4DC2A

Structure of pkc in complex with a substrate peptide from par-3
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
339
structure length
328
Chain Sequence
LGLQDFDLLRVIGRGSYAKVLLVRLKKTDRIYAMRVVKKELVNIDWVQTEKHVFEQASNHPFLVGLHSCFQTESRLFFVIEYVNGGDLMFHMQRQRKLPEEHARFYSAEISLALNYLHERGIIYRDLKLDNVLLDSEGHIKLTDYGMCKEGLRPGDTTSTFCGTPNYIAPEILRGEDYGFSVDWWALGVLMFEMMAGRSPFDIVGSNTEDYLFQVILEKQIRIPRSLSVKAASVLKSFLNKDPKERLGCHPQTGFADIQGHPFFRNVDWDMMEQKQVVPPFKPNISGEFGLDNFDSQFTNEPVQLPDDDDIVRKIDQSEFEGFEYINP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein kinase C iota type
publication title Substrate recognition mechanism of atypical protein kinase Cs revealed by the structure of PKC iota in complex with a substrate peptide from Par-3
pubmed doi rcsb
source organism Mus musculus
molecule tags Transferase/transferase substrate
total genus 96
structure length 328
sequence length 339
ec nomenclature ec 2.7.11.13: Protein kinase C.
pdb deposition date 2012-01-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
A PF00433 Pkinase_C Protein kinase C terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4dc2A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4dc2A01
4ORKA 3C7QA 3PUPA 4AP7A 4RQVA 3EZVA 3OOGA 3NNUA 3RHKA 2JBPA 4HPTE 4XH6A 3GFWA 4NM0A 4HNFA 4O0WA 4B9DA 4MAOA 1KOBA 5IUHA 2BFXA 3Q04A 3U6IA 4CZTA 3RPYA 4CFMA 5J9YA 1JOWB 3QUPA 4IACA 4O0SA 3MDYA 3FUPA 3F9NA 5LVPA 4U80A 1JBPE 1PF8A 3SX9A 4Y72A 2VWXA 1NVRA 1WBOA 3DLSA 3EN4A 4EK4A 4APPA 3GP0A 5I9XA 3V01A 4WNKA 5B7VA 3QQUA 3IW7A 1W82A 4ZSGA 4CYIA 3SA0A 3QGWA 2UZVA 1OL7A 2OJGA 3PVUA 4JQ8A 1M7QA 3DJ5A 3GENA 4AA5A 4BBFA 4UMPA 2ITOA 4I23A 4C38A 2ITQA 1FMKA 3ZFXA 2PUIA 3QX4A 2CGXA 4EJ7A 3E93A 3TV7A 4CFUA 3ATTA 4UALA 4CFXA 2XK7A 3GU6A 4S33A 4QP2A 4R3RA 3S2PA 3F7ZA 4DGLC 4CCBA 3MESA 2XRUA 3TJCA 2V7AA 3C5UA 4D2SA 2Y4IB 1Y57A 1WCCA 3F69A 3E7OA 2F2UA 3I7CA 3NCZA 3F88A 4FZFB 1XBBA 5AV0A 5LQFA 3OT3A 1SZMA 3DAKA 2E9NA 3HUCA 3PIXA 2EWAA 2HW6A 4NL0A 5CEIA 4N6ZA 3LCSA 4D0WA 5J9ZA 4A9RA 2YM8A 4I6FA 5CVFA 4JDIA 3VAPA 4BY9E 3A62A 4QP3A 1J1CA 4IDVA 2VWIA 1TQPA 4F99A 5HTBA 4HNIA 4A7CA 4UWCA 3ZH8A 2XNOA 4RC2A 1J3HA 4I5PA 5EHYA 5CX9A 4AS0A 1UKHA 3B2TA 4DINA 3CJFA 3D5XA 5HVYA 3SC1A 3WILA 4NWMA 1GZOA 4OTRA 3WF7A 3R7VA 3RHXA 4X3JA 5EFQA 3Q4TA 5CI6A 3LFFA 2PTKA 2XBAA 3BBWA 3AC4A 2REIA 3GGFA 5M08A 4KSQA 4JT3A 4U40A 3VUHA 5IA2A 3Q9ZA 3SRVB 4BCFA 4F7LA 2O5KA 4IQ6A 2I6LA 2FSLX 3DKFA 3KN6A 5BUIA 2NRUA 5CQWA 2VNYA 4KS7A 5I4NA 4CZUA 3K5VA 4ZJIA 1JKSA 4BHZA 1JKLA 4DEAA 4IXPA 4DGGA 4G34A 4FV4A 3RJCA 2RKUA 4U79A 3U9NA 4ZMEA 4ZZNA 2WTJA 3D7TA 5FP5A 3A8WA 5HLPA 5D10A 4XRLA 4YMJA 3PFQA 4TYGA 4QYGA 4DGOA 5DOSA 4BTKA 4C4GA 1WFCA 4FGRA 2ITWA 1CSNA 4F1TA 3TZMA 3IO7A 3MN3A 5FDPA 4W4XA 3KXHA 3IGGA 1K9AA 1IRKA 2R0IA 4LYNA 1XH8A 3FPMA 4DH8A 2KULA 4PX6A 4K1BA 2WMRA 1IAHA 4E4LA 3GB2A 3HA8A 4R5YA 3A7HA 4FIFA 2QOBA 2W1FA 3ORNA 4O1PA 5E8YA 4TYEA 1I44A 2CGVA 5AJQA 5GJFA 4KBKA 5DR2A 4XEYA 2JDRA 5CU4A 4ZK5A 4H1MA 1ZXEA 3PTGA 4BIEA 2XB7A 5H8GA 4GKIA 4UZHA 3OW4A 4LGHA 1PXNA 3C1XA 4LRMA 3VS5A 4YJOA 5EQYA 4EEVA 2ITUA 4E8AA 1JSVA 3R1NA 3VBQA 3LVPA 2XK3A 4HZSA 2A27A 2ETMA 4AOIA 5LCJA 2BTSA 3F2RA 3HRCA 4PTCA 3HV4A 2XBJA 3ZO3A 3C4CA 3H0YA 3UQFA 3VNTA 4UMUA 4FV8A 4Y8DA 3EFKA 5ANIA 3FI2A 3FAAA 3RK7A 2VWWA 3ZTXA 2C6LA 4FG9A 2C30A 4EC9A 1KSWA 1WVYA 3ZBXA 3BU3A 3IQ7A 2OG8A 4S2ZA 4USFA 3PDTA 4W9WA 4D5HA 3U51A 4B6LA 4EHVA 3D5UA 3WIKA 2Q83A 5CEKA 3LQ8A 1CKIA 3OHTA 4O1OA 5DBXA 3PIZA 2PVYA 2IPXA 3CIKA 4X2KA 3Q3BA 2XKEA 5DRBA 5A46A 3JY9A 3W16A 3ZO2A 1ZMVA 4ZIMA 5LARA 5LVNA 4PNKA 2C6TA 4B7TA 4BGGA 1R39A 3NR9A 2WGJA 4QPMA 2W9ZB 4YNEA 2C5XA 4QMLA 2WD1A 4NU1A 3SDJA 4YO6A 4AAAA 1ND4A 4BIBA 2J2IB 4EH8A 3FLYA 3S0OA 3UOLA 3W33A 3MFSA 3EZRA 2PSQA 3P79A 5HBHA 2Z02A 4E5AX 1RDQE 4O7ZA 1Z9XA 1ZY4A 2UW8A 4ZLOA 2RFEA 2VTRA 1GZ8A 3F7WA 2XYNA 2BHEA 3D5WA 3DQXA 5FEQA 4E6QA 3ID6C 2OU7A 3ENMA 5HIEA 4PQNA 4NW5A 4C2WA 4DLIA 3KREA 5H3QA 3TI1A 4E20A 3G15A 3FXWA 4GJ3A 3BZ3A 4G2FA 5AM6A 5HE0A 3G5DA 4P5ZA 2J0IA 3WZJA 4WOVA 3VUDA 1OZ1A 4C02A 5TT7A 2ITNA 5L4QA 2OFUA 3ORLA 4ANNA 2CGWA 4AFJA 4I22A 2DUVA 3QTQA 4D55A 2QOCA 2G2IA 3EYGA 3SVVA 4PPAA 1YXUA 3M11A 4BBMA 4Z7HA 2WB8A 2PUNA 4RWKA 1FQ1B 1PXMA 4XCUA 5EH0A 2BRMA 3W2OA 4CMUA 5KMMA 2X4FA 4N0SA 4YJSA 2FSTX 3OCSA 5LMAA 2J5EA 4F7JA 4FL1A 3MFTA 4RBLA 4LOPA 3I6WA 4L3PA 3EQHA 3F5XA 2WHBA 3ZXZA 2HIWA 4QYHA 4BHNA 2BRBA 3FYJX 2DWBA 4D1XA 3EQCA 4FNXA 5KMOA 4YBKA 5K3YA 3I7BA 3ZZWA 4ARKA 4GW8A 5ETIA 3MY5A 4QPSA 4DH1A 3OWPA 3EN7A 3IDPA 3QCXA 4O7NA 3JY0A 3SAYA 2PUUA 4F6SA 4O0YA 2R3FA 4HW7A 2C1AA 2X9FA 5HG8A 2QC6A 2XCKA 2HCKA 3WOWA 4C4EA 1MRVA 3F66A 2GNHA 4W4WA 4N6YA 4DG0E 1F0QA 3I4BA 4F4PA 2YIQA 3HX4A 3QRJA 5DH3A 4CYJA 3DBDA 3MTLA 1W7HA 3S00A 1ZZLA 1IEPA 4RIYB 2J6MA 4RVMA 2ZVAA 2RG5A 1PXKA 3MVHA 3SQQA 3TNPC 2HWPA 3PG3A 1YW2A 3ZDIA 2XKDA 2ERZE 4I0RA 2CSNA 2I0HA 5E1EA 5FWKK 4FA2A 4AA0A 1QCFA 2YFXA 3POZA 4YP8A 4EH7A 5IQFA 2VV9A 1RQQA 2QONA 4GFGA 1S9JA 3OXTA 4RZWA 4ACGA 4EOOA 4EWQA 3LJ1A 4PTGA 5HVKA 4F9CA 3PG1A 2IZTA 4ZTQA 4FSTA 2J0LA 3ZMMA 3OY1A 3VJOA 2JIVA 1FMOE 3NEWA 3KN5A 2IWIA 5AR4A 3JR1A 3UTOA 5BVNA 4K77A 3QF9A 4I41A 3QTXA 1FINA 2J90A 2PK9A 2BDFA 5E8VA 5D7AA 4HZRA 3NDMA 1OUKA 1Q4LA 3FC2A 1REKA 1Z57A 3FZ1A 4IIRA 3TNIA 3TWJA 5KO1A 4JDHA 1OI9A 1H26A 3HLLA 4CFFA 2VO3A 5DWRA 5HLWA 4TNDA 1MQBA 1SNXA 3F3UA 5J7BA 4BR3A 5DHJA 2PWLA 5CT7A 2C6DA 4RVKA 3TN8A 5I3RA 4ZS4A 3SG8A 1B38A 4E73A 2ZV9A 4MX9A 4CFVA 4YZBA 1U4DA 3F82A 5L2SA 3MI9A 2BR1A 1UKIA 1NVQA 3EMGA 3TG1A 4NYEA 3NMUF 4EWHA 3SXSA 3PRFA 4BWPA 5FEEA 3C9WA 3D9VA 5BPYA 3ALOA 3PYYA 3QZHA 3R28A 4ASXA 3TNHA 3MVLA 5CNOA 1P14A 2WMSA 3H9FA 2ZV7A 3LM0A 5IEYA 4KB8A 1Q61A 2W5AA 4GSBA 3QZFA 2VGPA 4FTLA 3BI6A 2VTTA 4U3YA 5BUEA 5TO8A 4AE9A 2QHMA 3R1SA 4AW0A 4EBVA 4IC7A 5CALA 4E7WA 2VU3A 5EW3A 2JKKA 2YA9A 3LQ5A 4I4EA 2UZDA 5FLFA 2XMYA 1QPEA 1K3AA 2NO3A 1Q62A 2YAKA 3MPAA 2R3OA 4O6EA 1JLUE 2PMNX 4FGBA 2GSFA 2XRWA 4FF8A 3NUYA 3R30A 4M3QA 5AP6A 2CLXA 4O7WA 2BZHB 4XLIA 3RK5A 1PYXA 2BROA 4CT2A 4XX9A 2C6IA 5AP1A 4G5PA 4YZDA 5C8NA 1JNKA 4M97A 5E90A 5IA1A 3SD0A 2HZ4A 4HVSA 4C2VA 1O6YA 2A0CX 4EQMA 5G1XA 2QLQA 3CQEA 3R7YA 1XBAA 5HE2A 4L67A 2I40A 2GPHA 2J50A 3R04A 4XOYA 3RBWA 2BAJA 5JGAA 3RVGA 4JI9A 2XNGA 4TKSA 4ZY5A 1QL6A 5DYJA 3Q6UA 4EH3A 3RWQA 3C0GA 5J79A 2H34A 2CKQA 3LPBA 4QP7A 4I93A 1OGUA 4ACMA 5K4JA 4CKIA 3MB7A 2WMVA 3K54A 3TM0A 3TIYA 1DAYA 5ANEA 5BUJA 4IVCA 5E1SA 5A4TA 4OBOA 4O7YA 2XA4A 3O7LB 3MSSA 2XK9A 5F94A 4AN2A 3B8RA 2QOOA 4FZDB 3FMNA 4AW1A 4DBXA 1W98A 5AUWA 1YXXA 2JEDA 4BCJA 4DG3E 4ITHA 4J8NA 1URWA 2BFYA 2VTNA 4A06A 3TUBA 2E9UA 1KOAA 2YWVA 4FOBA 5CLPA 3CY2A 3TTJA 4AWIA 5EKNA 4E3CA 5K5XA 3AG9A 4V04A 4BTJA 2ITTA 4I21A 4JX3A 4KBAA 4D4RA 3O8PA 2XZSA 1KE8A 5LMKA 4RJ6A 3SOCA 1OL2A 4JR7A 5EI8A 4ANOA 2VNWA 5ACKA 3OOMA 5JGDA 5AP4A 4AGDA 3LKMA 3DQWA 2VZ6A 2W1IA 3H4JA 1PXJA 3HDNA 3M1SA 4GVAA 2R7IA 1Q5KA 2C47A 4QNYA 4PL3A 5AV4A 5H8EA 4TXCA 4D4VA 2ITPA 5AR3A 4YZCA 4J7BA 2ZDTA 3PLSA 3G33A 1DI8A 3COMA 4AZWA 1ZRZA 2VO6A 1JKKA 3GNIB 1WBPA 3MTFA 3QXPA 5IEVA 3U9CA 1UU3A 1R0PA 2WMQA 5K0KA 4YHJA 1XWSA 3E8CA 1ZAOA 3DZQA 3P78A 4FKSA 4ITJA 2JIUA 4X3FB 3VJNA 1KE6A 1JSUA 3QD0A 3ZHPC 2YJSA 4GG5A 3RM7A 4C59A 4AXAA 4U5JA 4HJOA 1G8SA 2WTVA 5FTGA 5EOBA 3ALNA 3PA5A 1ZWSA 4OLIA 2XS0A 4RZVA 4U45A 2PYWA 3PXFA 3R00A 4J71A 2PMIA 5LMKC 2G1TA 2YCQA 5ETFA 3CKXA 4IE9A 4AT3A 1OL6A 2XNEA 5G6VA 3UOJA 3BE2A 4EZ3A 3FYKX 3AD5A 3TXOA 3I81A 2Y6OA 5IQEA 3PIYA 4JR3A 5L3AA 3MH2A 4QP6A 3NVKI 3U4UA 2J0JA 3UNJA 4TPTA 3PXRA 4TYHB 5HX6A 3DK6A 3LFBA 3ORPA 4KA3A 1GOLA 3SV0A 4ZS0A 3UYSA 3OEZA 4IBMA 3O50A 4DT9A 3QRKA 1Z5MA 3NUPA 4LV8A 4HVGA 5HE1A 5KHWA 2YZAA 3IOPA 5AAFA 1IASA 3OUKA 4BCNA 5LWNA 5EI6A 4ZSJA 4CEGA 2C5VA 3ETAA 2V62A 3OG7A 3RI1A 3S4QA 4GT4A 4FT5A 4CV8A 4WT6A 3MA3A 5D1JA 1WVWA 4KSPA 4DEDA 3CS9A 4DEHA 2UW9A 3DDQA 3QQLA 4DG2E 3E92A 4R5SA 5C4KA 3MA6A 3BYMA 4HCTA 3RAIA 5HCYA 4XBRA 1OB3A 2PE2A 4PV0A 3DB6A 3HRBA 3KMWA 1I09A 3TIZA 3Q5ZA 4MD7E 3PPZA 4FSRA 1CKPA 4LGDA 2XNPA 4ZSAA 3HKOA 4X6RA 5I9UA 4EOIA 4FZAB 4QMTA 2Z7SA 2JDSA 3QUDA 5FGKA 3PSBA 1LR4A 3QUEA 2R64A 2G01A 1Y91A 5AP7A 2J9MA 4LGGA 2UZWE 3VS6A 3NIEA 2B9JA 2B9FA 2W4JA 3C4FA 2PZRA 3U54A 2QG5A 1ZOHA 4I5CA 3HMPA 2WQNA 3GT8A 5HD7A 3DK3A 4NEUA 3FKLA 1YHSA 2XP2A 3DFAA 3P4KA 3PP1A 3JS2A 1IAJA 4NTSA 2PUPA 4MWHA 1OKZA 3KB7A 5IMEA 3V8TA 3ZRLA 4MXYA 3WIGA 1J1BA 4WRGA 5CQUA 5A4EA 3R9RA 2BILB 4S30A 4C57A 4D4YA 3R7GA 4EYJA 5GHVA 1LUFA 3C4ZA 4BCIA 2BHHA 4E4XA 4MNEB 3BLHA 4RX7A 4ANBA 1V0PA 1W83A 3BHUA 2ETKA 2JBOA 3E64A 3BRBA 3Q9WA 3GQLA 4WUAA 4D2WA 4NKSA 4D2PA 2YLEA 4V0GB 3SOAA 3LFDA 2VTAA 4ANMA 4F08A 1FVTA 5DFPA 3BEAA 2GDOA 3WZUA 4DGMA 3QBNA 5HIDA 4EQCA 4I94A 3LFCA 3C51A 4FSYA 4FC0A 2Q0NA 3MYGA 4PP9A 4R3PA 4XRJA 2C6OA 2EB3A 2OJ9A 2Z7QA 4Z9LA 4OR5A 3O23A 3QGYA 5HESA 4IVBA 4U43A 1OKVA 2YITA 4G6LA 4FYOA 5TE0A 1WBVA 5M4FA 4UN0C 3HZTA 3RPSA 2C3JA 2WPAA 2WFYA 4R1VA 4WNPA 3NLBA 5J5SA 4BCHA 2R3PA 4WRSA 4HVDA 3GFEA 5AA8A 2XKFA 5M07A 3BWFA 3EH9A 3SKCA 5I9WA 3ORXA 2R5TA 3BYSA 3FQEA 5CTPA 3BQRA 4ASDA 3AC5A 2UW0A 2FSOX 4E6CA 4UXQA 3TKIA 4PPCA 3OMVA 2YCFA 4ZLYA 5IPJA 3AT4A 3UNKA 1YRPA 2NRYA 2R3QA 3QFVA 4GK3A 4M13A 5E8SA 5JZNA 5E92A 5JGBA 3UQCA 3A7IA 2FUMA 2DQ7X 2YIXA 3CBLA 1H25A 2GS7A 2X8EA 4MNFA 3MY0A 1B6CB 3UE4A 4YZNA 2PE0A 3KL8A 1Y8YA 1YKRA 1ZYSA 2AYPA 3C0HA 3NGAA 4G5JA 3QRIA 4XG9A 3VWAA 4A9SA 4IM3A 1H27A 1JPAA 4N70A 4WSQA 3WF6A 5J5TA 4TZRA 4DLJA 5M51A 4ZTLA 2GHLA 3LCDA 3VUKA 3O96A 2QQ7A 3NW6A 5IEXA 3CCNA 5AADA 4IC8A 3TCPA 3S1HA 4K11A 2VO7A 3DXQA 3QCQA 2VTOA 5TKDA 2XM9A 3IW5A 4FEUA 3TDVA 3N4UA 4ALVA 3LZBA 5HORA 5CSVA 4FTUA 3FDNA 4K18A 5EHOA 3IW8A 4DEBA 5AUXA 2R3NA 4YJQA 3QKMA 2XEYA 5HICA 4FKVA 4YJNA 4FKWA 2QOKA 2ZAZA 4MWIA 4R7HA 5CF5A 2C0OA 4RIYA 3EQIA 4DBNA 4RJ3A 5CAPA 1BL7A 5CEMA 3QQKA 1WBWA 2C0IA 4OT6A 4QP8A 3ZLWA 1TKIA 3UBDA 5AR7A 4DFYA 4C0TA 4F6UA 4YJPA 4B4LA 4MXOA 4AF3A 3EJ1A 4RIWB 2UW5A 4KKGA 4L68A 1H1QA 3R9OA 4ZSEA 2QKWB 4EI4A 4U97A 3FHIA 4CKJA 4I6HA 3COIA 4S31A 4IZAA 4WO5A 4RLKA 5AV3A 3BPRA 3KC3A 2YACA 3F5GA 4LFIA 4QMPA 3RZFA 4RT7A 3R83A 4EL9A 4BDFA 4DGNA 2X4ZA 3ODYX 4ZLZA 1OVEA 4PNIA 1G3NA 3QA0A 5LCKA 5D11A 2JDOA 5A4LA 4O0UA 3MH0A 2NPQA 5IMXA 3KF7A 4RX5A 4CCUA 4CZYB 1BUHA 4J98A 3R8PA 5IF1A 3CJGA 3FE3A 2QNJA 3QRUA 4AZSA 3ORZA 3EB0A 2CN5A 3VRYA 1R0EA 2CCIA 5D41A 3W2QA 4NZWB 4F7NA 1XBCA 2QCSA 2W05A 4S32A 3DLZA 4LV5A 5B2LA 3NVMB 3PE2A 4GUBA 4YNOA 1UNHA 1Y6AA 3R9DA 3KA0A 3UP7A 1T46A 4O0VA 3N4TA 4OTFA 3HEGA 4ENYA 3VO3A 5IG1A 3PJ1A 2VTSA 4EYMA 4PMMA 4C4IA 2ZB0A 5E8UA 5IQHA 3UVRA 3Q60A 5E7RA 4RQKA 3ZLXA 4TN6A 2OJJA 2C5NA 3MW1A 4JBQA 2WTKB 3DTWA 2ITVA 4X2FA 3PZHA 3ROCA 2JGZA 2YCRA 4F09A 2WZJA 3VS3A 3Q9XA 4FE2A 3NYNA 3LW0A 3OXIA 4PL5A 4HYIA 3FY0A 3MIYA 4IM2A 3EWHA 3UG1A 3VIDA 1XKKA 3CC6A 4Y85A 5C27A 4IAFA 4JXFA 2R3GA 3G9NA 4RWIA 2W1DA 4A4LA 3BKBA 4FKOA 3FLSA 3IKAA 1XQZA 3N51A 3QTIA 4I1ZA 5M4CA 3ZFYA 3IK3A 2LAVA 5JEBA 1JKTA 1W0XC 1F5QA 2HZNA 4UMQA 4RC4A 5EYCA 3PY1A 2EVAA 3QQFA 5M4IA 3KULB 3DA6A 3DJ6A 3KKVA 4J97A 4WBBB 5KKRB 5EM8A 1SMHA 1YWVA 4YSMA 3F6XA 2WOTA 1H0WA 5M53A 2UW6A 2WU6A 1ZOGA 3RCJA 3ZC6A 1KV1A 3CTQA 4EOPA 3UO4A 5HU3A 1OIRA 1H1WA 1OKYA 4USEA 2OZAB 3GEQA 4XP3A 5BX0A 4FK6A 4FSUA 3TEIA 1OPKA 4A9YA 1H4LA 2PZ5A 3DPKA 4FV5A 3DKCA 3FMHA 2OJIA 1UWHA 2O2UA 2OXXA 5HGIA 2YM4A 4O83A 1GIHA 2J0KA 2OXYA 1NXKA 2CPKE 3ANRA 1Q24A 3NS9A 4PF4A 4ZTRA 5FXSA 3SGCA 2BRNA 4E4MA 3RWPA 3PP0A 3EQBA 5CANA 5CEPA 2W1HA 2BZJA 5HOAA 2C5YA 4DH5A 4Q9ZA 3QD2B 1VYZA 4H3PA 4EJNA 2J51A 5E8WA 3R7IA 4FTOA 3NNVA 4RJ8A 1AGWA 3DFCB 4FV1A 4XG3A 3RMFA 3AT2A 4AFEA 4ZMFA 3E8EA 2CN8A 5FBOA 4ZJVA 1AD5A 3EKKA 4L43A 2WTIA 3P5KA 4ZAUA 5I9ZA 5AR8A 4H39A 2C3KA 3GC8A 3QALE 3V5LA 5DA3A 3ANQA 1R1WA 2Y4PA 3LCOA 4TWOA 1PXOA 2XIRA 3THBA 4QMQA 5HNIX 4NT4A 3G6GA 3EFJA 4FKIA 3KK8A 4J53A 2GS6A 2WMUA 3FBVA 2E9OA 3HP2A 4JAIA 4RSSA 4WD5A 3T8OA 3V8WA 3FI8A 3WZKA 4DFNA 5HO8A 5L2IA 3QXOA 3L8PA 3LCKA 1M52A 3MB6A 5CSPA 3QX2A 2GMXA 4F9YA 2WAJA 3GI3A 4K6ZA 4M15A 4GKHA 4XOZA 4XG7A 3OVVA 3QC9A 4L3LA 4CTCA 3A99A 5FBNC 2QOLA 4NIFB 5ANKA 4V05A 5JZJA 2F9GA 3P23A 3CEKA 4DFXE 2JDTA 4XV1A 3FEGA 3ZBFA 3PWDA 2IVTA 5DI1A 3G2FA 2R3LA 2W99B 3ACKA 5JK3A 3DS6A 4ZJJA 3DU8A 2PZIA 4X7QA 3FC1X 3DY7A 3PA3A 3QAME 3COHA 4GYGA 4HCVA 5CSXA 4GS6A 4X3FA 2P2IA 3T9TA 3ZDUA 4CSVA 5JFXA 2YM5A 2F49A 2XK8A 2ZDUA 5CT0A 2PVMA 4U44A 3ZUVA 3QD3A 3RP9A 4OTPA 1URCA 3MBLA 5E8XA 4Y5HA 2V7OA 3VS1A 2R9SA 3KK9A 4FEQA 3WF5A 3QYWA 4HVHA 3C4EA 5LVOA 4LUEA 2BTRA 4P5QA 2GCDA 1YWNA 5KMIA 4QP1A 3ZXTA 4L00A 5AUTA 4F9BA 5K5NA 4O7VA 3KVXA 2GQGA 1LP4A 5KZIA 4NW6A 3NNXA 4HYSA 1OBDA 1PW2A 3R8LA 5DN3A 4Z3VA 4FTJA 2WTWA 3P86A 4A07A 3IONA 3G9LX 3OS3A 3VQUA 3NYVA 2WU7A 4U3ZA 5HU9A 3K2LA 5L6OA 4XYFA 5IKWA 3IW4A 4YTCA 2W5HA 2HXQA 4IB3A 4FZ6A 5CASA 2XIXA 1CTPE 1FVVA 1ATPE 1B39A 2GNJA 4IMYA 1WMKA 2PVRA 4FZ7A 3GCUA 3M42A 4G3EA 5JRSA 4FNYA 3QZIA 1E1VA 2XJ0A 4LRKA 2I7QA 3KF4A 1M17A 2HWOA 4LRJA 3HMNA 2QO7A 2A1AB 2I1MA 1U54B 2R3RA 4JDJA 3CSVA 3QTWA 2F57A 5HG5A 2YIRA 4AGCA 4QYFA 3FY2A 4ACDA 1ZMWA 3KGAA 3FSFA 4WG4A 2UZUE 3PXQA 3OD6X 2EU9A 3DBCA 4F7SA 3NAYA 4AOTA 5JFSA 3ZSIA 3NX8A 5EOLA 3W10A 4BI0A 4EK5A 1PKGA 3CQUA 2BAQA 3LMGA 4W8EA 4JNWA 5EYKA 4W4VA 3G90X 3ZCLA 5AUUA 3LMHA 3VS7A 4MH7A 3WF8A 4KIKA 3TDWA 1Q99A 3DXNA 3NPCA 3ORTA 4EQUA 5IQIA 3QA8A 1WBSA 4IWPA 4NM5A 3GCQA 2PVKA 2XVDA 4FUYA 1ERKA 4ASEA 5A14A 1J91A 3BHHA 3KRWA 3GBZA 5DRDA 4I3ZA 3H10A 3U8WA 4G9CA 2EB2A 3EQDA 3UIXA 4CLIA 4GRBA 4M69B 5KMJA 2ZMDA 4RLLA 5ANGA 3FL4A 1EH4A 4BDEA 3BE9A 5GZAA 3LXLA 3ZM9A 5HNGA 2BRGA 3AMYA 3LHJA 4GFOA 1OIUA 2JFLA 3MFUA 1CDKA 4I92A 3AC8A 4U7ZA 3SLSA 4BCMA 4G16A 4AG8A 5ETAA 3EKNA 1JVPP 3CY3A 2CHLA 3MPTA 3FZRA 3WBLA 3ORIA 3RGFA 2IZRA 2ZOQA 5H9BA 3AC2A 4ZXTA 4OAVB 4Y95A 3FSKA 1YDTE 2OK1A 4GCJA 3GCPA 3SHEA 5JT2A 2HAKA 4D1SA 3FL5A 2QURA 5H8BA 3W32A 4L46A 2GS2A 5BQ0A 1T45A 4QMSA 2O8YA 4V0GA 3D2KA 2UZEA 4JG6A 4PDSA 3R7EA 3VBWA 3VUMA 4O2ZA 3WZEA 1YHVA 5AM7A 3OCTA 2Y4IC 5IDPA 1J7UA 1H8FA 1PJKA 1MRUA 5E8TA 4IHPA 2CLQA 4QRCA 3V8SA 2X7FA 3QKKA 4BRXA 4BDBA 1H01A 3QHRA 4Z55A 2EXCX 3ZO4A 3PVBA 3T3UA 2BZKB 2WMBA 1M7NA 4E1ZA 1QPJA 2WEVA 4TRLA 4Y46A 2LGCA 4ZTHA 2RFNA 3KRJA 3OY3A 3QRTA 2IN6A 3PPJA 3NUSA 5CY3A 1VYWA 3W2RA 4FSWA 4F6WA 4YSJA 5DEWA 4IVAA 5GJGA 2V5QA 3OXZA 5HTCA 3ZZEA 4OT5A 4DA5A 3MPMA 2CKPA 3IW6A 3HV6A 3OP5A 3R2YA 3AD4A 3V5PA 2PY3A 3O51A 3TKUA 3LOKA 3QYZA 3JXWA 4NSTA 5DIAA 2X2LA 3ZYAA 2RSVA 3FMKA 3SXRA 2O3PA 2QLUA 2XF0A 4ACCA 2NNWB 4JIAA 2WMAA 2YDKA 3FMEA 4HYHA 4FVQA 2WIHA 3HECA 2YLFA 4NFMA 1Q41A 4U8ZA 3Q2MA 4M66A 2R3HA 3BLRA 3QD4A 5M55A 4D2TA 2VWBA 3LLTA 4K0YA 2PMLX 3KRRA 5C01A 4BDHA 1UVRA 2XJ2A 4KIQA 4DH7A 1YXTA 3C50A 4O91A 4YJVA 3ZS5A 1UU8A 3FXXA 5CF4A 4CG9A 3JPVA 1RE8A 3RKBA 4JBOA 2R4BA 3ZEWA 4EOKA 4Q9SA 4MCVA 3CE3A 5JN2A 4YZMA 2XK4A 4RC3A 1GIIA 4YTIA 3VF8A 3E87A 3OWLA 3EFWA 3MGYA 4OGRA 3JUHA 4IAAA 2VRXA 2BKKA 2YERA 3KXZA 3EN5A 1K2PA 3CQWA 3EQGA 4KKEA 4XP2A 2ITXA 2OLCA 5AR5A 3FMLA 3LQ3A 4CXAA 4QMWA 4FT3A 4J52A 2Y7JA 3FLQA 3OFMA 2RIOA 5C4LA 3RTPA 4JG7A 2YWPA 4IWOA 2OXDA 4FODA 3R0TA 5A4QA 5EDQA 2Z60A 2UZNA 3AXWA 3O0GA 4HOKA 2XK6A 4FKJA 1U46A 2QHNA 4BTFA 4CG8A 4RIWA 4CMTA 4IB0A 3R1QA 2JDVA 3DZOA 5CNNA 2UUEA 4ONAA 4M84A 3RM6A 1R3CA 3PXKA 3KXGA 4USDA 3G0FA 3C13A 5AP0A 4OW8A 5CAUA 4DEGA 5L2WA 1Q8YA 3OEFX 3LXNA 4AZTA 4QYYA 1YDRE 2RF9A 4MTAA 5HG7A 2HXLA 3C0IA 3H30A 1VJYA 5DG5A 2JIIA 4LUDA 4QQ5A 3TZ9A 1U59A 4ZY4A 2B0QA 4DITA 4AT4A 2QU5A 3BYVA 3FZOA 3NRMA 3R8VA 1L8TA 4M68A 4C35A 5A3XA 2Z2WA 5LVMA 5HG9A 4F0IA 3VBXA 3GC9A 4FR4A 4EOQA 3D7TB 4G3DA 4O86A 4DT8A 3C4WA 4F9WA 2R3KA 4GVJA 4UBAA 3DKGA 3UJGA 5JFWA 1MRYA 2GFSA 4CD0A 3GUBA 3H9RA 3KCKA 4DTKA 4DFUA 5CWZA 2BIKB 1H1PA 4I0SA 3P7CA 3P7BA 4BC6A 1BX6A 4HPUE 5AIKA 1DI9A 2UV2A 4MKCA 3NZ0A 4BVUA 2ETRA 1DM2A 4IX6A 4EZ7A 1GY3A 2WQEA 2RFDA 4O7SA 1H28A 1KE9A 2W06A 3DDPA 4WUNA 5KNJA 5IA0A 4NH1A 2UVZA 3BV2A 4BCOA 4YJRA 4DYMA 5IDNA 4FYNA 1IA9A 1H00A 2O63A 3FKOA 3UPZA 2UZOA 2IVUA 4P2KA 4TYIA 5EKOA 1SNUA 4LM5A 2WOUA 2B1PA 3HP5A 5F1ZA 1ZY5A 5K0XA 3VHEA 2R3IA 3O2MA 4C4JA 5JQ5A 4J1RA 4F64A 5HBEA 3OCBA 4BF2A 1MQ4A 3D2IA 5A6NA 5HLNA 4KUJA 3RPRA 3L8SA 2BCJA 2IG7A 3MS9A 4Q5EA 4O27B 4FTRA 5M09A 5J9LA 3TJDA 1VZOA 2JKQA 2ZMCA 4QMVA 4R7IA 4I20A 3I1AA 4I4FA 4V01A 4L7SA 3NUUA 5HCXA 4BDJA 4BCQA 4RX9A 3SRVA 4IDTA 1YVJA 5CU2A 4QTDA 3W55A 4QMYA 3KRXA 2ZYBA 4JRVA 1S9IA 5E4HA 4G17A 4TNBA 5T3QA 2ITZA 4C37A 3EN9A 3Q52A 3PJ2A 4FKQA 4C3RA 4AE6A 4OTIA 5J1WA 5AMNA 4DFBA 3OTUA 1CKJA 3PY3A 5KZ0A 1OITA 1OUYA 2HY0A 4L8MA 4W9XA 2IJMA 3A4PA 3GOPA 3LXKA 5FDXA 3CR0A 5JMSA 3R7OA 4IEBA 2P4IA 2YDIA 2SRCA 3VHKA 4FSZA 2Z7LA 2CNQA 3GCVA 2P33A 4KWPA 3V5WA 5FTQA 3QQHA 4O96A 2WQOA 4YJTA 5HKMA 3O8TA 2VTJA 5AUYA 2W0JA 5FXQA 4QP9A 4I0TA 5KUPA 5GIOE 4FIJA 5E9EA 2CJMA 1BI7A 4BGHA 2EUFB 4FEXA 3OUNB 2F4JA 3LFNA 3OF0A 4CTBA 3QCYA 4PDYA 2HY81 3KCFA 3LM5A 3PY0A 4L7FA 3HV7A 4R8QA 4FL3A 2GHGA 2X39A 3R63A 4L53A 1PYEA 5AUVA 2Y0AA 4FEVA 2VTMA 5AP3A 5LVLA 4FKGA 4HGLA 1OKWA 3ENHA 3ULIA 2E9VA 3V3VA 3ZO1A 4Z7GA 4H58A 2XIZA 4O82A 3UVQA 4EHZA 3DV3A 1WBNA 4UV0A 3JVRA 3S3IA 4AZEA 5ICPA 4DCAA 1YI4A 1ZLTA 4RFMA 3PRIA 3I5ZA 4KINA 5IA4A 3R9HA 3PJ8A 3DBEA 3OROA 5H2UA 3S95A 1R78A 2X2KA 3ZONA 4NIFA 3RAHA 3QCSA 2ZV8A 3K3IA 4U42A 3ORMA 4RJ7A 4E26A 5EM6A 3CTJA 4L42A 4NUSA 4E5BA 3HNGA 4F65A 3VW6A 5FRIA 4BCKA 2W96B 2ZB1A 2QOFA 2IZSA 3NUNA 5L6PA 4IAYA 3RPVA 3VBVA 4JBVA 3QC4A 4EKKA 5ITAA 4QD6A 4BBEA 2IZUA 4EK3A 3CPCA 3QL8A 2YIWA 4ITIA 3QWKA 4FX3A 4MYGA 4WHZA 4JOAA 3HRFA 4ZY6A 4QOXA 2IW9A 3UC4A 2BKZA 4YPDA 5F9EA 5KX8A 4FTCA 4AOJA 4JAJA 4KAOA 4OTHA 1V0OA 2G2FA 3T3VA 4ANSA 4HGTA 2O64A 4KNBA 2IO6A 5D12A 3BYUA 5BVKA 4XMOA 4A4XA 3ATSA 4O22A 3L9LA 1OPJA 4MXAA 3PZEA 3UNZA 2JKOA 4EOMA 3D15A 5JH6A 1GZKA 3IDBA 3CP9A 1YWRA 4AGUA 2X6EA 4YC6A 1UWJA 2QI8A 1YHWA 1XH7A 2GNGA 4G31A 4QMZA 3I0OA 4EHEA 2YISA 3FMDA 2UW3A 3Q9YA 3TZ7A 2QOIA 1OPLA 2QD9A 5EK7A 1YDSE 4YHTA 2WNTA 2QR7A 5J1VA 2OWBA 2V0DA 1PXIA 5C8KA 1Q3WA 5EQPA 4BGQA 1IA8A 1FGIA 4CMOA 3HMOA 4M0YA 1U54A 4BZNA 5F4NA 5AUZA 1W84A 4BWKA 2AC3A 2YM3A 4TYJA 3V5QA 3VF9A 4KIOA 3UO5A 3MJ2A 3NUXA 4XV9A 3UIMA 1LEWA 3P7AA 4BWXA 3RK9A 2PULA 4GUEA 2ONLA 4ASZA 4QYEA 3R6XA 2W7XA 4M8TA 4UWBA 3PWYA 4GK2A 4FIGA 5CSWA 3P9JA 3P1AA 2C4GA 3QLGA 3BGZA 1H24A 3R01A 4JL9A 4X21A 4DEEA 4E5WA 4G3GA 4U41A 3EOCA 4OBPA 3VQHA 4DCEA 4ERKA 3SXFA 2XKCA 2YJRA 4FSQA 4ZP5A 2XIKA 2WTDA 3IECA 4FI1A 4RG0A 4XV2A 2VN9A 3R73A 4MD8E 2H96A 3MIAA 4M69A 4XG8A 3WI6A 3AT3A 2JFMA 4Q2AA 2VD5A 4XV3A 4LMUA 5FD2A 4KKHA 4XLVA 1KE7A 3ZFMA 4BTMA 4DE4A 2CGUA 2DYLA 5IQCA 5KCVA 4AW5A 1OIQA 2W5BA 4F1MA 3FLWA 4FG7A 3OC1A 4AW2A 4EH6A 3KQ7A 5FM2A 1PMVA 2A2AA 4X2GA 3VUTA 4D9TA 5I9VA 3ZEPA 2KTYA 3NYOA 5JSMA 3HAVA 3PE1A 4LOQA 4ALUA 2PU8A 4EK8A 4L52A 4C7TA 2W1ZA 1GAGA 3LAUA 1H08A 3IG7A 2YCSA 2UZTA 3R2BA 3MH3A 1UV5A 3LLAA 1V0BA 4XBUA 2B4SB 2WMXA 4UXLA 1U5RA 3GU4A 3EL8A 3R8UA 3P08A 4IM0A 3R1YA 4M12A 4BZDA 2CNVA 5CVGA 5F20A 5IH4A 4YPSA 2VWZA 3AC3A 3HL7A 3BGQA 3TNWA 1XH4A 4GU9A 5M4UA 3EQFA 1ZARA 4E6DA 4R1YA 3TV4A 4AN3A 1WZYA 3FMMA 2OO8X 3AMAA 4FTIA 4HCUA 4JRNA 5HQ0A 3EYHA 3HV3A 4EH5A 3HYHA 5IA5A 2PMOX 4GH2A 3W2CA 4QO9A 4NM3A 4JQ7A 3L9NA 4BDDA 4U6RA 4APCA 5FM3A 4D2VA 3UGCA 1IR3A 4WG3A 5KBRA 4GYIA 5M06A 1YI6A 3TV6A 5GINE 2WELA 3BIZA 4X3FC 2OH4A 5BYLA 3DCVA 4J99A 4R6VA 3ZSHA 4TWCA 3DJ7A 3RAWA 4L9IA 4GL9A 4FIIA 4AX8A 4O0TA 4CV9A 3TTIA 3UO6A 3WE8A 3BEGA 5CS6A 3NW5A 4IB1A 5IQDA 4D2RA 2JAMA 4R77A 4IW0A 4JS8A 2WXVA 4CVAA 3ELJA 3VC4A 4MXXA 4JVGA 4EZ5A 4FG8A 4OBQA 4BKYA 2EXMA 3QQGA 3D0EA 3BYOA 5AWMA 2XNNA 2C69A 4UWYA 4BCPA 4BDCA 4DFLA 4ZTSA 2H6DA 2C0TA 2VTHA 4FMQA 2YHVA 4NJDA 5DMZA 3LJ2A 4QQCA 5M57A 3UMWA 4GIIA 3M2WA 3OBJA 2YAAA 4FV2A 2B53A 4UMRA 2BVAA 2F7XE 4PDPA 3TZ8A 3E3BX 3Q53A 3E7VA 3C4XA 3DBQA 2ITYA 3PJCA 3BLQA 4CRLA 5LOHA 4QMUA 4D5KA 1SVGA 4FICA 3D4QA 4RPVA 5ANDA 4LL0A 2JITA 3FWQA 2BAKA 5DT4A 3V51A 2BMCA 2YM6A 3WYYA 4Z16A 3U87A 5CF6A 1JAMA 2C6KA 4J8MA 2W9FB 1J7IA 3QTRA 3Q32A 4Q5HA 5L8JA 3D7ZA 5DGZA 4F9AA 4KRCA 5AV1A 2XCHA 3V6RA 4WBOA 5HBJA 3U4WA 4IWDA 4PMSA 2YN8A 3UOKA 4YLJA 4GJ2A 2XUUA 4RMZA 1ZMUA 3DGKA 4AACA 2WTCA 4FTMA 3UDBA 4EONA 1YOMA 4HYUA 1DAWA 2UZLA 3CD8A 4R7BA 5DE2A 2BIYA 1VR2A 2V22A 3WF9A 4P90A 2W1EA 3ET7A 3Q5IA 3R9NA 4CRSA 3TUDA 4WA9A 4PP7A 2ERKA 4YC8A 2OF4A 3OWJA 4LMNA 4PY1A 4CNHA 4O21A 3COKA 2QU6A 3NYXA 4ACHA 5IH5A 1GJOA 2CCHA 4OTQA 2BDWA 1J7LA 3DNEA 5BMSA 4DAWA 4FK3A 5D9HA 4K33A 4H3BA 5AX3A 5CYIA 2X6DA 4FTAA 5I0BA 3BHVA 2W1CA 3AGMA 5C03A 2VWVA 1X8BA 5CF8A 1STCE 2CKOA 4IX4A 4FKTA 3I79A 3V04A 4DH3A 4DFZE 3ZRKA 2HENA 3VBTA 2WQMA 3ZUTA 3U6HA 4TTHB 5KMNA 3AOXA 2GHMA 5AAEA 4WIHA 3CGFA 4BICA 5ETCA 5HO7A 2UW4A 4H1JA 4U81A 2WIPA 2QVSE 2ZV2A 3A7GA 5GJDA 4Y83A 4N4SA 5DR9A 4BKJA 1YI3A 2XIYA 1SM2A 5ACBC 5IU2A 4MBJA 4O7TA 3FQSA 1H0VA 3KY2A 1Q97A 1UA2A 5EHLA 4ERWA 5EDRA 2QODA 1PRYA 4W8DA 5LWMA 3FMJA 1YOLA 3E62A 3O17A 4PMTA 3NSZA 3MH1A 2X9EA 4M67A 1NY3A 4J96A 4NJ3A 1AQ1A 3BCEA 2PVHA 3AD6A 4DTBA 1Q8WA 3FZPA 4JBPA 1A9UA 4B8MA 3B2WA 4BB4A 2X7OA 3POOA 3FJQE 4RGJA 3E8NA 4UYAA 5AX9A 3DNDA 3O7LD 2XNMA 3GC7A 2FVDA 5A9UA 3HMIA 4DTAA 3RINA 4DF3A 4RJ4A 3ZRMA 5IQGA 3HAMA 4NK9A 1ZYJA 4PL4A 2E2BA 4BN1A 3DAJA 2G15A 5HZNA 4MF0A 5CAOA 4YO4A 1A48A 1UNGA 3BV3A 4XNEA 2BZIB 2PPQA 2WMTA 4PPBA 1BLXA 2Y9QA 4XHKB 5LJJA 4NFNA 1Y8GA 3FPQA 2IW6A 4B0GA 3U6JA 1FOTA 4EH9A 2G2HA 2IW8A 3A61A 2AC5A 3OW3A 2R2PA 3LIJA 4MXCA 1BMKA 2X8DA 5AFVA 4ZZMA 4D58A 3E63A 3NNWA 5EM5A 4EH4A 3MVMA 4RIXB 3KVWA 4X2JA 4F70A 5BVDA 4FV0A 1O9UA 4O38A 3QTSA 4GK4A 4G1WA 4TYHA 2OICA 5L8LA 2GNLA 2F7ZE 2C68A 4FSMA 3VULA 1OECA 5HTIA 3CGOA 5BYYA 4HVIA 2I0VA 4NCTC 2IVSA 4RWLA 5T68A 2WMWA 3CLYA 1APME 2OW3A 3NCGA 3NW7A 4IAKA 1GIJA 2UW7A 4FNWA 5M56A 1FBNA 3EQRA 3H3CA 4BYJA 2HYYA 5JFVA 3FQHA 5KMLA 3KXNA 5FUTA 2UZBA 1WAKA 2OJFE 4QQJA 4YLLA 5F95A 4TL0A 5LXMA 5L2TA 4X6QC 3F5PA 2EXEA 4KBCA 3T9IA 3AMBA 5GNKA 5CEOA 5HX8A 5L8KA 3F3TA 3VS4A 4ZEGA 2HZIA 2VTIA 1H1RA 2YIYA 4D28A 3Q6WA 2OH0E 5LMBA 5EW9A 5BNJA 2AUHA 5C8MA 2JC6A 5BMMA 3EL7A 4QQTA 3RCDA 2R3MA 1LPUA 4CFWA 5JKGA 4H3QA 3MV5A 4JX7A 4RVLA 4EORA 2GNFA 4AT5A 3NAXA 4GU6A 5HNBA 1PMNA 4FKUA 2Q0BA 1BI8A 5AEPA 5IISA 4GT3A 4P4CA 4FNZA 2W4OA 3WYXA 2BRHA 1RJBA 4YC3A 2QR8A 3FLZA 5J87A 3A7JA 3VN9A 4C3FA 2YM7A 4JJRA 4RWJA 1F3MC 3UP2A 4C62A 3G0EA 2H8HA 1QPCA 2DS1A 5TF9A 5CAVA 2I0YA 2X0GA 5IH6A 2P0CA 3BHTA 2OKRA 3LFAA 4IAZA 4JDKA 2XEZA 3IS5A 4XG4A 4BCGA 5J8IA 1G8AA 4NM7A 4EC8A 3REPA 2R7BA 3GCSA 3E3PA 3IDCA 4GV1A 4XG2A 5AAGA 5GZ8A 1CMKE 3L8XA 4MNEA 2FO0A 1MUOA 3LFEA 4S34A 1JWHA 3TL8A 2F2CB 2JLDA 1XH6A 3F3WA 3KRLA 4PWNA 1QPDA 5KBQA 3HA6A 4PTEA 2ZM4A 3MVJA 3HGKA 5K4IA 2RGPA 3DTCA 2Y8OA 4LOOA 2X8IA 2OGVA 4P7EA 4YGAA 4UX9A 4GT5A 5FQDC 2CKEA 3LFSA 4FKLA 3DBFA 3IGOA 5AV2A 3DB8A 3FLNC 4MVFA 1M2PA 1YXVA 2WTKC 4I5MA 3W8LA 4F1OA 4BDAA 5B2MA 2QG7A 4D4SA 1HCLA 4Y73A 4D9UA 4FBXA 4C3PA 1BKXA 1OIYA 3WE4A 4C36A 2OBJA 3FV8A 4O0RA 5EYDA 3AGLA 1P4OA 3W2SA 1NW1A 4CFNA 5CAQA 2PE1A 3E5AA 3GOKA 3UODA 4NTTA 4BZOA 1HOWA 1KUTA 3P0MA 4TW9A 2HELA 4MQ1A 2J4ZA 3HMMA 1XH5A 3UYTA 4X0MA 3WARA 3F5UA 2C3IB 2UVXA 5EI2A 2PVNA 4BKZA 3Q4UA 3O8UA 5DT0A 3BQCA 4FVPA 2UVYA 4ZTNA 4IZ7A 3JYAA 3QWJA 4ZZOA 4HGEA 5CENA 2C3LA 3CKWA 1MP8A 4AZFA 5HEZA 2B52A 3SG9A 1U5QA 4BIDA 5KKRC 4FT7A 1O6LA 2CNUA 4UMTA 5CU3A 3FZSA 4II5A 3KU2A 3ZU7A 2IVVA 1P4FA 4LG4A 1M2RA 3BU6A 3ZM4A 3DKOA 3G51A 4OUCA 4YTFA 4EUTA 3TUCA 2WO6A 5L6WL 2HZ0A 3B8QA 5AP5A 1XR1A 1LEZA 2BALA 3EQPA 4UY9A 4I5HA 1ZYDA 3WZDA 2X7GA 4XP0A 5HE3A 4G3CA 4NCTA 5AIRA 3R8MA 4M0ZA 3UOHA 4XUFA 4BDKA 4E6AA 1Y6BA 4YZ9A 4EOSA 4GMYA 3OT8A 1G5SA 4F0GA 1GNGA 4IVDA 4R78A 4AN9A 4XJ0A 1UU7A 4O7LA 1JQHA 4HGSA 3CTHA 4OAUC 3A8XA 4H36A 4U9AA 4UYNA 2JKMA 3FI4A 2QOHA 1KV2A 4FTTA 4MQ2A 1SYKA 4PRJA 3RNIA 1KWPA 3V5JA 4EH2A 1OM1A 2OI4X 3R21A 5I5ZA 3IOKA 4G6OA 2ACXA 4BDIA 2F7EE 3A2CA 4C61A 4YBJA 4L6QA 4F0FA 4CLJA 3AC1A 4MBIA 5CSHA 3CD3A 3D83A 4M14A 3VUIA 1XHAA 2Y6MA 2Z7RA 3U55A 3I60A 2PHKA 3H9OA 2OFVA 4IJPA 1O6KA 2X81A 3QU0A 4O6LA 4B8LA 4L44A 3OBGA 3OZ6A 3LFQA 2CDZA 3NWWA 4TY1A 4FSNA 4ANLA 4GEOA 2RG6A 3LXPA 5IUIA 2P3GX 3CPBA 1E9HA 3F61A 1ZYLA 3HV5A 4RA5A 1Q8TA 1KE5A 2QO9A 4EOLA 5KE0A 4D1ZA 1CM8A 3UC3A 1M2QA 4RX8A 3O71A 4QMMA 4BFMA 2BPMA 3BGPA 5C1QB 4IAIA 3GQIA 3IPHA 4E93A 3AQVA 5J95A 1PMEA 5BVWA 1NT2A 3KMUA 1GZNA 5HIBA 4ZOGA 3ERKA 3HUBA 3NIZA 3ODZX 1HCKA 3E8DA 5CZHA 3ULZA 5FEDA 3KXXA 4DEIA 5EYMA 2QO2A 5FP6A 4N57A 3ZC5A 3E88A 1NVSA 3Q2JA 3FKNA 3C5IA 4KIPA 3TACA 2C1BA 3L1SA 2BUJA 4C58A 3OWKA 4K9YA 3GVUA 4C33A 3D5VA 2VTQA 2H9VA 2RFSA 3VS2A 3TNQB 4BI2A 4QTCA 5FTOA 3QZGA 2P2HA 3A4OX 2X2MA 4O2PA 5CZIA 5KMKA 3F2NA 3F2AA 4K8AA 2C6MA 4QT1A 3MY1A 4MK0A 4FKPA 5TOZA 5AA9A 3KEXA 2VX1A 4IWQA 4BDGA 3EHAA 3EIDA 4GIHA 4ID7A 2YZLA 3TKHA 4IX3A 4MF1A 3TT0A 1PXLA 1BL6A 3DOGA 2R0UA 3K5UA 4C4HA 3PVWA 4FTKA 4FTQA 4DC2A 4D0XA 3VVHA 4AA4A 4WNMA 2VX3A 3KFAA 4O7RA 2OZOA 2W4KA 3BU5A 3LJ0A 3Q4ZA 3ROYA 3LE6A 5CXZA 3RNYA 4CKRA 2OF2A 3I0QA 4EKLA 1PY5A 2O65A 5D7VA 3D94A 3UMXA 2VO0A 4AUAA 3UVPA 1YXSA 3KULA 5E91A 5AP2A 5BVOA 3PA4A 5C9CA 4RFYA 3QHWA 4G9RA 2GFCA 3VS0A 1TVOA 4FEWA 2HK5A 2Z8CA 2WQBA 2ONLC 4FV6A 4IADA 2JD5A 3BWJA 4Y5QA 3MFRA 3Q96A 2VTLA 2WKMA 3VW8A 5HCZA 4PUZA 4FT0A 2OZAA 4L45A 5JQ8A 5B0XA 1OMWA 2PZPA 3OTVA 4FVRA 4IANA 4TWPA 3H0ZA 4NKAA 1FGKA 1PMUA 4A4OA 4FOCA 1YQJA 5AR2A 3QTUA 2GQRA 4ENXA 5IA3A 5DPVA 3N4VA 3VBYA 3A7FA 4UB7A 2VAGA 4RIOA 2E9PA 3DT1A 3ZLYA 3PXZA 5CI7A 3UZRA 3F3VA 5DNRA 4EBWA 4F63A 4C4FA 2GQSA 5HI2A 1SVHA 2ZM1A 3PVGA 5A4CA 1PXPA 3HVCA 2P55A 4E4NA 4IB5A 3ORKA 3A60A 3UZTA 3KMMA 5IQAA 4TWNA 1V1KA 5A6OA 4C34A 2J0MB 3MWUA 2GTNA 4MXZA 4JIKA 4O84A 4FT9A 3JVSA 2OIBA 3L9MA 3LCTA 2NP8A 4KD1A 4QP4A 5EG3A 4WSYA 3PXYA 5ANOA 4KS8A 2HOGA 2J7TA 3HDMA 2OIQA 3K3JA 4UEUA 5GZ9A 3QTZA 4O81A 4B99A 3UIUA 3L8VA 3EFLA 3VRZA 2B9HA 4JG8A 4W4YA 2FH9A 1DS5A 2GNIA 3KXMA 5CU0A 2YABA 4I6QA 2V55A 1OL5A 2OIDA 4FIHA 1FPUA 1Q8ZA 3GU8A 1XJDA 4BL1A 3DXPA 4LQMA 4YURA 1NA7A 4FV3A 5IZFA 4KRDA 4ZTMA 4YUQA 5I9YA 3R7UA 2X1NA 3MJ1A 3I5NA 4KIKB 4QMXA 5E8ZA 2FYSA 5J7HA 3GXLA 5HHWA 4A9UA 4AGWA 4I24A 5EQEA 3D14A 2FB8A 3II5A 1VEBA 4I6BA 1QMZA 3Q4CA 3LMIA 3CXWA 3R22A 4AQCA 2ZM3A 5K9IA 3UZPA 2PVFA 3R02A 3QLFA 3QKLA 4IH8A 1ZZ2A 3FI3A 1P2AA 4EUUA 4QTEA 3NUAA 2A4LA 4RRVA 3EN6A 4BYIA 3W1FA 2PZYA 1UNLA 4J95A 4ZSLA 4JQEA 4L01A 1E1XA 3GU7A 4PDOA 1UU9A 3RPOA 5HD4A 4EK6A 4YJUA 1TQMA 1BYGA 3OCGA 5HVJA 4FTNA 2I0EA 3ZUUA 5FXRA 1ZOEA 1W8CA 2XM8A 4OTDA 1OBGA 1TQIA 4RIXA 2BDJA 4QTAA 4QNAA 5DEYA 5KHXA 5DT3A 3RALA 2VTPA 1SVEA 2VUWA 1FVRA 4YLKA 3ZOSA 1Q8UA 4YU2A 4FUXA 3L9PA 1ZYCA 4XS2A 2XJ1A 4IJ9A 4WNOA 3ZLSA 4MEDA 5C26A 4RJ5A 4DHFA 5T6KA 2HW7A 2W17A 5BVFA 3W18A 5JRQA 2XYUA 3QQJA 3ACJA 1M14A 1PHKA 1H1SA 5L2QA 3ZSGA 1Q3DA 4UZDA 5IQBA 4K2RA 3W2PA 4CQGA 4IX5A 4FV9A 5CEQA 2JAVA 3PPKA 2CMWA 4YR8A 2VX0A 3UPXA 2J5FA 4L3JA 4IZYA 5B2KA 4RFZA 2RL5A 1YOJA 1PKDA 4YHFA 2FSMX 1RW8A 4QMNA 3FZTA 2FA2A 4U0IA 5CVHA 1XO2B 3BBTB 2GU8A 5IUGA 4MBLA 5M44A 4OTWA 3W8QA 1JSTA 1IG1A 1WBTA 4AU8A 4M7IA 4QTBA 5A54A 3DK7A 5HO6A 3V6SA 4QPAA 3F3ZA 5CU6A 3PSDA 5ANJA 2VGOA 3N9XA 3GU5A 4MD9E 3ITZA 4X2NA 4FIEA 3UG2A 5DVRA 4YTHA 4FV7A 3PLAE 2QOQA 3DAEA 4O0XA 2ZJWA 4XG6A 3R71A 1P5EA 3UIBA 5GIPE 2C5OA 3I6UA 2W1GA 4IZ5A 4LL5A 4RVTA 4WKQA 2YDJA 4JLCA 5DR6A 4KABA 2WEIA 4DN5A 1XH9A 4QMOA 4CQEA 2QKRA 4FKRA 3FXZA 2PVLA 4GFMA 3BHYA 3GC0A 5EM7A 4A9TA 2XNBA 2A19B 4RA4A 5FG8A 4G3FA 3PJ3A 3RZBA 3PSCA 4ANQA 4PMPA 4C8BA 4MHAA 2FGIA 3R8ZA 2B55A 5BVEA 4CT1A 2G9XA 2B54A 4AZVA 3RAKA 4OTGA 4H05A 5DLSA 1OL1A 2VWYA 4EOJA 3FHRA 3VUGA 2YEXA 5TR6A 2B9IA 4LI5A 5CXHA 3G6HA 5I3OA 1A06A 4R3CA 3V5TA 3BX5A 2PVJA 4IFGA 4BI1A 4GG7A 3SW7A 1L3RE 3BELA 5EDPA 4WG5A 2R3JA 1H07A 2C6EA 4IFCA 5EW8A 4CGAA 5BYZA 4ALWA 2VWUA 3SW4A 3UQGA 2XH5A 1WVXA 2ESMA 4G6NA 2GTMA 2B7AA 2OSCA 4FL2A 4EHGA 1REJA 4TT7A 2O0UA 2PL0A
chains in the Genus database with same CATH superfamily
4ORKA 3C7QA 3PUPA 4AP7A 4RQVA 3EZVA 3OOGA 3NNUA 3RHKA 3AKKA 2JBPA 4HPTE 1W2CA 4XH6A 3GFWA 4NM0A 4HNFA 4O0WA 4B9DA 4MAOA 1KOBA 5IUHA 2BFXA 3Q04A 3U6IA 4CZTA 3RPYA 4CFMA 5J9YA 1JOWB 3QUPA 4IACA 4O0SA 3MDYA 3FUPA 3F9NA 5LVPA 4U80A 1JBPE 1PF8A 3SX9A 4Y72A 2VWXA 1NVRA 1WBOA 3DLSA 3EN4A 4EK4A 4APPA 3GP0A 5I9XA 3V01A 4WNKA 5B7VA 3QQUA 3IW7A 1W82A 4ZSGA 4CYIA 3SA0A 3QGWA 2UZVA 1OL7A 2OJGA 3PVUA 4JQ8A 1M7QA 3DJ5A 3GENA 4AA5A 4BBFA 4UMPA 2ITOA 4I23A 4C38A 2ITQA 1FMKA 3ZFXA 2PUIA 3QX4A 2CGXA 4EJ7A 3E93A 3TV7A 4CFUA 3ATTA 4UALA 4CFXA 2XK7A 3GU6A 4S33A 4QP2A 4R3RA 3S2PA 3F7ZA 4DGLC 4CCBA 3MESA 2XRUA 3TJCA 2V7AA 3C5UA 4D2SA 2Y4IB 1Y57A 1WCCA 3F69A 3E7OA 2F2UA 3I7CA 3NCZA 3F88A 4FZFB 1XBBA 5AV0A 5LQFA 3OT3A 1SZMA 3DAKA 2E9NA 3HUCA 3PIXA 2EWAA 2HW6A 4NL0A 1XMMA 5CEIA 4N6ZA 3LCSA 4D0WA 5J9ZA 4A9RA 2YM8A 4I6FA 5CVFA 4JDIA 3VAPA 4BY9E 3A62A 4QP3A 1J1CA 4IDVA 2VWIA 1TQPA 4F99A 5HTBA 4MUQA 4HNIA 4A7CA 4UWCA 3ZH8A 2XNOA 4RC2A 1J3HA 4I5PA 5EHYA 1W2FA 5CX9A 4AS0A 1UKHA 3B2TA 4DINA 3CJFA 3D5XA 5HVYA 3SC1A 3WILA 4NWMA 1GZOA 4OTRA 3WF7A 3R7VA 3RHXA 4X3JA 5EFQA 3Q4TA 5CI6A 3LFFA 2PTKA 2XBAA 3BBWA 3AC4A 2REIA 3GGFA 5M08A 4KSQA 4JT3A 4U40A 3VUHA 5IA2A 3Q9ZA 3SRVB 4BCFA 4F7LA 2O5KA 4IQ6A 2I6LA 2FSLX 3DKFA 3KN6A 5BUIA 2NRUA 5CQWA 2VNYA 4KS7A 5I4NA 4CZUA 3K5VA 4ZJIA 1JKSA 4BHZA 1JKLA 4DEAA 4IXPA 4DGGA 4G34A 4FV4A 3RJCA 2RKUA 4U79A 3U9NA 4ZMEA 4ZZNA 2WTJA 3D7TA 5FP5A 4AXDA 3A8WA 5HLPA 5D10A 4XRLA 4YMJA 3PFQA 4TYGA 4QYGA 4DGOA 5DOSA 4BTKA 4C4GA 1WFCA 4FGRA 2ITWA 1CSNA 4F1TA 3TZMA 3IO7A 3MN3A 5FDPA 4W4XA 3KXHA 3W0PA 3IGGA 1K9AA 1IRKA 2R0IA 4LYNA 1XH8A 2IEWA 3FPMA 4DH8A 2KULA 3ML1A 4PX6A 4K1BA 2WMRA 1IAHA 4E4LA 3GB2A 3HA8A 4R5YA 3A7HA 4FIFA 2QOBA 2W1FA 3ORNA 4O1PA 5E8YA 4TYEA 1I44A 2CGVA 5AJQA 5GJFA 4KBKA 5DR2A 4XEYA 2JDRA 5CU4A 4ZK5A 4BJJA 4H1MA 1ZXEA 3PTGA 4BIEA 2XB7A 5H8GA 4GKIA 4UZHA 3OW4A 4LGHA 1PXNA 3C1XA 4LRMA 3VS5A 4YJOA 5EQYA 4EEVA 2ITUA 4E8AA 1JSVA 3R1NA 3VBQA 3LVPA 2XK3A 4HZSA 2A27A 2ETMA 4AOIA 5LCJA 2BTSA 3F2RA 3HRCA 4PTCA 3HV4A 2XBJA 3ZO3A 3C4CA 3H0YA 3UQFA 3VNTA 4UMUA 4FV8A 4Y8DA 3EFKA 5ANIA 3FI2A 3FAAA 3RK7A 2VWWA 3ZTXA 2C6LA 4FG9A 2C30A 4EC9A 1KSWA 1WVYA 3ZBXA 3BU3A 3IQ7A 2OG8A 4S2ZA 4USFA 3PDTA 4W9WA 4D5HA 3U51A 4B6LA 4EHVA 3D5UA 3WIKA 2Q83A 5CEKA 3LQ8A 1CKIA 3OHTA 4O1OA 5DBXA 3PIZA 2PVYA 2IPXA 3CIKA 4X2KA 3Q3BA 2XKEA 5DRBA 5A46A 3JY9A 3W16A 3ZO2A 1ZMVA 4ZIMA 5LARA 5LVNA 4PNKA 2C6TA 4B7TA 4BGGA 1R39A 3NR9A 2WGJA 4DDIA 4QPMA 2W9ZB 4YNEA 2C5XA 4QMLA 2WD1A 4NU1A 3SDJA 4YO6A 4AAAA 1ND4A 4BIBA 2J2IB 4EH8A 3FLYA 3S0OA 3UOLA 3W33A 3MFSA 3EZRA 2PSQA 3P79A 5HBHA 2Z02A 4E5AX 1RDQE 4O7ZA 1Z9XA 1ZY4A 2UW8A 4ZLOA 2RFEA 2VTRA 1GZ8A 3F7WA 2XYNA 2BHEA 3D5WA 3DQXA 5FEQA 4E6QA 3ID6C 2OU7A 3ENMA 5HIEA 4PQNA 4NW5A 4C2WA 4DLIA 3KREA 5H3QA 3TI1A 4E20A 3G15A 3FXWA 4GJ3A 3BZ3A 4G2FA 5AM6A 5HE0A 3G5DA 4P5ZA 2J0IA 3WZJA 4WOVA 3VUDA 1OZ1A 4C02A 5TT7A 2ITNA 5L4QA 2OFUA 3ORLA 4ANNA 2CGWA 4AFJA 4I22A 2DUVA 3QTQA 4D55A 2QOCA 2G2IA 3EYGA 3SVVA 4PPAA 1YXUA 3M11A 4BBMA 4Z7HA 2WB8A 2PUNA 4RWKA 1FQ1B 1PXMA 4XCUA 5EH0A 2BRMA 3W2OA 4CMUA 5KMMA 2X4FA 4N0SA 4YJSA 2FSTX 3OCSA 5LMAA 2ZFYA 2J5EA 4F7JA 4FL1A 3MFTA 4RBLA 4LOPA 3I6WA 4L3PA 3EQHA 3F5XA 2WHBA 3ZXZA 2HIWA 4QYHA 4BHNA 2BRBA 3FYJX 2DWBA 4D1XA 3EQCA 4FNXA 5KMOA 4YBKA 5K3YA 3I7BA 3ZZWA 4ARKA 4GW8A 5ETIA 3MY5A 4QPSA 4DH1A 3OWPA 3EN7A 3IDPA 3QCXA 4O7NA 3JY0A 3SAYA 2PUUA 4F6SA 4O0YA 2R3FA 4HW7A 2C1AA 2X9FA 5HG8A 2QC6A 2XCKA 2HCKA 3WOWA 4C4EA 1MRVA 3F66A 2GNHA 4W4WA 4N6YA 4DG0E 1F0QA 3I4BA 4F4PA 2YIQA 3HX4A 3QRJA 5DH3A 4CYJA 3DBDA 3MTLA 1W7HA 3S00A 3W0NA 1ZZLA 1IEPA 4RIYB 2J6MA 4RVMA 2ZVAA 2RG5A 1PXKA 3MVHA 3SQQA 3TNPC 2HWPA 3PG3A 1YW2A 3ZDIA 2XKDA 2ERZE 4I0RA 2CSNA 2I0HA 5E1EA 5FWKK 4FA2A 4AA0A 1QCFA 2YFXA 3POZA 4YP8A 4EH7A 5IQFA 2VV9A 1RQQA 2QONA 4GFGA 1S9JA 3OXTA 4RZWA 4ACGA 4EOOA 4EWQA 3LJ1A 4PTGA 5HVKA 4F9CA 3PG1A 2IZTA 4ZTQA 4FSTA 2J0LA 3ZMMA 3OY1A 3VJOA 2JIVA 1FMOE 3NEWA 3KN5A 2IWIA 5AR4A 3JR1A 3UTOA 5BVNA 4K77A 3QF9A 4I41A 3QTXA 1FINA 2J90A 2PK9A 2BDFA 5E8VA 5D7AA 4HZRA 3NDMA 1OUKA 1Q4LA 3FC2A 1REKA 1Z57A 3FZ1A 4IIRA 3TNIA 3TWJA 5KO1A 3TMOA 4JDHA 1OI9A 1H26A 3HLLA 4CFFA 2VO3A 5DWRA 5HLWA 4TNDA 1MQBA 1SNXA 3F3UA 5J7BA 4BR3A 5DHJA 2PWLA 5CT7A 2C6DA 4RVKA 3TN8A 5BV3A 5I3RA 4ZS4A 3SG8A 1B38A 4E73A 2ZV9A 4MX9A 4CFVA 4YZBA 1U4DA 3F82A 5L2SA 3MI9A 2BR1A 1UKIA 1NVQA 3EMGA 3TG1A 1ST0A 4NYEA 3NMUF 4EWHA 3SXSA 3PRFA 4BWPA 5FEEA 3C9WA 3D9VA 5BPYA 3ALOA 3PYYA 3QZHA 3R28A 4ASXA 3TNHA 3MVLA 5CNOA 1P14A 2WMSA 3H9FA 2ZV7A 3LM0A 5IEYA 4KB8A 1Q61A 2W5AA 4GSBA 3QZFA 2VGPA 4FTLA 3BI6A 2VTTA 4U3YA 5BUEA 5TO8A 4AE9A 2QHMA 3R1SA 4AW0A 4EBVA 4IC7A 5CALA 4E7WA 4I6LA 2VU3A 5EW3A 2JKKA 2YA9A 3LQ5A 4I4EA 2UZDA 5FLFA 2XMYA 1QPEA 1K3AA 2NO3A 1Q62A 2YAKA 3MPAA 2R3OA 4O6EA 1JLUE 2PMNX 4FGBA 2GSFA 2XRWA 4FF8A 3NUYA 3R30A 4M3QA 5AP6A 2CLXA 4O7WA 2BZHB 4XLIA 3RK5A 1PYXA 2BROA 4CT2A 4XX9A 2C6IA 5AP1A 4G5PA 4YZDA 5C8NA 1JNKA 4M97A 5E90A 5IA1A 3SD0A 2HZ4A 4HVSA 4C2VA 1O6YA 2A0CX 4EQMA 5G1XA 2QLQA 3CQEA 3R7YA 1XBAA 5HE2A 4L67A 3UDTA 2I40A 2GPHA 2J50A 3R04A 4XOYA 3RBWA 2BAJA 5JGAA 3RVGA 4JI9A 2XNGA 4TKSA 4ZY5A 1QL6A 4QEBA 3Q6UA 4EH3A 3RWQA 5DYJA 3C0GA 5J79A 2H34A 2CKQA 3LPBA 4QP7A 4I93A 1OGUA 4ACMA 5K4JA 4CKIA 3MB7A 2WMVA 3K54A 3TM0A 3TIYA 1DAYA 5ANEA 5BUJA 4IVCA 5E1SA 5A4TA 4OBOA 4O7YA 2XA4A 3O7LB 3MSSA 2XK9A 5F94A 4AN2A 3B8RA 2QOOA 4FZDB 3FMNA 4AW1A 4DBXA 1W98A 5AUWA 1YXXA 2JEDA 4BCJA 4DG3E 4ITHA 4J8NA 1URWA 2BFYA 2VTNA 4A06A 3TUBA 2E9UA 1KOAA 2YWVA 4FOBA 5CLPA 3CY2A 3TTJA 4AWIA 5EKNA 4E3CA 5K5XA 3AG9A 4V04A 4BTJA 2ITTA 4I21A 4JX3A 4KBAA 4D4RA 3O8PA 2XARA 2XZSA 1KE8A 5LMKA 4RJ6A 3SOCA 1OL2A 4JR7A 5EI8A 4ANOA 2VNWA 5ACKA 3OOMA 5JGDA 5AP4A 4AGDA 2XANA 3LKMA 3DQWA 2VZ6A 2W1IA 3H4JA 1PXJA 3HDNA 3M1SA 4GVAA 2R7IA 1Q5KA 2C47A 4QNYA 4PL3A 5AV4A 5H8EA 4TXCA 4D4VA 2ITPA 5AR3A 4YZCA 4J7BA 2ZDTA 3PLSA 3G33A 1DI8A 3COMA 4AZWA 1ZRZA 2VO6A 1JKKA 3GNIB 1WBPA 3MTFA 3QXPA 5IEVA 3U9CA 1UU3A 1R0PA 2WMQA 5K0KA 4YHJA 1XWSA 3E8CA 1ZAOA 3DZQA 3P78A 4FKSA 4ITJA 2JIUA 4X3FB 3VJNA 1KE6A 1JSUA 3QD0A 3ZHPC 2YJSA 4GG5A 3RM7A 4C59A 4AXAA 4U5JA 4HJOA 1G8SA 2WTVA 5FTGA 5EOBA 3ALNA 3PA5A 1ZWSA 4OLIA 2XS0A 4RZVA 4U45A 2PYWA 3PXFA 3R00A 4J71A 2PMIA 5LMKC 2G1TA 2YCQA 5ETFA 3CKXA 4IE9A 4AT3A 1OL6A 2XNEA 5G6VA 3UOJA 3BE2A 4EZ3A 3FYKX 3AD5A 3TXOA 3I81A 2Y6OA 5IQEA 3PIYA 4JR3A 5L3AA 3MH2A 4QP6A 3NVKI 3U4UA 2J0JA 3UNJA 4TPTA 3PXRA 4TYHB 5HX6A 3DK6A 3LFBA 3ORPA 4KA3A 1GOLA 3SV0A 4ZS0A 3UYSA 3OEZA 4IBMA 3O50A 4DT9A 3QRKA 1Z5MA 3NUPA 4LV8A 4HVGA 5HE1A 5KHWA 2YZAA 3IOPA 5AAFA 1IASA 3OUKA 4BCNA 5LWNA 5EI6A 4ZSJA 4CEGA 2C5VA 3ETAA 2V62A 3OG7A 3RI1A 3S4QA 4GT4A 4FT5A 4CV8A 4WT6A 3MA3A 5D1JA 1WVWA 4KSPA 4DEDA 3CS9A 4DEHA 2UW9A 3DDQA 3QQLA 4DG2E 3E92A 4R5SA 5C4KA 3MA6A 3BYMA 4HCTA 3RAIA 5HCYA 4XBRA 1OB3A 2PE2A 4PV0A 3DB6A 3HRBA 3KMWA 1I09A 3TIZA 3Q5ZA 4MD7E 3PPZA 4FSRA 1CKPA 4LGDA 2XNPA 4ZSAA 3HKOA 4X6RA 5I9UA 4EOIA 4FZAB 4QMTA 2Z7SA 2JDSA 3QUDA 5FGKA 3PSBA 1LR4A 3QUEA 2R64A 2G01A 1Y91A 5AP7A 2J9MA 4LGGA 2UZWE 3VS6A 3NIEA 2B9JA 2B9FA 2W4JA 3C4FA 2PZRA 3U54A 2QG5A 1ZOHA 4I5CA 3HMPA 1OGYA 2WQNA 3GT8A 5HD7A 3DK3A 4NEUA 3FKLA 1YHSA 2XP2A 3DFAA 3P4KA 3PP1A 3P5JC 3JS2A 1IAJA 4NTSA 2PUPA 4MWHA 1OKZA 3KB7A 5IMEA 3V8TA 3ZRLA 4MXYA 3WIGA 1J1BA 4WRGA 5CQUA 5A4EA 3R9RA 2BILB 4S30A 4C57A 4D4YA 3R7GA 4EYJA 5GHVA 1LUFA 3C4ZA 4BCIA 2BHHA 3W0SA 4E4XA 4MNEB 3BLHA 4RX7A 4ANBA 1V0PA 1W83A 3BHUA 2ETKA 2JBOA 3E64A 3BRBA 3Q9WA 3GQLA 4WUAA 4D2WA 4NKSA 4D2PA 2YLEA 4V0GB 3SOAA 3LFDA 2VTAA 4ANMA 4F08A 1FVTA 5DFPA 3BEAA 2GDOA 3WZUA 4DGMA 3QBNA 5HIDA 4EQCA 4I94A 3LFCA 3C51A 4FSYA 4FC0A 2Q0NA 3MYGA 4PP9A 4R3PA 4XRJA 2C6OA 2EB3A 2OJ9A 2Z7QA 4Z9LA 4OR5A 3O23A 3QGYA 5HESA 4IVBA 4U43A 1OKVA 2YITA 4G6LA 4FYOA 5TE0A 1WBVA 5M4FA 4UN0C 3HZTA 3RPSA 2C3JA 2WPAA 2WFYA 4R1VA 4WNPA 3NLBA 5J5SA 4BCHA 2R3PA 4WRSA 4HVDA 3GFEA 5AA8A 2XKFA 5M07A 3BWFA 3EH9A 3SKCA 5I9WA 3ORXA 2R5TA 3BYSA 3FQEA 5CTPA 3BQRA 4ASDA 3AC5A 2UW0A 2FSOX 4E6CA 4UXQA 3TKIA 4PPCA 3OMVA 2YCFA 4ZLYA 5IPJA 3AT4A 3UNKA 1YRPA 2NRYA 2R3QA 3QFVA 4GK3A 4M13A 5E8SA 5JZNA 5E92A 5JGBA 3UQCA 3A7IA 3W0RA 2FUMA 2DQ7X 2YIXA 3CBLA 1H25A 2GS7A 2X8EA 4MNFA 3MY0A 1B6CB 3UE4A 4YZNA 2PE0A 3KL8A 1Y8YA 1YKRA 1ZYSA 2AYPA 3C0HA 3NGAA 4G5JA 3QRIA 4XG9A 3VWAA 4A9SA 4IM3A 1H27A 1JPAA 4N70A 4WSQA 3WF6A 5J5TA 4DHZA 4TZRA 4DLJA 5M51A 4ZTLA 2GHLA 3LCDA 3VUKA 3O96A 2QQ7A 3NW6A 5IEXA 3CCNA 5AADA 4IC8A 3TCPA 3S1HA 4K11A 2VO7A 3DXQA 3QCQA 2VTOA 5TKDA 2XM9A 3IW5A 4FEUA 3TDVA 3N4UA 4ALVA 3LZBA 5HORA 5CSVA 4FTUA 3FDNA 4K18A 5EHOA 3IW8A 4DEBA 5AUXA 2R3NA 4YJQA 1XMLA 3QKMA 2XEYA 5HICA 4FKVA 4YJNA 4FKWA 2QOKA 2ZAZA 4MWIA 4R7HA 5CF5A 2C0OA 4RIYA 3EQIA 4DBNA 4RJ3A 5CAPA 1BL7A 5CEMA 3QQKA 1WBWA 2C0IA 4OT6A 4QP8A 1TZDA 3ZLWA 1TKIA 3UBDA 5AR7A 4DFYA 4C0TA 4F6UA 4YJPA 4B4LA 4MXOA 4AF3A 3EJ1A 4RIWB 2UW5A 4KKGA 4L68A 1H1QA 3R9OA 4ZSEA 2QKWB 4EI4A 4U97A 3FHIA 4CKJA 4I6HA 3COIA 4S31A 4IZAA 4WO5A 4RLKA 5AV3A 3BPRA 3KC3A 2YACA 3F5GA 4LFIA 4QMPA 3RZFA 4RT7A 3R83A 4EL9A 4BDFA 4DGNA 2X4ZA 3ODYX 4ZLZA 1OVEA 4PNIA 1G3NA 3QA0A 5LCKA 5D11A 2JDOA 5A4LA 4O0UA 3MH0A 2NPQA 5IMXA 3KF7A 4RX5A 4CCUA 4CZYB 1BUHA 4J98A 3R8PA 5IF1A 3CJGA 3FE3A 2QNJA 3QRUA 4AZSA 3ORZA 3EB0A 2CN5A 3VRYA 1R0EA 2CCIA 5D41A 3W2QA 4NZWB 4F7NA 1XBCA 2QCSA 2W05A 4S32A 3DLZA 3BL9A 4LV5A 5B2LA 3NVMB 3PE2A 4GUBA 4YNOA 1UNHA 1Y6AA 3R9DA 3KA0A 3UP7A 1T46A 4O0VA 3N4TA 4OTFA 4LV7A 3HEGA 4ENYA 3VO3A 5IG1A 3PJ1A 2VTSA 4EYMA 4PMMA 4C4IA 2ZB0A 5E8UA 5IQHA 3UVRA 3Q60A 5E7RA 3BL7A 4RQKA 3ZLXA 4TN6A 2OJJA 2C5NA 3MW1A 4JBQA 2WTKB 3DTWA 2ITVA 4X2FA 3PZHA 3ROCA 2X0PA 2JGZA 2YCRA 4F09A 2WZJA 3VS3A 3Q9XA 4FE2A 3NYNA 3LW0A 3OXIA 4PL5A 4HYIA 3FY0A 3MIYA 4IM2A 3EWHA 3UG1A 3VIDA 1XKKA 3CC6A 4Y85A 5C27A 4IAFA 4JXFA 2R3GA 3G9NA 4RWIA 2W1DA 4A4LA 3BKBA 4FKOA 3FLSA 3IKAA 1XQZA 3N51A 3QTIA 4I1ZA 5M4CA 3ZFYA 3IK3A 2LAVA 5JEBA 1JKTA 1W0XC 1F5QA 2HZNA 4UMQA 4RC4A 5EYCA 3PY1A 2EVAA 3QQFA 5M4IA 3KULB 3DA6A 3DJ6A 3KKVA 4J97A 1W2DA 4WBBB 5KKRB 5EM8A 1SMHA 1YWVA 4YSMA 3F6XA 2WOTA 1H0WA 5M53A 2UW6A 2WU6A 1ZOGA 3RCJA 3ZC6A 1KV1A 3CTQA 4EOPA 3UO4A 5HU3A 1OIRA 1H1WA 1OKYA 4USEA 2OZAB 3GEQA 4XP3A 5BX0A 4FK6A 4FSUA 3TEIA 1OPKA 4A9YA 1H4LA 2PZ5A 3DPKA 4FV5A 3DKCA 3FMHA 2OJIA 1UWHA 2O2UA 2OXXA 5HGIA 2YM4A 4O83A 1GIHA 2J0KA 2OXYA 1NXKA 2CPKE 3ANRA 1Q24A 3NS9A 4PF4A 4ZTRA 5FXSA 3SGCA 2BRNA 4E4MA 3RWPA 3PP0A 3EQBA 5CANA 5CEPA 2W1HA 2BZJA 5HOAA 2C5YA 4DH5A 4Q9ZA 3QD2B 1VYZA 4H3PA 4EJNA 2J51A 5E8WA 3R7IA 4FTOA 3NNVA 4RJ8A 1AGWA 3DFCB 4FV1A 4XG3A 3RMFA 3AT2A 4AFEA 3W0MA 4ZMFA 3E8EA 2CN8A 5FBOA 4ZJVA 1AD5A 3EKKA 4L43A 2WTIA 3P5KA 4ZAUA 5I9ZA 5AR8A 4H39A 2C3KA 3GC8A 3QALE 3V5LA 5DA3A 3ANQA 1R1WA 2Y4PA 3LCOA 4TWOA 1PXOA 2XIRA 3THBA 4QMQA 5HNIX 4NT4A 3G6GA 3EFJA 4FKIA 3KK8A 4J53A 2GS6A 2WMUA 3FBVA 2E9OA 3HP2A 4JAIA 4RSSA 4WD5A 3T8OA 3V8WA 3FI8A 3WZKA 4DFNA 5HO8A 5L2IA 3QXOA 3L8PA 3PUFC 3LCKA 1M52A 3MB6A 5CSPA 3QX2A 2GMXA 4F9YA 2WAJA 3GI3A 4K6ZA 4M15A 4GKHA 4XOZA 4XG7A 3OVVA 3QC9A 4L3LA 4CTCA 3A99A 5FBNC 2QOLA 4NIFB 5ANKA 4V05A 5JZJA 2F9GA 3P23A 3CEKA 4DFXE 2JDTA 4XV1A 3FEGA 3ZBFA 3PWDA 2IVTA 5DI1A 3G2FA 2R3LA 2W99B 3ACKA 5JK3A 3DS6A 4ZJJA 3DU8A 2PZIA 4X7QA 3FC1X 3DY7A 3PA3A 3QAME 3COHA 4GYGA 4HCVA 5CSXA 4GS6A 4X3FA 2P2IA 3T9TA 3ZDUA 4CSVA 5JFXA 2YM5A 2F49A 2XK8A 2ZDUA 5CT0A 2PVMA 4U44A 3ZUVA 3QD3A 3RP9A 4OTPA 1URCA 3MBLA 5E8XA 4Y5HA 2V7OA 3VS1A 2R9SA 3KK9A 4FEQA 3WF5A 3QYWA 4HVHA 3C4EA 5LVOA 4LUEA 2BTRA 4P5QA 2GCDA 1YWNA 5KMIA 4QP1A 3ZXTA 4L00A 5AUTA 4F9BA 5K5NA 4O7VA 3KVXA 2GQGA 1LP4A 5KZIA 4NW6A 3NNXA 4HYSA 1OBDA 1PW2A 3R8LA 5DN3A 4Z3VA 4FTJA 2WTWA 3P86A 4A07A 3IONA 3G9LX 3OS3A 3VQUA 3NYVA 2WU7A 4U3ZA 5HU9A 3K2LA 5L6OA 4XYFA 5IKWA 3IW4A 4YTCA 2W5HA 2HXQA 4IB3A 4FZ6A 5CASA 2XIXA 1CTPE 1FVVA 1ATPE 1B39A 2GNJA 4IMYA 1WMKA 2PVRA 4FZ7A 3GCUA 3M42A 4G3EA 5JRSA 4FNYA 3QZIA 4FRFA 1E1VA 2XJ0A 4LRKA 2I7QA 3KF4A 1M17A 2HWOA 4LRJA 3HMNA 2QO7A 2A1AB 2I1MA 1U54B 2R3RA 4JDJA 3CSVA 3QTWA 2F57A 5HG5A 2YIRA 4AGCA 4QYFA 3FY2A 4ACDA 1ZMWA 3KGAA 3FSFA 4WG4A 2UZUE 3PXQA 3OD6X 2EU9A 3DBCA 4F7SA 3NAYA 4AOTA 5JFSA 3ZSIA 3NX8A 5EOLA 3W10A 4BI0A 4EK5A 1PKGA 3CQUA 2BAQA 3LMGA 4W8EA 4JNWA 5EYKA 4W4VA 3G90X 3ZCLA 5AUUA 3LMHA 3VS7A 4MH7A 3WF8A 4KIKA 3TDWA 1Q99A 3DXNA 3NPCA 3ORTA 4EQUA 5IQIA 3QA8A 1WBSA 3NFFB 4IWPA 4NM5A 3GCQA 2PVKA 2XVDA 4FUYA 1ERKA 4ASEA 5A14A 1J91A 3BHHA 3KRWA 3GBZA 5DRDA 4I3ZA 3H10A 3U8WA 4G9CA 2EB2A 3EQDA 3UIXA 4CLIA 4GRBA 4M69B 5KMJA 2ZMDA 4RLLA 5ANGA 3FL4A 1EH4A 4BDEA 3BE9A 5GZAA 3LXLA 3ZM9A 5HNGA 2BRGA 3AMYA 3LHJA 4GFOA 1OIUA 2JFLA 3MFUA 1CDKA 4I92A 3AC8A 4U7ZA 3SLSA 4BCMA 4G16A 4AG8A 5ETAA 3EKNA 1JVPP 2NYAA 3CY3A 2CHLA 3MPTA 3FZRA 3WBLA 3ORIA 3RGFA 2XALA 2IZRA 2ZOQA 5H9BA 3AC2A 4ZXTA 4OAVB 4Y95A 3FSKA 1YDTE 2OK1A 4GCJA 2X0QA 3GCPA 3SHEA 5JT2A 2HAKA 4D1SA 3FL5A 2QURA 5H8BA 3W32A 4L46A 4QDEA 2GS2A 5BQ0A 1T45A 4QMSA 2O8YA 4V0GA 3D2KA 2UZEA 4JG6A 4PDSA 3R7EA 3VBWA 3VUMA 4O2ZA 3WZEA 1YHVA 5AM7A 3OCTA 2Y4IC 5IDPA 1J7UA 1H8FA 1PJKA 1MRUA 5E8TA 4IHPA 2CLQA 4QRCA 3V8SA 2X7FA 3QKKA 4BRXA 4BDBA 1H01A 3QHRA 4Z55A 2EXCX 3ZO4A 3PVBA 3T3UA 2BZKB 2WMBA 1M7NA 4E1ZA 4O4EA 1QPJA 2WEVA 4TRLA 4Y46A 2LGCA 4ZTHA 2RFNA 3KRJA 3OY3A 3QRTA 2IN6A 3PPJA 3NUSA 5CY3A 1VYWA 3W2RA 4FSWA 4F6WA 4YSJA 5DEWA 4IVAA 5GJGA 2V5QA 3OXZA 5HTCA 3ZZEA 4OT5A 4DA5A 3MPMA 2CKPA 3IW6A 3HV6A 3OP5A 3R2YA 3AD4A 3V5PA 2PY3A 3O51A 3TKUA 3LOKA 3QYZA 3JXWA 4NSTA 5DIAA 2X2LA 3ZYAA 2RSVA 2IF8A 3FMKA 2O3PA 2QLUA 2XF0A 3SXRA 4ACCA 2NNWB 4JIAA 2WMAA 2YDKA 3FMEA 4HYHA 4FVQA 2WIHA 3HECA 2YLFA 4NFMA 3O5AA 1Q41A 4U8ZA 3Q2MA 4M66A 2R3HA 3BLRA 3QD4A 5M55A 4D2TA 2VWBA 3LLTA 4K0YA 2PMLX 3KRRA 5C01A 4BDHA 1UVRA 2XJ2A 4KIQA 4DH7A 1YXTA 3C50A 1G8JA 4O91A 4YJVA 3ZS5A 1UU8A 3FXXA