4D4SA

Focal adhesion kinase catalytic domain
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
272
structure length
255
Chain Sequence
YEIQRERIELGRCIGEGQFGDVHQGIYMSPENPAMAVAIKTCKNCTSDSVREKFLQEALTMRQFDHPHIVKLIGVITENPVWIIMELCTLGELRSFLQVRKFSLDLASLILYAYQLSTALAYLESKRFVHRDIAARNVLVSATDCVKLGDFKLPIKWMAPESINFRRFTSASDVWMFGVCMWEILMHGVKPFQGVKNNDVIGRIENGERLPMPPNCPPTLYSLMTKCWAYDPSRRPRFTELKAQLSTILEEEKLQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords FOCAL ADHESION KINASE 1
publication title Allosteric Regulation of Focal Adhesion Kinase by Pip2 and ATP.
pubmed doi rcsb
source organism Gallus gallus
molecule tags Transferase
total genus 79
structure length 255
sequence length 272
chains with identical sequence B
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2014-10-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4d4sA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4d4sA01
3R7GA 5EOLA 4HYIA 3WOWA 3VBWA 2X9EA 5B7VA 4ZJIA 1JKSA 2ZM1A 1LP4A 1Q97A 3IG7A 4FKIA 5K0KA 3W2OA 4C4EA 4YC8A 2GPHA 3W33A 5B2MA 2XKFA 3NPCA 4F9YA 4IFCA 3R7UA 2Y6OA 4FT0A 5ICPA 4FK3A 3BGQA 2WQOA 4PDYA 4PY1A 3EB0A 2WOUA 4FKPA 5AMNA 4FNYA 4IH8A 2PVYA 3OTVA 2ZOQA 4XG6A 4EKLA 4D1ZA 4BWPA 3CKXA 4CCBA 3ALOA 4ERKA 2H8HA 4EOIA 2UZUE 4L44A 4NL0A 2VTLA 4CYJA 4EHVA 5D1JA 3DFCB 4PTCA 2I0VA 3ALNA 3LJ1A 2GTNA 4QRCA 3P1AA 3TZMA 4CYIA 2VTRA 5AP4A 2IN6A 2B54A 5AV1A 3FKOA 3O0GA 1A9UA 3WARA 4OT6A 4W4WA 4ZS4A 4YTHA 4IHPA 2VX1A 5A46A 2YM5A 5IA0A 5T3QA 3OW4A 3WZJA 4L3PA 3PXKA 5CZHA 2Z60A 2VWVA 3EQFA 4FICA 1OUKA 2QOQA 3E64A 3MTFA 4GL9A 4NM3A 4BICA 2ZMCA 5A3XA 3O51A 5CNOA 4O7RA 1B38A 4XV1A 4BTMA 1UWJA 2G01A 3Q6UA 4L42A 4EOJA 2W4OA 4TYGA 3LLAA 2A4LA 4GK2A 4FSWA 4UY9A 3DAEA 1K9AA 2W1CA 3AC5A 2BZIB 4NIFA 3QQKA 4H3QA 4Y46A 4ANLA 3GT8A 1V0BA 2BRBA 2G2IA 5EM8A 2JFMA 2I7QA 1E1XA 2C4GA 2UW6A 3K2LA 5HO6A 2PVRA 2IW8A 3LM0A 1P4OA 2IJMA 4EH9A 3ODYX 3IW5A 2QOLA 4BHZA 1PXMA 2UUEA 3S2PA 4BGQA 2ITXA 5AAEA 4CFFA 3FC2A 3MTLA 3RPSA 1PXLA 3FI8A 3LLTA 4BC6A 2A1AB 3AOXA 4O0UA 2ZM3A 3EMGA 4J1RA 1YRPA 2JD5A 3UNJA 4H05A 1NA7A 4QYFA 4A4XA 3PTGA 4RJ4A 2W1GA 5KHWA 4FT7A 4JDIA 4FT3A 3DAJA 1VR2A 4FV3A 2JIIA 4MAOA 5AUVA 3ORLA 4QMSA 4FIEA 4I4EA 4YJPA 4EC8A 3UO4A 4FVRA 1IR3A 2GFSA 3PG3A 2J5EA 5IQIA 1R78A 2A27A 4B7TA 3R63A 5IH4A 5GHVA 3NAXA 2R3IA 1WCCA 3PIXA 3MJ2A 1LEZA 4Y5QA 4XG7A 3MIYA 5DMZA 3BQCA 4GUEA 3MDYA 4G17A 4L00A 3TKUA 3VW6A 3C4ZA 3I0OA 4BDAA 1JSTA 4YZDA 3ZO2A 4D55A 4DEEA 3OCTA 5HIEA 1U5QA 4MTAA 3SQQA 3O71A 3COIA 4DA5A 3KA0A 1F0QA 3R7IA 3IO7A 5E9EA 4BR3A 1GZOA 3B2WA 4IAYA 3FC1X 1AD5A 4KSPA 4ACDA 2IZSA 1XR1A 3G90X 5GZAA 3D2IA 3OROA 1YWNA 2AC5A 5ANGA 2QC6A 4MEDA 1XH9A 1YDTE 4YUQA 3TI1A 4ZIMA 2JIUA 3MIAA 4ZSLA 5IEYA 2G2HA 4C2VA 5HU9A 3KULB 4BVUA 2OICA 4Z3VA 4ZSAA 1IAJA 3O7LB 2ITYA 3RALA 2ITTA 2F4JA 5DE2A 1S9JA 2BHEA 2PMNX 2R0UA 3SOCA 4C61A 5HIDA 3W2SA 3OC1A 3KULA 3OVVA 4RIYA 4U7ZA 4BBFA 4IC8A 3W18A 4USEA 5H3QA 4H58A 3IGOA 4IB5A 4F6UA 4BKZA 3FWQA 4I22A 4BBEA 3RCJA 4F63A 2X7GA 4YJOA 4LMUA 1UWHA 5ANDA 4WBOA 3ZUVA 3K5UA 1UNGA 4AZEA 3FV8A 1SYKA 2PWLA 4FV1A 4KIKB 3FLQA 3ZXTA 2WMBA 4HGSA 4CKIA 3N51A 3JPVA 5EI6A 1H1WA 4M3QA 1OVEA 1WBPA 4EZ3A 5A4CA 4EJ7A 1KE8A 3EFJA 4NJ3A 3COKA 1OIUA 3KEXA 3ORIA 1OECA 3I60A 4O0SA 2OBJA 4B9DA 4IW0A 4F6WA 2WQBA 3DKGA 5J79A 4ASZA 3BBTB 4O7WA 4IAIA 2PZIA 4IWQA 4V0GB 4FT9A 3BHTA 4RIOA 2BDWA 3H30A 4MBJA 1SNXA 5CT7A 4CT1A 4MXAA 3F7ZA 4UMQA 5HO7A 5IZFA 1P2AA 2O65A 3DJ7A 3DJ5A 2J0KA 1OPJA 1U59A 4D5KA 3DKCA 3U51A 2XK8A 1G8AA 5I9YA 4F9BA 4RWLA 5EYMA 2JKMA 4FV7A 4EJNA 2GS7A 2VWBA 4F7JA 2W5AA 2XA4A 4L67A 2O3PA 4RIXB 3MFSA 3PSDA 4BTFA 4RC3A 3R0TA 2XVDA 3F5PA 3E8CA 2BCJA 1DM2A 4H3BA 1WAKA 4KWPA 1F3MC 3NUNA 4CMUA 5I9WA 4RIXA 5LCKA 2EU9A 2WZJA 2GDOA 4F0GA 4GT4A 3A4PA 1OB3A 4LL0A 2FUMA 3IS5A 4XP2A 3C4XA 3SV0A 5L8KA 3S1HA 3FAAA 3U9CA 3R1SA 4KS7A 4AZTA 4FMQA 4JIKA 4IAAA 3D7TB 3ORTA 3RPOA 4FIFA 4QPMA 4B6LA 2ZMDA 5AADA 5FUTA 2BIYA 2B55A 5CF6A 4LOPA 4HYSA 3DJ6A 5CU0A 2QO7A 1E1VA 2W5HA 4LUDA 4O0RA 4RFZA 4YZBA 3UNKA 4OTRA 4DT9A 4KNBA 5HE3A 4Z7HA 5AP5A 4WG3A 4MHAA 3KF7A 4BDFA 1X8BA 3ZFYA 1VYWA 3KQ7A 4Y73A 4ASDA 1JKKA 4E26A 3VBXA 2Q0NA 3CR0A 3LJ0A 4GVJA 5E92A 3PRFA 4JAJA 3VS7A 4OBOA 2PHKA 5FEEA 3FMDA 4V04A 4BF2A 3EYGA 5AP1A 4BCGA 4CQEA 2XNOA 4P5ZA 3LFAA 4EC9A 4V01A 4HW7A 3Q53A 4AGUA 3DS6A 4KAOA 4M69A 4X2JA 4AZFA 5FRIA 3QGYA 3TJDA 3UYSA 4YSMA 5ITAA 4JRNA 3HUCA 4YLKA 3KXXA 4G5PA 4BN1A 1J1CA 2Y4PA 4HVGA 3BYOA 4IAZA 4YJUA 5GINE 5D12A 4BCQA 2B53A 4FIJA 4FL3A 2VX3A 4D2WA 3AQVA 4YO6A 2PMOX 4ZTMA 2GHGA 2W1EA 3NW7A 5FEQA 2Y4IB 4Y83A 5AP3A 3NWWA 5A4QA 2H96A 3QQGA 3NS9A 4E6QA 5EI8A 5EM6A 4K1BA 5L2WA 5EHYA 3DZQA 3JVRA 3QCXA 1JSVA 4MYGA 4G3FA 4IMYA 3BYSA 2C69A 4UZHA 3ZSIA 4G34A 4I5MA 4HVDA 5L2SA 4FI1A 1W8CA 4RPVA 5AIRA 5E90A 3UQFA 3W2QA 2HZ0A 3IDPA 3Q4TA 4E6CA 2HW6A 5FP6A 1SNUA 4PX6A 3MJ1A 4BI2A 4ERWA 5L6PA 4LL5A 3KVWA 4UMTA 5DBXA 5FDPA 2QNJA 3MA3A 3QWKA 4I6BA 3OUKA 4WKQA 3F2AA 5BUEA 4ZOGA 1ZOGA 1ZYLA 4G3EA 4BY9E 3GC7A 2HWOA 4USDA 3HMIA 5GIPE 3BIZA 4YNEA 5DT4A 2F7EE 4FTJA 5EW3A 1K2PA 3L8VA 4FGBA 5HTIA 3PY1A 4AW1A 4QNYA 3ZM9A 5C8KA 4PTEA 2VAGA 4ITJA 5EG3A 2GNIA 5HCYA 5K5XA 2OW3A 2OXDA 4FTCA 5G1XA 2A19B 4R7IA 3NVMB 5BQ0A 1KV1A 2X8EA 2Y6MA 3OXZA 2Z7RA 3NDMA 3SXSA 4RX5A 5FP5A 3L8SA 2J9MA 4RSSA 4HZRA 4BDEA 4FTKA 4G2FA 4RJ6A 3S0OA 1URCA 2C5VA 1VEBA 1GIIA 3T3UA 4UMPA 4GK4A 2QO9A 3AGLA 5IQHA 3DDPA 3VJNA 4EK4A 2OJ9A 3BGPA 4PWNA 2PZ5A 4QP1A 5I4NA 4DBXA 1J91A 4L6QA 3VUKA 3I7BA 4UZDA 4JDJA 3DK3A 3V5TA 3IQ7A 5HIBA 3LAUA 3L9NA 4L8MA 4MQ1A 2EWAA 5F20A 4ZLZA 2WTVA 5BVWA 4CFVA 3Q04A 3MFTA 4FV9A 2CDZA 3EKNA 2EB2A 4MXXA 4XV2A 5TKDA 4IVCA 4BI1A 4QD6A 5DR2A 1U4DA 4FYNA 2CGVA 2UZWE 3L9PA 3OXIA 4U80A 4M12A 3CD3A 2ESMA 5HCXA 4EK6A 4AF3A 4EK8A 3FXZA 3ZZEA 2I0HA 3GEQA 5IQCA 2BTRA 3H3CA 3SKCA 2EB3A 2PZYA 1PJKA 3BLRA 3C5IA 3D5UA 2CLQA 3F9NA 1GZNA 3VQUA 4HGTA 3V3VA 3ZC6A 3HP2A 4ACCA 4QYYA 1KE6A 4YR8A 4O7ZA 4NK9A 4QTAA 4FZDB 5EH0A 4I94A 5ETAA 4DGLC 5C8NA 2X1NA 5BYZA 3U54A 1B39A 1R1WA 4UX9A 2CKQA 2F7XE 1YOLA 1Q4LA 3QRIA 4FNZA 3E63A 5IA3A 5M44A 4EHZA 3PXZA 1IAHA 3I6UA 1PXJA 3DV3A 3LQ8A 5BMMA 3DBFA 3ZXZA 3VUDA 3LCDA 3ANQA 4G1WA 4APCA 5K4IA 3QUPA 3CSVA 1ZOEA 3AXWA 4EQUA 4PDOA 3OT8A 5GJGA 3OWJA 5C9CA 2R7IA 4P2KA 3TUCA 3PDTA 3DA6A 1LR4A 3QLFA 1V0PA 2VZ6A 2XZSA 3QRKA 3S95A 3FMMA 2JKKA 3BHHA 2YCRA 3FDNA 5JK3A 3EIDA 3ZBXA 5JQ5A 4NSTA 4NTSA 2YM4A 2PU8A 5GJFA 2R3MA 4UYNA 4I1ZA 3KN5A 2FGIA 4RMZA 5CXHA 4C4FA 4NYEA 4JG8A 2WTKB 3UP7A 2RIOA 3VBYA 2OG8A 4C37A 3R01A 2XKEA 4YTCA 2EXMA 4YMJA 3FL5A 5ETIA 2PUIA 2O8YA 3D83A 2Y0AA 2ITOA 2ONLA 3HAMA 4JAIA 3C0HA 2E9NA 4GVAA 5HESA 4EONA 3UQCA 2ITQA 4FL1A 4Y8DA 3MI9A 4C4HA 3R30A 4RRVA 1M2QA 5GIOE 2RFNA 3ROYA 4F65A 3EFLA 3DGKA 3LXNA 4RA5A 3ULIA 4I5HA 4QTDA 4M13A 3W10A 5AUUA 4RX8A 2BRHA 2JAVA 3QA0A 4TWOA 4FTNA 4X3FB 4BZOA 2OLCA 3MH2A 3Q9XA 3MVMA 2XCKA 4JJRA 2CMWA 5CSWA 3FXXA 1JAMA 4JR7A 3UOLA 3VF9A 4CFUA 4TYEA 4BIDA 1R39A 3CS9A 2GCDA 3R9NA 1GIHA 5CSPA 1FINA 2W4JA 4ZY6A 5KE0A 1PXNA 4KBKA 2V5QA 3WZDA 3OTUA 2HW7A 2BAQA 1G8SA 3F5UA 3NVKI 3UZPA 3TDVA 5M09A 2W17A 3QRJA 5HBHA 1S9IA 2GMXA 3OCSA 1BL7A 4AN3A 2XIXA 3BYVA 2CNVA 3QTQA 3EQGA 1JKTA 3C50A 4H3PA 3ORNA 4AA0A 4AGDA 5CYIA 3LFDA 3F6XA 3HX4A 1CSNA 1NT2A 2G2FA 5AP2A 4K11A 2C5YA 3WF7A 3QKMA 2GSFA 1AQ1A 2NPQA 4HCVA 3SLSA 4U40A 3PLAE 5JZNA 3UP2A 2CHLA 2HELA 4P4CA 3I6WA 3LFQA 1LPUA 3QTUA 4BDCA 1P14A 4WIHA 4CV8A 4PRJA 3VS5A 4IVAA 4MVFA 4O96A 3ZUTA 3R73A 5CENA 5AUZA 5C26A 5AUXA 2JDOA 5ACBC 4DCEA 3OCGA 4O7LA 3ANRA 3IPHA 4OTGA 1ZYSA 3DPKA 4GU6A 4BDIA 2FSLX 5CT0A 5HNBA 2UV2A 4D4VA 5FM2A 4ZLOA 4USFA 4D1XA 1U54B 5JFXA 2JKQA 3PJ2A 4CFMA 4YZMA 4RG0A 4EYJA 3LFEA 4P90A 1OL5A 4TNBA 3HEGA 3LZBA 4X7QA 4BWXA 1Y57A 3CQEA 2QURA 1Q8WA 4IWOA 3PUPA 3ZS5A 4XMOA 4XP0A 4DTAA 2R3KA 3BGZA 2RL5A 3ZMMA 4FC0A 3C4WA 3D9VA 3F82A 5EHLA 3FY0A 1PMUA 3BV2A 5J95A 4QMXA 5IA2A 4BDKA 5AAFA 1KOBA 5I0BA 3UOJA 4F1OA 3I5ZA 5J87A 4BYIA 2JLDA 3KRJA 2VTJA 4J53A 4NEUA 3LHJA 4IWPA 2XS0A 4DG2E 1ZY4A 4FKRA 4IM0A 5DVRA 2IW9A 3Q5ZA 2J0LA 3HRFA 4I0RA 4PV0A 1OBGA 3SG9A 2QKRA 4I23A 3ROCA 1UKIA 2CJMA 4A9TA 3R8PA 3TZ9A 3HUBA 3UVQA 2I0EA 4JVGA 3WILA 3KRRA 3VO3A 4AW0A 4KKGA 3VWAA 4NH1A 2ITWA 3CC6A 3FI3A 2C6TA 3GQLA 3TCPA 4YZ9A 1FOTA 4DFNA 5KZ0A 4Z16A 2I0YA 4YPSA 1MP8A 5J1VA 2X2MA 3BQRA 3KFAA 4CXAA 1W83A 3QBNA 2B9IA 2B9JA 2Z7SA 5F1ZA 5IA1A 4G6NA 3GU8A 2GNLA 4WBBB 5HQ0A 4O91A 2CN8A 4QP8A 3KK8A 2CLXA 2YITA 3H9RA 3CTHA 3A99A 2BFXA 3Q3BA 4FT5A 4BGGA 5D11A 3QUEA 1PXIA 5HD7A 3UODA 4DLJA 1ZMWA 3R00A 4XCUA 4HVIA 3UPXA 4F7SA 1H8FA 3RTPA 3FZ1A 3TXOA 1DI9A 3U87A 3ZFXA 3ZM4A 2C3JA 4U3YA 2BKKA 4DCAA 1H01A 2Z7QA 2P2IA 3DLSA 3O17A 2PL0A 3FXWA 2XM9A 4F7LA 3U55A 4I6FA 4LV5A 4I41A 4C3RA 2OIQA 2PVJA 2QR7A 2BAJA 4ZSJA 2BTSA 1PYEA 1ZRZA 1PMNA 4U0IA 4A9UA 3F7WA 5H8GA 4E7WA 3LKMA 3BWFA 3PP0A 5AFVA 5I9VA 2VGPA 4ANQA 3TV6A 1WVWA 3IOKA 1APME 3KL8A 3GCUA 4AXAA 4C02A 2QOIA 4BCKA 4O6EA 5HLWA 5JRQA 5I9XA 4C36A 5KUPA 4I92A 4QT1A 4GFMA 5HG7A 5LJJA 3AMAA 5DWRA 1DAYA 4ZP5A 3WZKA 5HE2A 3JUHA 4FTAA 4KS8A 3TV4A 3UIBA 3D5VA 4FV8A 3VVHA 3D7ZA 4BDGA 3A7JA 3C0GA 2E9OA 2OJGA 2R2PA 2YCQA 1WBVA 3Q9WA 4YP8A 5DYJA 3E8DA 2B9FA 3PWDA 4B8MA 3FHIA 1PY5A 2W0JA 5EHOA 5TO8A 4M0ZA 4YHFA 4Y85A 3RJCA 1STCE 4F0IA 3NUYA 1QPEA 1EH4A 3QXPA 5IU2A 5JRSA 1F5QA 3WF9A 3OXTA 3FLYA 4B4LA 4DC2A 2QI8A 3GU4A 3GU7A 3DQXA 4JQ7A 2J7TA 3G6HA 3BPRA 3A60A 2GNGA 3ENMA 3GCPA 4R3PA 4DE4A 3FY2A 3AT2A 3KMUA 4C38A 2B1PA 4YHJA 1P4FA 3CY2A 4C7TA 3LIJA 3BHVA 2IPXA 2OO8X 5IA5A 4YC3A 4FSNA 2IVTA 1OBDA 4DT8A 4E5AX 3WZUA 2ZV9A 4GKHA 1UNHA 5TE0A 5CQUA 3CTQA 5HE0A 3A7HA 4XEYA 4BZDA 2PUPA 2YIYA 3E3BX 4ZSGA 2WMAA 4FIHA 3KF4A 1K3AA 4BKYA 2WIHA 4JQ8A 1YDSE 4MD8E 2UZEA 4CVAA 4IACA 2IZRA 1Q41A 2VUWA 1WBNA 4GCJA 4OUCA 4O7NA 4HVHA 3R1QA 3EN6A 3VS1A 4L45A 4XHKB 3LMHA 2XNBA 4ENXA 3DNDA 2A0CX 3V5JA 2PSQA 2IWIA 3PJCA 2OXYA 2I40A 2QOKA 3QX4A 5H8EA 4EUTA 4YSJA 4QP2A 4R6VA 5HO8A 4I3ZA 3V8SA 4ZJVA 1M17A 3RKBA 4E1ZA 4EHGA 5DR6A 3LMIA 3SGCA 3Q2MA 4XV9A 3LXLA 4YZCA 1G3NA 4N70A 5KBQA 2VTTA 2NO3A 4FVPA 2OFVA 4EL9A 4DF3A 4QTEA 3NGAA 2W4KA 2UZNA 4X2FA 3VS3A 5D41A 2GFCA 1Q3WA 3I0QA 3P86A 1LUFA 2QLQA 4ZTQA 3B8QA 3Q52A 4CZUA 4Y72A 3RM6A 2C47A 4BDBA 4D9UA 3DXPA 5A4LA 2R7BA 5HX8A 2YEXA 1OKZA 5FTQA 4CG8A 3RHXA 4FTIA 2QOHA 3F3WA 4NIFB 4S2ZA 4K33A 2YM7A 4XOYA 4FSQA 5HTBA 5BMSA 2AYPA 2WB8A 4D4RA 5IMXA 5HHWA 3PG1A 2X6DA 2C6DA 1QCFA 2QU6A 4CV9A 1UNLA 2W5BA 3PSBA 3HRCA 4ZZMA 3VC4A 4DHFA 2RFDA 2XBAA 3FJQE 4EBVA 1I44A 4CMOA 4TYJA 3VUHA 4YO4A 4BBMA 4X21A 3A8WA 3SXFA 3FMKA 2ITUA 3EFWA 3T8OA 4BDDA 4EOPA 2FH9A 1RE8A 2JDTA 3R2BA 3QQUA 2PYWA 4RQVA 4MWIA 4E4XA 5G6VA 5HVYA 4BCOA 3C13A 4KRCA 2UVXA 3UC3A 4DH3A 4GKIA 3W32A 3HV4A 4FIGA 3SDJA 4UB7A 3UE4A 4RIWA 4EUUA 4ZAUA 4PMTA 1GZKA 3QQHA 3Q60A 2UVYA 2P2HA 5DH3A 5K0XA 4UXLA 4KSQA 4JDKA 4AACA 1U5RA 2R3OA 4AE6A 2SRCA 2O5KA 3V6RA 5EYKA 5EYDA 2QG7A 2XCHA 3NCGA 3FZPA 5A54A 3KVXA 4RLKA 1Q8TA 4S30A 1YHWA 1ZWSA 3LFFA 3Q4ZA 3VBQA 4ITHA 2OZOA 4KUJA 1M14A 4J98A 4DAWA 3QQFA 5E8ZA 5AWMA 4ZTLA 4F70A 3DU8A 2ACXA 5ETFA 4AFJA 4HVSA 3L9MA 2I1MA 4BKJA 3ZU7A 3NW6A 3SRVA 3OBJA 3TIYA 2IVUA 4A06A 1L8TA 4OT5A 3OMVA 2X2KA 3R7OA 4AT5A 3RM7A 3NIEA 1HOWA 1PMEA 4FTRA 2WOTA 4K8AA 4CLJA 3VUMA 4EH7A 2B52A 4QOXA 5FM3A 4MXCA 3Q2JA 2F7ZE 3CJFA 2BROA 4G5JA 5EFQA 2R5TA 4DGOA 3CJGA 3FKLA 4U45A 3BKBA 3QWJA 3TNHA 2X39A 3NUSA 2R64A 2XJ0A 3HYHA 2GTMA 3QTRA 3ORZA 2QOCA 4QP9A 3E8NA 1KV2A 3KKVA 3QD4A 4RIYB 3VIDA 2F57A 4EOLA 2XJ2A 4C3PA 4QYHA 3R6XA 2HZ4A 3TJCA 2QR8A 4AOTA 5IEXA 1RW8A 4EBWA 1ATPE 2WNTA 4I6QA 4WNKA 5M53A 2RF9A 3EWHA 3VW8A 4OGRA 1NVRA 2RG5A 3AG9A 4ZK5A 2O64A 2XKDA 2BALA 3DKFA 4FKSA 4QMZA 3QC4A 2ZV8A 4FSYA 4DG3E 4EH5A 5I5ZA 5KMNA 3ZFMA 4HPUE 1XBAA 4AX8A 4GIHA 3DOGA 1KSWA 3NZ0A 1CKIA 4L01A 4NKAA 3ET7A 4FUXA 3UYTA 4MBIA 1XWSA 4OTWA 4XJ0A 4X2GA 3MESA 4LUEA 3LVPA 1H0WA 5HG9A 4OTFA 4M68A 1DAWA 3KU2A 2HYYA 3BBWA 1W98A 4NTTA 4AUAA 3R71A 2ZV2A 1TVOA 3QZFA 1XQZA 5H2UA 3UZTA 2YISA 3AT4A 1V1KA 2VWZA 3WI6A 2QOOA 4M0YA 4BTKA 5IQAA 3DZOA 3HVCA 3NYVA 5A4TA 1Y8GA 4FODA 5A6NA 3U6HA 4L3JA 4K2RA 2C0OA 3KXMA 4U6RA 2KTYA 4FG9A 4JXFA 4WOVA 5J5SA 5EQYA 3U4UA 5L3AA 4RJ5A 3E3PA 2BFYA 1OIQA 3ZLWA 1FGIA 4O0XA 4ZY5A 2ERZE 5LWNA 4WD5A 3R9HA 4QQJA 4C4JA 3IGGA 3FSFA 3QGWA 5FTGA 3ETAA 4GV1A 3P23A 2OJIA 4FSUA 3GCQA 3D5WA 2O0UA 2E9PA 3E87A 4L3LA 2CGUA 3P79A 3F2NA 5AUWA 3W2CA 4MNEA 1JWHA 4BCJA 4HYUA 3ZRKA 4CFXA 1UA2A 2JDRA 3HL7A 4FZ6A 4ZTRA 3V5QA 4DEDA 4CGAA 3ORKA 1OPLA 3ZSGA 4D0XA 1H27A 5HU3A 5DNRA 1H1SA 1TQIA 3QAME 2YJSA 1L3RE 3UGCA 5EKNA 3JYAA 4D2RA 2JGZA 5LMBA 3OOGA 4FG8A 1CM8A 2VGOA 3IONA 1Y6AA 2XIRA 3WYYA 5T6KA 4A9YA 3P4KA 4CFWA 2NNWB 4L7SA 2WO6A 3V5PA 4II5A 3N4UA 2Y8OA 5E1SA 2XUUA 3RPRA 1LEWA 1XKKA 2BUJA 2H34A 2VTPA 3MVJA 4QMTA 4JBOA 1KE5A 4TWNA 3C4EA 4UN0C 4PL5A 1ZXEA 2X0GA 5FQDC 3FYJX 4XLVA 3PXQA 2IO6A 1ZARA 1R0PA 3ELJA 4QYGA 4S33A 5IMEA 4D4YA 1HCKA 3THBA 4E5WA 3I81A 4NFNA 2J2IB 4PMSA 1FBNA 2EVAA 4U42A 3TKHA 5E8XA 5KMJA 5KZIA 4ITIA 5AV0A 4ACHA 2GQRA 4YURA 3HV6A 3K54A 4FKQA 4RZVA 3SD0A 4R1VA 4RWIA 4O0VA 4C35A 5JKGA 3NR9A 4L68A 3UG1A 4DFZE 3CGOA 3R9DA 4M69B 4YJVA 2EUFB 3IW4A 4FZ7A 3GNIB 2WGJA 3UG2A 4GSBA 3BLQA 3LJ2A 4AA4A 4PL4A 2VTHA 4FA2A 5ETCA 2YDJA 4LGDA 4GS6A 2GNJA 4W4YA 4YLJA 4H1JA 4RJ7A 5IUGA 4Z55A 2BVAA 2VD5A 3MN3A 4CRLA 3AD4A 2WMQA 4LQMA 5HX6A 4RQKA 3NCZA 4I21A 1QPDA 3D14A 4EK3A 5J9YA 2CNQA 2XIYA 3OEZA 4JBVA 3IDCA 3NNVA 4BFMA 4E4MA 2ZB0A 3PJ1A 4TNDA 4HOKA 2I6LA 2EXCX 3WE4A 5KCVA 3O8TA 4EHEA 4HGLA 5E8VA 5AV2A 2BILB 3NNUA 3Q4UA 2X8IA 3H9FA 1J7LA 2UW7A 4TXCA 5AV3A 3L1SA 2YA9A 3EN5A 3QYWA 2PVFA 2F2UA 1YHSA 3KXGA 4LV8A 1CKPA 4BGHA 4IX5A 3AC3A 3KXNA 3WYXA 3Q9YA 1Q8UA 4LOOA 4XLIA 5C27A 2C6LA 3MPAA 4BCMA 4QQ5A 2UZTA 3OBGA 1SVGA 4RC2A 4XG8A 1NXKA 2WMVA 1OKVA 3NW5A 1BUHA 3HA6A 2DUVA 4O1OA 3WF5A 1YXXA 1YXTA 3E8EA 3QTIA 4XRLA 2C68A 3GC9A 4Z7GA 4FKWA 5HI2A 4FL2A 1GIJA 4OBQA 5L2QA 3GOKA 4YLLA 4RVKA 4N0SA 2PVNA 5BPYA 3EQIA 2DWBA 2WMXA 2UVZA 4DITA 4AW5A 5JEBA 5DLSA 3LCOA 3WIKA 1O6KA 4XYFA 3OT3A 3PXFA 3QZHA 3LMGA 1BKXA 2ITPA 4AN2A 5C8MA 5DIAA 5AR5A 5B0XA 2CN5A 4G3GA 2ZYBA 4G6LA 4GEOA 2PTKA 5AAGA 3R7EA 4NZWB 2XK4A 3ENHA 4BHNA 4IDVA 5IEVA 4LYNA 2W1ZA 5CTPA 2DS1A 2HCKA 4ONAA 3CGFA 2HZNA 2ITZA 2W1FA 3A4OX 3PZHA 4TY1A 1H4LA 2HXQA 4YGAA 4XG4A 3ZDIA 1Q99A 3MFUA 2V7OA 4X2KA 4D2VA 1OKYA 4OTDA 3ATSA 3LFNA 3OZ6A 4TW9A 3MGYA 2CKOA 3EQCA 4O81A 1OL6A 2ITVA 3NRMA 5E8TA 2Z02A 3B8RA 3MY5A 4RVMA 4YJNA 5I3OA 3PJ3A 1R0EA 3VHKA 4DFYA 2WAJA 3QTWA 4PPCA 1OGUA 4O82A 4I5PA 2O2UA 3D2KA 5HKMA 5J9LA 4C0TA 4BRXA 4CT2A 5J1WA 3TM0A 4J71A 4J8NA 5JMSA 4ZMFA 5AJQA 5DEWA 3DCVA 5FXSA 3BU6A 2FYSA 2VO6A 4CRSA 4DYMA 4EH6A 4RGJA 3A62A 5HOAA 3FPQA 4IJ9A 4I20A 4RA4A 3LQ5A 4NCTC 1YKRA 4BTJA 3P7AA 5L8LA 2HY81 3QD3A 1XJDA 4GUBA 5AX3A 2YWVA 1PYXA 3IW6A 3UBDA 5J8IA 5KKRB 4O86A 3IKAA 2J0MB 3A7FA 2VTQA 1SVEA 1YWRA 2C3KA 2UZBA 1W84A 3CTJA 2YLEA 5IPJA 5E8WA 4GFGA 4WO5A 4DFUA 2ETKA 3POZA 4U41A 3UQGA 4EOOA 5BVEA 2QCSA 2YFXA 4ID7A 3MWUA 4KBCA 1IA8A 3HV3A 2WEIA 2XP2A 3U9NA 3LQ3A 3QZGA 4BI0A 3D0EA 5KNJA 3TIZA 3ATTA 3ACKA 2BDJA 2YACA 5AP7A 4E3CA 3Q4CA 3OEFX 5IQEA 4HYHA 4JBPA 1J7IA 2OH4A 2DQ7X 3M2WA 5IQDA 2F49A 2JBOA 3OY1A 2GHMA 3P78A 3MVHA 2XM8A 3SG8A 4W4XA 2XIZA 4X0MA 4AOIA 4AT3A 2VU3A 5TT7A 3MPMA 2CKPA 3R28A 4BB4A 4I4FA 3KN6A 3R8LA 2R3QA 2WIPA 4L53A 1KUTA 3A8XA 3RAWA 4LGHA 4JLCA 3OUNB 4CMTA 3EKKA 3WIGA 2W1HA 4YTIA 3P0MA 4IJPA 5M55A 3ORMA 4BCNA 4LOQA 3RPVA 2XEZA 2PUNA 3DFAA 4LI5A 1H00A 2PVMA 2NRYA 4DEBA 2GS6A 4EWHA 4J52A 4ZY4A 1PKDA 1U46A 3O96A 4IBMA 5CU4A 5A6OA 3BYMA 4PPAA 2WTDA 3DTWA 4ALWA 1H24A 4MD7E 4HCUA 5DR9A 1M2RA 3EHAA 3QQLA 3PY3A 3R02A 1JVPP 3KK9A 4KINA 3PXYA 3C0IA 4K18A 4FKJA 5DRDA 3FEGA 3NIZA 4QTCA 4DGNA 3HA8A 4DLIA 5C03A 2XK9A 3UDBA 4FTLA 3W8QA 5M08A 4R78A 3L8XA 2CSNA 3EQPA 3TG1A 5L8JA 3A7IA 4MNFA 1URWA 1PMVA 4M97A 5BNJA 4I5CA 3HMOA 4R7HA 5FXQA 5F4NA 4EOKA 1WBSA 3G6GA 4UV0A 5CAUA 4NW5A 1YOJA 4IX6A 4MWHA 3ODZX 4ZXTA 1O9UA 1OMWA 5CI6A 3HRBA 2J6MA 3AD5A 3E93A 4E4NA 5K4JA 1SM2A 4OTPA 1M7NA 2FSMX 3BZ3A 4S32A 2HAKA 5EM5A 4AOJA 3GC8A 4RWJA 4F6SA 1ERKA 3OF0A 5JGDA 4J96A 4FBXA 4LG4A 3II5A 4YBJA 3AC8A 5LARA 4D2TA 1RJBA 3Q9ZA 4M7IA 4FV0A 3ORXA 3PPJA 2R3NA 1GZ8A 1Q8ZA 3BRBA 5HE1A 3EN7A 4AP7A 4B99A 2BHHA 1MQ4A 3FUPA 3OG7A 4ACMA 3SVVA 3VS2A 4A07A 4KKEA 4ZTSA 5ANKA 2GNFA 3DB6A 5M57A 2FSOX 3HGKA 2IZUA 1SZMA 2J5FA 4EQCA 1FVRA 2BMCA 1NVQA 5E8UA 4IADA 3E7VA 2W96B 5AR7A 3QL8A 4O83A 1OL2A 5KMMA 2XK7A 5IKWA 1VYZA 2YN8A 2WD1A 4TYHA 1FGKA 3O7LD 3E7OA 4ZTHA 3R8UA 4DGGA 4E6AA 5BYYA 1NVSA 4XG2A 5E1EA 3F69A 1YDRE 4D28A 3EFKA 5C4KA 4MD9E 3P7BA 3LM5A 3AD6A 4MBLA 3HV7A 3KMWA 3PZEA 5FG8A 1OM1A 4I6HA 3NUPA 2GQSA 3W16A 4E6DA 4O0YA 4ASEA 2UW3A 4HCTA 2WTIA 4UALA 5D10A 4W4VA 5CS6A 3TACA 5EW8A 3RK9A 3W2RA 4WG4A 2PMLX 2Y4IC 4OAVB 3CQWA 4QP6A 5E8YA 3JXWA 4ZJJA 2ZDUA 1YI4A 4BWKA 3ZOSA 1JNKA 2WQMA 3SHEA 3ZH8A 3E62A 3NAYA 3EL8A 4JX3A 3UMXA 3GGFA 3I7CA 3SXRA 4WSQA 4EI4A 3LPBA 3V8TA 3HAVA 3H9OA 1UU8A 5AX9A 3R9RA 1XH8A 4JG6A 4DFBA 4D2SA 1BI8A 2XF0A 3V8WA 4DG0E 3LCKA 4M15A 2VX0A 4W8EA 4YTFA 3DXNA 5JZJA 2B0QA 2YLFA 2UZOA 3C51A 3LFSA 3PY0A 2NRUA 3W2PA 3ZTXA 3MB6A 2QU5A 4G31A 2YJRA 4GW8A 4NW6A 3F2RA 4XG3A 3R7VA 5CANA 4AA5A 3DK7A 4E8AA 1PXPA 1CDKA 4JG7A 4U97A 5J7HA 4YNOA 5LVNA 4P7EA 5CY3A 1JPAA 4FTTA 3DBQA 4OR5A 4JQEA 2W9FB 2F2CB 3GUBA 5EW9A 4QMLA 4DFLA 5IQGA 5CF5A 3BCEA 3ZBFA 1M52A 1KE9A 3M11A 3TZ8A 2F9GA 4FR4A 4IIRA 2QLUA 4Z9LA 5HD4A 4XOZA 3SW7A 5GZ8A 4F9WA 4O27B 1ZZ2A 4V05A 4IVDA 4QMWA 2JDVA 2OIDA 1BMKA 4H36A 5J7BA 3F5GA 4FTQA 4BDHA 3RWQA 5CVGA 4A9SA 3I5NA 2E2BA 4HNIA 4PUZA 3IW8A 2JFLA 4L9IA 4XBUA 3FQSA 3GI3A 2XRWA 3KB7A 4LMNA 4FSZA 3RWPA 4UWCA 4ALVA 3D94A 5JQ8A 2R0IA 2YWPA 1B6CB 5I9ZA 2XYUA 1SVHA 2QKWB 4KIQA 3EOCA 2VV9A 3MH3A 4TT7A 4CZTA 3IDBA 4U9AA 1WVYA 2V0DA 4MF1A 5FBOA 5LMKA 4OTIA 4PL3A 1NW1A 4OW8A 3EQBA 4R1YA 4WHZA 4BCPA 3F66A 4TZRA 3KREA 2VRXA 4YC6A 3QHRA 3PE1A 1YI6A 3TNQB 3COHA 2WKMA 4FTMA 3QRTA 3CY3A 3OY3A 3QKKA 4F09A 2HXLA 4FGRA 3F3TA 1H28A 4J97A 4UEUA 4EKKA 3ZONA 4QMYA 1BYGA 5IDNA 3UIUA 2OI4X 3QX2A 4JS8A 4MXZA 4NUSA 4R5SA 5BX0A 3N4VA 2XIKA 3MS9A 2P0CA 4NU1A 4EH8A 1OI9A 4WUNA 1H1PA 3EN9A 5CAVA 1Q8YA 3BLHA 2WMRA 4K6ZA 2UZDA 3DBEA 3BU5A 4DH7A 3FE3A 4J8MA 4JL9A 4A4OA 4EEVA 3TDWA 4ACGA 1JBPE 3GFWA 5KMKA 4DEHA 4G16A 3G33A 4O22A 2WFYA 2FSTX 3EZVA 5JT2A 4BDJA 1H07A 4R5YA 2V22A 4B0GA 4TL0A 4FIIA 1ZYCA 3QLGA 4IEBA 2O63A 5HZNA 5B2LA 5D9HA 1CKJA 1V0OA 2WTKC 4U5JA 3RMFA 4AAAA 3JY9A 4BYJA 4O7SA 4OLIA 3ZDUA 3QZIA 3G0FA 2YCFA 4RJ3A 3QF9A 3ZYAA 2JAMA 3PP1A 4Q2AA 3RAKA 4FV2A 5EDPA 3P5KA 4H39A 3RAHA 4OBPA 2E9UA 4E4LA 5BVFA 5JFSA 2VNWA 2R3JA 5AA8A 3N9XA 4UXQA 4D58A 3VAPA 3NYOA 4M84A 2IW6A 1RDQE 3AGMA 4NFMA 1A48A 4S31A 3G2FA 3PA5A 4PP9A 1KOAA 3V6SA 4AU8A 2QHNA 3MBLA 1PXKA 2C30A 4O2ZA 1GAGA 3K3JA 1YI3A 1VJYA 4RVLA 5D7VA 5GNKA 4ANMA 5JFWA 2XK6A 3V5WA 3QCSA 3PRIA 3FZSA 5DA3A 4E5BA 3TUBA 4X3FC 2C1AA 3KCFA 3MFRA 2WMUA 2OZAA 3CQUA 4R77A 2UW8A 1VZOA 3FPMA 1QL6A 2W7XA 4FX3A 3SX9A 3ZO4A 2FB8A 5IUIA 4BIBA 2ZV7A 4QPAA 3RZBA 3PE2A 4G3DA 4QO9A 2QD9A 3QRUA 2J51A 4CTBA 3PVBA 3UVRA 4JRVA 4C33A 2H9VA 5JGBA 5H8BA 2WTWA 5CALA 1A06A 3QD0A 3JS2A 2PUUA 4DH1A 3FLWA 5GZ9A 3Q96A 2VWXA 3E88A 5M4UA 3TNWA 1FVTA 3TTJA 3F3ZA 5KMOA 3UOHA 1M7QA 2W05A 3VUIA 4EOSA 3H0ZA 3QXOA 5M56A 4S34A 5CSXA 2OJFE 3LXKA 3NUUA 2PY3A 4R3RA 4FSRA 4CD0A 3KGAA 2J0JA 3GU5A 4UMRA 2V62A 3BELA 5AM7A 4G3CA 4HNFA 4KABA 5CZIA 2IG7A 4BCHA 4AGCA 4QMVA 1HCLA 2JKOA 4EZ5A 4PDPA 1Z57A 3HDMA 4Q5HA 4RIWB 4YJTA 2AC3A 1DS5A 3WF6A 3RNIA 2Z7LA 3W55A 4A9RA 1PRYA 4X2NA 2W99B 5BUIA 2CNUA 2J50A 4X6RA 5LCJA 1T46A 2Z8CA 2XYNA 3EL7A 3PYYA 3R21A 1O6LA 5AR2A 3VS4A 3TTIA 2WU6A 2C6EA 4HPTE 4RFMA 5CWZA 4I24A 4CFNA 4DGMA 4UBAA 3NUAA 4AT4A 5LQFA 4DEAA 4CKJA 2R3GA 4X3JA 2JDSA 1FMKA 4XV3A 1ZAOA 5L4QA 2RGPA 3IW7A 3VUGA 2PE2A 3NNXA 3ZUUA 1Z5MA 5JFVA 3D15A 3P9JA 3SRVB 5TR6A 2OF2A 4UWBA 5LVMA 2OKRA 3HV5A 2CPKE 4IZ7A 4QYEA 3QTZA 1OUYA 3PPZA 4ZSEA 4GG5A 5AUTA 4ALUA 4D0WA 2RFSA 2CKEA 3SC1A 4PDSA 5EQPA 5LXMA 3RP9A 2XB7A 5CAQA 2BRNA 5DN3A 3TV7A 2QODA 2B7AA 5BVNA 2V7AA 3OP5A 1UU9A 3CD8A 4FV6A 2YIXA 4FOBA 5ANIA 3RI1A 5L2TA 2C3IB 3PFQA 2ZJWA 4I0SA 3CLYA 4JOAA 4BCFA 4DEGA 4GT3A 5HORA 1WZYA 5EK7A 3QCQA 2C6MA 3I1AA 4FK6A 5C4LA 4K77A 3GBZA 2VWYA 1WBOA 4LRJA 4XRJA 3RBWA 1W0XC 2UW0A 2XMYA 3O8UA 3BWJA 2GNHA 4F9CA 4YZNA 5IG1A 5BYLA 2Y7JA 2OSCA 4RLLA 3N4TA 2YDKA 3MPTA 3HZTA 1TQMA 3HECA 2WPAA 2PE1A 1REJA 4C57A 4ANBA 4LM5A 1UKHA 3O50A 3LCSA 5LMKC 3TNIA 3T9IA 3WBLA 4CLIA 5A4EA 2VO7A 2C5NA 4HGEA 4M66A 1T45A 4FKVA 2QHMA 3BHUA 3R83A 1J1BA 5GJDA 4E73A 4IM3A 4BZNA 3EH9A 5L2IA 1MQBA 5FD2A 3QA8A 2CCHA 4NM7A 5FTOA 1REKA 4RVTA 1OIYA 4MK0A 3U6JA 1J7UA 2QOBA 2OF4A 2IVSA 5IDPA 5M51A 3KMMA 2HY0A 4PQNA 4GYIA 1BX6A 3IECA 3RK7A 1WBTA 1ZMVA 3NX8A 4JNWA 3G15A 1I09A 1IA9A 4C3FA 2PK9A 3K5VA 4R7BA 4ARKA 4WRSA 3GFEA 1PKGA 3QC9A 3QU0A 1YHVA 3COMA 4MQ2A 4NCTA 3BEGA 5E8SA 3C7QA 3VNTA 5HCZA 2FO0A 2XNNA 3K3IA 2E9VA 2HK5A 4LRKA 2YIRA 3PVWA 1CTPE 4LFIA 5AUYA 3UIMA 4QQTA 4U81A 1YVJA 1ZMUA 3KC3A 3BE2A 2VTIA 2QQ7A 3BI6A 3Q6WA 4MNEB 1G5SA 2Z2WA 3KRLA 4AN9A 3G9LX 4FKOA 3JR1A 3ACJA 2R3RA 1MUOA 2WQEA 3R1NA 1ND4A 2OIBA 2C1BA 2RG6A 2W1IA 3I4BA 5F94A 4YU2A 5A14A 2X7OA 4KD1A 3WF8A 1Y6BA 3QD2B 5IUHA 5M06A 4U3ZA 3PA3A 4LRMA 4N6YA 4QNAA 4U8ZA 2C6KA 3LFCA 1J3HA 3QTXA 4GJ3A 2VTNA 2WHBA 4K9YA 4KIKA 4MCVA 4EWQA 4QMPA 2YM3A 3VBTA 4APPA 3QYZA 4EORA 4XS2A 3FZRA 5DHJA 1OPKA 2RKUA 4PPBA 4TRLA 2XK3A 5FEDA 3V5LA 4NM0A 2XNPA 3UC4A 3NEWA 4B8LA 3DT1A 5F95A 2WMWA 4CCUA 5FBNC 4FEQA 4O84A 4IC7A 1H08A 5DGZA 1ZY5A 5JSMA 4NM5A 3RAIA 3GCVA 4V0GA 2X4ZA 4XH6A 5CVHA 1AGWA 3VUTA 2VTSA 1ZLTA 2W06A 4JR3A 4TWCA 3CIKA 4E93A 3BE9A 4RC4A 3R7YA 4IE9A 4R8QA 3BU3A 1OKWA 2EXEA 3S00A 4K0YA 2PULA 5M4CA 3FSKA 2PZPA 3HMMA 3JY0A 1PHKA 3RHKA 3MSSA 1JSUA 4C4GA 2HENA 3C5UA 3MY0A 3NSZA 1JQHA 2P55A 3VN9A 5M4FA 4AS0A 1IRKA 4QMNA 3FMEA 3UVPA 4QMOA 3C1XA 1BI7A 4QMQA 4E20A 5AA9A 5AP0A 4PP7A 4IAKA 2GQGA 2OK1A 3MY1A 5KMIA 2WU7A 3HNGA 2X8DA 1H1QA 2ERKA 4YJRA 5CU3A 5E4HA 4FEVA 4NWMA 3LXPA 5HBJA 5DOSA 2BAKA 5DFPA 4D5HA 3UPZA 3NLBA 3QFVA 4PF4A 5M4IA 4WT6A 5H9BA 5JH6A 5IQBA 3CBLA 2W1DA 4QP7A 3D7TA 2ETMA 2V55A 3ZEPA 2QVSE 2BRGA 4EK5A 2R9SA 4F7NA 2QOFA 3P08A 2UZVA 4M8TA 3ZO3A 3FMHA 1MRVA 3KRXA 3HLLA 1XH5A 4KKHA 3RGFA 4JDHA 3TN8A 5J9ZA 5CXZA 2OJJA 4ZS0A 5HVJA 1Q5KA 1GOLA 2HOGA 2UW9A 3OOMA 5HEZA 4UMUA 5LMAA 3LCTA 3UO6A 2A2AA 4WNOA 1BL6A 4F99A 4O7YA 3R8ZA 3M42A 3MH1A 4RX9A 5CEKA 4MH7A 4EYMA 3LFBA 2YHVA 1PXOA 4AG8A 4AE9A 2G15A 1FMOE 3HKOA 4J95A 5AR3A 5KX8A 2VTMA 4FF8A 4FKUA 2J4ZA 3F61A 3MV5A 3UIXA 5HG5A 2OH0E 5HNIX 2JC6A 2IVVA 2WTCA 3QUDA 3G5DA 4FNWA 4I93A 3TL8A 5EOBA 4YJSA 2ITNA 4TTHB 3KXHA 4QP4A 5JGAA 2WELA 3OHTA 2IZTA 2Y9QA 4FTOA 2YIWA 4ENYA 3F3UA 2YERA 3KCKA 5CEIA 3IK3A 2JEDA 5EI2A 5CI7A 3FYKX 5CEMA 2Q83A 2C0IA 3POOA 5BVKA 3BYUA 4JBQA 4R3CA 5ANJA 3EQRA 3QCYA 4NT4A 5DT0A 3O2MA 5E7RA 4EOMA 3U6IA 3CPBA 2C6OA 2XNMA 3VS0A 3ZRLA 5LOHA 5LWMA 1P5EA 1Q24A 5HTCA 2XRUA 3FLZA 2ZB1A 3PJ8A 3R04A 1H0VA 1WVXA 5IF1A 1QPCA 3PWYA 1JLUE 4I0TA 2FVDA 4MXYA 3KRWA 4W8DA 4L7FA 4DINA 3DB8A 4PNIA 2OFUA 5DRBA 3S3IA 1H1RA 3E92A 3DAKA 4IAFA 4QQCA 3VRYA 2VO0A 4IB0A 2R3LA 2UW4A 3L9LA 3AC2A 3KXZA 4KA3A 3EJ1A 3EQDA 4FSTA 3RPYA 4ZZOA 1OIRA 2RSVA 4Y5HA 1KWPA 1Y91A 3G51A 5EQEA 2VTAA 3FZOA 4IANA 4XP3A 3F5XA 3R22A 3VS6A 3D5XA 3C4FA 3HDNA 3G9NA 3SW4A 4M14A 4NKSA 4PMMA 5LVPA 2LGCA 3PLSA 1M2PA 2REIA 1YXUA 2XNGA 3EN4A 4OTHA 5D7AA 3U4WA 4ZMEA 4C2WA 3D4QA 2RFEA 4Q9ZA 4WRGA 3LE6A 3UOKA 2VO3A 5CX9A 4F1TA 3ID6C 5CEOA 5CASA 2YAAA 5DPVA 4ZZNA 3MB7A 3KY2A 3FMJA 3F3VA 3O8PA 2GU8A 2CGXA 5DG5A 4IB3A 3ZZWA 5LVLA 5CAOA 5C1QB 3MVLA 2X4FA 4Q5EA 2YCSA 1Q62A 1TKIA 5HBEA 5FGKA 1NY3A 2PMIA 2VN9A 3BX5A 5FXRA 2X9FA 4JIAA 3VBVA 2P4IA 4N4SA 3GCSA 3A2CA 2BRMA 2BIKB 4GRBA 4DH8A 3IOPA 2YDIA 4RFYA 4YHTA 2BR1A 3OW3A 1IASA 3VQHA 3VJOA 3PPKA 4YBKA 2C6IA 2ZVAA 3PXRA 2PVKA 4DFXE 4DN5A 1Y8YA 4CQGA 3RCDA 3CXWA 3ZLXA 4L43A 4IDTA 5KHXA 2NP8A 2R4BA 2XNEA 4CSVA 5AV4A 5AEPA 3RVGA 4YPDA 3FKNA 2VWWA 4ORKA 4XUFA 5CLPA 5IA4A 2ETRA 3JVSA 4CTCA 4X6QC 4AZWA 2YABA 1JKLA 4AGWA 3GP0A 4C59A 4XBRA 4G6OA 5CU6A 4FOCA 3NNWA 4GIIA 4YJQA 5AIKA 5AM6A 1JOWB 2H6DA 4HJOA 4IZYA 4QP3A 3TWJA 4IZ5A 4WUAA 4U44A 3OWLA 5AR4A 4C8BA 3AMBA 4F64A 4F9AA 2BDFA 4O0WA 3WZEA 1OZ1A 5KBRA 5CVFA 3VHEA 3H0YA 1PF8A 2X7FA 2W9ZB 4AW2A 3QQJA 4MF0A 2C3LA 3I79A 5CSVA 5CF4A 2FA2A 3ZLYA 5HG8A 2X6EA 5CEQA 2XJ1A 3NMUF 2G9XA 1XHAA 1UV5A 4WSYA 1W7HA 4ANNA 3RZFA 4EH2A 3DQWA 2LAVA 1GY3A 4PTGA 4IB1A 3MW1A 3RINA 5CEPA 4N6ZA 4FG7A 3CEKA 5EDRA 5TF9A 3FQEA 4RZWA 4AQCA 1Z9XA 3FLNC 3PVGA 3LW0A 5I9UA 3GU6A 3TZ7A 1MRYA 1Q3DA 5HLPA 1WBWA 2C0TA 3R8VA 4EQMA 4FKGA 3ZLSA 4IX4A 5BVOA 1GJOA 4O0TA 1GNGA 4QPSA 5DI1A 3BV3A 4IM2A 5IQFA 4CG9A 4U79A 3OS3A 3ZO1A 2G1TA 3GVUA 5L6OA 3ORPA 2XH5A 5EDQA 3CPCA 3GOPA 4KB8A 2JITA 1E9HA 2C5OA 5J5TA 2B9HA 3OFMA 4IFGA 2P33A 2B4SB 3F88A 5HVKA 3T9TA 1WFCA 1QMZA 1ZYJA 4FV4A 4H1MA 3FI2A 3PIZA 4L46A 5CQWA 5KO1A 2X81A 3Q32A 4KRDA 2QO2A 1OITA 4TWPA 4X3FA 4AWIA 4DH5A 5IH6A 3UJGA 4ZEGA 5TOZA 5CNNA 5I3RA 4TYHB 5HNGA 1XBCA 3QKLA 4GU9A 3WE8A 3A7GA 2BZJA 3B2TA 4HZSA 2WEVA 5DEYA 4BCIA 4O7TA 2ZAZA 1YXSA 3ULZA 2PPQA 4G9CA 3FI4A 3PIYA 5FLFA 4PNKA 2PVLA 2QONA 3GENA 4Y95A 3BEAA 3CCNA 1TQPA 5BUJA 3QHWA 1O6YA 3EZRA 4FZAB 3FHRA 4BIEA 4FZFB 5K9IA 4AZVA 4MX9A 4GK3A 5F9EA 3DLZA 1FPUA 3TEIA 5E91A 2GHLA 5KMLA 5ACKA 3ZEWA 4DEIA 4GYGA 4D9TA 3OWPA 3L8PA 4IQ6A 4KIPA 4TPTA 4JI9A 3U8WA 4ANOA 1ZOHA 3TUDA 4FE2A 2YZAA 3GQIA 4D4SA 4O6LA 3GB2A 4XNEA 4P5QA 5JN2A 5IH5A 3HMPA 2HWPA 5HICA 4F08A 2XEYA 5L6WL 4O7VA 3DBCA 5CF8A 4F4PA 4WA9A 4WNPA 1UU3A 3FBVA 3A61A 5BVDA 4O1PA 2R3PA 3HP5A 3Q5IA 4RBLA 3W1FA 1YXVA 1XO2B 2WMSA 4AFEA 4CEGA 4WNMA 4U43A 4CZYB 4FEXA 2R3FA 1BLXA 4FTUA 4IVBA 4DBNA 2YM8A 4DTKA 2VWIA 3DNEA 3VF8A 3ZC5A 3V51A 5AP6A 3C4CA 3ZCLA 4EH4A 3R8MA 3S4QA 4A7CA 2P3GX 1U54A 4J7BA 4QMUA 5T68A 4KIOA 3P7CA 1ZYDA 5EM7A 2XBJA 2Q0BA 3PA4A 5ANEA 3M1SA 4OTQA 4ZLYA 1YQJA 1H25A 4XX9A 3LOKA 2ZM4A 3R9OA 3T3VA 5K3YA 3UTOA 2C5XA 4FKTA 2CGWA 2KULA 3AT3A 3AC1A 2J90A 4GMYA 4J99A 4WG5A 1OL1A 1PW2A 4FUYA 1FQ1B 1YW2A 3TT0A 3REPA 2OXXA 2PVHA 2YM6A 1YOMA 3FZTA 3ZSHA 2BKZA 4BL1A 1XH7A 3DKOA 4C4IA 3OCBA 4LGGA 3FQHA 4IXPA 3CKWA 3SAYA 3AC4A 3FMLA 1WMKA 4W9XA 2J0IA 4QMMA 4QTBA 4F0FA 4EZ7A 1YWVA 3DK6A 4G9RA 4O38A 4RWKA 3TNPC 5LVOA 3CE3A 3OWKA 3EQHA 2HZIA 2VWUA 3CP9A 4FEUA 3ZHPC 4PMPA 1H26A 3GXLA 5EKOA 1XH6A 3MH0A 2WQNA 4L52A 4AZSA 4GFOA 4RT7A 4OAUC 4DTBA 2ZDTA 5HGIA 3TKIA 3NYXA 3NYNA 2OU7A 2UZLA 4UYAA 1IEPA 3QALE 1W82A 2AUHA 3FLSA 4ASXA 5HLNA 4MXOA 3NUXA 1IG1A 3UO5A 3UZRA 2CCIA 5CAPA 4D1SA 2DYLA 2BZKB 2VNYA 3H10A 4EOQA 4Q9SA 4CNHA 3AMYA 4IX3A 3EYHA 4NJDA 4D2PA 3SA0A 5M07A 3HMNA 2YIQA 4C34A 1ZZLA 1MRUA 2YAKA 1SMHA 4XG9A 3SOAA 5KKRC 4FEWA 2X2LA 2WMTA 2WXVA 1UVRA 4TYIA 4MKCA 3BHYA 2GS2A 1Q61A 2XKCA 3PSCA 4FV5A 2BZHB 2WTJA 3VRZA 3FMNA 4A4LA 3ERKA 3W8LA 5A9UA 3V01A 4FSMA 4GT5A 3QTSA 3R1YA 3ITZA 5DT3A 5C01A 3UNZA 4FVQA 2OWBA 3DTCA 3GC0A 4IZAA 4UWYA 3O23A 4W9WA 3FL4A 4GG7A 2VTOA 3R2YA 1XH4A 5FWKK 3DXQA 4O2PA 3RNYA 1UU7A 3DBDA 4C62A 1RQQA 1DI8A 1KE7A 3C9WA 5IISA 3PVUA 2HIWA 4O21A 4GJ2A 4IWDA 3UMWA 4FYOA 3MYGA 5CSHA 3RK5A 4C58A 4FKLA 4ZTNA 3V04A 1FVVA 2PE0A 4CKRA 5ANOA 2JIVA 3VULA 4EH3A 5K5NA 4RJ8A 2R3HA 2UW5A 3DY7A 3G0EA 1CMKE 5AR8A 3ZRMA 5EYCA 2ONLC 2OGVA 1R3CA 4RX7A 5B2KA 5CU2A 3E5AA 3OD6X 2YZLA 2PZRA 4JT3A 4TKSA 4JX7A 4M67A 4FNXA 5FDXA 1XBBA 2JBPA 4GH2A 4F1MA 1QPJA 3DDQA 4KBAA 4ANSA 4TN6A 3H4JA 4N57A 2QG5A 2BPMA 2OZAB 3MA6A 1OL7A
chains in the Genus database with same CATH superfamily
3R7GA 5EOLA 4HYIA 3WOWA 3VBWA 2X9EA 5B7VA 4ZJIA 1JKSA 2ZM1A 1LP4A 1Q97A 3IG7A 4FKIA 5K0KA 3W2OA 4C4EA 4YC8A 2GPHA 3W33A 5B2MA 2XKFA 3NPCA 3O5AA 4F9YA 3W0RA 4IFCA 3R7UA 2Y6OA 4FT0A 5ICPA 4FK3A 3BGQA 2WQOA 4PDYA 4PY1A 3EB0A 2WOUA 4FKPA 5AMNA 4FNYA 4IH8A 2PVYA 3OTVA 2ZOQA 4XG6A 4EKLA 4D1ZA 4BWPA 3CKXA 4CCBA 3ALOA 4ERKA 2H8HA 4EOIA 2UZUE 4L44A 4NL0A 2VTLA 4CYJA 4EHVA 5D1JA 3DFCB 4PTCA 2I0VA 3ALNA 3LJ1A 2GTNA 4QRCA 3P1AA 3TZMA 4CYIA 2VTRA 5AP4A 2IN6A 2B54A 5AV1A 3FKOA 3O0GA 1A9UA 3WARA 4OT6A 4W4WA 4DDGA 4ZS4A 4YTHA 4IHPA 2XAMA 2VX1A 5A46A 2YM5A 5IA0A 5T3QA 3OW4A 3WZJA 4L3PA 3PXKA 5CZHA 2Z60A 2VWVA 3EQFA 4FICA 2XANA 1OUKA 2QOQA 3E64A 3MTFA 4GL9A 4NM3A 4BICA 2ZMCA 5A3XA 3O51A 5CNOA 4O7RA 1B38A 4XV1A 4BTMA 1UWJA 2G01A 3Q6UA 4L42A 4EOJA 2W4OA 4TYGA 3LLAA 2A4LA 4GK2A 4FSWA 4UY9A 3DAEA 1K9AA 2W1CA 3AC5A 2BZIB 4NIFA 3QQKA 4H3QA 4Y46A 4ANLA 3GT8A 1V0BA 2BRBA 2G2IA 5EM8A 2JFMA 2X0QA 2I7QA 1E1XA 2C4GA 2UW6A 3K2LA 5HO6A 2PVRA 2IW8A 3LM0A 1P4OA 2IJMA 4EH9A 3ODYX 3IW5A 2QOLA 4BHZA 1PXMA 2UUEA 3S2PA 4BGQA 2ITXA 5AAEA 4CFFA 3FC2A 3MTLA 3RPSA 1PXLA 3FI8A 3LLTA 4BC6A 2A1AB 3AOXA 4O0UA 2ZM3A 3EMGA 4J1RA 1YRPA 2JD5A 3UNJA 4H05A 1NA7A 4QYFA 4A4XA 3PTGA 4RJ4A 2W1GA 5KHWA 4FT7A 4JDIA 4FT3A 3DAJA 1VR2A 4FV3A 2JIIA 4MAOA 5AUVA 3ORLA 4QMSA 4FIEA 4I4EA 4YJPA 4EC8A 3UO4A 4FVRA 1IR3A 2GFSA 3PG3A 2J5EA 5IQIA 1R78A 2A27A 4B7TA 3R63A 5IH4A 5GHVA 3NAXA 2R3IA 1WCCA 3PIXA 3MJ2A 1LEZA 4Y5QA 4XG7A 3MIYA 5DMZA 3BQCA 4GUEA 3MDYA 4G17A 4L00A 3TKUA 3VW6A 3C4ZA 3I0OA 4BDAA 1JSTA 4YZDA 3ZO2A 4D55A 4DEEA 3OCTA 5HIEA 1U5QA 4MTAA 4LDTA 3SQQA 3O71A 3COIA 4DA5A 3KA0A 1F0QA 3R7IA 3IO7A 5E9EA 4BR3A 1GZOA 3B2WA 4IAYA 3FC1X 1AD5A 4KSPA 4ACDA 2IZSA 1XR1A 3G90X 5GZAA 3D2IA 3OROA 1YWNA 2AC5A 5ANGA 2QC6A 4MEDA 1XH9A 1YDTE 4YUQA 3TI1A 4ZIMA 2JIUA 3MIAA 4ZSLA 5IEYA 2G2HA 4C2VA 5HU9A 3KULB 4BVUA 2OICA 4Z3VA 4ZSAA 1IAJA 3O7LB 2ITYA 3RALA 2ITTA 2F4JA 5DE2A 1S9JA 2BHEA 2PMNX 2R0UA 3SOCA 4C61A 5HIDA 3W2SA 3OC1A 3KULA 3OVVA 4RIYA 4U7ZA 4BBFA 4IC8A 3W18A 4USEA 5H3QA 4H58A 3IGOA 4IB5A 4F6UA 4BKZA 3FWQA 4I22A 4BBEA 3RCJA 4F63A 2X7GA 4YJOA 4LMUA 1UWHA 5ANDA 4WBOA 3ZUVA 3K5UA 1UNGA 4AZEA 3FV8A 1SYKA 2PWLA 4FV1A 4KIKB 3FLQA 3ZXTA 2WMBA 4HGSA 4CKIA 3N51A 3JPVA 5EI6A 1H1WA 4M3QA 1OVEA 1WBPA 4EZ3A 5A4CA 4EJ7A 1KE8A 3EFJA 4NJ3A 3COKA 1OIUA 3KEXA 3ORIA 1OECA 3I60A 4O0SA 2OBJA 4B9DA 4IW0A 4F6WA 2WQBA 3DKGA 5J79A 4ASZA 3BBTB 4O7WA 4IAIA 2PZIA 4IWQA 4V0GB 4FT9A 3BHTA 4RIOA 2BDWA 3H30A 4MBJA 1SNXA 5CT7A 4CT1A 4MXAA 3F7ZA 4UMQA 5HO7A 5IZFA 1P2AA 2O65A 3DJ7A 3DJ5A 2J0KA 1OPJA 1U59A 4D5KA 3DKCA 3U51A 2XK8A 1G8AA 5I9YA 4F9BA 4RWLA 5EYMA 2JKMA 4FV7A 4EJNA 2GS7A 2VWBA 4I6LA 4O4EA 4F7JA 2W5AA 2XA4A 4L67A 2O3PA 4RIXB 3MFSA 3PSDA 4BTFA 4RC3A 3R0TA 2XVDA 3F5PA 3E8CA 2BCJA 1DM2A 4H3BA 1WAKA 4KWPA 1F3MC 3NUNA 4CMUA 5I9WA 4DHZA 4RIXA 5LCKA 2EU9A 2WZJA 2GDOA 4F0GA 4GT4A 1ST4A 3A4PA 1OB3A 4LL0A 2FUMA 3IS5A 4XP2A 3C4XA 3SV0A 5L8KA 3S1HA 3FAAA 2X0OA 3U9CA 3R1SA 4KS7A 4O4FA 4AZTA 4FMQA 4JIKA 4IAAA 3D7TB 3ORTA 3RPOA 4FIFA 4QPMA 4B6LA 2ZMDA 5AADA 5FUTA 2BIYA 2B55A 5CF6A 4LOPA 4HYSA 3DJ6A 5CU0A 2QO7A 1E1VA 2W5HA 4LUDA 4O0RA 4RFZA 4YZBA 3UNKA 4OTRA 4DT9A 4KNBA 5HE3A 4Z7HA 5AP5A 4WG3A 4MHAA 3KF7A 4BDFA 1X8BA 3ZFYA 1VYWA 3KQ7A 4Y73A 4ASDA 1JKKA 4E26A 3VBXA 2Q0NA 3CR0A 3LJ0A 4GVJA 5E92A 3PRFA 4JAJA 3VS7A 4OBOA 2PHKA 5FEEA 3FMDA 4V04A 4BF2A 3EYGA 5AP1A 4BCGA 4CQEA 2XNOA 4P5ZA 3LFAA 4EC9A 4V01A 4HW7A 3Q53A 4AGUA 3DS6A 4KAOA 4M69A 4X2JA 4AZFA 5FRIA 3QGYA 3TJDA 3UYSA 4YSMA 5ITAA 4JRNA 3HUCA 4YLKA 3KXXA 4G5PA 4BN1A 1J1CA 2Y4PA 4HVGA 3BYOA 4IAZA 4YJUA 5GINE 5D12A 4BCQA 2B53A 4FIJA 4FL3A 2VX3A 4D2WA 3AQVA 4YO6A 2PMOX 4ZTMA 2GHGA 2W1EA 3NW7A 5FEQA 2Y4IB 4Y83A 3AKLA 5AP3A 3NWWA 5A4QA 2H96A 3QQGA 3NS9A 4E6QA 5EI8A 5EM6A 4K1BA 5L2WA 5EHYA 3DZQA 3JVRA 3QCXA 1JSVA 1W2CA 4MYGA 4G3FA 4IMYA 3BYSA 2C69A 4UZHA 3ZSIA 4G34A 4I5MA 4HVDA 5L2SA 4FI1A 1W8CA 4RPVA 5AIRA 5E90A 3UQFA 3W2QA 3NFFB 2HZ0A 3IDPA 3Q4TA 4E6CA 2HW6A 5FP6A 1SNUA 4PX6A 3MJ1A 4BI2A 4ERWA 5L6PA 4LL5A 3KVWA 4UMTA 5DBXA 5FDPA 2QNJA 3MA3A 3QWKA 4I6BA 3OUKA 4WKQA 3F2AA 5BUEA 4ZOGA 1ZOGA 1ZYLA 4G3EA 4BY9E 3GC7A 2HWOA 4USDA 3HMIA 5GIPE 3BIZA 4YNEA 5DT4A 2F7EE 4FTJA 5EW3A 1K2PA 3L8VA 4FGBA 5HTIA 3PY1A 4AW1A 4QNYA 3ZM9A 5C8KA 4PTEA 2VAGA 4ITJA 5EG3A 2GNIA 5HCYA 5K5XA 2OW3A 2OXDA 4FTCA 5G1XA 2A19B 4R7IA 3NVMB 5BQ0A 1KV1A 2X8EA 2Y6MA 3OXZA 2Z7RA 3NDMA 3SXSA 4RX5A 5FP5A 3L8SA 2J9MA 4RSSA 4HZRA 4BDEA 4FTKA 4G2FA 4RJ6A 3S0OA 1URCA 2C5VA 1VEBA 1GIIA 3T3UA 4UMPA 4GK4A 2QO9A 3AGLA 5IQHA 3DDPA 3VJNA 4EK4A 2OJ9A 3BGPA 4PWNA 2PZ5A 4QP1A 5I4NA 4DBXA 1J91A 4L6QA 3VUKA 3I7BA 4UZDA 4JDJA 3DK3A 3V5TA 3IQ7A 5HIBA 3LAUA 3L9NA 4L8MA 4MQ1A 2EWAA 5F20A 4ZLZA 2NYAA 2WTVA 5BVWA 4CFVA 3Q04A 3MFTA 4FV9A 2CDZA 3EKNA 2EB2A 4MXXA 4XV2A 5TKDA 4IVCA 4BI1A 4QD6A 5DR2A 1U4DA 4FYNA 1XMMA 2CGVA 2UZWE 3L9PA 3OXIA 4U80A 4M12A 3CD3A 2ESMA 5HCXA 4EK6A 4AF3A 4EK8A 3FXZA 3ZZEA 2I0HA 3GEQA 5IQCA 2BTRA 3H3CA 3SKCA 2EB3A 2PZYA 1PJKA 3BLRA 3C5IA 3D5UA 2CLQA 3F9NA 1GZNA 3VQUA 4HGTA 3V3VA 3ZC6A 3HP2A 4ACCA 4QYYA 1KE6A 4YR8A 4O7ZA 4NK9A 4QTAA 4FZDB 5EH0A 4I94A 5ETAA 4DGLC 5C8NA 2X1NA 5BYZA 3U54A 1B39A 1R1WA 4UX9A 2CKQA 2F7XE 1YOLA 1Q4LA 3QRIA 4FNZA 3E63A 5IA3A 5M44A 4EHZA 3PXZA 1IAHA 3I6UA 1PXJA 3DV3A 3LQ8A 5BMMA 3DBFA 3ZXZA 3VUDA 3LCDA 3ANQA 4G1WA 4APCA 5K4IA 3QUPA 1G8JA 3CSVA 1ZOEA 3AXWA 4EQUA 4PDOA 3UDZA 3OT8A 5GJGA 3OWJA 5C9CA 2R7IA 4P2KA 3TUCA 3PDTA 3DA6A 1LR4A 3QLFA 1V0PA 2VZ6A 2XZSA 3QRKA 3S95A 3FMMA 2JKKA 3BHHA 2YCRA 3FDNA 5JK3A 3EIDA 3ZBXA 5JQ5A 4NSTA 4LV7A 4NTSA 2YM4A 2PU8A 5GJFA 2R3MA 4UYNA 4I1ZA 3KN5A 2FGIA 4RMZA 5CXHA 4C4FA 4NYEA 4JG8A 2WTKB 1TZDA 3UP7A 2RIOA 3VBYA 2OG8A 4C37A 3R01A 2XKEA 4YTCA 2EXMA 4YMJA 3FL5A 5ETIA 2PUIA 2O8YA 3D83A 2Y0AA 2ITOA 2ONLA 3HAMA 4JAIA 3C0HA 2E9NA 4GVAA 5HESA 4EONA 3UQCA 2ITQA 4FL1A 4Y8DA 3MI9A 4C4HA 3R30A 4RRVA 1M2QA 5GIOE 2RFNA 3ROYA 4F65A 3EFLA 3DGKA 3LXNA 4RA5A 3ULIA 4I5HA 4QTDA 4M13A 3W10A 5AUUA 4RX8A 2BRHA 2JAVA 3QA0A 4TWOA 4FTNA 4X3FB 4BZOA 2OLCA 3MH2A 3Q9XA 3MVMA 4DHIB 2XCKA 4JJRA 2CMWA 5CSWA 3FXXA 1JAMA 4JR7A 3UOLA 3VF9A 4CFUA 4TYEA 4BIDA 1R39A 3CS9A 2GCDA 3R9NA 1GIHA 5CSPA 5BV3A 1FINA 2W4JA 4O7SA 4ZY6A 5KE0A 1PXNA 4KBKA 2V5QA 3WZDA 3OTUA 2HW7A 2BAQA 1G8SA 3F5UA 3NVKI 3UZPA 3TDVA 5M09A 2W17A 3QRJA 5HBHA 1S9IA 2GMXA 3OCSA 1BL7A 4AN3A 2XIXA 3BYVA 2CNVA 3QTQA 3EQGA 1JKTA 3C50A 4H3PA 3ORNA 4AA0A 4AGDA 5CYIA 4BJJB 3LFDA 3F6XA 3HX4A 1CSNA 1NT2A 2G2FA 5AP2A 4K11A 2C5YA 3WF7A 3QKMA 2GSFA 1AQ1A 2NPQA 4HCVA 3SLSA 4U40A 3PLAE 5JZNA 3UP2A 2CHLA 2HELA 4P4CA 3I6WA 3LFQA 1LPUA 3QTUA 4BDCA 1P14A 4WIHA 4CV8A 4PRJA 3VS5A 2IF8A 4IVAA 4MVFA 4O96A 3ZUTA 3R73A 5CENA 5AUZA 5C26A 5AUXA 2JDOA 5ACBC 4DCEA 3OCGA 4O7LA 3ANRA 3IPHA 4OTGA 1ZYSA 3DPKA 4GU6A 4BDIA 2FSLX 5CT0A 5HNBA 2UV2A 4D4VA 5FM2A 4ZLOA 4USFA 4D1XA 1U54B 5JFXA 2JKQA 3PJ2A 4CFMA 4YZMA 4RG0A 4EYJA 3LFEA 4P90A 1OL5A 4TNBA 3HEGA 3LZBA 4X7QA 4BWXA 1Y57A 3CQEA 2QURA 1Q8WA 4IWOA 3PUPA 3ZS5A 4XMOA 4XP0A 4DTAA 2R3KA 3BGZA 2RL5A 3ZMMA 4FC0A 3C4WA 3D9VA 3F82A 5EHLA 3FY0A 1PMUA 3BV2A 5J95A 4QMXA 5IA2A 4BDKA 5AAFA 1KOBA 5I0BA 3UOJA 4F1OA 3I5ZA 5J87A 4BYIA 2JLDA 3KRJA 2VTJA 4J53A 4NEUA 3LHJA 3BL9A 4IWPA 2XS0A 4DG2E 1ZY4A 4FKRA 4IM0A 5DVRA 2IW9A 3Q5ZA 2J0LA 3HRFA 4I0RA 4PV0A 1OBGA 3SG9A 2QKRA 4I23A 3ROCA 1UKIA 2CJMA 4A9TA 3R8PA 3TZ9A 3HUBA 3UVQA 2I0EA 4JVGA 3WILA 3KRRA 3VO3A 4AW0A 4KKGA 3VWAA 4NH1A 2ITWA 3CC6A 3FI3A 2C6TA 3GQLA 3TCPA 4YZ9A 1FOTA 4DFNA 5KZ0A 4Z16A 2I0YA 4YPSA 1MP8A 5J1VA 2X2MA 3BQRA 3KFAA 4CXAA 1W83A 3QBNA 2B9IA 2B9JA 2Z7SA 5F1ZA 5IA1A 4G6NA 3GU8A 2GNLA 4WBBB 5HQ0A 4O91A 2CN8A 4QP8A 3KK8A 2CLXA 2YITA 3H9RA 3CTHA 3A99A 2BFXA 3Q3BA 4FT5A 4BGGA 5D11A 3QUEA 1PXIA 5HD7A 3UODA 4DLJA 1ZMWA 3R00A 4XCUA 4HVIA 3UPXA 4F7SA 1H8FA 3RTPA 3FZ1A 3TXOA 1DI9A 3U87A 3ZFXA 3ZM4A 2C3JA 4U3YA 2BKKA 4DCAA 1H01A 2Z7QA 2P2IA 3DLSA 3O17A 2PL0A 3FXWA 2XM9A 4F7LA 3U55A 4I6FA 4LV5A 4I41A 4C3RA 2OIQA 2PVJA 2QR7A 2BAJA 4ZSJA 2BTSA 1PYEA 1ZRZA 1PMNA 4U0IA 4A9UA 3F7WA 5H8GA 4E7WA 3LKMA 3BWFA 3PP0A 5AFVA 5I9VA 2VGPA 4ANQA 3TV6A 1WVWA 3IOKA 1APME 3KL8A 3GCUA 4AXAA 4C02A 2QOIA 4BCKA 4O6EA 5HLWA 5JRQA 5I9XA 4C36A 5KUPA 4I92A 4QT1A 4GFMA 5HG7A 5LJJA 3AMAA 5DWRA 1DAYA 4ZP5A 3WZKA 5HE2A 3JUHA 4FTAA 4KS8A 3TV4A 3UIBA 3D5VA 3PFYA 4AXCA 4FV8A 3VVHA 3W0MA 3D7ZA 4BDGA 3A7JA 3C0GA 2E9OA 2OJGA 2R2PA 2YCQA 1WBVA 3Q9WA 4YP8A 5DYJA 3E8DA 2B9FA 3PWDA 4B8MA 3FHIA 1PY5A 2W0JA 5EHOA 5TO8A 4M0ZA 4YHFA 4Y85A 3RJCA 1STCE 4F0IA 3NUYA 1QPEA 1EH4A 3QXPA 5IU2A 5JRSA 1F5QA 3WF9A 3OXTA 3FLYA 4B4LA 4DC2A 2QI8A 3GU4A 3GU7A 3DQXA 4JQ7A 2J7TA 3G6HA 3BPRA 3A60A 2GNGA 3ENMA 3GCPA 4R3PA 4DE4A 3FY2A 3AT2A 3KMUA 4C38A 2B1PA 4YHJA 1P4FA 3CY2A 4C7TA 3LIJA 3BHVA 2IPXA 2OO8X 5IA5A 4YC3A 4FSNA 2IVTA 1OBDA 4DT8A 4E5AX 3WZUA 2ZV9A 4GKHA 1UNHA 5TE0A 5CQUA 3CTQA 5HE0A 3A7HA 4XEYA 4BZDA 2PUPA 2YIYA 3E3BX 4ZSGA 2WMAA 4FIHA 3KF4A 1K3AA 4BKYA 2WIHA 4JQ8A 1YDSE 4MD8E 2UZEA 4CVAA 4IACA 2IZRA 1Q41A 2VUWA 1WBNA 4GCJA 4OUCA 4O7NA 4HVHA 3R1QA 3EN6A 3VS1A 4L45A 4XHKB 3LMHA 2XNBA 4ENXA 3DNDA 2A0CX 3V5JA 2PSQA 2IWIA 3PJCA 2OXYA 2I40A 2QOKA 3QX4A 5H8EA 4EUTA 4YSJA 4QP2A 4R6VA 5HO8A 4I3ZA 3V8SA 4ZJVA 1M17A 3RKBA 4E1ZA 4EHGA 5DR6A 3LMIA 3SGCA 3Q2MA 4XV9A 3LXLA 4YZCA 1G3NA 4N70A 5KBQA 2VTTA 2NO3A 4FVPA 2OFVA 4EL9A 4DF3A 4QTEA 3NGAA 2W4KA 2UZNA 4X2FA 3VS3A 5D41A 2GFCA 1Q3WA 3I0QA 3P86A 1LUFA 2QLQA 4ZTQA 3B8QA 3Q52A 4CZUA 4Y72A 3RM6A 2C47A 4BDBA 4D9UA 3DXPA 5A4LA 2R7BA 5HX8A 2YEXA 1OKZA 5FTQA 4CG8A 3RHXA 4FTIA 2QOHA 3F3WA 4NIFB 4S2ZA 4K33A 2YM7A 4XOYA 4FSQA 5HTBA 5BMSA 2AYPA 2WB8A 4D4RA 5IMXA 5HHWA 3PG1A 2X6DA 2C6DA 1QCFA 2QU6A 4CV9A 1UNLA 2W5BA 3PSBA 3HRCA 4ZZMA 3VC4A 4DHFA 4AAYA 2RFDA 2XBAA 3FJQE 4EBVA 1I44A 4CMOA 4TYJA 3VUHA 4YO4A 4BBMA 4X21A 3A8WA 3SXFA 3FMKA 2ITUA 3EFWA 3T8OA 4BDDA 4EOPA 2FH9A 1RE8A 2JDTA 3R2BA 3QQUA 2PYWA 4RQVA 4MWIA 4E4XA 5G6VA 5HVYA 4BCOA 3C13A 4KRCA 2UVXA 3UC3A 4DH3A 4GKIA 3W32A 3HV4A 1W2DA 4FIGA 3SDJA 4UB7A 3UE4A 4RIWA 4EUUA 4ZAUA 4PMTA 3ML1A 1GZKA 3QQHA 3Q60A 2UVYA 2P2HA 5DH3A 5K0XA 4UXLA 4KSQA 4JDKA 4AACA 1U5RA 2R3OA 4AE6A 2SRCA 2O5KA 3V6RA 5EYKA 5EYDA 2QG7A 2XCHA 3NCGA 3FZPA 5A54A 3KVXA 4RLKA 1Q8TA 4S30A 1YHWA 1ZWSA 3LFFA 3Q4ZA 3VBQA 4ITHA 2OZOA 4JMQA 4KUJA 1M14A 4J98A 4DAWA 3QQFA 5E8ZA 5AWMA 4ZTLA 4F70A 3DU8A 2ACXA 5ETFA 4AFJA 4HVSA 3L9MA 2I1MA 4BKJA 3ZU7A 3NW6A 3SRVA 3OBJA 3TIYA 2IVUA 4A06A 1L8TA 4OT5A 3OMVA 2X2KA 3R7OA 4AT5A 3RM7A 3NIEA 1HOWA 1PMEA 4FTRA 2WOTA 4K8AA 4CLJA 3VUMA 4EH7A 2B52A 4QOXA 5FM3A 4MXCA 3Q2JA 2F7ZE 3CJFA 2BROA 4G5JA 5EFQA 2R5TA 4DGOA 3CJGA 3FKLA 4U45A 3BKBA 3QWJA 3TNHA 2X39A 3NUSA 2R64A 2XJ0A 3HYHA 2GTMA 3QTRA 3ORZA 2QOCA 4QP9A 3E8NA 4BJJA 1KV2A 3KKVA 3QD4A 4RIYB 3VIDA 2F57A 4EOLA 2XJ2A 4C3PA 4QYHA 2XARA 3R6XA 2HZ4A 3TJCA 2QR8A 4AOTA 5IEXA 1RW8A 4EBWA 1ATPE 2WNTA 4I6QA 4WNKA 5M53A 2RF9A 3EWHA 3VW8A 4OGRA 1NVRA 2RG5A 3AG9A 4ZK5A 2O64A 2XKDA 2BALA 3DKFA 4FKSA 4QMZA 3QC4A 2ZV8A 4FSYA 4DG3E 4EH5A 5I5ZA 5KMNA 3ZFMA 4HPUE 1XBAA 4AX8A 4GIHA 3DOGA 1KSWA 3NZ0A 1CKIA 4L01A 4NKAA 3ET7A 4FUXA 3UYTA 4MBIA 1XWSA 4OTWA 4XJ0A 4X2GA 3MESA 4LUEA 3LVPA 1H0WA 5HG9A 4OTFA 4M68A 1DAWA 3KU2A 2HYYA 3BBWA 1W98A 4NTTA 4AUAA 3R71A 2ZV2A 1TVOA 3QZFA 1XQZA 5H2UA 3UZTA 4FJVA 2YISA 3AT4A 1V1KA 2VWZA 3WI6A 2QOOA 4M0YA 4BTKA 5IQAA 3DZOA 3HVCA 3NYVA 5A4TA 1Y8GA 4FODA 5A6NA 3U6HA 4L3JA 3AKJA 4K2RA 2C0OA 3KXMA 4U6RA 2KTYA 4FG9A 4JXFA 4WOVA 5J5SA 5EQYA 3U4UA 5L3AA 4RJ5A 4DDIA 3E3PA 2BFYA 1OIQA 3ZLWA 1FGIA 4O0XA 4ZY5A 2ERZE 5LWNA 4WD5A 3R9HA 4QQJA 4C4JA 3IGGA 3FSFA 3QGWA 5FTGA 3ETAA 4GV1A 3P23A 2OJIA 4FSUA 3GCQA 3D5WA 2O0UA 2E9PA 3E87A 4L3LA 4F78A 2CGUA 3P79A 3F2NA 5AUWA 3W2CA 4MNEA 1JWHA 4BCJA 4HYUA 3ZRKA 4CFXA 1UA2A 2JDRA 3HL7A 4FZ6A 3W0PA 4ZTRA 3V5QA 4DEDA 4CGAA 3ORKA 1OPLA 3ZSGA 4D0XA 1H27A 5HU3A 5DNRA 1H1SA 1TQIA 3QAME 2YJSA 1L3RE 3UGCA 5EKNA 3JYAA 4D2RA 2JGZA 5LMBA 3OOGA 4FG8A 1CM8A 4QEBA 2VGOA 3IONA 1Y6AA 2XIRA 3WYYA 5T6KA 4A9YA 3P4KA 4CFWA 2NNWB 4L7SA 2WO6A 3V5PA 4II5A 3N4UA 2Y8OA 5E1SA 2XUUA 3RPRA 1LEWA 1XKKA 2BUJA 2H34A 2VTPA 4QDEA 3MVJA 4QMTA 4JBOA 1KE5A 4TWNA 3C4EA 4UN0C 4PL5A 1ZXEA 2X0GA 5FQDC 3FYJX 4XLVA 3PXQA 2IO6A 1ZARA 1R0PA 3ELJA 4QYGA 4S33A 5IMEA 4D4YA 1HCKA 3THBA 4E5WA 3I81A 4NFNA 2J2IB 4PMSA 1FBNA 2EVAA 4U42A 3TKHA 5E8XA 5KMJA 5KZIA 4ITIA 5AV0A 4ACHA 2GQRA 4YURA 3HV6A 3K54A 4FKQA 4RZVA 3SD0A 4R1VA 4RWIA 4O0VA 4C35A 5JKGA 3NR9A 4L68A 3UG1A 4DFZE 3CGOA 3R9DA 4M69B 4YJVA 2EUFB 3IW4A 4FZ7A 3GNIB 2WGJA 3UG2A 4GSBA 3BLQA 3LJ2A 4AA4A 4PL4A 2VTHA 4FA2A 5ETCA 2YDJA 4LGDA 4GS6A 2GNJA 4W4YA 4YLJA 4H1JA 4RJ7A 5IUGA 4Z55A 2BVAA 2VD5A 3MN3A 4CRLA 3AD4A 2WMQA 4LQMA 5HX6A 4RQKA 3NCZA 4I21A 1QPDA 3D14A 4EK3A 5J9YA 2CNQA 2XIYA 3OEZA 4JBVA 3IDCA 3NNVA 4BFMA 4E4MA 2ZB0A 3PJ1A 4TNDA 4HOKA 2I6LA 2EXCX 3WE4A 5KCVA 3O8TA 4EHEA 4HGLA 5E8VA 5AV2A 2BILB 3NNUA 3Q4UA 2X8IA 3H9FA 1J7LA 2UW7A 4TXCA 5AV3A 3L1SA 2YA9A 3EN5A 3QYWA 2PVFA 2F2UA 1YHSA 3KXGA 4LV8A 1CKPA 4BGHA 4IX5A 3AC3A 3KXNA 3WYXA 3Q9YA 1Q8UA 4LOOA 4XLIA 5C27A 2C6LA 3MPAA 4BCMA 4DHJA 4QQ5A 2UZTA 3OBGA 1SVGA 4RC2A 4XG8A 1NXKA 2WMVA 1OKVA 3NW5A 1BUHA 3HA6A 2DUVA 4O1OA 3WF5A 1YXXA 1YXTA 3E8EA 3QTIA 4XRLA 2C68A 3GC9A 4Z7GA 4FKWA 5HI2A 4FL2A 1GIJA 4OBQA 5L2QA 3GOKA 4YLLA 1XMLA 4RVKA 4N0SA 2PVNA 5BPYA 3EQIA 2DWBA 2WMXA 2UVZA 4DITA 4AW5A 5JEBA 5DLSA 3LCOA 3WIKA 1O6KA 4XYFA 3OT3A 3PXFA 3QZHA 3LMGA 1BKXA 2ITPA 4AN2A 5C8MA 5DIAA 5AR5A 5B0XA 2CN5A 4G3GA 2ZYBA 4G6LA 4GEOA 2PTKA 5AAGA 3R7EA 4NZWB 2XK4A 3ENHA 4BHNA 4IDVA 5IEVA 4LYNA 2W1ZA 5CTPA 2DS1A 2HCKA 4ONAA 3CGFA 2HZNA 2ITZA 2W1FA 3A4OX 3PZHA 4TY1A 1H4LA 2HXQA 4YGAA 4XG4A 3ZDIA 1Q99A 3MFUA 2V7OA 4X2KA 4D2VA 1OKYA 4OTDA 3ATSA 3LFNA 3OZ6A 4TW9A 3MGYA 2CKOA 3EQCA 4O81A 1OL6A 2ITVA 3NRMA 5E8TA 2Z02A 3B8RA 3MY5A 4RVMA 4YJNA 5I3OA 3PJ3A 1R0EA 3VHKA 4DFYA 2WAJA 3QTWA 4PPCA 1OGUA 3UDSA 4O82A 4I5PA