4DC2A

Structure of pkc in complex with a substrate peptide from par-3
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
339
structure length
328
Chain Sequence
LGLQDFDLLRVIGRGSYAKVLLVRLKKTDRIYAMRVVKKELVNIDWVQTEKHVFEQASNHPFLVGLHSCFQTESRLFFVIEYVNGGDLMFHMQRQRKLPEEHARFYSAEISLALNYLHERGIIYRDLKLDNVLLDSEGHIKLTDYGMCKEGLRPGDTTSTFCGTPNYIAPEILRGEDYGFSVDWWALGVLMFEMMAGRSPFDIVGSNTEDYLFQVILEKQIRIPRSLSVKAASVLKSFLNKDPKERLGCHPQTGFADIQGHPFFRNVDWDMMEQKQVVPPFKPNISGEFGLDNFDSQFTNEPVQLPDDDDIVRKIDQSEFEGFEYINP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Substrate recognition mechanism of atypical protein kinase Cs revealed by the structure of PKC iota in complex with a substrate peptide from Par-3
pubmed doi rcsb
source organism Mus musculus
molecule tags Transferase/transferase substrate
molecule keywords Protein kinase C iota type
total genus 96
structure length 328
sequence length 339
ec nomenclature ec 2.7.11.13: Protein kinase C.
pdb deposition date 2012-01-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
A PF00433 Pkinase_C Protein kinase C terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4dc2A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4dc2A01
3R7GA 3ENHA 3KKVA 4O0UA 2OJFE 5LCKA 3V5QA 4R7IA 3KRJA 3PZEA 1WBTA 4IM0A 4XG8A 3TNPC 4V0GB 2GTMA 4LL5A 4EH3A 4YP8A 2C6LA 3MY5A 4FUXA 5I4NA 5KKRC 2CMWA 4O7LA 4BDDA 1QPCA 2EUFB 2F4JA 1OL5A 3OWPA 2E2BA 5CLPA 1ZY5A 3QCSA 1MQBA 1QCFA 4EWQA 1GY3A 3NUXA 4BGHA 4EOPA 3F3TA 2X0GA 2UZOA 4RT7A 1FGKA 4Y5QA 2CJMA 5TKDA 2UVXA 2YM3A 4YJUA 2RF9A 5CU0A 5IQCA 2BCJA 2XBAA 3ZS5A 3LFAA 4L42A 4DGGA 4CGAA 4UWCA 4K8AA 3AG9A 4OTFA 1RQQA 3N9XA 4A07A 4FG9A 4EYJA 2PWLA 1G8AA 2YLEA 1PHKA 1SM2A 3BHTA 2QCSA 3CLYA 4X6QC 3C4EA 3R83A 4C02A 3D94A 4GK2A 2G01A 1UNLA 5EDQA 1BLXA 3OT8A 3EFJA 4F63A 4HCUA 5ITAA 3MA3A 5HESA 4I4EA 1CSNA 4QMWA 2Z7RA 3GP0A 3ORTA 3FMLA 3N4UA 4ITHA 4RC4A 4QMMA 2Y9QA 4JDIA 4EQUA 2C6MA 2RFEA 4S34A 4C4IA 3CQUA 1W83A 4R78A 3LFDA 4EUTA 5LVMA 4CD0A 4GH2A 3AC4A 4X21A 1WVWA 4C37A 3SG9A 5IH5A 3NPCA 4G3GA 2PVNA 4BDJA 4KSQA 3KFAA 3RM6A 2GNJA 1HCLA 3U55A 3RNYA 1JKKA 4TNDA 4HCTA 4FTNA 3TJCA 2C5NA 3COMA 3HRBA 4I20A 4IM3A 5EDRA 3I6UA 4BCIA 4MXYA 4E20A 4FKOA 3PSBA 4MNFA 4S31A 2BILB 4IX5A 2YM5A 4FT5A 3O8PA 1QPEA 3LXLA 3L8XA 1YXXA 4O82A 4OR5A 4IAFA 5HG7A 5IH6A 5AAEA 4IVAA 3FPMA 2WFYA 4UZHA 1OGUA 3AXWA 1XR1A 3PPKA 2YABA 2EVAA 4XRJA 1BX6A 4EK3A 2OI4X 1MQ4A 4N6ZA 5IEXA 4YJNA 3POZA 4GT3A 2Z02A 3ZZEA 4QT1A 4TYJA 3LXKA 4OTDA 5L2TA 4HVGA 3ELJA 3CTJA 3Q4UA 4D2SA 5CF4A 1H0VA 1NVRA 1Y6AA 5KBRA 3Q52A 1ZWSA 1V0OA 2HZIA 4PNKA 3QCYA 2JIVA 2BDFA 4L45A 4U3YA 1JBPE 3BX5A 3QQHA 3R8ZA 1DAYA 2GHLA 4LMNA 4L00A 4FEWA 3A61A 3O2MA 4CSVA 2QOBA 3S4QA 3PPJA 4AZEA 4M69A 4YSJA 4MF0A 2C6DA 2R3QA 1XH7A 5AP3A 1FBNA 4RX8A 3R63A 2GCDA 4WG4A 3VBXA 3ZOSA 1R1WA 4TYEA 5E8SA 3FL4A 4BDKA 4JRNA 2WHBA 2GNFA 4O22A 5I3OA 4ASEA 1OECA 4AQCA 1YOMA 4RFMA 3UVPA 4BDGA 4BI1A 1YHWA 4BVUA 4QTEA 3QL8A 4I23A 3F7ZA 3DBEA 4DG3E 1H27A 3FE3A 1NY3A 5AP4A 3A7IA 1H8FA 3CD8A 4DGLC 2BTRA 4QMTA 2PMIA 3ZUTA 4CRSA 3OUKA 1REJA 3UMWA 4LYNA 5C8NA 2E9NA 4PUZA 3LXNA 4DEHA 5FGKA 4C4JA 2B7AA 4UXLA 3R00A 2R3IA 1YVJA 2QR8A 3C9WA 1H00A 3AGLA 2F9GA 3VAPA 3MIAA 4FTQA 5CYIA 3VRYA 2FH9A 2RFNA 1NT2A 3FMJA 4D4SA 1FVTA 4LM5A 4M69B 1F5QA 5L8LA 1AGWA 3D4QA 3ULIA 2FSLX 2WB8A 4AFEA 2LGCA 4YZNA 1Q8YA 3WARA 2X4ZA 4GSBA 5D41A 3R1YA 4XV2A 1QMZA 2WO6A 4H36A 5I9UA 4MWHA 2W17A 4ERWA 4GJ2A 4PP7A 3TM0A 4RIYA 4FV2A 3EYHA 3BBWA 4MTAA 3E92A 2ITPA 4WA9A 3WF6A 4AGDA 4BF2A 4D0WA 2J50A 3GCQA 3UIBA 3JYAA 4CEGA 3FYKX 3SKCA 1R78A 3F3UA 2OF4A 3F9NA 3FQHA 3OVVA 3R6XA 2WQBA 3BHVA 3CR0A 4IB3A 2WTJA 3SXRA 2G2IA 3BI6A 5AP0A 4IB0A 2WIHA 3R7YA 2VTIA 3ZTXA 4XLVA 3BWFA 5HIBA 3BV3A 3KC3A 1M17A 4C36A 5C26A 4IQ6A 5C8KA 5AJQA 2FO0A 3KY2A 5HBHA 5F95A 3W16A 3NUAA 4F9WA 3OT3A 3QYWA 3W2RA 4RIYB 3L9MA 4OTQA 3PYYA 3VW6A 5IZFA 4K9YA 4GK4A 5KMNA 4YNOA 3SXFA 3P4KA 1OPJA 3K5VA 5BNJA 4PDPA 3V01A 1JKTA 3PG1A 2JC6A 3UC4A 4EQMA 3BU6A 3LFFA 4XYFA 2QC6A 2X2LA 3QWJA 1W98A 2XK8A 4JDKA 2WMWA 2DQ7X 2F2CB 2R0IA 4AZTA 2QLUA 5BUIA 4FZ7A 5E9EA 1XBCA 2VWUA 2WGJA 4XEYA 2WMQA 5E92A 4M12A 4NJDA 4JG7A 4YJPA 5HG5A 3D83A 3QZHA 4CVAA 2QOLA 4R8QA 1WBNA 1TVOA 4U42A 3DV3A 4BDCA 3EQPA 3EYGA 2GSFA 4RFYA 3RNIA 4E3CA 4RZWA 2BIYA 4YTFA 1ZY4A 3F3WA 2GQRA 1IA9A 3MV5A 4L52A 3ZONA 2JBPA 4V0GA 4TWPA 4KIKA 5HVJA 1OUKA 5T3QA 4DFUA 1DI8A 3TUBA 4NM5A 2X4FA 2O8YA 2OXDA 3GC7A 4QMNA 2E9UA 4J53A 3C5UA 2O0UA 4EONA 3FY0A 3UOLA 5LCJA 2PZIA 2YCQA 2VTAA 4IWQA 3OC1A 4JQ8A 4QRCA 3R7EA 5EW9A 1JWHA 3QBNA 3FJQE 3NNWA 4MWIA 5J87A 5GJDA 1SZMA 4ZAUA 4I0SA 2A0CX 5KMIA 4O0XA 5TF9A 3OS3A 4FNWA 4QTDA 3GQLA 1JKLA 1WBVA 4AU8A 4O83A 2I0YA 4OAVB 5DEWA 4C0TA 3KRLA 3SC1A 2QI8A 4CLIA 4XV3A 2QNJA 2UVZA 2WTVA 4BYJA 3R1NA 5J8IA 1W84A 4PL3A 1Z57A 2V5QA 4NUSA 5E7RA 4UMRA 2R3JA 3ODZX 4L7SA 5FEQA 3BGPA 4QPMA 2PVLA 1KWPA 3BHUA 2QD9A 3QUPA 4FTCA 4IFCA 4ARKA 2GS2A 2Y4PA 5CSXA 2WOTA 4X2KA 1Q24A 5CASA 5EW3A 1YWVA 3BYOA 2BKKA 3D5VA 2J2IB 3H9FA 4EOJA 2C69A 2A19B 2XIYA 1URCA 3D2IA 4DLJA 5C4LA 3UVQA 2JFMA 3MGYA 1WBPA 2IW6A 3NW7A 1GIIA 4IANA 4PL5A 4Y72A 4APCA 3T8OA 3QQUA 3QRJA 4XS2A 3RP9A 2J7TA 3Q9YA 4BTMA 4GT5A 4F9CA 3PWYA 4X3FA 5L6OA 3MPTA 3QZIA 2UZUE 3DB6A 2EXMA 4FNYA 3SRVB 1OL2A 2HZ0A 3RBWA 3E62A 2UVYA 4AA5A 5CZHA 2YHVA 4C38A 3D5WA 2R4BA 5EHOA 2PMNX 3UQGA 2BRNA 3G33A 2PK9A 4DEDA 3RWQA 1W0XC 5BYZA 2C5XA 4GIIA 5EM8A 1OMWA 4EHGA 2A2AA 3ORMA 2HXQA 2ZMDA 3WYYA 3BQCA 3LFQA 2YIWA 3PVGA 2ITVA 4O27B 4YHTA 4LMUA 5I5ZA 5D10A 3FXWA 2YACA 2CPKE 4IWDA 3L1SA 3CGOA 4B8LA 2ZDUA 4KBAA 4BBMA 3QA0A 3WYXA 2JAMA 4UX9A 4KIKB 2YEXA 5F1ZA 1JLUE 3PY1A 2GMXA 3QKLA 4QYGA 4BBFA 4OT6A 1Y57A 4U45A 4FZDB 3KN6A 5CTPA 5H2UA 3UDBA 2XNPA 3MFTA 3ZDIA 3V5PA 3PXZA 3OY1A 3VUHA 2NRYA 4CT2A 3PXRA 2WZJA 4NW6A 3W2SA 3RM7A 3R30A 3I7CA 4ZTSA 2R0UA 4ZSEA 3QTWA 4JAIA 3TNHA 3CIKA 4FT0A 4YURA 2PPQA 3BLRA 2W06A 2ITTA 3C51A 2R7BA 3KXGA 3UQFA 4L68A 3OBGA 3KREA 2FB8A 5HO6A 1YI4A 1L3RE 2JGZA 4JR3A 4C3FA 2F2UA 4GFMA 4Z16A 2VX3A 4K18A 3I5ZA 5B2KA 1IAJA 3U6JA 4NTSA 5K4JA 4RJ4A 4I0TA 5BUEA 2VWWA 1R3CA 3PVWA 4XBUA 5CAVA 4X7QA 5L3AA 5EDPA 3O7LD 3V6SA 4PPCA 2XNGA 3PJ3A 4JDJA 4RJ8A 4RWJA 4CZTA 3QRTA 5IUHA 3LOKA 4J95A 4UMTA 2CN8A 2IWIA 4TN6A 3LQ8A 3RGFA 4ZY4A 3Q9ZA 2RG6A 4HJOA 4R3PA 1GZOA 4HNIA 4FKTA 5JFSA 1A48A 2BAKA 2XBJA 4ZSGA 4GVAA 2PYWA 1ZMWA 4EHEA 3JXWA 4C3PA 3VS4A 1KE5A 3UBDA 2VTPA 3MPMA 4R3CA 3CTHA 4KKEA 4IC8A 4O2PA 4YHJA 4ZSJA 4M0YA 3QD2B 1RE8A 4DTBA 2IVUA 1YXUA 3FLSA 4NWMA 4RIWA 5CEMA 3G0EA 4AZSA 5HICA 2JFLA 2GNGA 4AZWA 5AP7A 3HA8A 1LEZA 4MNEB 5KZ0A 5ANIA 3DTWA 5B2LA 3QD3A 2CKQA 2HK5A 2VTMA 3GXLA 1QPJA 2EXCX 2WU6A 3ULZA 3H9RA 3SV0A 3FUPA 1PMVA 2J0JA 3MY0A 4BCOA 3AMBA 1JQHA 3SOCA 1JAMA 2ZMCA 3LJ1A 4NEUA 3BLHA 2XVDA 4ZMEA 2HWOA 1YXSA 4ALUA 5KMMA 1J91A 2ITOA 3FLQA 3DJ5A 5C27A 4EC9A 5E8ZA 4F7SA 2IVVA 3IDCA 3OXIA 2YN8A 4JBOA 4FT7A 2HCKA 3OCGA 3A7HA 2A27A 2VGPA 3V3VA 5IEYA 3C7QA 2PUUA 1FOTA 1OUYA 3NIEA 5LVLA 4EBVA 4ZZNA 4G6LA 5FDXA 2OLCA 3DU8A 3EB0A 1LP4A 4BFMA 5AUUA 4L3JA 3FHRA 3JVSA 4B7TA 5AADA 3S1HA 4MXCA 4UMUA 4FEUA 2H96A 5CX9A 3AD5A 3HZTA 2Y4IB 4RVTA 3DKOA 3ENMA 2P0CA 3MN3A 3E93A 4GUBA 4MBIA 1FMOE 1XQZA 2RL5A 3C4CA 3Q96A 4G3CA 2HY81 2R9SA 3D2KA 2V22A 2WMUA 2ZOQA 3SW4A 5AR5A 3U4WA 3ZSHA 3QRKA 4JG6A 3MFRA 3NZ0A 4FF8A 4AN9A 2JIUA 2FSTX 4QMXA 4PTGA 4WSQA 4F9YA 2WMAA 2J0KA 2DYLA 5C03A 4FTRA 5IMXA 2PY3A 4U44A 2XK7A 2OFUA 1XHAA 3ZM4A 4TYHB 5CALA 3BGZA 1H1SA 5E8WA 3G90X 4UWBA 1WMKA 4DEAA 4QOXA 5BMSA 4OGRA 4YHFA 5C9CA 4DG2E 4FE2A 3KB7A 3WI6A 4ZTMA 4QYYA 1Q99A 2PVHA 3MVHA 4P2KA 1OIQA 2OJIA 4J7BA 4ZTRA 3D7TB 4Y85A 3Q2MA 4OLIA 3QRUA 3SXSA 3ATTA 4I6QA 4R7HA 1ZMVA 5DEYA 5CXZA 4A9YA 3QXPA 2W5BA 4OBQA 4PTCA 3PJ8A 4IJ9A 3NWWA 4X3FC 4PV0A 5HNGA 4E4LA 4TYGA 1FMKA 5E8YA 5AUXA 3UNJA 2B54A 2YZLA 4DH8A 3LCOA 3ORZA 4MAOA 3WF5A 5AIKA 2WMVA 3LM5A 5L8KA 3BHYA 3IDPA 4LG4A 4O0WA 1A06A 3KMMA 4RWIA 2W96B 4BB4A 4W4VA 4O1PA 2ZYBA 4I24A 3QX4A 2XMYA 2OIBA 2OGVA 5IDPA 3VN9A 3BBTB 3Q60A 3TKUA 4IVBA 3POOA 4JIAA 4WRSA 4FT9A 1ZOHA 2DS1A 4ITJA 2BFXA 3SOAA 3TCPA 3T9TA 3UPXA 4HZRA 4FV3A 3GQIA 5H8EA 2ITWA 3RTPA 4DYMA 4F6UA 4CZYB 4DTKA 2VU3A 4BDHA 3A99A 4PMPA 4KBKA 4U80A 4GYGA 3BYMA 3DFAA 4XG3A 5HTIA 1QPDA 4O7WA 5I9YA 1PJKA 3IPHA 2WMSA 3QQGA 3QQKA 3WIGA 3ZXTA 1ZRZA 4R1VA 3LCDA 4RJ7A 2WEIA 4JAJA 4YZMA 3W2PA 4JBVA 4J52A 3JY9A 5AA9A 2O64A 4ZP5A 5D9HA 3UG1A 4QQJA 3OFMA 4F70A 5AUVA 3SD0A 1Z5MA 4K1BA 5IA2A 2NNWB 4G3DA 4QMYA 4F64A 1PXKA 2PMOX 1E1VA 3QTIA 5A4TA 4FC0A 3ZBFA 1GAGA 3U51A 5DT3A 3GCPA 4PMMA 4L67A 4U0IA 3ROCA 1FINA 3E8EA 2X8EA 2RFDA 4FIIA 4IVDA 5FRIA 2BROA 4FSZA 3DQXA 5BUJA 1M14A 3F5XA 1WBSA 2CGWA 3HMOA 3KU2A 4IB1A 4IW0A 4RJ6A 3DBCA 5JGAA 2JAVA 3NNUA 4LGHA 4HVHA 4ZXTA 1I09A 2EU9A 4GU9A 4UBAA 4FR4A 4ANLA 1YXVA 4XMOA 5A3XA 3LMHA 5FD2A 4RX9A 4DCAA 2QOCA 4RLKA 3UIUA 5F9EA 5BX0A 4MXXA 4XH6A 4DG0E 3QWKA 3DZOA 1H01A 1RW8A 1O9UA 3DZQA 4JI9A 4MQ2A 5CI6A 3VBVA 5BVNA 5KKRB 3CEKA 3HDNA 5KHWA 3ZDUA 5L2SA 5HI2A 1DAWA 4GEOA 4IE9A 5DH3A 4FTKA 5E1SA 3V8TA 4P5ZA 3EL8A 5ANJA 5M4CA 3DKFA 3CQEA 1Q41A 1U54A 1AQ1A 3A8WA 5CWZA 3NS9A 1XH4A 5DGZA 3SRVA 5FLFA 4DFZE 4UYNA 5CAUA 2ZDTA 3DK7A 2DWBA 5FWKK 3IONA 2C5OA 4NCTC 5F4NA 3FZSA 2FSOX 2FUMA 3LJ0A 3SLSA 1YDSE 4NK9A 4HYSA 2AC3A 3VQUA 2ZV8A 1R39A 3MJ1A 3RKBA 2OH0E 4J1RA 1U54B 3F66A 4XUFA 2CN5A 2G9XA 3KVXA 3O71A 3CTQA 3TACA 4NKSA 4CLJA 2EXEA 5DHJA 4ANQA 2RKUA 3UZTA 1H1WA 3WZUA 4USEA 3SW7A 2W4KA 3E7VA 4XG2A 4XJ0A 3R01A 4HYIA 4EKKA 2VWBA 3OMVA 2XNOA 4PDSA 5CZIA 3V5JA 3KMWA 5M44A 3HP2A 3PIZA 3R9OA 4DE4A 3TZ9A 2VO6A 2YAKA 3C4XA 3ACJA 4H39A 4FVQA 5M4FA 2BRMA 3PA3A 4J71A 3TT0A 3ZO2A 1WBWA 1JVPP 4WNPA 1CKJA 1JSTA 1W7HA 4C33A 5K4IA 5DVRA 3TWJA 3UOJA 2Q0NA 2C3LA 4FKVA 4O21A 2V55A 3FLWA 2IZTA 3OBJA 4GRBA 5D12A 5ACKA 3CP9A 3MESA 3U54A 2W5AA 4XCUA 3IW7A 4G9CA 2GFCA 3RHXA 4RSSA 4D4RA 4L44A 5HCYA 4KSPA 1H24A 1PMEA 4JX3A 4M66A 5GNKA 2QQ7A 3DK6A 3IW6A 5AUWA 4CFUA 4KINA 3ZEPA 4A4XA 4D58A 3IKAA 2C1BA 4BDBA 5AP1A 4A9SA 2WMXA 3FZ1A 2OG8A 4QMQA 4ASDA 3F2NA 4PDOA 3KL8A 4WUAA 5HE1A 2IZSA 1RJBA 1XJDA 4NKAA 4I0RA 4YC8A 5AM7A 4UN0C 2XZSA 3P7AA 3UNZA 1Q8TA 2GHGA 1V1KA 4K2RA 4BDIA 5EFQA 5BYYA 3Q4CA 4I6HA 2PVRA 3ZRKA 3NCGA 3LFBA 4C7TA 3VULA 3CC6A 3A7GA 3FMNA 2VX0A 5HG9A 3HAMA 5KE0A 3PY3A 4CQEA 3CY3A 4YGAA 4O6LA 2Z7QA 3DAJA 3MW1A 5DBXA 3DK3A 4O7YA 1R0PA 5DI1A 4MXAA 4EEVA 4DBXA 4YO6A 5AR3A 2BKZA 4C8BA 4IM2A 1H0WA 2Q0BA 3EFWA 4FV6A 3PTGA 5HOAA 4PY1A 2XK3A 4IAKA 4ZY6A 5LVPA 2P55A 2R3OA 5DYJA 3L9LA 5DRDA 2JD5A 2ONLA 4OTRA 4MCVA 3ITZA 3R71A 4QMUA 3UG2A 2QKWB 3NUYA 3GI3A 2XA4A 3VUIA 5LJJA 3KN5A 3DDPA 4FKSA 3HKOA 3ANQA 5CQUA 3VUGA 4CQGA 2BVAA 5CEQA 2PMLX 3RJCA 3DNEA 4IXPA 2XM9A 5AP6A 4W8EA 4LQMA 4U81A 2W1CA 4TYHA 1WBOA 3ANRA 4F1OA 5CVGA 5IQEA 2Y0AA 5CEIA 3R22A 4E4MA 3S00A 4F1TA 5BVKA 2HELA 1PW2A 4DFLA 5DR2A 2PL0A 3QCQA 4UV0A 2O65A 2LAVA 5IQGA 3LPBA 4M0ZA 1AD5A 2ZJWA 3IOPA 4MX9A 4G16A 3VW8A 4E6CA 4I5HA 4S33A 1ND4A 3E64A 5CSHA 1UNGA 3TL8A 4M97A 5FEDA 3FZPA 3PIXA 3U4UA 2HW6A 2QG7A 5JK3A 4S32A 4EJ7A 3PXFA 4B0GA 3TUDA 4AW5A 5H8BA 3L8SA 5JMSA 2J5FA 4G34A 5L4QA 3SHEA 5KO1A 2JLDA 3R7IA 4DITA 3FQSA 2VV9A 3TV4A 1H26A 4AT3A 4FSYA 3EZVA 2I6LA 4M7IA 4AN3A 4C4GA 5DA3A 3E3PA 4RJ5A 3FI8A 3VBYA 1OB3A 1B38A 2C4GA 2CHLA 4OAUC 4K11A 2AYPA 4H1JA 3LIJA 3EZRA 4OTHA 3ZC5A 4OBOA 4ALVA 4PL4A 2C1AA 2OXXA 3VS1A 1OBDA 1FVVA 1YW2A 4UZDA 4EOIA 2GHMA 3HL7A 3OEFX 4AW0A 4O7NA 2WTCA 4MHAA 5K5XA 1S9IA 3E8CA 3R8LA 2ZM4A 4IX4A 5J79A 3GUBA 4TNBA 2X2KA 4O38A 4RVKA 2J5EA 4HNFA 3GU5A 4FGRA 3IG7A 3EJ1A 3H0YA 1YKRA 4IAZA 4NCTA 2FA2A 4NM3A 3UGCA 1T45A 4HPUE 1BL7A 2VRXA 2UW4A 4L9IA 3LMGA 3O23A 3VBWA 4AUAA 4A4OA 4IIRA 3AT2A 4AZVA 3P9JA 1CDKA 2UZNA 4WT6A 3K2LA 1OKVA 5GZAA 3FWQA 3EL7A 4B4LA 1X8BA 3LFNA 5HG8A 2R5TA 2XIRA 2CSNA 2XIKA 3PLSA 3ZUVA 4AW2A 3C5IA 2NRUA 5JRSA 3VJOA 2HXLA 2XCKA 4IWPA 4M8TA 5EM6A 5M4UA 4O96A 4WRGA 2ZV9A 4I22A 2X7GA 1P14A 3K3IA 4UB7A 2W0JA 3D5XA 4DBNA 1YHVA 4F4PA 5J7BA 2H34A 2YDJA 3DQWA 1UA2A 4DC2A 1A9UA 4RC2A 5FEEA 4I5MA 2PE1A 2BZIB 4IB5A 3VWAA 5CEPA 2QU5A 3S0OA 3CPCA 3DT1A 3F2AA 4BZOA 4Y8DA 5H3QA 1JSUA 3QTSA 4NL0A 5JQ5A 1WVXA 3EKNA 2BZJA 4FNZA 1G3NA 2AC5A 2W1EA 4Y83A 2OSCA 4W9XA 3VHEA 2VTHA 4J98A 4DT8A 4EUUA 3QAME 2QOHA 2UW5A 1FGIA 2IJMA 3ALNA 2V62A 2YM6A 3BCEA 3K3JA 4DEBA 2YJRA 3FKLA 4TY1A 3V5LA 2GNHA 4RFZA 4E8AA 3ATSA 3C0IA 4N6YA 3QYZA 3KA0A 3Q3BA 5TT7A 2GPHA 2ERKA 3DGKA 1XH8A 5GJFA 3OWLA 3NDMA 4D1XA 1Q8ZA 3BLQA 3M1SA 4FBXA 4HGLA 5JFXA 5JEBA 1U5QA 2AUHA 2O5KA 3DBDA 3II5A 3P1AA 4I94A 2WNTA 4EZ5A 4YU2A 3NVKI 5EW8A 4D2PA 2CNUA 3R9RA 4OTIA 5JSMA 3PVBA 3TNIA 3VQHA 1WZYA 3QKKA 2W1HA 1DI9A 1Q97A 2OICA 4GK3A 4EOQA 5FM3A 5C01A 4IAAA 2CGVA 4XP0A 3NYXA 3F61A 4YMJA 4RQVA 2C6OA 2OO8X 3MB7A 2HZNA 3LJ2A 2BZHB 4H3BA 5DR6A 4U6RA 3UIMA 4FTAA 1SMHA 2XEYA 2IW9A 5IA5A 4BCPA 4AGWA 3VS5A 1FPUA 4BGQA 3A7FA 3CJFA 3HUCA 3GCVA 4GMYA 4X3FB 3IOKA 5M4IA 4H3QA 4QP6A 5DG5A 3KRRA 1PXPA 5FBOA 3MBLA 5KNJA 2ONLC 1PF8A 1J7LA 1O6KA 4CV8A 4TPTA 3P0MA 4EC8A 2WPAA 5E4HA 4CCBA 4KKHA 3VHKA 4YPDA 3PWDA 4ZJJA 3AQVA 4YLJA 5I9VA 3PP0A 5TE0A 2XCHA 3HYHA 1KV2A 2PUNA 4N70A 1JKSA 3LQ3A 2XEZA 1Q62A 2WTKC 3KULB 2PHKA 3EQBA 3Q5IA 4XG4A 3SDJA 4QYEA 4RQKA 1P4FA 4D1SA 3ACKA 4EL9A 3WIKA 1F3MC 3QLFA 1YQJA 4IAYA 5CQWA 3ZLWA 3ZO4A 4QMPA 4BTJA 4D2VA 1M2RA 4HGSA 5J95A 4R7BA 1YDTE 3C4ZA 1OKZA 1ZYCA 3GBZA 4IX6A 4QQCA 4W8DA 3NYOA 2WKMA 4FL3A 4W9WA 4XOYA 2EWAA 3Q04A 1YWRA 1IR3A 2B9IA 4ITIA 3UZPA 3U6HA 5BYLA 3LMIA 1WAKA 5DPVA 2V0DA 4Y95A 2BDWA 4UWYA 2XM8A 2X6EA 2GNLA 5D7VA 4A9RA 4KIQA 4XV9A 5DMZA 4X2GA 3Q5ZA 4L3LA 3WZKA 3JPVA 5EI2A 5AIRA 5KZIA 4NW5A 4EH4A 5CENA 5A4LA 2JDOA 4EORA 3KCKA 1OIRA 4ZSAA 4XP2A 4BIBA 3OTUA 5EQPA 3DOGA 3OUNB 1H4LA 4R5YA 3FV8A 2W9FB 3GU7A 3MVLA 4QP1A 4CTCA 2YDIA 3EQHA 4O86A 4J8NA 3TKHA 1PYXA 4EHVA 2B0QA 3D15A 4QP2A 4EH2A 4IFGA 4NM0A 3GFEA 3RAWA 3JR1A 4JQEA 2QO7A 4CKIA 3P79A 5B2MA 3CSVA 3TNWA 4IVCA 4XX9A 3CXWA 2WOUA 5IQAA 4IADA 2CKEA 3NLBA 3EKKA 3VUMA 5AP2A 5C8MA 4C4FA 3FMEA 1QL6A 3IGGA 3PZHA 4F1MA 3BGQA 4FTLA 3HEGA 4R6VA 1KE8A 5ANDA 1NW1A 4KS7A 4K33A 1PKGA 2PZ5A 3CCNA 1DM2A 4KIOA 4LUDA 2ETMA 3OY3A 4RIXA 4AW1A 4F0IA 5L8JA 4HVDA 4FSWA 5M57A 4ZS4A 5CU4A 2QOIA 4D4YA 3G6HA 1OI9A 1PXNA 4WIHA 5FDPA 3EN5A 3F82A 4ORKA 2X7FA 4ZEGA 4AT5A 3BEAA 4C57A 4FKPA 3ETAA 3ZLXA 3KMUA 4XV1A 4AGUA 3A4OX 2ITQA 3V6RA 4E26A 4XHKB 4TWOA 2OXYA 3TTJA 2YWVA 3TDVA 1OPLA 4XOZA 2O2UA 2J0LA 3R8UA 5A4EA 3ORPA 4D4VA 4K77A 1ZYLA 2WTIA 4CMOA 4I92A 3IECA 1NVQA 4N0SA 4WD5A 3TN8A 4CMTA 2Z2WA 1GZ8A 5LOHA 3U6IA 1YOLA 4GU6A 4EH6A 2H9VA 3QALE 5FQDC 2IG7A 3ODYX 4HPTE 4QMZA 1NA7A 3ALOA 3K54A 2CCHA 4M67A 3BZ3A 3NW6A 4O6EA 3MA6A 4BWKA 5CVFA 1CKPA 3HGKA 2WMTA 4AF3A 4E4XA 1S9JA 2BR1A 2XRWA 4GKIA 4FIJA 1YXTA 3M2WA 3PDTA 3AD6A 4M3QA 4B6LA 3HV4A 3PUPA 4YJSA 1B6CB 3FKNA 5ETAA 4R77A 2YM4A 3JUHA 3PXYA 2P3GX 4JS8A 5BVDA 4ALWA 4GL9A 4IEBA 3NAYA 1VYWA 5EI6A 3QKMA 3WE8A 4WBOA 1VEBA 2VTOA 2SRCA 1TQMA 3PXKA 1J1BA 4YBKA 1BUHA 5LMBA 1Q8UA 2RFSA 5CNNA 5A14A 3E7OA 5BPYA 4MD7E 5LMAA 1XH9A 2VTLA 4TW9A 5IH4A 4CTBA 4P90A 2R3PA 4P4CA 3EQFA 5E8VA 4NT4A 3VC4A 2E9VA 2YCRA 2WMBA 4R1YA 3EFLA 3LW0A 4TXCA 4ACDA 5KMOA 2HZ4A 1H28A 4OTWA 2UZWE 3GGFA 3T3VA 3SAYA 4F9BA 5HZNA 4D9UA 4FZFB 4MXOA 3IGOA 2PVKA 5HIDA 4FI1A 5LARA 3H0ZA 4G17A 4YLLA 3HMMA 2PSQA 4AS0A 4BHNA 4FK6A 3KXZA 1WVYA 2J9MA 2QHMA 1IRKA 4TZRA 2CGUA 1Q3DA 4DGMA 1OBGA 4MNEA 3A62A 4B8MA 5GIOE 2VX1A 4AT4A 3NNVA 4CYIA 2C6KA 3R8PA 4F08A 4UMPA 2HWPA 1O6LA 2OU7A 2YA9A 4RIWB 3ORIA 3W2OA 2UW3A 1KSWA 3PJ1A 1FQ1B 4LGDA 2XB7A 3RCDA 2QLQA 3LLAA 3I60A 2YFXA 1LR4A 2BRBA 1H08A 2Z8CA 4IHPA 4WO5A 4DTAA 4FSQA 3TIZA 4NJ3A 5M55A 4U79A 4NM7A 4AOJA 3QQJA 4E5AX 5B7VA 3PVUA 3U87A 4ZSLA 4D2WA 3LFCA 2IZUA 3IDBA 4O81A 3GOPA 4BDAA 3RPYA 3E87A 2JEDA 3V51A 4OT5A 1RDQE 3I81A 4EKLA 3EN9A 4MVFA 2HAKA 3OCBA 4IC7A 4QMVA 3BRBA 2RG5A 5EK7A 3FHIA 4MD9E 4U8ZA 5M07A 3MJ2A 4X3JA 4EJNA 3O8TA 5J7HA 1PY5A 3B8QA 3IW4A 5A46A 3FLNC 3O8UA 3DKCA 2QONA 4D5KA 2XK6A 4FV0A 3ZHPC 4LRKA 1MUOA 3ZXZA 2BTSA 2VZ6A 3QHWA 3RZBA 4BCNA 4C4EA 5F20A 4HVIA 4ZOGA 4EZ3A 1JPAA 4UEUA 4XP3A 2XJ2A 5M56A 2VNWA 3GT8A 4BKJA 3EQRA 2WAJA 2P33A 5A4CA 4FTMA 5I9WA 2GS7A 4FYNA 4BCHA 3ZEWA 1MP8A 3I0QA 3JS2A 5EOBA 5IDNA 2NP8A 2UZVA 3GU6A 4UXQA 2OZAA 4MYGA 3MYGA 4RGJA 1ZOGA 2XNNA 3RPVA 3ZLSA 4FX3A 3MDYA 2VTTA 3MFUA 2WQEA 4FL1A 5DLSA 5IQFA 2CCIA 5CF6A 3LCTA 4QYFA 3GC9A 4PRJA 4YO4A 2ERZE 4H58A 5HO8A 2QKRA 3UOKA 3B8RA 4TWCA 2BFYA 2PE0A 4Y73A 4DEGA 1L8TA 4RWLA 4ANNA 4AAAA 5A4QA 3MB6A 3ZRLA 4ZTHA 5IQIA 3W55A 5CF5A 5CF8A 4Z9LA 3QGWA 1KE7A 3HUBA 3FSFA 5HBEA 3OCTA 1YWNA 4EH8A 3QRIA 1P5EA 3OWKA 4CKJA 5BVWA 4D55A 4EK6A 3O0GA 5J1VA 2VTSA 1YDRE 4CNHA 1J7IA 4MEDA 3I7BA 3G6GA 3RMFA 4F65A 3TTIA 4YUQA 5IEVA 3W10A 4DN5A 3NNXA 3D5UA 4JVGA 4ENYA 3UIXA 3BPRA 2UW9A 3MFSA 4YBJA 5CSPA 3OHTA 2Y4IC 5JFWA 4AFJA 1PXMA 1M2QA 4NYEA 3PSCA 1UWJA 4FICA 1H1QA 4JX7A 5EYCA 4ZZOA 5CAOA 4UY9A 3RAHA 3R7UA 3GOKA 2YCFA 3F3ZA 3FYJX 5AV3A 3S2PA 4FK3A 3FMHA 4AOIA 2F7XE 3HMNA 4KD1A 5CEKA 2CGXA 2C6EA 2PVMA 1OITA 4E4NA 4MK0A 3TDWA 4HOKA 3A7JA 5TOZA 4JOAA 3UE4A 5A9UA 2YIRA 1JSVA 1M2PA 2WQOA 4YZ9A 3MI9A 5DOSA 3E5AA 5E8XA 3G5DA 3UP2A 2OBJA 1XO2B 3MVJA 4JJRA 4TRLA 5ETCA 4C61A 3TIYA 4LRJA 4WUNA 4CFMA 4DT9A 3Q4ZA 3NUUA 4B9DA 3ORNA 2X39A 1J1CA 5J9YA 5E1EA 4QNYA 3IQ7A 5F94A 4IWOA 1E1XA 2W7XA 4FKQA 2BALA 3CJGA 4FV5A 2HYYA 4O0VA 4BWPA 4ERKA 3F5UA 5KX8A 3V5TA 4ZJVA 3BE2A 3R8VA 3AGMA 2W99B 4NFMA 2NO3A 4EHZA 5ICPA 4LV8A 4BCQA 5EYDA 3W8QA 4EYMA 3ORKA 5FXRA 5IG1A 1YI6A 5CY3A 4FEXA 4DEIA 4C34A 4USFA 4USDA 3LE6A 3AMAA 5AAFA 3Q32A 4FTIA 2UZBA 3EH9A 1OPKA 2XJ1A 3SG8A 2KTYA 1OL7A 3DDQA 2VTQA 2YISA 4G9RA 4D28A 3W8LA 3M42A 4Y5HA 4M68A 4JDHA 5EI8A 5LWMA 5T68A 3RPSA 4MH7A 5KHXA 2XH5A 4EWHA 2CKOA 4KNBA 1Q4LA 3R7VA 3MTLA 4BCFA 4O0YA 4Q5HA 3GFWA 4EK8A 4IJPA 4PX6A 4BTKA 3PE1A 2QURA 4BZNA 3LZBA 4EOOA 4RRVA 2XP2A 1XBBA 2OWBA 1VJYA 2JIIA 3KXHA 3RAKA 3VNTA 2IVTA 3DKGA 5BVFA 4XG9A 2C0IA 3RK9A 5HCZA 1KOBA 4CFXA 4KRCA 5LMKC 3NIZA 3UC3A 3OD6X 5EHYA 5HX6A 4G2FA 3GEQA 3HV5A 4G6OA 3VF8A 2ZB0A 4AXAA 4D5HA 5LWNA 1MRVA 1URWA 5DT4A 3HRFA 5EM5A 4CKRA 4G6NA 3QQFA 3H9OA 3VS2A 3DS6A 1OVEA 3PPZA 4U7ZA 2C6TA 3TZ7A 3TZMA 2VTJA 5J9LA 4R5SA 2BHEA 4PQNA 4ZY5A 5KMKA 1YOJA 5CXHA 3QX2A 3RINA 5CT7A 5M08A 2W1GA 3D0EA 1PKDA 4ZTNA 4CG9A 5I9XA 4GKHA 4DH1A 4U40A 3C1XA 3M11A 3JY0A 3VUDA 4NIFA 4F7JA 3DNDA 5C4KA 3FKOA 1GIJA 4DF3A 2B4SB 2OJGA 3OF0A 4I41A 5CAPA 2EB3A 4C2WA 4QTBA 3KRWA 4FSRA 5M53A 5JRQA 4YC3A 5CVHA 3OW4A 5L2IA 4XBRA 3V04A 5AUYA 3R9NA 3VS7A 2XNEA 3U9CA 4KS8A 5K5NA 2QVSE 1Q8WA 4RPVA 5GZ9A 2XKFA 5JGDA 4L7FA 2VWIA 2H8HA 3FY2A 5HQ0A 3Q6WA 3VVHA 3NUSA 3NSZA 3FZOA 2JDTA 3ZSIA 1T46A 3F88A 4FTJA 2UW6A 4ANBA 3ZCLA 5IISA 3I79A 4QPAA 4I5PA 1IA8A 4FEVA 4O7VA 2G2FA 4RC3A 3FAAA 5G6VA 3TV6A 2PVYA 1BL6A 1YHSA 1ZOEA 2JDVA 2FYSA 2FGIA 3ZMMA 3ZRMA 3HAVA 1LUFA 4MF1A 2OIQA 4IX3A 3AT4A 4RIXB 4TL0A 5JFVA 3VF9A 3MY1A 5DT0A 4O0SA 1BYGA 3QTQA 4O7RA 1GJOA 4Z3VA 3AMYA 5K9IA 1UU7A 4HZSA 5IUGA 3R73A 3Q2JA 4QMSA 3UJGA 3ET7A 1REKA 4FTTA 2IO6A 4GG5A 3UO5A 2ZM3A 5AP5A 2B9JA 4L53A 4Q9ZA 1HOWA 3R28A 4QQ5A 2UV2A 4K6ZA 4MXZA 2UW0A 4RVMA 5AV0A 4ACCA 4DEEA 3FMKA 3R2YA 4I21A 3GVUA 4YJRA 4F7LA 4CYJA 4H1MA 3UZRA 4V04A 4TWNA 2X8DA 3KULA 3DXNA 3TUCA 5DIAA 1SVGA 3RALA 1PMUA 2OJJA 4QMOA 3COHA 4X0MA 3IS5A 2ZV7A 4G31A 3CGFA 3KXMA 4U41A 3HDMA 4TKSA 3OXTA 3R8MA 4FT3A 3SGCA 4ZIMA 1TQPA 3ZZWA 3BEGA 3EQDA 4E93A 5FBNC 3VRZA 4GFGA 1XBAA 4AP7A 5EKNA 4DH3A 4RWKA 3G9NA 2C3IB 1IG1A 4S30A 4LOPA 4X2FA 2R3HA 5T6KA 2UZLA 1ZYDA 3OTVA 3FI2A 3IW5A 4DHFA 2YIYA 5LQFA 2YJSA 3NCZA 1R0EA 1K9AA 3UYTA 4AZFA 4WNKA 4UALA 1H07A 4C4HA 5EG3A 4FUYA 4M13A 3AT3A 2UZEA 3FBVA 5CI7A 3PA5A 3BHHA 3QFVA 4YJVA 1FVRA 4PNIA 4BCMA 4JT3A 4W4WA 5CU6A 4FMQA 3ZLYA 5AV4A 2VO3A 3F69A 1U5RA 2VWZA 3QTXA 1ZXEA 2QOOA 4ZLZA 2C3KA 3QXOA 3ROYA 4U43A 3FXXA 4WSYA 4EOSA 4J99A 5JN2A 2RIOA 4KABA 5HU9A 4FKIA 3QTRA 5GINE 3KK8A 2QO2A 4ASZA 3SA0A 1IASA 4ANOA 3TV7A 4HYUA 4KWPA 3RCJA 2YIXA 4LL0A 3A60A 5ACBC 3FPQA 2RSVA 2C68A 1LPUA 2W1ZA 3TJDA 3O7LB 4IACA 4L43A 4Q2AA 1YRPA 3RZFA 2VD5A 2GQGA 4BKYA 4DA5A 5IQDA 1UVRA 3LAUA 4EOKA 1ZARA 4EBWA 1IEPA 4Q5EA 4DAWA 3AD4A 2JDRA 3E3BX 3WOWA 5CEOA 3RPRA 5I9ZA 3WBLA 3WZJA 4O7ZA 3CQWA 3H4JA 5HGIA 2OFVA 1OM1A 3IO7A 2V7OA 4IBMA 3GB2A 2OH4A 5D11A 3I4BA 4E6DA 2JDSA 5EYKA 5IUIA 4AOTA 3G0FA 2Q83A 1H25A 2J90A 2W9ZB 4X2NA 1M7NA 4EQCA 4IZ5A 4CZUA 3HLLA 5ANKA 3WF8A 4A06A 3AC3A 1WCCA 5HORA 4RJ3A 4F6SA 4AGCA 3N4VA 2P2HA 2OK1A 4DLIA 3ZFMA 1UKIA 4KKGA 2YM8A 4CT1A 3MIYA 4A4LA 2ITUA 3OWJA 3RAIA 3ZC6A 5JZJA 4FKJA 3SVVA 3D14A 2WXVA 4I1ZA 3LKMA 3P78A 4G5PA 4AN2A 3T9IA 4F6WA 1F0QA 3AC8A 3P08A 5EH0A 1KUTA 5HCXA 4BL1A 2CKPA 3EQCA 4II5A 5HEZA 4AG8A 5CSVA 3QLGA 2ZV2A 4L46A 3OZ6A 2R3LA 3PRFA 3AC1A 3O51A 5DE2A 4DFXE 3V5WA 2I0HA 3NVMB 2X2MA 4MBLA 2WTKB 3DLZA 3KQ7A 4EH7A 2JBOA 3QCXA 5JT2A 4D2RA 5A54A 2BHHA 2ETRA 4IZ7A 3BYUA 3EIDA 5FG8A 3QHRA 1TKIA 3UMXA 4PPAA 4BICA 3BELA 3HNGA 4MD8E 2X7OA 4FTUA 3C13A 4IAIA 4LOQA 2VN9A 2VNYA 3F5GA 4N4SA 2YERA 4F0FA 4FL2A 2BRGA 1U59A 2CLXA 4HYHA 4W4YA 5GHVA 3UNKA 1WFCA 3FSKA 4IDTA 2VAGA 4QTAA 2J0IA 1P4OA 3UTOA 3ZU7A 2ITZA 2W1IA 2X9EA 3GCUA 3DTCA 2ACXA 2X1NA 3NAXA 2QO9A 1PYEA 3KXXA 3QC4A 4L6QA 3MPAA 5EHLA 4FIGA 4WBBB 5HU3A 4FSNA 3ZBXA 4WHZA 2A4LA 5FTQA 3W2CA 1IAHA 4CRLA 1OIYA 4O0TA 4D2TA 5CU2A 1UU8A 5DRBA 3AOXA 2PVFA 3RK5A 2ITXA 2R64A 3DY7A 4H3PA 1CMKE 4YC6A 1J7UA 2I7QA 1U4DA 5AFVA 4MKCA 4BY9E 2ZAZA 4EZ7A 3GU4A 4GCJA 4KBCA 1OL6A 1W8CA 2W5HA 2XKEA 4KIPA 1KOAA 5FXQA 4F9AA 2OF2A 2XK4A 5KMLA 2XIXA 2B53A 3G2FA 2W4OA 1KV1A 2WMRA 3CD3A 4LV5A 3W18A 2C0TA 2XNBA 4RA4A 5KUPA 4JLCA 4ZLOA 3V8SA 3KRXA 5CU3A 4BBEA 4LUEA 1OZ1A 5I0BA 1SVHA 2UUEA 2Z7SA 2BAJA 4RX5A 4KUJA 1UKHA 2KULA 3CY2A 2R7IA 3LQ5A 5I3RA 3FC1X 4I93A 4Z55A 1SVEA 3HX4A 3LFSA 5ANOA 2JKMA 3VUKA 5AX3A 3UOHA 1SNUA 3E8DA 4BRXA 3PE2A 2OKRA 3RI1A 3IW8A 3NYNA 2A1AB 3KF4A 3UODA 3REPA 4K0YA 4BI0A 3B2WA 3FZRA 3HVCA 4HGEA 3MH0A 4KB8A 4NFNA 4YZBA 4E7WA 1ZLTA 4BCKA 2GTNA 2VWXA 4P5QA 4IMYA 4A9UA 5M09A 3OCSA 4GYIA 3QTZA 5DFPA 3DB8A 2BMCA 4I6FA 1DS5A 4F7NA 1SNXA 2XRUA 3ZO1A 2FSMX 5GJGA 1PXIA 3L9NA 3BYVA 5KMJA 1I44A 3EQGA 2QODA 2VO7A 3QUDA 2W1FA 4BR3A 1HCKA 5EYMA 5EM7A 1Y8GA 4ACMA 5DWRA 1ZZLA 3I6WA 4YZCA 2I0EA 2C5YA 5LXMA 3QUEA 3A2CA 1JNKA 4ACHA 1GZNA 2YDKA 4HCVA 3OOGA 4JIKA 4DFYA 4CFWA 2WIPA 3EQIA 4N57A 3F2RA 2C30A 4PMSA 4XRLA 3G15A 2F7ZE 3MH3A 5IQHA 1BI8A 4FNXA 4ZJIA 3UYSA 3VBTA 2HOGA 2O3PA 2XUUA 5BMMA 5JGBA 2Z60A 2B52A 1V0BA 3KF7A 3K5UA 4NIFB 4J8MA 4NH1A 2R2PA 3E88A 2F7EE 3FZTA 4GIHA 2OIDA 3Q53A 2P4IA 2OZOA 3A8XA 2XKCA 4O2ZA 2REIA 2F57A 3QTUA 4NU1A 4CV9A 3MVMA 4LGGA 4DGNA 5C1QB 2IPXA 4BZDA 1V0PA 2DUVA 3DPKA 3LCSA 4G3FA 3VUTA 5IPJA 3W33A 2VO0A 4EH5A 2B55A 2E9OA 3FMMA 3QGYA 3QQLA 4JNWA 4YTHA 2JITA 2VTRA 2ZB1A 3C4WA 3HRCA 3OEZA 3HV3A 3COIA 4LOOA 4YTIA 2Z7LA 2IN6A 2C47A 2XS0A 5JZNA 5HHWA 4O91A 3FLYA 3P86A 4JBQA 4APPA 5KCVA 3GNIB 5AAGA 1Y91A 4GJ3A 3LCKA 3PSDA 4PF4A 5TO8A 2Y7JA 3R04A 1P2AA 4ENXA 2QU6A 4DINA 3NRMA 4I3ZA 4EH9A 5AUZA 5HE0A 5HIEA 3CKWA 3VBQA 3PRIA 2GS6A 3QZFA 4A7CA 1KE9A 3AC5A 3O17A 5J5TA 4M15A 2GDOA 2YLFA 3EN6A 1BI7A 5LVOA 2OW3A 3PP1A 4CFFA 4DFNA 4G1WA 4EI4A 4C58A 4JQ7A 3OROA 4OUCA 3LFEA 5LVNA 3MTFA 5JQ8A 1XH5A 3VO3A 2BAQA 2XKDA 5M51A 5AV2A 4OTGA 2UZDA 2BZKB 4FKLA 4OW8A 4PTEA 4ANMA 3D7ZA 4UMQA 3RHKA 4F09A 1OIUA 2J51A 5HLWA 5HVKA 2UW8A 3KEXA 4A9TA 4DH5A 3Q9WA 4KAOA 2C6IA 1UU9A 5HVYA 4CXAA 4F0GA 1O6YA 3W32A 2C0OA 4DCEA 5FTGA 4JRVA 3PIYA 3BQRA 2G2HA 5IA3A 4FKUA 5LMKA 3FDNA 5IF1A 1UWHA 4BDFA 2YM7A 3EN4A 3FXZA 4IDVA 4FV9A 4AE6A 1K2PA 2W4JA 3HA6A 1B39A 2H6DA 2JKOA 3C50A 3EWHA 5HD7A 4YR8A 3NYVA 1OL1A 5JH6A 3ERKA 5M06A 3RK7A 1UNHA 2Y8OA 3EMGA 4O0RA 2HIWA 2WU7A 4MQ1A 3DBFA 2O63A 4GS6A 3OP5A 2XK9A 4M84A 4OTPA 3GU8A 2XIZA 4X2JA 4BGGA 4FIFA 2ITYA 2B9HA 3DFCB 5AR7A 3Q6UA 4ZZMA 2G1TA 4BCJA 1STCE 4FVPA 3RWPA 1Z9XA 2X8IA 3TG1A 3U9NA 4Z7HA 3ZM9A 3HP5A 4MBJA 1XWSA 4JBPA 4FA2A 4QMLA 3NUNA 3ZFYA 1YI3A 4DH7A 1ZZ2A 2JKQA 4GV1A 1J3HA 4TTHB 4GFOA 2NPQA 5HE2A 4WG3A 2YIQA 4ONAA 5DNRA 1PMNA 5BQ0A 2BIKB 5J5SA 2FVDA 3I1AA 5AR4A 1ZYSA 3SX9A 3FQEA 2PUPA 1TQIA 4JXFA 4HGTA 5AUTA 4ZMFA 5HTBA 5AWMA 2PZPA 3DBQA 5E8TA 4WNOA 4NZWB 1CKIA 4V05A 4E6AA 3GENA 4LI5A 4FIHA 3O50A 4RX7A 3FEGA 5ETFA 3CS9A 3P7CA 4QP7A 2YITA 3DAEA 3UQCA 3E63A 2WQMA 2WEVA 4AACA 4E6QA 5FUTA 3F6XA 3P7BA 4FSUA 3UO6A 4PMTA 5HO7A 3EOCA 4C59A 4PPBA 3KXNA 3B2TA 3S3IA 4QP3A 4XLIA 4DGOA 3WILA 4ACGA 1E9HA 5EQYA 4GW8A 3PG3A 1JOWB 4IZAA 3WE4A 5K0XA 4O84A 3IK3A 4YNEA 4BTFA 4FG7A 5IQBA 3BV2A 2R3RA 3FC2A 5CNOA 5IU2A 2X9FA 3QU0A 2BUJA 4QPSA 3PJ2A 5AX9A 5FP5A 3DLSA 5HBJA 4YLKA 4M14A 3KGAA 4O7TA 4NSTA 1BKXA 4QYHA 2PTKA 4FSTA 4QO9A 4E5WA 3PFQA 5E90A 4YSMA 3NX8A 4XNEA 4V01A 1M52A 3UP7A 1LEWA 2PULA 3WF7A 2B9FA 1ATPE 3R7OA 3WZDA 1G8SA 3R9HA 1K3AA 2VWYA 4G3EA 3VS0A 4OBPA 4RLLA 2F49A 1PXOA 5BVOA 4UYAA 4JR7A 4BYIA 3MWUA 3TEIA 2GQSA 4RMZA 2OZAB 1GOLA 3ORXA 3VS6A 3L9PA 3H10A 4ANSA 5HNBA 4AA0A 3LM0A 3MSSA 2PZYA 5HNIX 2E9PA 4W4XA 1XH6A 3DXPA 4IZYA 5KBQA 4EK5A 4AE9A 1PXJA 5AR8A 4BN1A 1MRUA 4I5CA 1SYKA 2I0VA 4JL9A 2Y6OA 2QR7A 4EK4A 3C0HA 4YJTA 4FIEA 2P2IA 3VS3A 3D9VA 3I0OA 4FZAB 2VGOA 4E1ZA 3AC2A 4KA3A 4ZS0A 5E8UA 4ZLYA 2YWPA 3COKA 3F3VA 2W05A 3RPOA 4Q9SA 4GUEA 5K0KA 3QD4A 5BVEA 5HKMA 4BIEA 3D7TA 4FG8A 4CFNA 5CT0A 3NR9A 4F99A 3VIDA 5AV1A 3HMIA 1VYZA 2WD1A 4O7SA 1BMKA 2WQNA 3VJNA 5HX8A 4ZTQA 2ZM1A 1Q5KA 2HW7A 3CE3A 5L2QA 3HV6A 1ZAOA 2XF0A 2VWVA 3QC9A 3LHJA 4RBLA 2WTWA 4PP9A 1PXLA 3PXQA 4ID7A 4C35A 4R3RA 1Q3WA 2VUWA 3KCFA 1NVSA 4QP8A 2GNIA 4CCUA 3ZH8A 1UV5A 4KRDA 1GIHA 4J97A 5TR6A 2R3GA 4D1ZA 5HE3A 4ZTLA 4DFBA 1XKKA 2CDZA 4YPSA 5A6OA 5CANA 5AR2A 3MH1A 2CNQA 3S95A 3NMUF 3N51A 3ZO3A 5CAQA 3G51A 5HLNA 3JVRA 5J9ZA 1Y8YA 4WNMA 4Y46A 3LLTA 4U97A 1GZKA 2HENA 4I6BA 3EFKA 4QNAA 4X6RA 4B99A 4FEQA 4XG7A 3E8NA 2CLQA 5DR9A 4QD6A 1MRYA 3HMPA 4RG0A 2J4ZA 2X81A 5L6WL 4D9TA 3DCVA 1KE6A 2QHNA 2PUIA 4Z7GA 4BDEA 3OW3A 1PRYA 2BDJA 3NEWA 3OXZA 4IH8A 4CG8A 4ASXA 4HVSA 3BE9A 4HW7A 1Y6BA 4G5JA 5H9BA 4FKRA 4L3PA 3QA8A 5CSWA 3FI4A 3NUPA 4FVRA 2YZAA 5FP6A 3ZFXA 3ZUUA 2C5VA 3L8PA 4O1OA 4BIDA 3HV7A 3TI1A 3H30A 3BYSA 4GT4A 4NTTA 5IKWA 1ZYJA 2QG5A 2YCSA 4FKGA 3RVGA 4FV8A 4BC6A 3T3UA 3FL5A 3V8WA 4PDYA 3GC0A 4C62A 4WKQA 4YJOA 5JKGA 2G15A 3H3CA 5B0XA 3QD0A 4BWXA 2R3NA 1OKYA 5L2WA 3CPBA 2XJ0A 3L8VA 3F7WA 5IA1A 3UO4A 4BHZA 1CM8A 1M7QA 2R3MA 4FTOA 4S2ZA 5J1WA 4TT7A 3W2QA 4CMUA 1VR2A 1ZMUA 4E73A 2R3FA 4RIOA 2BRHA 5H8GA 2X6DA 3R9DA 3Q4TA 3TNQB 4BKZA 4C2VA 4RZVA 3TKIA 2PU8A 3QF9A 5FTOA 4U3ZA 3R1SA 1ERKA 1EH4A 4GG7A 2R3KA 5A6NA 5L6PA 1Q61A 4YZDA 3WF9A 4D0XA 2J6MA 3CBLA 3P5KA 5FM2A 4FV1A 3R1QA 3OOMA 1OKWA 2J0MB 5HTCA 2V7AA 5HLPA 1W82A 5CS6A 4FGBA 4XG6A 3U8WA 3R2BA 5D7AA 3P23A 2QOFA 3UPZA 2CNVA 2I1MA 3C0GA 5ETIA 3BWJA 4AWIA 4FODA 5GIPE 2GFSA 3ORLA 2C3JA 3KK9A 2EB2A 3BU3A 1U46A 4FKWA 4J96A 3OG7A 1APME 2PVJA 2XYNA 3BIZA 3NW5A 4P7EA 3HECA 1CTPE 5FXSA 2ZVAA 3TZ8A 3MS9A 3DJ6A 5EKOA 2JKKA 3DJ7A 4L01A 5D1JA 2WELA 4YJQA 5GZ8A 4FV4A 3DA6A 3EN7A 5AEPA 4WG5A 3A4PA 3O96A 3BU5A 4FSMA 3SQQA 4BCGA 3PA4A 4CFVA 5AMNA 4AA4A 2XYUA 2ETKA 4RA5A 3PJCA 4TYIA 5G1XA 4QTCA 3G9LX 1NXKA 2QOKA 2VTNA 2YAAA 5HD4A 1H1RA 2HY0A 4FYOA 4QP4A 5IA4A 2UZTA 2ESMA 2PZRA 2UW7A 2W1DA 4LRMA 3R02A 4U9AA 3BKBA 4QP9A 4H05A 5IMEA 5E91A 4YTCA 2IZRA 2WTDA 1GNGA 2BPMA 2GU8A 4FZ6A 3W1FA 3ZSGA 3GCSA 4GVJA 4LFIA 3N4TA 3C4FA 2B1PA 1G5SA 5EOLA 3F5PA 5IA0A 5EQEA 3PLAE 4U5JA 3UVRA 3FI3A 3LVPA 5AA8A 1UU3A 4PWNA 2Y6MA 4WOVA 3KVWA 3GC8A 4EOLA 2QOQA 3R21A 4FV7A 1VZOA 3EHAA 4RVLA 5AM6A 5K3YA 4L8MA 3Q9XA 5ANGA 3ZYAA 3TXOA 4FOCA 2I40A 2RGPA 4JG8A 2XNMA 3LXPA 2IW8A 3NGAA 3PY0A 3THBA 3FMDA 4C3RA 4AX8A 2ITNA 3WZEA 4BI2A 4E5BA 3CKXA 3QZGA 1H1PA 4ZK5A 5ANEA 4QQTA 2PE2A 4EOMA 3I5NA 5DN3A 3DXQA 3DAKA 2OJ9A 4FOBA 3ID6C 3R0TA 2IVSA 4I4FA 3MH2A 3FLZA
chains in the Genus database with same CATH superfamily
3R7GA 3ENHA 3KKVA 2AQXA 4O0UA 2OJFE 5LCKA 3V5QA 4R7IA 3W0QA 3KRJA 3PZEA 1WBTA 4IM0A 4XG8A 3TNPC 4V0GB 2GTMA 4LL5A 4EH3A 4YP8A 2C6LA 3MY5A 4FUXA 5I4NA 5KKRC 2CMWA 4O7LA 4BDDA 1QPCA 2EUFB 2F4JA 1OL5A 3OWPA 2E2BA 5CLPA 1ZY5A 3QCSA 1MQBA 1QCFA 4EWQA 1GY3A 3NUXA 4BGHA 4EOPA 3F3TA 2X0GA 2UZOA 4RT7A 1FGKA 4Y5QA 2CJMA 5TKDA 2UVXA 2YM3A 4YJUA 2RF9A 5CU0A 5IQCA 2BCJA 2XBAA 3ZS5A 3LFAA 4L42A 4DGGA 4CGAA 4UWCA 4K8AA 3AG9A 4OTFA 1RQQA 3N9XA 4A07A 4FG9A 4EYJA 2PWLA 1G8AA 2YLEA 1PHKA 1SM2A 3BHTA 2QCSA 3CLYA 4X6QC 3C4EA 3R83A 4C02A 3D94A 4GK2A 2G01A 1UNLA 5EDQA 3BL7A 1BLXA 3OT8A 3EFJA 4F63A 4HCUA 5ITAA 3MA3A 5HESA 4I4EA 1CSNA 4QMWA 2Z7RA 3GP0A 4QDEA 3ORTA 3FMLA 3N4UA 4ITHA 4RC4A 4QMMA 2Y9QA 4JDIA 4EQUA 2C6MA 2RFEA 4S34A 4C4IA 3CQUA 1W83A 4R78A 3LFDA 4EUTA 5LVMA 4CD0A 4GH2A 3AC4A 4X21A 1WVWA 4C37A 3SG9A 5IH5A 3NPCA 3TMOA 4G3GA 2PVNA 4BDJA 4KSQA 3KFAA 3RM6A 2GNJA 1HCLA 3U55A 3RNYA 1JKKA 4TNDA 4HCTA 4FTNA 3TJCA 2C5NA 3COMA 3HRBA 4I20A 4IM3A 5EDRA 3I6UA 3W0MA 4BCIA 4MXYA 4E20A 4FKOA 3PSBA 4MNFA 4S31A 2BILB 4IX5A 2YM5A 4FT5A 3O8PA 1QPEA 3LXLA 1ST4A 3L8XA 1YXXA 4O82A 4OR5A 4IAFA 5HG7A 5IH6A 5AAEA 4IVAA 3FPMA 2WFYA 4UZHA 1OGUA 3AXWA 1XR1A 3PPKA 2YABA 2EVAA 4XRJA 1BX6A 4EK3A 2OI4X 1MQ4A 4N6ZA 5IEXA 4YJNA 3POZA 4GT3A 2Z02A 3ZZEA 4QT1A 4TYJA 3LXKA 4OTDA 5L2TA 4HVGA 3ELJA 3CTJA 3Q4UA 4D2SA 5CF4A 1H0VA 1NVRA 1Y6AA 5KBRA 3Q52A 1ZWSA 1V0OA 2HZIA 4PNKA 3QCYA 2JIVA 2BDFA 4L45A 4U3YA 1JBPE 3BX5A 3QQHA 3R8ZA 1DAYA 2GHLA 4LMNA 2XAOA 4L00A 4FEWA 3A61A 3O2MA 4CSVA 4AXDA 2QOBA 3S4QA 3PPJA 4AZEA 4M69A 4YSJA 4MF0A 2C6DA 2R3QA 1XH7A 5AP3A 1FBNA 4RX8A 3R63A 2GCDA 4WG4A 3VBXA 3ZOSA 1R1WA 4TYEA 5E8SA 3FL4A 4BDKA 4JRNA 2WHBA 2GNFA 4O22A 5I3OA 4ASEA 1OECA 2ZFYA 4AQCA 1YOMA 4RFMA 3UVPA 4BDGA 4BI1A 1YHWA 4BVUA 4QTEA 3QL8A 4I23A 3F7ZA 3DBEA 4DG3E 1H27A 3FE3A 1NY3A 5AP4A 3A7IA 1H8FA 3CD8A 4DGLC 2BTRA 4QMTA 2PMIA 3ZUTA 4CRSA 3OUKA 1REJA 3UMWA 4LYNA 5C8NA 2E9NA 4PUZA 3LXNA 4DEHA 5FGKA 4C4JA 2B7AA 4UXLA 3R00A 2R3IA 1YVJA 2QR8A 3C9WA 1H00A 3AGLA 2F9GA 3VAPA 3MIAA 4FTQA 5CYIA 3VRYA 2FH9A 2RFNA 1NT2A 3FMJA 4D4SA 1FVTA 4LM5A 4M69B 1F5QA 5L8LA 1AGWA 3D4QA 3ULIA 2FSLX 2WB8A 4AFEA 2LGCA 4YZNA 3UDSA 1Q8YA 3WARA 2X4ZA 2X0PA 4GSBA 5D41A 3R1YA 4XV2A 1QMZA 2WO6A 4H36A 5I9UA 4MWHA 2W17A 4ERWA 4GJ2A 4PP7A 3TM0A 4RIYA 4FV2A 3EYHA 3BBWA 4MTAA 3E92A 2ITPA 4WA9A 3WF6A 4AGDA 4BF2A 4D0WA 2J50A 3GCQA 3UIBA 3JYAA 4CEGA 3FYKX 3SKCA 1R78A 3F3UA 2OF4A 3F9NA 3FQHA 3OVVA 3R6XA 2WQBA 3BHVA 3CR0A 4IB3A 2WTJA 3SXRA 2G2IA 3BI6A 5AP0A 4IB0A 2WIHA 3R7YA 2VTIA 3ZTXA 4XLVA 3BWFA 4O4CA 5HIBA 3BV3A 3KC3A 1M17A 4C36A 5C26A 4IQ6A 5C8KA 5AJQA 2FO0A 3KY2A 5HBHA 5F95A 3W16A 3NUAA 4F9WA 3OT3A 3QYWA 3W2RA 4RIYB 3L9MA 4OTQA 3PYYA 3VW6A 5IZFA 4K9YA 4GK4A 5KMNA 4YNOA 3SXFA 3P4KA 1OPJA 3K5VA 5BNJA 4PDPA 3V01A 1JKTA 3PG1A 2JC6A 3UC4A 4EQMA 3BU6A 3LFFA 4XYFA 2QC6A 2X2LA 3QWJA 1W98A 2XK8A 4JDKA 2WMWA 2DQ7X 2F2CB 2R0IA 4AZTA 2QLUA 5BUIA 4FZ7A 5E9EA 1XBCA 2VWUA 2WGJA 4XEYA 2WMQA 2IF8A 5E92A 4M12A 4NJDA 4JG7A 4YJPA 5HG5A 3D83A 3QZHA 4CVAA 2QOLA 4R8QA 1WBNA 1TVOA 4U42A 3DV3A 4BDCA 3EQPA 3EYGA 2GSFA 4RFYA 3RNIA 4E3CA 4RZWA 2BIYA 4YTFA 1ZY4A 3F3WA 2GQRA 1IA9A 3MV5A 4L52A 3ZONA 2JBPA 4V0GA 4TWPA 4KIKA 5HVJA 1OUKA 5T3QA 4DFUA 1DI8A 3TUBA 4NM5A 2X4FA 2O8YA 2OXDA 3GC7A 4QMNA 2E9UA 4J53A 3C5UA 2O0UA 4EONA 3FY0A 3UOLA 5LCJA 2PZIA 2YCQA 2VTAA 4IWQA 3OC1A 4JQ8A 4QRCA 3R7EA 5EW9A 1JWHA 3QBNA 3FJQE 3NNWA 4MWIA 5J87A 5GJDA 1SZMA 4ZAUA 4I0SA 2A0CX 5KMIA 4O0XA 5TF9A 3OS3A 4FNWA 4QTDA 3GQLA 1JKLA 1WBVA 4AU8A 4O83A 2I0YA 4OAVB 5DEWA 4C0TA 3KRLA 3SC1A 2QI8A 4CLIA 4XV3A 2QNJA 2UVZA 2WTVA 4BYJA 3R1NA 5J8IA 1W84A 4PL3A 1Z57A 2V5QA 4NUSA 5E7RA 4UMRA 2R3JA 3ODZX 4L7SA 5FEQA 3BGPA 4QPMA 2PVLA 1KWPA 3BHUA 2QD9A 3QUPA 4FTCA 4IFCA 4ARKA 2GS2A 2Y4PA 5CSXA 2WOTA 4X2KA 1Q24A 5CASA 5EW3A 1YWVA 3BYOA 2BKKA 3D5VA 2J2IB 3H9FA 4EOJA 2C69A 2A19B 2XIYA 1URCA 3D2IA 4DLJA 5C4LA 3UVQA 2JFMA 3MGYA 1WBPA 2IW6A 3NW7A 1GIIA 4IANA 4PL5A 4Y72A 4APCA 3T8OA 3QQUA 3QRJA 4XS2A 3RP9A 2J7TA 3Q9YA 4BTMA 4GT5A 4F9CA 3PWYA 4X3FA 5L6OA 3MPTA 3QZIA 2UZUE 3DB6A 2EXMA 4FNYA 3SRVB 1OL2A 2HZ0A 3RBWA 3E62A 2UVYA 4AA5A 5CZHA 2YHVA 4C38A 3D5WA 2R4BA 5EHOA 2PMNX 3UQGA 2BRNA 3G33A 2PK9A 4DEDA 3RWQA 1W0XC 5BYZA 2C5XA 4GIIA 5EM8A 1OMWA 4EHGA 2A2AA 3ORMA 2HXQA 2ZMDA 3WYYA 3BQCA 3LFQA 2YIWA 3PVGA 2ITVA 4O27B 4YHTA 4LMUA 5I5ZA 5D10A 3FXWA 2YACA 2CPKE 4IWDA 3L1SA 3CGOA 4B8LA 2ZDUA 4KBAA 4BBMA 3QA0A 3WYXA 2JAMA 4UX9A 4KIKB 2YEXA 5F1ZA 1JLUE 3PY1A 2GMXA 3QKLA 4QYGA 4BBFA 4OT6A 1Y57A 4U45A 4FZDB 3KN6A 5CTPA 5H2UA 3UDBA 2XNPA 3MFTA 3ZDIA 3V5PA 3PXZA 3OY1A 3VUHA 2NRYA 4CT2A 3PXRA 2WZJA 4NW6A 3W2SA 4BJJB 3RM7A 3R30A 3I7CA 3PFYA 4ZTSA 1G8KA 2R0UA 4ZSEA 3QTWA 4JAIA 3TNHA 3CIKA 4FT0A 4YURA 2PPQA 3BLRA 2W06A 2ITTA 3C51A 2R7BA 3KXGA 3UQFA 4L68A 3OBGA 3KREA 2FB8A 5HO6A 1YI4A 1L3RE 2JGZA 4JR3A 4C3FA 2F2UA 4GFMA 4Z16A 2VX3A 4K18A 3I5ZA 5B2KA 1IAJA 3U6JA 4NTSA 5K4JA 4RJ4A 4I0TA 5BUEA 2VWWA 1R3CA 3PVWA 4XBUA 5CAVA 4X7QA 5L3AA 5EDPA 3O7LD 3V6SA 4PPCA 2XNGA 3PJ3A 4JDJA 4RJ8A 4RWJA 4CZTA 3QRTA 5IUHA 3LOKA 4J95A 4UMTA 2CN8A 2IWIA 4TN6A 3LQ8A 3RGFA 4ZY4A 3Q9ZA 2RG6A 4HJOA 4R3PA 2XARA 1GZOA 4HNIA 4FKTA 5JFSA 1A48A 2BAKA 2XBJA 4ZSGA 4GVAA 2PYWA 1ZMWA 4EHEA 3JXWA 4C3PA 3VS4A 1KE5A 3UBDA 2VTPA 3MPMA 4R3CA 3CTHA 4KKEA 4IC8A 4O2PA 4YHJA 4ZSJA 4M0YA 3QD2B 1RE8A 3W0NA 4DTBA 2IVUA 1YXUA 3FLSA 4NWMA 4RIWA 5CEMA 3G0EA 4AZSA 5HICA 2JFLA 2GNGA 4AZWA 5AP7A 3HA8A 1LEZA 4MNEB 5KZ0A 5ANIA 3DTWA 5B2LA 3QD3A 2CKQA 2HK5A 2VTMA 3GXLA 1QPJA 2EXCX 2WU6A 3ULZA 3H9RA 3SV0A 3FUPA 1PMVA 2J0JA 3MY0A 4BCOA 3AMBA 1JQHA 3SOCA 1JAMA 2ZMCA 3LJ1A 4NEUA 3BLHA 2XVDA 4ZMEA 2HWOA 1YXSA 4ALUA 5KMMA 1J91A 2ITOA 3FLQA 3DJ5A 5C27A 4EC9A 5E8ZA 4F7SA 2IVVA 3IDCA 3OXIA 2YN8A 4JBOA 4FT7A 2HCKA 3OCGA 3A7HA 2A27A 2VGPA 3V3VA 5IEYA 3C7QA 2PUUA 1FOTA 1OUYA 3NIEA 5LVLA 4EBVA 4ZZNA 4G6LA 5FDXA 2OLCA 3DU8A 3EB0A 3AKLA 1LP4A 3UDTA 4BFMA 5AUUA 4L3JA 3FHRA 3JVSA 4B7TA 5AADA 3S1HA 4MXCA 4UMUA 4FEUA 2H96A 5CX9A 3AD5A 3HZTA 2Y4IB 4RVTA 3DKOA 3ENMA 2P0CA 3MN3A 3E93A 4GUBA 4MBIA 1FMOE 1XQZA 2RL5A 3C4CA 3Q96A 4G3CA 2HY81 2R9SA 3D2KA 2V22A 2WMUA 2ZOQA 3SW4A 5AR5A 3U4WA 3ZSHA 3QRKA 4JG6A 3MFRA 3NZ0A 4FF8A 4AN9A 2JIUA 2FSTX 2X0OA 4QMXA 4PTGA 4WSQA 4F9YA 2WMAA 2J0KA 2DYLA 5C03A 4FTRA 5IMXA 2PY3A 4U44A 2XK7A 2OFUA 1XHAA 3ZM4A 4TYHB 5CALA 3BGZA 1H1SA 5E8WA 3G90X 4UWBA 1WMKA 4DEAA 4QOXA 5BMSA 4OGRA 4YHFA 5C9CA 4DG2E 4FE2A 3KB7A 3WI6A 4ZTMA 4QYYA 1Q99A 2PVHA 3MVHA 4P2KA 1OIQA 2OJIA 4J7BA 4ZTRA 3D7TB 4Y85A 3Q2MA 4OLIA 3QRUA 3SXSA 3ATTA 4I6QA 4R7HA 1ZMVA 5DEYA 5CXZA 1TFFA 4A9YA 3QXPA 2IEWA 2W5BA 4OBQA 4PTCA 3PJ8A 4IJ9A 3NWWA 4X3FC 4PV0A 5HNGA 4E4LA 4TYGA 1FMKA 5E8YA 5AUXA 3UNJA 1OGYA 2B54A 2YZLA 4DH8A 3LCOA 3ORZA 4MAOA 3WF5A 5AIKA 2WMVA 3LM5A 5L8KA 3BHYA 3IDPA 4LG4A 4O0WA 1A06A 3KMMA 4RWIA 2W96B 4BB4A 4W4VA 4O1PA 2ZYBA 4I24A 3QX4A 2XMYA 2OIBA 2OGVA 5IDPA 3VN9A 3BBTB 3Q60A 3TKUA 4IVBA 3POOA 4JIAA 4WRSA 4FT9A 1ZOHA 2DS1A 4ITJA 2BFXA 3SOAA 3TCPA 3T9TA 3UPXA 4HZRA 4FV3A 3GQIA 5H8EA 2ITWA 3RTPA 4DYMA 4F6UA 4CZYB 4DTKA 2VU3A 4BDHA 3A99A 4PMPA 4KBKA 4U80A 4GYGA 3BYMA 3DFAA 4XG3A 5BV3A 1ST0A 5HTIA 1QPDA 4O7WA 5I9YA 1PJKA 3IPHA 2WMSA 3QQGA 2XANA 3QQKA 3WIGA 3ZXTA 1ZRZA 4R1VA 3LCDA 4RJ7A 2WEIA 4JAJA 4YZMA 3W2PA 4JBVA 4J52A 3JY9A 5AA9A 2O64A 4ZP5A 5D9HA 3UG1A 4QQJA 3OFMA 4F70A 5AUVA 3SD0A 1Z5MA 4K1BA 5IA2A 2NNWB 4G3DA 4QMYA 4F64A 1PXKA 2PMOX 1E1VA 3QTIA 5A4TA 4FC0A 3ZBFA 1GAGA 3U51A 5DT3A 3GCPA 4PMMA 4L67A 4U0IA 3ROCA 1FINA 3E8EA 2X8EA 2RFDA 4FIIA 4IVDA 5FRIA 2BROA 4FSZA 3DQXA 5BUJA 1M14A 3F5XA 1WBSA 2CGWA 3HMOA 3KU2A 4IB1A 4IW0A 4RJ6A 3DBCA 5JGAA 2JAVA 3NNUA 4LGHA 4HVHA 4ZXTA 1I09A 2EU9A 4GU9A 4UBAA 4FR4A 4ANLA 1YXVA 4XMOA 5A3XA 3LMHA 5FD2A 4RX9A 4DCAA 2QOCA 4RLKA 3UIUA 5F9EA 5BX0A 4MXXA 4XH6A 4DG0E 3QWKA 3DZOA 1H01A 1RW8A 1O9UA 3DZQA 4JI9A 4MQ2A 5CI6A 3VBVA 5BVNA 5KKRB 3CEKA 3HDNA 5KHWA 3ZDUA 5L2SA 5HI2A 1DAWA 4GEOA 4IE9A 5DH3A 4FTKA 5E1SA 3V8TA 4P5ZA 3EL8A 5ANJA 5M4CA 3DKFA 3CQEA 1Q41A 1U54A 1AQ1A 3A8WA 5CWZA 3NS9A 1XH4A 5DGZA 3SRVA 5FLFA 4DFZE 4UYNA 5CAUA 2ZDTA 3DK7A 2DWBA 5FWKK 3IONA 2C5OA 4NCTC 5F4NA 3FZSA 2FSOX 2FUMA 3LJ0A 3SLSA 1YDSE 4NK9A 4HYSA 2XAMA 2AC3A 3VQUA 2ZV8A 1R39A 3MJ1A 3RKBA 2OH0E 4J1RA 1U54B 3F66A 4XUFA 2CN5A 2G9XA 3KVXA 3O71A 3CTQA 3TACA 4NKSA 4CLJA 2EXEA 5DHJA 4ANQA 2RKUA 3UZTA 1H1WA 3WZUA 4USEA 3SW7A 2W4KA 3E7VA 4XG2A 4XJ0A 3R01A 4HYIA 4EKKA 2VWBA 3OMVA 2XNOA 4PDSA 5CZIA 3V5JA 3KMWA 5M44A 3HP2A 3PIZA 3R9OA 4DE4A 3TZ9A 2VO6A 2YAKA 3C4XA 3ACJA 4H39A 4FVQA 5M4FA 2BRMA 3PA3A 4J71A 3TT0A 3ZO2A 1WBWA 1JVPP 4WNPA 1CKJA 1JSTA 1W7HA 4C33A 5K4IA 5DVRA 3TWJA 3UOJA 2Q0NA 2C3LA 4FKVA 4O21A 2V55A 3FLWA 2IZTA 3OBJA 4GRBA 5D12A 5ACKA 3CP9A 3MESA 3U54A 2W5AA 4XCUA 3IW7A 4G9CA 2GFCA 3RHXA 4RSSA 4D4RA 4L44A 5HCYA 4KSPA 1H24A 1PMEA 1W2FA 4JX3A 4M66A 5GNKA 2QQ7A 3DK6A 3IW6A 5AUWA 4CFUA 4KINA 3ZEPA 4A4XA 4D58A 3IKAA 2C1BA 4BDBA 5AP1A 4A9SA 2WMXA 3FZ1A 2OG8A 4QMQA 3VONA 4ASDA 3F2NA 4PDOA 3KL8A 4WUAA 5HE1A 2IZSA 4I6LA 1RJBA 1XJDA 4NKAA 4I0RA 4YC8A 5AM7A 4UN0C 2XZSA 3P7AA 3UNZA 1Q8TA 2GHGA 1V1KA 4K2RA 4BDIA 5EFQA 5BYYA 3Q4CA 4I6HA 2PVRA 3ZRKA 3NCGA 3LFBA 4C7TA 3VULA 3CC6A 3A7GA 3FMNA 2VX0A 5HG9A 3HAMA 5KE0A 3PY3A 4CQEA 3CY3A 4YGAA 4O6LA 2Z7QA 3DAJA 3MW1A 5DBXA 3DK3A 4O7YA 1R0PA 5DI1A 4MXAA 4EEVA 4DBXA 4YO6A 5AR3A 2BKZA 4C8BA 4IM2A 1H0WA 2Q0BA 3EFWA 4FV6A 3PTGA 5HOAA 4PY1A 2XK3A 4IAKA 4ZY6A 5LVPA 2P55A 2R3OA 5DYJA 3L9LA 5DRDA 2JD5A 2ONLA 4OTRA 4MCVA 3ITZA 3R71A 4QMUA 3UG2A 2QKWB 3NUYA 3GI3A 2XA4A 3VUIA 5LJJA 3KN5A 3DDPA 4FKSA 3HKOA 3ANQA 5CQUA 3VUGA 4CQGA 2BVAA 5CEQA 2PMLX 3RJCA 3DNEA 4IXPA 2XM9A 5AP6A 4W8EA 4LQMA 4U81A 2W1CA 4TYHA 1WBOA 3ANRA 4F1OA 5CVGA 5IQEA 2Y0AA 5CEIA 3R22A 4E4MA 3S00A 4F1TA 5BVKA 2HELA 1PW2A 4DFLA 5DR2A 2PL0A 3QCQA 4UV0A 2O65A 2LAVA 5IQGA 3LPBA 4M0ZA 1AD5A 2ZJWA 3IOPA 4MX9A 4G16A 3VW8A 4E6CA 4I5HA 4S33A 1ND4A 3E64A 5CSHA 1UNGA 3TL8A 4M97A 5FEDA 3FZPA 3PIXA 3U4UA 2HW6A 2QG7A 5JK3A 4S32A 4EJ7A 3PXFA 4B0GA 3TUDA 4AW5A 5H8BA 3L8SA 5JMSA 2J5FA 4G34A 5L4QA 3SHEA 5KO1A 2JLDA 3R7IA 4DITA 3FQSA 3BLAA 2VV9A 3TV4A 1H26A 4AT3A 4FSYA 3EZVA 2I6LA 4M7IA 4AN3A 4C4GA 5DA3A 3E3PA 4RJ5A 3FI8A 3VBYA 1OB3A 1B38A 2C4GA 2CHLA 4OAUC 4K11A 2AYPA 1XMMA 4H1JA 3LIJA 3EZRA 4OTHA 3ZC5A 4OBOA 4ALVA 4PL4A 2C1AA 2OXXA 3VS1A 1OBDA 1FVVA 1YW2A 4UZDA 4EOIA 2GHMA 3HL7A 3OEFX 4AW0A 4O7NA 2WTCA 4MHAA 5K5XA 1S9IA 3E8CA 3R8LA 2ZM4A 4IX4A 5J79A 3GUBA 4TNBA 2X2KA 4O38A 4RVKA 2J5EA 4HNFA 3GU5A 4FGRA 3IG7A 3EJ1A 3H0YA 1YKRA 4IAZA 4NCTA 2FA2A 4NM3A 3UGCA 1T45A 4HPUE 1BL7A 2VRXA 2UW4A 4L9IA 3LMGA 3O23A 3VBWA 4AUAA 4A4OA 4IIRA 3AT2A 4AZVA 3P9JA 1CDKA 2UZNA 4WT6A 3K2LA 1OKVA 5GZAA 3FWQA 3EL7A 4B4LA 1X8BA 3LFNA 5HG8A 2R5TA 2XIRA 2CSNA 2XIKA 3PLSA 3ZUVA 4AW2A 3C5IA 2NRUA 5JRSA 3VJOA 2HXLA 2XCKA 4IWPA 4M8TA 5EM6A 5M4UA 4O96A 4WRGA 2ZV9A 4I22A 2X7GA 1P14A 3K3IA 4UB7A 2W0JA 3D5XA 4DBNA 1YHVA 4F4PA 5J7BA 2H34A 2YDJA 3DQWA 1UA2A 4DC2A 1A9UA 4RC2A 5FEEA 4I5MA 2PE1A 2BZIB 4IB5A 3VWAA 5CEPA 2QU5A 4AXCA 3S0OA 3CPCA 3DT1A 3F2AA 4BZOA 4Y8DA 5H3QA 1JSUA 3QTSA 4NL0A 5JQ5A 1WVXA 3EKNA 2BZJA 4FNZA 1G3NA 2AC5A 2W1EA 4Y83A 2OSCA 4W9XA 3VHEA 2VTHA 4J98A 3KIOC 4EUUA 4DT8A 3QAME 2QOHA 2UW5A 1FGIA 2IJMA 3ALNA 2V62A 2YM6A 3BCEA 3K3JA 4DEBA 2YJRA 3FKLA 4TY1A 3V5LA 2GNHA 4RFZA 4E8AA 3ATSA 3C0IA 4N6YA 3QYZA 3KA0A 3Q3BA 5TT7A 2GPHA 2ERKA 3DGKA 1XH8A 5GJFA 3OWLA 3NDMA 4D1XA 1Q8ZA 3BLQA 3M1SA 4FBXA 4HGLA 5JFXA 5JEBA 1U5QA 2AUHA 2O5KA 3DBDA 3II5A 3P1AA 4I94A 2WNTA 4EZ5A 4YU2A 4JMQA 3NVKI 5EW8A 4D2PA 2CNUA 3R9RA 4OTIA 5JSMA 3PVBA 3TNIA 3VQHA 1WZYA 3QKKA 2W1HA 1DI9A 1Q97A 2OICA 4GK3A 4EOQA 3BL9A 5FM3A 5C01A 4IAAA 2CGVA 4XP0A 3NYXA 3F61A 4YMJA 4RQVA 2C6OA 2OO8X 3MB7A 2HZNA 3LJ2A 2BZHB 4H3BA 5DR6A 4U6RA 3UIMA 4FTAA 1SMHA 2XEYA 2IW9A 5IA5A 4BCPA 4AGWA 3VS5A 1FPUA 4BGQA 3A7FA 3CJFA 3HUCA 3GCVA 4GMYA 4X3FB 3IOKA 5M4IA 4H3QA 4QP6A 5DG5A 3KRRA 1PXPA 5FBOA 3MBLA 5KNJA 2A98A 2ONLC 1PF8A 1J7LA 1O6KA 4CV8A 4TPTA 3P0MA 4EC8A 2WPAA 5E4HA 4CCBA 4KKHA 3VHKA 4YPDA 3PWDA 4ZJJA 3AQVA 4YLJA 5I9VA 3PP0A 5TE0A 2XCHA 3HYHA 1KV2A 2PUNA 4N70A 1JKSA 3LQ3A 2XEZA 1Q62A 2WTKC 3KULB 2PHKA 3EQBA 3Q5IA 4XG4A 3SDJA 4QYEA 4LDTA 4RQKA 1P4FA 4D1SA 3ACKA 4EL9A 3WIKA 1F3MC 3QLFA 1YQJA 4IAYA 5CQWA 3ZLWA 3ZO4A 4QMPA 4BTJA 4D2VA 1M2RA 4HGSA 5J95A 4R7BA 1YDTE 3C4ZA 1OKZA 1ZYCA 3GBZA 4IX6A 4QQCA 4W8DA 3NYOA 2WKMA 4FL3A 4W9WA 4XOYA 2EWAA 3Q04A 1YWRA 1IR3A 2B9IA 4ITIA 3UZPA 3U6HA 5BYLA 3LMIA 1WAKA 5DPVA 2V0DA 4Y95A 2BDWA 4UWYA 2XM8A 2X6EA 2GNLA 5D7VA 4A9RA 4KIQA 4XV9A 5DMZA 4X2GA 3Q5ZA 4L3LA 3WZKA 3JPVA 5EI2A 5AIRA 5KZIA 4NW5A 4EH4A 5CENA 5A4LA 2JDOA 4EORA 3KCKA 1OIRA 4ZSAA 4XP2A 4BIBA 3OTUA 5EQPA 3DOGA 3OUNB 1H4LA 4R5YA 3FV8A 2W9FB 3GU7A 3MVLA 4QP1A 4CTCA 2YDIA 3EQHA 4O86A 4J8NA 3TKHA 1PYXA 4EHVA 2B0QA 3D15A 4QP2A 4EH2A 4IFGA 4NM0A 3GFEA 3RAWA 3JR1A 4JQEA 2QO7A 4CKIA 3P79A 5B2MA 3CSVA 3TNWA 4IVCA 4XX9A 3CXWA 2WOUA 5IQAA 4IADA 2CKEA 3NLBA 3EKKA 3VUMA 5AP2A 5C8MA 4C4FA 3FMEA 1QL6A 3IGGA 3PZHA 4F1MA 3BGQA 4FTLA 3HEGA 4R6VA 1KE8A 5ANDA 1NW1A 4KS7A 4K33A 1PKGA 1W2DA 2PZ5A 3CCNA 1DM2A 4KIOA 4LUDA 2ETMA 3OY3A 4RIXA 4AW1A 4F0IA 5L8JA 4HVDA 4FSWA 5M57A 4ZS4A 5CU4A 2QOIA 4D4YA 3G6HA 4DDGA 1OI9A 1PXNA 4WIHA 5FDPA 3EN5A 3F82A 4ORKA 2X7FA 4ZEGA 4AT5A 3BEAA 4C57A 4FKPA 3ETAA 3ZLXA 3KMUA 4XV1A 4AGUA 3A4OX 2ITQA 3V6RA 4E26A 4XHKB 4TWOA 2OXYA 3TTJA 2YWVA 3TDVA 1OPLA 4XOZA 3ML1A 2O2UA 2J0LA 3R8UA 5A4EA 3ORPA 4D4VA 4K77A 1ZYLA 2WTIA 4CMOA 4I92A 3IECA 1NVQA 4N0SA 4WD5A 3TN8A 4CMTA 2Z2WA 1GZ8A 5LOHA 3U6IA 1YOLA 4GU6A 4EH6A 2H9VA 3QALE 5FQDC 2IG7A 3ODYX 4HPTE 4QMZA 1NA7A 3ALOA 3K54A 2CCHA 4M67A 3BZ3A 3NW6A 4O6EA 3MA6A 4BWKA 5CVFA 1CKPA 3HGKA 2WMTA 4AF3A 4E4XA 1S9JA 2BR1A 2XRWA 4GKIA 4FIJA 1YXTA