4DC2A

Structure of pkc in complex with a substrate peptide from par-3
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
339
structure length
328
Chain Sequence
LGLQDFDLLRVIGRGSYAKVLLVRLKKTDRIYAMRVVKKELVNIDWVQTEKHVFEQASNHPFLVGLHSCFQTESRLFFVIEYVNGGDLMFHMQRQRKLPEEHARFYSAEISLALNYLHERGIIYRDLKLDNVLLDSEGHIKLTDYGMCKEGLRPGDTTSTFCGTPNYIAPEILRGEDYGFSVDWWALGVLMFEMMAGRSPFDIVGSNTEDYLFQVILEKQIRIPRSLSVKAASVLKSFLNKDPKERLGCHPQTGFADIQGHPFFRNVDWDMMEQKQVVPPFKPNISGEFGLDNFDSQFTNEPVQLPDDDDIVRKIDQSEFEGFEYINP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Substrate recognition mechanism of atypical protein kinase Cs revealed by the structure of PKC iota in complex with a substrate peptide from Par-3
pubmed doi rcsb
source organism Mus musculus
molecule tags Transferase/transferase substrate
molecule keywords Protein kinase C iota type
total genus 96
structure length 328
sequence length 339
ec nomenclature ec 2.7.11.13: Protein kinase C.
pdb deposition date 2012-01-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
A PF00433 Pkinase_C Protein kinase C terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4dc2A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4dc2A01
4CSVA 4G1WA 1OITA 4PL4A 5C9CA 3HMNA 3COHA 4E73A 2OH4A 5M57A 4NK9A 5BYLA 3VBXA 1ZOGA 2XK3A 4G3GA 4XOZA 5IQBA 1BKXA 2XH5A 3CPBA 1IAHA 1H01A 3W18A 3Q96A 2ZMCA 4OBQA 2DS1A 3MVLA 4FUXA 2VU3A 3C0HA 4YUQA 2GPHA 4IAKA 1JSVA 3C4FA 4PDOA 1JPAA 2YITA 5LMAA 3N4VA 4ZTRA 2BKZA 3FYKX 4JBOA 4KNBA 4WSYA 4QMWA 3G9LX 2W17A 4E3CA 4KAOA 1ND4A 1KSWA 3TJCA 3ZOSA 2G01A 4YJQA 3KC3A 2LGCA 3KY2A 3QLFA 4PMSA 3VUIA 5AM7A 1YRPA 3R7IA 3ANRA 3VS0A 5FEEA 4EH4A 1IR3A 4MNEB 1KV1A 3CQUA 4C34A 3L9MA 4R6VA 4RJ7A 3FC1X 4L45A 4TWPA 4KUJA 4YSJA 3EQBA 3FUPA 4F0GA 1WAKA 2R3PA 5KBQA 4F6WA 2XK7A 3GCUA 3A7JA 1Q4LA 5EYMA 2HZNA 4K11A 3LFAA 1H0VA 3VRZA 3LCSA 4I22A 4Q5HA 4AW5A 3DFCB 3FSFA 3IOPA 4A9SA 4Z16A 2C1BA 2C6EA 4E8AA 2VV9A 2OGVA 4DFXE 4F9CA 1FMOE 4BTKA 3VJNA 1JWHA 3IECA 2XKCA 4ZSAA 4NM7A 1A48A 5ANOA 3KRXA 4WNOA 3LOKA 5AUVA 4U3ZA 4BI0A 5HGIA 4DEBA 3MB6A 5HZNA 5H9BA 1Z5MA 3RBWA 5CXHA 1U46A 2CLXA 2XP2A 2XIKA 3NPCA 3DA6A 4U42A 1JKSA 1VYZA 2B52A 2X2KA 2OF2A 2Z8CA 3AMYA 3N51A 4FIGA 3R02A 1SZMA 4II5A 2ZM3A 4OR5A 4YJVA 2Z7QA 4QTDA 3LIJA 3RAKA 1PJKA 3PTGA 4R3RA 2GTNA 4IWQA 2GS6A 4QMTA 3H4JA 2HENA 2X7GA 5CS6A 1QPJA 4F0IA 1OL6A 2BRHA 1BMKA 3KN6A 1ZLTA 4I92A 4TYHA 4AFEA 5HU3A 2VRXA 3U4UA 4KSQA 5CAOA 2OXXA 1OIQA 4F7LA 4GU9A 2WTKC 5L6OA 4HNFA 3FMHA 3SW7A 4EC9A 2WTCA 4ZJVA 4ZIMA 2IVUA 2WTWA 3VRYA 2B4SB 3BE2A 4UXQA 5EG3A 3QQKA 5FTQA 5L3AA 2E9VA 3L8VA 2NRYA 4YPSA 4C38A 4IB3A 4EWHA 5DNRA 1LEWA 5CF4A 4J98A 2YN8A 3R1YA 3EQPA 4E5BA 3FMNA 4GYIA 2CHLA 5FDXA 4F9BA 2Y8OA 3IGOA 1UWHA 5AV1A 4M7IA 1KOAA 3PVUA 3GOKA 5D9HA 4C3RA 1GY3A 1K3AA 1PXKA 1Y57A 2BPMA 4CEGA 4G3FA 4LOPA 4AS0A 4DGOA 3WYYA 1M14A 3SA0A 2BZHB 5H8GA 5IQFA 4FTUA 4DC2A 4S34A 4ACCA 4EKKA 3NIZA 4KKGA 3QX4A 1OIUA 3NUNA 4FKVA 4MVFA 2IWIA 3DAJA 3EH9A 3PZHA 2YEXA 4U3YA 4UV0A 3TZ7A 4CZUA 2R3OA 2CNVA 2VTSA 2ETRA 4GUBA 5DWRA 4BWXA 3WF5A 2EXMA 3NUPA 3LAUA 4TYEA 2VWZA 1YI4A 5IQDA 2PPQA 4GT5A 2I1MA 3I60A 3QQFA 2XF0A 4AFJA 4TWOA 2C6OA 4DBNA 2OJJA 1OKVA 3HL7A 4UX9A 2WTKB 3OUKA 2C0TA 3KXXA 3P79A 4BDKA 5A6OA 3QQUA 2ZDUA 4OTRA 4AT4A 4L3LA 3POZA 3GC8A 4M8TA 3ZRKA 4ZP5A 4BI1A 4EHGA 3QHWA 3VUTA 4PP7A 5HE1A 3OOMA 3N9XA 3TTIA 4ACMA 4IWOA 4UWCA 2XB7A 4NSTA 3O0GA 3WYXA 3VUDA 3F3TA 2GSFA 4EK5A 4CT2A 1XH5A 3MFTA 1KE7A 4JR3A 4Y85A 3OXTA 5F95A 5JGBA 3IDPA 4LGHA 1YHSA 2OZAA 2JDOA 4WT6A 4TWNA 1DAYA 2WXVA 2Y6MA 4A9YA 4F0FA 3PPZA 3QTZA 4G2FA 2WU7A 1U54B 3C1XA 3F2AA 5DG5A 2YACA 5AP7A 4CLIA 1HOWA 3KKVA 3PDTA 4JL9A 5LVOA 3VC4A 1QPCA 1PXIA 2XRWA 3IW6A 3RMFA 1XBCA 2JKQA 5AP0A 5EM5A 3PG3A 4IFGA 4O7ZA 2EUFB 2C5XA 4W4WA 4BZDA 4BHNA 2QOKA 4DEGA 4EJNA 5IMEA 4EBWA 3TNHA 4ANOA 1J7IA 1G8SA 2ITQA 5IA2A 4L52A 3E7OA 4YJUA 3VJOA 4F65A 3OOGA 1HCKA 4FZFB 4ZY5A 5IH4A 5E91A 3D83A 4APPA 2I0VA 3R04A 3LLAA 3BV2A 3HGKA 4HGEA 3H9FA 3SRVA 4FK6A 3F3WA 5AR2A 5A4LA 2QOIA 2R0UA 5BQ0A 2CGUA 3COKA 3VS5A 2X9FA 3Q32A 4V0GA 2IW9A 3BWFA 1OPJA 1VR2A 3IKAA 3L8SA 3LXLA 5ANGA 4ZTQA 3K5UA 4FKIA 1XH8A 2X39A 4CGAA 1JBPE 2FH9A 3FI4A 4B6LA 3F2RA 2IO6A 2UZLA 3PG1A 5A3XA 3QTUA 4I20A 4ERWA 4WRSA 3AQVA 5E8VA 5GJFA 3M1SA 4D55A 3OXZA 3KVWA 4FL1A 4BCJA 4AE9A 4LM5A 2R4BA 3PY1A 4I0RA 2R3MA 4KBKA 3F3ZA 4FVRA 4M84A 4HNIA 2UZDA 2GMXA 4QMYA 5CSWA 5AX3A 3IPHA 4IJ9A 1DS5A 3GGFA 4CQGA 3EL8A 5AUYA 4YTFA 1IRKA 2JKOA 2W1DA 3ATTA 2BDWA 4G3CA 4I5HA 4GCJA 2QOHA 2OIDA 3V5LA 1UNLA 2NRUA 3R1QA 3E7VA 5HEZA 2I6LA 5CAQA 1WCCA 2H6DA 2X8DA 2WMTA 1JAMA 4I41A 4U79A 4V0GB 4ACHA 4BVUA 2QO7A 5IQCA 4YNEA 4ENXA 3C9WA 3R9OA 3SG9A 4DTAA 2HZ4A 3QGWA 3AC5A 4LGGA 3MN3A 3RPRA 5IG1A 2R7BA 4FIHA 3VAPA 2ITOA 3TNIA 4A7CA 4QMMA 4ZTMA 4OAVB 4YLKA 1Q5KA 3GU4A 1IEPA 4CMUA 3CP9A 4NEUA 3U6JA 5E8UA 5GZ8A 4EWQA 4P90A 1JQHA 4R8QA 3E64A 5K4IA 2R5TA 4O84A 4XUFA 4RFMA 3UQFA 5HCYA 5DOSA 4EC8A 2X6DA 2XMYA 4G3EA 3ORXA 2RG6A 4IX6A 1WFCA 3OW3A 1KE8A 3UP2A 4UMTA 2OJIA 3BCEA 3JS2A 4DGMA 3NUUA 4HPTE 4GV1A 2WU6A 4CFMA 5E8XA 4F6UA 3LCKA 2UW0A 4KIPA 2GHGA 3BHTA 4AWIA 3ROCA 2WEIA 4F6SA 4U44A 4YNOA 4QMQA 2VGPA 5E4HA 5AR8A 1W7HA 5ETIA 2JAMA 2VWIA 4JDIA 2PWLA 3A4OX 2CGVA 2VTOA 4GKIA 1V0PA 4EH9A 5M09A 5C1QB 4AZTA 2X2MA 2X9EA 4G5PA 5JEBA 4QMLA 4R7HA 5JN2A 3LFCA 5FM3A 1UNGA 1I44A 2HY0A 2VNYA 3ZLXA 4K8AA 1W0XC 2JDSA 4TT7A 2CDZA 4UWBA 5AP5A 2XIXA 4RC3A 5JZNA 3BV3A 2UW9A 4BDBA 2VNWA 3UZRA 3NYNA 3QD0A 2B9FA 1H26A 2G9XA 4BDCA 3NMUF 4DT9A 3QCSA 3OVVA 2GFCA 3PJCA 2UZNA 3UZTA 4ANNA 2NNWB 2VTJA 4YTHA 4E5AX 2QKRA 4QYYA 4YZNA 3VUMA 4BCNA 5AADA 2CGXA 1NVSA 3LHJA 4MBIA 4R1VA 3PY0A 1A9UA 4GUEA 1CKPA 2BUJA 4FUYA 4GS6A 4U45A 5HIDA 3HV4A 5HBHA 2W5HA 3AGLA 2EXCX 2QHNA 2VTMA 3L9NA 3QUDA 3AMAA 3QYZA 4CFUA 2UV2A 1F3MC 4L42A 1J3HA 3BGQA 3NUXA 2BAKA 1K2PA 2F7ZE 2OWBA 2PVJA 5D11A 5TR6A 3ATSA 4MCVA 3A61A 4M69A 3E5AA 5ETAA 5KMNA 4BYIA 2GFSA 4FC0A 4FBXA 4YHFA 3ID6C 3CTJA 1W98A 4BDHA 1T46A 2FSMX 2FUMA 2PMOX 2V55A 3C7QA 5IUIA 3I0OA 4FTRA 4FSUA 3CE3A 5H8BA 1J7LA 2YM6A 3VS4A 1WVWA 1B6CB 3ZDIA 5CF6A 5IKWA 4QQTA 3QCXA 4AACA 2PTKA 1ZMUA 2W1CA 3GC0A 2W99B 2C3IB 4DHFA 1X8BA 4FR4A 5KNJA 1O6YA 5CLPA 4FVPA 2R3GA 3EFJA 4OT6A 4QPAA 4RIXB 5CYIA 3ZH8A 2J50A 2UZWE 4FG7A 4RC4A 4EHVA 5DH3A 5C01A 3G0EA 5HD4A 5EQPA 4YMJA 5F1ZA 1TKIA 5CT0A 2E9NA 4JQ8A 5KKRC 4BCIA 2R0IA 4F9AA 5I9WA 2CCIA 4RJ5A 1YOMA 2EB2A 3POOA 4QT1A 3ZS5A 5M4CA 3QZGA 4DBXA 4AW1A 4QMZA 5KZ0A 3UBDA 3IG7A 3KXHA 3LJ0A 2E2BA 5FDPA 2C0OA 2YFXA 2PVYA 2UW8A 4FYNA 1R0EA 2PL0A 3KF4A 3UYTA 5M4IA 2P55A 3FQHA 5FP6A 1XQZA 2QURA 3ORNA 3D4QA 1GZKA 3H30A 3HP5A 3TNWA 3VS3A 4Z3VA 4IAAA 3MBLA 4XP3A 2ITUA 4AT3A 3U55A 4C58A 4RJ3A 1MQBA 4DG2E 4FKTA 4G5JA 4V05A 4X2NA 4YJNA 5IDPA 1PRYA 2QOBA 5JFVA 3R00A 4U6RA 5HLNA 3COIA 2QLUA 3AC3A 3FL5A 5DMZA 5BX0A 2OJFE 2O8YA 4EH2A 3HDNA 4IHPA 5EW3A 2YJRA 5EI8A 5HQ0A 2VN9A 2PMNX 4ZLYA 1E9HA 4K2RA 4X3JA 4D2SA 3C4CA 3UZPA 4A4XA 4ENYA 3SXSA 3MGYA 4PNIA 3CIKA 2G2FA 4MXZA 5KHXA 2ITPA 5CU6A 2RSVA 3M11A 3TI1A 4F1OA 2JEDA 4QTBA 4GJ3A 4FV3A 3BYSA 3MH2A 2PUIA 3BZ3A 4P5QA 1F5QA 3OWPA 4KD1A 3DQXA 4D2WA 3EKNA 3R7OA 2W1GA 3RVGA 4AOTA 4YSMA 2F57A 2VGOA 4HYHA 4BZNA 5AFVA 4FT0A 4PQNA 3R8PA 2FB8A 1R78A 2QOFA 2UZTA 3WF8A 4BIEA 3TIZA 5BVWA 2HXQA 2A2AA 4FT3A 3E92A 4EK6A 3FMLA 3GQLA 4U8ZA 3CJGA 2IJMA 3KXNA 4E6DA 1YDRE 2XM9A 4QP7A 5ETCA 4EH7A 4WOVA 4XG2A 4F70A 3BU6A 4FG8A 5A4EA 2PE2A 3SW4A 4BYJA 5DE2A 3W2PA 4E6AA 1H0WA 4TW9A 2P4IA 4RWIA 4O83A 3SRVB 2BRBA 2ZAZA 2BDJA 5AR3A 5FP5A 4O0TA 5CSXA 5GHVA 4IJPA 1TQMA 4C36A 4L44A 5HD7A 1XO2B 3NAYA 2Y4PA 4GW8A 4YTIA 2J0JA 3AG9A 1R1WA 3P08A 4QMVA 4D4RA 1G8AA 4O7VA 4BR3A 1F0QA 2RFDA 3KB7A 4CXAA 3AT4A 3DLZA 3ELJA 3BIZA 4XH6A 2YM7A 4EOIA 2PVHA 4J95A 5HNBA 1JOWB 4O0XA 4G6NA 3G90X 4AU8A 5KX8A 3T3UA 4O0SA 5CF5A 4FNZA 4BCGA 4IAYA 4RJ8A 5TOZA 4AOJA 4S32A 3C5UA 5G6VA 3SHEA 4WD5A 1Y8GA 3PIXA 2BHEA 2FYSA 2XBAA 5HI2A 4EOQA 2VWXA 3Q4UA 3EN4A 3GP0A 3QYWA 2BHHA 1YI3A 1PW2A 3DTWA 4FVQA 1JLUE 3PXZA 3OY3A 5J9YA 4E20A 3BHHA 3F5XA 2VTIA 5AIKA 4QNYA 3E8CA 3HVCA 4A07A 3RWPA 2P2IA 4PDSA 3D2KA 4KIKA 4RJ6A 4ANBA 2OLCA 4X2GA 2OG8A 5HORA 3BHYA 3KEXA 3TCPA 3IDBA 5HLWA 1PYXA 3UG1A 4FKGA 4GH2A 4MH7A 3UMWA 4BWPA 5CAPA 4NJ3A 3C4XA 3FPMA 4ZTNA 2YM3A 2YM5A 5CU2A 4U0IA 3O96A 3ZSGA 3QCYA 4UWYA 3EQFA 4OAUC 1FGKA 4XP0A 5CSPA 5CSVA 5ACBC 3FKLA 3PYYA 4FTNA 3DK6A 3LCOA 4ANSA 2JKKA 4I5MA 5AJQA 3QA0A 5AR4A 3ZHPC 3DS6A 2ONLA 4ZSLA 5FWKK 5HCXA 3PLSA 4I24A 4Q5EA 4D0XA 1CM8A 2VTTA 4H58A 3KMMA 4YGAA 4OBOA 2WOTA 4BI2A 2OU7A 3FZRA 4J53A 3GQIA 3NYOA 5EH0A 5HO7A 4N0SA 3RCJA 4XS2A 2GCDA 2YM8A 3FLWA 4QYGA 4CCBA 5HG5A 3VBVA 1RE8A 3F2NA 4LL5A 4RIXA 4CYJA 1XJDA 3HMOA 1J91A 4USFA 4GG5A 3QRUA 2EXEA 4I6BA 3GCVA 4DFZE 1PKGA 4L67A 5KBRA 3EFKA 4O0UA 4E4MA 2WTJA 5AIRA 5B0XA 4EHZA 4HCVA 5HKMA 4BTFA 4FTMA 4KKEA 5DGZA 1NA7A 3NNUA 4HZRA 5IF1A 2ESMA 2WMVA 3Q9WA 4ZMEA 1S9IA 1OL1A 3OROA 1ZXEA 5M44A 3V51A 2Z02A 3W2CA 4O2ZA 4U40A 3FKOA 3LVPA 4YZMA 5CEQA 5CAUA 4IZ7A 5HG8A 4I6QA 4YJSA 2PVFA 3HECA 2PMLX 3ZUUA 4RFYA 2BAJA 4DH3A 3ORKA 3U51A 3R8UA 4HVIA 4OTGA 3CSVA 5ACKA 3DZQA 4PTEA 4YLLA 2OSCA 3KMUA 3L1SA 2DYLA 1ZMWA 3KULA 3LQ3A 4ZJIA 2W4OA 3SVVA 3ZBXA 5E8TA 2B1PA 2ITXA 3W8QA 3FLYA 3Q9XA 1H24A 4O82A 3NZ0A 4XV2A 3NNXA 1UU9A 3EKKA 3QCQA 2ACXA 4IC7A 3TUBA 2O65A 2YIXA 3GU8A 3DNDA 3RAIA 2BRGA 3AT2A 3HUCA 2ITYA 3DY7A 3H10A 4FSNA 4FV4A 1XKKA 4JBQA 4RBLA 2C6TA 3MH0A 2QC6A 2XRUA 5JKGA 4YC8A 3ZRMA 4O27B 2JFLA 4J8NA 4PUZA 4F7NA 2X2LA 2ZYBA 3LW0A 3V8WA 1U4DA 2XNBA 2JDRA 4L46A 2ITZA 3C4WA 3O51A 4KWPA 1DI9A 2P0CA 5BVKA 5J87A 1H8FA 3SDJA 1VEBA 1OPKA 3B2WA 3EB0A 3PA3A 1FQ1B 3PRIA 3LFDA 4FGRA 1H08A 2OFUA 3ZLSA 5I9ZA 1FINA 5HVYA 4NU1A 4WHZA 5IA1A 4ERKA 3DV3A 3W55A 4X6RA 3F66A 5DA3A 1S9JA 2XVDA 2QODA 2CGWA 1XR1A 3RAWA 4E5WA 2C3JA 3R71A 2Y7JA 4Y83A 4NW5A 3MI9A 4GK2A 3NVKI 4YBKA 4KSPA 4L8MA 3NVMB 2W5BA 2HOGA 4XBUA 1MRUA 1RQQA 1CKJA 4FZDB 1ZRZA 2WTIA 4R5SA 4J8MA 3ENMA 5ANKA 3UMXA 5HO6A 1BL7A 3KRRA 2HW6A 1U5QA 3KCKA 4RC2A 3TN8A 2CPKE 2W9FB 4XV3A 3ZONA 5KCVA 3ODYX 4IAZA 1SMHA 4MXAA 4K33A 4MAOA 1PXLA 3JVSA 5I3OA 4CYIA 1O6KA 3E63A 3VS2A 2GS7A 3AXWA 3CLYA 5E8ZA 3TIYA 3RNYA 3ZEWA 3MFSA 1H00A 2RF9A 4DYMA 2YWVA 3IW8A 2C5NA 5BVDA 4HCTA 4IVAA 5DIAA 2VO6A 4IMYA 3SOAA 4BTMA 2VO3A 2Y4IB 1CKIA 3ACKA 3U6IA 1PMVA 3BRBA 4ZK5A 3PP1A 3TG1A 4AZFA 3UIBA 4IX5A 5D1JA 3MH3A 3QTIA 3U8WA 5L8JA 5D12A 4YR8A 2WD1A 1FVRA 3MY0A 4L6QA 5AP1A 2JKMA 2PVNA 5I9YA 1WBTA 5IPJA 3A7GA 4PMPA 2WMRA 3BLQA 5EKOA 4L7FA 3RCDA 4FTIA 4CT1A 1QPDA 3CS9A 1RJBA 3PVBA 4QP4A 4UALA 4IM3A 5EDQA 3BKBA 1M2RA 4HOKA 4FIFA 3VWAA 4AGCA 4YU2A 4HGLA 1Q3DA 2BZIB 5J5TA 4O0WA 4ZSEA 3R73A 1YXVA 4L9IA 2F7EE 3CD8A 4GSBA 5I0BA 3GCPA 4UMRA 4P7EA 5DR2A 3LFQA 4DH5A 1BI7A 3AGMA 5LVPA 3BWJA 2R64A 3HDMA 4FEQA 1URCA 2FGIA 3S00A 1GZOA 5HBEA 3R83A 4DCEA 5DVRA 3WARA 3UPZA 3EQGA 1STCE 3C50A 3O8PA 5AAEA 4QP8A 2OKRA 1LPUA 5IH5A 2A0CX 5AV4A 1M7QA 4O0VA 3EFWA 2CSNA 3RNIA 4U9AA 4C4HA 3ORZA 1B38A 3PXKA 5H2UA 5BUIA 4M3QA 4O38A 3FMKA 4O6LA 3OEFX 4FMQA 2WFYA 4O7RA 4BRXA 3ERKA 4I4FA 3WZUA 3QZFA 4IB0A 4CMTA 5HESA 4CG9A 3QRKA 3EN9A 3OCTA 2ZB0A 1Q8YA 3NDMA 5DRBA 4HYIA 1U5RA 5C8NA 4FTKA 3TV7A 4K18A 4RIYB 4IADA 4J96A 3ORMA 3DB8A 2PVMA 3ZLYA 3OWJA 1OIRA 2H8HA 4ZTHA 2C0IA 2PY3A 2C6IA 3GXLA 4M69B 4RVTA 4P5ZA 3VO3A 1H1RA 3O7LD 4OT5A 4Q2AA 3F82A 3ZO4A 4C2WA 2QO9A 5IQGA 1OL7A 2ITVA 3P1AA 4G16A 2C5OA 4NKAA 4J99A 2XCKA 4M12A 3ALNA 4FOBA 4UMQA 3R9NA 3FI2A 1GIJA 2QU6A 2R3JA 3PXRA 2GTMA 4IZAA 3UIUA 1G5SA 2VX3A 3HKOA 2OBJA 4FKRA 3B2TA 5AV0A 4IB5A 1DM2A 1KE6A 4DGNA 2VWYA 3R1NA 1OBGA 2WMAA 3FY2A 4N70A 4D4SA 4RIWA 5GNKA 3LLTA 3R8VA 5DYJA 2WIPA 3A7HA 4LUDA 3AD5A 2FSLX 4KRCA 4D4YA 5HTIA 2BFYA 3DXNA 3HRBA 4S30A 2BRNA 4NKSA 4DFUA 4NUSA 5DT4A 1PXMA 4JRNA 3O8TA 3ZBFA 3KF7A 3M2WA 5FG8A 3ZDUA 3KN5A 4BCOA 3FLNC 3P23A 5KHWA 2JIVA 5B7VA 2V62A 4I6HA 1AD5A 2OZAB 2A27A 1PMNA 3VUHA 1JKTA 2OK1A 2W1HA 2IVVA 2ETKA 4CFXA 4C8BA 1W8CA 2GHMA 2WMWA 4L3JA 3LMIA 3F9NA 3QD4A 2B9HA 2XA4A 3Q9YA 4DITA 4C3PA 3SLSA 3UIXA 4QD6A 3DQWA 3P7BA 4TYGA 3O17A 1JVPP 2E9PA 4NCTC 2C69A 4BBFA 3MA3A 3Q52A 3VBYA 5K4JA 4FICA 4XLVA 4AA5A 3G9NA 1M52A 1PMEA 2XZSA 3QTWA 2WPAA 4AGDA 3CJFA 3FBVA 3L8PA 4D5KA 3F5UA 1OI9A 4BKJA 3U9CA 2J6MA 4AUAA 4YHJA 3GB2A 4ZZNA 2FVDA 4EK8A 3EYGA 2G2HA 3A2CA 2UW4A 5AR5A 3S0OA 4NL0A 4DEEA 4FSMA 4ZZOA 4XMOA 2W1ZA 3R6XA 4EOPA 4O96A 4EJ7A 3UOKA 2PE1A 3TKUA 2WHBA 4MNEA 3UG2A 4AE6A 1NT2A 5GIPE 5BPYA 4FTCA 4I4EA 3RZBA 3VS7A 5IEVA 4D1SA 3LFNA 4RT7A 4XYFA 3ZO2A 3SKCA 4WNKA 1WMKA 3ANQA 3KU2A 3VHKA 2GQRA 3LFEA 4IZYA 3PVGA 2ITTA 3E93A 2YJSA 1ERKA 3QF9A 4FIEA 4X2KA 4BDFA 3R0TA 1KE9A 2FO0A 4BDGA 3D2IA 3AC1A 2YCSA 3NGAA 4HPUE 4GIIA 4RWJA 2F2UA 4YHTA 2JAVA 4E4NA 4H39A 3U6HA 5CQUA 5FRIA 2V5QA 2XYNA 4FEWA 3T3VA 3CKXA 4G34A 4X3FA 4LYNA 2VTRA 5FXRA 1YWRA 2VAGA 4JS8A 1J7UA 5GIOE 2IZUA 3QQJA 3C4ZA 3CQWA 4IM0A 3RINA 4CKIA 5I5ZA 1ZY4A 5HE2A 3R1SA 4TN6A 5LMKC 3TTJA 1K9AA 5J7BA 4FIJA 1CMKE 3Q6UA 4H1MA 4MWHA 4FOCA 3ZUVA 2IPXA 5JGDA 5LWMA 1G3NA 3P78A 1ZZ2A 3H0YA 1XBBA 5E8SA 2X81A 3RZFA 1UVRA 3AC2A 3UVRA 5H8EA 4YP8A 3VUKA 3DAKA 3MW1A 3F7WA 4FNYA 3OUNB 1OECA 5FD2A 3LXNA 3U54A 2OH0E 2UUEA 5JK3A 3MPTA 4LL0A 5CANA 3D5UA 4JG8A 4M0ZA 2PZIA 3QRIA 3ZMMA 3HRCA 3WILA 4DEIA 2W4KA 3LXPA 3R9HA 2JIIA 3RP9A 3V8TA 5AUTA 3ET7A 4M15A 2ZMDA 3QKKA 4XBRA 1UU3A 2PMIA 4RIWB 3SXRA 3F69A 4WKQA 4ORKA 4E93A 1Q97A 2OXYA 5A54A 5J1VA 3LXKA 3UQCA 1H28A 5JT2A 1OMWA 3BLRA 4JR7A 4GMYA 4RZWA 5A6NA 3K3JA 3Q53A 4BCHA 4H3QA 4ZMFA 5CT7A 3PWDA 5BVFA 3OF0A 3ZTXA 4BC6A 3R9RA 1WBPA 3LQ5A 4YZCA 5IQIA 2QG7A 1B39A 1RW8A 4HJOA 5J95A 4DEHA 4RVLA 1FBNA 3I7CA 2PULA 1U54A 2JDTA 3EQRA 3SOCA 4YZDA 4D2VA 4IM2A 3RTPA 4LOQA 5DR9A 4A9RA 3PSBA 2EU9A 2W96B 1ZOEA 4ITJA 3NRMA 1P4OA 4GRBA 4MYGA 5IA3A 4N57A 3EQDA 3C4EA 4QP1A 1J1CA 2P2HA 3IW4A 3ZRLA 1OPLA 4AA4A 2GNGA 3ZFXA 3BYUA 1H1PA 1Q41A 3OXIA 4JOAA 3R7UA 2BALA 3CCNA 4WG4A 4YBJA 2UW7A 2IW8A 3TKIA 2Z7SA 3VN9A 2OJ9A 5AUWA 5L2WA 2OO8X 5HTCA 3P0MA 5TKDA 3ENHA 4AW2A 3ZC6A 4EHEA 2WGJA 2B9JA 3A8WA 3ZXTA 3HAVA 3ETAA 4OW8A 4JDKA 4RGJA 4M14A 1A06A 2PZPA 3DCVA 1SNXA 1WZYA 3VS6A 5CQWA 5T3QA 3I7BA 2YA9A 2XCHA 4UXLA 3PPJA 4W9WA 4ALUA 4XOYA 2Z2WA 4DFLA 2B9IA 3E3BX 4JLCA 2WEVA 5T6KA 4FNWA 3UNKA 2C4GA 5HCZA 2OXDA 2BCJA 5M06A 2J51A 3DBFA 3PXQA 3BPRA 4R77A 1WBWA 1V0OA 1GAGA 3EWHA 4RRVA 3JY0A 3WZKA 3IO7A 2R2PA 4LRJA 4EZ7A 1AQ1A 5AP3A 4BHZA 3OY1A 1ZY5A 4UY9A 1KUTA 5FXSA 1ZAOA 3QLGA 3Q4CA 3EZRA 4O0RA 4QYEA 4QMUA 5CVHA 2JBOA 2YZLA 4TYHB 5HLPA 4AZSA 4IANA 2BROA 2FSTX 4MXXA 3ZFMA 4DH8A 3GC9A 1OVEA 5CWZA 1JNKA 1OBDA 5C26A 4FKUA 3PIZA 3ZEPA 5KKRB 3KRWA 5E9EA 2PU8A 2W05A 4D9TA 2WNTA 4F7JA 1UKHA 2YZAA 4Y8DA 5FEQA 4D0WA 5K5NA 4EH8A 4NM3A 4JIKA 4M68A 4I1ZA 2BIYA 2PUUA 5E90A 3SGCA 3OW4A 3OCSA 5KZIA 3PJ2A 5A4TA 2XNMA 3H9OA 3RK5A 2UVYA 1QCFA 3VBTA 1PXNA 3CKWA 3GUBA 1Z57A 3G6GA 4IWDA 3OWKA 4LV5A 4R3CA 2X1NA 1Q61A 4Y95A 5E7RA 3KL8A 4ZXTA 2J2IB 3I81A 2ZM1A 3MPMA 4FTJA 4M97A 4OTPA 3F7ZA 4UYNA 3JUHA 4C59A 4CTBA 3CY3A 2WQEA 5HBJA 4MD7E 2VTNA 1R0PA 2J90A 3I79A 4U41A 2WMBA 2HZIA 3KCFA 2HWPA 3KQ7A 4FSTA 4FZ6A 4GK4A 4F4PA 3GENA 2H9VA 5GZAA 2X6EA 4PDPA 1WVYA 1IG1A 3G33A 4I93A 2ZOQA 2YDIA 3EJ1A 3EYHA 3E88A 2O64A 2PZ5A 2WZJA 3DBQA 1MUOA 5A14A 2C6LA 3PY3A 4FK3A 2AC5A 3UNZA 1JKLA 1Q8WA 3PSCA 3QTQA 3CEKA 4IACA 1V1KA 4Q9ZA 3ALOA 4XRJA 1UU8A 2VTLA 1LEZA 4U81A 4FTLA 1XH7A 1YOLA 3ZLWA 5J7HA 3LFSA 3Q4ZA 2EB3A 2DQ7X 4KIOA 4DA5A 4QQ5A 3HEGA 4MF1A 4BGGA 4C4IA 1CSNA 2C6MA 3HV7A 4RVMA 5IZFA 4JDJA 5BVNA 3FZOA 3L8XA 4F63A 3BYOA 3RI1A 4EONA 5L6WL 3LJ2A 4V01A 4DG3E 4B99A 2X4FA 4G3DA 5A4QA 5KO1A 3DPKA 2VTAA 2F2CB 2UZEA 5FLFA 4BIBA 5H3QA 4WA9A 5HNIX 4YPDA 1H4LA 3CPCA 5AA9A 4KABA 2Z7RA 4R7IA 4CMOA 3MS9A 3F5GA 2QG5A 4FTTA 2CJMA 1IA8A 4FNXA 3R9DA 2JIUA 4JQ7A 4MHAA 4NT4A 2PUNA 4O7WA 4FKSA 3FMJA 1W83A 5DN3A 4JG6A 2HYYA 3QALE 4BWKA 5HIBA 2XEZA 4NM0A 4BDJA 2AUHA 3BGPA 1Q24A 4DEAA 4AGUA 5BMSA 4EK3A 4JX7A 3GFWA 1OKWA 4MD8E 2QD9A 1XH6A 1ZARA 4PMMA 2BIKB 3KA0A 3RPVA 3KGAA 4B0GA 4PNKA 1ZYSA 2BDFA 4ANLA 3IW7A 3QWJA 4RA5A 4ZZMA 3ZUTA 1Q62A 3WIKA 3LMHA 4AG8A 3TZ8A 4M67A 3D5XA 4Q9SA 2YHVA 3OG7A 5FGKA 3QWKA 3HMMA 3FZTA 4MBLA 4BKZA 2XIYA 3H3CA 2VX1A 3QA8A 2NP8A 4OTFA 4ONAA 2YCFA 4UB7A 5CALA 5CEKA 2QOLA 4R78A 2AYPA 4CV9A 3HZTA 5KMKA 4NYEA 3HNGA 3KK8A 5LWNA 2CKOA 5FTGA 2WTDA 2XJ1A 4MQ2A 4FTOA 2QCSA 5CNOA 4KINA 3NUSA 1ZMVA 3EN5A 3K54A 4FKWA 4YTCA 4CVAA 5I9VA 2Y6OA 5K0XA 2DUVA 4WNMA 4PV0A 5ETFA 3PA4A 1PYEA 4XG7A 3V5WA 3ZZWA 5CX9A 4KIKB 3BEAA 4FSYA 4CFWA 5AA8A 5KUPA 1SNUA 3TUDA 4C62A 3EMGA 4AW0A 4EKLA 5ITAA 4BFMA 3EN7A 4FT5A 5EI6A 1Q8ZA 5DT3A 5B2KA 3KRJA 4Y46A 4A9TA 3PRFA 3HRFA 4F9WA 2C47A 3CGOA 5EI2A 4FX3A 3S3IA 3VHEA 3OBJA 3KK9A 5EOLA 4JVGA 4ARKA 4KA3A 3UO6A 2WAJA 1IAJA 4QMXA 5GJDA 3W2OA 4GT4A 3OMVA 2CKEA 2PZRA 4LV8A 2Y0AA 2HCKA 4O22A 4OTQA 3COMA 2V22A 5EHLA 3UOHA 3FLSA 2PVRA 4XJ0A 4IXPA 5J9ZA 3PP0A 3W8LA 2PZYA 2WMSA 3HMPA 4J52A 4HVDA 1UKIA 3QKMA 3WI6A 4K1BA 1ZYDA 2ERZE 2HXLA 3D7TA 4BBEA 4OTIA 3REPA 4RX9A 1GNGA 3FYJX 4H36A 5CI6A 4HVSA 2FA2A 4I3ZA 1OUYA 4NWMA 4WG5A 5M55A 3TNPC 1BI8A 4O6EA 4XEYA 3EQHA 4EZ5A 1V0BA 3DU8A 1SVHA 3EL7A 3ZO3A 4NIFB 2WMUA 4FV7A 3F6XA 3QC9A 5CZIA 3DKOA 3FDNA 2P3GX 5CZHA 3TL8A 4BBMA 3RPYA 1M2PA 2VWUA 2W7XA 5I9UA 4FI1A 2W0JA 4PTCA 2CN8A 3KXMA 1W82A 3VNTA 4BCKA 4D2TA 2WKMA 4EL9A 3DXPA 1MP8A 1H1QA 5CNNA 4FKJA 3HV3A 4IWPA 4K0YA 3CD3A 4IFCA 2BRMA 3EIDA 4WBBB 5LVLA 2VZ6A 5AP4A 2PHKA 3VS1A 3W16A 3UJGA 3MVMA 1MQ4A 2C3LA 1REJA 5AP2A 5EM7A 5JQ5A 4U5JA 3G5DA 4UZHA 5AV2A 2W1FA 4HZSA 4QP6A 3WOWA 4S2ZA 5I3RA 5M4UA 3K3IA 5FBOA 3K5VA 1YHVA 4IEBA 4X3FC 5B2LA 2YM4A 4BGQA 5BYZA 2XKFA 5CVGA 3WBLA 3S95A 5JFXA 1UA2A 5FXQA 1NVRA 3DXQA 1O6LA 3FLQA 5L4QA 4CKRA 5LCJA 2R3NA 5EOBA 4EOOA 5FEDA 3SV0A 3EHAA 4O81A 2J0KA 4G9RA 1DI8A 2OI4X 4MD9E 4N4SA 4TKSA 2O63A 2O5KA 2I0YA 3OHTA 4LRMA 3UVQA 3DK7A 4AT5A 5A9UA 4NIFA 5CEPA 5DHJA 3DDPA 4DN5A 2HIWA 3NWWA 4GYGA 3DKFA 2XKEA 4RQKA 5EYDA 4USEA 2CNQA 4PP9A 4TRLA 3DJ6A 5C4LA 3FXZA 5HVKA 2C6KA 3QU0A 5IH6A 5CU3A 2VO7A 3EN6A 1LR4A 4FYOA 4LUEA 5DFPA 3R8MA 4HW7A 3MSSA 4EOLA 4ZS4A 2F49A 2YLFA 3VBQA 2Z60A 3FE3A 3NNWA 3QQLA 3UDBA 4FV0A 2QHMA 3GT8A 3MFRA 2QLQA 4ZSGA 3LE6A 1OL5A 4TNDA 1BX6A 3KFAA 3LQ8A 3RPOA 4AQCA 4FSRA 2VWBA 4RIOA 4XG9A 3RAHA 3GU5A 3FV8A 2QKWB 2JC6A 3HX4A 1YWNA 2GQGA 2W06A 3D5WA 3FZ1A 5C03A 2O2UA 3E8NA 4EEVA 1REKA 4FODA 5G1XA 1OKYA 3K2LA 3NYVA 2QNJA 4EUUA 4XG4A 3ZSIA 3DJ7A 4O21A 4EK4A 2YIYA 4JAIA 1CTPE 5AUZA 2C5VA 3V04A 5EHYA 2YAKA 1Y6AA 5TE0A 3BYVA 3FMMA 3O2MA 4OTDA 3ORIA 2O3PA 3WZJA 4L68A 4ALVA 5JQ8A 4WRGA 3DGKA 3JVRA 2V7OA 4FG9A 4X0MA 2C68A 3DBDA 3PE2A 4E7WA 2OIQA 4I6FA 1H25A 4I5CA 4I21A 2GNJA 4FSQA 4IDVA 5LCKA 3RALA 5BUJA 5KMMA 3A7IA 3UO4A 1MRVA 4JBPA 2QONA 3FXXA 2BR1A 4H3BA 5JMSA 5CU4A 3OCBA 2UZUE 2WB8A 3JPVA 5TO8A 4E1ZA 4TXCA 4G31A 3BBWA 3RWQA 4DGGA 2PK9A 2ZV7A 4U97A 2DWBA 1E1VA 2YIWA 3KXZA 1OZ1A 4A4LA 3NW5A 3MB7A 2HELA 4O0YA 4EOSA 4EOJA 4ZY4A 3QD3A 4XP2A 3E87A 2NO3A 3QHRA 4FT9A 4JI9A 1GIHA 5IUHA 1XH4A 1NW1A 3ZFYA 3UC4A 4I0TA 4M0YA 4J97A 3T9TA 3P4KA 3TDWA 2E9UA 3KVXA 4JDHA 3MYGA 2ITWA 2WMXA 4YJPA 3TZMA 3W2QA 4HCUA 4O1PA 4ZLOA 3NYXA 4QNAA 4O7LA 2ETMA 3IGGA 3P9JA 3QRTA 4KIQA 5DPVA 3QZHA 3VVHA 5IEYA 5J9LA 5M51A 4A4OA 1UWJA 4GL9A 3A62A 4BDEA 3AMBA 3GC7A 5EFQA 3H9RA 4FV2A 2W9ZB 1L8TA 4MQ1A 4QQCA 4YC6A 3ZYAA 4HGTA 5FUTA 2UW6A 4W8DA 2I0EA 4DF3A 3TM0A 2G2IA 5AV3A 5F20A 3JXWA 3AD4A 5J5SA 3CTQA 3IW5A 3JYAA 3DKGA 4ANQA 4F1MA 5D7AA 3NCGA 2WELA 3DBCA 1XH9A 4GJ2A 2V7AA 4O1OA 3WZEA 2QOQA 4MF0A 2J0IA 4CFFA 2J4ZA 2V0DA 5J8IA 3F88A 3LKMA 4LOOA 3UIMA 5E8WA 2XNNA 5CF8A 3SC1A 4RJ4A 4L3PA 4ZY6A 4JQEA 1KE5A 3RPSA 5TF9A 2VX0A 4C57A 3FHRA 2Q0BA 1TQPA 3NIEA 3H0ZA 4P4CA 3MV5A 4BL1A 5IQHA 3HYHA 4PWNA 4ACDA 4E4LA 2X0GA 3C51A 3BYMA 5EM8A 3KREA 3ZZEA 3QC4A 4BDIA 3A7FA 3E8EA 3EQCA 3AC4A 2H34A 3FWQA 4YZ9A 2IZSA 3CBLA 4FL3A 5I4NA 3LCDA 4RWKA 3NUAA 4FV1A 2AC3A 4QQJA 2B53A 4LG4A 5HOAA 1RDQE 4L01A 4PPBA 4Z55A 5HE0A 4CNHA 3UC3A 4FEVA 3IONA 4ITHA 3BQRA 3GVUA 4FSZA 4X7QA 2J9MA 2BILB 3FI3A 4GK3A 4MXOA 3RJCA 3THBA 4L00A 2GHLA 2OIBA 3V5PA 3G15A 4FZ7A 4FV5A 3Q04A 2ZV8A 3ACJA 3WZDA 3FXWA 2QVSE 3OT8A 3I6UA 1YXSA 4RPVA 4AP7A 1I09A 1JSTA 2ITNA 3ORPA 3PXFA 4EH6A 4E26A 3RK9A 1YKRA 4RX5A 5DR6A 1JSUA 3AD6A 4IB1A 4IQ6A 4E6QA 4GFGA 4LMNA 1ZZLA 2R3RA 1WBNA 5HO8A 4HYUA 5AAFA 3O7LB 5IA4A 3NW7A 1M2QA 2XNEA 3VW6A 5LJJA 2FSOX 2R9SA 2RIOA 5JSMA 3E62A 1VYWA 4WO5A 4XG3A 5IMXA 3U87A 3BEGA 2QI8A 1R39A 1DAWA 1YXUA 2WOUA 3OEZA 1PXOA 3PA5A 4PTGA 5JRQA 4ZEGA 3ULZA 2BZJA 2CN5A 4KS8A 4O91A 3OCGA 3P7AA 5AAGA 3TEIA 4J71A 2R3QA 4DFNA 2XIZA 4LRKA 2R3HA 4APCA 3JY9A 3Q5ZA 1P4FA 3BU5A 4FV9A 4NFMA 5L2SA 4GKHA 3UNJA 2CKQA 5HNGA 3HP2A 4J7BA 4XV1A 4AA0A 3E8DA 5IQEA 3KULB 3I4BA 3QRJA 5E1EA 2OJGA 4IZ5A 4AGWA 3RM6A 1FGIA 5EHOA 2XS0A 1IASA 1Y91A 2QR7A 4TWCA 4U43A 3HA6A 4BIDA 3MJ2A 3A60A 3PJ8A 3NX8A 4YZBA 4L7SA 1CDKA 4TTHB 5IDNA 2UW3A 4GFOA 2WQMA 2A4LA 4DTBA 3GU7A 1XWSA 3QTRA 4C4EA 2YIRA 3DK3A 5ANJA 2CLQA 3FMEA 4EI4A 5EQEA 4QMSA 2C1AA 4K9YA 3T9IA 4EH5A 5HE3A 3WF7A 5LMBA 3HLLA 3R8LA 4D4VA 2X8IA 1KOBA 5DBXA 4UMPA 3OD6X 3DB6A 3SXFA 3FPQA 3DFAA 4RSSA 4E4XA 2UW5A 2C5YA 2WQOA 2YERA 3DT1A 1Z9XA 3BELA 3D0EA 3GBZA 5HHWA 2ZJWA 5CAVA 1Q8TA 4CFNA 4QPSA 2YIQA 3VUGA 3TACA 4O7SA 3F5PA 2W1EA 5CXZA 4DGLC 5ANDA 3OBGA 3MWUA 1ZYCA 2ERKA 4RX8A 4UBAA 1FVTA 2A19B 2BZKB 4ZS0A 4ZTSA 2BKKA 3V5JA 4OLIA 3EQIA 3UQGA 2YWPA 3D94A 5K9IA 4G6LA 4XG6A 2XBJA 3U4WA 4A9UA 3L9PA 1P14A 5CU0A 4WG3A 2KTYA 3QX2A 4CKJA 4C0TA 4U80A 4AF3A 5LMKA 1OGUA 2X7FA 2VTHA 2CCHA 4NJDA 4ITIA 4XV9A 2WQNA 4UEUA 2ZB1A 3HUBA 4JJRA 4EBVA 4PL5A 3IOKA 4C4GA 2YAAA 5HX8A 4N6YA 4OTWA 4EYJA 1H1SA 2XJ0A 3FJQE 4B9DA 5J79A 4E6CA 5EW9A 2CKPA 2XJ2A 3AOXA 3GEQA 3GFEA 3VF8A 4I23A 3W1FA 5L8KA 3CR0A 3W10A 4F99A 1YOJA 4FKOA 3PJ1A 4R3PA 2B55A 2ZV9A 4J1RA 2VTQA 3L9LA 1ZWSA 4FV8A 4RA4A 4W4XA 4W4YA 4Y72A 4Z9LA 4ACGA 5EDPA 2W4JA 4NCTA 4CZYB 4HGSA 4XLIA 3FMDA 3PE1A 1H07A 3ODZX 3P7CA 4PMTA 3W2RA 1R3CA 1UNHA 3AC8A 4IVDA 4OBPA 3UTOA 3MIYA 4QP3A 3TUCA 3RM7A 1PF8A 4N6ZA 5AP6A 3P86A 1UV5A 5JFWA 1OM1A 4PDYA 1WBOA 1ZYLA 1P2AA 3B8QA 1YXXA 2XK4A 3LJ1A 4CTCA 3HAMA 3Q2JA 3V6RA 3PFQA 3FLZA 1FVVA 5DEWA 2JLDA 1TVOA 2QR8A 3KMWA 1WBSA 5EK7A 3VF9A 2HZ0A 3MFUA 1T45A 4D1ZA 3LPBA 4TNBA 4CG8A 1SYKA 3ORLA 4O2PA 5AUXA 4FT7A 4IAFA 2C3KA 3IDCA 5EQYA 4DAWA 4AXAA 3FI8A 3BI6A 2G15A 4TY1A 2VTPA 4RX7A 4DFBA 5TT7A 3O23A 3OZ6A 2WIHA 4YLJA 4UN0C 4H1JA 5DRDA 4D5HA 4D1XA 2HK5A 5CSHA 4WNPA 4OGRA 3OTUA 4MTAA 3LCTA 2HAKA 4O7YA 3R7EA 1Q99A 3CTHA 1QMZA 3W32A 4C35A 4H3PA 3OC1A 4EZ3A 4BCPA 4F1TA 3OT3A 2UVXA 4GU6A 4ZOGA 4U7ZA 1YQJA 3UGCA 3VQUA 2PSQA 3SAYA 3FQSA 3R2BA 2B7AA 5BMMA 4IVCA 5AWMA 5HVJA 4DE4A 5J1WA 1NY3A 5IISA 3PWYA 4IW0A 4HVHA 5CENA 4PRJA 5IA0A 5GINE 4D2RA 4RIYA 4ANMA 4BF2A 1NVQA 5D10A 5FTOA 5C8KA 4BZOA 2WTVA 2J0LA 3TNQB 3WF6A 4ZLZA 2WO6A 4NW6A 4NZWB 3ZO1A 3P5KA 3BHVA 4X6QC 2J7TA 2RL5A 4QOXA 4CCUA 4FSWA 3R01A 1BYGA 4UYAA 2Q0NA 2H96A 4AAAA 2GNLA 4CRSA 4BY9E 5LVNA 3DAEA 1NXKA 3QXOA 3V8SA 1QPEA 3C0GA 3TV4A 2XIRA 3O8UA 1YW2A 3MESA 2O0UA 4MK0A 4MX9A 5LVMA 4MBJA 1MRYA 3QFVA 4JG7A 2QO2A 4GIHA 3Q60A 2VWVA 4LI5A 3QQHA 3QXPA 2R3KA 2J5FA 3MDYA 4WUNA 4DG0E 2WQBA 2YABA 4AZVA 3GU6A 3GOPA 4FA2A 2YDJA 2Y4IC 3I5ZA 4JNWA 2GNFA 3ULIA 4AZWA 1XHAA 2NPQA 4LFIA 2F9GA 5AX9A 2Z7LA 4IAIA 2YCQA 4G17A 4X3FB 4DLIA 2BTSA 3Q3BA 3Q4TA 4XG8A 5T68A 4W9XA 4GG7A 4CFVA 4JX3A 3RHKA 2ZM4A 5FQDC 2BVAA 2BAQA 4AN2A 3S4QA 4GT3A 4BKYA 2C6DA 2JDVA 4BDDA 5IUGA 3LFFA 4Z7GA 5BNJA 4YO6A 3FQEA 3Q9ZA 3QZIA 4UZDA 5JZJA 2BFXA 2LAVA 3SX9A 3MVJA 3R30A 4GVJA 4Y5QA 3FSKA 3ZXZA 2XYUA 1VZOA 3ORTA 4BCFA 1OL2A 2PE0A 3IS5A 5AR7A 2IN6A 2QQ7A 4G6OA 4Y5HA 1URWA 3GNIB 4F7SA 3GI3A 4IH8A 3LZBA 5HG7A 5EYCA 2XK9A 4DLJA 4HVGA 3RGFA 4B8LA 4C7TA 1PXPA 5D41A 4DEDA 4OUCA 3UO5A 5ICPA 2OW3A 3ZSHA 2UZVA 3S2PA 3NLBA 4NFNA 4QMOA 5L8LA 1E1XA 3FAAA 1KWPA 3TJDA 4X21A 3MTLA 2ZVAA 2QU5A 4QTEA 2X8EA 4S31A 2J5EA 3OS3A 5K0KA 4NM5A 5BVOA 5KE0A 3A8XA 3PVWA 4IE9A 5E8YA 4FF8A 3OP5A 3QBNA 4PX6A 3FZSA 3PPKA 4BDAA 2GNIA 4WBOA 4ASEA 4QYHA 3DBEA 4PF4A 2VWWA 4EUTA 4FTAA 2JFMA 3EFLA 4PY1A 3MIAA 3U9NA 4ID7A 5L2IA 3I6WA 3DOGA 5KMIA 1M7NA 2RFSA 2ZV2A 4I0SA 4EYMA 3MPAA 3UPXA 4ALWA 1YWVA 5D7VA 5CEOA 5C8MA 3FHIA 1M17A 4BB4A 1O9UA 1SVEA 4K6ZA 4RFZA 4IBMA 2BTRA 4IDTA 3LFBA 5LQFA 4ZJJA 4QP9A 3BE9A 3UP7A 3MY5A 4JBVA 4WIHA 3R8ZA 4C33A 3F3VA 1BLXA 3G2FA 3I5NA 3R7VA 2GDOA 3OTVA 3QUPA 5BVEA 5KMLA 1YVJA 5F4NA 2EWAA 2F4JA 4BTJA 2JBPA 4O86A 2R3LA 2REIA 5JFSA 3D7ZA 2IZTA 3R22A 1GIIA 2YLEA 4PL3A 5CI7A 3AT3A 4YJOA 5M56A 2R3FA 3NS9A 4FL2A 3V5QA 5M53A 3II5A 3C0IA 3FY0A 3TKHA 3V01A 4LMUA 2UZBA 2YDKA 4IC8A 4QP2A 3NNVA 4EOMA 5LOHA 3KRLA 4KBAA 3N4TA 2QOCA 5M07A 3TDVA 3PJ3A 4B4LA 4JIAA 5B2MA 4V04A 3N4UA 2YISA 2RFEA 4RLKA 1IA9A 5BUEA 4RZVA 3PIYA 2G1TA 4DH7A 2IVTA 4EQCA 4XCUA 3PXYA 4DH1A 4C2VA 2JGZA 4LGDA 4MXCA 4EH3A 4G9CA 3PLAE 3BLHA 4YJRA 4YC3A 2XNOA 4B8MA 3BX5A 3MVHA 5KMJA 3PSDA 3QKLA 4KBCA 2ZDTA 4M66A 3ZU7A 3G0FA 4KKHA 2XK8A 3DTCA 4C61A 4R7BA 3EZVA 2IVSA 4H05A 2VD5A 2XNPA 3DDQA 2CNUA 5F94A 1BUHA 4C4JA 2F7XE 4O7TA 2KULA 3BU3A 3RHXA 1ZOHA 3LM5A 3Q2MA 3G6HA 5JH6A 3QTXA 4W8EA 3TV6A 4HYSA 5L2TA 1H1WA 1Q3WA 3EOCA 3NW6A 4DCAA 3WE8A 3HA8A 4FV6A 3NSZA 3A4PA 3FKNA 3BQCA 4QPMA 5CEMA 3C5IA 1Q8UA 3NAXA 3MA6A 4GFMA 4RWLA 5EW8A 1UU7A 4WUAA 1L3RE 3WIGA 1APME 4AN3A 1PHKA 2I40A 2WMQA 3F3UA 5CTPA 3D5VA 2A1AB 2PVKA 1H27A 2ONLC 2RFNA 2SRCA 4XHKB 5F9EA 3SG8A 3TWJA 3TT0A 3WE4A 2GNHA 4YO4A 5GZ9A 1ZYJA 3UOLA 4YURA 3PZEA 3QGYA 4PPCA 5DT0A 3V5TA 3MJ1A 3ZM4A 4L53A 4XRLA 4RQVA 3R63A 4QTAA 4QYFA 3R7YA 2C30A 2HW7A 3QD2B 4LQMA 3PUPA 5BYYA 2GU8A 3LM0A 2OICA 4BGHA 1PY5A 5ANIA 3CGFA 3DZOA 4X2JA 5EYKA 4JAJA 1GJOA 1YHWA 3D15A 1PKDA 4WSQA 1YXTA 4Z7HA 5HIEA 4MXYA 4QTCA 3ITZA 4F09A 5HTBA 2XNGA 4KS7A 3V3VA 4CD0A 4IIRA 4RLLA 4RMZA 3QAME 4C4FA 3NR9A 3GCQA 3Q5IA 4FKPA 4TYJA 5KMOA 4FEUA 3NCZA 4C02A 4A06A 4RG0A 3QL8A 4MWIA 2VO0A 3R2YA 4BICA 4JRVA 4FGBA 3RKBA 2OFVA 3OWLA 3W33A 1FOTA 4EQUA 1GOLA 2W1IA 2R3IA 2JD5A 4KRDA 5ANEA 5E92A 2BMCA 4CQEA 2PVLA 3CQEA 4XNEA 3QQGA 2Y9QA 5IEXA 3CY2A 3R21A 4L43A 1SVGA 3FC2A 5L2QA 5AUUA 5LXMA 1U59A 2IW6A 3DNEA 2VUWA 3BBTB 5DI1A 5AEPA 4GEOA 4RVKA 2I7QA 4AX8A 1TQIA 4FTQA 5AM6A 2Q83A 4C37A 5EKNA 1KV2A 4DTKA 2XM8A 3QUEA 4FIIA 4ZAUA 2HWOA 3HV5A 4JT3A 2I0HA 2X4ZA 3MTFA 4GVAA 4YJTA 5CVFA 5FM2A 4OTHA 2IG7A 3VQHA 1VJYA 4K77A 2XK6A 5IU2A 5C27A 4MEDA 3C13A 1PXJA 5LARA 4F9YA 3VIDA 4EORA 4QMNA 2XKDA 5CY3A 3DKCA 5HICA 3IQ7A 3Q6WA 4S33A 2RGPA 4ASXA 4DFYA 2B54A 3KXGA 3BGZA 5HG9A 4FEXA 1P5EA 2QOOA 1OKZA 5EM6A 3JR1A 1BL6A 5JRSA 1W84A 1J1BA 1EH4A 3O71A 3QTSA 3VW8A 4CZTA 4D2PA 4F08A 3E3PA 4UMUA 2R7IA 4C3FA 4TL0A 3CC6A 4USDA 5A46A 1Y6BA 3CXWA 3SD0A 3ZM9A 5M08A 1PMUA 2XUUA 3TZ9A 4FZAB 4BCQA 2PUPA 4IX3A 3UYSA 5IQAA 3FEGA 3TXOA 4NTSA 3IK3A 5JGAA 3MY1A 1YDTE 3I1AA 3RK7A 1WBVA 4IVBA 4ZSJA 3BHUA 3T8OA 2X7OA 3F61A 2W5AA 3UVPA 4D9UA 2EVAA 4EOKA 3R7GA 1Y8YA 4FKQA 3VULA 5EDRA 5A4CA 4O7NA 1SM2A 4R1YA 3O50A 3SQQA 5CEIA 1XBAA 4PPAA 2PYWA 2GQSA 4XX9A 5M4FA 3D7TB 1LUFA 4AZEA 5L6PA 4DT8A 2XEYA 5DEYA 4QO9A 4EQMA 4CLJA 4BN1A 5AMNA 1OIYA 2JITA 3DJ5A 4P2KA 3R28A 4FKLA 4X2FA 5C4KA 4IX4A 1GZNA 2P33A 4Y73A 4QRCA 3ROYA 1AGWA 4TPTA 4BCMA 2J0MB 4R5YA 3ZC5A 3ZCLA 4TZRA 2GS2A 5HX6A 4JXFA 3HV6A 1QL6A 4TYIA 5K3YA 4ZTLA 3G51A 2IZRA 3NUYA 5GJGA 4NTTA 4ASZA 5FBNC 2UVZA 3FZPA 3VBWA 4DINA 4FE2A 1FPUA 5K5XA 4KB8A 3UODA 5CASA 3UE4A 2OF4A 1OB3A 4NH1A 5DLSA 1ATPE 3B8RA 3NEWA 3W2SA 3WF9A 1JKKA 1YDSE 4I94A 3M42A 4CRLA 2RG5A 2RKUA 4AOIA 4W4VA 4AN9A 5I9XA 1GZ8A 3UOJA 3I0QA 3MH1A 4D28A 2HY81 2B0QA 2YCRA 3D14A 1WVXA 3LMGA 1FMKA 2OZOA 1LP4A 4MNFA 4CV8A 2CMWA 2UZOA 3OFMA 4D58A 3A99A 2E9OA 4M13A 5HU9A 3S1HA 3HMIA 5IA5A 4B7TA 3D9VA 1YI6A 4MKCA 4QMPA 5E1SA 4I5PA 3V6SA 4ASDA 3FL4A 3GCSA 1OUKA 4F64A 1HCLA 3DLSA
chains in the Genus database with same CATH superfamily
4CSVA 4G1WA 1OITA 4PL4A 5C9CA 3HMNA 3COHA 4E73A 2OH4A 5M57A 4NK9A 5BYLA 3VBXA 1ZOGA 2XK3A 4G3GA 4XOZA 5IQBA 1BKXA 2XH5A 3CPBA 3UDTA 1IAHA 1H01A 3W18A 3Q96A 2ZMCA 4OBQA 2DS1A 3MVLA 4FUXA 2VU3A 3C0HA 4YUQA 2GPHA 4IAKA 1JSVA 3C4FA 4PDOA 1JPAA 2YITA 5LMAA 3N4VA 4ZTRA 2BKZA 3FYKX 4JBOA 4KNBA 4WSYA 4QMWA 3G9LX 2W17A 4E3CA 1ST4A 4KAOA 1ND4A 1KSWA 3TJCA 3ZOSA 2G01A 4YJQA 3KC3A 2LGCA 3KY2A 3QLFA 4PMSA 3VUIA 5AM7A 1YRPA 3R7IA 3ANRA 3VS0A 5FEEA 4EH4A 1IR3A 4MNEB 1KV1A 3CQUA 4C34A 3L9MA 4R6VA 4RJ7A 3FC1X 4L45A 4TWPA 4KUJA 4YSJA 3EQBA 3FUPA 4F0GA 1WAKA 2R3PA 5KBQA 4F6WA 2XK7A 3GCUA 3A7JA 1Q4LA 5EYMA 2HZNA 4K11A 3LFAA 1H0VA 3VRZA 3LCSA 4I22A 4Q5HA 4AW5A 3DFCB 3FSFA 3IOPA 4A9SA 4Z16A 2C1BA 2C6EA 4E8AA 2VV9A 2OGVA 4DFXE 4F9CA 1FMOE 4BTKA 3VJNA 1JWHA 3IECA 2XKCA 4ZSAA 4NM7A 1A48A 5ANOA 3KRXA 4WNOA 3LOKA 5AUVA 4U3ZA 4BI0A 5HGIA 4DEBA 3MB6A 5HZNA 5H9BA 1Z5MA 3RBWA 5CXHA 1U46A 2CLXA 2XP2A 2XIKA 3NPCA 3DA6A 4U42A 1JKSA 1VYZA 2B52A 2X2KA 2OF2A 2Z8CA 3AMYA 3N51A 4FIGA 3R02A 1SZMA 4II5A 2ZM3A 4OR5A 4YJVA 2Z7QA 4QTDA 3LIJA 3RAKA 1PJKA 3PTGA 4R3RA 2GTNA 4IWQA 2GS6A 4QMTA 3H4JA 2HENA 2X7GA 5CS6A 1QPJA 4F0IA 1OL6A 2BRHA 1BMKA 3KN6A 1ZLTA 4I92A 4TYHA 4AFEA 5HU3A 2VRXA 3U4UA 4KSQA 5CAOA 2OXXA 1OIQA 4F7LA 4GU9A 2WTKC 5L6OA 4HNFA 3FMHA 3SW7A 4EC9A 2WTCA 4ZJVA 4ZIMA 2IVUA 2WTWA 3VRYA 1TFFA 2B4SB 3BE2A 4UXQA 5EG3A 3QQKA 5FTQA 5L3AA 2E9VA 3L8VA 2NRYA 4YPSA 4C38A 4IB3A 4EWHA 5DNRA 1LEWA 5CF4A 4J98A 2YN8A 3R1YA 3EQPA 4E5BA 3FMNA 4GYIA 2CHLA 5FDXA 4F9BA 2Y8OA 3IGOA 1UWHA 5AV1A 4M7IA 1KOAA 3PVUA 3GOKA 5D9HA 4C3RA 1GY3A 1K3AA 1PXKA 3PUFC 1Y57A 2BPMA 4CEGA 4G3FA 4LOPA 4AS0A 4DGOA 3WYYA 1M14A 3SA0A 2BZHB 5H8GA 5IQFA 4FTUA 4DC2A 4S34A 4ACCA 4EKKA 3NIZA 4FJVA 4KKGA 3QX4A 1OIUA 3NUNA 4FKVA 4MVFA 2IWIA 3DAJA 3EH9A 3PZHA 2YEXA 4U3YA 4UV0A 3TZ7A 4CZUA 2R3OA 2CNVA 2VTSA 2ETRA 4GUBA 5DWRA 4BWXA 3WF5A 2EXMA 3NUPA 3LAUA 4TYEA 2VWZA 1YI4A 5IQDA 2PPQA 4GT5A 2I1MA 3I60A 3QQFA 2XF0A 4AFJA 4TWOA 2C6OA 4DBNA 2OJJA 1OKVA 3HL7A 4UX9A 2WTKB 3OUKA 2C0TA 3KXXA 3P79A 4BDKA 4BJJA 5A6OA 3QQUA 2ZDUA 4OTRA 4AT4A 4L3LA 3POZA 3GC8A 4M8TA 3ZRKA 4ZP5A 4BI1A 4EHGA 3QHWA 3VUTA 4PP7A 5HE1A 3OOMA 3N9XA 3TTIA 4ACMA 4IWOA 4UWCA 2XB7A 4NSTA 3O0GA 3WYXA 3VUDA 3F3TA 2GSFA 4EK5A 4CT2A 1XH5A 3MFTA 1KE7A 4JR3A 4Y85A 3OXTA 5F95A 5JGBA 3IDPA 4LGHA 1YHSA 2OZAA 2JDOA 4WT6A 4TWNA 1DAYA 2WXVA 2Y6MA 4A9YA 4F0FA 3PPZA 3QTZA 4G2FA 2WU7A 1U54B 3C1XA 3F2AA 5DG5A 2YACA 5AP7A 4CLIA 1HOWA 3KKVA 3PDTA 4JL9A 5LVOA 3VC4A 1QPCA 1PXIA 2XRWA 3IW6A 3RMFA 1XBCA 2JKQA 5AP0A 5EM5A 3PG3A 4IFGA 4O7ZA 2EUFB 2C5XA 4W4WA 4BZDA 4BHNA 2QOKA 4DEGA 4EJNA 5IMEA 4EBWA 3TNHA 4ANOA 1J7IA 1G8SA 2ITQA 5IA2A 4L52A 3E7OA 4YJUA 3VJOA 4F65A 3OOGA 1HCKA 4FZFB 4ZY5A 5IH4A 5E91A 3D83A 4APPA 2I0VA 3R04A 3LLAA 3BV2A 3HGKA 4HGEA 3H9FA 3SRVA 4FK6A 3F3WA 5AR2A 5A4LA 4O4FA 2QOIA 2R0UA 5BQ0A 2CGUA 3COKA 3VS5A 2X9FA 3Q32A 4V0GA 2IW9A 3BWFA 1OPJA 1VR2A 3IKAA 3L8SA 3LXLA 5ANGA 4ZTQA 3K5UA 4FKIA 1XH8A 2X39A 4CGAA 1JBPE 2FH9A 3FI4A 4B6LA 3F2RA 2IO6A 2UZLA 3PG1A 5A3XA 3QTUA 4I20A 4ERWA 4WRSA 3AQVA 5E8VA 5GJFA 3M1SA 4D55A 3OXZA 3VONA 3KVWA 4FL1A 2NYAA 4BCJA 4AE9A 4LM5A 2R4BA 3PY1A 4I0RA 2R3MA 4KBKA 3F3ZA 4FVRA 4M84A 4HNIA 2UZDA 2GMXA 4QMYA 5CSWA 5AX3A 3IPHA 4IJ9A 1DS5A 3GGFA 4CQGA 3EL8A 5AUYA 4YTFA 1IRKA 2JKOA 2W1DA 3ATTA 2BDWA 4G3CA 4I5HA 4GCJA 2QOHA 2OIDA 3V5LA 1UNLA 2NRUA 3R1QA 3E7VA 5HEZA 2I6LA 5CAQA 1WCCA 2H6DA 2X8DA 2WMTA 1JAMA 4I41A 4U79A 4V0GB 4ACHA 4BVUA 2QO7A 5IQCA 4YNEA 4ENXA 3C9WA 3R9OA 3SG9A 4DTAA 2HZ4A 3QGWA 3AC5A 4LGGA 3MN3A 3RPRA 5IG1A 2R7BA 4FIHA 3VAPA 2ITOA 3TNIA 4A7CA 4O4BB 4QMMA 4ZTMA 4OAVB 4YLKA 1Q5KA 3GU4A 1IEPA 4CMUA 3CP9A 4NEUA 3U6JA 5E8UA 5GZ8A 4EWQA 4P90A 1JQHA 4R8QA 3E64A 5K4IA 2R5TA 4O84A 4XUFA 4RFMA 3UQFA 5HCYA 5DOSA 4EC8A 2X6DA 2XMYA 4G3EA 3ORXA 2RG6A 4IX6A 1WFCA 3OW3A 1KE8A 3UP2A 4UMTA 3NFGB 2OJIA 3BCEA 3JS2A 4DGMA 3NUUA 4HPTE 4GV1A 2WU6A 4CFMA 5E8XA 4F6UA 3LCKA 2UW0A 4KIPA 2GHGA 3BHTA 4AWIA 3ROCA 2WEIA 4F6SA 4U44A 4YNOA 4QMQA 2VGPA 5E4HA 5AR8A 4FRFA 1W7HA 5ETIA 2JAMA 2VWIA 4JDIA 2PWLA 3A4OX 2CGVA 2VTOA 4GKIA 1V0PA 4EH9A 5M09A 5C1QB 4AZTA 2X2MA 2X9EA 4G5PA 5JEBA 4QMLA 4R7HA 5JN2A 3LFCA 5FM3A 1UNGA 1I44A 2HY0A 2VNYA 3ZLXA 4K8AA 1W0XC 2JDSA 4TT7A 2CDZA 4AXDA 4UWBA 5AP5A 2XIXA 4RC3A 5JZNA 3BV3A 2UW9A 4BDBA 2VNWA 3UZRA 3NYNA 3QD0A 4I6LA 2B9FA 1H26A 2G9XA 4BDCA 3NMUF 4DT9A 3QCSA 3OVVA 2GFCA 3PJCA 2UZNA 3UZTA 4ANNA 2NNWB 2VTJA 4YTHA 4E5AX 2QKRA 4QYYA 4YZNA 3VUMA 4BCNA 5AADA 2CGXA 4AXFA 1NVSA 3LHJA 4MBIA 4R1VA 3PY0A 1A9UA 4GUEA 1CKPA 2BUJA 4FUYA 4GS6A 4U45A 5HIDA 3HV4A 5HBHA 2W5HA 3AGLA 2EXCX 2QHNA 2VTMA 3L9NA 3QUDA 3AMAA 4DHIB 3QYZA 4CFUA 2UV2A 1F3MC 4L42A 1J3HA 3BGQA 3NUXA 2BAKA 1K2PA 2F7ZE 2OWBA 2PVJA 5D11A 5TR6A 3ATSA 4MCVA 3A61A 4M69A 3E5AA 5ETAA 5KMNA 4BYIA 2GFSA 4FC0A 4FBXA 4YHFA 3ID6C 3CTJA 1W98A 4BDHA 1T46A 2FSMX 2FUMA 2PMOX 2V55A 3C7QA 5IUIA 3I0OA 4FTRA 4FSUA 3CE3A 5H8BA 1J7LA 2YM6A 3VS4A 1WVWA 1B6CB 3ZDIA 5CF6A 5IKWA 4QQTA 3QCXA 4AACA 2PTKA 1ZMUA 2W1CA 3GC0A 2W99B 2C3IB 4DHFA 1X8BA 4FR4A 5KNJA 1O6YA 5CLPA 4FVPA 2R3GA 3EFJA 4OT6A 4QPAA 4RIXB 5CYIA 3ZH8A 2J50A 2UZWE 4FG7A 4RC4A 4EHVA 5DH3A 5C01A 3G0EA 5HD4A 5EQPA 4YMJA 5F1ZA 1TKIA 5CT0A 2E9NA 4JQ8A 5KKRC 4BCIA 2R0IA 4F9AA 5I9WA 2CCIA 4O4CA 1YOMA 2EB2A 3POOA 4QT1A 4RJ5A 3ZS5A 5M4CA 3QZGA 4AXEA 4DBXA 4AW1A 4QMZA 5KZ0A 3UBDA 3IG7A 3KXHA 4AAYA 3LJ0A 2E2BA 3ML1A 5FDPA 2C0OA 3UDSA 2YFXA 2PVYA 2UW8A 4FYNA 1R0EA 2PL0A 3KF4A 3UYTA 5M4IA 2P55A 3FQHA 5FP6A 1XQZA 2QURA 3ORNA 3D4QA 1GZKA 3H30A 3HP5A 3TNWA 3VS3A 4Z3VA 4IAAA 3MBLA 4XP3A 2ITUA 4AT3A 3U55A 1W2FA 4C58A 4RJ3A 1MQBA 4DG2E 4FKTA 4G5JA 4V05A 4X2NA 4YJNA 4QEBA 5IDPA 1PRYA 2QOBA 5JFVA 3R00A 4U6RA 5HLNA 3COIA 2QLUA 3AC3A 3FL5A 5DMZA 5BX0A 2OJFE 4AXCA 2O8YA 4EH2A 3HDNA 4IHPA 2XALA 5EW3A 2YJRA 5EI8A 5HQ0A 2VN9A 2PMNX 4ZLYA 1E9HA 4K2RA 4X3JA 4D2SA 3C4CA 3UZPA 4A4XA 4ENYA 3SXSA 3MGYA 4PNIA 3CIKA 2G2FA 4MXZA 5KHXA 2ITPA 5CU6A 2RSVA 3M11A 3TI1A 4F1OA 2JEDA 4QTBA 4GJ3A 4FV3A 3BYSA 3MH2A 2PUIA 3BZ3A 4P5QA 1F5QA 3OWPA 4KD1A 3DQXA 4D2WA 3EKNA 3R7OA 2W1GA 3RVGA 4AOTA 4YSMA 2F57A 2VGOA 4HYHA 4BZNA 5AFVA 4FT0A 4PQNA 3R8PA 2FB8A 1R78A 2QOFA 2UZTA 3WF8A 4BIEA 3TIZA 5BVWA 2HXQA 2A2AA 4FT3A 3E92A 4EK6A 3FMLA 3GQLA 4U8ZA 3CJGA 2IJMA 3KXNA 4E6DA 1YDRE 2XM9A 4QP7A 5ETCA 4EH7A 4WOVA 4XG2A 4F70A 3BU6A 4FG8A 5A4EA 2PE2A 3SW4A 4BYJA 5DE2A 3W2PA 4E6AA 1H0WA 4TW9A 2P4IA 4RWIA 4O83A 3SRVB 2BRBA 2ZAZA 2BDJA 5AR3A 5FP5A 4O0TA 5CSXA 5GHVA 4IJPA 1TQMA 4C36A 4L44A 5HD7A 4LDTA 1XO2B 3NAYA 2Y4PA 4GW8A 4YTIA 2J0JA 3AG9A 1R1WA 3P08A 4QMVA 4D4RA 1G8AA 4O7VA 4BR3A 1F0QA 2RFDA 3KB7A 4CXAA 3AT4A 3DLZA 3ELJA 3BIZA 4XH6A 2YM7A 4EOIA 2PVHA 4J95A 5HNBA 1JOWB 4O0XA 4G6NA 3G90X 4AU8A 5KX8A 3T3UA 4O0SA 5CF5A 4FNZA 4BCGA 4IAYA 4RJ8A 5TOZA 4AOJA 4S32A 3C5UA 5G6VA 3SHEA 4WD5A 1Y8GA 3PIXA 2BHEA 2FYSA 2XBAA 5HI2A 4EOQA 2VWXA 3Q4UA 3EN4A 3GP0A 3QYWA 2BHHA 1YI3A 1PW2A 3DTWA 4FVQA 1JLUE 3PXZA 3OY3A 5J9YA 4E20A 3AKLA 3BHHA 3F5XA 2VTIA 5AIKA 4QNYA 3E8CA 3HVCA 4A07A 3RWPA 2P2IA 4PDSA 3D2KA 4KIKA 4RJ6A 4ANBA 2OLCA 4X2GA 2OG8A 5HORA 3BHYA 3KEXA 3TCPA 3IDBA 5HLWA 1PYXA 3UG1A 4FKGA 4GH2A 4MH7A 3UMWA 4BWPA 5CAPA 4NJ3A 3C4XA 3FPMA 4ZTNA 2YM3A 2YM5A 5CU2A 4U0IA 3O96A 3ZSGA 3QCYA 4UWYA 3EQFA 4OAUC 1FGKA 4XP0A 5CSPA 5CSVA 5ACBC 3FKLA 3PYYA 4DHJA 4FTNA 3DK6A 3LCOA 4ANSA 2JKKA 4I5MA 5AJQA 3QA0A 5AR4A 3ZHPC 3DS6A 2ONLA 4ZSLA 5FWKK 5HCXA 3PLSA 4I24A 4Q5EA 4D0XA 1CM8A 2VTTA 4H58A 3KMMA 4YGAA 4OBOA 2WOTA 4BI2A 2OU7A 3FZRA 4J53A 3GQIA 3NYOA 5EH0A 5HO7A 4N0SA 3RCJA 4XS2A 3UDZA 2GCDA 2YM8A 3FLWA 4QYGA 4CCBA 5HG5A 3VBVA 1RE8A 3F2NA 4LL5A 4RIXA 4CYJA 1XJDA 3HMOA 1J91A 4USFA 4GG5A 3BL9A 3QRUA 2EXEA 4I6BA 3GCVA 4DFZE 1PKGA 4L67A 5KBRA 3EFKA 4O0UA 4E4MA 2WTJA 5AIRA 5B0XA 4EHZA 4HCVA 5HKMA 4BTFA 4FTMA 4KKEA 5DGZA 1NA7A 3NNUA 4HZRA 5IF1A 2ESMA 2WMVA 3Q9WA 4ZMEA 1S9IA 1OL1A 3OROA 1ZXEA 5M44A 3V51A 2Z02A 3W2CA 4O2ZA 4U40A 3FKOA 3LVPA 4YZMA 5CEQA 5CAUA 4IZ7A 5HG8A 4I6QA 4YJSA 2PVFA 3HECA 2PMLX 3ZUUA 4RFYA 2BAJA 4DH3A 3ORKA 3U51A 3R8UA 3P5JC 4HVIA 4OTGA 3CSVA 5ACKA 3DZQA 4PTEA 4YLLA 2OSCA 3KMUA 3L1SA 2DYLA 1ZMWA 3KULA 3LQ3A 4ZJIA 2W4OA 3SVVA 3ZBXA 5E8TA 2B1PA 2ITXA 3W8QA 3FLYA 3Q9XA 1H24A 4O82A 3NZ0A 4XV2A 3NNXA 1UU9A 3EKKA 3QCQA 2ACXA 4IC7A 3TUBA 2O65A 2YIXA 3GU8A 3DNDA 3RAIA 2BRGA 3AT2A 3HUCA 2ITYA 3DY7A 3H10A 4FSNA 4FV4A 1XKKA 4JBQA 4RBLA 2C6TA 3MH0A 2QC6A 2XRUA 5JKGA 4YC8A 3ZRMA 4O27B 2JFLA 4J8NA 4PUZA 4F7NA 2X2LA 2ZYBA 3LW0A 3V8WA 1U4DA 2XNBA 2JDRA 4L46A 2ITZA 3C4WA 3O51A 4KWPA 1DI9A 2P0CA 5BVKA 5J87A 1H8FA 3SDJA 1VEBA 1OPKA 3B2WA 3EB0A 3PA3A 1FQ1B 3PRIA 3LFDA 4FGRA 1H08A 2OFUA 3ZLSA 5I9ZA 4QDEA 1FINA 5HVYA 4NU1A 4WHZA 5IA1A 4ERKA 3DV3A 3W55A 4X6RA 3F66A 5DA3A 1S9JA 2XVDA 2QODA 2CGWA 1XR1A 3RAWA 4E5WA 2C3JA 3R71A 2Y7JA 4Y83A 4NW5A 3MI9A 4GK2A 3NVKI 4YBKA 1VLRA 4KSPA 4L8MA 3NVMB 2W5BA 2HOGA 4XBUA 1MRUA 1RQQA 1CKJA 4FZDB 2X0QA 1ZRZA 2WTIA 4R5SA 4J8MA 3ENMA 5ANKA 3UMXA 5HO6A 1BL7A 3KRRA 2HW6A 1U5QA 3KCKA 4RC2A 3TN8A 2CPKE 2W9FB 4XV3A 3ZONA 5KCVA 3ODYX 4IAZA 1SMHA 4MXAA 4K33A 4MAOA 1PXLA 3JVSA 5I3OA 4CYIA 1O6KA 3E63A 3VS2A 2GS7A 3AXWA 3CLYA 5E8ZA 3TIYA 3RNYA 3ZEWA 3MFSA 1H00A 2RF9A 4DYMA 2YWVA 3IW8A 2C5NA 5BVDA 4HCTA 4IVAA 5DIAA 2VO6A 4IMYA 3SOAA 4BTMA 2VO3A 2Y4IB 1CKIA 3ACKA 3U6IA 1PMVA 3BRBA 4ZK5A 3PP1A 3TG1A 4AZFA 3UIBA 4IX5A 5D1JA 3MH3A 3QTIA 3U8WA 5L8JA 5D12A 4YR8A 2WD1A 1FVRA 3MY0A 4L6QA 5AP1A 2JKMA 2PVNA 5I9YA 1WBTA 5IPJA 3A7GA 4PMPA 2WMRA 3BLQA 5EKOA 4L7FA 3RCDA 4FTIA 4CT1A 1QPDA 3CS9A 1RJBA 3PVBA 4QP4A 4UALA 4IM3A 5EDQA 3BKBA 1M2RA 4HOKA 4FIFA 3VWAA 4AGCA 4YU2A 4HGLA 1Q3DA 2BZIB 5J5TA 4O0WA 4ZSEA 3W0PA 3R73A 1YXVA 4L9IA 2F7EE 3CD8A 4GSBA 5I0BA 3GCPA 4UMRA 4P7EA 5DR2A 3LFQA 4DH5A 1BI7A 3AGMA 5LVPA 3BWJA 2R64A 3HDMA 4FEQA 1URCA 2FGIA 3S00A 1GZOA 5HBEA 4O4EA 3R83A 4DCEA 5DVRA 3WARA 3UPZA 3EQGA 1STCE 3C50A 3O8PA 5AAEA 4QP8A 2OKRA 1LPUA 5IH5A 2A0CX 5AV4A 1M7QA 4O0VA 3EFWA 2CSNA 3RNIA 4U9AA 4C4HA 3ORZA 1B38A 3PXKA 5H2UA 5BUIA 4M3QA 4O38A 3FMKA 4O6LA 3OEFX 4FMQA 2WFYA 4O7RA 4BRXA 3ERKA 4I4FA 3WZUA 3QZFA 4IB0A 4CMTA 5HESA 4CG9A 3QRKA 3EN9A 3OCTA 2ZB0A 1Q8YA 3NDMA 5DRBA 4HYIA 1U5RA 5C8NA 4FTKA 3TV7A 4K18A 4RIYB 4IADA 4J96A 3ORMA 3DB8A 2PVMA 1ST0A 3ZLYA 3OWJA 1OIRA 2H8HA 4ZTHA 2C0IA 2PY3A 2C6IA 3GXLA 4M69B 4RVTA 4P5ZA 3VO3A 1H1RA 3O7LD 4OT5A 4Q2AA 3F82A 3ZO4A 4C2WA 2QO9A 5IQGA 1OL7A 2ITVA 3P1AA 4G16A 2C5OA 4NKAA 4J99A 2XCKA 4M12A 3ALNA 4FOBA 4UMQA 3R9NA 3FI2A 1GIJA 2QU6A 2R3JA 3PXRA 2GTMA 4IZAA 3UIUA 1G5SA 2VX3A 3HKOA 2OBJA 4FKRA 3B2TA 5AV0A 4IB5A 1DM2A 1KE6A 4DGNA 2VWYA 3R1NA 1OBGA 2WMAA 3FY2A 4DHZA 4N70A 4D4SA 4RIWA 5GNKA 3LLTA 3AKKA 3R8VA 5DYJA 2WIPA 3A7HA 4LUDA 3AD5A 2FSLX 4KRCA 4D4YA 5HTIA 2BFYA 3DXNA 3HRBA 4S30A 2BRNA 4NKSA 4DFUA 4NUSA 5DT4A 1PXMA 4JRNA 3O8TA 3ZBFA 3KF7A 3M2WA 5FG8A 3ZDUA 3KN5A 4BCOA 3FLNC 3P23A 5KHWA 2JIVA 5B7VA 2V62A 4I6HA 1AD5A 2OZAB 2A27A 1PMNA 3VUHA 2XARA 1JKTA 2OK1A 2W1HA 2IVVA 2ETKA 4CFXA 4C8BA 5BV3A 1W8CA 2GHMA 2WMWA 4L3JA 3LMIA 3F9NA 3QD4A 2B9HA 2XA4A 3Q9YA 4DITA 4C3PA 3SLSA 3UIXA 4QD6A 3DQWA 3P7BA 4TYGA 3O17A 1JVPP 2E9PA 4NCTC 2C69A 4BBFA 3MA3A 3Q52A 3VBYA 5K4JA 4FICA 4XLVA 4AA5A 3G9NA 1M52A 1PMEA 2XZSA 3QTWA 2WPAA 4AGDA 3CJFA 3FBVA 3L8PA 4D5KA 3F5UA 1OI9A 4BKJA 3U9CA 2J6MA 4AUAA 4YHJA 3GB2A 4ZZNA 2FVDA 4EK8A 3EYGA 2G2HA 3A2CA 2UW4A 5AR5A 3S0OA 4NL0A 4DEEA 4FSMA 4ZZOA 4XMOA 2W1ZA 3R6XA 4EOPA 4O96A 4EJ7A 3UOKA 2PE1A 3TKUA 2WHBA 4MNEA 3UG2A 4AE6A 1NT2A 5GIPE 5BPYA 4FTCA 4I4EA 3RZBA 3VS7A 5IEVA 4D1SA 3LFNA 4RT7A 4XYFA 3ZO2A 3SKCA 3KIOC 4WNKA 1WMKA 3ANQA 3KU2A 3VHKA 2GQRA 3LFEA 4IZYA 3PVGA 2ITTA 3E93A 2YJSA 1ERKA 3QF9A 4FIEA 4X2KA 4BDFA 4F78A 3R0TA 1KE9A 2FO0A 4BDGA 3D2IA 3AC1A 2YCSA 3NGAA 4HPUE 4GIIA 4RWJA 2F2UA 4YHTA 2JAVA 4E4NA 4H39A 3U6HA 5CQUA 5FRIA 2V5QA 2XYNA 4FEWA 3T3VA 3CKXA 4G34A 4X3FA 4LYNA 2VTRA 5FXRA 1YWRA 2VAGA 4JS8A 1J7UA 5GIOE 2IZUA 3QQJA 3C4ZA 3CQWA 2IF8A 4IM0A 3RINA 4CKIA 5I5ZA 1ZY4A 5HE2A 3R1SA 4TN6A 5LMKC 3TTJA 1K9AA 5J7BA 4FIJA 1CMKE 3Q6UA 4H1MA 4MWHA 4FOCA 3ZUVA 2IPXA 5JGDA 5LWMA 1G3NA 3P78A 1ZZ2A 3H0YA 1XBBA 5E8SA 2X81A 3RZFA 1UVRA 3AC2A 3UVRA 5H8EA 4YP8A 3VUKA 3AKJA 3DAKA 3MW1A 3F7WA 4FNYA 3OUNB 1OECA 5FD2A 3LXNA 3U54A 2OH0E 2UUEA 5JK3A 3MPTA 4LL0A 5CANA 3D5UA 4JG8A 4M0ZA 2PZIA 3QRIA 3ZMMA 3HRCA 3WILA 4DEIA 2W4KA 3LXPA 3R9HA 2JIIA 3RP9A 3V8TA 5AUTA 3ET7A 4M15A 2ZMDA 3QKKA 4XBRA 1UU3A 2PMIA 4RIWB 3SXRA 3F69A 4WKQA 4ORKA 4E93A 1Q97A 2OXYA 5A54A 5J1VA 3LXKA 3UQCA 1H28A 5JT2A 1OMWA 3BLRA 4JR7A 4GMYA 4RZWA 5A6NA 3K3JA 3Q53A 2X0PA 4BCHA 4H3QA 4ZMFA 5CT7A 3PWDA 5BVFA 3OF0A 3ZTXA 4BC6A 3R9RA 1WBPA 3LQ5A 4YZCA 5IQIA 2QG7A 1B39A 1RW8A 4HJOA 3NFFB 5J95A 4DEHA 4RVLA 1FBNA 3I7CA 2PULA 1U54A 2JDTA 3EQRA 3SOCA 4YZDA 4D2VA 4IM2A 1G8KA 3RTPA 4LOQA 5DR9A 4A9RA 3PSBA 2EU9A 2W96B 1ZOEA 4ITJA 3NRMA 1P4OA 4GRBA 4MYGA 5IA3A 4N57A 3EQDA 3C4EA 4QP1A 1J1CA 2P2HA 3IW4A 3ZRLA 1OPLA 4AA4A 2GNGA 3ZFXA 3BYUA 1H1PA 1Q41A 3OXIA 4JOAA 3R7UA 2BALA 3CCNA 4WG4A 4YBJA 2UW7A 2IW8A 3TKIA 2Z7SA 3VN9A 2OJ9A 5AUWA 5L2WA 2OO8X 5HTCA 3P0MA 5TKDA 3ENHA 4AW2A 3ZC6A 4EHEA 2WGJA 2B9JA 3A8WA 3ZXTA 3HAVA 3ETAA 4OW8A 4JDKA 4RGJA 4M14A 1A06A 2PZPA 3DCVA 1SNXA 1WZYA 3VS6A 5CQWA 5T3QA 3I7BA 2YA9A 2XCHA 4UXLA 3PPJA 4W9WA 4ALUA 4XOYA 2Z2WA 4DFLA 2B9IA 3E3BX 4JLCA 2WEVA 5T6KA 4FNWA 3UNKA 2C4GA 5HCZA 2OXDA 2BCJA 5M06A 2J51A 3DBFA 3PXQA 3BPRA 4R77A 1WBWA 1V0OA 1GAGA 3EWHA 4RRVA 3JY0A 3WZKA 3IO7A 2R2PA 4LRJA 4EZ7A 1AQ1A 5AP3A 4BHZA 3OY1A 1ZY5A 4UY9A 1KUTA 5FXSA 1ZAOA 3QLGA 3Q4CA 3EZRA 4O0RA 4QYEA 4QMUA 5CVHA 3W0RA 2JBOA 2YZLA 4TYHB 5HLPA 4AZSA 4IANA 2BROA 2FSTX 4JMQA 4MXXA 3ZFMA 4DH8A 3GC9A 1OVEA 5CWZA 1JNKA 1OBDA 2XAOA 5C26A 4FKUA 3PIZA 3ZEPA 5KKRB 3KRWA 5E9EA 2PU8A 2W05A 4D9TA 2WNTA 4F7JA 1UKHA 2YZAA