH0E 1Q8WA 5FDXA 3T8OA 5CEMA 4MBIA 5J9ZA 1JSUA 3DDPA 4JJRA 5KMNA 1ZY4A 2QKRA 4BY9E 2IZRA 3FBVA 4TYJA 5HBEA 4DGMA 5HIEA 2OWBA 2UVYA 1G8AA 2X4ZA 5CWZA 4FT0A 4TW9A 4IWPA 1OI9A 5C1QB 2Q0NA 4IAFA 2HELA 4KIOA 1Q8YA 4RSSA 4O7VA 2YM7A 2BZIB 3D2IA 5DT4A 2X8DA 4PWNA 4IAIA 3NX8A 4BCHA 5ANOA 3D7TA 3DZOA 2EWAA 5DEYA 4EONA 2XIKA 3F3UA 4K2RA 4N57A 2FSTX 3KRJA 3QRKA 1UU9A 3LLAA 3WBLA 3SV0A 4CFWA 3FMDA 3CD3A 4C61A 1M7NA 4NW5A 3RBWA 2CJMA 3MFUA 4BBFA 4EUTA 4AXAA 5CALA 3FI4A 3Q9ZA 5A3XA 4EOJA 3O8UA 1JKLA 4F0IA 3PTGA 4YHJA 4KIQA 1OM1A 4RBLA 3G15A 2ZM1A 1Q8ZA 4GG7A 1FGIA 2ITYA 2Q0BA 4XRLA 3NIZA 4E4XA 4ALWA 2ACXA 1TQMA 4G16A 1H1QA 3I6WA 2UZBA 1Y8GA 2R3QA 2VO7A 2YEXA 3GVUA 4HOKA 4I92A 3KF7A 2CGUA 3LW0A 2UW0A 3M2WA 5EYCA 3AC2A 3ZC5A 4Q2AA 4RPVA 3H0ZA 2WFYA 2REIA 1IEPA 3GENA 4EORA 4IWDA 5JSMA 4F7NA 4RJ8A 3R1SA 4R7BA 2HY0A 4JDJA 2YM4A 1KOAA 1R0PA 3ENMA 1PY5A 2EU9A 3DA6A 3I1AA 5TF9A 3ZHPC 4QNAA 3HGKA 5AP3A 3LCTA 4EKLA 5CU0A 5AP6A 2PVRA 5CSPA 3LFSA 1ZZ2A 3V8SA 4AN2A 2XVDA 2ONLC 3Q6UA 1YXTA 5EDPA 1GOLA 3F61A 5F94A 2X0GA 1UNGA 3HKOA 4JQ8A 4ZTQA 5JH6A 5HG7A 4MF0A 3GCSA 4E20A 3BLQA 4UMPA 2QR7A 2JDOA 4P7EA 2O64A 1ZXEA 1IA9A 5B2KA 1Q3WA 2OJ9A 3GU4A 3EH9A 3LFEA 4U44A 5GNKA 3BPRA 5EFQA 4DH8A 2HENA 1W84A 4ANOA 1OKYA 5FXQA 3OWKA 2ITQA 2BRBA 3OXIA 2O63A 3PE1A 3IW4A 3WZJA 4B7TA 2RFEA 3AC8A 2YLFA 4DFYA 3UPXA 4PL5A 4DLJA 3TZ7A 2FGIA 2G2FA 4QYHA 4FZ7A 4GIHA 1A06A 4O7RA 4YHFA 4RLLA 3EKNA 3T3VA 4FNXA 2XNEA 1V0OA 4CT1A 3QQHA 4IMYA 4MXAA 4TPTA 4CV9A 4CKJA 3NW5A 4PDSA 3FY0A 3W16A 3RM6A 3LXKA 3KXXA 3QFVA 4PNKA 2VO3A 3ANQA 3SAYA 4YU2A 5C9CA 3KXGA 5HORA 4O83A 4UWYA 2YM5A 5IF1A 4X2NA 4GSBA 3VQHA 1YHVA 4FUXA 2CLQA 3E8NA 4L68A 2XK3A 5AP1A 3RK7A 4CTCA 2WQEA 4CFVA 5KMJA 2E9UA 2Z7LA 4UBAA 1FVRA 5D7VA 4AT5A 3RINA 4DTKA 2X6EA 3HUCA 4OAUC 4JDIA 3TDVA 4XG6A 3VNTA 4RX7A 4HVHA 5HX8A 4TYIA 5D11A 3SQQA 5C8NA 4XG7A 4EH6A 4GMYA 2XNPA 1HCLA 2HAKA 4CTBA 3REPA 4I94A 1P2AA 4YJNA 5EI8A 5FQDC 5IISA 4GVJA 4PX6A 2GMXA 4M66A 1Z5MA 4ORKA 4XX9A 2CCHA 4TYHB 4H05A 3C7QA 3VBVA 3IOKA 1J1CA 3ZBXA 3DFCB 1XH8A 3FL5A 3LQ5A 2DUVA 3QTRA 4PV0A 3WOWA 2PWLA 3E63A 4MXXA 3PG1A 4DAWA 4FEXA 2B55A 2A27A 4N6YA 3WILA 1M17A 4YC6A 2RG6A 3DS6A 2GNHA 3RM7A 2QOQA 3F5GA 4JRNA 3WZKA 4CMUA 4PMMA 1YWNA 4QMWA 3R7IA 2J0KA 5CU6A 2PMNX 1YI3A 3UVPA 3OY1A 2BKKA 2O0UA 5AR7A 2YDIA 3PXKA 2XEZA 4CD0A 3TACA 4BCJA 1ZARA 4LRMA 4FTIA 2F2CB 5DYJA 2WOTA 1WBTA 1OGUA 4QMTA 4WHZA 4FTLA 4GVAA 1BUHA 4ZTMA 3UIUA 1PXPA 3VUKA 4FKJA 4FTQA 2AC5A 1W83A 4KA3A 4O21A 5CAQA 1W0XC 4L44A 2YIWA 3NUSA 4TWPA 2F57A 3U4WA 4BTMA 4EI4A 5L3AA 4JG7A 4BHNA 4ZK5A 4TTHB 3WE8A 3QRUA 3Q9YA 2XNNA 4IWOA 4NH1A 2J2IB 4CZTA 3G0EA 1U5QA 3BRBA 1WBVA 3ORZA 3LAUA 3EYGA 4BR3A 3OP5A 5I5ZA 2Q83A 3RK9A 3N4UA 3R6XA 3R1NA 3U9CA 4FEUA 5GIPE 4QMMA 3FZTA 3HRFA 3KN5A 5BVFA 3PUPA 1ND4A 3QQFA 5HOAA 3AMYA 4IANA 1ZOEA 1PRYA 4XV9A 4HGTA 3WARA 2PHKA 3D5WA 4C38A 3BV3A 2OI4X 2UW3A 3BU3A 5LXMA 3E93A 4TYGA 2E9PA 3EN5A 4J97A 3CXWA 4R8QA 3G9NA 4ASDA 3E3BX 3QHWA 4XV2A 3SOAA 3CIKA 4H3PA 2BZJA 2R3OA 4DYMA 3MFSA 4FTRA 4JAJA 3HV7A 2W9FB 3EIDA 3IPHA 5G6VA 4DFBA 1PMUA 3RCJA 4FI1A 2ZMDA 4WO5A 2IVTA 3OUNB 3NMUF 4Q5HA 1Q62A 1U59A 3SG9A 2CCIA 4KS8A 2IJMA 1BLXA 5F95A 4EQUA 3Q4CA 2BFXA 2YCRA 1Y57A 4ZOGA 2ERZE 1PF8A 1ZLTA 1FMKA 2NP8A 3HRBA 3OWPA 5BMSA 2GHMA 1Q41A 4F1OA 1WVWA 3CKXA 3MH0A 3UPZA 3QALE 3UZTA 3R0TA 2UW8A 3NYOA 2HXLA 5HI2A 5IZFA 3KEXA 4YNEA 4OTWA 3HVCA 3TZ8A 1YI4A 4ZMFA 2VTSA 4FVPA 4AE6A 4AGCA 4JG6A 1URCA 4E6QA 4XHKB 5EW3A 5ANDA 4FL1A 3BLRA 3FKOA 5AX9A 3PXQA 1OIRA 2EXMA 2WB8A 3F69A 2XH5A 3COHA 4HVIA 3QA8A 3QX2A 1OUKA 2GTNA 4ZZOA 3PA5A 4G31A 1QCFA 3IS5A 2C6LA 4RIYB 4QYFA 1STCE 2VD5A 3PXYA 4JBPA 4E3CA 4FSUA 5EW9A 2BDJA 5J9YA 5LOHA 4RX8A 5KMIA 1IG1A 4I21A 2CPKE 4EH7A 3Q9XA 5IDNA 4W8DA 2CKEA 3MA6A 3OF0A 3PA3A 4MYGA 1PMNA 3QXPA 1GIIA 5C03A 1XH6A 5FEEA 3UNJA 3H9FA 2QO9A 1P4FA 2VWWA 1M2QA 3D4QA 2QR8A 3QTIA 1H0VA 4C8BA 1YXVA 2C1AA 3EJ1A 2Z2WA 2OSCA 4MQ1A 3T9IA 5TO8A 5IQDA 2UZWE 1YI6A 4Z3VA 3MIAA 2B52A 5BUJA 2YJRA 3OEFX 2B54A 3I5NA 3FLYA 4IX5A 2QURA 3E88A 4OBOA 3MY0A 4D4VA 4YSJA 3DLSA 5HCXA 4BWKA 3ZYAA 3COIA 4ZJVA 1OL7A 2P4IA 2WO6A 3U4UA 3DNDA 5E8UA 5CXHA 3KREA 2V7AA 3FWQA 1CKIA 2WTJA 3GU7A 5AX3A 4C4EA 5EKNA 1H24A 2PMLX 5HBJA 4W9XA 3HECA 4XLVA 3VBXA 3P5KA 4JXFA 2PTKA 4ZLZA 3W55A 4FG9A 4EOSA 5M4CA 3R8VA 4ERKA 3QC4A 4FSWA 4U40A 1H1PA 3VBWA 4C4IA 2O8YA 4E6DA 5JRQA 3RALA 4H3QA 4GKHA 2BPMA 3FC2A 1OKZA 2Z60A 4LUDA 3PRFA 2QOLA 3KCFA 2V5QA 4AE9A 3MPAA 3R2BA 1Q4LA 3ODYX 3EN4A 4F70A 2VAGA 4F1MA 4IM2A 4S31A 3SXSA 1H1RA 4JBVA 2PUUA 1HCKA 2VGOA 3UQGA 2GS2A 4WG4A 4LUEA 4F0GA 2PYWA 2XKDA 5TE0A 2R0UA 3Q4UA 4O0YA 5A4CA 2QG5A 4QMYA 3QUPA 3OWJA 2BR1A 5J5TA 2PUPA 4HYUA 2C3JA 3KY2A 5KBQA 2BAJA 1MRUA 4M0ZA 4JT3A 5AUWA 1BL6A 2YDJA 1AQ1A 4ZIMA 4GS6A 2J0MB 3AG9A 4BTJA 3JYAA 4QP4A 3KXHA 2X2MA 4ZZMA 4BKZA 4XRJA 4LI5A 2O3PA 4ZSEA 4BIEA 3R7VA 3OWLA 2W99B 3DU8A 2GHGA 4FT5A 3FXWA 2PZYA 4U0IA 4I23A 3BYVA 4QP6A 4HPUE 5DWRA 3UC4A 5BVDA 1H25A 5D1JA 2ZOQA 4I6QA 3ZH8A 1MUOA 1K2PA 5LCKA 2PE2A 3FLWA 3ZFMA 4OAVB 1H0WA 1OBDA 1UU8A 5KX8A 3DTWA 4TYHA 1RQQA 3HA8A 3IW8A 5KKRC 4D5HA 4IHPA 2GNLA 3MTLA 4OTRA 2C6MA 2P33A 3DB6A 3O8PA 3P7AA 3T9TA 4MX9A 3LCOA 2WTCA 3WZDA 2V0DA 4BN1A 4YJRA 3Q5IA 3TNQB 3EQDA 4KBAA 2X9FA 5BVKA 1FBNA 1PXNA 1H01A 4UYAA 3ZO3A 4PTEA 3W10A 3ZZEA 3T3UA 3LPBA 2YZAA 4XMOA 4AZSA 3C9WA 1U54B 4EK5A 3A61A 2GSFA 4DCAA 3TNPC 4CNHA 5HNGA 5LMAA 1V0BA 4AUAA 3VJOA 3FSFA 5KCVA 3QRJA 1GJOA 2B1PA 1T46A 4Y5HA 5CSHA 2BTRA 4QTDA 5CF5A 3DNEA 3O71A 5IA0A 2YA9A 2HZ0A 1FINA 2VUWA 3BYSA 2V55A 5IKWA 3VBTA 5CEPA 2UZLA 5TOZA 2UV2A 4QP2A 1LUFA 2P55A 2WHBA 3FMJA 3ODZX 2CGWA 3NYNA 2YIQA 4YLLA 4IB1A 3QWJA 3F7ZA 1O6YA 4DEBA 2ITWA 3ZS5A 3C50A 2DYLA 4FK6A 4ITIA 4DE4A 3A4PA 4BDAA 3EQCA 2NRUA 2JGZA 3JUHA 3CC6A 3OXTA 4Z16A 1APME 4YLJA 4FZAB 2W1ZA 4ASEA 4FKRA 4NIFB 3N4TA 3LFNA 1ZRZA 3QYWA 4ZSGA 4PP9A 3THBA 4EH3A 3LQ8A 5AV2A 1R78A 1YDSE 4DEHA 2EB3A 3TNIA 3DBCA 4UALA 3RAHA 3EFKA 2UW5A 2WXVA 1KE7A 2GQGA 4M68A 4NKSA 5CT0A 5CU3A 3BEGA 5DI1A 4AZWA 4EH4A 4V04A 3IG7A 4QMVA 1PJKA 2GPHA 3PSDA 4MEDA 5GJDA 5HG9A 3HMIA 4TZRA 5F20A 3GOPA 2J4ZA 3ZXTA 4IACA 4QP8A 4DFUA 4BCIA 4IW0A 4O84A 2QO7A 3QCSA 4QTEA 4DBXA 3CCNA 3QQGA 2YLEA 4O6LA 4RGJA 3HUBA 4TNDA 3UOLA 3UVRA 1YW2A 1MP8A 1G5SA 4FSNA 4ACHA 1SMHA 4BTKA 3OT8A 2W4KA 3S3IA 1EH4A 4F65A 2WMSA 3DLZA 3EMGA 1ZOGA 3ORKA 1CDKA 4UY9A 1OMWA 1QPCA 4IB3A 4NCTC 3FSKA 4FX3A 3KVWA 4D2TA 2F9GA 2G01A 2PPQA 2OO8X 3C4CA 2RGPA 3NNXA 4D55A 4RWKA 3MN3A 2A0CX 3D83A 3MYGA 4JNWA 5AM7A 4GV1A 2W1IA 4RG0A 2R3JA 4CLJA 2IO6A 1E1XA 2Y6MA 2ESMA 2YACA 4ZY4A 3BWFA 5AA8A 1E9HA 3QF9A 2C6TA 4EC8A 1WBSA 4JLCA 5FDPA 3BYOA 4IC7A 3K3JA 4LL0A 5AR8A 4E73A 2J6MA 3ENHA 4EUUA 4CEGA 4IADA 5A54A 4E26A 5A6NA 4NJ3A 5ANKA 3RPOA 5FLFA 3ORMA 3HP5A 3U87A 2IG7A 3AD6A 1KSWA 4WT6A 5KMKA 5BUIA 2PZIA 3MB7A 1URWA 3CE3A 3CP9A 5B7VA 2UZUE 4L3JA 3V5WA 3ZXZA 2BRGA 4L46A 4A4LA 4IH8A 3QTZA 4O0VA 4FIHA 3TIYA 1WBNA 4WBOA 2O65A 5EYKA 5HLWA 4FT3A 4IX6A 4CGAA 4LOOA 4LGHA 4ANMA 4BFMA 4YZNA 4FTJA 3UYTA 3PPJA 3OS3A 3R01A 3DFAA 5FM2A 4Z7GA 3C4ZA 4AACA 3AC5A 2R7BA 3VS5A 3E92A 3W2RA 3N4VA 3C5IA 2YJSA 4G3FA 3ZEPA 3QU0A 4XOYA 5AP5A 4D2RA 4ZSJA 3BCEA 2R5TA 2J50A 2PL0A 4EZ7A 5CT7A 5KMLA 5HKMA 5H9BA 5AP0A 3ULZA 2WQOA 3NCGA 3R02A 4FKGA 5IG1A 2PUNA 3LFQA 3QKLA 5C8MA 3ELJA 4AX8A 4U41A 2WGJA 3RPVA 4FTKA 3I0QA 3VAPA 2EXCX 3Q2JA 4O22A 1Q97A 2QU5A 3L1SA 4ZTNA 3UVQA 3GC9A 1ZZLA 4I5CA 3V5LA 5IQBA 2BIKB 3FPQA 2UZTA 5EG3A 5AR5A 3VRYA 2PUIA 1J91A 2Y7JA 2JDRA 1WZYA 5M55A 2DS1A 4EJNA 5BPYA 3EYHA 3Q60A 2XJ1A 3JVSA 3WZUA 4GJ2A 4D2PA 4DH5A 3PYYA 2XNOA 2VX1A 3W2PA 4HYHA 5H2UA 3QLFA 4X3FC 3HV5A 2FUMA 2XKFA 2W1CA 2W9ZB 1OBGA 2R0IA 5FD2A 4FSZA 3F3WA 1HOWA 2W1DA 3QKMA 2Z7QA 4IAAA 4OBQA 4ANBA 3CTQA 4ZP5A 1PXMA 3PJCA 4S32A 3KKVA 3C4XA 3VS7A 4AP7A 4F7LA 5CLPA 4S34A 3VF9A 2OF4A 4QT1A 2R9SA 3NGAA 5TT7A 2B9IA 1RJBA 2CMWA 5CZHA 5LCJA 4WNKA 3IKAA 3DXQA 3LIJA 2R3GA 2JBOA 4ALVA 4D1SA 2ZAZA 2R64A 5EK7A 3LMIA 2YISA 3D9VA 3CQUA 2XIRA 2OW3A 3RGFA 4KB8A 3CEKA 3GEQA 2Y4IB 5KZ0A 3L8SA 3DKFA 5K5XA 2GHLA 3BE2A 2OIQA 3QQKA 2ETRA 3UO4A 4PPAA 5B2LA 2OIDA 3TTJA 5I3RA 2R3NA 4TN6A 5FEDA 4DA5A 3PDTA 4H3BA 2ITVA 1WAKA 2J7TA 3OW3A 3R21A 4XS2A 5AP2A 4HPTE 5HESA 3BHYA 4QQTA 4N4SA 4NM3A 4FIEA 4O81A 5AWMA 4H58A 5AR3A 5F9EA 4BKYA 1T45A 4Y72A 4FEVA 2GQSA 1AD5A 5CU4A 4IXPA 2EUFB 3QKKA 1LPUA 5GZ8A 1V1KA 4WIHA 2Z8CA 3MI9A 4IDTA 2JAMA 1LR4A 4RFZA 5HG5A 3FL4A 3U6IA 4H1MA 4IJ9A 4MNEB 5DGZA 4O0UA 3RZFA 5LMKA 3D94A 4D2SA 4F1TA 3SA0A 2I40A 5LVLA 3AMAA 4EK3A 5I9ZA 3HL7A 3SLSA 5DIAA 4O7SA 4AN9A 5M08A 4XLIA 1U54A 3EB0A 3PXZA 4FOBA 4NFMA 3UJGA 2HW7A 1S9IA 3ZLXA 2C5XA 1VEBA 4B0GA 5M07A 3CJFA 4UB7A 1F5QA 3H0YA 4I6BA 4F0FA 3P78A 3EOCA 4YZDA 3Q32A 3AC4A 5CTPA 2B9JA 3G6GA 2F49A 2IVVA 3I7CA 5DG5A 5M44A 5HCYA 5CANA 2ITPA 4YUQA 4C3PA 1FPUA 1XQZA 3P23A 2XIXA 4Y95A 4GYGA 4I5HA 3NS9A 3II5A 4B6LA 2I0YA 2VWIA 3HDMA 3HLLA 4C7TA 4CZUA 5HX6A 3TG1A 2A1AB 3FI8A 1VJYA 2HWPA 4FV5A 4ZTHA 3A7FA 4WUAA 5J87A 3V5PA 4BVUA 4OTIA 3CGFA 2OXXA 3ZUTA 3D5VA 4EOIA 3ET7A 4FZDB 4NUSA 5FGKA 3MJ1A 5AV1A 4Y46A 5HVJA 3DV3A 3WYXA 3TM0A 2X9EA 4LMUA 4FIFA 1G3NA 4BL1A 1IAJA 3PFQA 1H1WA 3G51A 3SVVA 2OJJA 1J1BA 3NIEA 3QGYA 4UMRA 4NIFA 1XWSA 4YMJA 2VWUA 3E62A 4FR4A 4R3RA 5H3QA 4E4MA 4GFGA 4O6EA 2A2AA 5DVRA 4I24A 5K0KA 5IMXA 4W8EA 3K3IA 3VJNA 4AA4A 3HP2A 3WF8A 3S00A 1DI9A 3O7LB 1REJA 3GCVA 4EWHA 5GJGA 5JT2A 5ICPA 4O86A 3OW4A 4U8ZA 3E7OA 3ORXA 3GXLA 5AUYA 3DK3A 2CKPA 3EKKA 2QNJA 5HQ0A 3EN9A 5M4IA 2PVJA 1PHKA 2YIRA 4G2FA 4JS8A 3HV4A 4XOZA 5IPJA 3SKCA 4AZVA 2X39A 1S9JA 1OL6A 4WRGA 4DEAA 2WKMA 3KRXA 2ETKA 4YJSA 3UQCA 1XH5A 3H10A 3LE6A 5FEQA 3FQEA 3O8TA 4EC9A 4YZ9A 5HTCA 2XBJA 1OVEA 4RT7A 4C35A 3EN6A 4F7SA 1PXKA 4U79A 2FO0A 5DPVA 1UV5A 5JRSA 3QUDA 2WTIA 3TKIA 3ORTA 3PPZA 4BCGA 4ACCA 2X6DA 4BBEA 3FQHA 5C01A 4DGNA 5CAOA 4M8TA 3PIXA 3NLBA 2OIBA 4NKAA 4CQEA 2PZRA 1CKPA 3C51A 3FZPA 4YTHA 2R3RA 4JOAA 2X2KA 4UZHA 3V01A 2BHEA 1OIQA 2XJ0A 3R7OA 4HGSA 3W2SA 4DBNA 4WNMA 4FSTA 4P90A 4F64A 4C0TA 3QD3A 2AUHA 3QQUA 4C62A 4DG0E 1CSNA 3CPBA 3R8ZA 4BCMA 5AIKA 2QOKA 2UW9A 2XCHA 4M84A 4HYIA 3O50A 3I0OA 5LJJA 4YR8A 5GZ9A 2XRUA 5BQ0A 4MXOA 1H1SA 5JN2A 5ETIA 1H08A 1A9UA 3E7VA 3QX4A 4EWQA 5AJQA 2E9OA 3EQIA 2LAVA 2VU3A 1YWVA 4O7NA 1OKWA 1YRPA 4FV2A 4RIOA 2HOGA 5EM8A 5JGDA 4LRKA 4YTFA 3VF8A 1H28A 3BHVA 4GJ3A 4O7LA 5M06A 4M13A 4NWMA 3W2CA 1PXLA 1BMKA 2X8EA 1Y91A 2BUJA 2C47A 3CY2A 3DQXA 5IQEA 2Z02A 3U6HA 4L6QA 4EYJA 4AFEA 4QP3A 4F6WA 4HZSA 1ZYCA 4QMOA 4WOVA 3R8LA 4LGDA 4TNBA 4FG8A 5I4NA 5M51A 3R9NA 2W1HA 5EM7A 2WIPA 3S0OA 4YC3A 3WZEA 5AA9A 3PXFA 4NL0A 3IDBA 3K5VA 3O51A 2FH9A 2I0HA 3FLQA 2KULA 3OOGA 4FKOA 4JIAA 3QQJA 5EH0A 2GQRA 3BX5A 4RJ5A 3TV6A 1LP4A 3MB6A 4QP1A 4GKIA 4EJ7A 3KMWA 4HZRA 4X0MA 3I79A 2WMWA 3B8RA 3EWHA 2GS7A 4R5YA 3VO3A 4WBBB 4AWIA 3MTFA 3OBJA 4I22A 3WF6A 2VTRA 5EW8A 3FQSA 3KMUA 4EBWA 4EHZA 1ZYLA 4HVSA 4USFA 5J79A 2JDTA 1GZ8A 2PVMA 5FTOA 4PDPA 3L8VA 3DOGA 3LOKA 4FSQA 4K11A 4ZTRA 3EQPA 2HK5A 3MIYA 4IDVA 3C4WA 3KRLA 2VTPA 4IAYA 4IEBA 5IH6A 4HVDA 4CFXA 1WBOA 3ATTA 4F9WA 4U80A 3VULA 4O0RA 4CYJA 4I0SA 2OGVA 4L3LA 4CKRA 2IVSA 5BVNA 3AOXA 4J95A 3UMWA 2YM8A 3V04A 3VS6A 4EH2A 2B0QA 2E9NA 3PZEA 4DGLC 3F5XA 2WMAA 1PXOA 3V8TA 1ZYJA 3PJ3A 4IM3A 4GYIA 2X7GA 3KMMA 3NR9A 5CVHA 2NNWB 4RWLA 4DTBA 3R8MA 3GB2A 1FVTA 4BF2A 5ITAA 3SHEA 2PU8A 1Y8YA 1QMZA 4FF8A 1ZMWA 4LQMA 2FB8A 4ONAA 1DI8A 3QUEA 2H9VA 3NCZA 4FKIA 5AEPA 2BILB 2B7AA 4AT3A 4Q9SA 5HLPA 5CVGA 3RI1A 3B8QA 3PXRA 3PLSA 4FOCA 4ENXA 5M4UA 3IW5A 4I4FA 2YAKA 4ZS4A 2RFSA 5CQWA 3FAAA 2BZHB 3CPCA 2WMRA 4V05A 2VTIA 4X6QC 1Q8UA 3VW8A 4BKJA 4ZMEA 5E8YA 2EVAA 5GHVA 2QU6A 5BVEA 5EQYA 5DMZA 3C13A 2P2IA 2XYNA 4DG3E 5A4QA 2YCQA 3DKOA 4YC8A 4RVMA 4D28A 5DA3A 3I7BA 3VQUA 3PWYA 3FMKA 2XUUA 1PYEA 3ALOA 4X7QA 2OJFE 3Q3BA 5IA5A 5HE3A 3NNVA 4PMPA 5DR2A 2WTKC 4AQCA 3ZRKA 4BGHA 2HIWA 2WD1A 2PULA 4ERWA 5FBOA 2IVUA 5KHWA 1B38A 2QOCA 3FHIA 3LLTA 3QAME 5CVFA 1ZYSA 4AW5A 4O7WA 3DT1A 3ACKA 3TEIA 2GFSA 5HTBA 2PVFA 4MNEA 5JK3A 1WBWA 3I6UA 2BVAA 4MKCA 3UYSA 4EK8A 3B2WA 3BWJA 3OOMA 4QMQA 4EKKA 4KS7A 4K9YA 3ZRLA 5CAUA 3RPSA 4HCUA 2YM3A 4F6UA 1OL1A 4Y5QA 4XJ0A 5J1VA 4FV7A 2JFMA 3FMHA 2WEIA 2ZB0A 1H07A 4YTCA 5ETFA 5HTIA 3NVKI 4DEIA 2JIIA 1OKVA 4W4VA 4GK2A 4IVCA 2GU8A 3KC3A 2EXEA 2OF2A 5HIDA 4XG4A 3UG1A 3BI6A 4FGBA 5AMNA 4YURA 2FSMX 4QMLA 1WCCA 4R1YA 1F0QA 1W8CA 3UNKA 4JDHA 1KV2A 1R39A 1Q3DA 3F5UA 4BCFA 3DJ7A 2QONA 3EQGA 4K8AA 2CNUA 2FA2A 4OTQA 5CAVA 3UO5A 3L8PA 2C3KA 3M11A 4XG8A 3F3VA 5J1WA 2WQMA 2RIOA 2X8IA 4ZLYA 3F2RA 4CV8A 4D0XA 3TL8A 4MH7A 5A4TA 2SRCA 4OTDA 4XCUA 4AZTA 4DFLA 2JKKA 3ROCA 5L2SA 3DBFA 2C0TA 2IZUA 3LM5A 4I4EA 4W9WA 1JSVA 1YXXA 1Q99A 5LARA 3KFAA 5LWNA 1F3MC 4M97A 3TV4A 1UNLA 3UOJA 4EL9A 3OROA 4ZLOA 5HEZA 1NW1A 3WF7A 3Q53A 5BYZA 4PQNA 4NTSA 3QLGA 4FSYA 4DITA 2OJGA 2XK4A 3IDCA 1GAGA 4LYNA 4U97A 3LFAA 1OITA 2O5KA 4U42A 2P3GX 3KXMA 5AUUA 3R7UA 2XJ2A 4W4WA 3SDJA 1UA2A 4C36A 3VS0A 4NJDA 4JVGA 2ZB1A 1JSTA 1UU3A 4ALUA 5KNJA 1JKKA 3GC7A 4QMUA 5JGAA 3A7JA 2IW9A 3BYUA 4LFIA 1SVHA 4L42A 5LVOA 3U51A 5CEOA 3H30A 3KB7A 2ITTA 4DHFA 4L00A 2QOFA 4EEVA 4XP3A 4YLKA 4JX3A 4F6SA 3O23A 4BIDA 3DJ5A 4IC8A 1RDQE 3DB8A 4DEGA 2G1TA 2QOOA 2X81A 3A8XA 3IQ7A 4QPMA 4E8AA 1BYGA 2PE1A 2VX0A 3HMMA 4KRCA 3QRIA 1IASA 2WAJA 3PVWA 5DLSA 5HU3A 4YJPA 4UZDA 3GC0A 4XP2A 2Y8OA 4OBPA 4YZBA 1PXJA 3G2FA 2BDWA 3UZPA 3AGMA 2G15A 2C4GA 2XF0A 2XNMA 3PVGA 3TCPA 2XK9A 3BQCA 4TYEA 4EOKA 2YITA 3PIYA 4ZXTA 5JZJA 2JDVA 1UWJA 2I0VA 3GC8A 3VUIA 1JNKA 2C3LA 4DTAA 5CNNA 5C4LA 3JXWA 3Q2MA 2ONLA 5GIOE 1XHAA 1M14A 1XBCA 3O0GA 2WU6A 5EOLA 3E87A 2OZOA 3FV8A 2HCKA 5TKDA 4BWPA 2RF9A 1SYKA 1LEWA 4J8NA 2VWVA 3LCSA 1M2PA 1P5EA 3LM0A 5E90A 3BELA 4GG5A 5HZNA 4FTAA 2CGXA 2XEYA 3GUBA 4W4XA 3W33A 5L6PA 2R3KA 5CSVA 3DCVA 3MVLA 3ZO2A 3PSBA 2I7QA 3FI3A 3EFJA 2BAKA 3NAYA 1UVRA 5CAPA 2ERKA 2Y6OA 3Q04A 2C0IA 2C6DA 4BCNA 3QXOA 3GU5A 2I6LA 3CJGA 2H8HA 4YJQA 3ZOSA 5CEKA 3GT8A 4U81A 4CFUA 1NXKA 1PYXA 3PWDA 3G9LX 3RAIA 3GU8A 3UIBA 1U5RA 3TI1A 2NPQA 2PVNA 4R7IA 1DM2A 1SVEA 2W96B 4K77A 4RC2A 4FTCA 1W7HA 4EH9A 1NT2A 4M0YA 5C27A 3SC1A 4E4LA 3G90X 3KXZA 3VS1A 2WMXA 4WSQA 2HWOA 2WMQA 5IQFA 3TV7A 1AGWA 3LJ1A 3E5AA 4J53A 5M53A 4X2JA 4IB5A 2XB7A 3PSCA 4RZVA 2EB2A 3DJ6A 3HV6A 2QG7A 4ITHA 5H8BA 5T6KA 4AG8A 4UWBA 4EK6A 3QYZA 5HNIX 4BDBA 3NEWA 4L7SA 1P14A 4USEA 5HO7A 2BRHA 1GNGA 2GNFA 4NU1A 4TRLA 4I6HA 2BDFA 2WMBA 3OEZA 1H26A 4AW1A 2A19B 5EM5A 3ZSIA 3ALNA 1K9AA 3L9LA 5K3YA 3P4KA 3ZEWA 4ASZA 3AC1A 4XP0A 4L3PA 5E8VA 4ZEGA 3V5TA 2VV9A 4QD6A 1WFCA 3SW4A 4FGRA 3FYKX 4FTMA 3ZFYA 4JR7A 3C5UA 1YOLA 5M09A 1IR3A 2C5YA 4XEYA 4NEUA 3V51A 4AZEA 5DOSA 3PZHA 2JEDA 3EHAA 4J8MA 4WD5A 3UP2A 2E9VA 4UN0C 3GFEA 5K9IA 4IWQA 5E9EA 4OTPA 3MPTA 5LVNA 3UDBA 5KKRB 3Q96A 3IGOA 3LVPA 5BYLA 3ZO4A 3FLSA 3GCQA 3E8CA 4YHTA 5E1EA 4UXQA 3RP9A 4CFMA 2UZVA 4F9CA 4U45A 1R1WA 4JX7A 5FP5A 4IQ6A 3FMEA 4OT5A 3TN8A 2HZIA 1TQPA 3DKGA 3DK7A 5AAFA 3PJ2A 3ZM4A 1YQJA 2C5VA 3ATSA 4OTGA 4F4PA 4MK0A 4O0XA 3LZBA 4M14A 5EDQA 2J0LA 4G3CA 5AAEA 2ITXA 4C57A 4CZYB 2HXQA 3RAWA 1ATPE 3BGQA 5HHWA 4AZFA 4FV4A 2RKUA 4DEEA 3CQEA 3ZCLA 4CYIA 4IX3A 3CTHA 5LVPA 1M7QA 3HAMA 4FKLA 4F7JA 2PY3A 4D4YA 1O9UA 2XZSA 4QTBA 4TWCA 3DAKA 3P7CA 3EQRA 4I20A 5IQAA 1X8BA 4B9DA 5E4HA 4QPAA 5DH3A 1YVJA 3F2NA 3FZRA 3A7IA 4YZMA 4D1ZA 4E93A 5CU2A 2J51A 4ZY5A 5J8IA 4FT9A 2BMCA 4MVFA 3PVUA 3R9OA 4C2WA 1YWRA 4RMZA 3MSSA 2ZM3A 2RL5A 3R22A 3TUDA 3D15A 3V6RA 5DR9A 1JKTA 2YWVA 3KK9A 4EHEA 1SNXA 4EH8A 1IAHA 2JD5A 4J7BA 4EH5A 3SOCA 3ACJA 3ZUVA 5FRIA 4TXCA 5IUGA 4EOOA 4ZS0A 1PMVA 2PZPA 3CY3A 4BCQA 3C0GA 4XG9A 3SRVB 4RIWB 4YGAA 3RHKA 5CNOA 5HD7A 3A99A 2JFLA 2QI8A 2OKRA 4F99A 4FTTA 2HW6A 2C68A 2WEVA 3MGYA 2IPXA 3OMVA 4D58A 2IZTA 2ZMCA 4FUYA 4IZYA 5AUVA 5IUHA 5JEBA 4D4SA 2PVLA 3KRRA 4L01A 1PKGA 4EHGA 2QCSA 4UWCA 4HW7A 3NUYA 5M56A 4Y85A 1P4OA 3ZFXA 5EI2A 4G5PA 1BX6A 1JPAA 4II5A 1GZOA 3GP0A 4XYFA 2QVSE 3VUHA 2XK8A 4N0SA 3ZDIA 2HZNA 3C0IA 1W98A 2OXDA 4RQKA 4O7ZA 3NUUA 4HGLA 5HICA 5JFXA 2QOBA 4BRXA 3TKUA 4I0RA 2G9XA 4O7TA 3EZRA 4MTAA 3I5ZA 4YJUA 1VZOA 4M7IA 5EHLA 5M4FA 4J71A 3LMGA 3DBEA 4FKUA 4GL9A 2PZ5A 4PTCA 1Q5KA 5JFWA 3MESA 3ZM9A 3QTSA 4C4JA 3R73A 1W82A 1PKDA 2PVKA 3DGKA 2J5FA 3MFRA 2VN9A 5FTQA 2ZDUA 5DR6A 2XM8A 3KN6A 1E1VA 4ZTLA 1IA8A 3GU6A 4NZWB 4F9BA 2QHNA 4LOPA 1MRYA 4IJPA 3NVMB 4ENYA 4UX9A 5DNRA 3ERKA 4MD9E 4D2VA 4BBMA 4PY1A 4KNBA 2UW6A 1RW8A 3QTXA 2QLQA 4JI9A 2GNGA 2OLCA 5IA4A 3A2CA 4U7ZA 1KOBA 3LKMA 4K18A 1UKHA 3PJ1A 5FUTA 4E5WA 2R3HA 1YKRA 3VS4A 3H9OA 4WRSA 4PPBA 3IK3A 2W05A 4O38A 4UMQA 3D14A 5EHOA 3TJCA 4O96A 4BDFA 4M67A 2YFXA 3LFBA 5CI6A 5AUXA 5HIBA 5I9WA 2PSQA 3P08A 4BYJA 4BGQA 4M3QA 4XNEA 2J0IA 4FL3A 2BRNA 3HMNA 3VRZA 5HE1A 2OFUA 3ZTXA 5ACKA 4R77A 1OUYA 4BCPA 3K54A 4JRVA 3TXOA 4NTTA 1J7IA 4XV1A 5CASA 3D7ZA 4C34A 2ZYBA 4FIGA 4C4FA 1GZNA 1WVXA 3CLYA 2VGPA 3A7HA 3TT0A 1KV1A 4GT3A 2WMUA 3R71A 4YJTA 5BMMA 1DS5A 1WVYA 3RCDA 1CKJA 4P2KA 2PE0A 4RZWA 3FHRA 4D9TA 2WU7A 1J7UA 2Y0AA 5BVWA 3MY5A 4AW2A 3DK6A 5AV3A 3O96A 4E6AA 4MD8E 3TTIA 1BI7A 2GDOA 3OHTA 1TKIA 5GINE 4RX9A 3NW6A 2BKZA 1KUTA 4WKQA 4ACGA 2UW7A 4D0WA 2WQBA 4QP7A 3HNGA 1Y6BA 4J98A 4L7FA 4ASXA 1KE6A 3UBDA 5HO8A 3C1XA 4G3DA 5AR4A 4DF3A 2ZV7A 4YTIA 4B8LA 2C6EA 4RJ7A 3FXZA 4RJ4A 2BAQA 4FICA 4JAIA 1FQ1B 5E8XA 4QQCA 4AT4A 4EYMA 5CX9A 4X3FB 4EOPA 5B0XA 3QTQA 5J7BA 3BBTB 2IW8A 5HLNA 4ARKA 4TL0A 3F6XA 4BTFA 5L8LA 2XNGA 2ITUA 2C0OA 1VR2A 2H96A 2P0CA 5IA3A 3R7GA 1OIYA 4EZ3A 4ZSLA 4O27B 2JIVA 2R3IA 3FLZA 3G0FA 3N51A 4U3YA 5HBHA 3OCGA 1U4DA 5EDRA 4BHZA 4ZY6A 4CFFA 3NUNA 4FIJA 4TWOA 3WI6A 5L2WA 4RC4A 2GS6A 1NY3A 1KE8A 3ITZA 3OUKA 4GUEA 2DWBA 4RWJA 3TWJA 3AT2A 4DG2E 1OPLA 2V62A 4FKWA 4ITJA 4R3PA 2YIYA 2R3FA 2QOHA 5L2TA 3FE3A 4BDIA 4BDJA 4I5PA 4KBKA 4RIXB 4W4YA 5DBXA 2VO0A 2OJIA 3R28A 5A6OA 5IA1A 3DTCA 2XCKA 5FXSA 4A9UA 5L8KA 3N9XA 4WSYA 4CSVA 3VUGA 4IAZA 3UE4A 2C5OA 4RVLA 4R1VA 3SW7A 3ZLYA 1CM8A 3VS3A 3NYVA 5C4KA 3TZMA 2QC6A 3G6HA 4BDCA 4FV3A 5DHJA 4FKPA 3AD5A 3AT4A 1QPJA 5JQ8A 2QODA 4DC2A 5I9VA 1SM2A 1J3HA 2W1EA 5L6OA 3H9RA 1YDRE 3F82A 3PJ8A 5FXRA 4BZDA 4GW8A 5DRDA 4M69B 2OH4A 3BV2A 3ZBFA 2ITOA 4PNIA 2FYSA 4QO9A 4O2ZA 3R63A 1UWHA 3VVHA 3QCQA 4AW0A 5KMMA 1XR1A 5CQUA 5EI6A 5HVYA 3HDNA 5T3QA 4DFXE 4EK4A 1O6KA 3QRTA 3R9HA 3ZUUA 4G1WA 3MJ2A 2QHMA 2WNTA 3P9JA 2YABA 3BU5A 3KRWA 4EHVA 3FEGA 4ACDA 2E2BA 3NDMA 4MCVA 4BDGA 4FE2A 4PPCA 4FTUA 2UZEA 3COMA 4RVTA 2XYUA 4EQMA 1REKA 4QMSA 4AFJA 3F7WA 2YM6A 4CFNA 5HNBA 3WF9A 4F9YA 2VZ6A 1NVRA 4BI2A 1ZY5A 3ZMMA 4PTGA 1M52A 5KHXA 3UTOA 4CCBA 2XRWA 3BHHA 4J96A 3RPYA 1M2RA 1O6LA 3F2AA 4A9TA 4FV6A 3VHKA 4RC3A 3ID6C 3E8EA 2GFCA 3GCUA 3DPKA 2YN8A 3U8WA 4A9SA 3OZ6A 3Q4ZA 2VTMA 2VWXA 3RWPA 2X7FA 4I6FA 5FP6A 4APPA 2X7OA 5EYMA 2PK9A 4C58A 5IU2A 1ZYDA 4FVQA 4O91A 2R2PA 4CG8A 1ERKA 4IBMA 3HX4A 4OR5A 3IW6A 5F1ZA 4E5AX 2C6OA 1XH9A 5CEQA 1H8FA 2NO3A 2R3PA 4FODA 3AMBA 3SRVA 3VUTA 3HZTA 3M42A 2PVYA 4RIWA 4GU9A 4X2FA 4LG4A 4RQVA 5BUEA 5J7HA 2QOIA 3CD8A 4OW8A 5D10A 2ZJWA 4OUCA 2YCFA 1FVVA 1L3RE 4PF4A 4GH2A 3WF5A 4CQGA 3U54A 4LOQA 2HYYA 3DY7A 4HJOA 3MFTA
chains in the Genus database with same CATH superfamily
3LCKA 4IM0A 4EZ5A 4NK9A 5KUPA 4I5MA 4DFNA 3QCXA 3UQFA 3QC9A 4DFZE 2VTAA 2CLXA 5D7AA 3W2QA 3R9RA 3RKBA 4KKGA 2WOUA 4K0YA 5AR2A 3RHXA 4GFMA 4DLIA 4E4NA 3L9MA 2GTMA 4ZZNA 4DT9A 3PRIA 4QMPA 4NSTA 4GCJA 4ANSA 4GT4A 2OXYA 3ZLSA 2DQ7X 3HV3A 3BKBA 5I0BA 5TR6A 4IZ5A 4BDDA 2X2LA 4CCUA 4U5JA 3F5PA 4YP8A 5HE2A 5IQGA 4G9RA 2IN6A 5IQIA 4NCTA 3GCPA 4FNYA 5CZIA 4FNZA 5KZIA 4S33A 4ANNA 4G3EA 4C59A 3JR1A 1WBPA 4C4HA 4C33A 4U43A 3AC3A 4RFMA 3AD4A 4JL9A 5L2QA 2BTSA 4CRSA 1YOJA 3FDNA 4D4RA 5AUZA 4CLIA 4CVAA 3M1SA 4BCOA 2ZV2A 3EN7A 4TWNA 5IQCA 2AC3A 3QL8A 1JBPE 4I93A 5J9LA 2GNIA 3AT3A 3RNIA 5BYYA 4EOQA 4QTAA 1Y6AA 1YXSA 4QQ5A 4NT4A 2B9HA 3CR0A 4EOLA 3D5UA 3QZHA 4L8MA 4C3RA 2YAAA 4CMOA 4FYOA 3AXWA 2JKOA 4LM5A 2V7OA 4FG7A 1KE5A 4UMTA 1IRKA 4JQEA 3TNHA 1QPEA 3DDQA 3I4BA 2ZVAA 1WMKA 3G33A 3VBYA 2C1BA 3R7EA 3R04A 4KIKB 5DT0A 4BIBA 4KIPA 5ANGA 5G1XA 3LFFA 4PUZA 3FMLA 4BB4A 4FV9A 1R3CA 5HU9A 1ZOHA 5IH4A 4LL5A 4WG5A 1VLRA 3ETAA 5DFPA 3OTUA 5K4IA 4Y73A 1UNHA 4GU6A 2XK6A 3QD2B 1UU7A 1PW2A 4NW6A 3CSVA 2BALA 2BROA 2ITZA 4KKEA 3G5DA 3MWUA 4M15A 3LMHA 5FBNC 4S30A 1ZAOA 2IZSA 4ANQA 4L67A 4IVBA 5ACBC 2WPAA 4G17A 2QO2A 3DZQA 4Y8DA 5CYIA 4F09A 2VTHA 3DXPA 1K3AA 4XH6A 5DE2A 2GNJA 4G5JA 4FV0A 3W8LA 4WNOA 4YJOA 4QYYA 4R7HA 3V5QA 3BBWA 5E91A 3MVJA 1U46A 4ACMA 2AYPA 4BC6A 2BZKB 4RRVA 4MNFA 3FUPA 2JBPA 3JY0A 3MV5A 3EFLA 4U9AA 4A4OA 5CS6A 4X2KA 3ZC6A 2WTWA 3E8DA 4FVRA 3EZVA 2BRMA 2JIUA 3PY1A 4AGWA 3NUAA 5D41A 3UMXA 4AS0A 5IQHA 1CMKE 2FVDA 2QD9A 2W5HA 2WTVA 3Q9WA 4FA2A 2CGVA 2RFDA 4BZOA 4D5KA 4PP7A 2BIYA 3FKLA 3MW1A 4USDA 2BFYA 4BZNA 3TDWA 3O2MA 2VWYA 3BHUA 4ZAUA 3QQLA 3GBZA 4X3FA 4XUFA 3WIKA 4CMTA 4GT5A 5FM3A 2OZAB 4YBJA 3JVRA 4FV8A 2CSNA 4U3ZA 4TKSA 4D2WA 4OT6A 3ZLWA 1MQ4A 4EBVA 3POZA 2X1NA 5IA2A 3PA4A 4BI1A 3NNWA 4MBJA 3V8WA 3FMMA 3A8WA 3OBGA 4MQ2A 4QP9A 3ZONA 2G2HA 3LCDA 3RWQA 3ZSHA 1OL2A 2CNQA 1FGKA 3Q52A 3SG8A 3QTUA 3P1AA 3TKHA 2B53A 3DAJA 4C02A 5EM6A 3OFMA 3PP1A 4GK4A 2X0PA 3I60A 4KSQA 4QTCA 2J0JA 3FMNA 4CT2A 4BGGA 3ML1A 2XIYA 2ZV8A 2ETMA 3IECA 3LXNA 4GEOA 4L43A 4UMUA 5IH5A 3JS2A 3HMOA 3IO7A 3RAKA 3ZRMA 3GGFA 4RIXA 2F7ZE 4AOTA 4X21A 3AGLA 1OZ1A 4KD1A 4AGDA 2J90A 4P5ZA 4DH3A 2IW6A 3I81A 3R83A 2W06A 4FSMA 2VO6A 5E8TA 2W5AA 2WIHA 2RFNA 3PP0A 4RFYA 4YPSA 3QA0A 3U55A 2VTJA 2XP2A 4GK3A 3PPKA 5BVOA 3LHJA 1JVPP 2UVZA 3CTJA 4E1ZA 2V22A 3DBDA 2I0EA 3QD4A 4QYEA 5CF4A 3MY1A 3VC4A 3W0PA 3R30A 3EQHA 3FZSA 2WTKB 2B9FA 3PIZA 1MRVA 3P79A 1FMOE 4C4GA 4M69A 5L8JA 3FPMA 3W18A 3FYJX 3BZ3A 3U6JA 4CRLA 2BCJA 1YDTE 2YWPA 2CNVA 4C2VA 2WMVA 3SXRA 4AN3A 2XA4A 4A7CA 4YZCA 4AXCA 2WZJA 4J1RA 1H27A 1QPDA 2F7EE 1GZKA 3W0NA 4YSMA 5EOBA 5K0XA 3EL8A 1UKIA 4O0TA 5E8ZA 2JITA 4KBCA 5B2MA 5IEYA 2JKMA 3GI3A 4ANLA 2R3LA 2CHLA 4RA5A 4F08A 4IAKA 3UC3A 2QKWB 2UZOA 2VX3A 3S1HA 3NZ0A 4ZTSA 4KSPA 4I1ZA 3ZSGA 5CSWA 5CEIA 3Q5ZA 4M12A 5EYDA 3PVBA 4KRDA 4YJVA 3LFDA 4HYSA 3KL8A 3H4JA 3L9NA 3UZRA 1YXUA 4P4CA 3WE4A 1GY3A 3F66A 4RLKA 4CG9A 1CTPE 3PY0A 4O7YA 4FKSA 3FI2A 5LWMA 5FTGA 3A62A 3L8XA 3FXXA 3QCYA 1FOTA 2OICA 2UW4A 3MA3A 4L45A 2R7IA 3UOKA 1BI8A 3MH3A 5A46A 4PDOA 5LVMA 1ZMUA 4JDKA 4ZJJA 5D9HA 4GRBA 3S4QA 3QZGA 1R0EA 3NW7A 4KWPA 4QRCA 4ZJIA 3RMFA 4AAAA 5JQ5A 3QBNA 2OG8A 4K6ZA 3D5XA 3E64A 5JGBA 5I9XA 2UZDA 3P7BA 2OFVA 5T68A 3RK5A 3BQRA 4MWHA 4JR3A 3MVMA 4H39A 3OG7A 3W32A 3ANRA 2Z7RA 4BDKA 5EKOA 3DBQA 3HEGA 1RE8A 3KULB 4XBUA 2J5EA 4G6OA 4GUBA 4OTFA 5IDPA 2YIXA 3RNYA 5L2IA 3F3ZA 4N6ZA 3UDSA 3U9NA 3SD0A 3IGGA 5AP4A 2RSVA 3KXNA 3HYHA 4U6RA 2FSOX 4O4FA 4L52A 4IX4A 5HGIA 3VN9A 4CXAA 2KTYA 2W1GA 2YZLA 5J5SA 2FSLX 2Y4PA 3MBLA 5CF6A 4BWXA 3OC1A 3DQWA 4WUNA 4G6NA 1JLUE 4I0TA 5IUIA 4S2ZA 4QYGA 2I1MA 3GOKA 3UOHA 3VHEA 4Z55A 5CSXA 1H00A 2C6KA 2XMYA 5A4LA 5BNJA 5LMKC 5AV0A 3NUXA 2XS0A 3GFWA 2H6DA 5GJFA 5CI7A 2C6IA 5DRBA 5FWKK 4E6CA 1DAYA 4FKTA 2XIZA 3HAVA 2JC6A 3F88A 3IDPA 3KA0A 3VW6A 3A7GA 2OBJA 4FNWA 5CF8A 3EQBA 3BLHA 4G6LA 5HO6A 4OTHA 4LV5A 4A06A 4FIIA 4FEQA 4X2GA 2UVXA 4V0GB 4AQKA 4Y83A 2XK7A 4KKHA 4DHJA 4APCA 5AP7A 2P2HA 4YO6A 4KUJA 2W4OA 1Q61A 3W8QA 3BL9A 3VUMA 4IIRA 4JBOA 3OCTA 3OVVA 3RVGA 2JLDA 4HCTA 4Z7HA 4DINA 2WTDA 3DKCA 3HRCA 4Z9LA 4UYNA 4KIKA 5LQFA 1Q8TA 3QWKA 2HY81 3ZDUA 1V0PA 2H34A 3BEAA 3B2TA 3IONA 4QNYA 5L6WL 5AUTA 1GIHA 3RZBA 3SX9A 4DGGA 3R8UA 4V01A 2F2UA 2VTLA 4WNPA 2XANA 5E8WA 3BIZA 4IE9A 1JKSA 2X4FA 3C0HA 3P86A 1GIJA 3MDYA 2VNWA 4PRJA 3MVHA 2ZFYA 4R78A 1XKKA 2CKQA 1DAWA 4J52A 2GCDA 4UXLA 3W2OA 5JMSA 1MQBA 4RJ3A 4HVGA 3DAEA 4G9CA 5GZAA 4BDHA 3R1QA 3LQ3A 4YNOA 4BDEA 4RA4A 3E3PA 3TNWA 5E1SA 3P5JC 3C4EA 4UV0A 3SGCA 1BL7A 2PVHA 4H36A 2C5NA 5ETAA 3BLAA 3D7TB 2VTTA 2W4JA 3OT3A 5AIRA 3FZ1A 2YDKA 5I9UA 3RPRA 5HCZA 3S2PA 5CXZA 3GQIA 4L9IA 3L9PA 4B99A 5I3OA 5A14A 5JFVA 3A4OX 4A9RA 3ORNA 5HVKA 3TZ9A 4FBXA 5HE0A 4C37A 1YOMA 3UIMA 4G34A 1QL6A 4HCVA 4E5BA 4FC0A 4XG3A 3FLNC 3OCSA 1VYZA 4XG2A 1LEZA 2G2IA 4B8MA 3TUCA 2Y9QA 4JIKA 5EQPA 3QD0A 1BKXA 4FL2A 4TT7A 3LXLA 4MXCA 4KAOA 4O2PA 4FK3A 2OZAA 1SZMA 4FMQA 4HNFA 3QHRA 4O0WA 5JZNA 2RG5A 4B4LA 2PMOX 5AAGA 2C30A 2CDZA 2F7XE 5ANIA 4BI0A 1JOWB 3AQVA 3KGAA 3NYXA 2YCSA 3UNZA 3NUPA 2XKCA 2VWBA 3WIGA 3R1YA 2NRYA 3COKA 3CQWA 3DXNA 3FY2A 4ID7A 4MF1A 4QMZA 4LV8A 1ST0A 5I9YA 1XJDA 1XBBA 3GQLA 3OD6X 4KINA 3R9DA 4BICA 3NSZA 3P0MA 4GIIA 3R2YA 3TUBA 3Q6WA 3MPMA 3PG3A 4OLIA 1PXIA 4FTNA 3QZFA 4O1PA 1TQIA 4PL3A 3VS2A 3VWAA 3OTVA 3NPCA 4F9AA 2VTNA 2JAVA 2OK1A 2W1FA 1B39A 2VTQA 2WQNA 3QZIA 1J7LA 4RJ6A 3CGOA 1JWHA 1PMEA 2VWZA 3R7YA 4R5SA 5H8EA 2CKOA 2B4SB 5L4QA 4L53A 1YHWA 4MBLA 4E7WA 2HZ4A 3IOPA 3A60A 3UGCA 4F63A 4DCEA 1G8SA 2O2UA 4MXZA 1OECA 3HMPA 2WMTA 4LGGA 1L8TA 1OPKA 2A4LA 2R3MA 4MAOA 5CENA 3RJCA 5JKGA 4BYIA 4J99A 1OPJA 1I09A 3FZOA 3IW7A 1YHSA 4FSRA 4IZAA 3K5UA 3V5JA 2XKEA 5AV4A 5JFSA 2VRXA 3C4FA 3R8PA 4FYNA 4OGRA 4I3ZA 3ZO1A 5J95A 3ULIA 3ORPA 5H8GA 3SXFA 3FJQE 4EOMA 5AADA 1OB3A 4QOXA 4IVDA 4NYEA 3VUDA 5M57A 3QTWA 2XM9A 2YERA 4R3CA 4LRJA 1KE9A 1KWPA 3CS9A 3JY9A 4LMNA 5AM6A 4DEDA 5A4EA 1OL5A 3NAXA 4Q9ZA 3K2LA 1JAMA 2CN8A 3MH2A 4XBRA 4RIYA 5IEVA 1NVSA 2W5BA 3POOA 4AOIA 4DN5A 3HA6A 2J9MA 3O7LD 4WG3A 3ZZWA 4AA5A 2LGCA 1XH4A 3O17A 5EQEA 5FG8A 4MWIA 3ORIA 3FC1X 4FV1A 5KBRA 4O82A 2C3IB 3EL7A 1NVQA 2UUEA 4YPDA 4BCKA 4D1XA 2R4BA 5EHYA 2VTOA 2XBAA 4P5QA 1SVGA 2JDSA 3BU6A 4AU8A 1Z9XA 3VBQA 5KMOA 4FRFA 2CN5A 3H3CA 4QMXA 4AXFA 2JKQA 3CBLA 4EQCA 5DN3A 2W17A 3LFCA 4RWIA 3ROYA 4C3FA 4DH1A 4PDYA 3UP7A 1XBAA 3KK8A 4NM0A 5KO1A 5F4NA 2OU7A 5DEWA 1JQHA 2W0JA 4WA9A 3D0EA 4IVAA 3UG2A 3F3TA 4G3GA 3MS9A 3ZU7A 4QMNA 5E7RA 3O5AA 5KE0A 5D12A 5C8KA 3S95A 4HGEA 4A4XA 4AGUA 4X3JA 4ZSAA 1I44A 2QLUA 3GNIB 3LJ2A 3KF4A 4XV3A 4UEUA 4RX5A 4GFOA 2Y4IC 2ZDTA 2XNBA 3VIDA 2W7XA 4KABA 3OY3A 5K5NA 3F9NA 3CKWA 4LV7A 4O4DA 5HG8A 4QPSA 5DT3A 4IZ7A 4YO4A 5A9UA 4YBKA 5LMBA 3BYMA 3PE2A 4A07A 3KULA 1H4LA 4N70A 3NRMA 4K1BA 5ETCA 4AF3A 1SNUA 4JBQA 5K4JA 3KVXA 4R6VA 4FKQA 4TY1A 4IFGA 3WYYA 2BHHA 1OIUA 5IEXA 3PY3A 1A48A 3ORLA 3OCBA 3NNUA 1TVOA 4RVKA 3BHTA 4MHAA 4FZ6A 4NM7A 5ANJA 3UIXA 2ZV9A 3FKNA 3Q4TA 3V6SA 3MH1A 5CY3A 2F4JA 4A9YA 1Z57A 3EFWA 3V3VA 5AFVA 2VNYA 3W1FA 4AOJA 4FKVA 4AA0A 4MXYA 2ITNA 3RTPA 4PMSA 2QQ7A 3D2KA 3UODA 2PMIA 4DGOA 3LXPA 5E92A 3QGWA 4IB0A 3PLAE 2C69A 4NFNA 1XH7A 4FZFB 4DH7A 3KCKA 3KQ7A 3NWWA 3R00A 2IWIA 4O1OA 4X6RA 3JPVA 1B6CB 1NA7A 3BGZA 4JG8A 1ZMVA 4H1JA 4HNIA 5ANEA 4PMTA 2YHVA 2Z7SA 3EQFA 3KU2A 4NM5A 4IFCA 1XO2B 4O0SA 4V0GA 4D9UA 4FT7A 5BX0A 5C26A 5HD4A 4FEWA 5IMEA 4K33A 3BGPA 1Q24A 4Q5EA 4CKIA 3OXZA 4FTOA 4JQ7A 1ZWSA 2UZNA 4PL4A 3BE9A 3LJ0A 4MD7E 4QQJA 3TJDA 3UO6A 1VYWA 1W2CA 4I41A 5E8SA 3TIZA 2WELA 4DT8A 2ZM4A 2OH0E 1Q8WA 5FDXA 3T8OA 5CEMA 4MBIA 5J9ZA 1JSUA 3DDPA 4JJRA 5KMNA 1ZY4A 2QKRA 4BY9E 2IZRA 3FBVA 4TYJA 5HBEA 4DGMA 5HIEA 2OWBA 2UVYA 1G8AA 2X4ZA 5CWZA 4FT0A 4TW9A 4IWPA 1OI9A 5C1QB 2Q0NA 4IAFA 2HELA 4KIOA 1Q8YA 4RSSA 4O7VA 2YM7A 2BZIB 3D2IA 5DT4A 4O4EA 2X8DA 4O4CA 4IAIA 3NX8A 4PWNA 4BCHA 5ANOA 3D7TA 3DZOA 2EWAA 5DEYA 4EONA 2XIKA 3F3UA 4K2RA 4N57A 2FSTX 3KRJA 3QRKA 1UU9A 3LLAA 3WBLA 3SV0A 4CFWA 3FMDA 3CD3A 4C61A 1M7NA 4NW5A 3RBWA 2CJMA 3MFUA 4BBFA 4EUTA 4AXAA 5CALA 3FI4A 3Q9ZA 5A3XA 4EOJA 3O8UA 3TYKA 1JKLA 4F0IA 3PTGA 4YHJA 4KIQA 1OM1A 4RBLA 3G15A 2ZM1A 1Q8ZA 4GG7A 1FGIA 3PFYA 2ITYA 2Q0BA 4XRLA 3NIZA 4E4XA 4ALWA 2ACXA 1TQMA 4G16A 1H1QA 3I6WA 2UZBA 1Y8GA 2R3QA 2VO7A 2YEXA 3GVUA 4HOKA 4I92A 3KF7A 2CGUA 3LW0A 2UW0A 2AQXA 3M2WA 3AC2A 5EYCA 4Q2AA 4RPVA 3H0ZA 3ZC5A 2WFYA 2REIA 1IEPA 3GENA 4EORA 4IWDA 5JSMA 4F7NA 4RJ8A 3R1SA 4R7BA 2HY0A 4JDJA 2YM4A 1KOAA 1R0PA 3ENMA 1PY5A 2EU9A 3DA6A 3I1AA 5TF9A 3ZHPC 4QNAA 3HGKA 5AP3A 3LCTA 4EKLA 5CU0A 3BL7A 5AP6A 2PVRA 5CSPA 3LFSA 1ZZ2A 3V8SA 4AN2A 2XVDA 2ONLC 3Q6UA 1YXTA 5EDPA 1GOLA 3F61A 5F94A 2X0GA 1UNGA 3HKOA 4JQ8A 4ZTQA 5JH6A 5HG7A 4MF0A 3GCSA 4E20A 3BLQA 4UMPA 2QR7A 2JDOA 4P7EA 2O64A 1ZXEA 1IA9A 5B2KA 1Q3WA 2OJ9A 3GU4A 3EH9A 3LFEA 4U44A 5GNKA 3BPRA 5EFQA 4DH8A 2HENA 1W84A 4ANOA 1OKYA 5FXQA 3OWKA 2ITQA 2BRBA 3OXIA 2O63A 3PE1A 3IW4A 3WZJA 4B7TA 2RFEA 3AC8A 2YLFA 4DFYA 3UPXA 4PL5A 4DLJA 3TZ7A 2FGIA 2G2FA 4QYHA 4FZ7A 4GIHA 1A06A 4O7RA 4YHFA 4RLLA 3EKNA 3T3VA 4FNXA 2XNEA 1V0OA 4CT1A 3QQHA 4IMYA 4MXAA 4TPTA 4CV9A 4CKJA 3NW5A 4PDSA 3FY0A 3W16A 3RM6A 3LXKA 3KXXA 3QFVA 4PNKA 2VO3A 3ANQA 3SAYA 4YU2A 5C9CA 3KXGA 5HORA 4O83A 4UWYA 2YM5A 5IF1A 4X2NA 4GSBA 3VQHA 1YHVA 4FUXA 2CLQA 3E8NA 4L68A 2XK3A 5AP1A 3RK7A 4CTCA 2WQEA 4CFVA 5KMJA 2E9UA 2Z7LA 4UBAA 1FVRA 5D7VA 4AT5A 3RINA 4DTKA 2XAOA 2X6EA 3HUCA 4OAUC 4JDIA 3TDVA 4XG6A 3VNTA 2AEGA 4RX7A 4HVHA 5HX8A 4TYIA 5D11A 3SQQA 5C8NA 4XG7A 4EH6A 4GMYA 2XNPA 1HCLA 2HAKA 4CTBA 3REPA 4I94A 1P2AA 4YJNA 5EI8A 5FQDC 5IISA 4GVJA 4PX6A 2GMXA 4M66A 1Z5MA 4ORKA 4XX9A 2CCHA 4TYHB 4H05A 3C7QA 3VBVA 3IOKA 1J1CA 3ZBXA 3DFCB 4MUQA 1XH8A 3FL5A 3LQ5A 2DUVA 3QTRA 4PV0A 3WOWA 2PWLA 3E63A 4MXXA 3PG1A 4DAWA 4FEXA 2B55A 2A27A 4N6YA 3WILA 1M17A 4YC6A 2XARA 2RG6A 3DS6A 2GNHA 3RM7A 2QOQA 3F5GA 4JRNA 3WZKA 4CMUA 1TZDA 4PMMA 1YWNA 4QMWA 3R7IA 2J0KA 5CU6A 2PMNX 1YI3A 3UVPA 3OY1A 2BKKA 2O0UA 5AR7A 2YDIA 3PXKA 2XEZA 4CD0A 3TACA 4BCJA 1ZARA 4LRMA 4FTIA 2F2CB 5DYJA 2WOTA 1WBTA 1OGUA 4QMTA 4WHZA 4FTLA 4GVAA 1BUHA 4ZTMA 3UIUA 1PXPA 3VUKA 4FKJA 4FTQA 2AC5A 1W83A 4KA3A 4O21A 5CAQA 1W0XC 4L44A 2YIWA 3NUSA 4TWPA 2F57A 3U4WA 4BTMA 4EI4A 5L3AA 4JG7A 4BHNA 4ZK5A 4TTHB 3WE8A 3QRUA 3Q9YA 2XNNA 4IWOA 4NH1A 2J2IB 4CZTA 3G0EA 1U5QA 3BRBA 1WBVA 3ORZA 3LAUA 3EYGA 4BR3A 3OP5A 5I5ZA 2Q83A 3RK9A 3N4UA 3R6XA 3R1NA 3U9CA 4FEUA 5GIPE 4QMMA 3FZTA 3HRFA 3KN5A 5BVFA 3PUPA 1ND4A 3QQFA 5HOAA 3AMYA 4IANA 1ZOEA 1PRYA 4XV9A 4HGTA 3WARA 2PHKA 3D5WA 4C38A 3BV3A 2OI4X 2UW3A 3BU3A 5LXMA 3E93A 4TYGA 2E9PA 3EN5A 4J97A 3CXWA 4R8QA 3G9NA 4ASDA 3E3BX 3QHWA 4XV2A 3SOAA 3CIKA 4H3PA 2BZJA 2R3OA 4DYMA 3MFSA 4FTRA 4JAJA 3HV7A 2W9FB 3EIDA 3IPHA 5G6VA 4DFBA 1PMUA 3RCJA 4FI1A 2ZMDA 4WO5A 2IVTA 3OUNB 3NMUF 4Q5HA 1Q62A 1U59A 3SG9A 2CCIA 4KS8A 2IJMA 1BLXA 5F95A 4EQUA 3Q4CA 2BFXA 2YCRA 1Y57A 4ZOGA 2X0OA 2ERZE 1PF8A 1ZLTA 1FMKA 2NP8A 3HRBA 3OWPA 5BMSA 2GHMA 1Q41A 4F1OA 1WVWA 3CKXA 3MH0A 3UPZA 3QALE 3UZTA 3R0TA 2UW8A 3NYOA 2HXLA 5HI2A 5IZFA 3KEXA 4YNEA 4OTWA 3HVCA 3TZ8A 1YI4A 4ZMFA 2VTSA 4FVPA 4AE6A 4AGCA 4JG6A 1URCA 4E6QA 4XHKB 5EW3A 5ANDA 1TFFA 4FL1A 3BLRA 3FKOA 5AX9A 3PXQA 1OIRA 2EXMA 2WB8A 3F69A 2XH5A 3COHA 4HVIA 3QA8A 3QX2A 4AXEA 1OUKA 2GTNA 4ZZOA 3PA5A 4G31A 1QCFA 3IS5A 2C6LA 4RIYB 4QYFA 1STCE 2VD5A 3PXYA 4JBPA 4E3CA 4FSUA 5EW9A 2BDJA 5J9YA 5LOHA 4RX8A 5KMIA 1IG1A 4I21A 2CPKE 4EH7A 3Q9XA 5IDNA 4W8DA 2CKEA 3MA6A 3OF0A 3PA3A 4MYGA 1PMNA 3QXPA 1GIIA 5C03A 1XH6A 5FEEA 3UNJA 3H9FA 2QO9A 1P4FA 2VWWA 1M2QA 3D4QA 2QR8A 3QTIA 1H0VA 4C8BA 1YXVA 2C1AA 3EJ1A 2Z2WA 2OSCA 4MQ1A 3T9IA 5TO8A 5IQDA 2UZWE 1YI6A 4Z3VA 3MIAA 2B52A 5BUJA 2YJRA 3OEFX 2B54A 3I5NA 3FLYA 4IX5A 2QURA 3E88A 4OBOA 3MY0A 4D4VA 4YSJA 3DLSA 5HCXA 4BWKA 3ZYAA 3COIA 4ZJVA 1OL7A 2P4IA 2WO6A 3U4UA 3DNDA 5E8UA 5CXHA 3KREA 2V7AA 3FWQA 2XALA 1CKIA 2WTJA 3GU7A 5AX3A 4C4EA 5EKNA 1H24A 2PMLX 4AAYA 5HBJA 4W9XA 3NFFB 3HECA 4XLVA 3VBXA 3P5KA 4JXFA 2PTKA 4ZLZA 3W55A 4FG9A 4EOSA 5M4CA 3R8VA 4ERKA 3QC4A 4FSWA 4U40A 1H1PA 3VBWA 4C4IA 2O8YA 4E6DA 5JRQA 3RALA 4H3QA 4GKHA 2BPMA 3FC2A 1OKZA 2Z60A 4LUDA 3PRFA 2QOLA 3KCFA 2V5QA 4AE9A 3MPAA 3R2BA 1Q4LA 3ODYX 3EN4A 4F70A 2VAGA 4F1MA 4IM2A 4DHIB 4S31A 3SXSA 1H1RA 4JBVA 2PUUA 1HCKA 2VGOA 3UQGA 2GS2A 4WG4A 4LUEA 4F0GA 2PYWA 2XKDA 5TE0A 2R0UA 3Q4UA 4O0YA 5A4CA 2QG5A 4QMYA 3QUPA 3OWJA 2BR1A 5J5TA 2PUPA 4HYUA 2C3JA 3KY2A 3VONA 5KBQA 2BAJA 1MRUA 4M0ZA 4JT3A 5AUWA 1BL6A 2YDJA 1AQ1A 4ZIMA 4GS6A 2J0MB 3AG9A 4BTJA 3JYAA 4QP4A 3KXHA 2X2MA 4ZZMA 4BKZA 4XRJA 4LI5A 2O3PA 4ZSEA 4BIEA 3R7VA 3OWLA 2W99B 3DU8A 2GHGA 4FT5A 3FXWA 2PZYA 4U0IA 4I23A 3BYVA 4QP6A 4HPUE 5DWRA 3UC4A 5BVDA 1H25A 5D1JA 2ZOQA 4I6QA 3ZH8A 1MUOA 1K2PA 5LCKA 2PE2A 3FLWA 3ZFMA 4OAVB 3AKLA 1H0WA 1OBDA 1UU8A 5KX8A 3DTWA 4TYHA 1RQQA 3HA8A 3IW8A 5KKRC 4D5HA 4IHPA 2GNLA 3MTLA 4OTRA 2C6MA 2P33A 3DB6A 3O8PA 3P7AA 3T9TA 4MX9A 3LCOA 2WTCA 3WZDA 2V0DA 4BN1A 4YJRA 3Q5IA 3TNQB 3EQDA 4KBAA 2X9FA 5BVKA 1FBNA 1PXNA 1H01A 4UYAA 3ZO3A 4PTEA 3W10A 3ZZEA 4DDIA 3T3UA 3LPBA 2YZAA 4XMOA 4AZSA 3C9WA 1U54B 4EK5A 3A61A 2GSFA 4DCAA 3TNPC 4CNHA 5HNGA 5LMAA 1V0BA 4AUAA 3VJOA 3FSFA 5KCVA 3QRJA 1GJOA 2B1PA 1T46A 4Y5HA 5CSHA 2BTRA 4QTDA 5CF5A 3DNEA 3O71A 5IA0A 2YA9A 2HZ0A 1FINA 2VUWA 3BYSA 2V55A 5IKWA 3VBTA 5CEPA 2UZLA 5TOZA 2UV2A 4QP2A 1LUFA 2P55A 2WHBA 3FMJA 3ODZX 2CGWA 3NYNA 2YIQA 4YLLA 4IB1A 3QWJA 3F7ZA 1O6YA 4DEBA 2ITWA 3ZS5A 3C50A 2DYLA 4FK6A 4ITIA 4DE4A 3A4PA 4BDAA 3EQCA 4O4BB 2NRUA 2JGZA 3JUHA 3CC6A 3OXTA 4Z16A 1APME 4YLJA 4FZAB 2W1ZA 4ASEA 4FKRA 4NIFB 3N4TA 3LFNA 1ZRZA 3QYWA 4ZSGA 4PP9A 3THBA 4EH3A 3LQ8A 5AV2A 1R78A 1YDSE 4DEHA 2EB3A 3TNIA 4FJVA 3DBCA 4UALA 3RAHA 3EFKA 2UW5A 2WXVA 1KE7A 2GQGA 4M68A 4NKSA 5CT0A 5CU3A 3BEGA 5DI1A 4AZWA 4EH4A 4V04A 3IG7A 4QMVA 1PJKA 2GPHA 3PSDA