5GJDA

Crystal structure of human tak1/tab1 fusion protein in complex with ligand 2
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
306
structure length
292
Chain Sequence
GPLHMIDYKEIEVEEVVGRGAFGVVCKAKWRAKDVAIKQIESESERKAFIVELRQLSRVNHPNIVKLYGACLNPVCLVMEYAEGGSLYNVLHGAEPLPYYTAAHAMSWCLQCSQGVAYLHSMQPKALIHRDLKPPNLLLVAGGTVLKICDFGTACGSAAWMAPEVFEGSNYSEKCDVFSWGIILWEVITRRKPFDEIGGPAFRIMWAVHNGTRPPLIKNLPKPIESLMTRCWSKDPSQRPSMEEIVKIMTHLMRYFPGADEPLQYPCQHSLPGRVEPYVDFAEFYRLWSVDH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TAK1 kinase - TAB1 chimera fusion protein
publication title Development of a Method for Converting a TAK1 Type I Inhibitor into a Type II or c-Helix-Out Inhibitor by Structure-Based Drug Design (SBDD)
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 91
structure length 292
sequence length 306
ec nomenclature ec 2.7.11.25: Mitogen-activated protein kinase kinase kinase.
pdb deposition date 2016-06-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 5gjdA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 5gjdA01
4EWQA 3ATSA 2JKKA 3PE2A 1Q62A 5BVNA 1TQMA 4B8MA 4YNOA 4CEGA 4D1ZA 4HOKA 4RC4A 3QQGA 4TYGA 5CLPA 5HCZA 1LPUA 4ZSEA 4TYIA 5F95A 4XLVA 5K4JA 4UXQA 5K0KA 4KSPA 4IXPA 1WCCA 3NYVA 4FTKA 5I9ZA 1HCKA 4EOQA 5KE0A 3PXRA 4IVCA 5H9BA 1JKKA 5BVFA 4FT5A 4YJPA 4OLIA 1JSUA 3R9RA 4ZEGA 5CAPA 4IX5A 2QKRA 2BDFA 5DPVA 3KMMA 3O23A 4I24A 1NY3A 3QLFA 2OG8A 3ZUVA 4E5WA 3EWHA 4FF8A 4LUDA 5AAGA 5L8KA 2WMRA 4AZVA 4NTTA 3LLAA 5T3QA 4CGAA 2VUWA 5DHJA 3VHKA 1LP4A 2BZHB 3I79A 2XRWA 5GIOE 3VQHA 2XYNA 1FGKA 2YM8A 4QQJA 4PV0A 3EZVA 2QD9A 1XR1A 3EMGA 3TCPA 5C4KA 3RAIA 4YGAA 3JPVA 4QMZA 5DR9A 5HBHA 5KMLA 3P4KA 4IH8A 5EYDA 4AGUA 1OL1A 3TZ9A 3V04A 5M08A 4KIOA 1ZYDA 2BZKB 3FPMA 1VR2A 3Q4ZA 3QTUA 4NJDA 4OTDA 3EN7A 4JDKA 1MQ4A 1IRKA 3L9LA 4PRJA 4OW8A 5C9CA 4NEUA 4AGDA 5E91A 3KC3A 4C58A 2BRHA 4QTCA 4BTKA 4LGDA 2VTNA 4CXAA 3AGLA 5CSXA 4BDEA 1BI8A 2XIYA 5GJFA 1R1WA 4BCOA 3ORTA 4C2VA 1ZYSA 2O2UA 3BGPA 3MJ2A 2PVNA 5EFQA 4CLJA 5J9YA 4UZDA 2ZAZA 3C7QA 2UW5A 1ZYCA 3MYGA 3ORLA 3GCUA 3LFNA 2XKCA 4GT5A 4C02A 2BKZA 5IU2A 3NUAA 5HBJA 3POOA 3IDCA 4JRVA 3QAME 1X8BA 2BAQA 3Q9WA 2QNJA 3D5UA 3QKMA 2W9FB 4G1WA 4L44A 1WBVA 2UZUE 1H1SA 3WYYA 2R2PA 3V01A 5KBRA 5AFVA 5CEIA 4ZJIA 3VF9A 3VUKA 4BWXA 3BELA 2JIUA 3FZOA 3KCKA 5HG5A 3RCDA 3FPQA 3KXHA 3VUIA 1VZOA 4TXCA 3L9MA 2HY0A 3LCDA 4F7JA 4DA5A 2QLUA 5FM2A 5IUHA 3LFEA 5KMKA 3O7LD 4UMQA 3QA0A 3QD3A 3ZEPA 4I6FA 1RW8A 1FQ1B 4BHNA 3FYKX 5AUZA 1ZMVA 4IM2A 4UXLA 3GXLA 2QOFA 3UE4A 4FNYA 4BF2A 3NNWA 2WMXA 3EOCA 4F09A 3DGKA 3OCGA 1LEWA 1OL6A 3QF9A 3C9WA 3EFJA 3TACA 3ZLXA 4ZS4A 2HWPA 4RWLA 5EYKA 2C3JA 3PA4A 4UWCA 3VO3A 4QOXA 4DEBA 4F1MA 3PDTA 1J1BA 2WQBA 4BGQA 3WZDA 1O6LA 2GNGA 3EQRA 3CY3A 4OGRA 3VBTA 3COIA 4YU2A 5FUTA 3GBZA 3IW5A 5L3AA 3CJFA 4F9YA 1GIJA 1YI4A 4H36A 3HMIA 3CP9A 1CMKE 1U5QA 3ZO2A 5M53A 1OIUA 4JIAA 4BDJA 3JXWA 5ETFA 4RWKA 3TUCA 4F9WA 3AOXA 3PA3A 4YTCA 3IONA 4YJVA 2WQMA 4K1BA 2XJ1A 4IMYA 5HD7A 3HMNA 4JBQA 3TNPC 3QD2B 5CT0A 3UJGA 3NNUA 5DFPA 2BPMA 2XH5A 3LQ8A 1WBPA 5HCXA 3CXWA 4QQCA 4EONA 4ZLZA 2I7QA 2PVHA 3OG7A 3BV3A 1H25A 3E8DA 4UYNA 4PF4A 4O0SA 5AP4A 4ZTRA 2CGXA 4RPVA 3UPZA 4JVGA 3PRFA 4GYIA 3R01A 3GU7A 3BYOA 3RTPA 3ALNA 4S34A 4L7SA 4FIFA 4GK3A 4FSNA 4DEIA 2IW8A 4AOTA 4LMUA 4X21A 5C8KA 1RE8A 4O7YA 2RFEA 2B9IA 4FOBA 2WOTA 3ZC6A 3CS9A 2BROA 5L2WA 4ZTSA 4I6HA 5AV3A 5HORA 4X2FA 4FZDB 3DU8A 1XH5A 2UW7A 4L42A 3HLLA 2A19B 3BPRA 2IVSA 4CQEA 2QR8A 2GQRA 3F3TA 1PF8A 1YI3A 4U80A 5HVYA 4E93A 5EM8A 2XNNA 4AG8A 4R1YA 2Y8OA 5AUVA 3EFWA 2BRBA 5AP2A 5HZNA 4O2PA 1PYXA 1YXVA 5JKGA 2ITYA 4GRBA 4EOJA 4E6DA 2GQSA 2DUVA 2OZAB 2WZJA 2X2KA 3BWFA 2G9XA 4C33A 2QHMA 4G16A 4S32A 2C6TA 3E5AA 3F5PA 3R2BA 3V5WA 4IX3A 4X6QC 4IWQA 1YXSA 1CTPE 5AX3A 3SOCA 5I9YA 5F4NA 3OFMA 3QL8A 5AR8A 1PMNA 3C0HA 3QKKA 4KIKA 3AC1A 4HGLA 3OXZA 4TNDA 3NX8A 1LUFA 3BHHA 3MH1A 3GI3A 3QD0A 4WKQA 2OU7A 1A06A 1TVOA 3BE9A 4W9WA 1GIIA 4QMUA 4CKJA 4D9TA 4AE6A 5M4IA 3UIXA 3HP2A 4BY9E 4DEAA 1UNHA 4QTDA 5CS6A 5AJQA 3BCEA 2QOKA 3W1FA 2V7OA 3FL5A 4IWOA 4LRKA 3WZUA 2IZTA 4FSRA 1GNGA 4HPUE 3AT2A 5CYIA 1ND4A 4QQTA 2ZDUA 1XBCA 3N51A 3HVCA 5E4HA 3QHWA 4N70A 3EYGA 4YJOA 3ZEWA 5IG1A 4EOMA 3I81A 4DG3E 3MTLA 2B53A 3FC1X 2J0IA 2CSNA 4EOKA 1ZOGA 5B0XA 4GKHA 1WBWA 4QPAA 4IB5A 2H9VA 3IGOA 2JDRA 5M4CA 1OPJA 3O96A 2UW8A 3QALE 4YTIA 1YDRE 4OAVB 2WFYA 4C57A 4EH2A 2CGWA 3L8VA 3NYOA 2JDOA 1XJDA 5GIPE 2ERKA 3FDNA 4IZ5A 3Q9ZA 3VVHA 3PY0A 3TV6A 2QONA 4K18A 4KBCA 1LEZA 2H6DA 4FK3A 3R21A 4EK6A 4M69A 5L6WL 3NVKI 3PSDA 3QZFA 4QP1A 4S33A 5E8YA 3CJGA 4RIWB 2GTNA 4QMNA 5AV2A 3TIYA 3NW7A 5BYYA 3UQCA 3SXFA 5ITAA 5FEEA 2ZV7A 3QQUA 4PMMA 3JS2A 4DEEA 3P79A 3ACKA 4PL3A 4FGRA 3AT3A 1J7IA 5TR6A 3DNEA 2O0UA 4EUUA 3P9JA 4LV5A 3TNQB 4RC2A 2XP2A 1Q41A 3E7OA 4BGHA 4D58A 2RFNA 5CU4A 3V51A 4JBOA 2GQGA 3NUNA 3ZRMA 2GPHA 2QOCA 1SMHA 2Y4PA 3DBFA 4H3QA 1H1RA 5HD4A 2C6OA 4E6AA 3ORZA 4G17A 1YKRA 3C4WA 2X1NA 3MESA 4I5CA 3F3WA 4M68A 4EQCA 4E20A 1CSNA 4TN6A 3UOJA 4XV3A 3TDVA 2YDKA 4DGNA 3FBVA 4IVDA 3LQ3A 4FVRA 4AA5A 3DS6A 4Y8DA 2PTKA 4D4VA 4Q9SA 3W8QA 5KMOA 1B38A 2OSCA 4E4XA 4PTCA 4G3FA 1W7HA 2IZSA 3KQ7A 4H1MA 4OBOA 2NRUA 3AGMA 4ZY4A 3BKBA 3FI3A 3P0MA 2JBOA 4GT3A 5HCYA 4XOZA 3KREA 3NW5A 4FSUA 4IB3A 1WMKA 3QRTA 4Q9ZA 5DT3A 2BIYA 3DBQA 3BHUA 3L8PA 4AT4A 3BV2A 3ODZX 3FHIA 4FNWA 5BPYA 3E87A 1V0OA 2UZLA 4IAZA 3S4QA 5TT7A 3F5XA 4K6ZA 4GV1A 5BUIA 1STCE 2C5NA 2C0TA 2R64A 4YO4A 1XBAA 4UMRA 3F2RA 4A4LA 2VZ6A 2WGJA 2Z8CA 3RWPA 4CZYB 5AV4A 3FXXA 4CG8A 1F3MC 2FA2A 4FTCA 4EOSA 1JLUE 3VS5A 1GZ8A 4EQMA 1H1WA 5BVEA 5JQ5A 2PVYA 4M3QA 2G2FA 1VEBA 4ZOGA 4JX3A 4I92A 4QTAA 5E8VA 2PYWA 4BVUA 5HG9A 5AP0A 5AA8A 2FO0A 3FY0A 5JZJA 3KRJA 1SVHA 4CNHA 3PSCA 3AMBA 4JI9A 4RLLA 4DH5A 4LYNA 3N4UA 3SRVA 3HX4A 1Y8YA 2WPAA 3POZA 3DNDA 3GOPA 4GKIA 3DLZA 4BHZA 1OITA 1KOAA 4BCNA 2OGVA 2JLDA 1UU9A 2LGCA 4H3PA 5ANKA 4R1VA 4LQMA 4W9XA 2VWXA 2WTKB 5BVOA 2Q0BA 5M09A 4OBPA 2PMOX 4PQNA 1H24A 4RWJA 5CT7A 2W1GA 3RPOA 2YM3A 3KK9A 4JBVA 5JT2A 3ZFYA 4J8MA 5L8JA 2C5XA 3G90X 4BCQA 2YCFA 3GUBA 5LARA 4MNEB 4CKIA 3H0YA 3V5JA 3CKWA 4D2RA 2I0YA 3RM7A 5K9IA 3SGCA 1J1CA 2KULA 2OJJA 3HV7A 3DA6A 3ACJA 4G3GA 5FTQA 1WBNA 5GZ8A 1ZZLA 2I1MA 3OMVA 1Q61A 2UVXA 4FV5A 4RFYA 4C4FA 2GMXA 4EH8A 3PXFA 5L2SA 4H1JA 5CENA 2OK1A 2UUEA 2VTIA 2W5AA 2X7OA 4GG5A 3IW4A 4HNIA 3LFFA 3E62A 3A7HA 2F7XE 1FVRA 3FKNA 1KE6A 3LFQA 4EK8A 4HZRA 3E63A 3KULB 3V8TA 2ZMDA 1XH6A 2UW9A 3PIZA 3OT8A 2YDIA 3GU8A 3KCFA 4O1OA 3WE4A 1H27A 3AQVA 2VTJA 4HW7A 3QX2A 3UC4A 3PJCA 4FV8A 2PHKA 3FSKA 4RQVA 3EN9A 3BLQA 2NRYA 2WKMA 2XUUA 3GC8A 3R2YA 3T9IA 4ZJJA 5EYCA 4KSQA 3K5UA 4IAKA 2E2BA 2P3GX 4O38A 5LVOA 4ONAA 4FEVA 4KUJA 2EVAA 5EM7A 1H8FA 2P2HA 1Q8UA 1T45A 2XYUA 3DK7A 4FT9A 3DJ7A 4IDVA 5FP6A 4CVAA 4UX9A 4N57A 1Y57A 1OVEA 2OF4A 5AP1A 3RK7A 3EQBA 4YPDA 1OIQA 3I7CA 3LMIA 3O8TA 4YPSA 3KK8A 2G01A 2X0GA 2VTMA 3UQGA 4FV0A 5ANGA 4A9SA 1DI9A 3TKHA 3PP0A 4HCUA 4I6QA 2R3GA 4G9CA 1GOLA 3P1AA 3Q9XA 4GIHA 4DTBA 4D1SA 4AE9A 3DAKA 4EK5A 1QCFA 2R4BA 3R6XA 2PE2A 1K3AA 1FINA 4FC0A 2QU6A 1G8AA 4FVPA 2ZVAA 4PDYA 3R7IA 3A4OX 1K9AA 1YXUA 4C37A 3SW7A 1QMZA 1XH8A 1U54A 4KB8A 2WU7A 2XKFA 3PJ8A 4ZTNA 2B4SB 4O0WA 5EDRA 4BI0A 4E4NA 2BAKA 3HRBA 3E64A 3WZJA 4HZSA 2VO0A 4GVJA 3KA0A 5KZ0A 3O50A 4QO9A 3TTJA 3V8SA 4EYMA 4FTTA 1KV2A 3LQ5A 1IAJA 3KEXA 4IACA 4BRXA 5EOLA 3S00A 5J87A 2W1IA 3W2RA 4O0XA 3TDWA 3LHJA 4RJ3A 4WG4A 3K3IA 4XV9A 5C01A 4BDAA 4HVGA 2ZYBA 3E3BX 4GFOA 4DC2A 4F65A 1T46A 3AMYA 3R8VA 1GAGA 3ZTXA 4QNAA 2JDSA 5M4FA 4LL5A 3FEGA 2YZAA 4UB7A 3NDMA 4FV3A 2PUPA 1AD5A 4UALA 3OTUA 5A6NA 2ITZA 4L43A 4XLIA 5D7VA 3D9VA 2C6KA 3QTZA 4S31A 3WIKA 1REJA 3CLYA 3BHTA 4IANA 5HO8A 2O64A 5A4CA 1M52A 2X2MA 3OUNB 2JAMA 1OZ1A 4EWHA 1DS5A 4J7BA 3R00A 5HGIA 1XH4A 4RX8A 4WNKA 2EXMA 3DXNA 3R02A 4X2JA 3V5TA 4C4JA 4TL0A 5HE3A 5A46A 3NLBA 4FKIA 4YSJA 3E88A 3VBXA 4BDCA 3R7VA 3KY2A 4TYHB 2R9SA 3PIXA 3I6UA 4FTRA 4MX9A 3FQSA 4J97A 5EW8A 2OBJA 3HA8A 4FUYA 4O1PA 2J0MB 4W4XA 2XNMA 3IOKA 4W4YA 5JGBA 3IGGA 4G2FA 4AOIA 4C4EA 5FD2A 3W8LA 2QC6A 4MF0A 4TTHB 3U4UA 3UNKA 1KWPA 2J4ZA 3A7IA 3CPBA 4NUSA 4UMTA 2XB7A 5DMZA 5IKWA 1ZZ2A 3DAEA 4F9CA 3SXRA 2R3FA 3EQHA 2VX1A 4XOYA 4ARKA 2OWBA 4CSVA 1W98A 1Z57A 2C6IA 3AMAA 4G6OA 3WF7A 1BKXA 4GU9A 2Q0NA 2B9HA 1ZOEA 3D94A 5AIRA 4ZAUA 5JFXA 4L3LA 1V0BA 2WMBA 4I5PA 3H10A 4MNFA 5BX0A 4J98A 4O7TA 3G0EA 3ALOA 3LXPA 4RIYA 2X8IA 3UPXA 4N6YA 4BTFA 4DH8A 1UNGA 3MB6A 5B2KA 1G8SA 1ZWSA 3HUBA 4ENYA 4YZCA 5FG8A 4D4RA 4QYEA 3BBTB 4E6QA 3UBDA 2V5QA 2J51A 2VX0A 1M17A 3GVUA 3O8PA 3R73A 4NU1A 1YXXA 4JG6A 2JKOA 2OFUA 3RBWA 2VWVA 3QRUA 4U42A 4LUEA 3KN5A 2YJSA 4FV6A 4WNOA 4QMXA 2BHEA 4BWKA 4M7IA 4A07A 4Z16A 2REIA 3MA3A 4ZSJA 4EC9A 4QP3A 4D55A 2VTPA 1IG1A 2GU8A 4HPTE 2WTVA 3MN3A 4MD7E 2PVFA 3R1SA 5FDXA 4TWNA 3Q60A 3MDYA 3MIYA 3DAJA 4CKRA 3EZRA 3C4ZA 3DDQA 3GQLA 4U41A 3C0IA 3NIZA 2IJMA 5DVRA 5CSWA 3R8LA 3UVRA 1AGWA 1PKDA 4R7HA 4FUXA 4ZTMA 4MBIA 2YM7A 3G9LX 3ZDUA 3TKIA 4ZZNA 5J7BA 4BL1A 2E9PA 2YM6A 2EUFB 3Q3BA 5L6PA 2DS1A 5EH0A 5IF1A 3UMWA 3QTWA 5HQ0A 3F5UA 3HRFA 5D12A 2YDJA 3R7YA 3WIGA 4EH7A 4X3FB 4RJ7A 2QCSA 5IPJA 5AR4A 4BFMA 3IQ7A 3MFSA 4BIEA 1KOBA 1FPUA 2UZWE 2BALA 2XNPA 4GJ3A 5IEYA 3L9PA 2O8YA 4FL2A 3MVHA 3SA0A 3R71A 4EHVA 4EJ7A 2E9NA 1WVWA 3QGWA 5AA9A 3FL4A 3BYUA 3BBWA 4F99A 2UW0A 2BFYA 3QTQA 2PUNA 3OCBA 2FSOX 2WQOA 5BVDA 5H8GA 1Y8GA 4XMOA 4F9AA 2W5BA 2XCKA 1FMKA 3HEGA 4QQ5A 2I6LA 1F5QA 3VW6A 5H2UA 4BKZA 4I5HA 2JAVA 4YHFA 2CKOA 3NAYA 5KZIA 4BN1A 3HUCA 4FT3A 5F1ZA 1OKYA 2OJ9A 5EI2A 4O96A 5LCKA 4XP0A 1XKKA 3CPCA 4P5ZA 3SAYA 2QLQA 1Q3DA 1PMUA 5FXSA 4C7TA 4M14A 3ZYAA 1DM2A 5E8ZA 5LVPA 2JD5A 4NM7A 2YWPA 4W8DA 4LL0A 3WF5A 4Y83A 2YHVA 3CY2A 3FKLA 2E9VA 4C3RA 2XBAA 3KRWA 3KF4A 4U79A 3QWKA 4D2WA 3G6GA 3EQIA 2HAKA 3PFQA 4NYEA 3VS6A 3ZLWA 4C2WA 4IX6A 4WBBB 4RX7A 2Z02A 3AC5A 3ZFXA 2YIWA 4BCMA 5A14A 5HO6A 4I3ZA 3OWKA 3F3ZA 3DK3A 4ZP5A 4ITIA 1JQHA 4F63A 3RPRA 4ZSGA 5IDNA 3UIBA 3S0OA 1QPEA 3LXKA 5M56A 3D5WA 1E1XA 4CV8A 5ANIA 4YSMA 2FYSA 4L6QA 2C5OA 1NVRA 4ZY6A 4ITHA 3RHKA 4AU8A 1ZMWA 5F9EA 2F49A 1PMVA 1Q5KA 4U81A 3UNZA 3ZFMA 4D5KA 2XMYA 5LXMA 4NM0A 4JG7A 5B2MA 3R1NA 3SC1A 4FKGA 1H07A 2X4ZA 5E92A 5H8EA 3PJ3A 4EH3A 3F9NA 3G2FA 4YBKA 4C0TA 3FLZA 2BDJA 2BUJA 5L8LA 1Q99A 1VYWA 2VWIA 3P08A 3CQUA 3L8XA 3ZM4A 2ITVA 3QLGA 3DZQA 3ROCA 3A8XA 4NFNA 4NZWB 3QCXA 5CXZA 5CVFA 1PXLA 1OGUA 2UVYA 4ID7A 3DJ5A 4MXZA 2O3PA 2YACA 3RALA 3CR0A 4RG0A 2AUHA 4P5QA 4YJQA 4LFIA 1KE8A 1U4DA 4GFMA 2YN8A 4L00A 2BDWA 4TWOA 4DINA 2QO2A 2CNQA 1H01A 5CEQA 4F7NA 4BZOA 2C6EA 2VNYA 3ZOSA 4C34A 3PY3A 2HOGA 4FIGA 3QQHA 4BBEA 5ACKA 4AFEA 4DT9A 5DR2A 2OXDA 4WRGA 4U3ZA 5C1QB 2XK3A 3ID6C 3T9TA 3ORMA 5L2TA 4GJ2A 4U97A 4OTQA 5EQYA 5HX6A 4ZZMA 3WF6A 4CLIA 4DG2E 1YW2A 4E5BA 4XNEA 2G1TA 4Q5EA 4IAAA 5J1VA 5CEKA 2IZRA 3GGFA 3F7WA 2PE0A 4IE9A 3QZGA 4JDJA 2G2HA 4PTGA 4UWBA 5TO8A 5EDPA 5D9HA 4QMWA 5M44A 4WG5A 4AACA 3R04A 5ANEA 1MP8A 3HZTA 4MK0A 4AX8A 4FICA 1J7UA 1OKVA 2WHBA 3R9HA 5FQDC 3FXWA 5CX9A 1PXNA 4AN3A 3VRYA 3HMPA 3PXKA 2R3OA 5CQWA 1CM8A 5A4EA 4R3CA 4WG3A 3W2CA 2P33A 2W1HA 3A7GA 4E26A 5FXRA 4IB0A 2JC6A 5HIDA 2YCSA 3WARA 3D5VA 3CE3A 3QZHA 3G33A 4MF1A 2GFCA 2ZDTA 4H58A 2J7TA 4RVKA 3DKFA 3T3VA 4BTMA 5C8MA 3ENHA 3DB6A 4MAOA 4YBJA 2OH4A 2VTSA 4BDGA 4JQEA 1R0PA 4OT6A 4GH2A 5JK3A 4EK4A 4MWIA 5F94A 1JSVA 2BHHA 4M0ZA 3LLTA 4CG9A 3W55A 2BAJA 4GVAA 3RKBA 3ZMMA 2RGPA 2RL5A 3KRRA 4WSYA 4O7ZA 4CFUA 4L3JA 2OFVA 3QCQA 4TW9A 3NEWA 1YOMA 2ONLC 4R3PA 3U6JA 3RM6A 2BMCA 3GU6A 4BB4A 4PPCA 4RJ8A 2C69A 3K5VA 4FODA 5E8UA 3FLYA 5DEWA 4CFXA 3DLSA 4ANNA 5FBOA 4EEVA 3U87A 2ITQA 5JGAA 2FB8A 3Q52A 4ASDA 4Y72A 3GCQA 4E8AA 3U4WA 3N4TA 4H05A 5DBXA 2XF0A 5JRSA 2VWBA 3A61A 4XX9A 1URWA 3DBCA 1BMKA 5EM5A 3TV4A 1IA9A 3AD5A 4HJOA 5AV0A 4DYMA 5HESA 3EYHA 1V1KA 2ETKA 3EN5A 2UV2A 3QRJA 3RHXA 3DB8A 4DH3A 2W0JA 3LFSA 2WTCA 4FNXA 4PMPA 3PA5A 3GCSA 4JJRA 2OIQA 4YHJA 5LJJA 1P4FA 4KKGA 3PZEA 2W05A 3UIMA 3NUUA 2YZLA 3GC7A 4UZHA 4C35A 3QTRA 3RAWA 3UP7A 2R3IA 3UOLA 4E5AX 1FMOE 2O5KA 5LVNA 4D0WA 4L68A 1UU8A 3C4CA 3QRIA 4S2ZA 5A4TA 1FGIA 2ZM4A 4U3YA 4YNEA 1JKLA 3RCJA 3WZKA 3ZC5A 2XRUA 4MHAA 3TJDA 3OC1A 3D0EA 3DQXA 4N0SA 4AW5A 2VO3A 1H08A 4IAYA 1OM1A 3P23A 2WMVA 2QOBA 3OXIA 1W83A 3OXTA 3NCZA 5CU0A 4FSTA 3UODA 2JIVA 3CD3A 4BR3A 1ZRZA 5KNJA 1PW2A 1DI8A 2QQ7A 3DFAA 1U5RA 2NNWB 2R0UA 4FYNA 2V55A 5CTPA 3V6SA 4BTJA 4FTIA 4HVHA 2QG5A 3R8UA 4KRCA 4AA0A 4NJ3A 4A9RA 3DK6A 3TNIA 4M84A 2BIKB 1QPCA 1AQ1A 3K3JA 5CWZA 4FZAB 5AIKA 3TZ8A 5AM7A 4RVLA 5JFSA 4LOQA 4M8TA 4DEGA 4R7IA 3B2TA 3MH3A 4G9RA 3OWJA 3GC9A 4YJRA 2NPQA 2C6DA 3K2LA 3R7OA 4O81A 4FBXA 2VTQA 3LXNA 3VBVA 5IQBA 1MUOA 2F2UA 3H4JA 3BLHA 3Q5IA 3VULA 5TKDA 5DRDA 3VS2A 4HGSA 3EQGA 1NW1A 4DTKA 2ITUA 4DITA 5I5ZA 2XIKA 4ASXA 3EQFA 5AP6A 5IA0A 4ZTQA 4C3FA 2B52A 2OXXA 3ORNA 3NYXA 4XG8A 3FAAA 4I5MA 5CQUA 4I6BA 1BLXA 1NVQA 4RJ6A 5L2QA 3GOKA 4RJ4A 4TT7A 5JSMA 1FVTA 1QL6A 1DAYA 4FKQA 3DTWA 4W4VA 5GNKA 1ZY4A 3ZONA 3KN6A 2P55A 3NUSA 4USDA 4C38A 4DFUA 4FKWA 2W06A 3FMDA 3FMJA 3PVWA 3LCOA 4JXFA 4ENXA 1YQJA 4W8EA 5HE2A 5LWNA 3U55A 4BKJA 3T3UA 5AX9A 3MJ1A 3WI6A 1APME 1H28A 5E1EA 3JVSA 1JPAA 5E1SA 2UZTA 5DLSA 2GHLA 2X4FA 3R1QA 3R1YA 4DG0E 5IMEA 1KSWA 2W4JA 4CMTA 3NYNA 4BKYA 2HELA 3UO4A 3EB0A 2W4KA 3VUHA 4K2RA 5ETAA 5EYMA 4C8BA 4O7RA 1KE5A 2AC3A 1Q97A 2A4LA 3ETAA 4FIEA 1ERKA 4IQ6A 4OBQA 5TOZA 3VS1A 3ZDIA 3BQRA 2WXVA 3PVGA 3BE2A 4RQKA 4U44A 4USFA 1IASA 3II5A 4QPMA 2CN5A 4P7EA 3CD8A 3WILA 4FKRA 1SVEA 3ZRLA 5M51A 4P2KA 5FTOA 4QTEA 4Q2AA 1YHSA 2WIPA 4C61A 5L2IA 5L6OA 4O84A 4AQCA 1J7LA 2PZ5A 4AZWA 3GT8A 5IQDA 1WBOA 1SM2A 1RQQA 1OBDA 1OI9A 3VNTA 4C59A 2BVAA 2WNTA 5CNNA 4UYAA 3E3PA 3MTFA 2BTSA 3IPHA 4WSQA 3TNWA 4F70A 4FT7A 4RA4A 4EH5A 4APCA 5D11A 4FI1A 4RLKA 4J99A 2GHMA 4GK4A 2RG6A 2Z60A 3VUMA 2ZJWA 1U46A 4ACGA 2B0QA 3FZSA 4I1ZA 4EBWA 4J96A 4FX3A 4IZAA 2UVZA 2AYPA 3QKLA 4FKPA 1E1VA 4EH6A 4L67A 5HEZA 1OPKA 3QTSA 4UBAA 4CT2A 1BYGA 3VJOA 2QO7A 2R3QA 2WQNA 3OUKA 4AW0A 3MPMA 4XJ0A 2ERZE 2HW6A 4NL0A 2VU3A 2QURA 5KMMA 2ITTA 1GZNA 3LFDA 3UVQA 5HIEA 4IBMA 2IO6A 4IX4A 3VJNA 5EHLA 3UGCA 4D4YA 4G3DA 2RFSA 2YM4A 4NIFB 4BCFA 4M67A 4GIIA 4RFMA 2CGUA 3I0OA 3GFEA 3PJ1A 3OCTA 4XG2A 3ZLSA 4NFMA 1YRPA 4F0IA 3FJQE 5J9LA 2H8HA 1KUTA 4QYGA 1H1QA 3EHAA 5AUYA 2HCKA 4EK3A 3RNIA 3OEFX 2C6MA 5LVLA 4FZFB 3EIDA 4AOJA 3VHEA 5M06A 5KUPA 1CDKA 4IAIA 4FSMA 4YTHA 4X6RA 3I5NA 4EZ5A 4QMTA 3AC4A 2YLFA 4BDBA 3SD0A 5J95A 5E9EA 2UW3A 4A9YA 3F82A 1CKJA 3F61A 3E7VA 1S9JA 5I3RA 2F7EE 4BCIA 2YJRA 3MVMA 4FVQA 4FTJA 1JOWB 3R63A 1M7NA 3BGQA 1O6YA 2PSQA 2YIXA 3GC0A 3OY1A 4JS8A 4F6UA 2HENA 3GFWA 3RP9A 3N4VA 3FYJX 2XK7A 4TKSA 3THBA 1H4LA 4CTBA 3HAMA 2HZNA 3SDJA 2VX3A 4PNIA 5J7HA 3C5IA 4F64A 2GNJA 4IWDA 4K9YA 2CKPA 5EI8A 1ZLTA 4FTAA 3PZHA 3TJCA 4ASEA 2DQ7X 2VTHA 1PXPA 2ZMCA 3FMHA 1PXKA 4L52A 4KWPA 1PXMA 1RDQE 3FHRA 4MXOA 4YC6A 5K4IA 2XKEA 4G31A 3FI4A 3I1AA 4AW1A 4K77A 2JKMA 3PY1A 1WBTA 4WNPA 3R28A 4OTIA 4RFZA 4IFCA 3MFUA 2HK5A 4F1TA 2UZEA 3ANRA 2J6MA 2J0JA 3ERKA 1H00A 3MS9A 5IQEA 2X7GA 1BUHA 1K2PA 3HDMA 4I93A 3BU6A 3KXGA 4UN0C 1OB3A 4QP2A 3F88A 4HVSA 4JG8A 4R8QA 4BCGA 4LM5A 1XO2B 2BILB 5CEPA 2EWAA 2EXCX 4FIHA 4QRCA 5HTIA 1XQZA 2IG7A 4GG7A 4JDHA 4NW5A 3G5DA 4O7NA 4C62A 4AF3A 3UO5A 2VAGA 1BL6A 2WMWA 3BHVA 3Q4TA 5DGZA 3ROYA 3KF7A 3HV4A 3ODYX 3R8MA 5CALA 5I9WA 4B0GA 3WOWA 3FE3A 1M2PA 5HLNA 4FMQA 4DEDA 2OZAA 3QTIA 3D7TB 4PDOA 3C5UA 4ANBA 2B9FA 3NSZA 4IVBA 1ATPE 5E8XA 4BWPA 3LZBA 3LVPA 1Q8WA 4DE4A 2X6DA 5TE0A 3CEKA 3HP5A 1UVRA 1NA7A 3PXQA 3QC9A 1ZY5A 4L45A 2BR1A 4JRNA 3QQKA 1VYZA 4BDIA 4EOOA 2PUIA 4RWIA 3IK3A 3D2KA 2JITA 3AD6A 3UOKA 4DF3A 4FTUA 4D2PA 1M2QA 4QMLA 5IUGA 3FMKA 4R5YA 4UY9A 1TQIA 3M1SA 3MFTA 4KAOA 4FEXA 3DT1A 3GB2A 4YJTA 3BQCA 3LAUA 5KMNA 3MPTA 3PE1A 2W1CA 2Z2WA 5FDPA 3DCVA 4WD5A 5ACBC 3QX4A 4D0XA 2GS2A 4ZTHA 2WMAA 4O0YA 2GNLA 1GZOA 3ZXTA 3ORXA 4ANSA 3Q2MA 4IB1A 4QT1A 5DRBA 4HYSA 3A7FA 2WAJA 3CBLA 2FUMA 3PIYA 4KS7A 3DTCA 3PXZA 3Q5ZA 5KHXA 3KRLA 4IZYA 2IVVA 2XM9A 4FSZA 4V0GB 4I22A 1XWSA 1OPLA 4GFGA 3QUPA 3HL7A 5A4LA 3NCGA 2VV9A 4IW0A 1PXJA 5K3YA 5GJDA 5EKOA 3EFKA 5H8BA 3SG8A 4UMPA 3BU3A 2QVSE 1YVJA 2VTAA 5JFWA 4A9TA 1OL5A 4IFGA 4WRSA 3FV8A 4O91A 3FUPA 3PJ2A 2KTYA 4K0YA 4AFJA 1XH7A 2OICA 5A6OA 5FWKK 3WE8A 5LOHA 2CMWA 1R0EA 4MXYA 4F9BA 2X9EA 5E8WA 5J5SA 4KABA 5HBEA 3ZO4A 3QFVA 3EQCA 2HZIA 3TUDA 4RIWA 5ICPA 2BTRA 4NCTA 3FQHA 5KMIA 4YZBA 2I0VA 2WO6A 2J90A 1R78A 3MY5A 4NH1A 4NW6A 3UOHA 5CSPA 3FZTA 4JAJA 2VGOA 5EQEA 4QD6A 3UP2A 4AGWA 4R5SA 2DWBA 3SVVA 5CF4A 1ZYLA 2XNOA 5AV1A 2X8EA 3BI6A 4O21A 4U45A 3F7ZA 4F0FA 5BUJA 4WUNA 2JFLA 3W33A 4UMUA 5FTGA 3CQWA 3Q6UA 3PVBA 3EJ1A 4V01A 3REPA 4JNWA 4AZFA 4QMVA 4BCKA 2R3KA 2XJ0A 5IA2A 4EOLA 2C6LA 3PPJA 1W0XC 2Y0AA 2PL0A 4A06A 3RINA 2H96A 2XM8A 3ZUTA 5AAEA 5IISA 1KE9A 2EU9A 3EKKA 4PPBA 2E9OA 3VC4A 4G34A 4GU6A 2J9MA 3EL8A 3QTXA 4M66A 5IQHA 3W2QA 1OMWA 4IC8A 2W7XA 4CQGA 2Y9QA 5D1JA 5FRIA 2IVUA 4QYYA 4M13A 5EW3A 4UWYA 3TXOA 4ANQA 5KMJA 4IJ9A 5KKRC 3EQDA 3PG3A 5C03A 4FIIA 4ZK5A 4BDFA 4O6EA 2C30A 5I3OA 4BCJA 4DHFA 1BX6A 4RT7A 3VRZA 4BBMA 2C3KA 4JOAA 3TZMA 2BZIB 4G6LA 3R7UA 4BIDA 3HDNA 1PKGA 2R7IA 2QU5A 1CKIA 1G3NA 2WMSA 3F69A 4QTBA 3E8CA 4J52A 4RA5A 2A1AB 5LMKA 3WF8A 4LRMA 4E1ZA 4EHGA 5AM6A 3KXMA 4JAIA 4YZMA 3SKCA 4FV4A 5JFVA 2HXQA 3FMNA 3EL7A 4JR3A 1LR4A 1PHKA 1J3HA 2GHGA 3Q04A 3RZFA 4YC8A 3K54A 5HLWA 3TI1A 2WTDA 2XNGA 1YHWA 3P86A 2W4OA 4TYJA 5CAQA 3JVRA 5EW9A 2X2LA 3FI2A 2JKQA 3E8NA 3ZSGA 1YDTE 2CN8A 2GFSA 3QYWA 4WUAA 2P0CA 4DN5A 4CZUA 2XZSA 5CEMA 2VRXA 4QNYA 4FSYA 5A54A 5HNGA 1R39A 2UW4A 3QQLA 5GHVA 2B1PA 4FG8A 4X3JA 3TN8A 4D4SA 3V5QA 2ESMA 2JIIA 5HE0A 4N6ZA 1EH4A 4CFNA 1XHAA 4XHKB 4EH4A 4ZIMA 4J1RA 4NSTA 3NS9A 2PU8A 5HKMA 3MH0A 3LE6A 5FLFA 3TUBA 4PTEA 5CANA 4MVFA 1OL7A 4MD9E 5T6KA 2PVLA 4TWCA 1M2RA 4YZNA 3ORPA 3QCSA 4AN9A 2LAVA 3R8PA 3MIAA 1QPJA 2R3JA 2FGIA 2Y7JA 4MNEA 2YA9A 5GINE 3DDPA 5IUIA 1WVXA 3N9XA 2W17A 4IC7A 2CHLA 4RBLA 4GUBA 3VUGA 3W2SA 3MSSA 4YMJA 4FYOA 4DT8A 2CGVA 3FMEA 3ZO3A 5IA3A 2VTLA 4D5HA 2Y4IC 4KIQA 2BZJA 2ETRA 4FV2A 4NKAA 3DJ6A 4ZMEA 5K5NA 3D7TA 1NT2A 3QUEA 4ERKA 1BL7A 3KULA 2GSFA 3SW4A 4XEYA 4DCEA 5I0BA 4KS8A 2ACXA 3I5ZA 3KGAA 1UU7A 3L8SA 2J5EA 4JDIA 5BYZA 3SG9A 3OT3A 5KBQA 4Z7GA 4RIXB 3RPSA 3GP0A 3ZS5A 5J8IA 1OKZA 2O65A 2OJFE 4Y85A 3HV5A 4DGOA 2IPXA 4DAWA 4CT1A 4FA2A 2QOQA 1O6KA 4PNKA 4FKUA 4HGTA 1SYKA 3FWQA 3BGZA 3O17A 4U40A 5IH4A 4JIKA 4WIHA 5DOSA 5IDPA 5HI2A 4Z55A 1YHVA 3EQPA 4XG6A 1JKSA 2ITOA 4GSBA 5CU2A 5JEBA 2CPKE 4AUAA 3MI9A 2P4IA 2Y4IB 5CU3A 1XH9A 5DYJA 5EDQA 3QC4A 4ANOA 1WAKA 3O71A 4B4LA 4JX7A 4KRDA 3GNIB 4TWPA 5D41A 3ZSIA 3OBGA 3VBYA 3OWLA 4ACMA 4DFNA 4EZ7A 3H9RA 3NZ0A 2YLEA 4J53A 2UW6A 5CAOA 1Y91A 2E9UA 1REKA 4FTQA 3MY1A 4GK2A 3HA6A 5BVWA 4O86A 4AAAA 4TYEA 4ORKA 4KD1A 4U8ZA 2CLQA 5LMBA 4L9IA 5ETIA 4QMPA 3GQIA 4FSQA 3ZRKA 4H3BA 2GNFA 2ZM3A 2R7BA 4KNBA 2YABA 4OTPA 4HVDA 3A99A 3TEIA 4MEDA 4IEBA 4D2TA 3EFLA 5CI7A 4AT3A 4F4PA 2BRGA 3PG1A 3V5PA 3O2MA 3ZHPC 5C8NA 2GTMA 3PTGA 4KIKB 2PVRA 3EN4A 4F6WA 5BUEA 3F3UA 3OOGA 3EKNA 1DAWA 1I09A 4ZJVA 4UEUA 2I0EA 1YOLA 2XCHA 3Q4CA 3ZH8A 4O6LA 2VO6A 3PWDA 5CF5A 4X2NA 2ZOQA 4JQ7A 4QMOA 1SNUA 4PL4A 5FXQA 3U54A 3ORKA 3HNGA 5C27A 2IW9A 1IAHA 1PMEA 4AZTA 4R78A 3VBQA 4EI4A 3AXWA 4KINA 4G5JA 2A27A 3DKGA 3OOMA 2HY81 3GCPA 5E8TA 4USEA 3HAVA 5AWMA 3MB7A 4PWNA 2V22A 4YLKA 2PE1A 5I9XA 4YR8A 1OECA 3DV3A 3RPYA 3G51A 1Q4LA 2F7ZE 2IVTA 3QA8A 5E90A 4YZ9A 2ITWA 1CKPA 4MXCA 4L46A 3W16A 3OCSA 4F7LA 3PUPA 2JGZA 3ZZEA 3H9OA 4IDTA 1JSTA 3UMXA 4CYIA 2X8DA 2OJGA 3RGFA 5HTCA 2CKEA 4DGLC 5BNJA 3I0QA 5DIAA 2PZIA 3LCSA 4JT3A 4XG4A 4OTWA 4TYHA 4OUCA 3Q6WA 3U6HA 4E4LA 2WTWA 3QZIA 1BI7A 4BI2A 3SQQA 4O0UA 3KVXA 4JL9A 4M69B 5DA3A 3VN9A 5HG8A 2OIDA 3AG9A 4GCJA 4Z3VA 2OKRA 4FTOA 3S2PA 4DBXA 5I9VA 3LM5A 4PMSA 3UIUA 4XH6A 3O7LB 4L01A 2RIOA 4AP7A 4W4WA 4RVMA 5ANOA 3UC3A 3UVPA 3HGKA 4AN2A 3NR9A 1W82A 3S3IA 5CF8A 1P14A 3FKOA 4AS0A 5M4UA 3G15A 3RVGA 5CVGA 3G0FA 5DT4A 3LOKA 3IS5A 4FZ7A 3MV5A 5BYLA 3QQJA 4U43A 1B39A 1GZKA 4EOIA 5JGDA 3NGAA 4B6LA 4BICA 4NM3A 3NUYA 3D7ZA 3P78A 2BRMA 2OW3A 5CY3A 2H34A 3JUHA 3NUPA 4LV8A 4PMTA 1UKHA 2C3LA 5HNIX 4X2GA 4DLIA 2R3RA 4TNBA 4EH9A 2OF2A 3BIZA 1H0VA 3KMWA 2PPQA 5HLPA 5EHOA 4E73A 1WFCA 2EB3A 4FKJA 4ZLYA 5LWMA 4PY1A 2WU6A 3TT0A 1M14A 3ET7A 3Q96A 4RSSA 5FP5A 3V6RA 5CF6A 4C3PA 1SNXA 5KCVA 3NUXA 3QUDA 2VD5A 4BDDA 3W32A 5G6VA 4ZSAA 4XV2A 3E8EA 4IJPA 2ITNA 3VW8A 4DH1A 4E7WA 4CD0A 2W9ZB 5IZFA 5EM6A 3CTHA 5DN3A 3R9DA 2JDTA 4QMYA 5T68A 3OW3A 3VBWA 1F0QA 3NIEA 2XK6A 4X3FA 2RF9A 2GCDA 3C50A 3MBLA 3OVVA 2GS6A 4B9DA 3BYSA 4M15A 5H3QA 3HKOA 2PZYA 3EN6A 3F3VA 4OR5A 1PYEA 4E6CA 3DXPA 3MW1A 2EB2A 4BDKA 2VTOA 3D15A 3WYXA 3F2NA 3TM0A 5HU3A 2W99B 5IEVA 3FY2A 2JBPA 2OJIA 3LCKA 5ETCA 1UV5A 2Y6MA 3OBJA 4GT4A 4JR7A 4O83A 2YIQA 2ZV9A 2FSMX 4B99A 4O7LA 1RJBA 5IQCA 4E3CA 3TWJA 4F0GA 4A4OA 4YJUA 4FGBA 3BZ3A 4RIXA 4I94A 5B2LA 1ZXEA 1P2AA 3SRVB 2A0CX 4HYUA 3BEAA 4F1OA 3DBDA 2YFXA 3COMA 2YCQA 3KXZA 3BU5A 5AR2A 4ZXTA 3TG1A 4OT5A 3TNHA 3LJ2A 1PRYA 4BBFA 3Q2JA 1PJKA 1Q8TA 3Q9YA 2XNBA 2YITA 4Z9LA 1Q24A 1J91A 3ULZA 4EC8A 2IN6A 5B7VA 2HWOA 3V8WA 4I0TA 2PULA 4GW8A 3UQFA 4ALVA 4GMYA 4RMZA 2XEZA 4ZS0A 4AA4A 4AGCA 5A4QA 4F08A 4WOVA 4FOCA 1B6CB 2PMNX 4EJNA 3IOPA 4WA9A 4B8LA 2F4JA 3BEGA 4K11A 3MVJA 4LG4A 5KO1A 3CSVA 2XIRA 3VS0A 4KBKA 4ANLA 1TQPA 1JWHA 3FZPA 4YLLA 4XBRA 5AR7A 4CRLA 1UNLA 4IM3A 2WQEA 3PSBA 3BYMA 2CDZA 4BYIA 4DGMA 5EG3A 4LI5A 3VF8A 3FMMA 3SLSA 4DGGA 1M7QA 4U0IA 2VO7A 3A2CA 4CCUA 2PMLX 4YUQA 2IZUA 1PY5A 4FV9A 4O0TA 1Y6AA 3UZPA 2O63A 2YIYA 2XK9A 3P7CA 4FV1A 4B7TA 2HZ0A 2PVJA 2YAKA 4V04A 3I7BA 4PP9A 3ELJA 3ZBXA 2J0KA 4MH7A 4IM0A 4U5JA 1XBBA 4L7FA 5CZIA 4U9AA 2C5YA 5K5XA 3W2PA 4FKSA 2C47A 2XJ2A 2WB8A 2WTJA 5AADA 4XG9A 2JFMA 2QHNA 2BFXA 2QI8A 5IQGA 5D7AA 5ANDA 2IW6A 3VIDA 2OZOA 2ZB1A 4KA3A 2AC5A 2B7AA 3RMFA 4AWIA 5LQFA 5CEOA 4TZRA 3QU0A 5HE1A 3UZTA 1OUYA 4DH7A 4DCAA 4NCTC 3SV0A 3OROA 3V5LA 2CKQA 4DFBA 5EK7A 3RZBA 4L8MA 4Q5HA 1WZYA 2XA4A 3IKAA 2V7AA 3HECA 3NWWA 2WIHA 4RGJA 5IQIA 4KBAA 3O51A 4DEHA 3GU5A 4C4IA 1JVPP 3FMLA 4J95A 1Q3WA 4LGGA 2Z7SA 4TRLA 3RI1A 1W8CA 2WEVA 3TTIA 3LIJA 2GS7A 2X81A 4WHZA 4C36A 4D9UA 2W5HA 2F57A 4FIJA 4O27B 5I4NA 5L4QA 3UTOA 2YM5A 4G3CA 3ULIA 2OLCA 2BCJA 3RK5A 4MBJA 1U54B 5DE2A 1O9UA 4OTFA 3VAPA 4A4XA 4FKVA 2C0OA 2A2AA 4OTRA 5DG5A 2UZOA 4EL9A 4WBOA 1Q8ZA 4MYGA 3ZCLA 2G2IA 3SX9A 3JR1A 4FNZA 4ZMFA 4PDPA 3V3VA 4NM5A 3H0ZA 4IHPA 5BMSA 4Z7HA 5GZ9A 4C4HA 3ITZA 2PVMA 2V62A 4M12A 1Z5MA 4UV0A 3D2IA 4XG3A 3C4XA 4MTAA 4Y95A 2W1FA 2YWVA 3W2OA 2JDVA 5DWRA 5J9ZA 1IA8A 4XRJA 3NPCA 4LMNA 5EHYA 2J0LA 1A9UA 3I6WA 3CTQA 3JY9A 3TL8A 1U59A 2CLXA 4EORA 4FKOA 5FEDA 4O7VA 2OH0E 3QHRA 3ZUUA 5KHWA 1OKWA 2CCIA 3F6XA 5HTBA 3KMUA 3NRMA 5HU9A 2P2IA 4PX6A 2YIRA 4FV7A 4FG7A 3MH2A 3IG7A 2Z7LA 4FKLA 5FGKA 3LMGA 5EQPA 5F20A 4LOPA 2WD1A 3GU4A 3RWQA 2QO9A 5JZNA 3FLSA 3LCTA 2F2CB 5LMKC 5AUUA 4R3RA 3KKVA 2ITXA 3FLNC 4O0RA 4CCBA 1H1PA 2PUUA 1H0WA 1UWJA 3IW6A 1YOJA 2R5TA 1S9IA 4KIPA 5CAVA 4J71A 2GDOA 2HXLA 1FBNA 1YWVA 5A3XA 1NXKA 3WZEA 2ETMA 4D2SA 2ITPA 1Y6BA 3H3CA 3T8OA 1L8TA 5E8SA 4XCUA 4CMUA 1OUKA 2UZVA 4CTCA 1QPDA 3B8RA 3FSFA 3MA6A 4LGHA 3BWJA 5J79A 2EXEA 3A60A 3C13A 3D83A 3MFRA 4GEOA 4DLJA 1UA2A 3Q53A 4R77A 4YJSA 3D4QA 4I0SA 4S30A 2ONLA 4HCTA 3P7AA 4I23A 4V05A 4YURA 3JYAA 2WTKC 4HYHA 2QG7A 2HW7A 1MRYA 4HCVA 1HCLA 4ANMA 1WVYA 3IDBA 4P90A 3KL8A 2VTRA 3B2WA 3P7BA 4RIYB 4QYFA 2XEYA 5D10A 3RNYA 3L1SA 3C4EA 3OTVA 2C4GA 4FKTA 2OO8X 4PUZA 4EKLA 2C0IA 3QRKA 3KFAA 4K33A 3QCYA 2R3MA 4PDSA 3RJCA 2XNEA 3GENA 3FXZA 1JAMA 5AEPA 5IA4A 2DYLA 4JBPA 4NKSA 4N4SA 3SXSA 5J1WA 4YHTA 2XK4A 3NNXA 3P5KA 4HYIA 4KKHA 2RSVA 1YWNA 3E92A 2QKWB 3LW0A 4IVAA 4QP6A 3H9FA 4XBUA 2XIXA 5A9UA 3R0TA 5J5TA 2WMTA 1MRUA 1OIRA 4NK9A 4O82A 4II5A 3I60A 5M55A 2WOUA 4PPAA 5HX8A 2WTIA 3A7JA 4XS2A 4O0VA 4YC3A 4FR4A 5CVHA 4RRVA 4RX9A 3QWJA 5CSHA 5HVKA 3L9NA 3OS3A 3EH9A 3OP5A 4DFLA 2GNIA 1Z9XA 3AC8A 1ZAOA 4Y5QA 5IMXA 1SZMA 4FTNA 4BYJA 2X7FA 3CQEA 3O0GA 3WF9A 2C1AA 2HYYA 3CIKA 3OWPA 4FL3A 2F9GA 4L53A 1YI6A 4LRJA 5CI6A 1ZYJA 5DR6A 5ANJA 5HVJA 1OBGA 3FI8A 3TV7A 4ZY5A 3MWUA 2HZ4A 4G3EA 2WMUA 3ZLYA 4GS6A 2R3LA 4AT5A 3VS4A 3ZBFA 3UG1A 4YO6A 3NW6A 4I21A 3C1XA 5DI1A 4MKCA 3KRXA 4TY1A 2NP8A 2VWYA 2Y6OA 4RIOA 3NAXA 2OXYA 4WNMA 2J2IB 4XP2A 5E7RA 5CASA 2B9JA 3G9NA 1TKIA 3A8WA 2PY3A 3PPZA 5M57A 4XV1A 2ZM1A 1P5EA 2YERA 4GL9A 3IECA 3ZU7A 4CRSA 5EKNA 4BIBA 5FM3A 5I9UA 5LCJA 4I20A 5C4LA 4MQ2A 5TF9A 2PMIA 2CNUA 3NNVA 1PXIA 1UKIA 2W1DA 3C0GA 2JEDA 4MXXA 2FSLX 3CGFA 3DKOA 4QP8A 4ALWA 3FZRA 3DBEA 3OHTA 4YTFA 3OW4A 2ZV8A 4NTSA 4FEUA 3IW7A 4OTGA 4PP7A 3CGOA 5IA5A 3U9CA 2RFDA 1G5SA 2FSTX 5K0XA 3R83A 3ENMA 4FG9A 3M2WA 1JKTA 4IWPA 4ALUA 4CV9A 4EBVA 5CSVA 3HMMA 3DY7A 3PWYA 3KXNA 3LJ1A 2XVDA 4EHZA 5DEYA 3DZOA 3BYVA 3S1HA 5AUWA 2X6EA 4EUTA 4RZWA 3UO6A 3HV3A 4IZ7A 3U8WA 1H26A 3FLWA 4AZEA 2YEXA 4O7WA 4QMMA 4A9UA 3VQUA 4I0RA 3R7EA 3TZ7A 3OF0A 3VUDA 1Q8YA 2I0HA 5M07A 1ZMUA 4A7CA 2BRNA 4JLCA 2VWZA 2ZB0A 5HO7A 5JH6A 3MGYA 1JNKA 3RAKA 1KE7A 1GY3A 4EZ3A 1UU3A 4R7BA 4O2ZA 3RK9A 4BZNA 1IEPA 2VWUA 4FSWA 4ACHA 4CMOA 4FTLA 4PL5A 5BVKA 5EI6A 3PLSA 3UNJA 4RJ5A 2QOLA 2HIWA 2SRCA 4EKKA 2VN9A 3Q32A 3HRCA 1E9HA 4ZLOA 2WELA 3UZRA 3C4FA 3UYTA 4OAUC 5DT0A 3MVLA 1MQBA 4DBNA 4C4GA 2UZNA 3QXPA 3BX5A 1JBPE 4CFVA 2R0IA 3FQEA 4MQ1A 2QOOA 3FLQA 4CYJA 4EQUA 4FK6A 3PVUA 4IAFA 4TPTA 3VS7A 4J8NA 2VGPA 4DFYA 5GZAA 5IQFA 1KV1A 4NIFA 4LOOA 3LM0A 4M97A 3R9OA 2B54A 2CCHA 3QGYA 4G5PA 2R3NA 5HG7A 3B8QA 2X9FA 4YP8A 5CAUA 2XIZA 3G6HA 3PRIA 3TKUA 4G6NA 4ZSLA 4APPA 2G15A 2VNWA 4NT4A 1V0PA 4ERWA 2BKKA 4QMSA 3LJ0A 3LFBA 4DFZE 4EHEA 4CFWA 3OY3A 3QD4A 5HIBA 1MRVA 3WBLA 4QYHA 4RZVA 1OIYA 3HMOA 2C3IB 3LFCA 3ZZWA 3UG2A 5IA1A 5AAFA 2WMQA 3PXYA 3QYZA 5GJGA 2Q83A 4AXAA 3HYHA 5KX8A 5AP3A 3PYYA 2W1EA 3OD6X 4FEQA 2QOIA 4FL1A 3VS3A 1OL2A 4BDHA 5IH6A 3C51A 5IQAA 1I44A 2XKDA 3VUTA 4BCHA 2C5VA 2C1BA 2W96B 3GCVA 3U9NA 4U7ZA 4ACCA 1YWRA 3ANQA 2FH9A 2OI4X 4WO5A 3R8ZA 1YXTA 3U51A 4MXAA 4QP9A 3R7GA 3ZO1A 2QOHA 4ITJA 3SHEA 3O8UA 3QXOA 2UZDA 3R22A 4M0YA 3ZSHA 2FVDA 3BRBA 4R6VA 3UDBA 1FOTA 4QP7A 4RVTA 4XUFA 5DH3A 5EOBA 4ASZA 5KKRB 3CC6A 3IO7A 4DTAA 4DFXE 3COKA 4RC3A 2J50A 2R3HA 5AR3A 1UWHA 4BGGA 3OEZA 3OZ6A 2C68A 2WEIA 4XP3A 3W18A 5JMSA 3NVMB 3LFAA 1P4OA 3QBNA 5CU6A 3DFCB 3DPKA 3ZM9A 4BZDA 3RPVA 2RKUA 1W84A 2PK9A 2B55A 4NWMA 4QPSA 4MWHA 4AZSA 5AUTA 2CNVA 3GEQA 4HGEA 4K8AA 1GJOA 3A62A 2XK8A 2PZPA 3JY0A 3IW8A 3I4BA 1A48A 4O7SA 3M11A 1GIHA 3HV6A 3A4PA 3MY0A 2QODA 4MBLA 4X3FC 4X7QA 3F2AA 2VWWA 3W10A 4F6SA 3DXQA 2I40A 3VWAA 2R3PA 4XG7A 5JRQA 4BC6A 5HNBA 4CZTA 4H39A 4X2KA 4CFMA 4HVIA 3F5GA 2RG5A 3AT4A 4MD8E 3F66A 3CKXA 3AC3A 4F7SA 3CTJA 3LMHA 5IH5A 2V0DA 5BMMA 2CJMA 1R3CA 2GNHA 4AW2A 4E4MA 2J5FA 5AR5A 3RAHA 4EOPA 2YISA 4IIRA 3D14A 4Y5HA 3NMUF 4I4EA 3DOGA 5HOAA 3SOAA 4GUEA 3BHYA 3M42A 4OTHA 4HNFA 4ZZOA 3IDPA 4JQ8A 4YJNA 1VJYA 5IEXA 5JN2A 1SVGA 2ZV2A 4MCVA 5FBNC 2XBJA 4O22A 1URCA 2Z7RA 3QQFA 2VTTA 3AD4A 4Y46A 4WT6A 4ZTLA 4YLJA 4KKEA 1ZOHA 1FVVA 2OIBA 2UZBA 5AUXA 2Z7QA 3H30A 3R9NA 4D1XA 1NVSA 3FC2A 1IR3A 4P4CA 4I4FA 4I41A 4GYGA 4X0MA 5G1XA 5DNRA 4D28A 5AP7A 3U6IA 4Y73A 3DKCA 4YZDA 3S95A 2YAAA 3Q4UA 5HHWA 5HICA 5JQ8A 3LXLA 1PXOA 3PLAE 3DQWA 3BLRA 3R30A 4QMQA 1L3RE 2YCRA 1YDSE 3LPBA 3FZ1A 4FE2A 3AC2A 4RX5A 2PWLA 5LVMA 5FEQA 3PP1A 4FEWA 2QR7A 4FZ6A 4V0GA 4IADA 5LMAA 5CNOA 3UYSA 3MPAA 3TIZA 5C26A 2W1ZA 4D2VA 5AMNA 3ZXZA 4L3PA 2PZRA 4FTMA 4U6RA 4CFFA 3D5XA 4QP4A 2X39A 4BI1A 5BQ0A 1HOWA 3KB7A 4EYJA 1WBSA 3CCNA 3KXXA 4FT0A 2XS0A 3KU2A 3LKMA 3COHA 4BCPA 3ATTA 1ZARA 4XYFA 5CXHA 4XRLA 5AP5A 4ACDA 3ORIA 3KVWA 5CZHA 2IWIA 3PPKA 2PVKA 3E93A 2NO3A
chains in the Genus database with same CATH superfamily
4EWQA 3ATSA 2JKKA 3PE2A 1Q62A 5BVNA 1TQMA 4B8MA 4YNOA 4CEGA 4D1ZA 4HOKA 2NYAA 4RC4A 3QQGA 4TYGA 5CLPA 5HCZA 1LPUA 4ZSEA 4TYIA 5F95A 4XLVA 5K4JA 4UXQA 5K0KA 4KSPA 4IXPA 1WCCA 3NYVA 4FTKA 5I9ZA 1HCKA 4EOQA 5KE0A 3PXRA 4IVCA 5H9BA 1JKKA 5BVFA 4FT5A 4YJPA 4OLIA 1JSUA 3R9RA 4ZEGA 5CAPA 4IX5A 2QKRA 2BDFA 5DPVA 3KMMA 3O23A 4I24A 1NY3A 3QLFA 2OG8A 3ZUVA 4E5WA 3EWHA 4FF8A 4LUDA 5AAGA 5L8KA 2WMRA 4AZVA 4NTTA 3LLAA 5T3QA 4CGAA 2VUWA 5DHJA 3VHKA 1LP4A 2BZHB 3I79A 2XRWA 5GIOE 3VQHA 2XYNA 1FGKA 2YM8A 4QQJA 4PV0A 3EZVA 2QD9A 1XR1A 3EMGA 3TCPA 5C4KA 3RAIA 4YGAA 3JPVA 4QMZA 5DR9A 5HBHA 5KMLA 3P4KA 4IH8A 5EYDA 4AGUA 1OL1A 3TZ9A 3V04A 2X0QA 5M08A 4KIOA 1ZYDA 2BZKB 3FPMA 1VR2A 3Q4ZA 3QTUA 4NJDA 4OTDA 3EN7A 4JDKA 1MQ4A 1IRKA 3L9LA 4PRJA 4OW8A 5C9CA 4NEUA 4AGDA 5E91A 3KC3A 4C58A 2BRHA 4QTCA 4BTKA 4LGDA 2VTNA 4CXAA 3AGLA 5CSXA 4BDEA 1BI8A 2XIYA 5GJFA 1R1WA 4BCOA 3ORTA 4C2VA 1ZYSA 2O2UA 3BGPA 3MJ2A 2PVNA 5EFQA 4CLJA 5J9YA 4UZDA 2ZAZA 3C7QA 2UW5A 1ZYCA 3MYGA 3ORLA 3GCUA 3LFNA 2XKCA 4GT5A 4C02A 2BKZA 5IU2A 3NUAA 5HBJA 3POOA 3IDCA 4JRVA 3QAME 1X8BA 2BAQA 3Q9WA 2QNJA 3D5UA 3QKMA 2W9FB 4G1WA 4L44A 1WBVA 2UZUE 1H1SA 3WYYA 2R2PA 3V01A 5KBRA 5AFVA 5CEIA 4ZJIA 3VF9A 3VUKA 4BWXA 3BELA 2JIUA 3FZOA 3KCKA 5HG5A 3RCDA 3FPQA 3KXHA 3VUIA 1VZOA 4TXCA 3L9MA 2HY0A 3LCDA 4F7JA 4DA5A 2QLUA 5FM2A 5IUHA 3LFEA 5KMKA 3O7LD 4UMQA 3QA0A 3QD3A 3ZEPA 4I6FA 1RW8A 1FQ1B 4BHNA 3FYKX 5AUZA 1ZMVA 4IM2A 4UXLA 3GXLA 2QOFA 3UE4A 5BV3A 4FNYA 4BF2A 3NNWA 2WMXA 3EOCA 4F09A 3DGKA 3OCGA 4FJVA 1LEWA 1OL6A 3QF9A 3C9WA 3EFJA 3TACA 3ZLXA 4ZS4A 2HWPA 4RWLA 5EYKA 2C3JA 3PA4A 4UWCA 3VO3A 4QOXA 4DEBA 4F1MA 3PDTA 1J1BA 2WQBA 4BGQA 3WZDA 1O6LA 2GNGA 3EQRA 3CY3A 4OGRA 3VBTA 3COIA 4YU2A 5FUTA 3GBZA 3IW5A 5L3AA 3CJFA 4F9YA 1GIJA 1YI4A 2XAMA 4H36A 3HMIA 3CP9A 1CMKE 1U5QA 4AXDA 3ZO2A 5M53A 1OIUA 4JIAA 4BDJA 3JXWA 5ETFA 4RWKA 3TUCA 4F9WA 3AOXA 3PA3A 4YTCA 3IONA 4YJVA 2WQMA 4K1BA 2XJ1A 4IMYA 5HD7A 3HMNA 4JBQA 3TNPC 3QD2B 5CT0A 3UJGA 3NNUA 5DFPA 2BPMA 2XH5A 3LQ8A 1WBPA 5HCXA 3CXWA 4QQCA 4EONA 4ZLZA 2I7QA 2PVHA 3OG7A 3BV3A 1H25A 3E8DA 4UYNA 4PF4A 4O0SA 5AP4A 4ZTRA 2CGXA 4RPVA 3UPZA 4JVGA 3PRFA 4GYIA 3R01A 3GU7A 3BYOA 3RTPA 3ALNA 4S34A 4L7SA 4FIFA 4GK3A 4FSNA 4DEIA 2IW8A 4AOTA 4LMUA 4X21A 5C8KA 1RE8A 4O7YA 2RFEA 2B9IA 4FOBA 2WOTA 4I6LA 3ZC6A 3CS9A 2BROA 5L2WA 4ZTSA 4I6HA 5AV3A 5HORA 4X2FA 4FZDB 3DU8A 1XH5A 2UW7A 4L42A 3HLLA 2A19B 3BPRA 2IVSA 4CQEA 2QR8A 2GQRA 3F3TA 1PF8A 1YI3A 4U80A 5HVYA 4E93A 5EM8A 2XNNA 4AG8A 4R1YA 2Y8OA 5AUVA 3EFWA 2BRBA 5AP2A 5HZNA 4O2PA 1PYXA 1YXVA 5JKGA 2ITYA 4GRBA 4EOJA 4E6DA 2GQSA 2DUVA 2OZAB 2WZJA 2X2KA 3BWFA 2G9XA 4C33A 2QHMA 4G16A 4S32A 2C6TA 3E5AA 3F5PA 3R2BA 3V5WA 4IX3A 4X6QC 4IWQA 1YXSA 1CTPE 5AX3A 3SOCA 5I9YA 5F4NA 3OFMA 3QL8A 5AR8A 1PMNA 3C0HA 3QKKA 4KIKA 3AC1A 4HGLA 3OXZA 3AKLA 4TNDA 3NX8A 1LUFA 3BHHA 3MH1A 3GI3A 3QD0A 4WKQA 2OU7A 1A06A 1TVOA 3BE9A 4W9WA 1GIIA 4QMUA 4CKJA 4D9TA 4AE6A 5M4IA 3UIXA 3HP2A 4BY9E 4DEAA 1UNHA 4QTDA 5CS6A 5AJQA 3BCEA 2QOKA 3W1FA 2V7OA 3FL5A 4IWOA 4LRKA 3WZUA 2IZTA 4FSRA 1GNGA 4HPUE 3AT2A 5CYIA 1ND4A 4QQTA 2ZDUA 1XBCA 3N51A 3HVCA 5E4HA 3QHWA 4N70A 3EYGA 4YJOA 3ZEWA 5IG1A 4EOMA 4DDIA 3I81A 4DG3E 3MTLA 2B53A 3FC1X 2J0IA 2CSNA 4EOKA 1ZOGA 5B0XA 4GKHA 1WBWA 4QPAA 4IB5A 2H9VA 3IGOA 2JDRA 5M4CA 1OPJA 3O96A 2UW8A 3QALE 4YTIA 1YDRE 4OAVB 2WFYA 4C57A 4EH2A 2CGWA 3L8VA 3NYOA 2JDOA 1XJDA 5GIPE 2ERKA 3FDNA 4IZ5A 3Q9ZA 3VVHA 3PY0A 3TV6A 2QONA 4K18A 4KBCA 1LEZA 2H6DA 4FK3A 3R21A 4EK6A 4M69A 5L6WL 3NVKI 3PSDA 3QZFA 4QP1A 4S33A 5E8YA 3CJGA 4RIWB 2GTNA 4QMNA 5AV2A 3TIYA 3NW7A 5BYYA 3UQCA 3SXFA 5ITAA 5FEEA 2ZV7A 3QQUA 4PMMA 3JS2A 4DEEA 3P79A 3ACKA 4PL3A 4FGRA 3AT3A 1J7IA 5TR6A 3DNEA 2O0UA 4EUUA 3P9JA 4LV5A 3TNQB 4RC2A 2XP2A 1Q41A 3E7OA 4BGHA 1VLRA 4D58A 2RFNA 5CU4A 3V51A 4JBOA 2GQGA 3NUNA 3ZRMA 2GPHA 2QOCA 1SMHA 2Y4PA 3DBFA 4H3QA 1H1RA 5HD4A 2C6OA 4E6AA 3ORZA 4G17A 1YKRA 3C4WA 2X1NA 3MESA 4I5CA 3F3WA 4M68A 4EQCA 4E20A 1CSNA 4TN6A 3UOJA 4XV3A 3TDVA 2YDKA 4DGNA 3FBVA 4IVDA 3LQ3A 4FVRA 4AA5A 3DS6A 4Y8DA 2PTKA 4D4VA 4Q9SA 3W8QA 5KMOA 1B38A 2OSCA 4E4XA 4PTCA 4G3FA 1W7HA 2IZSA 3KQ7A 4H1MA 4OBOA 2NRUA 3AGMA 4ZY4A 3BKBA 3FI3A 3P0MA 2JBOA 4GT3A 5HCYA 4XOZA 3KREA 3NW5A 4FSUA 4IB3A 1WMKA 3QRTA 4Q9ZA 5DT3A 2BIYA 3DBQA 3BHUA 3L8PA 4AT4A 3BV2A 3ODZX 3FHIA 4FNWA 5BPYA 3E87A 1V0OA 2UZLA 4IAZA 3S4QA 5TT7A 3F5XA 4K6ZA 4GV1A 5BUIA 1STCE 2C5NA 2C0TA 2R64A 4YO4A 1XBAA 4UMRA 3F2RA 4A4LA 2VZ6A 2WGJA 2Z8CA 3RWPA 4CZYB 5AV4A 3FXXA 4CG8A 1F3MC 2FA2A 4FTCA 4EOSA 1JLUE 3VS5A 1GZ8A 4EQMA 4LV7A 1H1WA 5BVEA 5JQ5A 2PVYA 4M3QA 2G2FA 1VEBA 4ZOGA 4JX3A 4I92A 4QTAA 5E8VA 2PYWA 4BVUA 5HG9A 5AP0A 5AA8A 2FO0A 3FY0A 5JZJA 3KRJA 1SVHA 4CNHA 3PSCA 3AMBA 4JI9A 4RLLA 4DH5A 4LYNA 3N4UA 3SRVA 3HX4A 1Y8YA 2WPAA 3POZA 3DNDA 3GOPA 4GKIA 3DLZA 4BHZA 1OITA 1KOAA 4BCNA 2OGVA 2JLDA 1UU9A 2LGCA 4H3PA 5ANKA 4R1VA 4LQMA 4W9XA 2VWXA 2WTKB 5BVOA 2Q0BA 5M09A 4OBPA 2PMOX 4PQNA 1H24A 4RWJA 5CT7A 2W1GA 3RPOA 2YM3A 3KK9A 4JBVA 5JT2A 3ZFYA 4J8MA 5L8JA 2C5XA 3G90X 4BCQA 2YCFA 3GUBA 5LARA 4MNEB 4CKIA 3H0YA 3V5JA 3CKWA 4D2RA 2I0YA 3RM7A 5K9IA 3SGCA 1J1CA 2KULA 2OJJA 3HV7A 3DA6A 3ACJA 4G3GA 5FTQA 1WBNA 5GZ8A 1ZZLA 2I1MA 3OMVA 1Q61A 2UVXA 4FV5A 4RFYA 4C4FA 2GMXA 4EH8A 3VONA 3PXFA 5L2SA 4H1JA 5CENA 2OK1A 2UUEA 2VTIA 2W5AA 2X7OA 4GG5A 3IW4A 4HNIA 3LFFA 3E62A 3A7HA 2F7XE 1FVRA 3FKNA 1KE6A 3LFQA 4EK8A 4HZRA 3E63A 3KULB 3V8TA 2ZMDA 1XH6A 2UW9A 3PIZA 3OT8A 2YDIA 3GU8A 3KCFA 4O1OA 3WE4A 1H27A 3AQVA 2VTJA 4HW7A 3QX2A 3UC4A 3PJCA 4FV8A 2PHKA 3FSKA 4RQVA 3EN9A 3BLQA 2NRYA 2WKMA 2XUUA 3GC8A 3R2YA 3T9IA 4ZJJA 5EYCA 4KSQA 3K5UA 4IAKA 2E2BA 2P3GX 4O38A 5LVOA 4ONAA 4FEVA 4KUJA 2EVAA 5EM7A 1H8FA 2P2HA 1Q8UA 1T45A 2XYUA 3DK7A 4FT9A 3DJ7A 4IDVA 5FP6A 4CVAA 1G8KA 4UX9A 4N57A 1Y57A 1OVEA 2OF4A 5AP1A 3RK7A 3EQBA 4YPDA 1OIQA 3I7CA 3LMIA 3O8TA 4YPSA 3KK8A 2G01A 2X0GA 2VTMA 3UQGA 4FV0A 5ANGA 4A9SA 1DI9A 3TKHA 3PP0A 4HCUA 4I6QA 2R3GA 4G9CA 1GOLA 3P1AA 3Q9XA 4GIHA 4DTBA 4D1SA 4AE9A 3DAKA 4EK5A 1QCFA 2R4BA 3R6XA 2PE2A 1K3AA 1FINA 4FC0A 2QU6A 1G8AA 4FVPA 2ZVAA 4PDYA 3R7IA 3A4OX 1K9AA 1YXUA 4C37A 3SW7A 1QMZA 1XH8A 1U54A 4KB8A 2WU7A 2XKFA 4BJJA 3PJ8A 4ZTNA 2B4SB 4O0WA 5EDRA 4BI0A 4E4NA 2BAKA 3HRBA 3E64A 3WZJA 4HZSA 2VO0A 4GVJA 3KA0A 5KZ0A 3O50A 4QO9A 3TTJA 3V8SA 4EYMA 3TMOA 4FTTA 1KV2A 1W2FA 3LQ5A 1IAJA 3KEXA 4IACA 4BRXA 5EOLA 3S00A 5J87A 2W1IA 3W2RA 4O0XA 3TDWA 3LHJA 4RJ3A 4WG4A 3K3IA 4XV9A 5C01A 4BDAA 4HVGA 3O5AA 2ZYBA 3E3BX 4GFOA 4DC2A 4F65A 1T46A 3AMYA 3R8VA 1GAGA 3ZTXA 4QNAA 2JDSA 5M4FA 4LL5A 3FEGA 2YZAA 4UB7A 3NDMA 4FV3A 2PUPA 1AD5A 4UALA 3OTUA 5A6NA 2ITZA 4L43A 4XLIA 5D7VA 3D9VA 2C6KA 3QTZA 4S31A 3WIKA 1REJA 3CLYA 3BHTA 4IANA 5HO8A 2O64A 5A4CA 1M52A 2X2MA 3OUNB 2JAMA 1OZ1A 4EWHA 1DS5A 4J7BA 3R00A 5HGIA 1XH4A 4RX8A 4WNKA 2EXMA 3DXNA 3R02A 4X2JA 3V5TA 4C4JA 4TL0A 5HE3A 5A46A 3NLBA 4FKIA 4YSJA 3E88A 3VBXA 4BDCA 3R7VA 3U54A 3KY2A 4TYHB 2R9SA 3PIXA 3I6UA 4FTRA 4MX9A 3FQSA 4J97A 5EW8A 2OBJA 3HA8A 4FUYA 4O1PA 2J0MB 4W4XA 2XNMA 3IOKA 4W4YA 5JGBA 3IGGA 4G2FA 4AOIA 4C4EA 5FD2A 3W8LA 2QC6A 4MF0A 4TTHB 3U4UA 3UNKA 1KWPA 2J4ZA 3A7IA 3CPBA 4NUSA 4UMTA 2XB7A 5DMZA 5IKWA 1ZZ2A 3DAEA 4F9CA 3SXRA 2R3FA 3EQHA 2VX1A 4XOYA 4ARKA 2OWBA 4CSVA 1W98A 1Z57A 2C6IA 3AMAA 4G6OA 3WF7A 1BKXA 4GU9A 2Q0NA 2B9HA 1ZOEA 3D94A 5AIRA 4ZAUA 5JFXA 4L3LA 1V0BA 2WMBA 4I5PA 3H10A 4MNFA 5BX0A 4J98A 4O7TA 3G0EA 3ALOA 3LXPA 4RIYA 2X8IA 3UPXA 4N6YA 4BTFA 4DH8A 1UNGA 3MB6A 5B2KA 1G8SA 1ZWSA 3HUBA 4ENYA 4YZCA 5FG8A 4D4RA 4QYEA 3BBTB 4E6QA 3UBDA 2V5QA 2J51A 2VX0A 1M17A 3GVUA 3O8PA 3R73A 4NU1A 1YXXA 4JG6A 2JKOA 2OFUA 3RBWA 3PFYA 2VWVA 3QRUA 4U42A 4LUEA 3KN5A 2YJSA 4FV6A 4WNOA 4QMXA 2BHEA 4BWKA 4M7IA 4A07A 4Z16A 2REIA 3MA3A 4ZSJA 4EC9A 4QP3A 4D55A 2VTPA 1IG1A 2GU8A 4HPTE 2WTVA 3MN3A 4MD7E 2PVFA 3R1SA 5FDXA 4TWNA 3Q60A 3MDYA 3MIYA 3DAJA 4CKRA 3EZRA 3C4ZA 3DDQA 3GQLA 4U41A 3C0IA 3NIZA 2IJMA 5DVRA 5CSWA 3R8LA 3UVRA 1AGWA 1PKDA 4R7HA 4FUXA 4ZTMA 4MBIA 4O4DA 2YM7A 3G9LX 3ZDUA 3TKIA 4ZZNA 5J7BA 4BL1A 2E9PA 2YM6A 2EUFB 3Q3BA 5L6PA 2DS1A 5EH0A 5IF1A 3UMWA 3QTWA 5HQ0A 3F5UA 3HRFA 5D12A 2YDJA 3R7YA 3WIGA 4EH7A 4X3FB 4RJ7A 2QCSA 5IPJA 5AR4A 4BFMA 3IQ7A 3MFSA 4BIEA 1KOBA 1FPUA 2UZWE 2BALA 2XNPA 4GJ3A 5IEYA 3L9PA 2O8YA 4FL2A 3MVHA 3SA0A 3R71A 4EHVA 4EJ7A 2E9NA 1WVWA 3QGWA 5AA9A 3NFFB 3FL4A 3BYUA 3BBWA 4F99A 2UW0A 2BFYA 3QTQA 2PUNA 3OCBA 2FSOX 2WQOA 5BVDA 5H8GA 1Y8GA 4XMOA 4F9AA 2W5BA 2XCKA 1FMKA 3HEGA 4QQ5A 2I6LA 1F5QA 3VW6A 5H2UA 4BKZA 4I5HA 2JAVA 4YHFA 2CKOA 3NAYA 5KZIA 4BN1A 3HUCA 4FT3A 5F1ZA 1OKYA 2OJ9A 5EI2A 4O96A 5LCKA 4XP0A 1XKKA 3CPCA 4P5ZA 3SAYA 2QLQA 1Q3DA 1PMUA 5FXSA 4C7TA 4M14A 3ZYAA 1DM2A 5E8ZA 5LVPA 2JD5A 4NM7A 2YWPA 4W8DA 4LL0A 3WF5A 4Y83A 2YHVA 3CY2A 3FKLA 2E9VA 4C3RA 2XBAA 3KRWA 3KF4A 4U79A 3QWKA 4D2WA 3G6GA 3EQIA 2HAKA 3PFQA 4NYEA 3VS6A 3ZLWA 4C2WA 4IX6A 4WBBB 4RX7A 2Z02A 3AC5A 3ZFXA 2YIWA 4BCMA 5A14A 1ST4A 5HO6A 4I3ZA 3OWKA 3F3ZA 3DK3A 4ZP5A 4ITIA 1JQHA 4F63A 3RPRA 4ZSGA 5IDNA 3UIBA 3S0OA 1QPEA 3LXKA 5M56A 3D5WA 1E1XA 4CV8A 5ANIA 4YSMA 2FYSA 4L6QA 2C5OA 1NVRA 4ZY6A 4ITHA 3RHKA 4AU8A 1ZMWA 5F9EA 2F49A 1PMVA 1Q5KA 4U81A 3UNZA 3ZFMA 4D5KA 2XMYA 5LXMA 4NM0A 4JG7A 1XMLA 5B2MA 3R1NA 3SC1A 4FKGA 1H07A 2X4ZA 5E92A 5H8EA 3PJ3A 4EH3A 3F9NA 3G2FA 4YBKA 4C0TA 3FLZA 2BDJA 2BUJA 4F78A 5L8LA 1Q99A 3NFGB 1VYWA 2VWIA 3P08A 3CQUA 3L8XA 3ZM4A 2ITVA 3QLGA 3DZQA 3ROCA 3A8XA 4NFNA 4NZWB 3QCXA 5CXZA 5CVFA 1PXLA 1OGUA 2UVYA 4ID7A 3DJ5A 4MXZA 2O3PA 2YACA 3RALA 3CR0A 4RG0A 2AUHA 4P5QA 4YJQA 4LFIA 1KE8A 1U4DA 4GFMA 2YN8A 4L00A 2BDWA 4TWOA 4DINA 2QO2A 2CNQA 1H01A 5CEQA 4F7NA 4BZOA 2C6EA 2VNYA 3ZOSA 4C34A 3PY3A 2HOGA 4FIGA 3QQHA 4BBEA 5ACKA 4AFEA 4DT9A 5DR2A 2OXDA 4WRGA 4U3ZA 5C1QB 2XK3A 3ID6C 3T9TA 3ORMA 5L2TA 4GJ2A 4U97A 4OTQA 5EQYA 5HX6A 4ZZMA 3WF6A 4CLIA 4DG2E 1YW2A 4E5BA 4XNEA 2G1TA 4Q5EA 4IAAA 5J1VA 5CEKA 2IZRA 3GGFA 3F7WA 2PE0A 4IE9A 3QZGA 4JDJA 2G2HA 4PTGA 4UWBA 5TO8A 5EDPA 5D9HA 4QMWA 5M44A 4WG5A 4AACA 3R04A 5ANEA 1MP8A 3HZTA 4MK0A 4AX8A 4FICA 1J7UA 1OKVA 2WHBA 3R9HA 5FQDC 3FXWA 5CX9A 1PXNA 4AN3A 3VRYA 3HMPA 3PXKA 2R3OA 5CQWA 1CM8A 5A4EA 4R3CA 4WG3A 3W2CA 2P33A 2W1HA 3A7GA 4E26A 2XALA 5FXRA 4IB0A 2JC6A 5HIDA 2YCSA 3WARA 3D5VA 3CE3A 3QZHA 3G33A 4MF1A 2GFCA 2ZDTA 4H58A 2J7TA 4RVKA 3DKFA 3T3VA 4BTMA 5C8MA 3ENHA 3DB6A 4MAOA 4YBJA 2OH4A 2VTSA 4BDGA 4JQEA 1R0PA 4OT6A 4GH2A 5JK3A 4EK4A 4MWIA 5F94A 1JSVA 2BHHA 4M0ZA 3LLTA 4CG9A 3W55A 2BAJA 4GVAA 3RKBA 3ZMMA 2RGPA 2RL5A 3KRRA 4WSYA 4O7ZA 4CFUA 4L3JA 2OFVA 3QCQA 4TW9A 3NEWA 1YOMA 2ONLC 4R3PA 3U6JA 3RM6A 2BMCA 3GU6A 4BB4A 4PPCA 4RJ8A 1ST0A 2C69A 3K5VA 1OGYA 4FODA 5E8UA 3FLYA 5DEWA 4CFXA 3DLSA 2X0PA 4ANNA 5FBOA 4EEVA 3U87A 2ITQA 5JGAA 2FB8A 3Q52A 4ASDA 4Y72A 3GCQA 4E8AA 3U4WA 3N4TA 4H05A 5DBXA 2XF0A 5JRSA 2VWBA 3A61A 4XX9A 1URWA 3DBCA 1BMKA 5EM5A 3TV4A 1IA9A 3AD5A 4HJOA 5AV0A 4DYMA 5HESA 3EYHA 1V1KA 2ETKA 3EN5A 2UV2A 3QRJA 3RHXA 3DB8A 4DH3A 2W0JA 3LFSA 2WTCA 4FNXA 4PMPA 3PA5A 3GCSA 4JJRA 2OIQA 4YHJA 5LJJA 1P4FA 3PUFC 4KKGA 4AXFA 3PZEA 2W05A 3UIMA 3NUUA 2YZLA 3GC7A 4UZHA 4C35A 3QTRA 3RAWA 3UP7A 2R3IA 3UOLA 4E5AX 1FMOE 1TZDA 2O5KA 4D0WA 4L68A 5LVNA 1UU8A 3C4CA 3QRIA 4S2ZA 5A4TA 1FGIA 2A98A 2ZM4A 4U3YA 1JKLA 4YNEA 3RCJA 3WZKA 3ZC5A 2XRUA 4MHAA 3TJDA 3OC1A 3D0EA 3DQXA 4N0SA 4AW5A 2VO3A 1H08A 4IAYA 1OM1A 3P23A 2WMVA 2QOBA 2IEWA 3OXIA 1W83A 3OXTA 3NCZA 5CU0A 4FSTA 3UODA 2JIVA 3CD3A 4BR3A 1ZRZA 5KNJA 1PW2A 1DI8A 2QQ7A 3DFAA 1U5RA 2NNWB 2R0UA 4FYNA 2V55A 5CTPA 3V6SA 4BTJA 4FTIA 4HVHA 2QG5A 3R8UA 4KRCA 4AA0A 4NJ3A 4A9RA 3DK6A 3TNIA 4M84A 4AXCA 2BIKB 1QPCA 1AQ1A 3K3JA 5CWZA 4FZAB 5AIKA 3TZ8A 5AM7A 4RVLA 2AQXA 5JFSA 4LOQA 4M8TA 4DEGA 4R7IA 3B2TA 3MH3A 4G9RA 3OWJA 3GC9A 4YJRA 2NPQA 2C6DA 3K2LA 3R7OA 4O81A 4FBXA 2VTQA 3LXNA 3VBVA 5IQBA 1MUOA 2F2UA 3H4JA 3BLHA 3Q5IA 3VULA 5TKDA 5DRDA 3VS2A 4HGSA 3EQGA 1NW1A 4DTKA 2ITUA 4DITA 5I5ZA 2XIKA 4ASXA 3EQFA 5AP6A 5IA0A 4ZTQA 4C3FA 2B52A 2OXXA 3ORNA 3NYXA 4XG8A 3FAAA 4I5MA 5CQUA 4I6BA 1BLXA 1NVQA 4RJ6A 5L2QA 3GOKA 4RJ4A 4TT7A 5JSMA 1FVTA 1QL6A 1DAYA 4FKQA 3DTWA 4W4VA 5GNKA 1ZY4A 3ZONA 3KN6A 2P55A 3NUSA 4USDA 4C38A 4DFUA 4FKWA 2W06A 3FMDA 3FMJA 3PVWA 3LCOA 4JXFA 4ENXA 1YQJA 4W8EA 5HE2A 5LWNA 3U55A 4BKJA 3T3UA 5AX9A 3MJ1A 3WI6A 1APME 1H28A 5E1EA 3JVSA 1JPAA 5E1SA 2UZTA 5DLSA 2GHLA 2X4FA 3R1QA 3R1YA 4DG0E 5IMEA 1KSWA 2W4JA 4CMTA 3NYNA 4BKYA 2HELA 3UO4A 3EB0A 2W4KA 3VUHA 4K2RA 5ETAA 5EYMA 4C8BA 2AEGA 4O7RA 1KE5A 2AC3A 1Q97A 2A4LA 3ETAA 4FIEA 1ERKA 4IQ6A 4OBQA 5TOZA 3VS1A 3ZDIA 3BQRA 2WXVA 3PVGA 3BE2A 4RQKA 4U44A 4USFA 1IASA 3II5A 4QPMA 2CN5A 4P7EA 3CD8A 3WILA 4FKRA 1SVEA 3ZRLA 5M51A 4P2KA 5FTOA 4QTEA 4Q2AA 1YHSA 2WIPA 4C61A 5L2IA 5L6OA 4O84A 4AQCA 4FRFA 2PZ5A 4AZWA 1J7LA 3GT8A 5IQDA 1WBOA 1SM2A 1RQQA 1OBDA 1OI9A 3VNTA 4C59A 2BVAA 2WNTA 5CNNA 4UYAA 3E3PA 3MTFA 2BTSA 3IPHA 4WSQA 3TNWA 4F70A 4FT7A 4RA4A 4EH5A 4APCA 3P5JC 5D11A 4FI1A 4RLKA 4J99A 2GHMA 4GK4A 2RG6A 2Z60A 3VUMA 2ZJWA 1U46A 4ACGA 1W2CA 2B0QA 3FZSA 4I1ZA 4EBWA 4J96A 4FX3A 4IZAA 2UVZA 2AYPA 3QKLA 4FKPA 1E1VA 4EH6A 4L67A 5HEZA 1OPKA 3QTSA 4UBAA 4CT2A 1BYGA 3VJOA 2QO7A 2R3QA 2WQNA 3OUKA 4AW0A 3MPMA 4XJ0A 2ERZE 2HW6A 4NL0A 2VU3A 2QURA 5KMMA 2ITTA 1GZNA 3LFDA 4O4BB 3UVQA 5HIEA 4IBMA 2IO6A 4IX4A 3VJNA 5EHLA 3UGCA 4D4YA 4G3DA 2RFSA 2YM4A 4NIFB 4BCFA 4M67A 4GIIA 4RFMA 2CGUA 3I0OA 3GFEA 3PJ1A 3OCTA 4XG2A 3ZLSA 4NFMA 1YRPA 4F0IA 3FJQE 5J9LA 2H8HA 1KUTA 4QYGA 1H1QA 3EHAA 5AUYA 2HCKA 4EK3A 3RNIA 3OEFX 2C6MA 5LVLA 4FZFB 3EIDA 4AOJA 3VHEA 5M06A 5KUPA 1CDKA 4IAIA 4FSMA 4YTHA 4X6RA 3I5NA 4EZ5A 4QMTA 3AC4A 2YLFA 4BDBA 3SD0A 5J95A 5E9EA 2UW3A 4A9YA 3F82A 1CKJA 3F61A 3E7VA 1S9JA 5I3RA 2F7EE 3ML1A 4BCIA 2YJRA 3MVMA 4FVQA 4FTJA 1JOWB 3R63A 1M7NA 3BGQA 1O6YA 2PSQA 2YIXA 3GC0A 3OY1A 4JS8A 4F6UA 2HENA 3GFWA