4D4SA

Focal adhesion kinase catalytic domain
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
272
structure length
255
Chain Sequence
b'YEIQRERIELGRCIGEGQFGDVHQGIYMSPENPAMAVAIKTCKNCTSDSVREKFLQEALTMRQFDHPHIVKLIGVITENPVWIIMELCTLGELRSFLQVRKFSLDLASLILYAYQLSTALAYLESKRFVHRDIAARNVLVSATDCVKLGDFKLPIKWMAPESINFRRFTSASDVWMFGVCMWEILMHGVKPFQGVKNNDVIGRIENGERLPMPPNCPPTLYSLMTKCWAYDPSRRPRFTELKAQLSTILEEEKLQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords FOCAL ADHESION KINASE 1
publication title Allosteric Regulation of Focal Adhesion Kinase by Pip2 and ATP.
pubmed doi rcsb
source organism Gallus gallus
molecule tags Transferase
total genus 79
structure length 255
sequence length 272
chains with identical sequence B
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2014-10-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4d4sA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4d4sA01
2GTMA 2OXXA 2UZBA 2BILB 2W4JA 3H10A 5EM8A 4N0SA 3ZO2A 4CZYB 3DK3A 3FZSA 2ITNA 3DTCA 2OF4A 4C35A 1MQ4A 3LFSA 1OPKA 3MS9A 4TY1A 3QHWA 2WPAA 4M84A 2I7QA 1SNXA 4FUYA 1JNKA 3U4UA 2R3PA 4XV9A 3F5XA 5L8JA 4TPTA 4YZNA 3W2RA 5JRQA 4DBXA 1CM8A 3KULA 1Z9XA 3E8DA 1TQMA 4IVDA 4C36A 2QHNA 5BMMA 4GG5A 3KB7A 3TV4A 2HZ0A 1H1WA 4IAKA 4YBJA 4QYGA 4X2FA 5H8GA 3OXIA 4D2RA 4QMPA 2W1CA 3SOAA 2VV9A 3NYVA 4B4LA 3RAKA 2BFXA 3WARA 2PVYA 3F82A 3EQRA 5AAEA 4EUTA 4QMNA 2YCRA 3Q4CA 4ERWA 3EQFA 1LR4A 4DFZE 4YR8A 4C3RA 2YIWA 5KZ0A 4GG7A 2YZAA 1GIJA 2QR7A 3NLBA 1XKKA 3PPZA 3R9NA 5GHVA 3R8ZA 2J9MA 2DUVA 3WZDA 4XNEA 3UNZA 3TNPC 2W96B 4GUBA 1SVEA 3LJ0A 5IG1A 4USEA 2O64A 4EQUA 1X8BA 4PX6A 4QOXA 4MKCA 4ASEA 2YM3A 2WQBA 5M4UA 3LMGA 2GQGA 3SVVA 3I6WA 4MXOA 3SRVA 4DFYA 3SD0A 2DWBA 4DFNA 4XH6A 5C1QB 2VTMA 2QHMA 3DBDA 4LFIA 1FVTA 3FSFA 3P79A 2R3QA 4GVAA 4KKEA 4M7IA 4W4WA 3W10A 3CGFA 2C5OA 3QALE 1PXIA 3N9XA 2RFSA 2XNEA 3IW5A 3NUXA 5ETCA 1DI8A 5FEEA 4BTKA 4FEUA 1FINA 3GOKA 3OBJA 4JOAA 4AP7A 2CKOA 1PXJA 3JVRA 3Q6UA 1DAWA 3BX5A 1K9AA 3MVLA 3QTSA 2OWBA 3R28A 4MTAA 3NSZA 5CTPA 4EH9A 2F7XE 1GNGA 4ONAA 3C4WA 2PTKA 3PWDA 4BF2A 2I40A 5IMXA 2YDJA 3JPVA 4BVUA 3KRJA 2FSLX 2VNYA 4E5BA 4F0GA 2QKRA 2NNWB 5T68A 4O27B 5KMIA 4CYJA 3IDBA 1AQ1A 3G90X 2XK9A 3F2NA 1S9IA 2HOGA 3G6GA 3QUEA 3PFQA 4TWOA 4BBMA 5AJQA 2X81A 4CRLA 4DGGA 4Z55A 5L3AA 4D1XA 4J1RA 1H1RA 3DS6A 4QMXA 4UXLA 5JH6A 4EOQA 5CNNA 2O63A 4FV8A 3C13A 3DBCA 4MX9A 4QP4A 1DM2A 3QD4A 4KRDA 2EXMA 2X4ZA 3UP2A 5EM7A 2VTPA 4TYIA 3M2WA 2XIXA 4AS0A 4K0YA 3DKGA 5DRBA 2J0IA 2VTNA 4JDKA 4O91A 2B9JA 4BKYA 3MVMA 1FGKA 1H27A 2XCKA 4S31A 3FC2A 4I4FA 4E6AA 4IVBA 1WVYA 2VU3A 2KTYA 2VO3A 4G6NA 4H58A 4HYSA 2J0KA 3LQ8A 5E1EA 2JIVA 3CJFA 3V04A 4UMRA 3FQSA 3OD6X 1WFCA 3U6JA 3CE3A 4DFUA 3D2IA 3NCZA 3ZO1A 4LOPA 4CFNA 5IF1A 3GCVA 3DY7A 2P2HA 1GY3A 2BIKB 3FKLA 4FOCA 2XIZA 3FUPA 4LMNA 4PMMA 1PYXA 3AGMA 1JSVA 2GNIA 4W9XA 3CTJA 5E8XA 2J7TA 4E5WA 1JKSA 4BICA 1WVXA 2I6LA 2Z7RA 3QWKA 3R1YA 4L7FA 5LMKA 3BIZA 3WF5A 3HRBA 4GKIA 3VBQA 4O1OA 1WMKA 2Q83A 4YZ9A 1XBBA 4MCVA 1Q8TA 3BHUA 3EQBA 4IQ6A 4P7EA 4QMYA 4S33A 4ZSEA 3HMOA 5EHOA 5TKDA 1UNHA 1Q24A 4F70A 3BGQA 5CSVA 3REPA 3MSSA 5B7VA 2OW3A 4J8NA 2UZDA 3E7VA 3TTIA 1TVOA 2WB8A 3OS3A 2DQ7X 4IADA 3GBZA 2R3FA 4WRGA 1YOLA 2A19B 1R3CA 1Y6AA 4IAZA 4WG5A 2WMRA 3SXSA 4CLJA 2O8YA 3OWKA 5C03A 4TL0A 3L8SA 4XBRA 3BHTA 4X3FC 3LM5A 5T3QA 5J7HA 4JBVA 1Z5MA 5L2TA 4NU1A 3Q60A 2IVSA 2R3KA 4DINA 2BTRA 4O0SA 5CWZA 3MFTA 4H1JA 4MD7E 4U44A 4FV6A 3QZFA 4R77A 2Y0AA 4HZSA 4FTRA 2CKQA 1VJYA 3F69A 1A48A 5FXQA 1ZMWA 2C1AA 3OHTA 2JDRA 3R1QA 5AV3A 5HLWA 3UIUA 4FA2A 5AR2A 4WNKA 1YDRE 1YI6A 4L53A 2XEYA 5AR3A 2WQNA 4PRJA 1APME 2YLFA 3H0ZA 1H00A 3IW7A 5DR9A 5DT4A 3DA6A 5E90A 4YO4A 3I6UA 4RJ3A 5CU3A 4ZY5A 3DB6A 1JKLA 3CXWA 5EOBA 3ZLXA 4FTQA 1H08A 5IA5A 3OZ6A 1YVJA 2J51A 4YTCA 2FA2A 4A9SA 1P5EA 4FVQA 1IR3A 5DH3A 4X3FA 3B8QA 3MH0A 3W8QA 2CKEA 4FSWA 3ZDIA 3C50A 4RIWA 2VWIA 5IQHA 4C3FA 2XB7A 4NUSA 3AXWA 2J90A 4FSUA 4FYOA 5DE2A 4GL9A 2HAKA 3FPQA 4P5ZA 2PZRA 2C30A 3C4XA 4QP2A 1J1BA 4YJOA 4USFA 1M52A 4XOYA 3GCUA 4R5SA 2ZAZA 1RW8A 3HV4A 3BGPA 2H34A 5AUWA 3BV2A 2UW6A 3EN7A 1YWNA 3ZC5A 5IPJA 3L9NA 3QC4A 4E6CA 3AD5A 2UW0A 2XKFA 3DJ6A 2W1HA 3NUPA 4KRCA 4NWMA 1BX6A 4AWIA 2AYPA 2W5AA 4BBEA 4LGGA 5H2UA 1OBGA 3RZBA 3HMIA 2QU5A 2GQSA 4QTEA 3DBQA 1XH5A 2JAVA 3ZEWA 3KN5A 4NW5A 3ACJA 2F9GA 3PLSA 4H05A 2PUPA 2HXLA 3GC8A 4DF3A 4TTHB 1J1CA 5BVFA 3E5AA 3KCKA 3C9WA 3KEXA 4JR7A 4KIQA 4DEGA 4U42A 2YWVA 3PIZA 2V0DA 4TKSA 5LARA 4BCJA 1PXMA 3COKA 2QQ7A 3BE2A 3PRFA 3QXOA 3TNQB 1P4FA 1SYKA 4ZEGA 4ANNA 5BVNA 3KRXA 4EL9A 4BWPA 3A61A 2R3RA 3IS5A 3O8UA 3H3CA 4IWDA 5IEYA 3TUCA 1KE7A 4Y5HA 5K9IA 4XEYA 2W4KA 1JLUE 3UIBA 2BCJA 4JX7A 4WSQA 3ZSHA 4QTBA 2OGVA 4O96A 5HICA 5AR7A 4AGWA 4FIJA 2BPMA 3AQVA 4LQMA 4O2PA 1E9HA 4QPSA 4BDKA 4MD8E 3PG1A 4JVGA 1MRYA 4O7VA 3O7LB 3ETAA 3PE2A 2VGPA 3UNJA 4EK4A 1QPDA 1FMKA 2ZJWA 3ZYAA 5K5XA 1OPLA 3DNDA 3EN9A 5AV1A 4V05A 3LFFA 4IFCA 1ZZ2A 2HZNA 4EQCA 4M0ZA 5B0XA 5HD4A 2J6MA 4QP6A 3EN5A 1ZYLA 2XK4A 4C8BA 4PDOA 4DGMA 3MESA 5JGAA 3TEIA 4CFWA 2VZ6A 3DQWA 3P5KA 4FIEA 3VQHA 3FI4A 1U59A 5HU9A 5JFSA 4QQJA 4AOIA 3G15A 2OBJA 1KE5A 3PIYA 4AN3A 4D4SA 1H28A 4HGEA 4FTJA 1XQZA 3VHKA 3ENMA 3BU5A 3NAYA 2YISA 4FOBA 3JUHA 2CMWA 1H26A 5I3OA 5KO1A 4OAUC 3DLSA 3VBXA 4IBMA 1XR1A 1WBOA 3Q9XA 4CFMA 3BHYA 4MBLA 3QRIA 4DLJA 3JVSA 3NUYA 2W1GA 4FTAA 4JAIA 4UMTA 2W5HA 4EEVA 4EI4A 3CTHA 4C37A 3EQHA 4I0RA 2WTJA 2C5NA 3A8WA 2YERA 3GC7A 3QLGA 3HA6A 3KK9A 4GJ3A 3KQ7A 3QRUA 3W33A 2JDSA 3R6XA 4WA9A 4BCOA 3T9TA 4G6LA 1W8CA 4HZRA 4HVHA 1CMKE 4IAAA 5I9ZA 3QQGA 1YI4A 2RSVA 2WMBA 2WQEA 3I5ZA 4FTOA 4ZTQA 4ZLYA 4J99A 3D0EA 3R30A 4RFZA 2PZ5A 2X8IA 5E7RA 4GKHA 5AFVA 3RPOA 5I9VA 2VWYA 3KU2A 2R3GA 4A4LA 3RK9A 3SV0A 4JRVA 2FSOX 2J0MB 3ZUVA 3HECA 5H3QA 3DPKA 2UUEA 4PP7A 5DA3A 3LCTA 4FK3A 4U79A 3TNIA 2UZVA 5EK7A 3OY1A 2I0HA 1MUOA 4H3QA 4Z7HA 4I41A 4MBIA 1LUFA 4R1YA 4BDCA 5M53A 3DXPA 4L3LA 3PP1A 5JGBA 5H8EA 4PL5A 3E8CA 4BCQA 2UZOA 2G2HA 4IHPA 4EOOA 5I9YA 2IZTA 4FEVA 4L46A 3Q53A 1P4OA 1JSTA 4FG9A 4DYMA 4Y5QA 4L42A 5IEVA 2WMQA 1V0PA 3UQCA 3SLSA 3Q4TA 1W7HA 1ZOEA 2H9VA 3OT3A 4F6WA 4KA3A 1Y8YA 3R83A 4RLLA 5ANJA 3EH9A 5AUZA 4NCTC 3R1NA 3ZOSA 3D7TB 2PU8A 3LVPA 4OTRA 5HLNA 1SZMA 4KIKB 4NH1A 4PQNA 3GU7A 4UXQA 2J50A 1PMVA 2X7GA 3D7ZA 4II5A 3LQ3A 3Q6WA 3D5WA 3DT1A 1IA9A 5F95A 2R3NA 4EHGA 2BMCA 1Q8WA 1WZYA 2HK5A 3O0GA 4D5KA 1QPCA 3QFVA 2OKRA 4P90A 4W9WA 4JS8A 1R78A 4UWYA 2QOIA 4IWQA 5DMZA 3GU8A 4GT3A 5IA0A 4JLCA 3AC1A 4NK9A 2JITA 4JIAA 5CY3A 5M06A 5TR6A 4EYMA 3LLTA 3MYGA 2A1AB 5E8UA 3M1SA 3NNVA 5IU2A 5KMNA 2IZRA 4K2RA 4RQVA 4G16A 3GU6A 3NW5A 3OEFX 3FMDA 4AZTA 1GZNA 3A4PA 5KMOA 4OTPA 3COHA 4BTFA 4RFMA 4QMOA 5TE0A 4E93A 3PG3A 3HV3A 4FKTA 5JRSA 3GC0A 3BELA 4WD5A 4BTMA 4IAYA 2CN5A 3AMYA 3W2CA 3GCSA 5FXRA 2JFMA 3G0FA 2QURA 4FSRA 4M66A 4RWLA 4AACA 2CLQA 3ZSIA 3FLSA 3NUNA 3MGYA 5CAOA 3M42A 3ZXTA 4JDIA 4X2NA 3VNTA 2R7IA 2YN8A 4K11A 4F7SA 3ZM4A 4BI0A 3LMIA 4QPAA 1YXUA 3S00A 3V5TA 2QG7A 5E8WA 2J5EA 2W1DA 4YGAA 1K2PA 3FWQA 4RIYB 4D2VA 2B9HA 4KSQA 3EQDA 1B38A 3QXPA 2QI8A 3QRTA 3E87A 3FY0A 3L9LA 4HVGA 4K33A 1URCA 3L1SA 3F66A 4WG4A 1OKVA 5HG8A 4O7YA 5CU0A 4FIIA 4ZY4A 4G3DA 5IA1A 4XCUA 4ZTHA 4G3FA 5DNRA 3IQ7A 5J5TA 4FC0A 1M17A 1Y57A 3OC1A 1XH6A 4L45A 5A4LA 2XVDA 5J1VA 3LQ5A 3OEZA 5HTBA 3QHRA 5HG5A 1S9JA 3SG9A 1B39A 4E73A 3U51A 2BZKB 4BDJA 4RWIA 3QQKA 5DGZA 3PZHA 4CFVA 3T3UA 3NZ0A 3VUKA 2XF0A 2JKQA 5E8TA 4WOVA 3PIXA 4PF4A 3RKBA 2WAJA 2XA4A 4YO6A 4A06A 4EZ7A 4F7LA 5B2KA 3OP5A 3VUDA 3QQHA 2JEDA 4MNEB 4QQ5A 4XP2A 5K5NA 4ZMEA 4YHTA 3IPHA 2BTSA 4I23A 3HMMA 1CSNA 4M68A 3ZFXA 4AZVA 2QOFA 4IB1A 4QYHA 4IDVA 4QD6A 3UO6A 4CQGA 5HZNA 4WT6A 4AN9A 5GIOE 3O2MA 2ZV7A 4UYNA 4X6RA 5J95A 5IZFA 4QYEA 4A7CA 3BYUA 3QKMA 5JMSA 4CSVA 4D5HA 3PXRA 2WD1A 3NW7A 4FTLA 2C0TA 1H25A 3F7WA 3RAIA 2QOKA 4S30A 1H1PA 3UE4A 2PZIA 4FX3A 3FXXA 3BCEA 3EFJA 1JVPP 4E4LA 5BUEA 1FMOE 4HYUA 3AMBA 4HGLA 2XUUA 5LVMA 4YLJA 3DU8A 4EHZA 3GXLA 5HHWA 2JKOA 3NX8A 2GHMA 2JDVA 5CU2A 1Y8GA 3FL4A 4KUJA 3ANQA 5A4QA 4WKQA 3EQGA 2BRHA 2Z2WA 4M13A 5F4NA 4B9DA 4YTFA 3O8TA 3RINA 5EH0A 1VR2A 3IECA 4NFNA 3H9OA 3TDWA 3PJ8A 4G1WA 5HI2A 5LCJA 4C2WA 2WXVA 2PZYA 4G31A 4U41A 4N4SA 4BDEA 3N4UA 3ORPA 4ZTSA 5DEWA 4DGNA 2W5BA 1IAJA 5FDXA 1HCLA 2ZVAA 4XUFA 5DFPA 2IO6A 3FMHA 4O6EA 3R8PA 3VS5A 4AT3A 1HOWA 5I4NA 4LGHA 4DA5A 1KV2A 4FGBA 4NKAA 1BI8A 4EZ3A 1URWA 3PJ3A 2ETKA 3ENHA 5KMMA 2Z7SA 3VWAA 2CLXA 1IA8A 3VUGA 1KV1A 3FMKA 2FSTX 4CMUA 3F5PA 3O17A 3BYOA 4OR5A 3DFAA 4RRVA 4X2KA 3BYVA 4XP3A 3R02A 4C61A 4FT9A 3F3WA 3GB2A 2W1IA 3NYXA 1GAGA 3OXZA 2UZWE 1PMUA 3MIAA 4AAAA 5KMLA 5GINE 2XMYA 5HIBA 1F5QA 5HEZA 3OG7A 5EHYA 1CKJA 4QQTA 4ZIMA 3K3JA 2R7BA 2WQOA 3LJ2A 4KB8A 2CJMA 3VULA 1T45A 1W84A 1PHKA 4WSYA 3COIA 4D1ZA 1R0EA 1KE9A 4JDHA 5E91A 5BX0A 4UMPA 4RGJA 2PVKA 2FO0A 2OXDA 3MWUA 4YZMA 1ZYJA 3UZRA 1LPUA 3DKCA 3UVRA 3OWJA 3R2YA 3VUIA 1YOMA 2QU6A 2R3OA 3RPRA 5HTIA 4NEUA 3AMAA 4L67A 3QTXA 4GFMA 2ZB0A 2ZM3A 3KRLA 4WNMA 2CGVA 1W82A 2Y9QA 3MB7A 3UNKA 4XX9A 4IZAA 4TYJA 2Y4IB 1UWJA 3RI1A 4N57A 2QOHA 3CQWA 2WU7A 4ACCA 2X4FA 3Q2JA 3UGCA 2IZSA 2YDIA 1REJA 2IZUA 3SDJA 4CCBA 2JDTA 2O65A 2W05A 5ETIA 3FJQE 2OK1A 3DK7A 3E8EA 1OECA 4OTHA 4TN6A 4FKUA 4LL5A 4WIHA 5HQ0A 3QTRA 2WIHA 3ID6C 1JKKA 1F3MC 4Q5EA 2XNPA 5JQ8A 3VS2A 5JQ5A 5HO6A 2W1EA 3RPSA 4EH3A 3QA8A 5GJFA 5BYYA 1ND4A 4FEWA 1FVRA 2YAKA 3CP9A 4YJRA 4WNOA 4J97A 1KUTA 3FY2A 3HEGA 3UIXA 2BRNA 2WIPA 4F1TA 3BYSA 1VYWA 4UALA 4O0RA 2XM9A 2RFEA 4XV2A 4CT2A 3HAVA 4O0XA 5FBNC 3WZJA 2H6DA 4CFUA 3NUUA 3CPCA 4ZS0A 2ITUA 3SOCA 3FLZA 4U43A 2PHKA 3VVHA 3ATSA 3ORTA 5IKWA 4BCFA 3Q04A 4LM5A 4WRSA 5DLSA 2Q0BA 4FNZA 2PPQA 3IKAA 2PMOX 1PXOA 3GP0A 3K2LA 2WOUA 3A7GA 1RE8A 4IANA 5AMNA 4GS6A 4PP9A 3I7CA 4DTBA 2GNGA 4O38A 2OJJA 3QA0A 5J1WA 2ERKA 4X6QC 1OBDA 1B6CB 4FV1A 5HKMA 4O86A 2V7AA 3NAXA 2PUUA 3HP5A 2WQMA 2C47A 1M2RA 2J0LA 4YZDA 2XYUA 2B7AA 3HP2A 3WILA 3Q9ZA 4FTUA 3ZBXA 2EXCX 2ETRA 4UV0A 5CU4A 5FRIA 4O83A 2Y7JA 3N4VA 2EVAA 3NRMA 5IUHA 2QONA 3CS9A 3N51A 4P5QA 4JQ8A 4FSQA 4XG8A 5EYDA 2QC6A 4J53A 3DLZA 3G5DA 4QO9A 3A7HA 4R7HA 5AV0A 3FXZA 5K0XA 4AW1A 3EIDA 2R0UA 3NWWA 5I9XA 4BY9E 4FKWA 3S2PA 3E8NA 2VTLA 5CYIA 5DT3A 2YHVA 3ZEPA 4CLIA 4YURA 1VZOA 1ZMUA 2VTSA 4TWNA 2GFCA 2WNTA 3EFKA 5CVFA 1U5RA 4CCUA 4XV1A 5JFWA 2B53A 4OUCA 3QTIA 2ONLC 4PL3A 4JBQA 3FI2A 5EI2A 4I6HA 3ZLSA 2P2IA 5I9WA 4IM3A 3D94A 3WZEA 4HGSA 4QMWA 2PE2A 3E62A 4NZWB 2A27A 3G9NA 4OTGA 3RALA 4D58A 3S1HA 2O0UA 2VN9A 2XNMA 5KZIA 2RKUA 4YMJA 5D9HA 4C4EA 4KKGA 3LZBA 2F57A 4OLIA 3TT0A 1M14A 1Q99A 3OROA 4C7TA 5CLPA 2VTQA 3D7TA 5KHWA 3UZPA 1JKTA 2XRUA 5FGKA 2OIDA 4FZFB 3UVQA 4AZWA 4AT5A 1H1SA 4PMPA 2VTHA 4PDSA 3VRYA 4WG3A 5JSMA 3UC4A 2KULA 4FT3A 4L7SA 1Q61A 4H3BA 2VUWA 4JT3A 4QYYA 4RVLA 3RCDA 3V6SA 3VUTA 4DGOA 4CG8A 3KY2A 4LOOA 3PJ1A 3GI3A 1GZKA 4YNEA 3MY0A 2XH5A 2LAVA 2G2IA 5JK3A 5J9ZA 4DG2E 3DFCB 4C0TA 5DN3A 2XYNA 4AOTA 1PKGA 4MXCA 4EOLA 3AT3A 3IDPA 1Q5KA 2VX0A 3F5UA 1OL5A 5CVHA 5HVJA 4RX5A 4JI9A 5LCKA 4FV9A 1Z57A 3BQRA 3CD3A 5CXHA 2JC6A 4YC6A 4L8MA 2B52A 3ORKA 3W18A 2IVTA 4GK2A 5AM6A 4IACA 4PPAA 2ZV8A 4YJNA 3MFUA 4N6ZA 3KF4A 4PPCA 4X2JA 4FKSA 5EQPA 3EWHA 5AUVA 3TCPA 2W99B 1R0PA 3DAEA 1BUHA 5IQDA 4EOIA 2VWZA 2P33A 3H0YA 5EQYA 3POOA 4OAVB 2JLDA 1U54B 1WBVA 4LL0A 4L01A 4IB3A 4JAJA 1PKDA 3CIKA 2OO8X 1YW2A 2CDZA 4F09A 5L2QA 4F9BA 2R3LA 4FMQA 4J95A 2GCDA 5I3RA 4BZNA 3U55A 2CGXA 3ZLWA 4BDFA 1PMNA 1M7NA 3PVWA 2GTNA 3KRRA 1NW1A 3OY3A 4CTBA 2OJGA 3P9JA 5A46A 2QOOA 3OT8A 3HNGA 5BVDA 2ERZE 2C6MA 3R7VA 3IW6A 4CV9A 1YDSE 3NW6A 2R3HA 1DAYA 3KXNA 4I20A 3R7IA 3VS7A 1IRKA 3F61A 3NDMA 1WBNA 4OW8A 3FE3A 4S34A 4HVSA 1ATPE 5DT0A 4O7RA 3FDNA 4FNYA 2X8DA 4IX6A 3ORXA 3LFBA 1IEPA 3L8PA 4UX9A 3ET7A 4X3JA 5FEDA 4IM0A 4FL3A 2QD9A 3MVHA 3KA0A 4FSNA 4BWKA 3ZDUA 4AG8A 3EQPA 3I0QA 3LCDA 4YSMA 5GJGA 4IE9A 4LV8A 4GK4A 4M12A 4ITJA 4EH8A 4ZJIA 4EC9A 4GT5A 5AP6A 2W7XA 4MNEA 1J7LA 1Q41A 3BZ3A 5ANKA 4CZTA 2CGUA 3KXZA 2A4LA 4RVTA 2RGPA 4YTHA 3PDTA 2PVHA 3QGWA 1H24A 4LG4A 4DFBA 2UW8A 3OTVA 3GU5A 4GYIA 4E1ZA 2NP8A 1O6LA 5HCXA 4X0MA 3CBLA 4X21A 2AC3A 4YJUA 1G8SA 2E9PA 4PV0A 1Q4LA 3PA5A 4GEOA 4XG2A 3EZRA 2EB3A 5HLPA 4CNHA 5M09A 1O6KA 4GV1A 4DC2A 3U87A 3QYZA 5G1XA 3GCPA 2QO7A 4BZDA 2JKMA 3COMA 2UW3A 3TUBA 3UYTA 2JAMA 2UW9A 3OF0A 4JBPA 2J0JA 4UZHA 2GHGA 3SW7A 3DB8A 2JBOA 1E1XA 3O51A 2RF9A 3I4BA 4UZDA 4HVDA 4FODA 4RJ6A 5HX6A 3GQIA 1REKA 3MB6A 5CAUA 4NIFB 4GCJA 2ZDUA 5AEPA 4FT0A 2QOQA 4J98A 1OGUA 3HV6A 4DLIA 5M4FA 4C4HA 4C33A 3DDQA 1W98A 4I3ZA 1YHSA 2E9VA 1ZYSA 4ENXA 3IK3A 2PE1A 4JXFA 3QCSA 1JWHA 4HNFA 4EORA 3MH3A 4ITHA 4BKZA 1TQIA 4XLVA 2ITWA 1XH8A 1Y6BA 3AC2A 4R5YA 4U80A 3E92A 4IVAA 4L43A 2VTOA 3EYGA 2XBJA 3ZBFA 3R8VA 3RTPA 1SVGA 2CHLA 3BHHA 4OT6A 5EKOA 4D28A 3NMUF 5CAQA 3PY1A 3OCGA 4ITIA 4JQ7A 5I5ZA 3FQEA 5IA3A 3KKVA 2AC5A 2UZUE 3NYNA 4HOKA 4AFJA 3PPKA 4IB0A 4M3QA 2F2UA 2W9FB 4O0YA 3QCYA 1NA7A 1SVHA 4MQ2A 4L3JA 4E20A 4NM0A 5CEIA 3WF6A 4ZY6A 4EK5A 4E8AA 4JJRA 3ELJA 1P2AA 2Y6MA 4FT5A 2Y4IC 3E3PA 4AT4A 2E9UA 4KBAA 3VUHA 3LFQA 3MV5A 3OW3A 4DEHA 4PMTA 3IGGA 2JGZA 3FLYA 4MQ1A 2HWPA 3LMHA 2VWUA 2C6TA 5DHJA 5ANGA 3TL8A 3PSBA 4ZSGA 2ZOQA 4PTCA 5GJDA 5BVKA 2O3PA 1PXLA 4JL9A 2PULA 3P23A 2E9OA 3QD3A 3WIKA 4EHEA 3NNWA 3EL8A 2XKCA 4IH8A 3B8RA 4M97A 4G34A 4YLLA 4B99A 2X1NA 3L9MA 4I22A 5KBRA 4LOQA 5CX9A 2ETMA 4AA0A 3VRZA 4GRBA 3V51A 5AUYA 4FV2A 4RVMA 3NCGA 5CQWA 4FZDB 2GPHA 2GSFA 3QTUA 3T3VA 3PXYA 3FMLA 2C3LA 2HW6A 2R2PA 2VWVA 3HL7A 4CTCA 2YCQA 2VAGA 5FXSA 4YPSA 4BDAA 2XBAA 3W55A 4U81A 5IH6A 3MTLA 5L4QA 3MN3A 5IUIA 5EOLA 4W4YA 5HCZA 5C9CA 2VO7A 2BZJA 2PUIA 2GU8A 5J79A 4GFGA 5M4CA 4IJ9A 1YXTA 2C6KA 4IVCA 4O7ZA 3NVMB 4ZTRA 3C0IA 1U46A 2O2UA 4DEAA 3FAAA 4H1MA 3HZTA 2Z7QA 1OL7A 1SNUA 1IASA 2HXQA 4M69A 3VIDA 3ZS5A 1OL1A 4EBVA 2C6IA 3PJCA 3O8PA 3ZH8A 4YZBA 1Q62A 2F7ZE 2UW5A 4QTCA 4V01A 4BI2A 2YZLA 4EZ5A 4RJ5A 3PSDA 4MH7A 2ITZA 3KF7A 5KX8A 3HRFA 2OSCA 4QMVA 3DV3A 3LE6A 4FIFA 1YWVA 4GYGA 3AC4A 5EW8A 3V8WA 5GZAA 4MYGA 2B55A 2HZIA 4YBKA 4C2VA 5E9EA 2WTDA 3ANRA 4OTFA 3G0EA 2GFSA 3LFCA 3ORLA 1YXVA 3RHXA 4O81A 3A7JA 2YLEA 2YA9A 1XH7A 3Q32A 4C4JA 4FTCA 5A54A 2UZLA 4H39A 3A60A 4RC3A 4XG6A 3QLFA 5C01A 3S4QA 2JIIA 4RA5A 4W8EA 3C5IA 4DG3E 2OH0E 2UZNA 3THBA 5DEYA 5CEKA 1V0OA 3P7BA 4XLIA 4I94A 3W1FA 2XKEA 4I92A 4YJSA 3D15A 2W17A 2JDOA 4FT7A 4ZLZA 3TG1A 5CEMA 2I0EA 1H1QA 4BI1A 3V5LA 4Y83A 1OL6A 5HE0A 2P0CA 2RFDA 5LMAA 5DG5A 1OUKA 2QOBA 1GIIA 1ZY5A 4F4PA 5D10A 3R0TA 3FEGA 4BGGA 3KMMA 5B2LA 3FLWA 5C27A 2Y8OA 4Y73A 3DJ5A 5M55A 3EKKA 3VC4A 3TTJA 4YC3A 3MPTA 5L6OA 4C59A 2B1PA 4IMYA 4RC2A 4TW9A 3Q96A 5CZIA 4AFEA 3LAUA 2EUFB 2V5QA 1YKRA 2JBPA 1ZZLA 5TOZA 2QLQA 4DBNA 5CF4A 2WMUA 5JGDA 1PF8A 5LVNA 3VQUA 3GQLA 2DS1A 3FZOA 5AR4A 5JEBA 2CKPA 4FSYA 4G3GA 3F3UA 4S32A 3GCQA 4ZXTA 3SRVB 4KKHA 3D5XA 2Z02A 3ODYX 1XBCA 4L3PA 4BCHA 4EBWA 3ORMA 2CNUA 3PXKA 2BRMA 4YJPA 4RPVA 3H9FA 2P55A 3FHIA 2IVVA 1YHWA 4LI5A 2ESMA 2HELA 3TI1A 4E4XA 5EDRA 5CT0A 3BYMA 3LFEA 4YNOA 4RJ8A 4YU2A 5JT2A 3R8LA 4AE6A 1ERKA 2FVDA 4IEBA 2WHBA 3O7LD 4B8LA 3UVPA 1PXNA 2RFNA 3OWPA 4Q9ZA 4HNIA 3LCKA 2WMAA 3TXOA 5D11A 2BAKA 2WMTA 3A7FA 3QCXA 4AA4A 4U3ZA 4ZZOA 3CQUA 2ITYA 2XK8A 1K3AA 2C3JA 3SW4A 3V5PA 5A4TA 2FB8A 3MJ2A 2ZMDA 3UO5A 4YJQA 4ZZMA 3TN8A 2UW4A 4NCTA 1KE6A 4W4XA 2EWAA 4LV5A 4RMZA 4D2PA 4U8ZA 3BV3A 3NIZA 4U5JA 5E8YA 3R7UA 3ZMMA 2PMLX 4R78A 3IOPA 3F3VA 4F6UA 3MI9A 4F9YA 1G8AA 4FVPA 2X6DA 3TKHA 5AUTA 1OIYA 3GT8A 4QMMA 4A9YA 4QP1A 5D7AA 5FTOA 3MPAA 1LP4A 4TXCA 3V01A 3R8MA 2XKDA 5CSPA 3QRJA 5EW9A 2PMNX 2Y4PA 4AA5A 2B9IA 1NT2A 2C0OA 1PXKA 3EZVA 2X9EA 4AW5A 3WE8A 1IG1A 2C5VA 4ZOGA 4FGRA 5CI6A 4DFLA 4AGCA 1Q3WA 4EK6A 3G51A 1RJBA 4RQKA 4DH5A 4U97A 4E6DA 4KABA 1ZYCA 4D55A 2CNVA 4YJTA 4UBAA 3P7AA 3MH2A 4RIXB 4Z9LA 5J87A 4EJNA 2ZV9A 2WKMA 2VO0A 4XHKB 4XG7A 4IZ7A 5E92A 4E3CA 4RLKA 4HGTA 2C6DA 3PLAE 4ZJVA 3NNUA 3KC3A 4FKQA 4O0UA 5GZ8A 4E4MA 2WFYA 3KXGA 3PPJA 3AC3A 4LMUA 4I24A 4RJ4A 5LVPA 3NR9A 4A9RA 3QRKA 3TZ8A 3F2RA 4O7NA 1U54A 5LMBA 1XBAA 2W1ZA 5JZNA 4NL0A 5BVOA 2RL5A 5IDPA 3NVKI 2W06A 3QL8A 3BU6A 4BKJA 3QTWA 3ZXZA 4QP7A 4FTNA 4CZUA 5HBHA 4FV3A 4EH5A 3R9RA 4JRNA 3MIYA 2BR1A 5HO8A 3DXQA 4ACDA 3MVJA 4U45A 3VJNA 4C4FA 1YDTE 3IO7A 4P4CA 3HDMA 1XJDA 4YJVA 4TYHB 5DBXA 3LXLA 4NFMA 1YXSA 5IA4A 1L3RE 2ZM4A 3MBLA 3MJ1A 2BRGA 5AP5A 3VAPA 3M11A 4PDYA 4GMYA 2JFLA 4ANMA 4AUAA 2PK9A 2VRXA 4FTTA 4BCGA 2RG5A 4S2ZA 3UOKA 4DH8A 3MDYA 3DBFA 4A9TA 3ZUUA 4G6OA 1YWRA 3BRBA 4DH1A 5HGIA 3CEKA 2BDFA 4O0WA 4MXAA 3ZZEA 2YIYA 4JG6A 3ZRKA 4HPUE 2VNWA 3W2SA 3P86A 3PRIA 2UVZA 3AD6A 3KFAA 3FZ1A 4GU9A 1MRVA 2ACXA 3TIYA 1XWSA 2GNLA 4KIOA 4QNAA 4F9CA 5IA2A 4IIRA 3F7ZA 4GFOA 1FQ1B 3BU3A 4UYAA 4B8MA 5EYMA 1UNGA 3MA3A 4ANOA 3KK8A 1H0VA 1YQJA 4KWPA 2F49A 3UC3A 3SHEA 2XP2A 4JNWA 4Q2AA 2YM5A 3T9IA 1ZLTA 3QAME 4M8TA 2BAJA 4BDIA 4ZTMA 1CDKA 1ZOGA 5IISA 3P0MA 3FV8A 3R7OA 3OCTA 4W8DA 3WBLA 3BKBA 3UMXA 4NIFA 5L8KA 3C4ZA 3L8XA 3UBDA 5CEOA 1OI9A 1R39A 2BALA 2OH4A 4RWJA 3IW4A 5LXMA 5D1JA 4DITA 3GU4A 3KREA 4FK6A 2XM8A 3C7QA 3AT4A 3NGAA 4ZP5A 3UP7A 4BRXA 3HMNA 4J7BA 3UG2A 4EUUA 1BI7A 4F9AA 3PXQA 4PUZA 4H3PA 3MTFA 4OTDA 2GNFA 3QGYA 4BDDA 4W4VA 5CANA 5KUPA 5FEQA 4DT8A 3F3ZA 4RIWB 3W32A 4G5PA 4KAOA 5AP1A 5M56A 3LFAA 4G9CA 2G01A 3DJ7A 4FZ7A 4BL1A 3PUPA 3RNYA 3RWQA 5KHXA 4O22A 2QKWB 1ZARA 5HD7A 3CQEA 3SG8A 3U9NA 2IVUA 4O6LA 3FXWA 3RGFA 5A6NA 4OTQA 5LWNA 2WOTA 5EG3A 2PZPA 1DI9A 3JY9A 2VTRA 3U8WA 2PVNA 3UOLA 4A07A 4LRKA 3HA8A 3CPBA 4ANBA 3PE1A 4KINA 2X6EA 4EK8A 3K5VA 5CENA 2QOLA 2YM8A 2REIA 3DK6A 4HYIA 4RWKA 4V04A 5CALA 4AXAA 5J9LA 5FDPA 4JQEA 4APCA 1R1WA 4MK0A 3QU0A 4CV8A 5CAVA 2F4JA 4HPTE 4XMOA 4KD1A 4LGDA 4UEUA 3KCFA 3TV7A 2WEVA 3OOMA 2XNGA 2FSMX 5B2MA 5TO8A 2OU7A 2F7EE 1PYEA 1UU7A 3GEQA 3CC6A 5FTQA 5IH5A 2FH9A 4C62A 4FKIA 4NT4A 4WBOA 5AADA 4F6SA 5IQEA 2G1TA 2DYLA 5F94A 2C68A 3T8OA 2PL0A 2XNBA 3NIEA 5BMSA 2PVMA 4KBKA 4AX8A 1BMKA 4TNDA 4V0GB 3R22A 5FP5A 5CNOA 3UOHA 2VD5A 4BC6A 3UZTA 4K1BA 3KRWA 4ID7A 5FP6A 3FQHA 2OG8A 1ZYDA 4IZYA 4QMUA 1UU3A 4M0YA 3TJDA 2X0GA 3HYHA 5D41A 3TZMA 1H01A 5FG8A 4ERKA 5FQDC 3QX4A 2CCIA 4XBUA 4CKRA 3TM0A 4NKSA 1KOAA 4EOJA 2R3MA 5F20A 2I0VA 3W2PA 1PXPA 5HE3A 4ARKA 4E5AX 2QCSA 1IAHA 3QTZA 4IX3A 5KCVA 5I9UA 3WE4A 2RG6A 5HX8A 4MXXA 4R3RA 4D4YA 3VBTA 3F88A 2EU9A 4O2ZA 3BHVA 2E2BA 1OIUA 4F0IA 5FBOA 4CEGA 3V8TA 3GC9A 3VS6A 4BB4A 5L8LA 2ZMCA 3WOWA 5KE0A 3C5UA 4QP3A 4ANQA 2HY81 3N4TA 1ZRZA 4FEQA 3ZRLA 2UV2A 4NM7A 3FC1X 4QP8A 4Y85A 4EH6A 2R64A 3IW8A 1OITA 3QYWA 3VHEA 3II5A 3VF9A 3FL5A 3I5NA 3QQLA 5IMEA 4BGQA 4EKKA 1W83A 1YXXA 1F0QA 2JKKA 4BIDA 3QUDA 5HIDA 4C4IA 4FI1A 4TYEA 3NYOA 2BRBA 4I5MA 1H0WA 4MF0A 4ASDA 1AGWA 2BVAA 1UNLA 3IG7A 4AGUA 3EFLA 3RWPA 3JXWA 5ITAA 4DE4A 1JBPE 5HCYA 4DEEA 4BDGA 3U6IA 4HYHA 2XNOA 2BAQA 4LRMA 3VO3A 1U5QA 1OMWA 4F63A 1SMHA 3PSCA 4QMTA 3QD0A 4FKRA 4ACHA 2QO9A 4ZAUA 4FIHA 5E8SA 3DAKA 1WAKA 3FZPA 4NW6A 3ZHPC 4D0WA 3UPXA 4NM5A 4M14A 3V8SA 1Q8YA 3LXKA 4R8QA 2OLCA 2VX3A 5JKGA 5AWMA 4G17A 5M44A 4BZOA 3HGKA 3LW0A 4GK3A 3WZKA 4MWHA 3FYJX 4U40A 5J5SA 3V3VA 4CFFA 3DBEA 4C58A 3DNEA 2BKZA 1M2PA 2C3KA 3MPMA 5HG9A 3I7BA 3QQJA 4FTIA 5CF5A 4KS7A 3E64A 3PY3A 2VWWA 2WZJA 1U4DA 4ZSLA 3TIZA 4ANLA 2OFVA 4J96A 3PWYA 5EHLA 4I6FA 1TKIA 1BL7A 4EQMA 3LXPA 2WU6A 3CTQA 3DZOA 4IDTA 3D14A 3RMFA 2UW7A 3WIGA 2BKKA 2O5KA 3I1AA 4KIKA 4C57A 5JN2A 2A2AA 4C02A 4O0VA 3WF7A 5EYCA 1O9UA 3E93A 4E26A 2R5TA 5HO7A 1GOLA 4B0GA 3MY1A 4O7TA 5CXZA 4PL4A 3DKFA 3FYKX 3R7EA 4NYEA 3H4JA 3R00A 4F0FA 1UWHA 1OKYA 4O7WA 4PNKA 2ZB1A 4JIKA 5AP3A 2ONLA 3OVVA 3Q3BA 4MXYA 5HNGA 5BYLA 1V0BA 1G5SA 3KXHA 3R04A 1A9UA 3RVGA 2VTAA 3EOCA 4G5JA 4ALVA 3ROCA 2I0YA 3GVUA 4RX9A 5EFQA 3VBYA 4FR4A 4O1PA 2BHEA 3HUCA 2IW8A 3VS0A 1FGIA 4EOSA 5AA9A 3R21A 1T46A 3C4CA 4CVAA 2BFYA 4A4OA 2OIBA 3BGZA 4C3PA 2C3IB 2EB2A 4I6QA 3VF8A 3P4KA 2R3IA 5LQFA 3VBWA 2VWBA 3NUSA 2VTJA 3S3IA 4LUEA 5EM5A 3DDPA 3BWFA 4TYGA 2OZOA 4ACGA 4XJ0A 2C1BA 2C0IA 2XZSA 4DEBA 2J5FA 5GIPE 4QPMA 4YSJA 2W0JA 4AZFA 5DR2A 5K3YA 4RIYA 5LMKC 5CS6A 1Y91A 4Z16A 3DKOA 2QLUA 4FKJA 4RC4A 4WBBB 4QMQA 5C26A 5KBQA 3P78A 5IQGA 4MD9E 3BPRA 5G6VA 1PW2A 2IW6A 4RIXA 4BCIA 1GZOA 3PP0A 3QC9A 1NXKA 1OIQA 4D4RA 3FSKA 3HMPA 3HX4A 4JG8A 4QRCA 5H8BA 4IX5A 4A4XA 2X2LA 3OOGA 4BTJA 4IJPA 2GQRA 4GIHA 3P08A 5HE1A 1RDQE 3NEWA 5HOAA 1L8TA 1ZMVA 2X7FA 2C6OA 3AGLA 3K3IA 4EH2A 4AZEA 3S0OA 4CXAA 4I1ZA 4F99A 3ULIA 3MW1A 3UO4A 3E3BX 2YM6A 5KKRB 4AGDA 1CKIA 3RJCA 4AW2A 4FSZA 1WBPA 4QNYA 4L68A 3AC8A 3TKIA 3JS2A 4MVFA 3PXFA 3D2KA 4QTAA 4TRLA 4Y46A 2IWIA 4TYHA 4XP0A 4R7BA 4BWXA 3UQFA 4PWNA 3DOGA 4HVIA 2VX1A 4BYJA 4NSTA 3ZO3A 5FTGA 3AOXA 3OWLA 3HDNA 3OTUA 3WI6A 3QF9A 4P2KA 5ACKA 4RA4A 5AA8A 3ZZWA 3FZRA 2BIYA 4CFXA 3GUBA 3VUMA 5IDNA 4EH4A 3BEGA 3D5UA 3WF9A 2QNJA 1KOBA 4EKLA 2H8HA 1UVRA 1GIHA 3PXZA 4PY1A 3EKNA 4JR3A 5AX9A 3RM7A 4DG0E 4IM2A 2NPQA 4WUNA 3LCOA 4CKIA 4FTMA 5AR5A 3GOPA 3HV5A 4F1OA 1DS5A 2X7OA 3Q5ZA 5CSWA 3CD8A 4D9TA 4ZMFA 3RAWA 4BCPA 2QOCA 2I1MA 3ZUTA 4MF1A 4MNFA 3SA0A 2WO6A 5C8NA 5D12A 3BBTB 1J7IA 4Q5HA 2HY0A 2ZM1A 4AN2A 3O96A 3OUKA 3Q2MA 3E88A 4FKPA 5HG7A 4AQCA 4EOKA 4Z7GA 5EM6A 3V6RA 4ZS4A 4R3CA 2GNJA 2WEIA 2UZEA 2XK7A 2C69A 3UMWA 1Q8ZA 3BE9A 4OTIA 4AW0A 5TT7A 4FV7A 4I5PA 2EXEA 2XJ2A 2GS2A 4R3PA 3PJ2A 2G9XA 3TACA 4I6BA 2B9FA 2SRCA 3JR1A 2IN6A 4PTEA 4R6VA 5DIAA 3R2BA 5KNJA 4EH7A 5CSHA 3R8UA 5KMKA 4ZSJA 2QR8A 5DI1A 4FKLA 2VO6A 2X39A 4FV0A 4YP8A 2BDJA 3ZM9A 3SGCA 5AP4A 4RBLA 1OPJA 4ANSA 4ZK5A 2LGCA 4F7NA 5IUGA 1H8FA 3ITZA 4YHJA 5CVGA 4UMUA 5HESA 5A4CA 3SXRA 4R1VA 3TZ7A 3LJ1A 3KXXA 3K54A 3BLRA 2C6EA 1CKPA 2G15A 1OKZA 1V1KA 3NPCA 4GVJA 3UOJA 4CMTA 3CR0A 2YEXA 4FG8A 4IXPA 2CGWA 2ITTA 5CSXA 5AAGA 1Q3DA 5E4HA 4U9AA 4FV4A 5C4LA 3CKXA 4H36A 3Q4ZA 5HVKA 3HV7A 4N6YA 1OIRA 2YITA 5ANOA 4NTTA 4X7QA 5E8ZA 3LFDA 4UB7A 3WYYA 2Z7LA 2R9SA 4BIBA 3V5WA 1UV5A 2OFUA 4QMLA 5DPVA 3FZTA 2W4OA 3IOKA 2PVLA 4QMZA 3TDVA 4BR3A 1XHAA 3UYSA 3LM0A 4YHFA 2PE0A 5L6WL 1JPAA 3PA4A 1YRPA 4L44A 3A99A 3BBWA 4DCAA 3ROYA 4HCVA 1WBTA 2VGOA 2ITOA 2RIOA 4LUDA 5AR8A 2BUJA 3R71A 5FLFA 4D2TA 5BNJA 4XG3A 4K6ZA 4ORKA 4FE2A 4IAIA 2HIWA 1WVWA 2QO2A 2OZAB 3ODZX 4GU6A 4XG9A 5EDPA 2J2IB 2IW9A 4K18A 5CASA 2PUNA 3GENA 3OCBA 3EQIA 4ZSAA 4PNIA 4HJOA 2GNHA 1LEZA 2ITQA 5GZ9A 5LVLA 4FL1A 3RAHA 1J91A 4WHZA 3TJCA 2CCHA 5IQAA 4HCTA 1CTPE 3RP9A 5EYKA 3C4FA 5JFVA 1PJKA 3PVGA 2YJRA 4MXZA 2XS0A 3EYHA 1BKXA 3Q9WA 4JDJA 5ACBC 3W8LA 3ZTXA 4EK3A 1FPUA 3CY2A 4MEDA 4U3YA 2YWPA 5J8IA 5HNBA 3ZU7A 2C5XA 3DGKA 4PMSA 4DEDA 5KMJA 5JFXA 3IGOA 2B0QA 4IZ5A 4V0GA 3CY3A 3SXFA 3CCNA 3SC1A 3KL8A 1OZ1A 3ORZA 3C1XA 4MBJA 3AC5A 3I60A 1MRUA 4BCNA 3QBNA 2WMVA 1FVVA 5FUTA 4O82A 3U54A 1OKWA 1VEBA 3RK5A 3LCSA 4IC8A 3H30A 3TV6A 4BN1A 3F9NA 2NRUA 2CN8A 5HVYA 3RK7A 5LJJA 4B6LA 3BLQA 3HRCA 2OJFE 1UKHA 3L8VA 1NVSA 3QZHA 3FPMA 5CI7A 2OI4X 3OW4A 3QWJA 4FZ6A 5JZJA 3E7OA 4KSPA 4YLKA 3ZC6A 2YM7A 3FLQA 2WTKB 5K0KA 1JSUA 2AUHA 4TT7A 3EJ1A 2OF2A 2R0IA 3FMMA 2XK3A 4PPBA 2IG7A 1OVEA 3HVCA 4I4EA 3LOKA 4FICA 1M2QA 3FI8A 5CZHA 3ACKA 3P7CA 3P1AA 5IQFA 1WBWA 3KULB 4DTKA 4FIGA 3MH1A 4RZVA 3DAJA 4I5HA 5J7BA 1RQQA 3OUNB 4BHNA 3QQUA 2JD5A 4RVKA 3UDBA 4HCUA 3C0HA 4BCKA 2XIRA 3EN4A 4OBOA 4FKVA 2GMXA 4PDPA 2UVYA 4L52A 2X2KA 1OUYA 1ZWSA 2FYSA 3QZIA 4Q9SA 3W2OA 3SX9A 2UVXA 3A4OX 3KMUA 3RPVA 3O23A 3HAMA 3UJGA 5AV4A 4GUEA 1NVRA 5FD2A 2W1FA 5AX3A 4XYFA 1HCKA 3EFWA 1NY3A 4KNBA 1GJOA 4QYFA 4C34A 2WTVA 4G3EA 2E9NA 4U6RA 3VS1A 2QG5A 3V5JA 3LPBA 4TZRA 4AZSA 3QTQA 3GGFA 4O7SA 5GNKA 3DXNA 3V5QA 2CSNA 4UMQA 3TWJA 1A06A 2YIQA 4WUAA 3RZFA 4O21A 3ZFYA 4UN0C 5A4EA 3HKOA 4FSTA 5AP7A 5ETAA 1AD5A 4BIEA 4CGAA 4IC7A 3FMNA 3FBVA 3G6HA 4FBXA 3CJGA 4MWIA 2CPKE 4NJ3A 5CU6A 3AG9A 5BVWA 4D4VA 4FNWA 4EONA 3F2AA 1UKIA 4RFYA 4CD0A 2P3GX 4CYIA 1ZOHA 2YDKA 4FEXA 3ZO4A 4WNPA 3OMVA 3NS9A 4OBQA 3ZCLA 3SQQA 2XEZA 4QMSA 1Q8UA 1FOTA 3L9PA 4D1SA 4YTIA 2BDWA 4APPA 3DQXA 5L2IA 4CQEA 2X9FA 1YI3A 4ALWA 3CGOA 1E1VA 2WMSA 2CNQA 3UG1A 3I0OA 4B7TA 4GH2A 2XIKA 3FMJA 3JYAA 1ZAOA 2WELA 3MA6A 1ZY4A 3RM6A 5AUUA 2HWOA 3EB0A 1OL2A 2HENA 3A62A 4FNXA 4RSSA 1STCE 3TNWA 2B4SB 1J7UA 2HCKA 5ICPA 5BUJA 2NRYA 2XIYA 2Q0NA 4DN5A 4AE9A 5ANEA 3O71A 4I0SA 3OFMA 2PSQA 1MP8A 3TZ9A 4O7LA 4UWBA 4QTDA 5ETFA 5K4IA 1YOJA 3EL7A 4GIIA 4I93A 4Y8DA 3OCSA 4WO5A 1FBNA 3QD2B 4DTAA 1UU8A 3MFSA 4PTGA 2QVSE 2A0CX 1QPEA 4BDBA 1Q97A 3EHAA 1KE8A 5A6OA 3LXNA 1TQPA 3ULZA 4ASZA 3FHRA 5AIKA 5HORA 4CT1A 5HU3A 3LKMA 4FG7A 5E1SA 2C5YA 4M67A 4YPDA 4K9YA 4QT1A 4FTKA 4RZWA 4ZLOA 5EQEA 4EYJA 5IEXA 3EQCA 4D0XA 5CF8A 5HTCA 4AF3A 2WMXA 3ERKA 3D83A 1G3NA 3GFEA 2GDOA 3KVWA 4C38A 3IONA 3BWJA 5AP2A 4F9WA 2P4IA 5BPYA 4L6QA 5A9UA 2OJ9A 3ORNA 2YACA 5C8KA 4DEIA 3B2WA 3ZLYA 4KIPA 3R73A 4CG9A 4X2GA 3KN6A 2GHLA 5FM3A 3QCQA 2ITVA 4R7IA 4ZZNA 4RG0A 5KKRC 3RBWA 4ALUA 4OTWA 5BYZA 3LIJA 3DCVA 4I0TA 2YIXA 3VJOA 3I79A 5M51A 4EOPA 3FKNA 3VS4A 3FLNC 4E7WA 2YM4A 3BEAA 5EI6A 3A2CA 5FWKK 3ZONA 3E63A 3VW6A 3UTOA 2BZHB 1PY5A 4BGHA 5ANIA 4M15A 4QQCA 4BHZA 3JY0A 2NO3A 3S95A 3TNHA 1H4LA 3FKOA 3FI3A 3F6XA 3QX2A 2C6LA 3RNIA 2XK6A 4DGLC 2FUMA 3ORIA 3KGAA 2VTTA 5DWRA 4J8MA 3A7IA 3KVXA 4G9RA 3SKCA 1PRYA 3R7GA 2ZV2A 3F3TA 5T6KA 3R7YA 1QCFA 3LLAA 4XV3A 3UIMA 5E8VA 3HLLA 3TUDA 5L2SA 1PMEA 4EC8A 5CT7A 4O84A 4FV5A 3U9CA 3NUAA 2PWLA 2OXYA 2YJSA 3R9HA 4C4GA 5LWMA 4EJ7A 5CAPA 3EN6A 4FUXA 2FGIA 2WMWA 2GS7A 4RX8A 2VTIA 4F08A 4ASXA 3UPZA 5DR6A 2B54A 4YC8A 3RHKA 3AD4A 4GSBA 3D4QA 5HNIX 2BZIB 4Y72A 5DVRA 4AU8A 4BDHA 3LFNA 2PYWA 3BQCA 3B2TA 3UQGA 4FSMA 5DYJA 2H96A 3BI6A 4UY9A 5IH4A 4LRJA 2WTCA 4XRJA 3KMWA 4ACMA 3EMGA 5F1ZA 3R63A 3MY5A 4FYNA 3RCJA 2JIUA 3HUBA 4GT4A 4MHAA 3PVBA 4LYNA 5A3XA 4J52A 4OGRA 3GFWA 4XRLA 4J71A 3VBVA 2R3JA 1SM2A 4XG4A 4FKGA 2R4BA 1JOWB 2BROA 5EKNA 2X8EA 3D9VA 4OBPA 4U7ZA 5A14A 2GS6A 5BQ0A 5HBJA 3ALNA 4RT7A 5LOHA 3R01A 4FF8A 4CKJA 4IAFA 3PTGA 3I81A 5L6PA 4AOJA 3PYYA 4ENYA 1QPJA 3WYXA 4IB5A 2ZYBA 3ZSGA 2Y6OA 3SAYA 4F7JA 2PMIA 5J9YA 4U0IA 5DRDA 1QL6A 3VN9A 3OXTA 5AAFA 3U6HA 1QMZA 3AT2A 3BLHA 3IDCA 4FL2A 4IWPA 5LVOA 2WTWA 4TNBA 4D9UA 2UZTA 2HZ4A 5EDQA 3C4EA 4D2SA 4TWPA 4JX3A 2VWXA 5TF9A 5DOSA 3G9LX 5AP0A 2PY3A 3POZA 2C4GA 4MAOA 1UU9A 4JBOA 2XJ1A 4FKOA 1H07A 4EWHA 4YUQA 4I5CA 4X3FB 2X2MA 1O6YA 1XH4A 1OM1A 1VYZA 3PVUA 5H9BA 3R9OA 2V55A 4JG7A 1WCCA 1GZ8A 3PZEA 2OICA 5CF6A 2YABA 3QUPA 5FM2A 3WF8A 1P14A 3GNIB 3W2QA 1MQBA 1W0XC 2XRWA 2YCSA 5CQUA 1OB3A 4GJ2A 3UODA 3VS3A 3LHJA 5M07A 1BYGA 4Z3VA 2BHHA 3PA3A 4FVRA 3CSVA 1XH9A 4TWCA 4DT9A 4RX7A 4XS2A 4O0TA 2ITXA 1NVQA 2Z60A 1EH4A 4USDA 4IW0A 5K4JA 2ZDTA 5D7VA 3D5VA 4DH3A 5F9EA 3DZQA 2ITPA 2Z8CA 1BL6A 4DHFA 3QKLA 4CRSA 4OT5A 3ALOA 4ZTNA 4F64A 4NJDA 3W16A 2OJIA 5L2WA 2HYYA 2YIRA 3VW8A 3CLYA 1XO2B 2F2CB 2XJ0A 1ZXEA 4GW8A 4RJ7A 3NNXA 5HE2A 2PVFA 3RPYA 4EOMA 3C0GA 1UA2A 4HW7A 2V7OA 4F1MA 1JAMA 3QKKA 2HW7A 5AIRA 4ZTLA 3PY0A 3Q5IA 2QODA 1KWPA 3FMEA 3QZGA 4NM3A 1LEWA 4CMOA 2J4ZA 5ANDA 4QP9A 2IJMA 4BBFA 2YFXA 5IQCA 2XNNA 4K77A 4ZJJA 5EW3A 2G2FA 4IWOA 5IQIA 5BVEA 3KXMA 1M7QA 4YZCA 2V22A 3CKWA 2PVRA 2V62A 2XCHA 3Q4UA 3ZFMA 1I09A 5M57A 1J3HA 4N70A 3Q52A 2OZAA 4E4NA 3R9DA 5AM7A 3TKUA 4BCMA 1KSWA 4DFXE 2WTKC 3G33A 3OBGA 4UWCA 1BLXA 3O50A 4IX4A 4KBCA 4D2WA 3QQFA 5EI8A 4DH7A 3R1SA 5AUXA 2WTIA 5HIEA 3A8XA 3K5UA 4NTSA 3U4WA 5M08A 4A9UA 3ATTA 1YHVA 3G2FA 4DAWA 4XOZA 4EWQA 1I44A 5C4KA 3C51A 4KS8A 2W9ZB 5HBEA 5AV2A 5CEPA 2YCFA 4G3CA 4Y95A 5IQBA 4I21A 4M69B 3Q9YA 5M4IA 4DCEA 4BFMA 2WGJA 3DTWA 4L00A 4RIOA 3ZRMA 4G2FA 2YAAA 4K8AA 3WZUA 2OIQA 4FZAB 4EHVA 5C8MA 3H9RA 5BUIA 3MFRA 4IFGA 5CEQA 5I0BA 4BYIA 1JQHA 2PVJA 4F65A 4L9IA 3F5GA 4E6QA 1WBSA 2IPXA
chains in the Genus database with same CATH superfamily
2GTMA 2OXXA 2UZBA 2BILB 2W4JA 3H10A 5EM8A 4N0SA 3ZO2A 4CZYB 3DK3A 3FZSA 2ITNA 3DTCA 2OF4A 4C35A 3KIOC 1MQ4A 3LFSA 1OPKA 3MS9A 4TY1A 3QHWA 2WPAA 4M84A 2I7QA 1SNXA 4FUYA 1JNKA 3U4UA 2R3PA 4XV9A 3F5XA 5L8JA 4TPTA 4YZNA 3W2RA 5JRQA 4DBXA 1CM8A 4QDVA 3KULA 1Z9XA 3E8DA 1TQMA 4IVDA 4C36A 2QHNA 5BMMA 4GG5A 3KB7A 3TV4A 2HZ0A 1H1WA 4IAKA 4YBJA 4QYGA 4X2FA 5H8GA 3OXIA 4D2RA 4QMPA 2W1CA 3SOAA 2VV9A 3NYVA 4B4LA 3RAKA 2BFXA 3WARA 2PVYA 3F82A 3EQRA 5AAEA 4EUTA 4QMNA 2YCRA 3Q4CA 4ERWA 3EQFA 1LR4A 4DFZE 4YR8A 4C3RA 2YIWA 5KZ0A 4GG7A 2YZAA 1GIJA 2QR7A 3NLBA 1XKKA 3PPZA 3R9NA 5GHVA 3R8ZA 2J9MA 2DUVA 3WZDA 4XNEA 3UNZA 3TNPC 2W96B 4GUBA 1SVEA 3LJ0A 5IG1A 4USEA 2O64A 4EQUA 1X8BA 4PX6A 4QOXA 4MKCA 4ASEA 2YM3A 2WQBA 5M4UA 3LMGA 2GQGA 1W2CA 3SVVA 3I6WA 4MXOA 3SRVA 4DFYA 3SD0A 2DWBA 4DFNA 4XH6A 5C1QB 2VTMA 2QHMA 3DBDA 4LFIA 1FVTA 3FSFA 3P79A 2R3QA 4GVAA 4KKEA 4M7IA 4W4WA 3W10A 3CGFA 2C5OA 3QALE 1PXIA 3N9XA 2RFSA 2XNEA 3IW5A 3NUXA 5ETCA 1DI8A 5FEEA 4BTKA 4FEUA 1FINA 3GOKA 3OBJA 4JOAA 4AP7A 2CKOA 1PXJA 3JVRA 3Q6UA 1DAWA 3BX5A 1K9AA 3MVLA 3QTSA 2OWBA 3R28A 4MTAA 3NSZA 5CTPA 4EH9A 2F7XE 1GNGA 4ONAA 3C4WA 2PTKA 3PWDA 4BF2A 2I40A 5IMXA 2YDJA 3JPVA 4BVUA 3KRJA 2FSLX 2VNYA 4E5BA 4F0GA 2QKRA 2NNWB 2XALA 5T68A 4O27B 5KMIA 4CYJA 3IDBA 1AQ1A 3G90X 2XK9A 3F2NA 1S9IA 2HOGA 3G6GA 3QUEA 3PFQA 4TWOA 4BBMA 5AJQA 2X81A 4CRLA 4DGGA 4Z55A 5L3AA 4D1XA 4J1RA 1H1RA 3DS6A 4QMXA 4UXLA 5JH6A 4EOQA 5CNNA 2O63A 4FV8A 3C13A 3DBCA 4MX9A 4QP4A 1DM2A 3QD4A 4KRDA 2EXMA 2X4ZA 3UP2A 5EM7A 2VTPA 4TYIA 3M2WA 2XIXA 4AS0A 4K0YA 3DKGA 5DRBA 2J0IA 2VTNA 4JDKA 4O91A 2B9JA 4BKYA 3MVMA 1FGKA 1H27A 2XCKA 4S31A 3FC2A 4I4FA 4E6AA 4IVBA 1WVYA 2VU3A 2KTYA 2VO3A 4G6NA 4H58A 4HYSA 2J0KA 3LQ8A 5E1EA 2JIVA 3CJFA 3V04A 4UMRA 3FQSA 4I6LA 3OD6X 1WFCA 3U6JA 3CE3A 4BJJB 3D2IA 3NCZA 4DFUA 3ZO1A 4LOPA 4CFNA 5IF1A 3GCVA 3DY7A 2P2HA 1GY3A 2BIKB 3FKLA 4FOCA 2XIZA 3FUPA 4LMNA 4PMMA 1PYXA 3AGMA 1JSVA 2GNIA 4W9XA 3CTJA 5E8XA 2J7TA 4E5WA 3BL7A 1JKSA 4BICA 1WVXA 2I6LA 2Z7RA 3QWKA 3R1YA 4L7FA 5LMKA 3BIZA 3WF5A 3HRBA 4GKIA 3VBQA 4O1OA 1WMKA 2Q83A 4YZ9A 1XBBA 4MCVA 1Q8TA 3BHUA 3EQBA 4IQ6A 4P7EA 4QMYA 4S33A 4ZSEA 3HMOA 5EHOA 5TKDA 1UNHA 1Q24A 4F70A 3BGQA 5CSVA 3REPA 3MSSA 5B7VA 2OW3A 4J8NA 2UZDA 3E7VA 3TTIA 3AKKA 1TVOA 2WB8A 3OS3A 2DQ7X 4IADA 3GBZA 2R3FA 4WRGA 1YOLA 2A19B 1R3CA 1Y6AA 3TMOA 4IAZA 4WG5A 2WMRA 3SXSA 4CLJA 2O8YA 3OWKA 5C03A 4TL0A 3L8SA 4XBRA 3BHTA 4X3FC 3LM5A 5T3QA 5J7HA 4JBVA 1Z5MA 5L2TA 4NU1A 3Q60A 2IVSA 2R3KA 4DINA 2BTRA 4O0SA 5CWZA 3MFTA 4H1JA 4MD7E 4U44A 4FV6A 3QZFA 4R77A 2Y0AA 4HZSA 4FTRA 2CKQA 1VJYA 3F69A 1A48A 5FXQA 1ZMWA 2C1AA 3OHTA 2JDRA 3R1QA 5AV3A 5HLWA 3UIUA 4FA2A 5AR2A 4WNKA 1YDRE 1YI6A 4L53A 2XEYA 5AR3A 2WQNA 4PRJA 1APME 2YLFA 3H0ZA 1H00A 3IW7A 5DR9A 5DT4A 3DA6A 5E90A 4YO4A 3I6UA 4RJ3A 5CU3A 4ZY5A 3DB6A 1JKLA 3CXWA 4O4EA 5EOBA 3ZLXA 4FTQA 1H08A 5IA5A 3OZ6A 1YVJA 2J51A 4YTCA 2FA2A 4A9SA 1P5EA 4FVQA 1IR3A 5DH3A 4X3FA 3B8QA 3MH0A 3W8QA 2CKEA 4FSWA 3ZDIA 3C50A 4RIWA 2VWIA 5IQHA 4C3FA 2XB7A 4NUSA 3AXWA 2J90A 4FSUA 4FYOA 5DE2A 4GL9A 2HAKA 3FPQA 4P5ZA 2PZRA 2C30A 3C4XA 4QP2A 1J1BA 4YJOA 4USFA 1M52A 4XOYA 3GCUA 4R5SA 2ZAZA 1RW8A 3HV4A 3BGPA 2H34A 5AUWA 3BV2A 2UW6A 3EN7A 1YWNA 3ZC5A 5IPJA 3L9NA 3QC4A 4E6CA 3AD5A 2UW0A 2XKFA 3DJ6A 2W1HA 3NUPA 4KRCA 4NWMA 1BX6A 4AWIA 2AYPA 2W5AA 4BBEA 4LGGA 5H2UA 1OBGA 3RZBA 3HMIA 2QU5A 2GQSA 4QTEA 3DBQA 1XH5A 2JAVA 3ZEWA 3KN5A 4NW5A 3ACJA 2F9GA 3PLSA 4FJVA 4H05A 2PUPA 2HXLA 3GC8A 4DF3A 4TTHB 1J1CA 5BVFA 3E5AA 3KCKA 3C9WA 3KEXA 4JR7A 4KIQA 4DEGA 4U42A 2YWVA 3PIZA 2V0DA 4TKSA 5LARA 4BCJA 1PXMA 3COKA 2QQ7A 3BE2A 3PRFA 3QXOA 3TNQB 1P4FA 1SYKA 4ZEGA 4ANNA 5BVNA 3KRXA 4EL9A 4BWPA 3A61A 2R3RA 3IS5A 3O8UA 3H3CA 4IWDA 5IEYA 3TUCA 1KE7A 4Y5HA 5K9IA 4XEYA 2W4KA 1JLUE 3UIBA 2BCJA 4JX7A 4WSQA 3ZSHA 4QTBA 2OGVA 4O96A 5HICA 5AR7A 4AGWA 4FIJA 2BPMA 3AQVA 4LQMA 4O2PA 1E9HA 4QPSA 4BDKA 4MD8E 3PG1A 4JVGA 1MRYA 4O7VA 3O7LB 3ETAA 3PE2A 2VGPA 3UNJA 4EK4A 1QPDA 1FMKA 2ZJWA 3ZYAA 5K5XA 1OPLA 3DNDA 3EN9A 5AV1A 3W0SA 4V05A 3LFFA 4IFCA 1ZZ2A 2HZNA 4EQCA 4M0ZA 5B0XA 5HD4A 2J6MA 4QP6A 3EN5A 1ZYLA 2XK4A 4C8BA 4PDOA 4DGMA 3MESA 5JGAA 3TEIA 4CFWA 2VZ6A 3DQWA 3P5KA 4FIEA 3VQHA 3FI4A 1U59A 5HU9A 5JFSA 4QQJA 4AOIA 3G15A 2OBJA 1KE5A 3PIYA 4AN3A 4D4SA 3TYKA 1H28A 4HGEA 4FTJA 1XQZA 3VHKA 3ENMA 3BU5A 3NAYA 2YISA 4FOBA 3JUHA 2CMWA 1H26A 5I3OA 5KO1A 4OAUC 3DLSA 3VBXA 4IBMA 1XR1A 1WBOA 3Q9XA 4CFMA 3BHYA 4MBLA 3QRIA 4DLJA 3JVSA 3NUYA 2W1GA 4FTAA 4JAIA 4UMTA 2W5HA 4EEVA 4EI4A 3CTHA 4C37A 3EQHA 4I0RA 2WTJA 2C5NA 3A8WA 2YERA 3GC7A 3QLGA 3HA6A 3KK9A 4GJ3A 3KQ7A 3QRUA 3W33A 2JDSA 3R6XA 4WA9A 4BCOA 3T9TA 4G6LA 1W8CA 4HZRA 3UDZA 4HVHA 1CMKE 4IAAA 5I9ZA 3QQGA 1YI4A 2RSVA 2WMBA 2WQEA 3I5ZA 4FTOA 4ZTQA 4ZLYA 4J99A 3D0EA 3R30A 4RFZA 2PZ5A 2X8IA 5E7RA 4GKHA 5AFVA 3RPOA 5I9VA 2VWYA 3KU2A 2R3GA 4A4LA 3RK9A 3SV0A 4JRVA 2FSOX 2J0MB 3ZUVA 3HECA 5H3QA 3DPKA 2UUEA 4PP7A 5DA3A 3P5JC 3LCTA 4FK3A 4U79A 3TNIA 2UZVA 5EK7A 3OY1A 2I0HA 1MUOA 4H3QA 4Z7HA 4I41A 4MBIA 1LUFA 4R1YA 4BDCA 5M53A 3DXPA 4L3LA 3PP1A 5JGBA 5H8EA 4PL5A 3E8CA 5BV3A 4BCQA 2UZOA 2G2HA 4IHPA 4EOOA 5I9YA 2IZTA 3W0RA 4FEVA 4L46A 3Q53A 1P4OA 1JSTA 4FG9A 4DYMA 4Y5QA 4L42A 5IEVA 2WMQA 1V0PA 3UQCA 3SLSA 3Q4TA 1W7HA 1ZOEA 2H9VA 3OT3A 4F6WA 3UDTA 4KA3A 1Y8YA 3R83A 4RLLA 5ANJA 3EH9A 5AUZA 4NCTC 3R1NA 3ZOSA 3D7TB 2PU8A 3LVPA 4OTRA 5HLNA 1SZMA 4KIKB 4NH1A 4PQNA 3GU7A 4UXQA 2J50A 1PMVA 2X7GA 3D7ZA 4II5A 3LQ3A 3Q6WA 3D5WA 3DT1A 1IA9A 5F95A 2R3NA 4EHGA 2BMCA 1Q8WA 1WZYA 2HK5A 3O0GA 4D5KA 1QPCA 3QFVA 2OKRA 4P90A 4W9WA 4JS8A 1R78A 4UWYA 2QOIA 4IWQA 5DMZA 3GU8A 4GT3A 5IA0A 4JLCA 3AC1A 4NK9A 2JITA 4JIAA 5CY3A 5M06A 5TR6A 4EYMA 3LLTA 3MYGA 2A1AB 5E8UA 3M1SA 3NNVA 5IU2A 5KMNA 2IZRA 4K2RA 4RQVA 4G16A 3GU6A 3NW5A 3OEFX 3FMDA 4AZTA 1GZNA 3A4PA 5KMOA 4OTPA 3COHA 4BTFA 4RFMA 4QMOA 5TE0A 2IEWA 4E93A 3PG3A 3HV3A 4FKTA 5JRSA 3GC0A 3BELA 4WD5A 4BTMA 4IAYA 2CN5A 3AMYA 3W2CA 3GCSA 5FXRA 2JFMA 3G0FA 2QURA 4FSRA 4M66A 4RWLA 4AACA 2CLQA 3ZSIA 3FLSA 3NUNA 3MGYA 5CAOA 3M42A 3ZXTA 4JDIA 4X2NA 3VNTA 2R7IA 2YN8A 4K11A 4F7SA 3ZM4A 4BI0A 3LMIA 4QPAA 1YXUA 3S00A 3V5TA 2QG7A 5E8WA 2J5EA 2W1DA 4YGAA 1K2PA 3FWQA 4RIYB 4D2VA 2B9HA 4KSQA 3EQDA 1B38A 3QXPA 2QI8A 3QRTA 3E87A 3FY0A 3L9LA 4HVGA 4K33A 1URCA 3L1SA 3F66A 4WG4A 1OKVA 5HG8A 4O7YA 5CU0A 4FIIA 4ZY4A 4DHJA 4G3DA 5IA1A 4XCUA 4ZTHA 4G3FA 5DNRA 3IQ7A 5J5TA 4FC0A 1M17A 1Y57A 3OC1A 1XH6A 4L45A 5A4LA 2XVDA 5J1VA 3LQ5A 3OEZA 5HTBA 3QHRA 5HG5A 4BJJA 1S9JA 3SG9A 1B39A 4E73A 3U51A 2BZKB 4BDJA 4RWIA 3QQKA 5DGZA 3PZHA 4CFVA 3T3UA 3NZ0A 3VUKA 3BL9A 2XF0A 2JKQA 5E8TA 4WOVA 3PIXA 4PF4A 3RKBA 2WAJA 2XA4A 4YO6A 4A06A 4EZ7A 4F7LA 5B2KA 3OP5A 3VUDA 3QQHA 2JEDA 4MNEB 4QQ5A 4XP2A 5K5NA 4ZMEA 4YHTA 3IPHA 2BTSA 4I23A 3HMMA 1CSNA 4M68A 3ZFXA 4AZVA 4AXCA 2QOFA 4IB1A 4QYHA 4IDVA 4QD6A 3UO6A 4CQGA 5HZNA 4WT6A 4AN9A 3W0PA 5GIOE 3O2MA 2ZV7A 4UYNA 4X6RA 5J95A 5IZFA 4QYEA 4A7CA 3BYUA 3QKMA 5JMSA 4CSVA 4D5HA 3PXRA 2WD1A 3NW7A 4FTLA 2C0TA 1H25A 3F7WA 3RAIA 2QOKA 4S30A 1H1PA 3UE4A 2PZIA 4FX3A 3FXXA 3BCEA 3EFJA 1JVPP 4E4LA 5BUEA 1FMOE 4HYUA 3AMBA 4HGLA 2XUUA 5LVMA 3BLAA 4YLJA 3DU8A 4EHZA 3GXLA 5HHWA 2JKOA 3NX8A 2GHMA 2JDVA 5CU2A 1Y8GA 3FL4A 4KUJA 3ANQA 5A4QA 4WKQA 3EQGA 2BRHA 2Z2WA 4M13A 5F4NA 4B9DA 4YTFA 3O8TA 3RINA 5EH0A 1VR2A 3IECA 4NFNA 3H9OA 3TDWA 3PJ8A 4G1WA 5HI2A 5LCJA 4C2WA 2WXVA 2PZYA 4G31A 4U41A 4N4SA 4BDEA 3N4UA 3ORPA 4ZTSA 5DEWA 4DGNA 2W5BA 1IAJA 5FDXA 1HCLA 2ZVAA 4XUFA 5DFPA 2IO6A 3FMHA 4O6EA 3R8PA 3VS5A 4AT3A 1HOWA 5I4NA 4LGHA 4DA5A 1KV2A 4FGBA 2IF8A 4NKAA 1BI8A 4EZ3A 1URWA 3PJ3A 2ETKA 3ENHA 5KMMA 2Z7SA 3VWAA 2CLXA 1IA8A 3VUGA 1KV1A 3FMKA 2FSTX 4CMUA 3F5PA 3O17A 3BYOA 4OR5A 3DFAA 4RRVA 4X2KA 3BYVA 4XP3A 3R02A 4C61A 4FT9A 3F3WA 3GB2A 2W1IA 3NYXA 1GAGA 3OXZA 2UZWE 1PMUA 3MIAA 4O4BB 4AAAA 5KMLA 5GINE 2XMYA 5HIBA 1F5QA 5HEZA 3OG7A 5EHYA 1CKJA 4QQTA 4ZIMA 3K3JA 2R7BA 2WQOA 3LJ2A 4KB8A 1OGYA 2CJMA 3VULA 1T45A 1W84A 1PHKA 4WSYA 3COIA 4D1ZA 1R0EA 1KE9A 4JDHA 5E91A 5BX0A 4UMPA 4RGJA 2PVKA 2FO0A 2OXDA 3MWUA 4YZMA 1ZYJA 3UZRA 1LPUA 3DKCA 3UVRA 3OWJA 3R2YA 3VUIA 1YOMA 2QU6A 2R3OA 3RPRA 5HTIA 4NEUA 3AMAA 4L67A 3QTXA 4GFMA 2ZB0A 2ZM3A 3KRLA 4WNMA 2CGVA 1W82A 2Y9QA 3MB7A 3UNKA 4XX9A 4IZAA 4TYJA 2Y4IB 1UWJA 3RI1A 4N57A 2QOHA 3CQWA 2WU7A 4ACCA 2X4FA 3Q2JA 3UGCA 2IZSA 2YDIA 1REJA 2IZUA 3SDJA 4CCBA 2JDTA 2O65A 2W05A 5ETIA 3FJQE 2OK1A 3DK7A 3E8EA 1OECA 4OTHA 4TN6A 4FKUA 4LL5A 4WIHA 5HQ0A 3QTRA 2WIHA 3ID6C 1JKKA 1F3MC 4Q5EA 2XNPA 5JQ8A 3VS2A 5JQ5A 5HO6A 2W1EA 3RPSA 4EH3A 3QA8A 5GJFA 5BYYA 1ND4A 4FEWA 1FVRA 2YAKA 3CP9A 4YJRA 4WNOA 4J97A 4DDGA 1KUTA 3FY2A 3HEGA 3UIXA 2BRNA 2WIPA 4F1TA 1XMLA 3BYSA 1VYWA 4UALA 4O0RA 2XM9A 2RFEA 4XV2A 4CT2A 3HAVA 4O0XA 5FBNC 3WZJA 2H6DA 4CFUA 3NUUA 3CPCA 4ZS0A 2ITUA 3SOCA 3FLZA 4U43A 2PHKA 3VVHA 3ATSA 3ORTA 5IKWA 4BCFA 3Q04A 4LM5A 4WRSA 5DLSA 2Q0BA 4FNZA 2PPQA 3IKAA 2PMOX 1PXOA 3GP0A 3K2LA 2WOUA 3A7GA 1RE8A 4IANA 5AMNA 4GS6A 4PP9A 3I7CA 4DTBA 2GNGA 4O38A 2OJJA 3QA0A 5J1WA 2ERKA 4X6QC 1OBDA 1B6CB 4FV1A 5HKMA 4O86A 3O5AA 2V7AA 3NAXA 2PUUA 3HP5A 2WQMA 2C47A 1M2RA 2J0LA 4YZDA 2XYUA 2B7AA 3HP2A 3WILA 3Q9ZA 4FTUA 3ZBXA 3AKLA 4DHZA 2EXCX 2ETRA 4UV0A 5CU4A 5FRIA 4O83A 2Y7JA 3N4VA 2EVAA 3NRMA 5IUHA 2QONA 3CS9A 3N51A 4P5QA 4JQ8A 4FSQA 4XG8A 5EYDA 2QC6A 4J53A 3DLZA 3G5DA 4QO9A 3A7HA 4R7HA 5AV0A 3FXZA 5K0XA 4AW1A 3EIDA 2R0UA 3NWWA 5I9XA 4BY9E 4FKWA 3S2PA 3E8NA 2VTLA 5CYIA 5DT3A 2YHVA 3ZEPA 4CLIA 4YURA 1VZOA 1ZMUA 2VTSA 4TWNA 2GFCA 2WNTA 3EFKA 5CVFA 1U5RA 4CCUA 4XV1A 5JFWA 2B53A 4OUCA 3QTIA 2ONLC 4PL3A 4JBQA 3FI2A 5EI2A 4I6HA 3ZLSA 2P2IA 5I9WA 4IM3A 3D94A 3WZEA 4HGSA 4QMWA 2PE2A 3E62A 4NZWB 2A27A 3G9NA 4OTGA 3RALA 4D58A 3S1HA 2O0UA 2VN9A 2XNMA 5KZIA 2RKUA 4YMJA 5D9HA 4C4EA 4KKGA 3LZBA 2F57A 4OLIA 3TT0A 1M14A 1Q99A 3OROA 4C7TA 5CLPA 2VTQA 3D7TA 5KHWA 3UZPA 1JKTA 2XRUA 5FGKA 2OIDA 4FZFB 3UVQA 4AZWA 4AT5A 1H1SA 4PMPA 2VTHA 4PDSA 3VRYA 4WG3A 5JSMA 3UC4A 2KULA 4FT3A 4L7SA 1Q61A 4H3BA 2VUWA 4JT3A 4QYYA 4RVLA 3RCDA 3V6SA 3VUTA 4DGOA 1VLRA 4CG8A 3KY2A 4LOOA 3PJ1A 3GI3A 1GZKA 4YNEA 3MY0A 2XH5A 2LAVA 2G2IA 5JK3A 5J9ZA 4DG2E 3DFCB 4C0TA 5DN3A 2XYNA 4AOTA 1PKGA 4MXCA 4EOLA 3AT3A 3IDPA 1Q5KA 2VX0A 3F5UA 1OL5A 5CVHA 5HVJA 4RX5A 4JI9A 5LCKA 4FV9A 1Z57A 3BQRA 3CD3A 5CXHA 2JC6A 4YC6A 4L8MA 2B52A 3ORKA 3W18A 2IVTA 4GK2A 5AM6A 4IACA 4PPAA 2ZV8A 4YJNA 3MFUA 4N6ZA 3KF4A 4PPCA 4X2JA 4FKSA 5EQPA 3EWHA 5AUVA 3TCPA 2W99B 1R0PA 3DAEA 1BUHA 5IQDA 4EOIA 2VWZA 2P33A 3H0YA 5EQYA 3POOA 4OAVB 2JLDA 1U54B 1WBVA 4LL0A 4L01A 4IB3A 4JAJA 1PKDA 3CIKA 2OO8X 1YW2A 2CDZA 4F09A 5L2QA 4F9BA 2R3LA 4FMQA 4J95A 2GCDA 5I3RA 4BZNA 3U55A 2CGXA 3ZLWA 4BDFA 1PMNA 1M7NA 3PVWA 2GTNA 3KRRA 1NW1A 3OY3A 4CTBA 2OJGA 3P9JA 5A46A 2QOOA 3OT8A 3HNGA 5BVDA 2ERZE 2C6MA 3R7VA 3IW6A 4CV9A 1YDSE 3NW6A 2R3HA 1DAYA 3KXNA 4I20A 3R7IA 3VS7A 1IRKA 3F61A 3NDMA 1WBNA 4OW8A 3FE3A 4S34A 4HVSA 1ATPE 5DT0A 4O7RA 3FDNA 4FNYA 2X8DA 4IX6A 3ORXA 3LFBA 1IEPA 3L8PA 4UX9A 3ET7A 4X3JA 5FEDA 4IM0A 4FL3A 2QD9A 2XANA 3MVHA 3KA0A 4FSNA 4BWKA 3ZDUA 4AG8A 3EQPA 3I0QA 3LCDA 4YSMA 5GJGA 4IE9A 4LV8A 4GK4A 4M12A 4ITJA 4EH8A 4ZJIA 4EC9A 4GT5A 5AP6A 2W7XA 4MNEA 1J7LA 1Q41A 3BZ3A 5ANKA 4CZTA 2CGUA 3KXZA 2A4LA 4RVTA 2RGPA 4YTHA 3PDTA 2PVHA 3QGWA 1H24A 4LG4A 4DFBA 2UW8A 3OTVA 3GU5A 4GYIA 4E1ZA 2NP8A 1O6LA 5HCXA 4X0MA 3CBLA 4X21A 2AC3A 4YJUA 1G8SA 2E9PA 4PV0A 1XMMA 1Q4LA 3PA5A 4GEOA 4XG2A 3EZRA 2EB3A 5HLPA 4CNHA 5M09A 1O6KA 4GV1A 4DC2A 3U87A 3QYZA 5G1XA 3GCPA 2QO7A 4BZDA 2JKMA 3COMA 2UW3A 3TUBA 3UYTA 2JAMA 2UW9A 3OF0A 4JBPA 2J0JA 4UZHA 2GHGA 3SW7A 3DB8A 2JBOA 1E1XA 3O51A 2RF9A 3I4BA 3VONA 4UZDA 4HVDA 4FODA 4RJ6A 5HX6A 3GQIA 1REKA 3MB6A 5CAUA 4NIFB 4GCJA 2ZDUA 5AEPA 4FT0A 2QOQA 4J98A 1OGUA 3HV6A 4DLIA 5M4FA 4C4HA 4C33A 3DDQA 1W98A 4I3ZA 1YHSA 2E9VA 1ZYSA 4ENXA 3IK3A 2PE1A 4JXFA 3QCSA 1JWHA 4HNFA 4EORA 3MH3A 4ITHA 4BKZA 4LDTA 1TQIA 4XLVA 2ITWA 1XH8A 1Y6BA 3AC2A 4R5YA 4U80A 3UDSA 3E92A 4IVAA 4L43A 2VTOA 3EYGA 2XBJA 3ZBFA 3R8VA 3RTPA 1SVGA 2CHLA 3BHHA 4OT6A 5EKOA 4D28A 3NMUF 5CAQA 3PY1A 3OCGA 4ITIA 4JQ7A 5I5ZA 3FQEA 5IA3A 3KKVA 2AC5A 2UZUE 3NYNA 4HOKA 4AFJA 3PPKA 4IB0A 4M3QA 2F2UA 2W9FB 4O0YA 3QCYA 1NA7A 1SVHA 4MQ2A 4L3JA 4E20A 4NM0A 5CEIA 3NFFB 3WF6A 4ZY6A 4EK5A 4E8AA 4JJRA 3ELJA 1P2AA 2A98A 2Y6MA 4FT5A 2Y4IC 3E3PA 4AT4A 2E9UA 4KBAA 3VUHA 3LFQA 3MV5A 3OW3A 4DEHA 4PMTA 3IGGA 2JGZA 3FLYA 4MQ1A 2HWPA 3LMHA 2VWUA 2C6TA 4DHIB 5DHJA 5ANGA 3TL8A 3PSBA 4ZSGA 2ZOQA 4PTCA 5GJDA 5BVKA 2O3PA 1PXLA 2AEGA 4JL9A 2PULA 3P23A 2E9OA 3QD3A 3WIKA 4EHEA 3NNWA 3EL8A 2XKCA 4IH8A 3B8RA 4M97A 4G34A 4YLLA 4B99A 2X1NA 1W2DA 3L9MA 4I22A 5KBRA 4LOQA 5CX9A 2ETMA 4AA0A 3VRZA 4GRBA 3V51A 5AUYA 4FV2A 4RVMA 3NCGA 5CQWA 4FZDB 2GPHA 2GSFA 3QTUA 3T3VA 3PXYA 3FMLA 2C3LA 2HW6A 2R2PA 2VWVA 3HL7A 4CTCA 2YCQA 2VAGA 5FXSA 4YPSA 4BDAA 2XBAA 3W55A 4U81A 5IH6A 3MTLA 5L4QA 3MN3A 5IUIA 5EOLA 4W4YA 5HCZA 5C9CA 2VO7A 2BZJA 2PUIA 4AXFA 2GU8A 5J79A 4GFGA 5M4CA 4IJ9A 1YXTA 2C6KA 4IVCA 4AXDA 4O7ZA 3NVMB 4ZTRA 3C0IA 1U46A 2O2UA 4DEAA 3FAAA 4H1MA 3HZTA 2Z7QA 1OL7A 1SNUA 1IASA 2HXQA 4M69A 3VIDA 3ZS5A 1OL1A 4EBVA 2C6IA 3PJCA 3O8PA 3ZH8A 4YZBA 1Q62A 2F7ZE 2UW5A 4QTCA 4V01A 4BI2A 2YZLA 4EZ5A 4RJ5A 3PSDA 4MH7A 2ITZA 3KF7A 5KX8A 1W2FA 3HRFA 2OSCA 4QMVA 3DV3A 3LE6A 4FIFA 1YWVA 4GYGA 3AC4A 5EW8A 3V8WA 5GZAA 4MYGA 2B55A 2HZIA 4YBKA 4C2VA 5E9EA 2WTDA 3ANRA 4OTFA 3G0EA 2GFSA 3LFCA 3ORLA 1YXVA 3RHXA 4O81A 3A7JA 2YLEA 2YA9A 1XH7A 3Q32A 4C4JA 4FTCA 5A54A 2UZLA 4H39A 3A60A 4RC3A 4XG6A 3QLFA 5C01A 3S4QA 2JIIA 4RA5A 4W8EA 3C5IA 4DG3E 2OH0E 2UZNA 3THBA 4JMQA 5DEYA 5CEKA 1V0OA 3P7BA 4XLIA 4I94A 3W1FA 2XKEA 4I92A 4YJSA 3D15A 2W17A 2JDOA 4FT7A 4ZLZA 3TG1A 5CEMA 4O4DA 2I0EA 1H1QA 4BI1A 3V5LA 4Y83A 1OL6A 5HE0A 2P0CA 2RFDA 5LMAA 5DG5A 1OUKA 2QOBA 1GIIA 1ZY5A 4F4PA 5D10A 3R0TA 3FEGA 4BGGA 3KMMA 5B2LA 3FLWA 5C27A 2Y8OA