4DC2A

Structure of pkc in complex with a substrate peptide from par-3
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
339
structure length
328
Chain Sequence
LGLQDFDLLRVIGRGSYAKVLLVRLKKTDRIYAMRVVKKELVNIDWVQTEKHVFEQASNHPFLVGLHSCFQTESRLFFVIEYVNGGDLMFHMQRQRKLPEEHARFYSAEISLALNYLHERGIIYRDLKLDNVLLDSEGHIKLTDYGMCKEGLRPGDTTSTFCGTPNYIAPEILRGEDYGFSVDWWALGVLMFEMMAGRSPFDIVGSNTEDYLFQVILEKQIRIPRSLSVKAASVLKSFLNKDPKERLGCHPQTGFADIQGHPFFRNVDWDMMEQKQVVPPFKPNISGEFGLDNFDSQFTNEPVQLPDDDDIVRKIDQSEFEGFEYINP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/transferase substrate
molecule keywords Protein kinase C iota type
publication title Substrate recognition mechanism of atypical protein kinase Cs revealed by the structure of PKC iota in complex with a substrate peptide from Par-3
pubmed doi rcsb
source organism Mus musculus
total genus 96
structure length 328
sequence length 339
ec nomenclature ec 2.7.11.13: Protein kinase C.
pdb deposition date 2012-01-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
A PF00433 Pkinase_C Protein kinase C terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4dc2A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4dc2A01
3C7QA 3ZO4A 4NZWB 4WG3A 4TWOA 4N70A 1UA2A 1M2RA 2W05A 4I0SA 4NM7A 2G9XA 3BE2A 3VULA 3R7EA 4UWYA 2XBJA 2WQBA 2ERZE 4XUFA 2J0MB 3ZUUA 1H24A 3JY9A 5A14A 4JDKA 5HQ0A 3A62A 4Z16A 4Z7GA 3LFQA 4RWKA 4U97A 5B2KA 4JJRA 3QD4A 5KZIA 3TWJA 4A9UA 2FSLX 3IW5A 2XCKA 3HX4A 1KUTA 4I0RA 4O0SA 4YR8A 2WMQA 2XNBA 3SXSA 3E7OA 4R3CA 3R8UA 3E3PA 2BZKB 2WHBA 3IDBA 4IDTA 4XV9A 4XG6A 5K9IA 1PYXA 3R8PA 4K77A 4JBPA 4I6BA 4RJ6A 4XP0A 5IH4A 3RWPA 3UIUA 3L8VA 3FY0A 4QNYA 2W9ZB 2WMRA 3O23A 5AR5A 4GKHA 3LQ3A 3E7VA 5DPVA 4EKKA 4GCJA 5HU9A 2RKUA 1U59A 1IAJA 3FLNC 1YDSE 4WRSA 3UO4A 3V3VA 4DHFA 4FVQA 4PPAA 4EHZA 4UMQA 2YIXA 3SRVB 3V04A 3ZLWA 4EH6A 2BIKB 3U6HA 4EH4A 3NDMA 3EB0A 3ZFYA 3SAYA 1PXKA 5L2IA 1PXNA 5CXZA 1JKSA 3DK3A 4GG7A 2HWOA 2WMBA 4XEYA 1L8TA 4R78A 4CYJA 3MI9A 3PWDA 4YLKA 4MEDA 2HAKA 4MBLA 5FWKK 2BUJA 4CQGA 5JFXA 2CKPA 1YOJA 3FMDA 1SNXA 3G9NA 3LCSA 4PY1A 3G0EA 2ZOQA 4F99A 5CANA 3EOCA 5IA1A 4FV7A 3F88A 3FLSA 4MK0A 1BKXA 4O0WA 3MVHA 3U9CA 4NIFA 4DE4A 2J0JA 1H01A 3BHVA 4FEVA 4AA5A 5AP6A 5K5NA 3R1NA 2XK9A 3G51A 3LQ5A 4D58A 3UZTA 2R7IA 1ZYSA 3FYKX 2G15A 3M42A 4L7FA 4RPVA 4TYJA 3V01A 3W2PA 4O1PA 1R0PA 4YPSA 2F49A 2C5XA 3AT4A 1FVRA 2NRYA 3ELJA 3QUDA 4GJ3A 3WZEA 4UMRA 1PMUA 3F3ZA 4O38A 5IZFA 4FIJA 1O6KA 3SC1A 2R3KA 2Y7JA 3HDNA 2OSCA 2O8YA 2O2UA 1YRPA 3GU7A 2OJIA 3DFAA 4OTHA 4YBKA 4FX3A 3RK7A 2OGVA 4UALA 2QOBA 1JNKA 1U5QA 3PXRA 2QODA 4PWNA 4U79A 2GQSA 4PL3A 4PPCA 4YLLA 3HA8A 4FV1A 2FUMA 4XG2A 3F3VA 5EK7A 4NK9A 1KE8A 1M17A 4RRVA 4E6AA 3PJ3A 3QKLA 4ZAUA 2X9FA 4F70A 3JVSA 3OXTA 5GZ8A 3E8NA 4FTNA 3C51A 4JOAA 3FL5A 2X8EA 5I5ZA 4ZLOA 4D2VA 4AXAA 4D1ZA 1F0QA 3DAJA 5ANGA 4F9BA 3RPSA 4PDSA 4ZLYA 3GU4A 5FGKA 4WNOA 1YW2A 3VJOA 4IH8A 4X7QA 4Y95A 4XMOA 5A46A 3O50A 3P86A 4MNEA 2VD5A 4OAVB 4JG6A 3R21A 4TKSA 5HVKA 5L2SA 4A9SA 2BCJA 3ZFMA 3F9NA 3DAKA 2QHMA 4M7IA 2GTMA 5EW9A 3BGPA 4KS8A 4JDJA 1MQ4A 4BHNA 4K11A 1UKIA 4M68A 5CEKA 4FG8A 4U44A 2PY3A 3ZHPC 4ALWA 2OKRA 4JIKA 4EHGA 2ZJWA 3CGFA 3RAIA 4GVJA 5DBXA 5CF8A 5EM7A 4PNKA 1GZ8A 1P4OA 2R2PA 4M0YA 4C4IA 4QMQA 2DYLA 2YDKA 3HDMA 2ITYA 3D14A 3QX4A 4DBNA 4UN0C 2BKKA 1PXOA 3EQIA 2B0QA 3QRKA 1IA8A 4FKRA 3KREA 3QF9A 4OT5A 4TYHB 4ZMEA 3CIKA 3BU6A 4AZEA 4CMUA 4F1MA 3DPKA 4KBKA 3W32A 3ZC6A 3ZMMA 5I9WA 2XNEA 4GYIA 5E1EA 4HPUE 2PVHA 5DGZA 2GNIA 4PPBA 2VO7A 3ZBFA 2CJMA 2F7XE 2VX1A 1H27A 2H9VA 2XEYA 3QCQA 5CY3A 3FE3A 4GEOA 1OL1A 2ZDTA 4O7VA 3M1SA 4BCJA 3BBTB 4RVMA 4E1ZA 1OPKA 3RZBA 2UW6A 4I1ZA 3NIZA 2Y4PA 2IZRA 2R3IA 2X7FA 4G2FA 2XM9A 3VHKA 2VTHA 4MVFA 3WOWA 2YITA 4LGHA 4AS0A 2OJJA 5A6NA 3U6IA 3OXZA 4BRXA 4I22A 5E90A 5A6OA 2BZHB 3EN9A 2BDWA 2PZ5A 3KN6A 2WXVA 2W5AA 5BVKA 5K4JA 3BIZA 3NS9A 4L3PA 1H1PA 4TW9A 2BDJA 3BGQA 5G6VA 2CGVA 5JGAA 1FINA 5E7RA 3R1SA 5AV4A 3KK9A 2YERA 3RHXA 5ICPA 1AGWA 3G2FA 3NUYA 5KHWA 4NU1A 3E8DA 4FR4A 4ALVA 1CDKA 3WF8A 4Y8DA 3FMHA 3LW0A 4PRJA 1ZY4A 5IUHA 4FTCA 5LCJA 3TEIA 4OAUC 1NW1A 5BVEA 3UDBA 4FZ6A 4KKHA 4NM0A 4YLJA 2W9FB 4D9UA 4EOSA 3NUNA 3MYGA 3G15A 2W1CA 2C3IB 2BTSA 4MXCA 5GJFA 5AP1A 1KE6A 4LFIA 4NEUA 4D0XA 5ETFA 4D55A 2QHNA 2HZIA 4RJ4A 3R7IA 4R77A 4FTJA 4EZ3A 3E93A 1W98A 2QD9A 3GUBA 3KQ7A 3PSCA 3PWYA 4M8TA 4NJDA 4D2PA 1XBBA 3UP7A 2GHGA 5LVLA 4MQ1A 3P0MA 3NCZA 3A8XA 3IO7A 1AD5A 4HZSA 3G90X 2I1MA 4AOTA 3CTQA 3RPRA 4E93A 4CVAA 5AP7A 3ATTA 3BYOA 2OU7A 4PMMA 5FM2A 3NUPA 4AW1A 1DAYA 5KBRA 4BWPA 2VTNA 5J79A 3MB7A 4EYJA 5F9EA 3NEWA 5J5TA 2VTAA 2E9VA 2PMOX 4HNIA 4U6RA 2XK4A 3R73A 2UZUE 4XOZA 4GRBA 2EXCX 3RKBA 4F08A 3CCNA 5D7AA 5AM7A 3AQVA 2WPAA 4PV0A 2O0UA 3CQWA 4BYJA 1XBAA 3OP5A 3LXPA 4BZOA 3W2SA 2B52A 4OTRA 4ZY6A 2HY0A 4FVRA 2V0DA 3VUTA 3VW8A 4Z7HA 2GNJA 4PL4A 3UIBA 2QO9A 2VNYA 3GVUA 3KULA 3ODZX 4HYHA 1YHWA 3D5UA 3PRFA 4C58A 4FKSA 5M4FA 1LP4A 3OXIA 5DT0A 3KMMA 4TXCA 4JDHA 4WRGA 3CD8A 3QUPA 5IQGA 1DI9A 4QP8A 5HORA 3RPYA 1OM1A 5H3QA 4DEIA 4EJ7A 3QA8A 3F7ZA 5BQ0A 1ZXEA 2ESMA 5A4QA 2WKMA 4UZHA 4BY9E 1ZMWA 4XOYA 5JZNA 4PDYA 3O0GA 4E3CA 2P0CA 4JG8A 4A4OA 4QO9A 4KIQA 1YXVA 3GXLA 1NT2A 2QI8A 3KRLA 2BZIB 3HUCA 3Q4UA 5ETAA 3SOCA 3DJ5A 3DJ6A 4FEQA 5KO1A 4ZSAA 4DC2A 4W4YA 3TTJA 5AEPA 4A7CA 4DGOA 5KMLA 1K9AA 4G1WA 4MH7A 4WA9A 3DQXA 2PVYA 5EW3A 4JAJA 1OVEA 2YM7A 3R71A 4X2KA 3EFWA 5AIRA 5AJQA 3R9NA 3R8LA 5A4EA 2CDZA 3OD6X 3ZBXA 4C59A 3DLZA 3F82A 4WNPA 3PPJA 4TT7A 4NKSA 1DS5A 3PXQA 4RIYB 1W84A 4RX9A 2QG5A 5JN2A 5BYYA 1XJDA 3QD2B 3O7LB 3TNWA 3TZ7A 3ZLXA 1X8BA 2W1HA 2BZJA 4XV3A 4F9YA 2ITVA 3BQRA 3R6XA 3MFTA 4APCA 5IQEA 5AMNA 2BRNA 2PYWA 2C6LA 4XG8A 4GSBA 4J71A 3AD4A 3HMOA 4E6QA 4APPA 4EUTA 3E8CA 1E9HA 4B7TA 4CFMA 2Z7LA 4F9AA 4OBPA 1YKRA 4RA5A 2B55A 4H39A 3ZH8A 5HEZA 4CSVA 3KN5A 2J0IA 3FZ1A 4U9AA 1E1XA 2VTTA 3COHA 4U0IA 5HIEA 1Q8ZA 2YIQA 3AT3A 3ZDUA 4AQCA 2WTWA 2X7GA 5AIKA 1MRUA 4AFJA 3Q60A 3FZTA 3HZTA 1CMKE 4U81A 3E63A 4K6ZA 1H1RA 3FQEA 1R1WA 4H1MA 1M2PA 3R30A 2CN8A 4RIWA 3A61A 3HUBA 2IPXA 5KZ0A 4EK3A 1VZOA 2J0LA 3CP9A 1J1BA 1E1VA 4BDHA 2Z7QA 1PXMA 4IB5A 5CYIA 4YUQA 1Q8WA 2EB3A 4I94A 5EW8A 5LCKA 4FV2A 3FV8A 3VBYA 3BEGA 2CKOA 4J97A 2CNVA 2QOFA 2XNOA 3AC1A 3ORLA 2PUUA 4ZZNA 3MFUA 4IFCA 5AV2A 4M15A 1KE7A 4RX7A 1YXSA 4IJPA 3I7CA 5ANIA 4HVDA 1PMVA 3ZCLA 5BNJA 5M09A 4QPMA 4JXFA 5IEXA 1VEBA 4W4VA 4UWCA 3A7HA 4QMOA 5AUZA 4CFUA 3ZM4A 4FYOA 2VTPA 2EUFB 4O86A 2AUHA 3RCDA 5HTBA 2UW9A 3WE4A 5C8KA 3Q9WA 3UP2A 4O7RA 4XBRA 2PUPA 4EH7A 2H8HA 3ACKA 2E9OA 1LUFA 5AUVA 4AN3A 1GIHA 2PPQA 4EK6A 1YDRE 1IR3A 2GDOA 4EHEA 5L8LA 4CFVA 4HGTA 4ONAA 3NYVA 1W83A 2R3FA 4YJOA 4BB4A 3FLZA 1U54A 1H08A 3QRTA 5E4HA 4FI1A 4FNZA 2YIRA 3WI6A 1YHSA 3ZZWA 1AQ1A 1ZMVA 3OEFX 4U80A 3UQFA 3KA0A 4IX3A 3FLWA 5ACKA 5T6KA 3D2KA 3ORXA 3SXRA 4DEGA 5M55A 4FNYA 5TO8A 4BGHA 4FT5A 2BHEA 2GFCA 2WD1A 3Q5IA 4I6FA 1S9IA 4L00A 3UNJA 3VS4A 4ANSA 4QQ5A 2GNLA 4L6QA 3F5UA 3SHEA 3ZXTA 4LUEA 4CZUA 1JSTA 4H3PA 2X39A 1SMHA 2VAGA 4O0YA 4ZSJA 2C0TA 3VBWA 4AT4A 1PJKA 2PZYA 3H30A 3KC3A 4V0GB 2C69A 5I9ZA 2BFYA 3WYYA 4BBEA 4KABA 4WNKA 1WVXA 2OXDA 3IGGA 3WIGA 2UVZA 3ITZA 3S95A 5M07A 3W18A 4D2WA 1G8AA 2I0VA 2QO7A 3BLRA 2C6EA 3DBEA 3QX2A 4L68A 3OROA 4X21A 5HCXA 4EC9A 3PXKA 1IAHA 5DR6A 5FEDA 5CSHA 2WOUA 5BVFA 4ZSGA 3SD0A 4F1OA 4EOLA 5H8EA 2B9JA 4EBWA 3HRFA 3HV6A 3C13A 3DU8A 4EOOA 2R0IA 2CSNA 2PWLA 4Z3VA 5CSVA 2C3JA 3R9DA 2J4ZA 2YISA 3GCUA 4IX5A 4YTHA 5D11A 2G2FA 3MTLA 3HVCA 1WZYA 5BUIA 1R39A 4N6YA 4ZZMA 1LEZA 3W2RA 1W8CA 3KB7A 2GNGA 2BMCA 3VS7A 5HLPA 4AW0A 4B8LA 1UNLA 4TNBA 5BVNA 2WTDA 3BQCA 5BUEA 1OPLA 1ZOHA 1GNGA 4LI5A 4QMYA 3NUXA 2X81A 1YWNA 3OY1A 2HXQA 4G9CA 5EYCA 2J7TA 4FMQA 4W4WA 2R3HA 5CF4A 1MP8A 2PVRA 3AC8A 3FSKA 5EG3A 3K54A 4I5MA 3SQQA 3V5LA 2ETKA 3CTJA 1LR4A 4BIBA 4TNDA 5DR9A 5FD2A 4O84A 4O7NA 4DEHA 4ZZOA 3EYHA 5EQPA 3ZRKA 4AGUA 3C4CA 2XCHA 2VV9A 2ITOA 2PE1A 4GK4A 4I92A 2VTMA 5I0BA 5IDPA 4YJSA 4NM3A 4G3GA 5HKMA 4BDIA 2IN6A 3MY1A 4H3BA 3ZC5A 3MGYA 1Y8YA 5CF5A 4YZBA 3DB8A 2BTRA 4UYAA 4YURA 2VX0A 3Q9XA 1WAKA 4RFMA 4IZYA 4GUEA 1YOMA 5M06A 2C4GA 5FBOA 1IEPA 2JIVA 1XH6A 3T9IA 3UG2A 3VS0A 2PSQA 4CFFA 3EQRA 4MD9E 2HK5A 4YC8A 2FVDA 3W2OA 4CRSA 2OLCA 4B99A 2A19B 3DXNA 4AZSA 4K18A 4C57A 2H96A 4H36A 5EDQA 4ERKA 5EM6A 5FEQA 4KIKB 4A9TA 4A9RA 3PFQA 4O7SA 3NNWA 4C4HA 5AX3A 5KCVA 2YM4A 2UZWE 2QR7A 2OZAB 3CKWA 3ORKA 2ZAZA 3L8SA 4JR7A 5DR2A 2W5BA 4ALUA 5IH6A 4KUJA 4LOQA 4YC6A 3KRWA 4L53A 2V7AA 2OH4A 4DEBA 4IM0A 4IVAA 3D5WA 1PXJA 3SLSA 3TUBA 4O82A 4BTJA 5J9YA 3OC1A 4YPDA 3VO3A 2BRMA 3MTFA 3CGOA 3UG1A 5CU0A 2C47A 3RNYA 5IQCA 3IGOA 5DLSA 3ZUVA 3HECA 3AC2A 3NUUA 4FZAB 3WF9A 4QMUA 2OWBA 2RGPA 3LFNA 3P7CA 1NXKA 3RZFA 4RJ5A 4EEVA 3U6JA 4NKAA 3MW1A 4RVLA 4XH6A 4BZDA 2B4SB 2OICA 3TDWA 4IDVA 4YBJA 5EI2A 3RJCA 5FEEA 3FKOA 5HVJA 3VS3A 5EQYA 4USDA 3MY0A 4IX6A 3I79A 5BMSA 3UPZA 3E64A 1OITA 2J9MA 5CT7A 4M0ZA 1XBCA 1XH4A 2WMSA 3H0YA 2RF9A 3DY7A 2UZDA 2UZEA 3KVWA 4I5CA 4P4CA 2YFXA 4R3RA 5IA2A 1ND4A 4MBIA 3NUSA 4ZK5A 1FPUA 3MJ1A 4EC8A 4L7SA 3AD5A 1Q99A 3A99A 2DQ7X 4XV2A 5E1SA 3TV4A 5FDPA 1WBWA 4RMZA 3HKOA 2XNMA 3PA5A 1ERKA 4M13A 1W82A 3EL8A 4ANLA 3V5PA 3D5VA 3EKNA 3MPTA 4ACGA 3D7TA 3PDTA 3SOAA 5LWNA 3O51A 3PIZA 4UBAA 4X6RA 4E4XA 5M44A 3C5IA 4DF3A 2XVDA 4GV1A 3LXLA 2F7ZE 2RSVA 5M4UA 4YJNA 4KSQA 2R3OA 4IAKA 2PE2A 4IBMA 4MAOA 4PQNA 4BKJA 1B39A 3R22A 4H1JA 3PY3A 4ZJJA 5DIAA 3LM0A 2GMXA 3AGLA 2IW9A 3Q4TA 1VYZA 2P3GX 4ZXTA 1UU7A 5HI2A 2X4FA 3QFVA 1J1CA 4FYNA 4MXXA 4RWLA 5A54A 1OIQA 4O21A 3JR1A 2VGPA 2Y9QA 3IK3A 4X2FA 3VWAA 4E73A 2CKEA 2YM8A 4WBBB 1UWJA 2VNWA 4G3FA 4J98A 5IKWA 3ORZA 4L9IA 4M69B 4QYYA 3R7VA 3A7JA 5CQWA 4BCOA 2HENA 4BI2A 3ZO3A 3RM6A 4DITA 5DI1A 3O71A 5BPYA 4BDAA 1CM8A 4QMPA 4BTFA 3POOA 4DEEA 1YI4A 3H4JA 3U9NA 3PJ1A 1REJA 2B9IA 3II5A 4O91A 2OK1A 2BROA 3DKFA 3Q96A 5FLFA 4USFA 4RLKA 3R02A 1UKHA 4LUDA 5CVGA 2WELA 3EQCA 2GS7A 4IX4A 4JX7A 4J99A 4OTIA 1Q4LA 4BF2A 3NGAA 4O0VA 3Q4CA 4EWHA 3WYXA 4DAWA 2NNWB 2XIZA 4AN9A 1WMKA 2HZNA 2UV2A 3A7GA 3ANRA 3QC4A 2SRCA 2QOIA 3O8PA 3FMLA 3ZEPA 1JAMA 3NLBA 4IACA 5HE0A 1MQBA 1H1SA 4CD0A 4QP7A 3LFFA 4FTQA 3EQHA 2VWBA 2QQ7A 2IZUA 3TNQB 3TUCA 5BVOA 5JKGA 3RMFA 3W2QA 3RAHA 4K0YA 3NYXA 4D28A 2JITA 3P9JA 5FTGA 3UOLA 4AZFA 3NWWA 4NH1A 4EHVA 3CQUA 3P78A 3F5XA 4GW8A 4TYIA 2ZV2A 3QLGA 4GKIA 4FNWA 4DH8A 3LXNA 3SDJA 3QHWA 2PVJA 4UMUA 5AP5A 3KU2A 3A2CA 4O83A 5AP2A 5F20A 4RQKA 3OOMA 3JS2A 3CXWA 3CLYA 3LCKA 2BPMA 3QXPA 3KGAA 3RPOA 4WKQA 4OBOA 3UNKA 2VRXA 4C2WA 3HEGA 1Q8TA 3OW3A 3O8UA 3LMHA 2R9SA 4IAYA 4X3FC 4CCUA 4U7ZA 3TKIA 4AAAA 2EU9A 2YEXA 2PULA 1HCKA 4RJ8A 1KOBA 5H9BA 1Q24A 3EIDA 4LMNA 1RE8A 3C4EA 3QTQA 4ANNA 3RAWA 2C3KA 3NYNA 2C6DA 3FMNA 4D2SA 2W5HA 4Y72A 4QP9A 4CTCA 4YZDA 1SVGA 4ZTSA 2PTKA 4AP7A 4DYMA 2JIIA 4C02A 5HZNA 3DXQA 4FTIA 4Y83A 4AA0A 1REKA 4JR3A 4WNMA 2CGWA 2W17A 2GCDA 3ORNA 3K5UA 3PJCA 3QKMA 4G6NA 4QMZA 5F94A 4C4JA 3SKCA 2ITNA 4L46A 3GFWA 4WBOA 4AGCA 2OIBA 3NVMB 3GCSA 3ZSHA 5LVMA 3GC0A 4LYNA 3HA6A 3V5QA 1PXLA 3KY2A 3NAXA 3RK5A 4L8MA 2QOOA 1DM2A 3Q5ZA 3T3VA 5KHXA 2CNUA 3UO5A 4CG9A 3R2BA 1CTPE 3Q4ZA 3T9TA 1M2QA 4HYUA 2OFVA 4R1VA 3ODYX 3WIKA 4FIIA 5ETCA 2Z7SA 3EHAA 4GFGA 3JVRA 4Q9SA 1URWA 4IZ7A 2YCQA 5D9HA 3TIZA 4BKZA 3ZO1A 4E4NA 1JSUA 5HBEA 3FKNA 1JSVA 4V01A 4NT4A 3FAAA 4YMJA 3LKMA 5CAQA 4RC3A 2CLQA 3DNDA 5CENA 2C1AA 4C35A 4ZTHA 5K0KA 2QC6A 4LRMA 5CI7A 3V8SA 1H1WA 1NVRA 2R3LA 2WIPA 3LFAA 3EQPA 3Q2MA 4FZDB 2ZV9A 2PVMA 1JLUE 4O6LA 1ZARA 3PTGA 3ATSA 5BYLA 4FT9A 4IWDA 3KCKA 1V1KA 3F69A 3R9HA 1PMEA 2X9EA 4DGLC 5AM6A 5IH5A 1H00A 3QTXA 3TNHA 4FSMA 4WD5A 1JPAA 3IOPA 4RFZA 4BGGA 4D5KA 4EOPA 3R63A 4FSZA 4CZYB 1JBPE 3BPRA 3OY3A 5DE2A 3VN9A 2C0OA 3R01A 4CGAA 2NP8A 2XMYA 4FKQA 4YNOA 1YVJA 1Z57A 2E2BA 5AX9A 4O1OA 2VTRA 5ETIA 3QL8A 2WTIA 3SVVA 3WZDA 5C4KA 3SXFA 3HL7A 1OBDA 3G6HA 4J52A 1LPUA 3MH3A 4F64A 3ALOA 3FZOA 4PTEA 1WVWA 3DB6A 4TY1A 3TN8A 4U5JA 5E91A 2YCRA 3OTVA 1ZLTA 4S32A 1SNUA 2XM8A 3MBLA 4Z9LA 3R7OA 2BRHA 3Q53A 3GQIA 1UU8A 2QOQA 3D5XA 1BLXA 1OI9A 2I0HA 4DEDA 3RHKA 3COIA 4QMVA 3QTSA 1MRYA 2VO6A 2ONLA 3QYZA 2PL0A 3OCBA 3CY3A 2ZV8A 4PUZA 3WZUA 4DFXE 2OW3A 3Q9YA 4EK5A 4F09A 4IWQA 4WO5A 4FA2A 4FZFB 3KXGA 2A0CX 2ETRA 3K3JA 4OTGA 5HE2A 3VIDA 2OJGA 2XKEA 3ACJA 3QCYA 4FKWA 2BDFA 2BFXA 3PP1A 4UWBA 4C4GA 2J90A 4FZ7A 4F7JA 3C9WA 2REIA 3FEGA 1OECA 4S30A 5DG5A 2WO6A 3BHYA 2VO3A 3AMYA 4BVUA 3MH0A 4OT6A 2WQOA 4HYIA 5E92A 3GOPA 3F61A 3I5NA 4CEGA 3IQ7A 3UVPA 1XQZA 5EH0A 4JBOA 5HNIX 1YI3A 1ZZLA 2VX3A 4EQCA 4RVTA 3V5TA 2VWYA 2VWUA 3GOKA 4P7EA 5IA5A 1OGUA 2PK9A 3AOXA 3RI1A 2OFUA 3P08A 4YHJA 5EYMA 2YLFA 3OVVA 3KRJA 3LFSA 4O2PA 5HG8A 4O0RA 3MY5A 4IJ9A 4G3DA 3C1XA 4BCGA 4O81A 4CMTA 5CWZA 5EHLA 4CFWA 2VN9A 4LGGA 2ZMCA 4X0MA 5J87A 3R8ZA 3H10A 3VNTA 4EH2A 3N4VA 3BKBA 3C4FA 3NR9A 5J1WA 3LHJA 3UYTA 2W06A 5HE3A 1SZMA 4KS7A 4CLJA 1BUHA 4P5ZA 4QP1A 2BKZA 3FMEA 4CFXA 4YZ9A 5HO8A 2BAJA 2W1ZA 1PXPA 2WMUA 4MXAA 4CV9A 3LMIA 4WUNA 1IASA 2PMIA 4DINA 5IEYA 3TKHA 1O6LA 3F3TA 3I81A 2PZIA 4USEA 3NMUF 4LOOA 4QPAA 3QGWA 3RVGA 4NJ3A 1QL6A 5CAUA 1H1QA 5H8GA 1R78A 5CS6A 5K5XA 1KV2A 3O8TA 2CNQA 4RLLA 5HE1A 2CCHA 3MVLA 5KBQA 4NCTA 1Q3WA 2UZVA 3R1YA 3HP2A 2JAMA 3IW7A 3R7UA 3PVGA 4DTKA 3BYMA 1K2PA 4BKYA 1NY3A 3QQFA 4IB0A 1U46A 3BE9A 1BYGA 4BI1A 3HP5A 5IG1A 2W1GA 2A1AB 1TVOA 3JYAA 3U54A 3FSFA 3OUKA 5D1JA 3CD3A 3QQHA 2OF2A 3KULB 3EFKA 4FK6A 2C6OA 4FG7A 3FI3A 2OO8X 2G2HA 2B1PA 3T8OA 2RG6A 3DV3A 3PRIA 4U43A 4UMPA 4XYFA 5LJJA 2OZOA 1P14A 3DTCA 2PVNA 1RQQA 4WOVA 5TT7A 4U42A 2EWAA 4FV0A 3TJDA 4NW6A 3VUDA 5JMSA 3OHTA 3MFRA 4IFGA 4DG2E 4EOQA 4L42A 4JAIA 4FT3A 3GT8A 3GQLA 5KMKA 5ITAA 2Z02A 3MPMA 5IQAA 3I6UA 4I3ZA 4GIHA 3RALA 4N6ZA 3TL8A 4ZEGA 1IG1A 4OTWA 4JL9A 4C0TA 1I44A 4N4SA 1PY5A 5BYZA 5DWRA 4D0WA 3ALNA 3BRBA 2FSOX 4I4EA 4RWIA 5HD4A 5IA4A 3N4UA 4FKGA 3UIXA 1YXUA 3MV5A 4CMOA 3P7AA 4Q5EA 4U40A 2VZ6A 5C4LA 2IW8A 4FF8A 4G3CA 4WG5A 2E9PA 4YJTA 4YZNA 1A9UA 2UZNA 2DWBA 2XUUA 3BV2A 4QD6A 4PTCA 3TIYA 1SVHA 4EBVA 4PP7A 3ERKA 5LMAA 1BL7A 4MF1A 3TJCA 4ACDA 3BYSA 3P5KA 4KBAA 4CCBA 3HMIA 3EQDA 3NPCA 1OIUA 3BX5A 4K1BA 4FTLA 4ZS0A 2YM5A 3W1FA 4K8AA 1XHAA 3JXWA 3QYWA 4QMWA 2QVSE 1PMNA 4QTEA 5LOHA 4QNAA 3PYYA 5E8WA 5GJDA 3LZBA 3PJ8A 3K3IA 4RA4A 5HLWA 3VBQA 3WZKA 4IM3A 5IQHA 4I0TA 2UUEA 3TV7A 3D2IA 3S3IA 4F7NA 3H9OA 2UZLA 3GC7A 4B0GA 3BLHA 5L6WL 2GSFA 4A9YA 2QKWB 3OCGA 5LVOA 4YTIA 2NRUA 2V62A 1YQJA 4R5YA 2C0IA 1YXTA 3R00A 2WMVA 3KMWA 3N4TA 3GCQA 2HXLA 3IKAA 3LXKA 3PIXA 3ID6C 5IUIA 3QD3A 2GQGA 2PUIA 2YABA 2XBAA 4FVPA 1ZAOA 3UE4A 4C36A 5FTQA 1FOTA 2JDOA 5DRDA 4IXPA 5ANEA 5DFPA 3VHEA 1OIRA 3SV0A 4ZTQA 3HV7A 5KMOA 5L2WA 4QYFA 3Q32A 3HMPA 4KAOA 1JQHA 3ZXZA 5JGDA 4RIWB 2EB2A 2XKFA 3DQWA 3LLTA 4FKTA 4GK2A 3FMMA 4NWMA 3RNIA 2XIYA 3U51A 4EZ7A 5M4IA 4IEBA 1PYEA 1DAWA 4MTAA 4JS8A 3F7WA 4K33A 3V5WA 4L01A 5F4NA 2QR8A 5JFSA 4DBXA 1LEWA 3TT0A 3R7YA 3VBTA 4HYSA 1JVPP 2CMWA 2R7BA 2UW7A 2XS0A 2QOKA 2WTKB 4LV8A 4ZJVA 5M57A 3COKA 4YO6A 1Q61A 2B9HA 4LQMA 3JPVA 4OGRA 5AUUA 5J7BA 3QZHA 5CU4A 4FV8A 3GENA 2XIKA 3IW4A 3QRIA 1OKVA 3E5AA 3HMNA 3OWKA 3LFEA 3U4WA 4UYNA 3FY2A 4G17A 4D4YA 4DFLA 4IC8A 4I5HA 4IVCA 5M56A 4E26A 4O7YA 4OTFA 5KMIA 2Q0NA 3FZPA 4KSPA 4M67A 5C27A 3SG8A 1YOLA 4BCKA 2HELA 2UVXA 4D9TA 2RFSA 5CEMA 2G01A 2ERKA 4NFNA 4QT1A 3VS2A 3ORIA 2JD5A 1CKPA 2OF4A 3UVRA 3GC9A 3VS1A 3GC8A 4U3ZA 5CNNA 3F6XA 5EQEA 4KKEA 2IW6A 3QTWA 5E8UA 5K0XA 5LVNA 2R3RA 4HCUA 4O22A 5HX8A 5EM8A 4FL1A 5EOLA 2YWVA 1U54B 3I0OA 3GI3A 2F7EE 4HGLA 4FKJA 4BGQA 1Z9XA 1J7LA 3OG7A 1M52A 4CV8A 4N0SA 3DT1A 4QMTA 4YZCA 4RGJA 2XB7A 5EKOA 1XO2B 2IJMA 3NW7A 3PXZA 3QA0A 3QQGA 4MD8E 4QMSA 3EMGA 2Z2WA 2WTCA 2YHVA 4IQ6A 4QMMA 2LAVA 3VUGA 5CF6A 3E8EA 4R6VA 3UYSA 4BCPA 5CSPA 5LMKA 4ARKA 4DTAA 2QOLA 3UZRA 1KOAA 3RCJA 3UBDA 1TKIA 2JIUA 3PUPA 1CKIA 2QLQA 3DZQA 4FL2A 5BVDA 3ZOSA 3GGFA 3Q3BA 5HCZA 3KXZA 1ZWSA 5GIOE 5BVWA 3BHUA 3E87A 3GFEA 3P7BA 4JRNA 1JKTA 1M14A 3QWJA 5CTPA 2X8IA 1QCFA 1VYWA 2X2MA 2QCSA 3FQSA 3VF8A 3CR0A 3UJGA 2PMLX 5JEBA 5JK3A 4AACA 3OFMA 5IQIA 4C33A 3BGZA 4JBVA 3REPA 2CPKE 2HW7A 3V5JA 4E4LA 3ZO2A 3RPVA 3MIYA 4BIEA 4O7WA 4MF0A 5C8NA 3QRJA 4EWQA 4HVSA 4NM5A 5HIDA 4AE9A 3I6WA 1KSWA 2XJ2A 3OF0A 3HNGA 1Q62A 3MB6A 4UV0A 3BCEA 3DK6A 3R0TA 1BL6A 4BYIA 4YU2A 4FC0A 1XH9A 3DJ7A 3IG7A 4QYGA 3R9OA 1Y57A 3QLFA 4C4EA 4KD1A 4FEXA 4II5A 5EDRA 4LGDA 3BBWA 2P33A 4EQMA 3UTOA 2HOGA 4FIEA 4OW8A 2NPQA 3O17A 4XG3A 3NIEA 4H05A 4WG4A 3HLLA 5DRBA 2F4JA 3AMAA 3S0OA 1U5RA 2QURA 1FMOE 4XV1A 2W1DA 1GAGA 4C3PA 3DBQA 4IZ5A 4IC7A 4LV5A 4IADA 3OWJA 4QTCA 1TQIA 3TACA 2G2IA 4AN2A 1Z5MA 3F2RA 2VWVA 5EKNA 3FC1X 2XEZA 4AT3A 3Q2JA 3RTPA 3PZEA 3DZOA 3FMKA 4AX8A 1Y8GA 3L9LA 3PG3A 4AA4A 4BDFA 3PZHA 4ZIMA 4ANQA 5DYJA 5CEOA 1GY3A 4QPSA 1VR2A 3AT2A 4X3FB 4O0XA 4ZLZA 3ORPA 4AOJA 5FQDC 2ZB0A 3V51A 2RFDA 2HIWA 2XH5A 3CPBA 1KWPA 2YDIA 3BI6A 3H9FA 3L9PA 2A27A 2PVFA 3QQKA 5EM5A 2CKQA 4FSQA 4ID7A 5I4NA 3CC6A 5HD7A 4IANA 2CLXA 4KRCA 4AOIA 4ZY5A 4DTBA 3OBJA 4DT8A 2XK6A 5HIBA 3TTIA 1GIJA 4LG4A 3DA6A 4FTUA 3PA3A 1KV1A 3T3UA 4XP3A 3EN6A 5HESA 2VGOA 2IVVA 4BBFA 3EZVA 5DOSA 4RIXA 4OBQA 2JEDA 5CXHA 1JOWB 3PVBA 3UNZA 4E8AA 3RBWA 2JLDA 4RT7A 2AC3A 3ZSIA 2JGZA 5FXRA 2WAJA 4XHKB 1Q97A 2W96B 5CU3A 3QC9A 3WBLA 3NW6A 4FSTA 5IA0A 5JFVA 3EJ1A 4P2KA 2Y6MA 2PVKA 4M12A 3M11A 1BI7A 4I24A 2JBOA 3HMMA 4O0UA 4RC4A 3U8WA 2RG5A 3MESA 1G5SA 4PF4A 1GIIA 1Y6AA 4O0TA 5E8TA 1OMWA 5T3QA 3LJ0A 4MQ2A 4HOKA 4RSSA 3L8XA 5BMMA 2C30A 4YJRA 3B2TA 4FTKA 2B7AA 3VJNA 1HOWA 5CI6A 3C0HA 3KF4A 5AP0A 1WFCA 2XA4A 2KULA 5D12A 4C3FA 1HCLA 5AAEA 2WTKC 5L8KA 5TR6A 3SG9A 4QRCA 2UZTA 4FODA 4RJ7A 4ANBA 4AZTA 3PG1A 4D4RA 4DLIA 3L8PA 3A4OX 3D7TB 4R7IA 3FI2A 4E6CA 3KFAA 4C61A 2OBJA 5M51A 4DCEA 4F7SA 3PJ2A 4RX8A 3FI4A 2FO0A 4FOCA 1YWVA 4BCNA 2F57A 3K2LA 3EZRA 3FUPA 3KCFA 4KIKA 1VJYA 2YA9A 2BILB 4AE6A 4DEAA 4X2GA 2YDJA 3FXWA 3HRBA 4BCHA 4RC2A 2XJ0A 3OT3A 1H28A 2OZAA 1Q8YA 1TQMA 5KMJA 2WMTA 4QMLA 2QOHA 5C26A 3UODA 3ANQA 3FZRA 5HG5A 4QMNA 1G3NA 1Y91A 3VS6A 4XP2A 4C38A 2C6KA 4B4LA 4F63A 4GUBA 4Y46A 4LMUA 2JDTA 3MVJA 4FKVA 4KINA 3ZRMA 3ZUTA 3R8MA 4BL1A 4FTMA 4TWPA 4C4FA 5ANOA 2CGXA 1NVSA 3ET7A 5JZJA 4PNIA 5E8XA 3EKKA 4E7WA 4DH3A 1J7UA 4C7TA 3PPZA 4YNEA 4LRJA 2WEVA 5A3XA 3TKUA 1XH7A 2XKDA 1H0VA 1STCE 1XH5A 3FC2A 1F3MC 4BDCA 5D7VA 4NTSA 3VQUA 3OTUA 4EI4A 5KNJA 4IIRA 4UX9A 1JKKA 5J9LA 4TYGA 2V55A 3I7BA 5EFQA 4KIOA 1Q3DA 5AP4A 3BZ3A 5CAOA 1Q5KA 3H0ZA 3QHRA 3UGCA 4U3YA 2R3NA 3LJ1A 1PF8A 1P5EA 2P2IA 4DN5A 3OCSA 2W4JA 5DNRA 3EQBA 2W7XA 1OB3A 3QALE 3MFSA 4EK4A 5DEYA 3CJFA 2C5YA 3OEZA 4IAZA 4YC3A 1OKYA 2I0EA 2QU6A 3W55A 4J53A 3QCXA 2OI4X 3IONA 4XBUA 2EXEA 4YJPA 3V8TA 5A4CA 4YJVA 4RBLA 4C62A 1APME 4UB7A 3TI1A 4XG9A 3VUIA 4B6LA 3R2YA 3DAEA 3GCVA 3QTZA 4TWCA 4BZNA 2UW8A 4RJ3A 2JFLA 4FUYA 3NYOA 5G1XA 2VTQA 1NVQA 2HY81 2UVYA 4RWJA 1O6YA 3NNXA 3BELA 5KMNA 3ORTA 5FDXA 4G6LA 4UY9A 4DFYA 4E5BA 4WT6A 4AGWA 2WTJA 4DH5A 5BX0A 2EXMA 3I0QA 3P1AA 4KA3A 5IPJA 3FMJA 5JFWA 3PE2A 3OOGA 1OPJA 1S9JA 4GK3A 4MNFA 2IVTA 3KF7A 5F95A 3KVXA 2PVLA 4XJ0A 1K3AA 5E8VA 1OL5A 3KK8A 2YIYA 5DMZA 2BAKA 3L1SA 5TF9A 3IW8A 4TPTA 2IZSA 3NSZA 2X0GA 4M69A 2J5FA 1ZYLA 1BMKA 1FVTA 3ZZEA 2WEIA 5DT3A 4CLIA 2YAAA 3QZGA 4PX6A 3U87A 4F0GA 5LMBA 5AR2A 3FHIA 5HU3A 2R5TA 4R7HA 4XG7A 5DVRA 1NA7A 4JQ7A 5J7HA 3OZ6A 2E9UA 3IOKA 3ZU7A 4EH5A 1I09A 4ACMA 5CQUA 5EYKA 5HCYA 4DFNA 3QD0A 5B7VA 3CEKA 3R04A 4FGRA 4W4XA 2W1IA 3F2NA 3V6RA 5ACBC 4L43A 3OWLA 4RX5A 2DUVA 3EL7A 3KXHA 4EH3A 2W1FA 2W99B 2YM3A 4FV5A 4JVGA 4W8EA 3LAUA 4MXZA 1YHVA 5HICA 4YHFA 3C5UA 2FSMX 3E88A 3V6SA 2C3LA 2UZBA 4NIFB 5A9UA 4EH9A 2RFEA 3SGCA 5IEVA 3LCDA 2JAVA 3D94A 5HNBA 4AF3A 3FLQA 2C68A 5IF1A 4MXYA 4FK3A 2C5VA 5IU2A 3A7IA 1SVEA 4BN1A 2H34A 1BX6A 5IDNA 3B8QA 4F6UA 3GBZA 2I7QA 5FM3A 2WQNA 2ITZA 1ZYJA 1ZRZA 1ZY5A 3D83A 2C6MA 1T46A 2XYNA 2C1BA 4TN6A 1H25A 3HGKA 2HCKA 5I3OA 2JKQA 2QNJA 3DDPA 4G5PA 3RK9A 3QU0A 4O7TA 4LRKA 2ZM1A 3PSDA 3FXXA 3SW4A 4FE2A 2X8DA 3DS6A 1UV5A 1UU9A 3GB2A 3QUEA 4QMXA 3VUMA 3KL8A 2OJFE 4WUAA 5D10A 4DLJA 3FL4A 4G3EA 4KNBA 5CALA 1ZOGA 3NRMA 3G9LX 4FSYA 2Z7RA 4WHZA 1FBNA 5J8IA 2HZ4A 1PW2A 2YIWA 2HW6A 2O65A 1OIYA 2Z60A 4Y73A 5DHJA 1PRYA 2Y0AA 1WBNA 5GZ9A 4LM5A 3PSBA 2B9FA 3PVWA 4GU6A 2VTSA 3KRRA 4MNEB 1ZOEA 3KXMA 3MA6A 4KKGA 4QP6A 3SRVA 5A4TA 5L2QA 5GZAA 4U41A 4BTKA 2ZM3A 1U4DA 3A4PA 5CAVA 3UOJA 3ZFXA 4M97A 4CYIA 4QOXA 4C37A 5KMMA 3C0IA 4RFYA 5EDPA 2CHLA 2CN5A 3ULZA 2FYSA 4O7LA 3G0FA 1KE9A 3G5DA 4JQ8A 1WVYA 3VF9A 3F66A 4DH1A 2WQEA 3VS5A 3AC4A 2W4OA 3FKLA 3GNIB 2ZB1A 3ENMA 4BDEA 4FG9A 5HX6A 1F5QA 5IUGA 3CE3A 4U45A 3W8LA 5CLPA 5I9VA 4ITIA 3AMBA 4RZVA 4DA5A 3QBNA 3Q04A 1JWHA 3UPXA 2XNNA 2VUWA 4PDPA 5JH6A 4R5SA 4FKOA 4HCVA 4F1TA 4J1RA 2YCSA 3CBLA 3CS9A 3NW5A 3B2WA 3ZLYA 2JKOA 4G34A 5CASA 1ZZ2A 3TM0A 2UW3A 5L4QA 4FIHA 3VRYA 1P2AA 3VC4A 2O64A 4FV9A 2EVAA 2YM6A 3S2PA 4ZMFA 3U55A 2R0UA 3P23A 4MHAA 3UO6A 4CXAA 5DN3A 2PZRA 3BHTA 4EKLA 5TOZA 4DCAA 4FV3A 4F7LA 5L6PA 4F6SA 2W1EA 3CPCA 4S2ZA 1B38A 1H4LA 4YZMA 4ZJIA 2FA2A 4IE9A 1M7QA 3TXOA 3DFCB 3KXNA 3LVPA 3BU3A 4J7BA 2GNFA 4ZTLA 3U4UA 3QQJA 4BDDA 4DH7A 2JDRA 3PXYA 4H58A 2WB8A 2Y8OA 2YZLA 3O96A 5ANKA 3R9RA 5CVFA 5K3YA 3UMXA 2GHLA 4I4FA 3S4QA 4PMPA 5KX8A 2WMWA 3UQCA 4JDIA 3BU5A 4W9WA 4A4LA 4XLIA 5EHOA 4BR3A 3EH9A 3AD6A 3D9VA 4EK8A 3CQEA 2A2AA 3PIYA 3PP0A 3PY1A 4S34A 3C0GA 2AC5A 4X2NA 3FBVA 4L3JA 4A4XA 3ULIA 2QU5A 3W16A 1J3HA 2P2HA 1GZOA 3NCGA 4I21A 5CU6A 3TNIA 3TNPC 4HGSA 5TE0A 3UIMA 3IS5A 3S00A 3LMGA 2V5QA 4L67A 3DK7A 4E20A 1EH4A 3PXFA 4MWIA 2ITUA 4BDJA 4BCQA 2HZ0A 2V22A 2WIHA 4AW2A 4TZRA 4TYHA 3WARA 3QKKA 4CFNA 3RWQA 4Q2AA 4M3QA 1RJBA 4C3RA 2WMAA 2XNGA 3FWQA 3KKVA 5KKRB 1OKZA 4K2RA 4UXLA 2Y4IB 3EWHA 2ITTA 1UVRA 1ZMUA 3UZPA 4C8BA 3MA3A 3TZ9A 1UNGA 3A8WA 2BRGA 1YI6A 4ASDA 4P90A 2OIDA 3CJGA 3LCOA 2P55A 5CSXA 3MDYA 5B0XA 4GH2A 4QP2A 3MSSA 2XIRA 3DBDA 2CCIA 3NX8A 4IM2A 4L45A 4HVGA 5AFVA 3WF5A 3TUDA 4R1YA 3VQHA 2C5OA 2ZDUA 4GT3A 2JC6A 2ETMA 4JRVA 3MIAA 3RGFA 3DKCA 4D4VA 4YHTA 4J8MA 4I20A 3AGMA 4QYEA 4JBQA 4YJUA 5DA3A 5AR8A 4ZTNA 2DS1A 4XNEA 3PVUA 4PP9A 3FXZA 1OL7A 1ZYDA 3JUHA 3VRZA 1OUYA 4FV4A 4TYEA 3ZS5A 2O5KA 3EQGA 3L9MA 4ZP5A 5IQDA 1R3CA 4PTGA 4C2VA 3E62A 4D1SA 1YXXA 4FEUA 4GS6A 4KBCA 4MWHA 3HAVA 4FTTA 3B8RA 5CZHA 3ZRLA 4YTCA 3SX9A 3MJ2A 2R3MA 1H26A 3COMA 3I1AA 2W0JA 4ZY4A 4O2ZA 1H0WA 5TKDA 4BTMA 5LWMA 4R3PA 2GTNA 4MCVA 2JDVA 4PDOA 1GZNA 2WQMA 1PKGA 4QQCA 1QPJA 4GT4A 3FDNA 3QAME 2R3QA 3IDPA 2YJSA 4CG8A 4BDBA 5HLNA 5IA3A 4G31A 4IVDA 5I9UA 4O6EA 3UMWA 4FIFA 3DCVA 4IAFA 1CSNA 1YWRA 2ZYBA 4BCMA 3WE8A 3KEXA 4HGEA 4L44A 4QQJA 4Y5QA 2H6DA 1FGIA 4ZTMA 2BRBA 5AR7A 4D1XA 2XNPA 5CEIA 1IA9A 4KRDA 2GHMA 4IVBA 3RAKA 4Q9ZA 4EJNA 4JQEA 5AA9A 4FTRA 4RIOA 2NO3A 1WCCA 4CZTA 2BAQA 4UEUA 4EUUA 4BWKA 3QZIA 4ASXA 2XK7A 5EYDA 4CNHA 5LXMA 2FSTX 2P4IA 4DFUA 2IG7A 4DFZE 4EL9A 2Z8CA 5L3AA 2R64A 3PPKA 1JKLA 3A60A 5FG8A 1PXIA 2B54A 4M66A 3UQGA 5JSMA 4MKCA 4IZAA 2WNTA 3QWKA 4HVHA 4CKRA 4NYEA 1UWHA 3VUHA 5FP6A 3GEQA 3NNVA 2VU3A 4FKLA 3MWUA 5GJGA 3G33A 3PA4A 4OUCA 4ACHA 5HO7A 5GINE 4DT9A 2OG8A 3QQLA 3HAMA 3QZFA 2J2IB 2VWZA 2QO2A 1OL2A 2VTJA 5L2TA 4CT2A 5KE0A 5HHWA 2I40A 4FKPA 1SYKA 2XIXA 3CY2A 4JI9A 3PY0A 4ANOA 4YO4A 4JNWA 4IWPA 3C4XA 3LE6A 4Q5HA 4U8ZA 5HBJA 3WILA 4FIGA 3KMUA 1FVVA 1CKJA 2VO0A 3C50A 3LJ2A 4N57A 2ONLC 3EN4A 3P79A 4MBJA 2YWPA 5JT2A 2IWIA 3I5ZA 1GZKA 1WBTA 4K9YA 4WSQA 2ZMDA 5CX9A 3V8WA 1WBVA 2HWPA 4YSMA 4DGMA 5CEQA 3A7FA 3ZDIA 1ZYCA 3WF6A 4KB8A 4EZ5A 3M2WA 1BI8A 5HGIA 3TDVA 2E9NA 3MH2A 2F2UA 3N9XA 3QRUA 1WBOA 3W2CA 2PUNA 4E6DA 1XH8A 1L3RE 4MYGA 3RINA 4PMSA 4AFEA 4AW5A 4JIAA 2BIYA 2VTIA 4GG5A 4O7ZA 3BWFA 5AV0A 3ORMA 3DKOA 3FJQE 2J50A 4FUXA 4JG7A 5DH3A 5AUXA 5ANDA 2X2LA 4W8DA 2OXXA 3BLQA 2J0KA 2ZV7A 3WZJA 1YDTE 2XRUA 4IHPA 4RIYA 5DT4A 4CRLA 4D4SA 5JQ5A 1QMZA 3MS9A 5T68A 3FHRA 2GPHA 5AAFA 3QQUA 1QPEA 3W33A 1XR1A 4G5JA 4XRLA 3CSVA 2Y6OA 4DG3E 4ZOGA 3C4WA 4GT5A 4TL0A 4ENYA 3NUAA 1FMKA 1MUOA 1PHKA 2X6DA 2QKRA 3D7ZA 2WU7A 3D15A 2UZOA 3SW7A 4W9XA 4EOKA 5HG9A 4GYGA 1A48A 3BYUA 3LPBA 2IVSA 4NFMA 2KTYA 4J95A 3N51A 3ETAA 2QONA 2PHKA 4BHZA 2XP2A 3THBA 2I0YA 2XZSA 2BR1A 2HYYA 3DDQA 5LVPA 2W4KA 1OUKA 3CTHA 4OR5A 5CNOA 1Q41A 5H8BA 2GQRA 2GS6A 2YLEA 3DOGA 4IAIA 2ITQA 5L8JA 4QTBA 4GVAA 4NCTC 3EN7A 3E3BX 3SA0A 2Q83A 4XS2A 4Z55A 4OTQA 1FQ1B 2B53A 5B2MA 4AGDA 4R7BA 3VBVA 2O3PA 5IMEA 5HVYA 3MN3A 1URCA 5M4CA 3PLSA 2BHHA 4G16A 5FTOA 4XRJA 5IMXA 3UOHA 1UNHA 3BHHA 4IAAA 5AUWA 3PE1A 2ITXA 4GMYA 3ZLSA 4QQTA 4YTFA 5EI6A 1PKDA 3GU8A 2XYUA 4I93A 5FP5A 2V7OA 2IZTA 3TG1A 3IW6A 5KKRC 2Y4IC 3W10A 1GJOA 2Q0BA 3ZEWA 4UMTA 4XCUA 4C34A 4WIHA 4AZVA 4FEWA 2WFYA 1UU3A 2RFNA 3R28A 4GL9A 2YAKA 3DNEA 4QTDA 2PMNX 4A07A 1B6CB 2YACA 3OMVA 3POZA 3HV5A 4FSNA 2JBPA 4IB3A 2X6EA 2QLUA 2C5NA 2VTOA 5CSWA 4FOBA 5AP3A 5H2UA 3DXPA 2OH0E 2WZJA 5LQFA 3FLYA 3FPMA 3ROCA 4NUSA 5C01A 1M7NA 4TTHB 5AUYA 3GCPA 5I3RA 3UVQA 3MVMA 5FXQA 4FTOA 4B9DA 4M14A 4QTAA 4EOIA 5DEWA 3D4QA 2WU6A 4MXOA 3F3UA 2YN8A 3O7LD 4M84A 5D41A 5FRIA 4EYMA 4F0IA 1MRVA 4ZTRA 3K5VA 4GIIA 4D2TA 4YSJA 4FKUA 5A4LA 2R3JA 2X7OA 1RW8A 4AU8A 4O96A 4Y85A 3NZ0A 3I60A 1FGKA 4HJOA 5AV1A 3RP9A 3QXOA 4FV6A 5HBHA 3QTRA 3JY0A 2QOCA 4I5PA 5M53A 2OIQA 2R3PA 3EQFA 3I4BA 4V04A 1TQPA 3WF7A 4FSRA 5GIPE 4B8MA 4AWIA 2XRWA 5IQFA 3KXXA 3W8QA 2JKKA 2RL5A 4P5QA 2XKCA 3BV3A 4PL5A 4EOMA 2O63A 4BCIA 1Y6BA 2JDSA 4HPTE 5FUTA 4E5AX 4NSTA 4X6QC 3TZMA 4ACCA 4E4MA 5CAPA 3BYVA 3C4ZA 4E5WA 4TWNA 4QP3A 1OZ1A 1V0OA 2WMXA 3DBFA 4ZSEA 4RIXB 4V0GA 3ENHA 4FBXA 4GFMA 3R7GA 2OJ9A 3FI8A 4ZS4A 3F2AA 2VTLA 4FT0A 3FYJX 1XKKA 3P4KA 4F65A 1RDQE 3DKGA 5M08A 4IWOA 5BUJA 5AWMA 5J9ZA 2J5EA 3G6GA 3HYHA 3MH1A 3OWPA 5JRSA 5GNKA 2BALA 3EN5A 3ZYAA 5C1QB 5J95A 3QGYA 4RVKA 4X3JA 5CZIA 5C8MA 3LFDA 5J1VA 4IB1A 2GU8A 2X1NA 4J96A 3GU6A 4UZDA 4XG4A 3DBCA 4LL0A 2XJ1A 4NW5A 3VBXA 4BWXA 4CTBA 3HV3A 4LOPA 5AADA 5K4IA 4DGGA 3AG9A 5IQBA 3OUNB 1J91A 5J5SA 4OTDA 3ROYA 4AT5A 5CU2A 4R8QA 3LLAA 1IRKA 2WGJA 4BBMA 4AG8A 3FQHA 3LFBA 3EFJA 4WSYA 5EHYA 4F0FA 2ZVAA 4AUAA 3S1HA 2LGCA 3OS3A 3LM5A 5AV3A 4X3FA 3E92A 5AA8A 4AZWA 3HV4A 1OBGA 5L6OA 2R3GA 5C9CA 4HW7A 1W7HA 3PLAE 5EI8A 3TZ8A 5EOBA 2XK3A 4X2JA 1QPDA 3H3CA 4PMTA 2PU8A 2UW4A 2WTVA 3EFLA 4BIDA 2FB8A 3NAYA 3RM7A 4ENXA 4DG0E 2GFSA 4Y5HA 3F5PA 2G1TA 3R1QA 1H8FA 4IMYA 5HTIA 2VWWA 4F4PA 2YJRA 3D0EA 2VWXA 5HO6A 3QCSA 3IPHA 4I6HA 3LQ8A 4NTTA 3Q6UA 4KIPA 5HG7A 5FXSA 4HNFA 2PE0A 4BC6A 1H07A 4HZRA 4JX3A 4FICA 2X2KA 1KE5A 4JT3A 4QYHA 2PZPA 3UOKA 2OXYA 4L3LA 4F9WA 1WBSA 1G8SA 4NL0A 3BWJA 3DLSA 2FGIA 4BDGA 4FSUA 3F3WA 1V0PA 1ATPE 1P4FA 3KRXA 5GHVA 4BICA 2AYPA 3OW4A 4MX9A 3VUKA 4FL3A 4BI0A 4FTAA 5LMKC 4I23A 2IVUA 3HRCA 5E8YA 4UXQA 4JLCA 5AR4A 5LARA 2ITWA 3CKXA 3FZSA 4A06A 1R0EA 4HVIA 2WOTA 4ORKA 2XF0A 4EQUA 4XLVA 2CGUA 2F2CB 2QG7A 5E9EA 3R8VA 4BCFA 3LCTA 1V0BA 3GU5A 4LL5A 4KWPA 4OTPA 4QP4A 4O27B 3NNUA 4ASZA 3UC3A 4ZSLA 2JKMA 3QTUA 4V05A 4D5HA 5HNGA 2IO6A 3VW6A 2J51A 4GJ2A 5I9XA 4ANMA 4ITHA 3ZM9A 4CKJA 1QPCA 4IW0A 5CVHA 3QTIA 2RIOA 4RQVA 4EH8A 2VWIA 5JGBA 4FT7A 4ASEA 2UW0A 2C6TA 3DTWA 5CEPA 1GOLA 3AXWA 3OT8A 4GFOA 4L52A 4I41A 1A06A 4F9CA 3O2MA 4FKIA 1OL6A 5B2LA 3BEAA 4BFMA 2UW5A 2BVAA 3Q6WA 1W0XC 4FNXA 4S31A 3R83A 3ZTXA 4CT1A 3FPQA 3TCPA 4YGAA 4S33A 4G9RA 1Q8UA 3L9NA 4F6WA 5I9YA 2ACXA 5HOAA 2FH9A 3LOKA 1SM2A 4CQEA 3AC5A 5FBNC 4YP8A 3UC4A 2GNHA 5AUTA 4CKIA 2I6LA 3EYGA 3GP0A 3H9RA 4RZWA 2F9GA 4XX9A 2R4BA 4HCTA 3VVHA 5IISA 5KUPA 1WBPA 4J8NA 2JFMA 5AAGA 2YZAA 4H3QA 4I6QA 4RG0A 5HTCA 2ITPA 1XWSA 5JQ8A 3F5GA 4MD7E 4DFBA 4DGNA 3TV6A 3OCTA 4ERWA 3Q9ZA 2X4ZA 4FGBA 4D2RA 5C03A 1O9UA 1OKWA 5F1ZA 3NVKI 3IDCA 2A4LA 3OBGA 3LFCA 4ITJA 5AR3A 4G6OA 4TRLA 3IECA 3LIJA 4EONA 5E8SA 4YJQA 5E8ZA 4EORA 3MPAA 4EOJA 2GS2A 5JRQA 4FSWA 5ANJA 4BDKA 5CT0A 3ZSGA 2J6MA 4OLIA 3ZONA 1J7IA 3DGKA 2C6IA 3Q52A 3AC3A 3VAPA 4GU9A 1T45A 1DI8A 2ZM4A 2YCFA 2XK8A
chains in the Genus database with same CATH superfamily
3C7QA 3ZO4A 4NZWB 4WG3A 4TWOA 4N70A 1UA2A 1M2RA 2W05A 4I0SA 4NM7A 2G9XA 3BE2A 3VULA 3R7EA 4UWYA 2XBJA 4DHIB 2WQBA 2ERZE 4XUFA 2J0MB 3ZUUA 1H24A 3JY9A 5A14A 4JDKA 5HQ0A 3A62A 4Z16A 4Z7GA 3LFQA 4RWKA 4U97A 5B2KA 4JJRA 3QD4A 5KZIA 3TWJA 4A9UA 2FSLX 3IW5A 2XCKA 3HX4A 1KUTA 4I0RA 4O0SA 4YR8A 2WMQA 2XNBA 3SXSA 3E7OA 4R3CA 3R8UA 3E3PA 2BZKB 2WHBA 3IDBA 4IDTA 4XV9A 4XG6A 5K9IA 1PYXA 3R8PA 4K77A 4JBPA 4I6BA 4RJ6A 4XP0A 5IH4A 3RWPA 3UIUA 3L8VA 3FY0A 4QNYA 2W9ZB 2WMRA 3O23A 5AR5A 4GKHA 3LQ3A 3W0MA 3E7VA 5DPVA 4EKKA 4GCJA 5HU9A 2RKUA 1U59A 1IAJA 3FLNC 1YDSE 4WRSA 3UO4A 3V3VA 4DHFA 4FVQA 4PPAA 4EHZA 4UMQA 2YIXA 3SRVB 3V04A 3ZLWA 4EH6A 2BIKB 3U6HA 4EH4A 3NDMA 3EB0A 3ZFYA 3SAYA 1PXKA 5L2IA 1PXNA 5CXZA 1JKSA 3DK3A 4GG7A 2HWOA 2WMBA 4XEYA 1L8TA 4R78A 4CYJA 3MI9A 3PWDA 4YLKA 4MEDA 2HAKA 4MBLA 5FWKK 2BUJA 4CQGA 5JFXA 2CKPA 1YOJA 3FMDA 1SNXA 3G9NA 3LCSA 4PY1A 3G0EA 2ZOQA 4F99A 5CANA 3EOCA 5IA1A 4FV7A 3F88A 3FLSA 4MK0A 1BKXA 4O0WA 3MVHA 3U9CA 4NIFA 4DE4A 2J0JA 1H01A 3BHVA 4FEVA 4AA5A 5AP6A 5K5NA 3R1NA 2XK9A 3G51A 3LQ5A 4D58A 3UZTA 2R7IA 1ZYSA 3FYKX 2G15A 3M42A 4L7FA 4RPVA 4TYJA 3V01A 3W2PA 4O1PA 1R0PA 4YPSA 2F49A 2C5XA 3AT4A 1FVRA 2NRYA 3ELJA 3QUDA 4GJ3A 3WZEA 4UMRA 1PMUA 3F3ZA 4O38A 5IZFA 4FIJA 1O6KA 3SC1A 2R3KA 2Y7JA 3HDNA 2OSCA 1W2DA 2O8YA 2O2UA 1YRPA 3GU7A 2OJIA 3DFAA 4OTHA 4YBKA 4FX3A 3RK7A 2OGVA 4UALA 2QOBA 1JNKA 1U5QA 3PXRA 2QODA 4PWNA 4U79A 2GQSA 4PL3A 4PPCA 4YLLA 3HA8A 4FV1A 2FUMA 4XG2A 3F3VA 4AXEA 5EK7A 4NK9A 1KE8A 1M17A 4RRVA 4E6AA 3PJ3A 3QKLA 4ZAUA 2X9FA 4F70A 3JVSA 3OXTA 5GZ8A 3E8NA 4FTNA 3C51A 4JOAA 3FL5A 2X8EA 5I5ZA 4ZLOA 4D2VA 4AXAA 4D1ZA 1F0QA 3DAJA 5ANGA 4F9BA 3RPSA 4PDSA 4ZLYA 3GU4A 5FGKA 4WNOA 1YW2A 3VJOA 4IH8A 4X7QA 4Y95A 4XMOA 5A46A 3O50A 3P86A 4MNEA 2VD5A 4OAVB 4JG6A 3R21A 4TKSA 5HVKA 5L2SA 4A9SA 2BCJA 3ZFMA 3F9NA 3DAKA 2QHMA 4M7IA 2GTMA 5EW9A 3BGPA 4KS8A 4JDJA 1MQ4A 4BHNA 4K11A 1UKIA 4M68A 5CEKA 4FG8A 4U44A 2PY3A 3ZHPC 4ALWA 2OKRA 4JIKA 4EHGA 2ZJWA 3CGFA 3RAIA 4GVJA 5DBXA 5CF8A 5EM7A 4PNKA 1GZ8A 1P4OA 2R2PA 4M0YA 4C4IA 4QMQA 2DYLA 2YDKA 3HDMA 2ITYA 3D14A 3QX4A 4DBNA 4UN0C 2BKKA 1PXOA 3EQIA 2B0QA 3QRKA 1IA8A 4FKRA 3KREA 3QF9A 4OT5A 4TYHB 4ZMEA 3CIKA 3BU6A 4AZEA 4CMUA 4F1MA 3DPKA 4KBKA 3W32A 3ZC6A 3ZMMA 5I9WA 2XNEA 4GYIA 5E1EA 4HPUE 2PVHA 5DGZA 2GNIA 4PPBA 2VO7A 3ZBFA 2CJMA 2F7XE 2VX1A 1H27A 2H9VA 2XEYA 3QCQA 5CY3A 3FE3A 4GEOA 1OL1A 2ZDTA 4O7VA 3M1SA 4BCJA 4I6LA 3BBTB 4RVMA 4E1ZA 1OPKA 3RZBA 2UW6A 4I1ZA 3NIZA 2Y4PA 2IZRA 2R3IA 2X7FA 4G2FA 2XM9A 3VHKA 2VTHA 4MVFA 3WOWA 2YITA 4LGHA 4AS0A 2OJJA 5A6NA 3U6IA 3OXZA 4BRXA 4I22A 5E90A 5A6OA 2BZHB 3EN9A 2BDWA 2PZ5A 3KN6A 2WXVA 2W5AA 5BVKA 5K4JA 3BIZA 3NS9A 4L3PA 1H1PA 4TW9A 2BDJA 3BGQA 5G6VA 2CGVA 5JGAA 1FINA 5E7RA 3R1SA 5AV4A 3KK9A 2YERA 3RHXA 5ICPA 1AGWA 3G2FA 3NUYA 5KHWA 4NU1A 3E8DA 4FR4A 4ALVA 1CDKA 3UDSA 3WF8A 4Y8DA 3FMHA 3LW0A 4PRJA 1ZY4A 5IUHA 4FTCA 5LCJA 3TEIA 4OAUC 1NW1A 5BVEA 3UDBA 4FZ6A 4KKHA 4NM0A 4YLJA 2W9FB 4D9UA 4EOSA 3NUNA 3MYGA 3G15A 2W1CA 2C3IB 2BTSA 4MXCA 5GJFA 5AP1A 4DHJA 1KE6A 4LFIA 4NEUA 4D0XA 5ETFA 4D55A 3AKLA 2QHNA 2HZIA 4RJ4A 3R7IA 4R77A 4FTJA 4EZ3A 3E93A 1W98A 2QD9A 3GUBA 3KQ7A 3PSCA 3PWYA 4M8TA 4NJDA 4D2PA 1XBBA 3UP7A 2GHGA 5LVLA 4MQ1A 3P0MA 3NCZA 3A8XA 3IO7A 1AD5A 4HZSA 3G90X 2I1MA 4AOTA 3CTQA 3RPRA 4E93A 4CVAA 5AP7A 3ATTA 3BYOA 2OU7A 4PMMA 5FM2A 3NUPA 4AW1A 1DAYA 5KBRA 4BWPA 2VTNA 5J79A 3MB7A 4EYJA 5F9EA 3NEWA 5J5TA 1ST4A 2VTAA 2E9VA 2PMOX 4HNIA 4U6RA 2XK4A 3R73A 2UZUE 4XOZA 4GRBA 2EXCX 3RKBA 4F08A 3CCNA 5D7AA 5AM7A 3AQVA 2WPAA 4PV0A 2O0UA 3CQWA 4BYJA 1XBAA 3OP5A 3LXPA 4BZOA 3W2SA 2B52A 4OTRA 4ZY6A 2HY0A 4FVRA 2V0DA 3VUTA 3VW8A 4Z7HA 2GNJA 4PL4A 3UIBA 2QO9A 2VNYA 3GVUA 3KULA 3ODZX 4HYHA 1YHWA 3D5UA 3PRFA 4C58A 4FKSA 5M4FA 1LP4A 3OXIA 5DT0A 3KMMA 4TXCA 4JDHA 4WRGA 3CD8A 3QUPA 5IQGA 1DI9A 4QP8A 5HORA 3RPYA 1OM1A 5H3QA 4DEIA 4EJ7A 3QA8A 3F7ZA 5BQ0A 1ZXEA 2ESMA 5A4QA 2WKMA 4UZHA 4BY9E 1ZMWA 4XOYA 5JZNA 4PDYA 3O0GA 4E3CA 2P0CA 4JG8A 4A4OA 4QO9A 4KIQA 1YXVA 3GXLA 1NT2A 2QI8A 3KRLA 2BZIB 3HUCA 3Q4UA 5ETAA 3SOCA 3DJ5A 3DJ6A 4FEQA 5KO1A 4ZSAA 4DC2A 4W4YA 3TTJA 5AEPA 4A7CA 4DGOA 5KMLA 1K9AA 4G1WA 4QDVA 4MH7A 4WA9A 3DQXA 2PVYA 5EW3A 4JAJA 1OVEA 2YM7A 3R71A 4X2KA 3EFWA 5AIRA 5AJQA 3R9NA 3R8LA 5A4EA 2CDZA 3OD6X 3ZBXA 4C59A 3DLZA 3F82A 4WNPA 3PPJA 4TT7A 4NKSA 1DS5A 3PXQA 4RIYB 1W84A 4RX9A 2QG5A 5JN2A 5BYYA 1XJDA 3QD2B 3O7LB 3TNWA 3TZ7A 3ZLXA 1X8BA 2W1HA 2BZJA 4XV3A 4F9YA 2ITVA 3BQRA 3R6XA 3MFTA 4APCA 5IQEA 5AMNA 2BRNA 2PYWA 2C6LA 4O4EA 4XG8A 4GSBA 4J71A 3AD4A 3HMOA 4E6QA 4APPA 4EUTA 3E8CA 1E9HA 4B7TA 4CFMA 2Z7LA 4F9AA 4OBPA 1YKRA 4RA5A 2B55A 4H39A 3ZH8A 5HEZA 4CSVA 3KN5A 2J0IA 3FZ1A 4U9AA 1E1XA 2VTTA 3COHA 4U0IA 5HIEA 1Q8ZA 2YIQA 3AT3A 3ZDUA 4AQCA 2WTWA 2X7GA 5AIKA 1MRUA 4AFJA 3Q60A 3FZTA 3HZTA 1CMKE 4U81A 3E63A 4K6ZA 1H1RA 3FQEA 1R1WA 3O5AA 4H1MA 1M2PA 3R30A 2CN8A 4RIWA 3A61A 3HUBA 2IPXA 5KZ0A 4EK3A 1VZOA 2J0LA 3CP9A 1J1BA 1E1VA 4BDHA 2Z7QA 1PXMA 4IB5A 5CYIA 4YUQA 1Q8WA 2EB3A 4I94A 5EW8A 5LCKA 4FV2A 3FV8A 3VBYA 3BEGA 2CKOA 4J97A 2CNVA 2QOFA 2XNOA 3AC1A 3ORLA 2PUUA 4ZZNA 3MFUA 4IFCA 5AV2A 4M15A 1KE7A 4RX7A 1YXSA 4IJPA 3I7CA 5ANIA 4HVDA 1PMVA 3ZCLA 5BNJA 5M09A 4QPMA 4JXFA 5IEXA 1VEBA 4W4VA 4UWCA 3A7HA 4QMOA 5AUZA 4CFUA 3ZM4A 4FYOA 2VTPA 2EUFB 4O86A 2AUHA 3RCDA 5HTBA 2UW9A 3WE4A 5C8KA 3Q9WA 3UP2A 4O7RA 4XBRA 2PUPA 4EH7A 2H8HA 3ACKA 2E9OA 1LUFA 5AUVA 4AN3A 1GIHA 2PPQA 4EK6A 1YDRE 1IR3A 2GDOA 4EHEA 5L8LA 4CFVA 4HGTA 4ONAA 3NYVA 1W83A 2R3FA 4YJOA 4BB4A 3FLZA 1U54A 1H08A 3QRTA 5E4HA 4FI1A 4FNZA 2YIRA 3WI6A 1YHSA 3ZZWA 1AQ1A 1ZMVA 3OEFX 4U80A 3UQFA 3KA0A 3W0OA 4IX3A 3FLWA 5ACKA 5T6KA 3D2KA 3ORXA 3SXRA 4DEGA 5M55A 4FNYA 5TO8A 4BGHA 4FT5A 2BHEA 2GFCA 2WD1A 3Q5IA 4I6FA 1S9IA 4L00A 3UNJA 3VS4A 4ANSA 4QQ5A 2GNLA 4L6QA 3F5UA 3SHEA 3ZXTA 4LUEA 4CZUA 1JSTA 4H3PA 2X39A 1SMHA 2VAGA 4O0YA 4ZSJA 3BL7A 2C0TA 3VBWA 4AT4A 1PJKA 2PZYA 3H30A 3KC3A 4V0GB 2C69A 5I9ZA 2BFYA 3WYYA 4BBEA 4KABA 4WNKA 1WVXA 2OXDA 3IGGA 3WIGA 2UVZA 3ITZA 3S95A 5M07A 3W18A 4D2WA 1G8AA 2I0VA 2QO7A 3BLRA 2C6EA 3DBEA 3QX2A 4L68A 3OROA 4X21A 5HCXA 4EC9A 3PXKA 1IAHA 5DR6A 3ML1A 5FEDA 5CSHA 2WOUA 5BVFA 4ZSGA 3SD0A 4F1OA 4EOLA 5H8EA 2B9JA 4EBWA 3HRFA 3HV6A 3C13A 3DU8A 4EOOA 2R0IA 4AXDA 2CSNA 2PWLA 4Z3VA 5CSVA 2C3JA 3R9DA 2J4ZA 2YISA 3GCUA 4IX5A 4YTHA 5D11A 2G2FA 3MTLA 3HVCA 1WZYA 5BUIA 1R39A 4N6YA 4ZZMA 1LEZA 3W2RA 1W8CA 3KB7A 2GNGA 2BMCA 3VS7A 5HLPA 4AW0A 4B8LA 1UNLA 4TNBA 5BVNA 2WTDA 3BQCA 5BUEA 1OPLA 1ZOHA 1GNGA 4LI5A 4QMYA 3NUXA 2X81A 1YWNA 3OY1A 2HXQA 4G9CA 5EYCA 2J7TA 4FMQA 4W4WA 2R3HA 5CF4A 1MP8A 2PVRA 3AC8A 3FSKA 5EG3A 3K54A 4I5MA 3SQQA 3V5LA 2ETKA 3CTJA 1LR4A 4BIBA 4TNDA 5DR9A 5FD2A 4O84A 4O7NA 4DEHA 4ZZOA 3EYHA 5EQPA 3ZRKA 4AGUA 3C4CA 2XCHA 2VV9A 2ITOA 2PE1A 4GK4A 4I92A 2VTMA 5I0BA 5IDPA 4YJSA 4NM3A 4G3GA 5HKMA 4BDIA 2IN6A 3MY1A 4H3BA 3ZC5A 3MGYA 1Y8YA 5CF5A 4YZBA 3DB8A 2BTRA 4UYAA 4YURA 2VX0A 3Q9XA 1WAKA 4RFMA 4IZYA 4GUEA 1YOMA 5M06A 2C4GA 5FBOA 1IEPA 2JIVA 1XH6A 3T9IA 3UG2A 3VS0A 2PSQA 4CFFA 3EQRA 4MD9E 2HK5A 4YC8A 2FVDA 3W2OA 4CRSA 2OLCA 4B99A 2A19B 3DXNA 4AZSA 4K18A 4C57A 2H96A 4H36A 5EDQA 4ERKA 5EM6A 5FEQA 4KIKB 4A9TA 4A9RA 3PFQA 4O7SA 3NNWA 4C4HA 5AX3A 5KCVA 2YM4A 2UZWE 2QR7A 2OZAB 3CKWA 3ORKA 2ZAZA 3L8SA 4JR7A 5DR2A 2W5BA 4ALUA 5IH6A 4DHZA 4KUJA 4LOQA 4YC6A 3KRWA 4L53A 2V7AA 2OH4A 4DEBA 4IM0A 4IVAA 3D5WA 1PXJA 3SLSA 3TUBA 4O82A 4BTJA 5J9YA 3OC1A 4YPDA 3VO3A 2BRMA 3MTFA 3CGOA 3UG1A 5CU0A 2C47A 4O4CA 2AQXA 3RNYA 3IGOA 5DLSA 5IQCA 3ZUVA 3HECA 3AC2A 3NUUA 4FZAB 3WF9A 4QMUA 2OWBA 2RGPA 3LFNA 3P7CA 1NXKA 3RZFA 4RJ5A 4EEVA 3U6JA 4NKAA 3MW1A 4RVLA 4XH6A 4BZDA 2B4SB 2OICA 3TDWA 4IDVA 4YBJA 5EI2A 3RJCA 5FEEA 3FKOA 5HVJA 3VS3A 5EQYA 4USDA 3MY0A 4IX6A 3I79A 5BMSA 3UPZA 3E64A 1OITA 2J9MA 5CT7A 4M0ZA 1XBCA 1XH4A 2WMSA 3H0YA 2RF9A 3DY7A 2UZDA 2UZEA 3KVWA 4I5CA 4P4CA 2YFXA 4R3RA 5IA2A 1ND4A 4MBIA 3NUSA 4ZK5A 1FPUA 3MJ1A 4EC8A 3AKKA 4L7SA 3AD5A 1Q99A 3A99A 2DQ7X 4XV2A 5E1SA 3TV4A 5FDPA 1WBWA 4RMZA 3HKOA 2AEGA 2XNMA 3PA5A 1ERKA 4M13A 1W82A 3EL8A 4ANLA 3V5PA 3D5VA 3EKNA 3MPTA 4ACGA 3D7TA 3PDTA 3SOAA 5LWNA 3O51A 3PIZA 4UBAA 4X6RA 4E4XA 5M44A 3C5IA 4DF3A 2XVDA 4GV1A 3LXLA 2F7ZE 2RSVA 5M4UA 4YJNA 4KSQA 2R3OA 4IAKA 2PE2A 4IBMA 4MAOA 4PQNA 4BKJA 1B39A 3R22A 4H1JA 3PY3A 4ZJJA 5DIAA 3LM0A 2GMXA 3AGLA 2IW9A 3Q4TA 1VYZA 2P3GX 4ZXTA 1UU7A 5HI2A 2X4FA 3QFVA 1J1CA 4FYNA 4MXXA 4RWLA 5A54A 1OIQA 4O21A 3JR1A 2VGPA 2Y9QA 3IK3A 4X2FA 3VWAA 4E73A 2CKEA 2YM8A 4WBBB 1UWJA 2VNWA 4G3FA 4J98A 5IKWA 3ORZA 4L9IA 4M69B 4QYYA 3R7VA 3A7JA 5CQWA 4BCOA 2HENA 4BI2A 3ZO3A 3RM6A 4DITA 5DI1A 3O71A 5BPYA 4BDAA 4FRFA 1CM8A 4QMPA 4BTFA 3POOA 4DEEA 1YI4A 3H4JA 3U9NA 3PJ1A 1REJA 2B9IA 3II5A 4O91A 2OK1A 2BROA 3DKFA 3Q96A 5FLFA 4USFA 4RLKA 3R02A 1UKHA 4LUDA 5CVGA 2WELA 3EQCA 2GS7A 4IX4A 4JX7A 4J99A 4OTIA 1Q4LA 4BF2A 3NGAA 4O0VA 3Q4CA 4EWHA 3WYXA 4DAWA 2NNWB 2XIZA 4AN9A 1WMKA 2HZNA 2UV2A 3A7GA 3ANRA 3QC4A 2SRCA 2QOIA 3O8PA 3FMLA 3ZEPA 1JAMA 3NLBA 4IACA 5HE0A 1MQBA 1H1SA 4CD0A 4QP7A 3LFFA 4FTQA 3EQHA 2VWBA 2QQ7A 2IZUA 3TNQB 3TUCA 5BVOA 5JKGA 3RMFA 3W2QA 3RAHA 4K0YA 3NYXA 4D28A 2JITA 3P9JA 5FTGA 3UOLA 4AZFA 3NWWA 4NH1A 4EHVA 3CQUA 3P78A 3F5XA 4GW8A 4TYIA 2ZV2A 3QLGA 4GKIA 4FNWA 4DH8A 3LXNA 3SDJA 3QHWA 2PVJA 4UMUA 5AP5A 3KU2A 3A2CA 4O83A 5AP2A 5F20A 4RQKA 3OOMA 3JS2A 3CXWA 3CLYA 3LCKA 2BPMA 3QXPA 3UDZA 3KGAA 3RPOA 4WKQA 4OBOA 3UNKA 2VRXA 4C2WA 3HEGA 1Q8TA 3OW3A 3O8UA 3LMHA 2R9SA 4IAYA 4X3FC 4CCUA 4U7ZA 3TKIA 4AAAA 2EU9A 2YEXA 2PULA 2A98A 1HCKA 4RJ8A 1KOBA 5H9BA 1Q24A 3EIDA 4LMNA 1RE8A 3C4EA 3QTQA 4ANNA 3RAWA 2C3KA 3NYNA 2C6DA 3FMNA 4D2SA 2W5HA 4Y72A 4QP9A 4CTCA 4YZDA 1SVGA 4ZTSA 2PTKA 4AP7A 4DYMA 2JIIA 4C02A 5HZNA 3DXQA 4FTIA 4Y83A 4AA0A 1REKA 4JR3A 4WNMA 2CGWA 2W17A 2GCDA 3ORNA 3K5UA 3PJCA 3QKMA 4G6NA 4QMZA 5F94A 4C4JA 3SKCA 2ITNA 4L46A 3GFWA 4WBOA 4AGCA 2OIBA 3NVMB 3GCSA 3ZSHA 5LVMA 3GC0A 4LYNA 3HA6A 3V5QA 1PXLA 3KY2A 3NAXA 3RK5A 4L8MA 2QOOA 1DM2A 3Q5ZA 3T3VA 5KHXA 2CNUA 3UO5A 4CG9A 3R2BA 1CTPE 3Q4ZA 3T9TA 1M2QA 4HYUA 2OFVA 4R1VA 3ODYX 3WIKA 4FIIA 5ETCA 2Z7SA 3EHAA 4GFGA 3JVRA 4Q9SA 1URWA 4IZ7A 2YCQA 5D9HA 3TIZA 4BKZA 3ZO1A 4E4NA 1JSUA 5HBEA 3FKNA 1JSVA 4V01A 4NT4A 3FAAA 4YMJA 3LKMA 5CAQA 4RC3A 2CLQA 3DNDA 5CENA 2C1AA 4C35A 4ZTHA 5K0KA 3KIOC 2QC6A 4LRMA 5CI7A 3V8SA 1H1WA 1NVRA 2R3LA 2WIPA 3LFAA 3EQPA 3Q2MA 4FZDB 2ZV9A 2PVMA 1JLUE 4O6LA 1ZARA 3PTGA 3ATSA 5BYLA 4FT9A 4IWDA 3KCKA 1V1KA 3F69A 3R9HA 1PMEA 2X9EA 4DGLC 5AM6A 5IH5A 1H00A 3QTXA 3TNHA 4FSMA 4WD5A 1JPAA 3IOPA 4RFZA 4BGGA 4D5KA 4EOPA 3R63A 4FSZA 4CZYB 1JBPE 3BPRA 3OY3A 5DE2A 3VN9A 2C0OA 3R01A 4CGAA 2NP8A 2XMYA 4FKQA 4YNOA 1YVJA 1Z57A 2E2BA 5AX9A 4O1OA 2VTRA 5ETIA 3QL8A 2WTIA 3SVVA 3WZDA 5C4KA 3SXFA 3HL7A 1OBDA 3G6HA 4J52A 1LPUA 3MH3A 4F64A 3ALOA 3FZOA 4PTEA 3BL9A 1WVWA 3DB6A 4TY1A 3TN8A 4U5JA 5E91A 2YCRA 3OTVA 1ZLTA 4S32A 1SNUA 2XM8A 3MBLA 4Z9LA 3R7OA 2BRHA 3Q53A 3GQIA 1UU8A 2QOQA 3D5XA 1BLXA 1OI9A 2I0HA 4DEDA 3RHKA 3COIA 4QMVA 3QTSA 1MRYA 2VO6A 2ONLA 3QYZA 2PL0A 3OCBA 3CY3A 2ZV8A 4PUZA 3WZUA 4DFXE 2OW3A 3Q9YA 4EK5A 4F09A 4IWQA 4WO5A 4FA2A 4FZFB 3KXGA 2A0CX 2ETRA 3K3JA 4OTGA 5HE2A 3VIDA 2OJGA 2XKEA 3ACJA 3QCYA 4FKWA 2BDFA 2BFXA 3PP1A 4UWBA 4C4GA 2J90A 4FZ7A 4F7JA 3C9WA 2REIA 3FEGA 1OECA 4S30A 5DG5A 2WO6A 3BHYA 2VO3A 3AMYA 4BVUA 3MH0A 4OT6A 2WQOA 4HYIA 5E92A 3GOPA 3F61A 3I5NA 4CEGA 3IQ7A 3UVPA 1XQZA 5EH0A 4JBOA 5HNIX 1YI3A 1ZZLA 2VX3A 4EQCA 4RVTA 3V5TA 2VWYA 2VWUA 3GOKA 4P7EA 5IA5A 1OGUA 2PK9A 3AOXA 3RI1A 2OFUA 3P08A 4YHJA 5EYMA 2YLFA 3OVVA 3KRJA 3LFSA 4O2PA 5HG8A 4O0RA 3MY5A 4IJ9A 4G3DA 3C1XA 4BCGA 4O81A 4CMTA 5CWZA 5EHLA 4CFWA 2VN9A 4LGGA 2ZMCA 4X0MA 5J87A 3R8ZA 3H10A 3VNTA 4EH2A 3N4VA 3BKBA 3C4FA 3NR9A 5J1WA 4F78A 3LHJA 3UYTA 2W06A 5HE3A 1SZMA 4KS7A 4CLJA 1BUHA 4P5ZA 4QP1A 2BKZA 3FMEA 4CFXA 4YZ9A 5HO8A 2BAJA 2W1ZA 1PXPA 2WMUA 4MXAA 4CV9A 3LMIA 4WUNA 1IASA 2PMIA 4DINA 5IEYA 3TKHA 1O6LA 3F3TA 3I81A 2PZIA 4USEA 3NMUF 4LOOA 4QPAA 3QGWA 3RVGA 4NJ3A 1QL6A 5CAUA 1H1QA 5H8GA 1R78A 5CS6A 5K5XA 1KV2A 3O8TA 2CNQA 4RLLA 5HE1A 2CCHA 3MVLA 5KBQA 4NCTA 1Q3WA 2UZVA 3R1YA 3HP2A 2JAMA 3IW7A 1TFFA 3R7UA 3PVGA 4DTKA 3BYMA 1K2PA 4BKYA 1NY3A 3QQFA 4IB0A 1U46A 3BE9A 1BYGA 4BI1A 3HP5A 5IG1A 2W1GA 2A1AB 1TVOA 3JYAA 3U54A 3W0NA 4AXCA 3FSFA 3OUKA 5D1JA 3CD3A 3QQHA 2OF2A 3KULB 3EFKA 4FK6A 2C6OA 4FG7A 3FI3A 2OO8X 2G2HA 2B1PA 3T8OA 2RG6A 3DV3A 3PRIA 1VLRA 4U43A 4UMPA 4XYFA 5LJJA 2OZOA 1P14A 3DTCA 2PVNA 1RQQA 4WOVA 5TT7A 4U42A 2EWAA 4FV0A 3TJDA 4NW6A 3VUDA 1XMLA 5JMSA 3OHTA 3MFRA 4IFGA 4DG2E 4EOQA 4L42A 4JAIA 4FT3A 3GT8A 3GQLA 5KMKA 5ITAA 2Z02A 3MPMA 5IQAA 3I6UA 4I3ZA 4GIHA 3RALA 4N6ZA 3TL8A 4ZEGA 1IG1A 4OTWA 4JL9A 4C0TA 1I44A 4N4SA 1PY5A 5BYZA 5DWRA 4D0WA 3ALNA 3BRBA 2FSOX 4I4EA 4RWIA 5HD4A 5IA4A 3N4UA 4FKGA 3UIXA 1YXUA 3MV5A 4CMOA 3P7AA 4Q5EA 4U40A 2VZ6A 4AQKA 2IW8A 5C4LA 4FF8A 4G3CA 4WG5A 2E9PA 4YJTA 4BJJA 4YZNA 1A9UA 2UZNA 2DWBA 2XUUA 3BV2A 4QD6A 4PTCA 3TIYA 1SVHA 4EBVA 4PP7A 3ERKA 5LMAA 1BL7A 4MF1A 3TJCA 4ACDA 3BYSA 3P5KA 4KBAA 4CCBA 3HMIA 3EQDA 3NPCA 1OIUA 3BX5A 4K1BA 4FTLA 4ZS0A 2YM5A 3W1FA 4K8AA 1XHAA 3JXWA 3QYWA 4QMWA 2QVSE 1PMNA 4QTEA 5LOHA 4QNAA 3PYYA 5E8WA 5GJDA 3LZBA 3PJ8A 3K3IA 4RA4A 5HLWA 3VBQA 3WZKA 4IM3A 5IQHA 4I0TA 2UUEA 3TV7A 3D2IA 3S3IA 4F7NA 3H9OA 2UZLA 3GC7A 4B0GA 3BLHA 5L6WL 2GSFA 4A9YA 2QKWB 3OCGA 5LVOA 4YTIA 2NRUA 2V62A 1YQJA 4R5YA 2C0IA 1YXTA 3R00A 2WMVA 3KMWA 3N4TA 3GCQA 2HXLA 3IKAA 3LXKA 3PIXA 3ID6C 5IUIA 3QD3A 2GQGA 2PUIA 2IEWA 2XBAA 2YABA 1ZAOA 4FVPA 3UE4A 4C36A 5FTQA 1FOTA 2JDOA 5DRDA 4IXPA 5ANEA 5DFPA 3VHEA 1OIRA 3SV0A 4ZTQA 3HV7A 5KMOA 5L2WA 4QYFA 3Q32A 3HMPA 4KAOA 1JQHA 3ZXZA 5JGDA 4RIWB 2EB2A 2XKFA 3DQWA 3LLTA 4FKTA 4GK2A 3FMMA 4NWMA 3RNIA 2XIYA 3U51A 4EZ7A 5M4IA 4IEBA 1PYEA