5GJDA

Crystal structure of human tak1/tab1 fusion protein in complex with ligand 2
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
306
structure length
292
Chain Sequence
GPLHMIDYKEIEVEEVVGRGAFGVVCKAKWRAKDVAIKQIESESERKAFIVELRQLSRVNHPNIVKLYGACLNPVCLVMEYAEGGSLYNVLHGAEPLPYYTAAHAMSWCLQCSQGVAYLHSMQPKALIHRDLKPPNLLLVAGGTVLKICDFGTACGSAAWMAPEVFEGSNYSEKCDVFSWGIILWEVITRRKPFDEIGGPAFRIMWAVHNGTRPPLIKNLPKPIESLMTRCWSKDPSQRPSMEEIVKIMTHLMRYFPGADEPLQYPCQHSLPGRVEPYVDFAEFYRLWSVDH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/transferase inhibitor
molecule keywords TAK1 kinase - TAB1 chimera fusion protein
publication title Development of a Method for Converting a TAK1 Type I Inhibitor into a Type II or c-Helix-Out Inhibitor by Structure-Based Drug Design (SBDD)
pubmed doi rcsb
source organism Homo sapiens
total genus 91
structure length 292
sequence length 306
ec nomenclature ec 2.7.11.25: Mitogen-activated protein kinase kinase kinase.
pdb deposition date 2016-06-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 5gjdA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 5gjdA01
5A4LA 5KMNA 3C50A 3EFWA 2C6LA 4JBOA 1XBAA 3PVUA 4N70A 5A4TA 5E4HA 2C5NA 4MBIA 3ZONA 1OL6A 4J71A 4G9CA 3TUBA 3WF5A 4RIYA 3VS0A 2WMRA 3WZDA 3P7AA 2QLQA 5HTIA 4C37A 5EI8A 3DQWA 4TZRA 1YDSE 2HY81 2I0VA 4RLLA 5CXZA 4KA3A 4QP2A 1Q99A 4FEXA 3COHA 4RFMA 3POOA 4JDIA 4IAZA 5EYCA 4BTFA 4KIKB 3MESA 4KAOA 2XNGA 2ITVA 5C03A 4EOIA 1YWRA 4AS0A 3TZMA 4I6HA 3QRKA 3OOGA 3L9NA 3F3TA 4X2FA 4CV8A 4FG7A 4QQ5A 2H8HA 3V6SA 1CTPE 1OIUA 4IJ9A 4A4LA 2C0TA 3KK9A 5EM7A 5FTQA 4J8NA 5KUPA 4LOOA 4C3PA 3QCQA 2UVXA 3QC4A 5HTCA 3CLYA 5HKMA 2VTAA 5EW8A 2C6IA 2XIXA 2YHVA 4AW2A 3TNIA 4PTEA 3BHTA 5IUHA 3F2NA 4FSZA 3F6XA 3CEKA 3OCBA 4R5YA 3GU5A 3R21A 4CNHA 3C4FA 4X0MA 4A9SA 3IS5A 4DC2A 3RJCA 2JEDA 3EQHA 4L43A 2YABA 5AIKA 4X2NA 3O7LD 4FZDB 3RBWA 3QZGA 2HZ4A 1YDRE 3RVGA 1PXIA 4CRSA 4XUFA 4EC9A 2XB7A 3DXPA 4YBKA 2RFSA 1JKSA 1Q3DA 1IEPA 1H1SA 3DNDA 4WSQA 2Z60A 2G2IA 3GC0A 3KULB 3P7CA 5ETAA 3VJNA 4OTDA 2OO8X 2WTJA 2QD9A 3UO4A 4FTOA 5AV0A 4CLIA 3NIEA 3EHAA 3FKNA 4E20A 4TYHA 4AWIA 2B53A 4YC8A 5CU3A 4BHNA 3AC4A 1FBNA 3U9NA 2J6MA 3LOKA 1E9HA 2EB3A 1EH4A 4FNZA 2Q0BA 3R00A 2HW7A 3PWYA 3UVQA 4V0GA 2PVRA 5ANKA 5CT7A 3RTPA 4FKJA 3PRFA 4HYSA 3OCGA 4M84A 3UE4A 4A06A 3Q5ZA 4ALWA 2IW6A 2CHLA 4JR3A 3V5LA 4LYNA 4ZP5A 5HGIA 5HE1A 3Q9YA 3JYAA 3LMHA 3BWFA 3FI2A 3PTGA 3ROCA 4BCJA 3LFSA 2UW4A 3M42A 2XNNA 3LCTA 4ACHA 4FIEA 1NVSA 2EU9A 1T45A 2UVZA 3R0TA 4FV4A 4RFYA 5DWRA 1ZMUA 4ZK5A 2C1BA 5AAEA 5CVHA 4ASXA 4BGHA 2W1HA 2WEIA 3EQPA 4BCKA 1YOJA 4AN2A 2GNIA 2WTKC 3Q4ZA 4I5CA 2ZV8A 3KU2A 3UO6A 4EZ7A 3G9NA 4K0YA 3LHJA 3RALA 5DOSA 1V0OA 1CDKA 2C0OA 5IA4A 2VTTA 5DT3A 4Z7GA 5CSHA 3CBLA 5AM6A 3TG1A 4FT3A 4WHZA 3HV5A 4N57A 5J8IA 3BI6A 3QCYA 3PJ2A 4M97A 4BCPA 4EC8A 3EQIA 3C0GA 4L3PA 4MD8E 5HBEA 2NO3A 4GFOA 4IIRA 4FIJA 4PMTA 3BYSA 4MNEB 1LEWA 2W1ZA 3QQHA 3ZS5A 3DDQA 3R73A 2RL5A 3F9NA 4LV5A 4R7HA 5AMNA 1R0PA 1WMKA 3EB0A 3KA0A 3ZXZA 2CNVA 4F0GA 4HVHA 4F99A 1XH7A 4D5HA 2J0LA 4QYYA 3R01A 4R7IA 2OJGA 2FA2A 3U8WA 2GHMA 2UZLA 5BYZA 4EYJA 5LMKA 3LW0A 4U43A 5KX8A 3ZZWA 2QLUA 2YDJA 4MXOA 4TRLA 4UWYA 3FPQA 3WF8A 5FXQA 2BIYA 1Q41A 5FUTA 2JFMA 1WBVA 3JVSA 4I23A 4J53A 5CQWA 5CF6A 2BAJA 3FXZA 2GQRA 3DXQA 4G6LA 4PDOA 4AGCA 3KRRA 4I5PA 4X2JA 5H3QA 4GFGA 4I41A 1OL5A 4E73A 2X2MA 2QI8A 2VTQA 1OUYA 3GOKA 3DQXA 2VO6A 3GFEA 3V01A 1OL2A 3WF9A 5AP6A 2O3PA 2VO3A 3BV3A 4G5JA 4F6SA 2GS2A 1Q8YA 4D4RA 4DEIA 5F94A 2PMIA 3DAJA 3LJ1A 3DB8A 2PSQA 2ZM3A 4O27B 4CMTA 2VV9A 1UWHA 5CALA 4U45A 5DG5A 2YIWA 4ZSJA 2F57A 3MW1A 4TT7A 3VBQA 4O0SA 4O7NA 5IMEA 3P9JA 2HXLA 2Z2WA 5AUWA 4IEBA 1QL6A 3QD3A 2VZ6A 1OZ1A 3PXRA 4YJVA 5FGKA 4EH2A 1U54B 3FYKX 5AP2A 1PXPA 2P3GX 3FZSA 4U0IA 2XA4A 4RT7A 4S31A 3VS3A 4R7BA 5DRBA 3TM0A 2ITNA 2PVKA 3D14A 3P0MA 2R0UA 5CYIA 2HCKA 1QPDA 2OZAB 2VO0A 4AT5A 1PMVA 3U55A 4L42A 3OTUA 2BMCA 3CXWA 5K5NA 1GNGA 3VHEA 4KIQA 3ZSIA 5LQFA 4WRSA 2VAGA 5BNJA 4FIFA 3OMVA 3FEGA 4DF3A 3SC1A 5IQAA 1CKJA 2B1PA 2G9XA 4IX3A 5CWZA 4HVSA 1WZYA 3PJ8A 3PIZA 2PPQA 4H3QA 4I1ZA 3NDMA 2W4KA 4XG9A 1GZOA 1Q5KA 1YXUA 2JLDA 4MX9A 2OIQA 4QMYA 3K5UA 4CCUA 5DR6A 4ZTMA 3QFVA 2VX1A 1R39A 4D0WA 2QR8A 3MY1A 1A48A 2OI4X 5E1EA 4RIXA 3UC3A 4GKIA 2YISA 3JY0A 5L6OA 5B7VA 3NRMA 3QAME 3FZ1A 4JBPA 4EQCA 3I79A 5DRDA 3REPA 1IG1A 4YP8A 5KKRC 4F6WA 1VEBA 1IR3A 4GUEA 3V5TA 3KN5A 2J9MA 3FZRA 3Q6WA 5EHLA 4GVAA 1JSVA 3DOGA 3RAWA 3HL7A 1YW2A 4BFMA 3ACKA 3C4XA 3RCJA 2WMSA 2B52A 4O81A 4EJNA 4AFEA 3ZUVA 2B0QA 4ENXA 4IANA 3L9MA 4BCFA 2Y4IC 3G2FA 3R8LA 4AN9A 5AR7A 5CU4A 3NAYA 3RHXA 5AEPA 4DH5A 3MA3A 1W82A 1Y6AA 5E8TA 4NM3A 3SXRA 2PWLA 3V3VA 4AZWA 1H1PA 4EL9A 4IE9A 5AUTA 5BUIA 3IECA 5AP1A 3BU6A 3O51A 4H3BA 3TJCA 2ITZA 3GEQA 4WD5A 5HHWA 3I1AA 4B0GA 5J5SA 5TO8A 3TKHA 3NYNA 1REKA 3COKA 4RJ6A 2UW8A 2B9HA 2GNFA 2XBJA 5BQ0A 1PY5A 4ACMA 3W2CA 2R5TA 4IVDA 4IZ7A 3KK8A 4IAIA 3A7IA 2PY3A 3FI8A 1IASA 4FK6A 1UWJA 3GU4A 2R3MA 3ITZA 4X3FB 3UQFA 4RBLA 5AA9A 3QTQA 1UNGA 2XNOA 4DFNA 2BRNA 2JC6A 3MTFA 4AZVA 3DZOA 4K6ZA 4CT1A 2DUVA 1BI7A 3BGQA 4IDVA 3SW4A 4JX3A 2VX0A 3FKOA 3RI1A 3NW5A 5FRIA 4A4OA 1B38A 4OGRA 4YJSA 4CYIA 2VWUA 4PDSA 3TZ9A 3ZU7A 1ZLTA 3FSKA 1UVRA 5CAVA 3E93A 4EEVA 5A54A 3B8RA 1S9IA 5DEWA 1UU9A 3D15A 3WBLA 4QPMA 4FUXA 4NEUA 3MFRA 5HLPA 4ANMA 3QZIA 5A9UA 4XJ0A 4W4YA 3BYMA 1FPUA 4D58A 2A2AA 3HV4A 1OB3A 2BDFA 3A7HA 4BDDA 4D2VA 4IADA 5IEYA 2GDOA 3BU3A 4I20A 4F9CA 3UQCA 2C4GA 4CXAA 3BE9A 4MKCA 3VS6A 3MIYA 2QOOA 2I7QA 5FWKK 3N4UA 3QQLA 3WF6A 4MF1A 1ZMVA 2ITWA 2QU5A 2F9GA 2FGIA 5GJFA 3PXFA 2BDWA 3KN6A 4ZTQA 2WFYA 4EHEA 4KKHA 4G1WA 4DBNA 5GINE 3PRIA 4FT9A 3NWWA 4IVBA 4XH6A 5LVOA 3BHVA 3H9OA 4KNBA 3B2WA 3C0HA 4JRVA 4RQVA 3IK3A 5EH0A 3SRVA 3R7UA 4N6YA 3HMMA 5HVJA 5HLNA 1OIQA 4LOQA 3RPYA 5K9IA 3EKKA 1GIJA 2CKPA 3OXZA 4FNYA 5HICA 2B9IA 4RJ5A 2OIDA 2JBOA 3QRJA 4AE6A 4F0FA 5IF1A 3CTHA 4YC3A 3A2CA 4CT2A 4RX9A 4UEUA 1AGWA 3VQUA 5F9EA 4PPAA 3HMPA 4U40A 4FVPA 4WNOA 5A4CA 5TE0A 4FNWA 4JQ8A 4KRCA 4ZY6A 4JI9A 3NAXA 4WG5A 2YITA 4ERKA 5K0XA 4IX5A 4AN3A 2XIZA 3Q96A 5L2TA 2GQSA 3GCPA 3DBQA 5CEIA 5JGBA 4Q9ZA 3B2TA 3UBDA 2HIWA 3CPBA 3DS6A 3AD4A 4K11A 4LRKA 2OJIA 3WARA 3QXOA 4BWPA 4FT5A 2X1NA 1GZKA 2P2IA 4MH7A 4XBRA 4CG8A 4D4VA 5EKNA 3H9RA 4CQEA 2PVHA 1DAYA 4DLJA 4B7TA 4D2PA 3A7JA 4BTKA 4IVCA 5CNNA 5I9WA 4RLKA 3P23A 3L8SA 2J51A 1LP4A 3W2PA 1WBOA 4FMQA 3TTIA 4ACCA 1OKZA 2NP8A 5CS6A 4DTAA 3MVMA 1OKYA 4C4HA 3D2KA 2WTCA 4AOIA 1F0QA 1MUOA 3OZ6A 2V0DA 4NU1A 4EOMA 2R7IA 4AA0A 3B8QA 4OBPA 4U8ZA 2QO7A 3NYXA 1XKKA 4Q9SA 3MH1A 3VS4A 1YVJA 4QQTA 4H39A 4J97A 3MDYA 4MCVA 4DINA 5LVNA 2UW5A 3IW6A 2WMVA 3OXIA 3RGFA 2OXXA 4OAVB 4V04A 3P1AA 2UW0A 5EKOA 2E9NA 2XEZA 5J1WA 2ETMA 2XK9A 3HRCA 3H3CA 5EYDA 2YLEA 3KEXA 2AUHA 4GT4A 4QO9A 1L3RE 3L8VA 4O91A 2I1MA 5HNIX 3PJ1A 4WNPA 4ZLOA 3HYHA 3V51A 2GU8A 3DPKA 3RWQA 4E7WA 4FTLA 3ZC6A 4LOPA 1FMKA 2OIBA 3DK3A 4L7FA 3R28A 4LL0A 5AR8A 3R7GA 5KCVA 1MRYA 1WAKA 2C5VA 2G2FA 2YEXA 3U9CA 5LWNA 3PG1A 3R2YA 3G51A 4FKIA 4GS6A 2GSFA 5IKWA 2OZOA 1Y91A 4IAYA 3HV7A 4OT6A 4A9UA 4BDBA 4FEWA 5EDPA 3QD0A 5JFXA 3NNWA 2PVMA 1PYEA 3LCSA 4RX8A 4FV7A 3MBLA 4WBBB 3NMUF 5DR9A 3V8SA 3R9RA 5JZJA 4AU8A 3PLAE 3E64A 2R3RA 2CJMA 5CSVA 4QP7A 4Z55A 5HIBA 5T3QA 3F61A 4IZYA 1YI3A 2R3NA 4J96A 4RC3A 4S33A 5L6WL 3RK9A 4AAAA 3CSVA 2X9FA 4CGAA 4NM5A 3AT2A 3HV3A 4NTTA 4HVGA 4O7LA 3ODZX 3GENA 1OI9A 4ZEGA 4H3PA 5IQIA 1W8CA 3Q53A 3WE8A 1P5EA 2F2UA 4TYEA 3P5KA 2XK7A 4II5A 2CN8A 4DHFA 1YHWA 3CQUA 5DYJA 2CLQA 2IVUA 3JUHA 4U6RA 1R0EA 4XV1A 3W2QA 5D9HA 4PUZA 2H96A 1H0VA 3R1QA 5KZIA 5A46A 4FVRA 3MGYA 4L3LA 5AP7A 3ZTXA 4E6DA 3HA8A 5FM3A 4AX8A 5M06A 3DXNA 2Z7SA 4FKWA 5I3RA 2PVNA 4IH8A 4WSYA 5JN2A 4OBQA 3AD6A 3NS9A 5ANDA 2YM8A 4U41A 4ZTHA 5IEXA 1V0BA 3TT0A 2B55A 4LL5A 4K8AA 3SVVA 3PP1A 5E9EA 2X39A 2JIVA 5BVKA 4AZTA 3O0GA 1E1XA 3ZC5A 3E62A 4BGGA 5CEOA 2CGXA 5AV3A 3R6XA 3FDNA 4ZSLA 5HBHA 4MAOA 2H9VA 3ENMA 3MS9A 1ZZLA 3KF7A 2J7TA 1ZMWA 4DTKA 4O82A 1U5QA 2GCDA 1SM2A 4FSUA 4GT3A 4O6EA 5G6VA 4YLKA 3UP2A 5M53A 4M67A 3MN3A 3HAVA 2X8DA 1ZYLA 3EFLA 3HUCA 4PPCA 4ANNA 2PE0A 4TWPA 2VNYA 5LWMA 2OKRA 5IQDA 2I0YA 3JS2A 3OROA 4FKQA 4G16A 4I5MA 4BYIA 4BF2A 3LFAA 5ETCA 2W5HA 2QC6A 5CEMA 4OLIA 4HGTA 3ZEPA 1IAJA 4DGLC 3R04A 4G34A 3QHWA 3G0EA 3U6JA 3PPKA 3Q9ZA 1ERKA 3EZVA 1B6CB 4QNYA 1BI8A 2UVYA 3RWPA 2XIYA 3CS9A 4F63A 2IW8A 4CKRA 3HX4A 3Q04A 3Q2MA 2GS7A 1M14A 4V0GB 4E4MA 1ZYSA 2ZYBA 3A4OX 4MF0A 5AP3A 3SGCA 3H30A 5M44A 3LM0A 2X8IA 4C34A 3D7TB 3FMMA 3O8TA 3EYGA 3PP0A 3GCSA 5IQEA 2UZWE 4IAAA 5B2MA 3PSBA 4DFUA 4TWOA 3UVPA 3SQQA 2R3KA 2BTSA 2V5QA 3DZQA 5DT0A 2WAJA 1IRKA 4QYEA 4FKSA 1TVOA 2XF0A 3H4JA 4KB8A 3IOKA 3HECA 1JPAA 3P79A 2XM9A 4O0RA 2GFCA 1KE5A 4M0YA 4UB7A 3OFMA 4GH2A 2GS6A 5FG8A 5JRSA 1YXSA 2X6EA 4BZOA 5CU0A 5J1VA 4FSMA 4QMXA 1NVQA 4FIIA 5AWMA 4C38A 5GJGA 4XOZA 4DH1A 3QCXA 5FXRA 1P14A 3CR0A 4WA9A 3RP9A 3RHKA 1G5SA 3LE6A 1PXLA 2BRHA 1X8BA 3LFFA 3KXGA 2J0JA 4QYHA 1NY3A 3F66A 1GAGA 4S30A 3R71A 2GHGA 4I0SA 3WE4A 3LJ0A 3DJ6A 4LQMA 3EZRA 2C30A 4I6FA 4J99A 4O0UA 5ANGA 4NYEA 4RZVA 3CTQA 4ANBA 4EKLA 4ERWA 2ITPA 2FO0A 3ZOSA 3ORZA 3FQSA 2IJMA 4M66A 2C3KA 3KVWA 2C6KA 2CPKE 3QKMA 3DA6A 3UC4A 3PG3A 4FBXA 4FG9A 1W0XC 1SZMA 3KFAA 3OY3A 2IVTA 3W10A 4F65A 3GQLA 3RZBA 1REJA 3M11A 3UO5A 4CKIA 4ARKA 3ZDUA 5AV2A 3BX5A 4EH3A 4C36A 3LFCA 4BKZA 4XYFA 1JNKA 4M69B 4PNIA 4GJ2A 2W4OA 2R4BA 5CVFA 3AC3A 2CNQA 3NLBA 1OGUA 3TTJA 3QTSA 3L8PA 5ETIA 3Q9XA 4IWPA 5CNOA 2F7EE 2QNJA 3WZUA 2XH5A 3FMKA 4YLLA 2C6MA 1RJBA 4E3CA 4M12A 2XMYA 4QMTA 4JDJA 1PHKA 3DKFA 1YXVA 2Y4PA 2YIQA 4QYGA 4Y8DA 3ZHPC 5B2LA 5M55A 5EQYA 4O2PA 3NX8A 4EHVA 3G6GA 4EWHA 3UODA 3SG9A 4LGHA 1VR2A 3H0ZA 4APCA 2H6DA 3A61A 3PLSA 3SOCA 5JQ8A 3G6HA 5E8ZA 5HO8A 1U5RA 5HESA 3ZM9A 4FKRA 5CZHA 2VTPA 4PV0A 2ITTA 2OG8A 1SVHA 3V5PA 3CIKA 3PSDA 1GJOA 2ACXA 2UZUE 4Z16A 2Y0AA 3HLLA 3ULZA 1QMZA 3BU5A 3ORLA 3WIKA 4ZSAA 4KD1A 3RPRA 2PUPA 3EJ1A 4OBOA 2R0IA 4GG7A 1KE9A 4DH3A 4G6NA 2VX3A 5ICPA 5A4EA 3ANQA 5DHJA 3BYUA 2CNUA 5DBXA 2HXQA 5CSXA 1Q8UA 4F7JA 4ZZNA 3MPMA 4W4XA 2UW9A 4ITIA 4JL9A 4FV0A 4J52A 5KMMA 4IB5A 3MY5A 1YDTE 4GEOA 1OUKA 5DGZA 4EOLA 4EYMA 5BUEA 4O21A 5LMBA 1I44A 2E9PA 1WBPA 4J8MA 3S95A 3F3WA 4PMMA 4UMUA 3FSFA 1Z5MA 5HNBA 4PP9A 4ANQA 4ALVA 1ZY5A 3MY0A 3UYSA 4FKGA 4Z7HA 3LXPA 3ZRLA 2F2CB 4FEQA 4Y5HA 4ASEA 3C4EA 3DLZA 4Q5EA 5HG7A 1V0PA 4FSWA 4I24A 4LI5A 3BBTB 5BPYA 2PYWA 1ATPE 3NGAA 3QLFA 4O86A 3QTZA 5ANEA 2FVDA 4EBVA 5IQCA 1ZOEA 1JKKA 3IPHA 4WRGA 4DFBA 2IO6A 1M52A 1DM2A 4K33A 3FQEA 4TXCA 2P0CA 4R6VA 3O50A 4AF3A 3HMIA 4BTMA 2IZUA 5H8EA 3R8UA 4GU6A 4O22A 5LVPA 5EQEA 2W5BA 4JAJA 3PXKA 5F20A 1XH8A 5AUYA 1H25A 4ALUA 3ZUTA 4C02A 2PMOX 2C6DA 3PA4A 4UYNA 4BCNA 3MH3A 3ORMA 1XH6A 4IX6A 3VBXA 5KO1A 4I21A 5M51A 1VZOA 3FZPA 2FSOX 3EQFA 4YMJA 4HPUE 4EONA 4ANSA 2WO6A 4FYNA 5CENA 3LM5A 4G31A 4XP3A 3MTLA 4U3ZA 2WOTA 5FP5A 5D12A 4IZ5A 2F7XE 4BR3A 4JOAA 1FMOE 2Z8CA 1YI6A 2BROA 4CV9A 4CFNA 2W5AA 3UPXA 4E6QA 2HK5A 4G3FA 2X8EA 2XS0A 3HEGA 2XYNA 5I9VA 3NEWA 3KRXA 3OUNB 3L9LA 3VC4A 4UMTA 4UX9A 2XK4A 2YCQA 5E91A 4PY1A 4CZYB 5KMJA 3UG2A 4GK3A 4BZNA 5HQ0A 3AT3A 4MXZA 3BEGA 4QD6A 2XRUA 4F64A 2WB8A 1KUTA 1RDQE 2IPXA 3PPJA 5J7HA 5JKGA 4BIBA 5HG5A 2HY0A 2JGZA 4U3YA 4YBJA 4EJ7A 1H26A 4ZS0A 3A8WA 2QURA 4F1TA 3TNWA 2W1CA 4L53A 3MI9A 1FOTA 2FB8A 2JD5A 4HNFA 2W9ZB 4FV2A 2BRBA 4AACA 1BMKA 1YOLA 4MXXA 4CZTA 3LFBA 2VWZA 4DG2E 2ZB0A 4TW9A 4AUAA 4I0RA 3RM7A 4TN6A 5E92A 3F7WA 3LQ8A 3R9DA 3LMIA 4AW1A 2WMTA 4FT0A 3SHEA 4FGRA 5LCJA 4BCQA 3HGKA 3IW5A 3FLQA 2G2HA 5IA0A 2PZPA 4XLVA 5DNRA 3CJGA 2BKKA 4KS8A 5CF4A 3FL4A 2VU3A 2R9SA 2XK3A 2YZLA 1JOWB 3VW8A 3KY2A 1FGKA 4UXLA 4YJTA 1H27A 3P7BA 5IH4A 2ZV9A 3PVGA 2PZYA 4JDHA 3A7FA 2GTMA 3IGOA 3QRTA 2VN9A 3EQBA 4CFFA 4QMLA 2YJRA 4DFZE 2VTMA 3VUTA 3Q32A 4D1SA 3DT1A 3QGWA 3QUDA 4FV5A 4FL3A 1BYGA 4KABA 4XV3A 4QMNA 3P86A 1Q4LA 3T8OA 4PX6A 4RPVA 5AP4A 2WMWA 4ZSEA 3MSSA 4TKSA 5AP5A 2ESMA 4HGEA 4X6QC 3EN4A 3WZKA 4AT4A 2FUMA 2P2HA 4M14A 3E88A 3ZXTA 3FBVA 4ZXTA 4EOOA 4MHAA 3QTIA 2WTVA 3TZ8A 2BKZA 1QPEA 4KRDA 3KXXA 3ZZEA 5IA5A 2J50A 1Q8ZA 3ZDIA 1OVEA 5IH6A 2WTKB 4BDHA 2ITYA 3VUIA 4ZJIA 4YURA 4DEDA 4DEEA 1IA8A 3V5QA 4XV2A 1NXKA 1O6YA 1ZZ2A 2W4JA 2BZIB 2XKEA 3BEAA 2A4LA 4H1MA 5E7RA 2CCHA 3BHUA 1MQBA 4TNDA 5HO6A 3KCKA 4M15A 3QCSA 4ACDA 2VD5A 1UKHA 3UNKA 4QRCA 4FV3A 5CANA 2VWIA 4UALA 4O7RA 5E8XA 1OECA 4LUDA 3FPMA 3VBWA 5DE2A 4A4XA 4O0VA 4EZ3A 5I9UA 4NL0A 4HVIA 2RFDA 1M7NA 3NIZA 4EORA 4KBAA 3GB2A 3OWLA 3RNIA 4D9UA 3GCUA 3OCTA 4O7YA 1OL7A 3QD4A 2XK6A 4FSNA 3ANRA 4IQ6A 3R9OA 4A9RA 3LFDA 1LEZA 4YPDA 1JKLA 2VUWA 3PXZA 4OTPA 5DI1A 4DBXA 4HGSA 4DGMA 4IZAA 4MBJA 3DU8A 2VWVA 4JT3A 2VTLA 5AP0A 4BIEA 1WBWA 3QWKA 3F5PA 3FMDA 2CSNA 4L68A 1OMWA 5HX8A 5CI7A 3BGPA 1YXTA 4CEGA 1XWSA 2CGUA 3LJ2A 4QP6A 2XIRA 4QPSA 5KE0A 2BUJA 4TYIA 4ITHA 4PDYA 2BHEA 1WBSA 4QTBA 2W06A 4F9WA 5AV4A 2P33A 2GNHA 5KMLA 2GTNA 1RE8A 2B7AA 4JR7A 4DH7A 5AADA 3CJFA 4EK4A 3KRLA 4MQ1A 3DAEA 2WTWA 4RA4A 4UZDA 3W2RA 4IJPA 3AC2A 3TACA 1H1WA 2PVLA 1JQHA 3L9PA 3LXKA 2C6EA 4FKUA 4G2FA 4FTQA 4YZ9A 3FI3A 5ACKA 3OWPA 3TL8A 4CLJA 2JIUA 3LLTA 3EQGA 4K18A 5L3AA 2R3OA 3QUPA 4PWNA 3KKVA 1ZYJA 4QQJA 4EH7A 4RX5A 4JG8A 1TQIA 5D10A 1R1WA 3BQCA 4HYUA 2XNBA 3R7IA 5G1XA 4LMUA 4BICA 4DLIA 3BHYA 2W1EA 3AMAA 3C7QA 2BALA 3DV3A 3S0OA 4D1ZA 4AZSA 3DTCA 3GFWA 3CQEA 2B54A 2ZM1A 4BB4A 2XKFA 2BZKB 4ZJVA 4A9YA 5HIEA 5LCKA 4BCIA 1PYXA 2XK8A 4LMNA 3DJ5A 5HG9A 2EXMA 1BL6A 3VW6A 4EI4A 5HI2A 2I0EA 3W1FA 2IWIA 3F2RA 4ACGA 3D83A 5JEBA 2C5XA 3QALE 3G90X 3VAPA 2C6TA 4D4YA 5K5XA 4D2RA 4M7IA 2GHLA 1ZYCA 5AX9A 4OAUC 4QYFA 5CVGA 4MWIA 5FBNC 4IFGA 4Y5QA 4GIHA 5BVOA 5KKRB 2ERKA 5CASA 3ZRMA 4IFCA 4LRMA 2BTRA 3O7LB 5IUGA 3IGGA 3WZJA 4BDEA 4GT5A 2YDKA 4GYIA 5M4FA 4EUUA 5JGAA 2WD1A 4LUEA 3DJ7A 3H10A 3QXPA 2X6DA 3W32A 3V5JA 2Y4IB 3AGMA 2W1GA 3ENHA 3W18A 4AFJA 3UTOA 1Q3WA 4I4FA 5FBOA 4BWXA 2C47A 2J5EA 2JAMA 4JQEA 4MD7E 2BRGA 3ZSGA 1KE8A 2YIRA 4JX7A 4KKEA 5J9YA 4QPAA 3VUMA 3ELJA 4O7SA 2QOFA 3O23A 3KULA 4U44A 5F1ZA 4XRLA 4C61A 1H24A 3GU6A 5GIPE 4FV8A 3T9IA 5A14A 2VWWA 4IWDA 4S32A 4EOSA 3LCKA 1KSWA 3AMBA 4E4XA 4UV0A 2YM3A 1OM1A 4ZJJA 4CMOA 1H07A 5TKDA 1CMKE 3OVVA 5DLSA 5C4KA 2DYLA 3Q3BA 3HAMA 3HV6A 3WYXA 4FZFB 5FM2A 3IKAA 4EOJA 3FKLA 3VRYA 2WELA 4YJNA 4G3CA 1OITA 2X7FA 3DK6A 3LAUA 1UNHA 3W16A 2UZVA 3ZH8A 4WUAA 3QF9A 5I5ZA 5IUIA 3S2PA 4HPTE 4XS2A 2V7AA 5CLPA 3L1SA 1DI9A 3G5DA 4RZWA 2F7ZE 4F1MA 3R8PA 3KREA 4FKTA 4RJ4A 2ITQA 3NNXA 3GXLA 1PXOA 5IDNA 1P4FA 4NTSA 3QQGA 3CY3A 1UV5A 1PKGA 3P08A 4JNWA 5IZFA 1OKWA 5L8JA 3C9WA 3QUEA 5HOAA 2XZSA 1K3AA 2YM5A 3P78A 4USEA 4DGOA 5HBJA 3QQJA 5HD7A 4AW0A 3UZRA 3E63A 4GU9A 2OK1A 2OGVA 4UBAA 2XJ1A 4DH8A 4FTMA 3BKBA 4M68A 4I94A 4MWHA 3DGKA 3VBTA 4YU2A 4JG6A 1FVVA 3UG1A 5DMZA 3PZEA 4I4EA 4DN5A 1YXXA 2W1FA 1YHVA 3LMGA 3QRUA 4CFUA 4H05A 2V62A 2X4FA 5LXMA 4HCUA 4BBFA 4JVGA 5IEVA 4WNMA 3CKXA 5HEZA 1JSUA 3ZCLA 3PVWA 2QO9A 4E4LA 3W2OA 3NW7A 1G8AA 4UMRA 3RAHA 3FLWA 3FLSA 3O2MA 2R3LA 4JG7A 3TNHA 3EIDA 3DNEA 4MNEA 3R8VA 4AE9A 4EH4A 3VS5A 4AQCA 2ZM4A 4P4CA 4XG2A 3ALNA 3UZPA 4MVFA 1OBDA 3MH0A 5E8VA 4Y95A 3CD8A 3TV4A 3IONA 3SAYA 1OL1A 2C3JA 2ETRA 2ZDUA 3OWJA 4OTWA 1SVGA 5I3OA 5HE3A 4J98A 2W96B 4WBOA 3GQIA 3R2BA 5EM5A 3R7VA 3BE2A 5CSWA 1APME 2NRUA 2X7OA 3EOCA 4NZWB 5JFSA 1I09A 3TDVA 1PMUA 3BQRA 3NUUA 2QOHA 3K5VA 4FTTA 5EM6A 5BMSA 5IQHA 4YUQA 5I4NA 5LVLA 2BZJA 3KL8A 4DT9A 2J0IA 4F1OA 4YTHA 3D4QA 4LG4A 4YZDA 5A3XA 4H36A 3IW8A 5AJQA 3PWDA 2C69A 3SXFA 3UIXA 4EOQA 4I6QA 2PMNX 5TOZA 5IA2A 5CU2A 3HRBA 2FSLX 2PULA 4D1XA 4R78A 2GNLA 2HYYA 2PUIA 2VGOA 3SA0A 3ORPA 4Q5HA 5E8SA 2OFUA 2XKDA 2R2PA 4J1RA 4PDPA 1ZYDA 4HNIA 4AG8A 3QKKA 4W8EA 3LZBA 5HZNA 3EFJA 3VVHA 4XV9A 5BVEA 4FX3A 2XBAA 4I22A 1W7HA 4TPTA 4CMUA 1R78A 5BUJA 5AA8A 1PRYA 1JSTA 4KSPA 3DDPA 5HE2A 4WG3A 4E1ZA 5IMXA 3UIMA 5L8KA 4PTCA 4GL9A 3F2AA 3UPZA 3ORTA 4OR5A 5AAGA 4C4FA 5EDQA 3UIUA 2JBPA 3BLHA 5EYKA 3GC9A 3ORNA 4RWLA 4CZUA 4RIYB 3U6IA 3EMGA 4L6QA 2XNEA 2YCRA 5K4JA 1TQPA 3RNYA 4BCGA 2OJ9A 4R77A 4O7ZA 3QYWA 4LGDA 2XP2A 3SV0A 1KV2A 1STCE 2IN6A 2UV2A 1P2AA 1J7LA 2IVSA 4YHJA 4PPBA 2JFLA 4FZ7A 4O84A 4IM0A 4WG4A 4AGDA 4QP9A 2E9VA 1PXJA 4JIAA 4QP4A 2EXCX 2OLCA 3NYVA 4FT7A 4RSSA 3U87A 2REIA 3K3IA 3QA8A 4NW6A 4C4JA 2A0CX 2PE1A 5TF9A 4ZAUA 2O8YA 4QTEA 4NH1A 2YLFA 2UW3A 3PE1A 4HW7A 4DEBA 4YO4A 4BCMA 5CI6A 3VS1A 1FVRA 3S4QA 2E9OA 2H34A 4P7EA 4CQGA 3VBVA 1PXNA 2ZMCA 3KGAA 4NCTC 3ZEWA 5CEQA 3RPSA 2X2KA 1SNUA 1J1BA 4C2VA 4H1JA 5JZNA 3R02A 4DE4A 4X21A 5AM7A 3SG8A 4ZLZA 4YHFA 2IZTA 3QQUA 5JRQA 3V6RA 1PW2A 4HJOA 3QD2B 4NKAA 2R7BA 5HCXA 2WMXA 4CYJA 2V22A 5EM8A 1YKRA 4TYGA 3QX4A 4PMSA 4OT5A 4XMOA 3EFKA 2C5OA 3ZFXA 2BAQA 2JDVA 3MA6A 3QL8A 2OH4A 2QCSA 3ROYA 1GY3A 4GSBA 4DITA 5GNKA 3OUKA 5HVYA 3UP7A 4RIWA 3GC8A 3T3VA 3PJ3A 2FSTX 4BWKA 5L2WA 3ACJA 4XG3A 4ZZMA 2R3GA 5JT2A 2XUUA 5C01A 4BI2A 3R1YA 3RCDA 4BKYA 4F9BA 4FNXA 3V5WA 4DCAA 3EN9A 2WTIA 1O6LA 2XIKA 2JKMA 4IVAA 4TYHB 5ITAA 3G33A 3VUGA 3OW4A 4BY9E 3FLZA 4IC8A 5DPVA 4AT3A 3UZTA 3LQ5A 1VYZA 4QMVA 4OW8A 3VF9A 4BDGA 4CKJA 2XNMA 1FINA 4OTRA 4X2KA 2C68A 3O71A 1J3HA 2QHMA 2YJSA 3CY2A 4DYMA 4E4NA 5AAFA 2EVAA 3AG9A 5FDXA 4UN0C 2WU7A 4YNEA 2GPHA 3D5XA 1PXMA 1ZARA 3C4WA 3E5AA 1URCA 3HMNA 3MFTA 2X4ZA 3CPCA 1AQ1A 3M1SA 2QQ7A 3IG7A 3Q4TA 4IDTA 4C4IA 2X7GA 4DG3E 1ZXEA 4GK2A 2IZSA 4FTJA 4KS7A 1YRPA 3CKWA 3CQWA 3DCVA 3BYOA 3FXXA 4O6LA 4QQCA 3EN6A 5HORA 3MPTA 3QTRA 5HU3A 3U6HA 2WPAA 3GI3A 3MFSA 3ETAA 2CKQA 4L45A 5IPJA 1Q8WA 4EOKA 5FEQA 3A60A 1XQZA 2QG5A 3I7BA 4V01A 1F5QA 2BR1A 4UXQA 1LPUA 4WOVA 2C0IA 2YAAA 4KBKA 2JIIA 2X81A 2J0MB 1MRVA 3C0IA 2J2IB 3ORKA 5C27A 3S00A 4I93A 4GFMA 4IWOA 2ZJWA 4MXYA 3E8NA 1MQ4A 4LFIA 1PJKA 5K4IA 2YM7A 3FI4A 4FK3A 4D2SA 5JK3A 3R1SA 2J4ZA 3ZYAA 5M4IA 5CY3A 4ZS4A 2KTYA 2Q0NA 1W83A 2P4IA 4C8BA 3GGFA 2WQNA 5GZAA 1V1KA 4TL0A 4XOYA 1BKXA 5IA1A 1WVYA 2VTHA 4FTRA 4QMPA 4EK6A 5A6NA 3O96A 3U4UA 3Q9WA 4JLCA 2P55A 1OBGA 4O0TA 4Y73A 3QTWA 2WQOA 3HP2A 3NCZA 3O8UA 4BZDA 1K2PA 4C4GA 4FEVA 5EYMA 4BYJA 3R7OA 3VUHA 3FQHA 4YJUA 1WFCA 1M17A 3P4KA 4IWQA 3EYHA 5M09A 3CD3A 3BV2A 4XBUA 3ZM4A 3GOPA 2C1AA 4UMPA 2QONA 3O8PA 5EHYA 3UVRA 3Q2JA 4B8MA 2LAVA 3Q60A 5T68A 1YOMA 2QVSE 4QMSA 5BMMA 3QTUA 3QYZA 5H8BA 3MH2A 3LFNA 5DEYA 5A6OA 2W1IA 2R3QA 2HZNA 4D0XA 3K54A 3A7GA 3R8ZA 3LCDA 2C3IB 2OXYA 3PY1A 1GOLA 4EQUA 5I0BA 1J7IA 4PL4A 5AR4A 4B6LA 4C62A 4GK4A 4BBEA 2WMBA 1KWPA 4OTQA 3KXNA 1PXKA 4FICA 4YTCA 4C7TA 3I7CA 3VUDA 3TI1A 4AA4A 3GCVA 5DVRA 4B99A 1YWVA 1JWHA 1WCCA 4YZNA 4PNKA 3LLAA 1JVPP 3FYJX 1ND4A 4BIDA 4WT6A 5DH3A 3TDWA 2R3JA 3F5UA 2PTKA 4FZAB 4JXFA 3ID6C 2IVVA 2OJFE 4GW8A 4I3ZA 3IOPA 3CC6A 3OWKA 3R22A 4N4SA 3VIDA 5J9LA 1FQ1B 2RG6A 3ZUUA 4IM3A 1VYWA 5CAUA 4EUTA 4G5PA 4EH8A 2CCIA 4U5JA 2G01A 4IB0A 2F49A 2Z02A 3WILA 4ZLYA 1QCFA 2YZAA 4C2WA 4D2TA 3QRIA 4E6AA 1YWNA 2PZRA 1KOAA 3GNIB 3QBNA 2ITOA 5J87A 4C3FA 2WMUA 1H0WA 3OHTA 2ITUA 4O0WA 3ZO1A 2PE2A 3E3PA 3V04A 3ZLYA 3ZMMA 5C9CA 3C5IA 3G15A 5CTPA 3RPOA 2VTRA 4JBVA 1UU7A 4KINA 2QOBA 4JQ7A 5B0XA 4AZFA 2I40A 4WKQA 5M56A 3UNJA 1SMHA 2B4SB 3NPCA 2QKRA 3FC2A 3Q4CA 2VGPA 5L2QA 3UYTA 4C58A 3DAKA 5IDPA 1G8SA 4L00A 2EB2A 4Y83A 3R8MA 3SOAA 2A19B 3BLRA 4O1PA 1H1QA 2ZV7A 3GU7A 3HRFA 4EH9A 2YWPA 2BZHB 3LVPA 4ENYA 5L8LA 4YJPA 4EQMA 1KE6A 4IACA 4O0XA 3PY3A 4FTNA 3EH9A 3PSCA 4RIXB 3RM6A 4JJRA 3VHKA 3NUAA 4ZMEA 2FH9A 4XCUA 4XX9A 3TEIA 3TUDA 4ITJA 4R3RA 4BDJA 2YM6A 2HWPA 3MB7A 2LGCA 4EH5A 4IAKA 2RFEA 3POZA 5HU9A 2XKCA 2BAKA 2WGJA 3V8TA 3KF4A 1NA7A 1H08A 3RINA 2BCJA 5EI2A 4HCVA 5E8WA 3FHIA 5HLWA 3EL8A 4X3JA 5JQ5A 5KMKA 3PXQA 5I9XA 3R7YA 3QGYA 4ZTNA 4ASDA 3D5UA 2ERZE 3CE3A 2VNWA 3JXWA 3OG7A 4OTFA 3JR1A 3MIAA 4XG8A 4UY9A 2PZIA 2QG7A 3NVKI 3A99A 2J5FA 1QPCA 3BIZA 3UJGA 3UOLA 4NCTA 4AOJA 3TNPC 2RSVA 4FL1A 5KMOA 3F88A 4IM2A 4RJ7A 4H58A 3MVJA 4O83A 3NCGA 5C8MA 1BL7A 1ZOHA 4QMOA 5BVFA 4BL1A 1PMNA 2W17A 2WIHA 4EOPA 5JH6A 4QP8A 4MBLA 5LMAA 3BHHA 4E8AA 2GNJA 3A62A 3FY2A 3FV8A 4F4PA 5JSMA 4FG8A 3R1NA 2VTIA 1IAHA 4R8QA 4E93A 5C1QB 1SNXA 1XBCA 4RFZA 4M8TA 4U7ZA 3UOHA 4DT8A 2OICA 3LFEA 3UMWA 4BGQA 2UZBA 3RAIA 5KMIA 1PMEA 3JY9A 2E9UA 3MJ2A 3PZHA 3BLQA 3EQDA 4C0TA 5CAOA 4FI1A 2CLXA 4CD0A 4ZZOA 3GUBA 4OTIA 5GIOE 4FSRA 2VTJA 1Y57A 1Q97A 3O17A 5CSPA 1HCLA 2NPQA 2QOKA 2BFXA 4FKOA 4L8MA 4TYJA 5EG3A 3UOJA 3LQ3A 3E7OA 4TTHB 4EH6A 1JBPE 4X7QA 4DGGA 4BDKA 1ZRZA 2PUUA 3I5NA 4AA5A 3MYGA 3FAAA 5IISA 4XHKB 3TCPA 4I92A 4K1BA 3MVHA 1ZOGA 2BRMA 5E90A 2ETKA 4YLJA 4YPSA 4YGAA 5AUVA 1ZAOA 5EOLA 5I9YA 4ZY5A 1WVXA 3FZOA 5CEKA 1NW1A 3D7TA 4BVUA 3ATSA 4HZRA 2VWBA 2CDZA 2JDSA 3OT3A 4IBMA 4L52A 4NT4A 5C8NA 4XG4A 1BX6A 2KULA 4RG0A 3ZLSA 1XHAA 3DK7A 2OW3A 1XH9A 4YNOA 1S9JA 3ET7A 3G0FA 3OBGA 3SLSA 5EI6A 4ANOA 1Y8GA 3E92A 5M08A 3MB6A 3NR9A 1IA9A 3ALOA 5FP6A 3SRVB 2PVFA 3ZO4A 1MP8A 1LUFA 2HAKA 2XEYA 5ANJA 3PDTA 1H8FA 3IDBA 4KUJA 5BYLA 3VS7A 1KE7A 3F3UA 3HKOA 3KRWA 1OPKA 4FIHA 4DEAA 2UZDA 3ODYX 3MWUA 4L67A 2RGPA 1XJDA 5GHVA 3KMMA 2YCFA 4S34A 4BDAA 3WIGA 4O1OA 2WTDA 3E3BX 4AGUA 5CT0A 1F3MC 3NSZA 2FSMX 4O7TA 3GP0A 4O0YA 4FTCA 4JAIA 4DFLA 2BPMA 2CGWA 5FD2A 2YIXA 2JAVA 3GCQA 4AZEA 5M4CA 2OJJA 2RF9A 3CCNA 4F0IA 3C13A 3DFCB 1KV1A 4DTBA 5KHXA 5HD4A 4EKKA 3HMOA 5L2SA 1PKDA 4LV8A 4JRNA 3F3VA 3R63A 2BHHA 3E8EA 4GUBA 3BYVA 5T6KA 4E26A 5HG8A 1Q61A 4L9IA 1E1VA 2WEVA 2VWXA 4J95A 4JS8A 3VULA 3ZO3A 1U59A 4NIFA 4WO5A 2J90A 2G1TA 2BDJA 4PRJA 5HCZA 3FLYA 3ZBFA 4M0ZA 1WVWA 5IQBA 2IZRA 3UGCA 4AW5A 2JDRA 3DTWA 5ANIA 3QZHA 3ORXA 2QOIA 4EWQA 4M69A 3PVBA 3KC3A 4NJDA 4ZY4A 5HTBA 5IA3A 2UZOA 4IB3A 2PUNA 4P5ZA 4BI1A 2AYPA 2QU6A 4RVKA 2A27A 3BZ3A 3PPZA 3Q4UA 3SXSA 4NKSA 4Z3VA 2I0HA 2UW7A 3K2LA 4LGGA 2X2LA 4RGJA 3GBZA 5BX0A 3IW7A 5D11A 3RPVA 4U42A 2YACA 2WQMA 4IC7A 4QMZA 5IG1A 5L6PA 1Y6BA 2YM4A 5F95A 3I0OA 5HIDA 1MRUA 1Q62A 4PP7A 2YAKA 4QNAA 5CQUA 3UDBA 2C5YA 3KB7A 3F82A 4BCHA 3CGOA 3NNVA 4FTIA 1AD5A 3OEFX 5L4QA 3DKCA 3SD0A 1URWA 4RJ8A 4GKHA 2UW6A 3U4WA 4FSTA 4YO6A 1TKIA 3F3ZA 3KMUA 3PA5A 3I6WA 3ZFMA 2XJ0A 5KBQA 1H00A 1OPLA 4YJRA 3KVXA 5EW9A 4MTAA 1U4DA 3TUCA 3ERKA 4E6CA 2YWVA 2C6OA 2OWBA 3H9FA 4FL2A 5EFQA 4U80A 5CX9A 4YTIA 4NM7A 5M07A 3AC1A 2PZ5A 4E5AX 4ZMFA 1JAMA 3BCEA 3VS2A 2PK9A 4O96A 3IQ7A 4RVLA 1Q8TA 4OTGA 3N4VA 3FZTA 3SKCA 2CN5A 4F08A 4Y85A 5D1JA 1T46A 3MJ1A 3WZEA 4KBCA 5GZ9A 1LR4A 2DWBA 3AD5A 4ZTSA 1XH5A 2O63A 3N9XA 1NVRA 1CM8A 3CGFA 3IO7A 3LPBA 3ZFYA 4NSTA 5C26A 1OKVA 3VJOA 4KIKA 2PL0A 3RKBA 3DKGA 4QP1A 3N51A 3QQKA 5BYYA 5E1SA 2A1AB 4D5KA 5CAPA 2Q83A 3W2SA 1QPJA 4W9WA 4HOKA 4R5SA 2J0KA 1HCKA 3R83A 4A07A 3C4CA 3D94A 2ONLC 2OFVA 3NW6A 2ITXA 1U46A 3IDPA 3PIYA 2X9EA 5FQDC 1FVTA 2RG5A 3NVMB 2JITA 3HNGA 2WMAA 2WU6A 3D5VA 5ANOA 5D7AA 5EHOA 4CTBA 3OTVA 1WBNA 3NNUA 4R3PA 2JKQA 5J9ZA 4NFNA 3BELA 4RC2A 4PF4A 5HCYA 4BDFA 4BN1A 5JMSA 1DS5A 4YJQA 3GC7A 5LARA 3I81A 4YHTA 4C35A 5FTGA 4KIPA 4KSQA 4O7VA 2O5KA 3TZ7A 4X3FC 3W55A 5F4NA 4CFXA 3FXWA 3E8DA 2OF4A 1SVEA 5KNJA 4RIWB 4GVJA 1JLUE 5CU6A 4FKPA 1G3NA 4IW0A 3ZLXA 4CCBA 3PY0A 4CVAA 4YC6A 3NUXA 4LM5A 1YI4A 2VWYA 4QMWA 3HUBA 3TV7A 1UU8A 3PUPA 4ORKA 2Z7QA 4F7LA 4O2ZA 4NFMA 4FIGA 3BPRA 4G17A 3TXOA 5AUUA 1CSNA 1XH4A 3NUYA 2G15A 4G6OA 3FY0A 4XNEA 2XNPA 4WNKA 4HYHA 2ZDTA 3NUPA 5FLFA 2AC3A 3Q52A 4M13A 1OIYA 2YIYA 2C3LA 3TV6A 3PA3A 4FA2A 2PVJA 2YA9A 3KQ7A 4AXAA 4M3QA 3OXTA 4NUSA 2UZEA 2UZNA 5D7VA 3EN5A 2GNGA 3HDMA 3OD6X 2GQGA 2V55A 3QWJA 2HZ0A 4GIIA 4P2KA 4I5HA 2E2BA 3FMLA 2UZTA 4GYGA 3FL5A 3UOKA 5L2IA 3I4BA 3C4ZA 4ZOGA 5DR2A 3TIYA 5CAQA 1M7QA 3LKMA 2B9FA 3FHRA 3OCSA 4I0TA 1UKIA 1VJYA 3EQCA 3T3UA 4C4EA 5B2KA 4CFVA 4N0SA 2YERA 4FUYA 4FYOA 5IU2A 4ONAA 2QHNA 2Y6MA 5KHWA 4K9YA 3DKOA 2CKOA 2XCKA 4NJ3A 1J7UA 2BILB 4FKVA 4YJOA 3OW3A 4F7SA 1H01A 1OIRA 2W05A 4DA5A 2W99B 1YQJA 3AGLA 4JIKA 1R3CA 5H8GA 4XLIA 3W33A 4QMQA 5TR6A 4ZTLA 3ZO2A 2GFSA 4X2GA 3ZLWA 3R7EA 4O38A 4FC0A 4F9AA 2GMXA 1H4LA 4RC4A 4U9AA 3UQGA 1FGIA 3AT4A 5DIAA 3OY1A 3TIZA 4USFA 2HZIA 4YSJA 3HDNA 3I60A 4YZBA 2WZJA 4CG9A 2HOGA 2OBJA 5D41A 2XYUA 3CP9A 1L8TA 4RRVA 2R3HA 4L44A 3NUNA 4OTHA 4QTAA 1XBBA 1W98A 5A4QA 3KXMA 5ACBC 4D28A 4DEGA 1XO2B 5EK7A 1W84A 4FGBA 4J7BA 1A06A 2R3PA 4FOCA 4PMPA 2R3FA 4NW5A 5E8UA 1CKPA 4W9XA 3QZFA 3FJQE 3FMNA 3M2WA 1OPJA 4RQKA 3KMWA 3E87A 3EN7A 4XP2A 1A9UA 4IMYA 4MD9E 3FC1X 2B9JA 5DN3A 1M2PA 4PQNA 4D55A 3HZTA 5EOBA 3S3IA 3AC5A 2BVAA 4FV6A 4AP7A 2XRWA 3QC9A 4XEYA 2WOUA 5ETFA 3A8XA 3IW4A 4RVTA 4E5WA 3RAKA 3RK7A 4HCTA 3OF0A 2PMLX 3R9HA 4K2RA 3C5UA 4EK3A 4IAFA 4WIHA 2RKUA 3EWHA 4YTFA 3QX2A 5IQFA 5DA3A 3VQHA 5GZ8A 2Y9QA 3OP5A 2W9FB 2CKEA 1Y8YA 2Z7LA 3ZBXA 3JVRA 1XR1A 1Z9XA 4FF8A 4G9RA 4JBQA 3PYYA 5E8YA 2WQBA 3NZ0A 3V8WA 3U51A 4D2WA 3R9NA 5JFWA 4FTUA 5AX3A 5BVNA 4GG5A 3MVLA 3NYOA 2WXVA 2Y7JA 1J1CA 3UMXA 1NT2A 3QA0A 4RA5A 3QKLA 4W8DA 4MYGA 3PE2A 5J95A 3TWJA 3F7ZA 2VTNA 3LFQA 4QP3A 1U54A 4DFYA 3FMEA 3H0YA 2OSCA 5AR3A 1B39A 3QU0A 4OUCA 4R1YA 3GVUA 2JDOA 4G3EA 4HGLA 5FTOA 3VF8A 3VO3A 4P90A 5M57A 4RX7A 3EL7A 2OZAA 5IH5A 5M4UA 4HZSA 1ZWSA 4QMUA 4TWNA 5AV1A 3SX9A 3C1XA 3S1HA 5I9ZA 4FEUA 4K77A 4TY1A 4CSVA 5HVKA 1BLXA 3DB6A 4RWJA 4XG7A 3QTXA 4NM0A 4QTCA 5FDPA 4KKGA 4L7SA 2QOQA 4YSMA 3AOXA 2EWAA 2PU8A 3W8QA 3F69A 4G3DA 4DEHA 3WF7A 4L46A 2Z7RA 5EQPA 4APPA 2OXDA 4DGNA 2PHKA 4RWIA 5HO7A 5JGDA 1GIIA 4UZHA 2NRYA 4NWMA 4G3GA 2R3IA 5KBRA 2YCSA 2YFXA 3FWQA 2DQ7X 4I6BA 3QLGA 3II5A 3RZFA 3IDCA 3MPAA 3TKIA 1RW8A 2WNTA 5LOHA 1GZNA 3N4TA 2WKMA 4E5BA 4QTDA 5FEEA 2XM8A 2QOCA 5AUZA 5KZ0A 3BGZA 4RVMA 3BBWA 3VNTA 3AQVA 3DY7A 4GRBA 4MNFA 3OOMA 4LRJA 1PF8A 4KWPA 5IQGA 4GMYA 4UWBA 4CTCA 3OT8A 3I0QA 3JPVA 4FZ6A 3TKUA 4DCEA 5AFVA 3FUPA 2SRCA 5FXSA 2XJ2A 1DAWA 3QHRA 3BRBA 4ZIMA 2ONLA 3DFAA 5HNGA 4XRJA 4A7CA 4AGWA 4B4LA 4DFXE 4NK9A 4CRLA 5J7BA 3F5GA 4GV1A 4BC6A 5EDRA 2Y8OA 3L8XA 3PIXA 3D9VA 2RFNA 5AR5A 4HVDA 2IG7A 4A9TA 4BHZA 2CGVA 3PFQA 4ZTRA 4BBMA 5DT4A 4BRXA 4BDIA 2QODA 3KXHA 5K3YA 3OEZA 4TNBA 2V7OA 2W7XA 4X6RA 3RMFA 1UU3A 4R1VA 4Z9LA 2JDTA 3DBFA 3OBJA 5EW3A 2O2UA 3DBCA 3THBA 4X3FA 3MV5A 2IW9A 3VRZA 2HELA 4D4SA 4EBWA 3MFUA 4W4VA 5CXHA 1GIHA 2X0GA 4EHZA 2NNWB 4ASZA 4FSYA 4C3RA 4XG6A 3ZSHA 4Q2AA 2ZAZA 3ULIA 4FVQA 3F5XA 2BFYA 3QQFA 2DS1A 4IHPA 3HP5A 3Q5IA 3I6UA 2OU7A 5C4LA 4RJ3A 3BWJA 1K9AA 5J5TA 4MXCA 4R3CA 1JKTA 2UUEA 4JDKA 3COMA 4C59A 3DBEA 3HVCA 4XP0A 3NUSA 4CFWA 3OC1A 3TN8A 1Q24A 4L3JA 4D9TA 4FE2A 2VTSA 3D2IA 3D5WA 3ORIA 2RIOA 1UA2A 2XCHA 4FTKA 5AIRA 4ANLA 5DFPA 4DG0E 4F9YA 1Z57A 2QKWB 5FEDA 3TJDA 2PVYA 4BCOA 2O64A 2ZMDA 3DBDA 4ID7A 2OH0E 3HA6A 3LXNA 5BVDA 4PL3A 4BTJA 5CEPA 3VBYA 5K0KA 4UMQA 3EQRA 4ZSGA 4F6UA 1P4OA 2VO7A 3T9TA 3AC8A 2WQEA 1M2RA 2WIPA 4Y46A 3W8LA 2FYSA 4FV1A 3LXLA 5JFVA 4DAWA 1DI8A 2OF2A 2WMQA 3GU8A 4KIOA 1SYKA 4FSQA 4BDCA 3ATTA 4FTAA 4CFMA 3KRJA 4FOBA 4QT1A 3TNQB 1YHSA 3PXYA 2EUFB 1UNLA 2YN8A 5J79A 4FV9A 3KXZA 1ZY4A 5AUXA 4QMMA 5HE0A 4B9DA 5C8KA 3D7ZA 4MQ2A 4RMZA 4C33A 2R64A 4EZ5A 4GCJA 3CTJA 4V05A 3G9LX 5BVWA 4Y72A 5LMKC 4UYAA 4YZCA 2HENA 4UWCA 3WOWA 3U54A 3COIA 5H9BA 5LVMA 1O6KA 2QO2A 5AR2A 1BUHA 2Y6OA 2BIKB 3K3JA 3WI6A 4QOXA 1CKIA 2VTOA 3A4PA 1H28A 3PJCA 4IX4A 4U81A 2F4JA 4MXAA 2O0UA 4PTGA 2W0JA 4F70A 3KCFA 3C51A 4EHGA 4P5QA 5GJDA 5LJJA 2CMWA 2QR7A 2WHBA 4W4WA 2JKKA 1RQQA 2AC5A 4RIOA 3WYYA 4HYIA 4IXPA 4IB1A 4NIFB 2VRXA 3VUKA 5CF5A 4BKJA 3OS3A 5CZIA 5H2UA 1WBTA 5TT7A 3AMYA 4O7WA 1M2QA 2JKOA 2ZVAA 5CF8A 3DLSA 4FKLA 3LIJA 3E8CA 4TWCA 3R30A 4MK0A 4N6ZA 4YR8A 4F7NA 3UIBA 3UNZA 3VN9A 2HW6A 2QOLA 1KOBA 1H1RA 3FMJA 3I5ZA 3VWAA 4BI0A 3ZRKA 4FR4A 1J91A 1TQMA 3FMHA 4L01A 3EKNA 4MEDA 2ZV2A 4EK5A 3E7VA 2W1DA 2ZOQA 2ZB1A 3RK5A 5HX6A 4WUNA 2O65A 3Q6UA 3LCOA 4U97A 4YZMA 3SDJA 2EXEA 4GJ3A 3SW7A 1O9UA 2XVDA 1HOWA 4U79A 2HWOA 4F09A 2I6LA 4FODA 3FLNC 3AXWA 4AOTA 4C57A 2YDIA 3D0EA 4PL5A 3GT8A 1GZ8A 4RWKA 4S2ZA 4USDA 4B8LA 4EK8A 3FE3A
chains in the Genus database with same CATH superfamily
5A4LA 5KMNA 3C50A 3EFWA 2C6LA 4JBOA 1XBAA 3PVUA 4N70A 5A4TA 5E4HA 2C5NA 4MBIA 3ZONA 1OL6A 4J71A 4G9CA 3TUBA 3WF5A 4RIYA 3VS0A 2WMRA 3WZDA 3P7AA 2QLQA 5HTIA 4C37A 5EI8A 3DQWA 4TZRA 1YDSE 2HY81 2I0VA 4RLLA 5CXZA 4KA3A 4QP2A 1Q99A 4FEXA 3COHA 4RFMA 3POOA 4JDIA 4IAZA 5EYCA 4BTFA 4KIKB 3MESA 4KAOA 2XNGA 2ITVA 5C03A 4EOIA 1YWRA 4AS0A 3TZMA 4I6HA 3QRKA 3OOGA 3L9NA 2A98A 3F3TA 4X2FA 4CV8A 4FG7A 4QQ5A 2H8HA 3V6SA 1CTPE 1OIUA 4IJ9A 4A4LA 2C0TA 3KK9A 5EM7A 5FTQA 4J8NA 5KUPA 4LOOA 4C3PA 3QCQA 2UVXA 3QC4A 5HTCA 3CLYA 5HKMA 2VTAA 5EW8A 2C6IA 2XIXA 2YHVA 4AW2A 3TNIA 4PTEA 3BHTA 5IUHA 3F2NA 4FSZA 3F6XA 3CEKA 3OCBA 4R5YA 3GU5A 3R21A 4CNHA 3C4FA 4X0MA 4A9SA 3IS5A 4DC2A 3RJCA 2JEDA 3EQHA 4L43A 2YABA 5AIKA 4X2NA 3O7LD 4FZDB 3RBWA 3QZGA 2HZ4A 1YDRE 3RVGA 1PXIA 4CRSA 4XUFA 4EC9A 2XB7A 3DXPA 4YBKA 2RFSA 1JKSA 1Q3DA 4AXCA 3PFYA 1IEPA 1H1SA 3DNDA 4WSQA 2Z60A 2G2IA 3GC0A 3KULB 3P7CA 3P5JC 5ETAA 3VJNA 4OTDA 2OO8X 2WTJA 2QD9A 3UO4A 4FTOA 5AV0A 4CLIA 3NIEA 3EHAA 3FKNA 4E20A 4TYHA 4AWIA 2B53A 4YC8A 5CU3A 4BHNA 3AC4A 1FBNA 3U9NA 2J6MA 3LOKA 1E9HA 2EB3A 1EH4A 4FNZA 2Q0BA 3R00A 2HW7A 3PWYA 3UVQA 3KIOC 4V0GA 2PVRA 5ANKA 5CT7A 3RTPA 4FKJA 3PRFA 4HYSA 3OCGA 4M84A 3UE4A 4I6LA 4A06A 3Q5ZA 4ALWA 2IW6A 2CHLA 4JR3A 3V5LA 4LYNA 4ZP5A 5HGIA 5HE1A 3Q9YA 3JYAA 3LMHA 3BWFA 3FI2A 3PTGA 3ROCA 4BCJA 3LFSA 2UW4A 3M42A 2XNNA 4F78A 3LCTA 4ACHA 4FIEA 1NVSA 2EU9A 1T45A 2UVZA 3R0TA 4FV4A 4RFYA 5DWRA 1ZMUA 4ZK5A 2C1BA 5AAEA 5CVHA 4ASXA 4BGHA 2W1HA 2WEIA 3EQPA 4BCKA 1YOJA 4AN2A 2GNIA 2WTKC 3Q4ZA 4I5CA 2ZV8A 3KU2A 3UO6A 4EZ7A 3G9NA 4K0YA 3LHJA 3RALA 5DOSA 1V0OA 1CDKA 2C0OA 5IA4A 2VTTA 5DT3A 4Z7GA 5CSHA 3CBLA 5AM6A 3TG1A 4FT3A 4WHZA 3HV5A 4N57A 5J8IA 3BI6A 3QCYA 3PJ2A 4M97A 4BCPA 4EC8A 3EQIA 3C0GA 4L3PA 4MD8E 5HBEA 2NO3A 4GFOA 4IIRA 4FIJA 4PMTA 3BYSA 4MNEB 1LEWA 2W1ZA 3QQHA 3ZS5A 3DDQA 3R73A 2RL5A 3F9NA 4LV5A 4R7HA 5AMNA 1R0PA 1WMKA 3EB0A 3KA0A 3ZXZA 2CNVA 4F0GA 4HVHA 4F99A 1XH7A 4D5HA 2J0LA 4QYYA 3R01A 4R7IA 2OJGA 2FA2A 3U8WA 2GHMA 4AAYA 2UZLA 5BYZA 4EYJA 5LMKA 3LW0A 4U43A 5KX8A 3ZZWA 2QLUA 2YDJA 4MXOA 4TRLA 4UWYA 3FPQA 3WF8A 5FXQA 2BIYA 1Q41A 5FUTA 2JFMA 1WBVA 3JVSA 4I23A 4J53A 5CQWA 5CF6A 2BAJA 3FXZA 2GQRA 3DXQA 4G6LA 4PDOA 4AGCA 3KRRA 4I5PA 4X2JA 5H3QA 4GFGA 4I41A 1OL5A 4E73A 2X2MA 2QI8A 2VTQA 1OUYA 3GOKA 3DQXA 2VO6A 3GFEA 3V01A 1OL2A 3WF9A 5AP6A 2O3PA 2VO3A 3BV3A 4G5JA 4F6SA 2GS2A 1Q8YA 4D4RA 4DEIA 5F94A 2PMIA 3DAJA 3LJ1A 3DB8A 2PSQA 2ZM3A 4O27B 4DHJA 4CMTA 2VV9A 1UWHA 5CALA 4U45A 5DG5A 2YIWA 4ZSJA 2F57A 3MW1A 4TT7A 3VBQA 4O0SA 4O7NA 5IMEA 3P9JA 2HXLA 2Z2WA 5AUWA 4IEBA 1QL6A 3QD3A 2VZ6A 1OZ1A 3PXRA 4YJVA 5FGKA 4EH2A 1U54B 3FYKX 5AP2A 1PXPA 2P3GX 3FZSA 3BL9A 4U0IA 2XA4A 4RT7A 4S31A 3VS3A 4R7BA 5DRBA 3TM0A 2ITNA 2PVKA 3D14A 3P0MA 2R0UA 5CYIA 2HCKA 1QPDA 2OZAB 2VO0A 4AT5A 1PMVA 3U55A 4L42A 3OTUA 2BMCA 3CXWA 5K5NA 1GNGA 3VHEA 4KIQA 3ZSIA 5LQFA 4WRSA 2VAGA 5BNJA 4FIFA 3OMVA 3FEGA 4DF3A 3SC1A 5IQAA 1CKJA 2B1PA 2G9XA 4IX3A 5CWZA 4HVSA 1WZYA 3PJ8A 3PIZA 2PPQA 4H3QA 4I1ZA 3NDMA 2W4KA 4XG9A 1GZOA 1Q5KA 1YXUA 2JLDA 4MX9A 2OIQA 4QMYA 3K5UA 4CCUA 5DR6A 4ZTMA 3QFVA 2VX1A 1R39A 4D0WA 2QR8A 3MY1A 1A48A 2OI4X 5E1EA 4RIXA 3UC3A 4GKIA 2YISA 3JY0A 5L6OA 5B7VA 3NRMA 3QAME 3FZ1A 4JBPA 4EQCA 3I79A 5DRDA 3REPA 1IG1A 4YP8A 5KKRC 4F6WA 1VEBA 1IR3A 4GUEA 3V5TA 3KN5A 2J9MA 3FZRA 3Q6WA 5EHLA 4GVAA 1JSVA 3DOGA 3RAWA 3HL7A 1YW2A 4BFMA 3ACKA 3C4XA 3RCJA 2WMSA 2B52A 4O81A 4EJNA 4AFEA 3ZUVA 2B0QA 4ENXA 4IANA 3L9MA 4BCFA 2Y4IC 3G2FA 3R8LA 4AN9A 5AR7A 5CU4A 3NAYA 3RHXA 5AEPA 4DH5A 3MA3A 1W82A 1Y6AA 5E8TA 4NM3A 3SXRA 2PWLA 3V3VA 4AZWA 1H1PA 4EL9A 4IE9A 5AUTA 5BUIA 3IECA 5AP1A 3BU6A 3O51A 4H3BA 3TJCA 2ITZA 3GEQA 4WD5A 5HHWA 3I1AA 4B0GA 5J5SA 5TO8A 3TKHA 3NYNA 1REKA 3COKA 4RJ6A 2UW8A 2B9HA 2GNFA 2XBJA 1TFFA 5BQ0A 1PY5A 4ACMA 3W2CA 2R5TA 4IVDA 4IZ7A 3KK8A 4IAIA 3A7IA 2PY3A 3FI8A 1IASA 4FK6A 1UWJA 3GU4A 2R3MA 3ITZA 4X3FB 3UQFA 4RBLA 5AA9A 3QTQA 1UNGA 2XNOA 4DFNA 2BRNA 2JC6A 3MTFA 4AZVA 3DZOA 4K6ZA 4CT1A 2DUVA 1BI7A 3BGQA 4IDVA 3SW4A 4JX3A 2VX0A 3FKOA 3RI1A 3NW5A 5FRIA 4A4OA 1B38A 4OGRA 4YJSA 4CYIA 2VWUA 4PDSA 3TZ9A 3ZU7A 1ZLTA 3FSKA 1UVRA 5CAVA 3E93A 4EEVA 5A54A 3B8RA 1S9IA 5DEWA 1UU9A 3D15A 3WBLA 2XAMA 2XARA 4QPMA 4FUXA 4NEUA 3MFRA 5HLPA 4ANMA 3QZIA 5A9UA 4XJ0A 4W4YA 3BYMA 1FPUA 4D58A 2A2AA 3HV4A 1OB3A 2BDFA 3A7HA 4BDDA 4D2VA 4IADA 5IEYA 2GDOA 3BU3A 4I20A 4F9CA 3UQCA 2C4GA 4CXAA 3BE9A 4MKCA 3VS6A 3MIYA 2QOOA 2I7QA 5FWKK 3N4UA 3QQLA 3WF6A 4MF1A 1ZMVA 2ITWA 2QU5A 2F9GA 2FGIA 5GJFA 3PXFA 2BDWA 3KN6A 4ZTQA 2WFYA 4EHEA 4KKHA 4G1WA 4DBNA 5GINE 3PRIA 4FT9A 3NWWA 4IVBA 4XH6A 5LVOA 3BHVA 3H9OA 4KNBA 3B2WA 3C0HA 4JRVA 4RQVA 3IK3A 5EH0A 3SRVA 3R7UA 4N6YA 3HMMA 5HVJA 5HLNA 1OIQA 4LOQA 3RPYA 5K9IA 3EKKA 1GIJA 2CKPA 4QDEA 3OXZA 4FNYA 5HICA 2B9IA 4RJ5A 2OIDA 2JBOA 3QRJA 4AE6A 4F0FA 5IF1A 3CTHA 4YC3A 3A2CA 4CT2A 4RX9A 4UEUA 1AGWA 3VQUA 5F9EA 4PPAA 3HMPA 4U40A 4FVPA 4WNOA 5A4CA 5TE0A 4FNWA 4JQ8A 4KRCA 4ZY6A 4JI9A 3NAXA 4WG5A 2YITA 4ERKA 5K0XA 4IX5A 2IEWA 4AN3A 2XIZA 3Q96A 5L2TA 2GQSA 2XALA 3GCPA 3DBQA 5CEIA 5JGBA 4Q9ZA 3B2TA 3UBDA 2HIWA 3CPBA 3DS6A 3AD4A 4K11A 4LRKA 2OJIA 3WARA 3QXOA 4BWPA 4FT5A 2X1NA 1GZKA 2P2IA 4MH7A 4XBRA 4CG8A 4D4VA 5EKNA 3H9RA 3NFFB 4CQEA 2PVHA 1DAYA 4DLJA 4B7TA 4D2PA 3A7JA 4BTKA 4IVCA 5CNNA 5I9WA 4RLKA 3P23A 3L8SA 2J51A 1LP4A 3W2PA 1WBOA 4FMQA 3TTIA 4ACCA 1OKZA 2NP8A 5CS6A 4DTAA 3MVMA 1OKYA 4C4HA 3D2KA 2WTCA 4AOIA 1F0QA 1MUOA 3OZ6A 2V0DA 4NU1A 4O4EA 2R7IA 4AA0A 4EOMA 3B8QA 4OBPA 4U8ZA 2QO7A 3NYXA 1XKKA 4Q9SA 3MH1A 3VS4A 1YVJA 4QQTA 4H39A 4J97A 3MDYA 4MCVA 4DINA 5LVNA 2UW5A 3IW6A 2WMVA 3OXIA 3RGFA 2OXXA 4OAVB 4V04A 3P1AA 2UW0A 5EKOA 2E9NA 2XEZA 5J1WA 2ETMA 2XK9A 3HRCA 3H3CA 5EYDA 2YLEA 3KEXA 2AUHA 4GT4A 4QO9A 1L3RE 3L8VA 4O91A 2I1MA 5HNIX 4MUQA 3PJ1A 4WNPA 4ZLOA 3HYHA 3V51A 4AXFA 2GU8A 3DPKA 3RWQA 4E7WA 4FTLA 3ZC6A 4LOPA 1FMKA 2OIBA 3DK3A 4L7FA 3R28A 4LL0A 5AR8A 3R7GA 5KCVA 1MRYA 1WAKA 2C5VA 2G2FA 2YEXA 3U9CA 5LWNA 3PG1A 3R2YA 3G51A 4FKIA 4GS6A 2GSFA 5IKWA 2OZOA 1Y91A 4IAYA 3HV7A 4OT6A 4A9UA 4BDBA 4FEWA 5EDPA 3QD0A 5JFXA 3NNWA 2PVMA 1PYEA 3LCSA 4RX8A 4FV7A 3MBLA 4WBBB 3NMUF 5DR9A 3V8SA 3R9RA 5JZJA 4AU8A 3PLAE 3E64A 2R3RA 2NYAA 2CJMA 5CSVA 4QP7A 4Z55A 5HIBA 5T3QA 3F61A 4IZYA 1YI3A 2R3NA 4J96A 4RC3A 4S33A 5L6WL 3RK9A 4AAAA 3CSVA 2X9FA 4CGAA 4NM5A 3AT2A 3HV3A 4NTTA 4HVGA 4O7LA 3ODZX 3GENA 1OI9A 4ZEGA 4H3PA 5IQIA 1W8CA 3Q53A 3WE8A 1P5EA 2F2UA 4TYEA 3P5KA 2XK7A 4II5A 2CN8A 4DHFA 1YHWA 3CQUA 5DYJA 2CLQA 2IVUA 3JUHA 4U6RA 1R0EA 4XV1A 3W2QA 5D9HA 4PUZA 2H96A 1H0VA 3R1QA 5KZIA 5A46A 4FVRA 3MGYA 4L3LA 5AP7A 3ZTXA 4E6DA 3HA8A 5FM3A 4AX8A 5M06A 4JMQA 3DXNA 2Z7SA 4FKWA 5I3RA 2PVNA 4IH8A 4WSYA 5JN2A 4OBQA 3AD6A 3NS9A 5ANDA 2YM8A 4U41A 4ZTHA 5IEXA 1V0BA 3TT0A 2B55A 4LL5A 4K8AA 3SVVA 3PP1A 5E9EA 2X39A 2JIVA 5BVKA 4AZTA 3O0GA 1E1XA 3ZC5A 3E62A 4BGGA 5CEOA 2CGXA 5AV3A 3R6XA 3FDNA 4ZSLA 5HBHA 4MAOA 2H9VA 3ENMA 3MS9A 1ZZLA 1XMLA 3KF7A 4AQKA 2J7TA 1ZMWA 4DTKA 4O82A 1U5QA 2GCDA 1SM2A 4FSUA 4GT3A 4O6EA 5G6VA 4YLKA 3UP2A 5M53A 4M67A 3MN3A 3HAVA 2X8DA 1ZYLA 3EFLA 3HUCA 4PPCA 4ANNA 2PE0A 4TWPA 2VNYA 5LWMA 2OKRA 5IQDA 2I0YA 3JS2A 3OROA 4FKQA 4G16A 4I5MA 4BYIA 4BF2A 3LFAA 5ETCA 2W5HA 2QC6A 5CEMA 4OLIA 4HGTA 3ZEPA 1IAJA 4DGLC 3R04A 4G34A 3QHWA 3G0EA 3U6JA 3PPKA 3Q9ZA 1ERKA 3EZVA 1B6CB 4QNYA 1BI8A 2UVYA 3RWPA 2XIYA 3CS9A 4F63A 2IW8A 4CKRA 3HX4A 3Q04A 3Q2MA 2GS7A 1M14A 4V0GB 4E4MA 1ZYSA 2ZYBA 3A4OX 4MF0A 5AP3A 3SGCA 3H30A 5M44A 3LM0A 2X8IA 4C34A 3D7TB 3FMMA 3O8TA 3EYGA 3PP0A 3GCSA 5IQEA 2UZWE 4IAAA 5B2MA 3PSBA 4DFUA 4TWOA 3UVPA 3SQQA 2R3KA 2BTSA 3W0NA 2V5QA 3DZQA 5DT0A 2WAJA 1IRKA 4QYEA 4FKSA 1TVOA 2XF0A 3H4JA 4KB8A 3IOKA 3HECA 1JPAA 3P79A 2XM9A 4O0RA 2GFCA 1KE5A 4M0YA 4UB7A 3OFMA 4GH2A 2GS6A 5FG8A 5JRSA 1YXSA 2X6EA 4BZOA 5CU0A 5J1VA 4FSMA 4QMXA 1NVQA 4FIIA 5AWMA 4C38A 5GJGA 4XOZA 4DH1A 3QCXA 5FXRA 1P14A 3CR0A 4WA9A 3RP9A 3RHKA 1G5SA 3LE6A 1PXLA 2BRHA 1X8BA 3LFFA 3KXGA 2J0JA 4QYHA 1NY3A 3F66A 1GAGA 4S30A 3R71A 2GHGA 4I0SA 3WE4A 3LJ0A 3DJ6A 4LQMA 3EZRA 2C30A 4I6FA 4J99A 4O0UA 5ANGA 4NYEA 4RZVA 3CTQA 4ANBA 4EKLA 4ERWA 2ITPA 2FO0A 3ZOSA 3ORZA 3FQSA 2IJMA 4M66A 2C3KA 2X0OA 3KVWA 2C6KA 2CPKE 3QKMA 3DA6A 3UC4A 3PG3A 4FBXA 4FG9A 1W0XC 1SZMA 3KFAA 3OY3A 2IVTA 3W10A 4F65A 3GQLA 3RZBA 1REJA 3M11A 3UO5A 4CKIA 4ARKA 3ZDUA 5AV2A 3BX5A 4EH3A 4C36A 3LFCA 4BKZA 4XYFA 1JNKA 4M69B 4PNIA 4GJ2A 2W4OA 2R4BA 5CVFA 3AC3A 2CNQA 3NLBA 1OGUA 3TTJA 3QTSA 3L8PA 5ETIA 3Q9XA 4IWPA 5CNOA 2F7EE 2QNJA 3WZUA 2XH5A 3FMKA 4YLLA 2C6MA 1RJBA 4E3CA 4M12A 2XMYA 4QMTA 4JDJA 1PHKA 3DKFA 1YXVA 2Y4PA 2YIQA 4QYGA 4Y8DA 3ZHPC 5B2LA 5M55A 5EQYA 4O2PA 3NX8A 4EHVA 3G6GA 4EWHA 3UODA 3SG9A 4LGHA 1VR2A 3H0ZA 4APCA 2H6DA 3A61A 3PLSA 3SOCA 5JQ8A 3G6HA 5E8ZA 5HO8A 1U5RA 5HESA 3ZM9A 4FKRA 5CZHA 2VTPA 4PV0A 2ITTA 2OG8A 1SVHA 3V5PA 3CIKA 3PSDA 1GJOA 2ACXA 2UZUE 4Z16A 2Y0AA 3HLLA 3ULZA 1QMZA 3BU5A 3ORLA 3WIKA 4ZSAA 4KD1A 3RPRA 2PUPA 3EJ1A 4OBOA 2R0IA 4GG7A 1KE9A 4DH3A 4G6NA 2VX3A 5ICPA 5A4EA 3ANQA 5DHJA 3BYUA 2CNUA 5DBXA 2HXQA 5CSXA 1Q8UA 4F7JA 4ZZNA 3MPMA 4W4XA 2UW9A 4ITIA 4JL9A 4FV0A 4J52A 5KMMA 4IB5A 3MY5A 1YDTE 4GEOA 1OUKA 5DGZA 4EOLA 4EYMA 5BUEA 4O21A 5LMBA 1I44A 2E9PA 1WBPA 4J8MA 3S95A 3F3WA 4PMMA 4UMUA 3FSFA 1Z5MA 5HNBA 4PP9A 4ANQA 1OGYA 4ALVA 1ZY5A 3MY0A 3UYSA 4FKGA 4Z7HA 3LXPA 3ZRLA 2F2CB 4FEQA 4Y5HA 4ASEA 3C4EA 3DLZA 4Q5EA 5HG7A 1V0PA 4FSWA 4I24A 4LI5A 3BBTB 5BPYA 2PYWA 1ATPE 3NGAA 3QLFA 4O86A 3QTZA 5ANEA 2FVDA 4EBVA 5IQCA 1ZOEA 1JKKA 3IPHA 4WRGA 4DFBA 2IO6A 1M52A 1DM2A 4K33A 3FQEA 4TXCA 2P0CA 4R6VA 3O50A 4AF3A 3HMIA 4BTMA 2IZUA 5H8EA 3R8UA 4GU6A 4O22A 5LVPA 5EQEA 2W5BA 4JAJA 3PXKA 5F20A 1XH8A 5AUYA 1H25A 4ALUA 4DDGA 3ZUTA 4C02A 2PMOX 2C6DA 3PA4A 4UYNA 4BCNA 3MH3A 3ORMA 1XH6A 4IX6A 3VBXA 5KO1A 4I21A 5M51A 1VZOA 3FZPA 2FSOX 3EQFA 4YMJA 4HPUE 4EONA 4ANSA 2WO6A 4FYNA 4O4FA 5CENA 3LM5A 4G31A 4XP3A 3MTLA 4U3ZA 2WOTA 5FP5A 5D12A 4IZ5A 2F7XE 4BR3A 4JOAA 1FMOE 2Z8CA 1YI6A 2BROA 4CV9A 4CFNA 2W5AA 3UPXA 4E6QA 3W0OA 2HK5A 4G3FA 2X8EA 2XS0A 3HEGA 2XYNA 5I9VA 3NEWA 3KRXA 3OUNB 3L9LA 3VC4A 4UMTA 4DHZA 4UX9A 2XK4A 2YCQA 5E91A 4PY1A 4CZYB 5KMJA 3UG2A 4GK3A 4BZNA 5HQ0A 3AT3A 4MXZA 3BEGA 4QD6A 2XRUA 4F64A 2WB8A 1KUTA 1RDQE 2IPXA 3PPJA 5J7HA 5JKGA 4BIBA 5HG5A 2HY0A 2JGZA 4U3YA 4YBJA 4EJ7A 1H26A 4ZS0A 3A8WA 2QURA 4F1TA 3TNWA 2W1CA 4L53A 3MI9A 1FOTA 2FB8A 2JD5A 4HNFA 2W9ZB 4FV2A 2BRBA 4AACA 1BMKA 1YOLA 4MXXA 4CZTA 3LFBA 2VWZA 4DG2E 2ZB0A 4TW9A 4AUAA 4I0RA 3RM7A 4TN6A 5E92A 3F7WA 3LQ8A 3R9DA 3LMIA 4AW1A 2WMTA 4FT0A 3SHEA 4FGRA 5LCJA 4BCQA 3HGKA 3IW5A 3FLQA 2G2HA 5IA0A 2PZPA 4XLVA 5DNRA 3CJGA 2BKKA 4KS8A 5CF4A 3FL4A 2VU3A 2R9SA 2XK3A 2YZLA 1JOWB 3VW8A 3KY2A 1FGKA 3UDTA 4UXLA 4YJTA 1H27A 3P7BA 5IH4A 2ZV9A 3PVGA 2PZYA 4JDHA 3A7FA 2GTMA 3IGOA 3QRTA 2VN9A 3EQBA 4CFFA 4QMLA 2YJRA 4DFZE 2VTMA 3VUTA 3Q32A 4D1SA 3DT1A 3QGWA 3QUDA 4FV5A 4FL3A 1BYGA 4KABA 4XV3A 4QMNA 3P86A 1Q4LA 3T8OA 4PX6A 4RPVA 5AP4A 2WMWA 4ZSEA 3MSSA 4TKSA 5AP5A 2ESMA 1W2CA 4HGEA 4X6QC 3EN4A 3WZKA 4AT4A 2FUMA 2P2HA 4M14A 3E88A 3ZXTA 3FBVA 4ZXTA 4EOOA 4MHAA 3QTIA 2WTVA 3TZ8A 2BKZA 1QPEA 4KRDA 3KXXA 3ZZEA 5IA5A 2J50A 1Q8ZA 3ZDIA 1OVEA 5IH6A 2WTKB 4BDHA 2ITYA 3VUIA 4ZJIA 4YURA 4DEDA 4DEEA 1IA8A 3V5QA 4XV2A 1NXKA 1O6YA 1ZZ2A 2W4JA 1G8KA 2BZIB 2XKEA 3BEAA 2A4LA 4H1MA 5E7RA 2CCHA 3BHUA 1MQBA 4TNDA 5HO6A 3KCKA 4M15A 3QCSA 4ACDA 2VD5A 1UKHA 3UNKA 4QRCA 4FV3A 5CANA 2VWIA 4UALA 4O7RA 5E8XA 1OECA 4LUDA 3FPMA 3VBWA 5DE2A 4A4XA 4O0VA 4EZ3A 5I9UA 4NL0A 4HVIA 2RFDA 1M7NA 3NIZA 4EORA 4KBAA 3GB2A 3OWLA 3RNIA 4D9UA 3GCUA 3OCTA 4O7YA 1OL7A 3QD4A 2XK6A 4FSNA 3ANRA 4IQ6A 3R9OA 4A9RA 3LFDA 1LEZA 4YPDA 1JKLA 2VUWA 3PXZA 4OTPA 5DI1A 4DBXA 4HGSA 4DGMA 4IZAA 4MBJA 3DU8A 2VWVA 4JT3A 2VTLA 5AP0A 4BIEA 1WBWA 3QWKA 3F5PA 3FMDA 2CSNA 4L68A 3TYKA 1OMWA 5HX8A 5CI7A 3BGPA 1YXTA 4CEGA 1XWSA 2CGUA 3LJ2A 4QP6A 2XIRA 4QPSA 5KE0A 2BUJA 4TYIA 4ITHA 4PDYA 2BHEA 1WBSA 4QTBA 2W06A 4F9WA 5AV4A 2P33A 2GNHA 5KMLA 2GTNA 1RE8A 2B7AA 4JR7A 4DH7A 5AADA 4QEBA 3CJFA 4EK4A 3KRLA 4MQ1A 3DAEA 2WTWA 4RA4A 4UZDA 3W2RA 4IJPA 3AC2A 3TACA 1H1WA 2PVLA 1JQHA 3L9PA 3LXKA 2C6EA 4FKUA 4G2FA 4FTQA 4YZ9A 3FI3A 5ACKA 3OWPA 3TL8A 4CLJA 3UDSA 2JIUA 3LLTA 3EQGA 4K18A 5L3AA 2R3OA 3QUPA 4PWNA 3KKVA 1ZYJA 4QQJA 4EH7A 4RX5A 4JG8A 1TQIA 5D10A 1R1WA 3BQCA 4HYUA 2XNBA 3R7IA 5G1XA 4LMUA 4BJJB 4BICA 4DLIA 3BHYA 2W1EA 3AMAA 3C7QA 2BALA 3DV3A 3S0OA 4D1ZA 4AZSA 3DTCA 3GFWA 3CQEA 2B54A 2ZM1A 4BB4A 2XKFA 2BZKB 4ZJVA 4A9YA 5HIEA 5LCKA 4BCIA 1PYXA 2XK8A 4LMNA 2X0PA 3DJ5A 5HG9A 2EXMA 1BL6A 3VW6A 4EI4A 5HI2A 2I0EA 3W1FA 2IWIA 3F2RA 4ACGA 3D83A 5JEBA 2C5XA 3QALE 3G90X 3VAPA 2C6TA 4D4YA 5K5XA 4D2RA 4M7IA 2GHLA 1ZYCA 5AX9A 4OAUC 4QYFA 5CVGA 4MWIA 5FBNC 4IFGA 4Y5QA 4GIHA 5BVOA 5KKRB 2ERKA 5CASA 3ZRMA 4IFCA 4LRMA 2BTRA 3O7LB 5IUGA 3IGGA 3WZJA 4BDEA 4GT5A 2YDKA 4GYIA 5M4FA 4EUUA 5JGAA 2WD1A 4LUEA 3DJ7A 3H10A 3QXPA 2X6DA 3W32A 3V5JA 2Y4IB 3AGMA 2W1GA 3ENHA 3W18A 4AFJA 3UTOA 1Q3WA 4I4FA 5FBOA 4BWXA 2C47A 2J5EA 2JAMA 4JQEA 4MD7E 2BRGA 3ZSGA 1KE8A 2YIRA 4JX7A 4KKEA 5J9YA 4QPAA 3VUMA 3W0MA 3ELJA 4O7SA 2QOFA 3O23A 3KULA 4U44A 5F1ZA 4XRLA 4C61A 1H24A 3GU6A 5GIPE 4FV8A 3T9IA 5A14A 2VWWA 4IWDA 4S32A 4EOSA 3LCKA 1KSWA 3AMBA 4E4XA 4UV0A 2YM3A 1OM1A 4ZJJA 4CMOA 1H07A 5TKDA 1CMKE 3OVVA 5DLSA 5C4KA 2DYLA 3Q3BA 3HAMA 3HV6A 3WYXA 4FZFB 5FM2A 3IKAA 4EOJA 3FKLA 3VRYA 2WELA 4YJNA 4G3CA 1OITA 2X7FA 2IF8A 3DK6A 1UNHA 3LAUA 2UZVA 3W16A 4WUAA 3QF9A 3ZH8A 5IUIA 3S2PA 4HPTE 4XS2A 2V7AA 5CLPA 3UDZA 3L1SA 1DI9A 3G5DA 4RZWA 2F7ZE 4F1MA 3R8PA 3KREA 4FKTA 4RJ4A 2ITQA 3NNXA 3GXLA 1PXOA 5IDNA 1P4FA 4NTSA 3QQGA 3CY3A 1UV5A 1PKGA 3P08A 4JNWA 5IZFA 1OKWA 5L8JA 3C9WA 3QUEA 5HOAA 2XZSA 1K3AA 2YM5A 3P78A 4USEA 4DGOA 5HBJA 3QQJA 2X0QA 5HD7A 4AW0A 3UZRA 3E63A 4GU9A