3UG1A

Crystal structure of the mutated egfr kinase domain (g719s/t790m) in the apo form
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
322
structure length
296
Chain Sequence
b'EAPNQALLRILKETEFKKIKVLSSGTVYKGLWIPEGEKVKIPVAIKESPKANKEILDEAYVMASVDNPHVCRLLGICLTSTVQLIMQLMPFGCLLDYVREHKDNIGSQYLLNWCVQIAKGMNYLEDRRLVHRDLAARNVLVKTPQHVKITDFGLAKLLGAEEKEYHAEGGKVPIKWMALESILHRIYTHQSDVWSYGVTVWELMTFGSKPYDGIPASEISSILEKGERLPQPPICTIDVYMIMVKCWMIDADSRPKFRELIIEFSKMARDPQRYLVIQGDDEEDMDDVVDADEYLI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Epidermal growth factor receptor
publication title Structural basis for the altered drug sensitivities of non-small cell lung cancer-associated mutants of human epidermal growth factor receptor
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 86
structure length 296
sequence length 322
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2011-11-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3ug1A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3ug1A01
2X9FA 4K9YA 5JFXA 4W4XA 4PDYA 3RAIA 4ZLOA 2Z2WA 5ACKA 4KAOA 2EWAA 5IQHA 4CTCA 3M2WA 4PPCA 4FK6A 4TXCA 5I4NA 2W1IA 5EDQA 3COIA 4RWKA 3WIGA 3MFRA 3UIMA 3VF9A 4TZRA 3ZZEA 4O7TA 2C69A 1Q99A 3UMWA 2VX0A 2IW6A 3BI6A 4BZNA 3FLWA 4F63A 3TTJA 2YABA 4LUDA 1YW2A 3U6IA 2BZJA 1PMEA 4M0YA 2PE0A 3ROYA 4II5A 5HO7A 1ZY4A 4AF3A 3N9XA 3V5TA 2BPMA 2OJ9A 4XJ0A 2GS7A 5CXHA 4D0XA 4R5SA 2OIDA 1OIYA 2NPQA 4M84A 4I93A 2X7OA 3EQBA 1XH8A 4DFNA 2FSOX 2XNPA 4C3PA 3OXIA 1OIQA 5A4QA 2VTAA 2QU6A 4XRLA 3OF0A 3VW6A 3GC0A 5HG5A 5TO8A 4F9BA 2PUPA 2DUVA 2Y7JA 3WZJA 3UZPA 2ONLA 3ENHA 1UA2A 5HOAA 4ACGA 4L8MA 3MH2A 3ZFYA 1K3AA 3N4VA 2DS1A 3HMIA 2E2BA 3ERKA 2GMXA 4APPA 2YWPA 5CT7A 3RK5A 2UZWE 3A2CA 4QP4A 4L6QA 4DCAA 1YVJA 2OF4A 3BEGA 3W16A 5IDPA 2PVYA 1B38A 3OWPA 4FT5A 3HUBA 3JVSA 5D41A 2BUJA 3T3UA 3MVLA 4YJPA 5EHOA 3GC9A 4NCTC 4WBOA 3ZUUA 5BNJA 4AW1A 1GZ8A 4QPSA 5HG8A 4D2WA 1H24A 1V0PA 3PJ8A 4APCA 2CNVA 2Z8CA 4EOOA 5B2LA 2HIWA 2ERZE 2XNOA 3ODZX 2AC3A 4AAAA 2GS6A 2YM7A 3HECA 2NP8A 3MVJA 4G16A 5H8EA 3RBWA 1WVWA 3ZDUA 4AUAA 3FZTA 4PMPA 4QMLA 2VV9A 2C6IA 4YO6A 5EW3A 3D2KA 5EM8A 2F2CB 4FT9A 3BGQA 5JGDA 3EFLA 4QPMA 2UW7A 2ZV7A 5B0XA 4JXFA 2QC6A 4GFGA 1W82A 3WI6A 3RK9A 3QTQA 4HZRA 4TW9A 3PXFA 4G17A 1B39A 4IVDA 2WNTA 5IQDA 1R3CA 2XK4A 2YEXA 4PUZA 2CNUA 3R9RA 5EQYA 3GENA 3GOPA 3NMUF 3CGFA 4GVAA 4AG8A 2W96B 2HOGA 5CZIA 5E8UA 2C0OA 3ROCA 3HV4A 3BCEA 4XRJA 1U5QA 1JSTA 3ZZWA 1GAGA 3KY2A 3ENMA 3NYOA 4MEDA 4Q5HA 3C51A 3OG7A 1LP4A 3JR1A 2XF0A 3NNWA 4QMVA 2GDOA 2WU6A 1U54B 3D4QA 4ZXTA 3K2LA 2GNFA 4RA4A 3NCZA 1G8AA 3E8NA 4ZTLA 4ZIMA 3ID6C 4HGSA 4NM0A 4NEUA 4LUEA 2CKQA 3KEXA 3FMJA 4B8LA 2XIXA 5DA3A 4BICA 3IG7A 4DH5A 4E6DA 3W2SA 1RJBA 4ZY6A 4B99A 5CU6A 2EXCX 2PVMA 2QR8A 5HVKA 4QQ5A 2GNHA 4DC2A 2YM5A 2Y9QA 4L53A 2UW0A 4DFYA 3F66A 4H36A 1KOAA 5EM6A 4BGQA 3R02A 4O81A 3W2CA 3T9TA 3WF8A 1E1XA 1Q3WA 2WD1A 3E3BX 4I41A 3FZOA 3SOCA 2C3JA 4BCFA 5IEXA 3B8RA 3FL4A 5M07A 1JOWB 4NTSA 4TY1A 4DG3E 3QBNA 3EOCA 3S3IA 4USFA 5KBRA 3BYUA 5B2KA 5D11A 1PXNA 2VTTA 3NUUA 3BPRA 4MH7A 4HW7A 5DFPA 3PWYA 3G15A 4IIRA 3TJDA 5CI6A 4E6CA 5IQGA 4AX8A 2GHGA 5FEQA 1NVRA 3TWJA 4O7LA 3NW7A 4RJ5A 3RHKA 3S95A 4CFVA 2W06A 5DRDA 3TEIA 3WF5A 3M1SA 3E7OA 5IG1A 4X2FA 5D12A 2C68A 3QLGA 4XP2A 3TDWA 2JDRA 3R1SA 5CWZA 2CGXA 4KS8A 4FTRA 4E7WA 5ANKA 3P23A 2EXEA 4EUTA 1GIIA 4E5WA 2YLFA 3VAPA 4WG5A 4MKCA 3GI3A 5K0XA 2X6DA 2WTCA 5HKMA 4QMZA 3F3VA 3HV5A 4IAIA 4E4MA 3A7IA 4GS6A 4HCTA 4X3FB 3VVHA 2XM9A 1PMVA 4QTDA 4W8DA 4B7TA 1WAKA 2PSQA 2PZYA 3SXRA 3LMGA 3DNEA 4TWOA 1WBNA 3W2RA 4YJQA 4PMTA 4F0IA 4FNYA 3NUSA 4X3FC 5M08A 4AZTA 4E8AA 1BYGA 5T68A 2PULA 3KXNA 3I5NA 4MTAA 4E4LA 2VD5A 3OCGA 2W05A 5KKRB 4IVBA 3LPBA 3QTZA 4NK9A 5CVHA 4JDHA 4L43A 4YZDA 3OBGA 2ITXA 4CMOA 5KCVA 4IDVA 4MXOA 4R77A 3P79A 5D10A 3D9VA 4XLVA 1OIUA 1REJA 3GFWA 1YXXA 5IU2A 3IOKA 3ZU7A 2UZOA 3TV4A 2ITVA 2PMLX 5AAGA 4CQGA 4NM5A 3Q5ZA 3E63A 2GNGA 3R9DA 1G3NA 2OJFE 1U5RA 2VWXA 5A46A 3ATTA 3R01A 5B7VA 4NFMA 4ITHA 5AV3A 5BUIA 4PPBA 3EB0A 3LXNA 2XJ2A 5EG3A 2XKDA 4EH4A 2VTIA 4BWPA 3IGOA 3PY0A 2JEDA 2CKPA 3F6XA 4ZSAA 4D4SA 5JZJA 1WCCA 1BI8A 4AZFA 3PG3A 2RG6A 5AR4A 1BL7A 3VNTA 4ZJIA 4FTKA 4O6LA 3NR9A 3ZEPA 3BIZA 3PYYA 4FOBA 4FGRA 3FHRA 4BGHA 3OOMA 5I3OA 4AA4A 4O0RA 3EZRA 2LAVA 4M15A 5CSHA 1Y8YA 1PY5A 3PY1A 4NCTA 4XP3A 4ZTHA 4BR3A 5CVFA 2OZAB 3QD3A 2ITUA 4C62A 3QA8A 5ANEA 4EOLA 3WF6A 4XG2A 1MUOA 4O0UA 4XNEA 4A4OA 1PRYA 2VTHA 2PE2A 4D55A 4NW6A 1XH9A 2ZJWA 3R1NA 3KK8A 2BDWA 4V05A 5HTIA 2A0CX 2XVDA 4GYGA 3AD6A 4FV4A 1QCFA 4XYFA 1CKPA 2OO8X 3TV7A 2H8HA 2XBAA 4O27B 5FDXA 3UODA 5CTPA 2J2IB 4HVDA 5LWMA 4G1WA 3ZLYA 4O84A 4BYJA 4CMTA 2P3GX 1ZYDA 4FSZA 3SQQA 4YMJA 2XZSA 2E9PA 2HELA 4U42A 3TZ9A 5JQ5A 4E73A 1A48A 4DGLC 4C36A 1YOJA 2QOHA 5IMEA 2QOFA 4UZDA 5HVYA 3BHHA 2F9GA 3D15A 3QQHA 4MBIA 5ANIA 4JOAA 4LFIA 3UVQA 2C5YA 2Y4IB 1PKDA 4QMXA 3D5WA 4BIEA 1KOBA 3PIZA 3QCXA 4I6FA 1OI9A 2HZIA 1H25A 3CE3A 4BL1A 4BHZA 2ZV8A 4E4XA 1ZMUA 3UMXA 1IA9A 3PXKA 1YHVA 3PVWA 3VBQA 4IX5A 5KUPA 2Y4IC 5BVNA 2KTYA 4MBLA 5KBQA 4J95A 4GJ2A 2ERKA 4ANMA 4FIFA 4GV1A 3DXQA 4QMPA 3QRJA 4S32A 5GNKA 4DTAA 4MAOA 4ZLYA 4ANBA 4O7RA 4AZVA 5CENA 3R8LA 3HMPA 4TWCA 4XG6A 2XK8A 4F1OA 2REIA 1OL5A 4USDA 2B9IA 2YM4A 3W10A 1Q41A 2EVAA 3VS5A 4L42A 2XUUA 4WNOA 3LCKA 4XG8A 4FL2A 2VTQA 3AOXA 3OROA 2VWIA 2W1EA 2WHBA 3R2YA 4L3LA 4YR8A 3WYYA 3KXZA 4O21A 4TRLA 1DI9A 1Q24A 5HO6A 2XKCA 4AT5A 3QTIA 3DB6A 5E8YA 5FBOA 4MXZA 4WIHA 5J1VA 1Q97A 4UBAA 4CFXA 4PF4A 2QOIA 3FLQA 4EH5A 1OKZA 2BAQA 4L01A 3WF9A 4H1JA 3CPBA 4QTBA 2QG7A 4G9RA 5LVNA 4GU9A 1KE6A 2OIBA 4WRSA 3LJ2A 3EQPA 3SOAA 1MQBA 4WA9A 3UOJA 4IX6A 3JPVA 4FNZA 2JKQA 4N4SA 4GT5A 2B7AA 1WVXA 4ID7A 2UW6A 3OMVA 1YDTE 3R73A 2XIZA 2I1MA 2J90A 3QA0A 1MRUA 3QU0A 4JQ8A 3C0GA 4TPTA 4FV6A 4WO5A 3NUYA 4C3RA 5CANA 4NIFB 2W0JA 5H8GA 3VBVA 4ZY5A 1E9HA 1OL7A 4BTFA 2QOOA 1SVHA 1UU3A 2NO3A 2YFXA 2PVFA 3UC3A 3O23A 3CY3A 3SA0A 3MI9A 4G6LA 2QOLA 4FICA 1W84A 5EH0A 3FPQA 4ACHA 2Z7RA 3MJ1A 4WNPA 5K4IA 3COHA 4JI9A 4F9WA 3A60A 3IPHA 2W1GA 3PPJA 4X3FA 5CEQA 4ONAA 4YNEA 2X6EA 4E26A 3V5PA 3MVHA 3HA6A 4R1YA 4BZOA 3PXRA 3QRTA 4JS8A 3VJNA 3ATSA 3MESA 4KBCA 4BYIA 4PP9A 3LXKA 4B0GA 1TQIA 2WTIA 4MD8E 2W1DA 2VZ6A 4I4EA 4Q2AA 2FGIA 3PZEA 3RAWA 5A9UA 4FSYA 5FTGA 4Z7HA 4RLLA 3UC4A 2PMNX 1OKWA 4F7SA 1YXVA 4CSVA 2JKMA 3BHTA 5CF6A 5D7AA 3NYVA 2HENA 4TWNA 3LXLA 3LMHA 4S34A 2V62A 2E9VA 5CEPA 3RALA 1NXKA 2YM6A 4C4FA 2B9JA 2KULA 3W2PA 2YN8A 1Q3DA 3IDCA 4Z7GA 4AZSA 5EKOA 4DFZE 1OPKA 5D9HA 5ETCA 4QT1A 5HIDA 4CCUA 2C6TA 2H96A 2IVSA 4C8BA 2QOCA 3RPYA 2Y8OA 4FTQA 1QPCA 5HBHA 4EOSA 5DMZA 2CMWA 2IPXA 5H9BA 3CSVA 4XLIA 3I6WA 4JBPA 1J7LA 4X0MA 4W4WA 3OTUA 3P4KA 3WILA 4EONA 3SVVA 4DTBA 4D2TA 4CFWA 4O6EA 4QP6A 4GVJA 4C02A 1ZXEA 1ZARA 3ZSIA 3TT0A 3OVVA 3PP1A 3RAKA 2ZM4A 2F7ZE 3WBLA 1CTPE 1NT2A 4RC4A 1SM2A 3NUPA 4X2JA 3IW5A 4FKLA 3PG1A 4CTBA 4YZCA 1YQJA 3BU6A 5IPJA 1STCE 3QXPA 3Q32A 4QMOA 2GNIA 3BYSA 3HDMA 4RJ6A 4DG2E 5HX8A 4IAKA 4D1SA 2OZAA 3DGKA 2YM8A 4C2WA 5HBEA 4EEVA 2JDVA 4KIKB 5LCJA 4FSWA 5FTQA 3UNKA 2R3GA 3KN5A 4IAFA 4BCGA 3GNIB 4R3PA 3GU7A 3AD4A 4L67A 2WMQA 4IQ6A 5AV2A 5HG7A 3DTCA 1H1WA 4GCJA 5IMXA 3KK9A 3LFDA 3DZOA 3B2WA 4ZSLA 1U46A 3F7ZA 4O0XA 3FZSA 4MHAA 3A62A 3EQHA 3F61A 4CFFA 2OIQA 2C3LA 3K5UA 1XKKA 2UW8A 1XHAA 4FIEA 3ZC5A 1H07A 3MWUA 2JBOA 2X7FA 4MWHA 4DEAA 1T46A 1UU9A 5EOBA 3VBXA 1UVRA 3OZ6A 4UMQA 3U9NA 4O86A 2B1PA 2CPKE 3ORMA 5BVKA 5HZNA 5F1ZA 2HZ0A 2IJMA 5ETIA 4EH2A 3DT1A 2V5QA 3DDPA 3MW1A 4FEXA 1R39A 5FEDA 3QUDA 4KINA 4DH8A 2IG7A 3VUIA 2R3IA 2FSTX 4FSUA 4O0YA 4ZOGA 5A6OA 2WQMA 1YHSA 4ASEA 1ZMWA 4F65A 4WNKA 5AR2A 4HCVA 3QKLA 3LM0A 3BBWA 3QYWA 1OECA 2Q0BA 3BKBA 2QURA 2YJSA 4I21A 2WPAA 4IM2A 4NUSA 4ZJJA 4CVAA 2Z60A 4UV0A 4PRJA 4F99A 2ITTA 4GK4A 4BBFA 4QYGA 2YACA 3EKNA 3VQUA 3FXWA 3WOWA 2VGPA 4I3ZA 2ZM3A 4J7BA 3RKBA 3MYGA 3V5LA 5LCKA 4CNHA 4YLJA 3HUCA 1GOLA 2OZOA 4H3PA 4FVRA 2BTSA 3C5UA 3H0YA 1CMKE 2YHVA 2VWZA 5LVMA 3V5WA 2UV2A 3C0IA 3BV3A 2YJRA 1A06A 2W1FA 3GFEA 4RVMA 4KIQA 3UE4A 3ZDIA 3Q6WA 5AJQA 4F1MA 5AIKA 1REKA 4RVKA 5BYLA 4YNOA 3O51A 4Y5HA 4YC6A 4CKRA 4RX5A 3IQ7A 5HNIX 2C47A 3FKLA 3UDBA 2JIIA 4OTRA 4FT0A 3G6GA 3NYXA 5C8MA 5JK3A 1JWHA 1ZOHA 4RWJA 3DBEA 1JLUE 4RIXB 4G34A 2XK6A 4NFNA 5TE0A 4B9DA 4EKLA 3E87A 3QC4A 1UNGA 4L44A 1ERKA 3TN8A 3T9IA 4GIHA 5J8IA 4AXAA 1Y57A 4P5ZA 4BHNA 4F0FA 3OXZA 3PPZA 4LGGA 3DAKA 2PTKA 4RX8A 3Q4UA 4UMPA 5JN2A 5CQWA 3LHJA 4FZFB 3GCVA 4W9WA 3TV6A 1OPJA 3HV7A 2CN8A 2VX3A 4S31A 5EW9A 5DR6A 3SRVA 5EK7A 3ANRA 4B6LA 4OTIA 4AW0A 4D9TA 4CKJA 4DGOA 3G9LX 1OPLA 4D2SA 4QMNA 4QQJA 3RWPA 4XX9A 2B53A 3FHIA 3N4TA 4JQEA 1ZYSA 4QQCA 3TI1A 3WE4A 1XR1A 2FSLX 2OI4X 3FKNA 3QCYA 3THBA 2C3KA 4DH1A 3H10A 3GU8A 2E9NA 2Y0AA 2XKFA 2XNNA 3RPVA 3IDPA 3OHTA 4F70A 3FQSA 4C3FA 1WBPA 5L8KA 5CU0A 2R3FA 4X7QA 5AP1A 3EQCA 1HCKA 3PJCA 5M51A 1Q8WA 1KE5A 2QCSA 2XIYA 3PPKA 2CHLA 4DH3A 3Q52A 3R6XA 4YGAA 3Q04A 4BCHA 4JBQA 5HE1A 4BCMA 4PMSA 4ZS0A 4U79A 2W9FB 3E64A 4PWNA 3UVRA 4BDKA 2VO3A 4MQ1A 4A4XA 4FR4A 1R0PA 5LMAA 3U51A 2UUEA 2C6EA 2CCHA 1ZZ2A 2BZIB 2C6LA 5TT7A 3MPMA 1J91A 2XRWA 2F7EE 4OBOA 3TNHA 3VWAA 4FKVA 2Z7QA 1XWSA 3AC3A 3QQLA 4Y95A 5GHVA 3V8TA 4YTFA 5IA4A 4CLJA 2QODA 5AUXA 2IW8A 3PDTA 5CASA 2UW4A 3R7YA 1B6CB 1WBWA 2F2UA 5J95A 5FM3A 3UQGA 3S00A 4B8MA 5BMSA 1OMWA 2PY3A 4FODA 3RWQA 2IVTA 2JIUA 4NH1A 1ZYCA 2QKRA 3CQEA 3MH0A 5CSPA 5IQIA 4FIHA 1H26A 2QO9A 3GP0A 4I92A 4LQMA 4U41A 4IAZA 3VIDA 3FLZA 4O7WA 1TQPA 3FMDA 3WZUA 4JIKA 2HY0A 4DG0E 2VN9A 5JH6A 3P7BA 4XCUA 1FGKA 4FSNA 1Q8YA 4QP2A 2ZMCA 3TDVA 2XNMA 3D14A 4BKYA 3RM7A 3UG2A 4CT2A 1WZYA 3I5ZA 5CU3A 5G6VA 3NZ0A 2XS0A 2OG8A 3COKA 4GH2A 4I0RA 4MF0A 4D2PA 4F08A 4KS7A 5FXSA 3FDNA 4EK8A 3LCOA 3QC9A 4G5JA 2ITNA 4R7IA 5CYIA 4FSMA 3VO3A 4A9RA 5CF5A 4BCPA 5JZNA 4QPAA 3NRMA 2R3PA 4FKUA 4KIKA 3VBYA 4AOTA 3DBCA 5I3RA 3DKOA 3JS2A 4BI2A 4ANOA 5A4TA 3GQIA 3TXOA 2WAJA 3F3WA 3O8TA 3BX5A 4RFYA 4U5JA 2YCRA 2XRUA 3E3PA 4FZ6A 3FWQA 5HTBA 1GIHA 4U45A 2PZ5A 1LUFA 4E1ZA 4FTAA 4YJNA 3AD5A 3C4XA 5HORA 3R63A 3TM0A 3R7OA 3LLTA 4BIBA 4R1VA 1JKLA 5HNGA 4N6YA 4NM3A 3OWLA 3R7VA 4WT6A 5K9IA 3MH3A 5E91A 2PVKA 1O9UA 1SMHA 4KNBA 4FEVA 4JX3A 1I44A 3NS9A 2ITPA 3LW0A 1J3HA 2B0QA 5AV4A 3R2BA 4L46A 3SW7A 1PYXA 2J0JA 3W55A 4DLJA 4UALA 4WRGA 3ZXTA 1PYEA 4MD9E 4AFJA 2R7BA 5M4UA 4KBAA 2ITQA 3S2PA 1FMKA 4AW5A 4CV8A 3EIDA 4EOMA 2QQ7A 2WQOA 3CEKA 3MA3A 4X2NA 3LIJA 3BE9A 3CTHA 2BMCA 3JXWA 5KHXA 1DS5A 5K0KA 5IISA 1GY3A 1PXMA 2XA4A 4I5PA 4A9SA 3C0HA 4RPVA 5TF9A 2GFSA 2VO7A 3DBFA 3PLSA 3W1FA 4F4PA 1GZOA 4I4FA 4LMNA 5HQ0A 5M53A 4OBPA 3ULIA 4EWQA 4ANNA 1JVPP 4DEDA 3U4UA 4M69B 2X9EA 4PTCA 4U81A 4K1BA 3NSZA 2J50A 3F3UA 4IZAA 4C4HA 4K33A 4E20A 5M4CA 4BVUA 4J96A 4FKPA 3UOHA 4HJOA 5DN3A 2OLCA 4UMRA 1PMNA 5IA2A 4MWIA 4BDEA 5ETAA 1ZYJA 3OP5A 4F6UA 3UNJA 4P5QA 1V0OA 2YCFA 5F4NA 4QRCA 3VS2A 1ZAOA 3EYGA 2JIVA 2Y4PA 3NEWA 3TNPC 3LKMA 5IQBA 4EC9A 2R3KA 2Y6OA 3MFUA 4I94A 4RIWB 3PXQA 4CZUA 3Q4CA 1KUTA 3FL5A 1UWJA 3A7JA 3ZH8A 3UYSA 3CBLA 4ACCA 3FI2A 3NW5A 3FPMA 3E7VA 5DEWA 1ZOGA 4YTIA 3CPCA 3PE1A 3ZLSA 4QO9A 4M67A 3W18A 2RFEA 1IAJA 4NT4A 3LQ3A 3QQJA 5EHLA 1XH5A 2PZRA 3JY9A 4QMMA 2B9HA 4W4VA 3ZRLA 2IN6A 5E8SA 1MP8A 1YXSA 3F5UA 3II5A 2WZJA 3DCVA 3ZUVA 4XUFA 2VWWA 1LEWA 2R3OA 4I22A 1GNGA 4DYMA 3KL8A 4O1PA 4RFZA 2X8EA 3D7TB 3NVMB 3ZSHA 4YLLA 2EU9A 2G1TA 5IQAA 3CCNA 5CALA 5JT2A 3F7WA 3QD0A 3VHEA 4GRBA 4O7YA 3QZIA 1M2QA 3QUPA 3R7UA 2CGUA 4IACA 5J9ZA 3ETAA 2XCHA 3C4EA 3OEFX 3P7AA 4M7IA 5LWNA 2W5BA 2ITWA 3H9OA 5IF1A 1W83A 4FZ7A 2JFLA 4K2RA 4HYUA 2P33A 3RM6A 3S0OA 1OVEA 4UYAA 2FB8A 4OLIA 1KV1A 3QF9A 2VO0A 5CNOA 4AGDA 3DKFA 5M56A 2YIQA 3I7CA 5HCXA 3GB2A 1F5QA 3W8LA 5L8JA 2VU3A 2DQ7X 4EH9A 3QX2A 2YERA 3L8PA 3RCJA 3HRCA 2YDJA 3QAME 4FL3A 4E5BA 2PWLA 2ZV2A 3S1HA 5CS6A 4ANLA 5EOLA 1MQ4A 4KB8A 5E8VA 4KSQA 4JRVA 4C34A 3G0EA 2UZLA 2X2KA 3QD2B 4EYJA 3MH1A 3LOKA 3R00A 4G3DA 4YBJA 3EJ1A 4GEOA 4ZSGA 2YCQA 4AGCA 3ZFMA 3GUBA 3K3JA 3BHUA 2XJ0A 3MTFA 4R5YA 4HNIA 3QTWA 4J53A 3NNXA 3OBJA 3GU6A 3RK7A 2C5NA 2UZVA 4QNAA 1LPUA 4FMQA 5HIBA 4Q9ZA 5GIOE 1T45A 3ORTA 5HE2A 4J52A 2W7XA 2V55A 3TIZA 5ANGA 4EOPA 1BL6A 4FKWA 4FKSA 4Y5QA 3CP9A 2I0HA 3LFFA 2QONA 2PVNA 4HGEA 3D83A 4FTLA 4U9AA 5AUZA 4A4LA 4TWPA 4M8TA 5DNRA 2HXLA 5F95A 3VRYA 2XYNA 4ZZMA 3BZ3A 2B54A 3NX8A 4EZ3A 4IAAA 2C6DA 4GMYA 4EQUA 3QCQA 3AC2A 3QUEA 3PTGA 5FP5A 4ZLZA 3UO4A 4M14A 3MJ2A 3OCTA 4I0SA 1WBTA 4RQVA 5HU9A 3P86A 4FZDB 4YZMA 3OUNB 1U4DA 5E8XA 4PPAA 5D7VA 5E92A 2X7GA 4L7SA 4RIYB 4JDKA 4F1TA 2OGVA 5CAOA 2VTSA 4OT6A 5AUWA 5EDPA 3KGAA 3HA8A 4QYFA 5KKRC 1JKKA 2HYYA 2WFYA 3FMLA 5J7HA 4IADA 2WMXA 4WD5A 3COMA 2W4KA 3DDQA 2W99B 2GCDA 2ZAZA 3ORLA 4KABA 4A7CA 2YIRA 2PHKA 3BLRA 4O38A 4EOQA 3NLBA 4L68A 3OWKA 2X8DA 3CY2A 4YZ9A 3ZXZA 4BB4A 4DBNA 4OW8A 1ZWSA 4NU1A 4W9XA 2J51A 4H3BA 2IZTA 2CLQA 5IEYA 5C26A 4FTOA 4FVQA 3E8CA 3F88A 4QYYA 2F4JA 2WEIA 4RZVA 3MB6A 5CNNA 3R7IA 3R1YA 1KSWA 4W4YA 5M06A 4DGMA 5HEZA 4FKQA 3C4FA 4CFUA 2PMOX 2BHEA 3V6SA 4QMTA 3AMBA 5HHWA 3QWJA 4G9CA 4C58A 3WYXA 3HVCA 5AADA 3C5IA 3MFSA 2BAJA 4UX9A 4LOOA 5HCYA 2GFCA 1BKXA 4MD7E 4TYJA 4F6WA 3EWHA 5L2IA 3LFQA 2JITA 2OFVA 2XEYA 3SV0A 2GU8A 3RZBA 4AA5A 2WMBA 3VHKA 4YJRA 4RJ4A 5FP6A 1L8TA 5IA3A 4L3PA 3ZS5A 4P4CA 4XV3A 3PXZA 3P5KA 3IDBA 3BLQA 3QZHA 3A4PA 4GUBA 2J0IA 5ANDA 3MSSA 5CEMA 5HGIA 1W0XC 3O96A 4M69A 1OIRA 3O7LD 3EQGA 2UW3A 2UVXA 1M2PA 3MY5A 2WMSA 1FVVA 5BYZA 1ZZLA 3R8VA 4IX3A 2O0UA 2VX1A 3ET7A 4AWIA 2QG5A 3PJ3A 4HGTA 2UVYA 3KKVA 4FV5A 4N70A 4ENXA 5AIRA 2YWVA 5JFSA 3FI3A 3KXHA 4NSTA 5CAVA 4M66A 1O6KA 3HDNA 4R78A 1PXKA 2O3PA 4ZP5A 3OW4A 5C8NA 4GSBA 3F2AA 3I6UA 3S4QA 1S9JA 4ZTMA 4C0TA 5AR7A 2IO6A 5M4FA 3R9OA 2BCJA 3DBQA 3KXXA 5T6KA 2YZLA 1H8FA 4QNYA 4O0VA 4XMOA 4EHEA 2CNQA 4EI4A 2XB7A 5J79A 3DAEA 4RWLA 3FY2A 5E90A 1OL1A 4OBQA 1DAYA 3FV8A 2WO6A 5HG9A 5LXMA 4BBMA 5IUHA 1QPDA 1U54A 1H1RA 4WNMA 5EQEA 1SVGA 1FVTA 3IECA 4D2VA 5EI2A 3UJGA 4EK5A 4R8QA 1XBCA 1LEZA 4K0YA 3JUHA 4YLKA 5D1JA 4OGRA 1YI6A 2PE1A 4FSTA 2G01A 3W33A 3ZTXA 3L9LA 2CSNA 5M55A 4O7SA 2GPHA 4CG9A 3F82A 2I40A 5DEYA 2JAVA 5CVGA 3OTVA 4Z9LA 3TKIA 4F9YA 4AN9A 3FLYA 2WTKB 3BGPA 2HAKA 3DLSA 4L9IA 4NTTA 3POOA 1RE8A 2PU8A 2RFSA 4KA3A 2IW9A 5G1XA 2OU7A 3FEGA 2ZMDA 4PL5A 3Q5IA 4EBVA 2O2UA 3SC1A 1QPEA 2JKOA 3GOKA 4V01A 3R28A 3CJGA 4FG8A 3HP5A 3UQFA 2WTKC 1PHKA 5I9YA 3HMMA 1URWA 1V0BA 4NM7A 3RP9A 3EQFA 2J0MB 1CSNA 3E8EA 2VWBA 4ASZA 5DG5A 1FVRA 3EQDA 4I5CA 2J0KA 4FV2A 4WSYA 4XP0A 2O8YA 5GZ9A 3HEGA 3HRFA 3I7BA 4X6RA 4O0WA 3GC8A 2WQBA 4KBKA 3PLAE 3VS6A 3KRWA 2W1HA 1VJYA 5CU2A 3KMUA 5C8KA 3KVXA 1NVSA 2F7XE 2PPQA 2XNBA 2JDOA 4KKGA 1GZKA 2GNJA 5E9EA 1TQMA 3R8PA 5LVPA 4RLKA 4LRMA 2CKOA 5DIAA 5AP4A 2J9MA 3BWJA 3ZO1A 2XK3A 2FO0A 1UNHA 3FXZA 4I23A 3WIKA 3TUBA 4JQ7A 4PNIA 2X2MA 2OW3A 3DXNA 1P2AA 4J97A 4MK0A 5CT0A 4Y85A 3N4UA 5JRSA 2WOTA 4TYIA 3Q2JA 3W8QA 5I0BA 2WGJA 1CKJA 2BILB 3DQWA 2WMUA 4P2KA 3P78A 1FINA 3ZFXA 2G2FA 3CQUA 1P5EA 1WMKA 2JFMA 3BYMA 3KRXA 1JPAA 4AACA 2IVVA 1JBPE 4BZDA 4IB1A 4YSMA 3TNQB 4IXPA 5CQUA 5KE0A 4IM3A 2WTDA 3EHAA 5ACBC 3U9CA 3PE2A 4FIIA 2QNJA 2JBPA 2ZDTA 4Y72A 2VTPA 4JBOA 3E5AA 4G3CA 3HMOA 3QRIA 2WMRA 4FNWA 1XBAA 2PVRA 4D4RA 1G8SA 3FMMA 4EH8A 5LARA 4P7EA 5L3AA 3EN7A 4TKSA 5HD7A 1OUKA 2C5XA 4G3EA 3EMGA 4EHGA 3L1SA 4HVSA 5IH6A 5IQCA 2R0IA 4CXAA 4E4NA 1XH4A 3FE3A 1RW8A 2BR1A 4IWPA 2PVJA 4NKSA 3OT3A 5HO8A 4AW2A 4CG8A 3KF7A 3ZLXA 3HKOA 4AFEA 2WQEA 4FIGA 5CAQA 4X2GA 1Q5KA 2X0GA 4HOKA 5GZAA 3PUPA 5JFVA 4HCUA 3UOKA 3EQRA 2QLUA 4RRVA 3KULB 3LFSA 1ZOEA 3PVGA 2BDFA 3HLLA 2A2AA 5TOZA 1IAHA 4G5PA 5FBNC 3FJQE 5EKNA 3D0EA 4E3CA 4BTKA 2R3RA 4ZEGA 4FKTA 3GU5A 4MQ2A 2WTJA 4ANQA 3VBWA 2QR7A 4PDPA 1JAMA 4FV1A 4QP3A 4BIDA 1NVQA 4ZY4A 5LVLA 3AXWA 4R6VA 4D5KA 2XK7A 2PYWA 1JQHA 4Z16A 1YRPA 2OBJA 3MA6A 5KZ0A 4ZZNA 3NNUA 5CAUA 3C4CA 3QRUA 1ZMVA 3O50A 5EYCA 3KMWA 4BDCA 2WU7A 1PXJA 3OWJA 1WBVA 2C5VA 4C4JA 5DVRA 1J7UA 4X2KA 5CEIA 2O63A 5A4EA 2ZOQA 1BLXA 2J5EA 3DK7A 3OS3A 3LJ1A 1APME 4I6HA 4NL0A 3V8WA 4YHFA 1QL6A 1ZLTA 1JSVA 3KN6A 3NNVA 4D1XA 4HVIA 4HVHA 3MY0A 4XHKB 2YM3A 3DOGA 4KIOA 4L7FA 3UZRA 4TT7A 4MF1A 4Z3VA 3O8PA 4OTGA 2ZDUA 4JG7A 2E9UA 3H0ZA 4G3GA 5BVOA 1R1WA 5K3YA 4PL4A 3IONA 4RMZA 3ZO2A 2QOBA 5AUYA 4BWXA 1OL6A 2BRBA 1UU7A 4LV5A 5T3QA 4AA0A 5LJJA 1PF8A 1YDRE 2G9XA 5AP5A 3DJ5A 4LG4A 4GT3A 5L6WL 4IBMA 5IA1A 4IW0A 1URCA 1H1QA 3QTSA 3O8UA 3H9FA 5BVWA 1K2PA 1P4OA 4KRCA 3SX9A 5EQPA 2GQSA 3HYHA 1M2RA 4PL3A 4WUNA 4QQTA 2FSMX 1UU8A 3P08A 5I9ZA 2FYSA 2C0IA 2ITYA 1OKVA 4QYHA 4TYHB 3LFCA 2RL5A 5BMMA 2OXYA 2C3IB 2LGCA 3O71A 4R7BA 4YSJA 4EL9A 2VO6A 2G2IA 2XMYA 3EH9A 3FY0A 2P0CA 2A1AB 3GCUA 4FSRA 1H1PA 3Q96A 4GUEA 4IH8A 4JG6A 2OWBA 2Z02A 2RSVA 4IC8A 5E1SA 4GK2A 4BGGA 4OAVB 4M12A 4DF3A 4I0TA 3AMAA 3L9NA 4XV2A 5HE0A 1BUHA 2QVSE 3FKOA 3G6HA 5J87A 2I0EA 3FQHA 4DHFA 5M09A 3UNZA 4GFOA 5A4CA 1V1KA 3L9MA 5CEKA 2V7AA 3VULA 2OJGA 3QZGA 1TKIA 3FAAA 4S30A 1SVEA 1OL2A 2ONLC 4FV3A 2ZB1A 2GTMA 4U3YA 2RFDA 2XYUA 4AGUA 2FVDA 3OXTA 3PIXA 4L52A 4FV7A 4E5AX 2P55A 3UOLA 3TACA 3E92A 5AP2A 3U55A 4JR3A 5CF8A 3NWWA 2AUHA 5DBXA 3UBDA 2W17A 4O2ZA 4C37A 2BKKA 2WQNA 3MDYA 4M13A 3ZYAA 5C27A 2CDZA 4OTWA 4LGHA 3U54A 2W5AA 3NDMA 5BX0A 4S2ZA 5CI7A 2VAGA 4DEGA 3FC1X 5FRIA 3TNWA 2J4ZA 2C30A 3R1QA 4MVFA 3RHXA 4CFMA 2O5KA 2XH5A 3FMHA 4MX9A 1MRYA 3D5UA 4NIFA 3WE8A 2IZUA 3D2IA 3Q53A 4UZHA 5LOHA 5F94A 4IZ5A 3VS1A 4HYHA 3HGKA 4ZJVA 4K11A 4ERWA 3MBLA 4OAUC 2V0DA 4FVPA 4BDJA 3JYAA 4E93A 5FDPA 2OH0E 2WIHA 3AT4A 3R7EA 5F9EA 5C01A 2YISA 4MNFA 3LM5A 1NA7A 3HX4A 1H28A 3DV3A 3NUNA 3ORPA 4MCVA 5EFQA 5GJGA 4A9TA 4FE2A 4FK3A 3TKUA 5HIEA 4J99A 1Q8ZA 4FYNA 4RX7A 5IH5A 4FKIA 1FBNA 3HP2A 1FPUA 1WBSA 1E1VA 4ENYA 5AM7A 3RCDA 4JR7A 4LI5A 5KZIA 4AN2A 4RFMA 3JVRA 5HD4A 1NW1A 5DYJA 4FC0A 4JDJA 4UXQA 4C4GA 3EN9A 3GCSA 2WTWA 4FIJA 4UXLA 4EQMA 4LL0A 3E88A 2ZVAA 4G6OA 3MVMA 3EFKA 2UZTA 4OR5A 4GFMA 2X2LA 2UZUE 4FTUA 1W7HA 4MNEB 3RZFA 3QHWA 2VTNA 4I1ZA 3PIYA 4CLIA 4PTEA 4DFLA 4J71A 2E9OA 4A9UA 3RMFA 3MY1A 3VBTA 3GCQA 4QTCA 5IQFA 2QI8A 3KMMA 2CN5A 3QGWA 4R3RA 3ODYX 4FKJA 5B2MA 4M3QA 3SHEA 3QXOA 4ZMFA 4RBLA 4F64A 2IZRA 4JT3A 5EI8A 5ITAA 2RF9A 5DT0A 2WMVA 3IGGA 3O7LB 4YJVA 1W98A 3LCDA 3ALNA 5LMBA 2PUNA 4BCIA 1OKYA 2HW7A 5JKGA 4IWOA 5JFWA 5I5ZA 4MXCA 3RINA 2BVAA 4ZSJA 3R22A 3G90X 3KREA 3F3TA 1XJDA 1KWPA 2JDSA 4A06A 5BQ0A 1QPJA 3VF8A 4XBRA 4LOPA 3KULA 3OC1A 3POZA 4FZAB 5A54A 4U43A 1ZYLA 2SRCA 5IA5A 3U8WA 3WZDA 3ZONA 4HVGA 2Q83A 4F7JA 3ORZA 5C9CA 4EH3A 1AGWA 2G2HA 4XG4A 4D4YA 2XCKA 5L4QA 4YPSA 2CLXA 4WSQA 5LVOA 2W1ZA 2PL0A 4WOVA 2WTVA 4O82A 3FLNC 3IW6A 3NAYA 2OFUA 3CD3A 4A9YA 3REPA 3NIEA 4BBEA 3Q2MA 4D1ZA 2WELA 4AT3A 3O2MA 3UPXA 4P90A 1OB3A 2X39A 4EC8A 5AX9A 4EORA 4DEBA 2R3QA 4O22A 2J5FA 4DFUA 2XIKA 4BRXA 2X4ZA 3ZRKA 3R8UA 2QU5A 4O0TA 1AQ1A 4BDFA 5EW8A 2XEZA 1XO2B 3MPTA 3VUDA 3ZC6A 1YDSE 4EJ7A 4UWCA 3PRIA 2AYPA 2EXMA 1UV5A 2A27A 3OT8A 2HY81 4I20A 1IA8A 1YWRA 4KIPA 4XOZA 4MXAA 4YHJA 3CJFA 3ZHPC 3VS0A 4UMUA 4FF8A 4MXYA 2EB2A 3DY7A 3NW6A 5A3XA 4LM5A 4FEUA 2GTNA 4FBXA 4TTHB 3RTPA 3GXLA 3QLFA 2V22A 3OCSA 4OTDA 4ZK5A 5FD2A 3RNIA 5GZ8A 5K5XA 3HV6A 4LRKA 2BRMA 1H1SA 2YAKA 3FZ1A 1L3RE 3ZUTA 4GW8A 3FMKA 2XK9A 2X81A 3HZTA 4H58A 4MXXA 4XG9A 4W8EA 4EOJA 4JJRA 5C1QB 3Q4ZA 5L6OA 2BZKB 4U80A 4BCOA 3WARA 3UPZA 2VWVA 1DAWA 2C6OA 3LE6A 2HWOA 3G0FA 4XH6A 2H34A 2NRUA 3QZFA 2Q0NA 4TYHA 4EBWA 2PUUA 5HBJA 1OBGA 5GJFA 2I7QA 2QO7A 4ZTSA 5DR2A 5FTOA 3EL8A 4FV0A 4TYEA 3FUPA 3LJ0A 3ORKA 2BRNA 2YA9A 5EDRA 4D28A 4R3CA 5DWRA 3F3ZA 3V04A 3O17A 4CRSA 3UO5A 2PMIA 4BDIA 4BDHA 3E8DA 4AGWA 3A8XA 3FYKX 3CD8A 4JIAA 4YZBA 1H0WA 2C5OA 3BLHA 1Y6BA 1SNUA 3F5PA 4XV1A 1UWHA 5CSXA 4ZZOA 3EL7A 3FZRA 2GNLA 3IKAA 4MBJA 4LYNA 3PFQA 4PX6A 3W2QA 4ACMA 3Q3BA 2HZNA 4USEA 1FMOE 1GZNA 4C57A 2IZSA 4UMTA 5KMKA 2BIKB 4QMUA 3V8SA 3VJOA 3N51A 5I9UA 4YURA 3HAMA 3SKCA 4C4IA 3UZTA 4J1RA 2WEVA 2VUWA 3TZ8A 4MYGA 4RIXA 4DGNA 3C9WA 4CD0A 2WOUA 3R71A 3TUCA 3V5QA 2WIPA 2YLEA 4FKRA 4AOJA 3CTQA 4FG7A 5K4JA 3MPAA 4K18A 3A99A 1K9AA 4EYMA 5CX9A 4NJDA 4D58A 3DXPA 3PVUA 2W5HA 2OH4A 3OEZA 4TL0A 1EH4A 3UYTA 3UQCA 4ARKA 3BELA 3KQ7A 4BWKA 4IDTA 4CEGA 1XBBA 4RSSA 5HLNA 4LRJA 2CGWA 3GQLA 4QP8A 4IB5A 3GEQA 4B4LA 2YCSA 3VQHA 4CMUA 2B9FA 1H0VA 3UIBA 3HAVA 4CKIA 4I24A 4ZS4A 3HRBA 3LQ8A 3TTIA 4JDIA 5DH3A 5JQ8A 3PSBA 3ZRMA 2RFNA 3AT2A 3GGFA 1JKSA 5E4HA 4RQKA 4KKEA 4CRLA 3UP2A 3T3VA 3QFVA 2JAMA 3R04A 3DQXA 1CKIA 3FZPA 2OJIA 4H3QA 4HZSA 2VTOA 2R3NA 1FQ1B 3DBDA 4BDAA 2FUMA 2RIOA 5BUEA 3U6HA 4QP9A 3D5VA 2J0LA 4AT4A 5A14A 2BFXA 5EYKA 3C4ZA 3BGZA 3C13A 3C50A 3ZO3A 3QKKA 3I4BA 4YTHA 5GJDA 1I09A 4MNEA 5I9VA 5AP6A 1H4LA 4L00A 1YWVA 3F2RA 4F09A 4Y83A 4OTHA 3MIAA 3NGAA 4PMMA 3ELJA 1H27A 5KMIA 2QOQA 2XNEA 3DTWA 2UZBA 2ZM1A 4YJUA 3AG9A 4FTTA 4QTAA 2O65A 2XJ1A 2BZHB 3KCFA 4U8ZA 3FSFA 5FM2A 3W2OA 4F7LA 1SYKA 5FXRA 4BKZA 3DAJA 4CT1A 4OUCA 2R9SA 2DWBA 4QYEA 4ALUA 3PA5A 4GYIA 4RT7A 2GHMA 2CGVA 4RJ8A 4PNKA 1H01A 4D0WA 3T8OA 1PJKA 4UY9A 2EUFB 4PP7A 3C1XA 3R7GA 4FTJA 5FEEA 3SGCA 5HCZA 4FNXA 5FQDC 3G5DA 3L8VA 5AV1A 3D94A 4HGLA 5DLSA 2OXXA 5AA9A 4O7NA 4RWIA 4FX3A 4CCBA 3EN5A 5GINE 1Q8TA 4CZYB 4DLIA 3DJ6A 4RG0A 4XV9A 5CXZA 3L9PA 3F5GA 4J8MA 4LMUA 3A7HA 4IB0A 4WHZA 3B2TA 3VUTA 2OICA 2A19B 5CSWA 1R0EA 3ULZA 3EN4A 1GIJA 3OOGA 4YC8A 3BV2A 5AP3A 5IKWA 1YI4A 4D2RA 2YITA 5HE3A 2C6KA 4C35A 3H30A 1BMKA 4HPUE 5H8BA 5FWKK 3VS4A 5HTCA 1PXLA 4DAWA 2VWYA 5DHJA 3MN3A 3LFBA 1J1BA 4EH7A 4ERKA 3PWDA 2YDKA 1HCLA 5H2UA 5I9XA 3CLYA 1SNXA 3GBZA 5DI1A 3ZM4A 3FI8A 3PA3A 2XP2A 4GIIA 3GVUA 5IQEA 4JAJA 4KWPA 3I0QA 3O0GA 4FT3A 4AQCA 3DK6A 3SG9A 4GG7A 4PTGA 3TZ7A 4F9AA 2HW6A 4FTNA 4KD1A 1M14A 3V3VA 4EWHA 5CZHA 5JMSA 3LVPA 3CC6A 4F6SA 4GT4A 3OFMA 3VS3A 3I0OA 2OK1A 4GL9A 5C4KA 4G6NA 2XNGA 1O6YA 4RVTA 4FEQA 2PK9A 3BHVA 1M7NA 4WG4A 2RG5A 4XG3A 3VUMA 1KE9A 3BYOA 4C38A 5KMJA 5IH4A 3VUGA 1CDKA 3DJ7A 4UEUA 4BY9E 5HVJA 4AZEA 4BCNA 3H3CA 3ORXA 3PZHA 4DEHA 2VTLA 3FI4A 5EM7A 2X4FA 5CEOA 5FLFA 3KRJA 1YXTA 4FSQA 5M57A 4GJ3A 1UKIA 4ALWA 3Q4TA 5FG8A 1KE7A 3AQVA 2BRHA 4IWDA 2J6MA 3A8WA 3OW3A 4O96A 5EYMA 1W8CA 4FKOA 3V01A 3R21A 4FI1A 3FSKA 1UNLA 3MS9A 5JGAA 3RAHA 4BF2A 5HLPA 3BWFA 1H08A 4BTMA 5LQFA 2WMWA 4IWQA 5EM5A 2OSCA 2OJJA 3G33A 3I60A 4YTCA 4XBUA 2W4OA 1Y6AA 4FUYA 4F9CA 2QO2A 3ACKA 4FOCA 4U0IA 3MGYA 1OBDA 2I6LA 2QLQA 3RNYA 5HESA 1YI3A 3MFTA 3AT3A 2GSFA 4FV9A 4I5HA 3FC2A 3R30A 3ZLWA 5KMMA 1Z9XA 2PZPA 1U59A 3F69A 2GQRA 3KRLA 4YBKA 4EOIA 5L2SA 4DTKA 5L8LA 3B8QA 3PA4A 3GU4A 4CV9A 4BCKA 4KUJA 4V04A 4O7VA 3A61A 3KVWA 3QQKA 2JC6A 1VYZA 1RDQE 2R0UA 3TG1A 3L8XA 4OTQA 3WZEA 3BU3A 2UZNA 4IFCA 4O91A 5J9YA 4ZAUA 2B4SB 2XM8A 3CIKA 3DNDA 3M11A 3LXPA 4RIWA 4U97A 5EI6A 4U3ZA 4M0ZA 3VRZA 3R0TA 2BTRA 3ITZA 4Y8DA 3RPSA 5BVFA 3QYZA 1A9UA 2B52A 1BX6A 2NNWB 4QMSA 3EZVA 2NRYA 4ZTNA 5BVEA 3OUKA 4RGJA 3TIYA 2PUIA 4O7ZA 3EYHA 3U4WA 5IA0A 3P1AA 3ZMMA 3WZKA 4BFMA 5E1EA 3G9NA 3I79A 2VNWA 4JVGA 2P4IA 4IJ9A 1G5SA 4UWBA 1PXOA 1IR3A 3QD4A 2JGZA 3D7TA 5HU3A 4NKAA 1DM2A 3BEAA 4FG9A 3QQFA 2VRXA 3QCSA 5A6NA 4TNBA 4H1MA 1XH6A 3Q6UA 3E62A 4KSPA 1NY3A 5EHYA 4YO4A 4C7TA 1RQQA 2HWPA 2ETMA 1F3MC 4O0SA 3LAUA 3ORNA 1JNKA 5IUIA 3ZEWA 2O64A 5IDNA 2F57A 2WXVA 3I1AA 3A7GA 4BTJA 1O6LA 5AUUA 3ANQA 3G2FA 4EHVA 2FA2A 1MRVA 3ZOSA 2WMTA 4F7NA 4QMWA 4EOKA 3DFAA 3TL8A 4BDBA 5FUTA 1XH7A 3EQIA 2IWIA 5FXQA 5L2QA 3QTRA 1PW2A 4U7ZA 3SD0A 5CY3A 3M42A 4OT5A 4XEYA 4YJTA 5KX8A 5AR3A 3R9HA 3ZO4A 2CJMA 3GC7A 3BRBA 4UN0C 5AM6A 4LV8A 4TN6A 2ITZA 3UTOA 4JNWA 5AMNA 4H39A 3TJCA 5K5NA 5ANJA 3VN9A 2BAKA 3MB7A 3QRKA 2YIWA 4YJSA 1YXUA 3FMEA 3FQEA 3HV3A 3SAYA 4QMYA 5KMNA 5J1WA 2ITOA 5KNJA 4JAIA 3C4WA 1KE8A 3CQWA 3CTJA 4PDSA 1IRKA 4ORKA 2RKUA 3BHYA 4WUAA 3NIZA 3Q9YA 5HI2A 2V7OA 5TR6A 3CKWA 2HK5A 4O1OA 5KHWA 3C7QA 3GCPA 4IM0A 2B55A 4JBVA 1WFCA 3SRVB 4KRDA 4GG5A 1YWNA 4NW5A 5L2WA 3EFJA 3NYNA 3RI1A 4BCJA 4EJNA 5C4LA 4X6QC 4RJ3A 4Q9SA 3KF4A 2C0TA 3ZBXA 3ZM9A 3ORIA 2C1BA 2OF2A 4IJPA 3V6RA 5ICPA 5JEBA 1DI8A 1VR2A 5I9WA 3SDJA 3K54A 2UW9A 4JL9A 2G15A 4ANSA 3P0MA 4QP1A 2YIYA 4I5MA 2CKEA 5AR8A 4YUQA 2A4LA 3BE2A 5F20A 3FLSA 3SLSA 4RIYA 2ETRA 4O2PA 3QGYA 3KA0A 3DLZA 4IVAA 5J5TA 1KV2A 3QQGA 3EKKA 4G2FA 5AA8A 4C59A 4U6RA 3LFEA 3OCBA 4DH7A 5HLWA 2P2HA 3CR0A 4V0GB 5E8ZA 2F49A 5AAFA 4EK6A 3DA6A 5L2TA 4YC3A 1PXPA 3OY1A 4E6QA 2R5TA 1XQZA 1OITA 1OM1A 3CXWA 1YKRA 1M17A 3ACJA 3P7CA 3V51A 4GU6A 3LCSA 4L3JA 4IX4A 3KFAA 4J98A 1QMZA 4QMQA 2VWUA 3JY0A 4AE6A 5LMKC 4QD6A 2QHMA 4FTMA 5BVDA 2ACXA 3KRRA 4RZWA 5HICA 5M44A 4DBXA 3KC3A 3LZBA 4I6BA 2ETKA 2VTRA 2H6DA 4YHTA 3RJCA 4BN1A 4DEEA 3DZQA 1P4FA 3BYVA 5DPVA 5DT3A 2BRGA 2I0VA 2YIXA 3HNGA 3KU2A 3Q9WA 4WBBB 3AC1A 3ALOA 1LR4A 3RVGA 4FL1A 1M7QA 2GQGA 3AGMA 3BU5A 3UG1A 4C33A 2YDIA 2GHLA 4UB7A 4UYNA 3TZMA 5AX3A 4CZTA 1VZOA 4EZ5A 3NVKI 4EH6A 3AC4A 2Y6MA 3PRFA 4YU2A 3U87A 2VTJA 5DGZA 4BI1A 4Z55A 4RJ7A 4BDDA 4RA5A 3SG8A 2R7IA 2ZB0A 1YOMA 3DU8A 3K5VA 5IEVA 5J7BA 1VEBA 4RC3A 4AE9A 3EN6A 5L6PA 2PVHA 4Y73A 1ZRZA 4DGGA 4D4VA 1TVOA 1WBOA 3GT8A 3DFCB 4ZMEA 2YAAA 4EUUA 3AC8A 1FGIA 4PY1A 4U40A 3PSCA 1Z57A 5HNBA 4H05A 2X8IA 3P9JA 2W1CA 4FTCA 4WKQA 4BI0A 5ETFA 4NJ3A 4IVCA 4HYIA 3CGOA 1UKHA 3KCKA 5CLPA 3LMIA 4BC6A 5GIPE 4YZNA 2XBJA 5BYYA 2BKZA 2VNYA 3NCGA 4YP8A 2JD5A 2J7TA 3Q9ZA 2C4GA 4CFNA 2HZ4A 3R8MA 3EFWA 1Q61A 3QTXA 4ZSEA 5JGBA 4I6QA 2C6MA 5KMOA 4J8NA 4GK3A 1J1CA 1IASA 2GS2A 2X1NA 4CYIA 5CAPA 5KO1A 5DOSA 2R3LA 4QOXA 2R2PA 2QD9A 3QWKA 1Y91A 3H9RA 5EYDA 4E6AA 5IUGA 5E8TA 4QP7A 1Q8UA 3QTUA 4RIOA 3OY3A 3K3IA 3UO6A 5C03A 4FGBA 4FKGA 4IZYA 4N57A 5HX6A 1ZY5A 5AEPA 2QOKA 3FXXA 5BPYA 3AMYA 4IC7A 4KKHA 4AN3A 4JRNA 3QHRA 4CYJA 4HNFA 1M52A 2I0YA 3F9NA 4FTIA 4QTEA 4Y46A 3PXYA 4TYGA 3QKMA 3AC5A 3SW4A 5JSMA 3QL8A 3TCPA 2OKRA 4N6ZA 2BDJA 3I81A 4ZTRA 1P14A 4PQNA 3F5XA 5CU4A 3PP0A 4EHZA 1BI7A 3D7ZA 4EKKA 3VW8A 4HYSA 4S33A 4FV8A 3HMNA 5FGKA 4GKIA 1OGUA 5J9LA 4IE9A 4D5HA 5H3QA 3IO7A 2H9VA 2HXQA 4RVLA 5DR9A 4EK4A 3FMNA 4ZTQA 2HCKA 1GJOA 4D9UA 4DITA 5DE2A 4ITIA 4K6ZA 2BFYA 3E93A 4UWYA 3LCTA 5CSVA 3OD6X 2R3MA 1S9IA 4AOIA 3IOPA 4CQEA 3RGFA 1Z5MA 3DK3A 3DB8A 3QQUA 4IAYA 4X3JA 2W4JA 4EQCA 1PKGA 5BUJA 4R7HA 4RX9A 3Q9XA 2PZIA 4IFGA 4DEIA 4XS2A 2BHHA 5AV0A 2QHNA 3A7FA 2ESMA 2ZV9A 4K8AA 4PDOA 3R9NA 4DFXE 5CF4A 3NUXA 4XOYA 4ITJA 3RPRA 4AP7A 2XKEA 3TNIA 3SXSA 2CCIA 3IK3A 5M4IA 3U6JA 1Q62A 4FT7A 1JKTA 3UIUA 3V5JA 4G3FA 3QX4A 4IANA 1HOWA 4L45A 3PJ2A 3WF7A 3BBTB 4PV0A 2JKKA 2PVLA 2VTMA 4NZWB 2UVZA 4LL5A 4EK3A 1OZ1A 2EB3A 3DPKA 2IVUA 4NYEA 4XG7A 3IW8A 3NAXA 5IZFA 2UW5A 5AWMA 4DE4A 2BALA 3UIXA 5AP0A 5DT4A 5E7RA 2JDTA 3LFAA 4DFBA 1IG1A 5TKDA 4X21A 1PMUA 3F2NA 3IS5A 4IZ7A 3VUHA 3MTLA 4DN5A 5J5SA 3TUDA 4RC2A 1X8BA 3L8SA 5AUVA 5AR5A 3MIYA 4BKJA 4F0GA 4FA2A 5JRQA 5KMLA 4M97A 1J7IA 3AGLA 1Y8GA 4JLCA 1R78A 4YJOA 3TKHA 4DCEA 3CS9A 1YOLA 4M68A 5ANOA 3D5XA 4N0SA 2Z7SA 5AP7A 3LLAA 3G51A 4Q5EA 4DT8A 3H4JA 4FUXA 4GKHA 3LFNA 4HPTE 1FOTA 3SXFA 3KXMA 3DKCA 4V0GA 4DT9A 4BCQA 3FBVA 4TNDA 2JLDA 3VS7A 4ASDA 3UVPA 2UZEA 4OTPA 5LMKA 4FYOA 3DKGA 4CGAA 5E8WA 1AD5A 2WKMA 3VC4A 4AU8A 2Z7LA 4U44A 3R83A 3PVBA 3ZSGA 2DYLA 3DS6A 3VUKA 4A07A 1JSUA 2ZYBA 1WVYA 3Q60A 3ZCLA 3RPOA 2RGPA 1VYWA 4K77A 2C1AA 4YPDA 4ASXA 3NUAA 3A4OX 4OTFA 3NPCA 4O83A 3IW7A 4LGDA 4LOQA 2R3HA 3KB7A 2BROA 3BQRA 4IHPA 5AAEA 1OUYA 2VGOA 3FYJX 1SZMA 4C4EA 1Q4LA 3MV5A 4WG3A 3ZBFA 3UGCA 1PXIA 3UP7A 2P2IA 3CKXA 2WMAA 3W32A 4ALVA 4IB3A 4JX7A 5A4LA 3QALE 4C2VA 4DA5A 3LQ5A 3PY3A 3BQCA 2OXDA 2UZDA 2WB8A 4JG8A 4AZWA 2XIRA 4FEWA 1IEPA 3IW4A 1ATPE 3PJ1A 2QKWB 3PSDA 2R64A 2AC5A 3KXGA 3R8ZA 5AFVA 4AS0A 1F0QA 4IEBA 2R4BA 2FH9A 5AUTA 4G31A 1CM8A 4IMYA 4NWMA 4BDGA 5DRBA 2W9ZB 4DINA 1YHWA 1H00A 4C61A 4EZ7A 2R3JA 1ND4A 4ACDA 2BIYA 2YZAA 3HL7A
chains in the Genus database with same CATH superfamily
2X9FA 4K9YA 5JFXA 4W4XA 4PDYA 3RAIA 4ZLOA 2Z2WA 5ACKA 4KAOA 2EWAA 5IQHA 4CTCA 3M2WA 4PPCA 3TMOA 4FK6A 4TXCA 5I4NA 2W1IA 5EDQA 3COIA 4RWKA 3WIGA 3MFRA 3UIMA 3VF9A 4TZRA 3ZZEA 4O7TA 2C69A 1Q99A 3UMWA 2VX0A 2IW6A 3BI6A 4BZNA 3FLWA 4F63A 3TTJA 3PFYA 2YABA 4LUDA 1YW2A 3U6IA 2BZJA 1PMEA 4M0YA 2PE0A 3ROYA 4II5A 5HO7A 1ZY4A 4AF3A 3N9XA 3V5TA 2BPMA 2OJ9A 4XJ0A 2GS7A 5CXHA 4D0XA 4R5SA 2OIDA 1OIYA 2NPQA 4M84A 4I93A 2X7OA 3EQBA 1XH8A 4DFNA 2FSOX 2XNPA 4C3PA 3OXIA 1OIQA 5A4QA 2VTAA 2QU6A 4XRLA 3OF0A 3VW6A 3GC0A 5HG5A 5TO8A 4F9BA 2PUPA 2DUVA 2Y7JA 3WZJA 3UZPA 2ONLA 3ENHA 1UA2A 5HOAA 4ACGA 4L8MA 3MH2A 3ZFYA 1K3AA 3N4VA 2DS1A 3HMIA 2E2BA 3ERKA 2GMXA 4APPA 2YWPA 5CT7A 3RK5A 2UZWE 3A2CA 4QP4A 4L6QA 4DCAA 1YVJA 2OF4A 3BEGA 3W16A 5IDPA 2PVYA 1B38A 3OWPA 4FT5A 3HUBA 3JVSA 5D41A 2BUJA 3T3UA 3MVLA 4AXDA 4YJPA 5EHOA 3GC9A 4NCTC 4WBOA 3ZUUA 5BNJA 4AW1A 1GZ8A 4QPSA 5HG8A 4D2WA 1H24A 1V0PA 3PJ8A 4APCA 2CNVA 2Z8CA 4EOOA 5B2LA 2HIWA 2ERZE 2XNOA 3ODZX 2AC3A 4AAAA 2GS6A 2YM7A 3HECA 2NP8A 3MVJA 4G16A 5H8EA 3RBWA 1WVWA 3ZDUA 4AUAA 3FZTA 4PMPA 4QMLA 2VV9A 2C6IA 4YO6A 5EW3A 3D2KA 5EM8A 2F2CB 4FT9A 3BGQA 5JGDA 3EFLA 4QPMA 2UW7A 2ZV7A 5B0XA 4JXFA 2QC6A 4GFGA 1W82A 3WI6A 3RK9A 3QTQA 4HZRA 4TW9A 3PXFA 4G17A 1B39A 4IVDA 2WNTA 5IQDA 1R3CA 2XK4A 2YEXA 4PUZA 2CNUA 3R9RA 5EQYA 3GENA 3GOPA 3NMUF 3CGFA 4GVAA 4AG8A 2W96B 2HOGA 5CZIA 5E8UA 2C0OA 3ROCA 3HV4A 3BCEA 4XRJA 1U5QA 1JSTA 3ZZWA 1GAGA 3KY2A 3ENMA 3NYOA 4MEDA 4Q5HA 3C51A 3OG7A 1LP4A 3JR1A 2XF0A 3NNWA 4QMVA 2GDOA 2WU6A 1U54B 3D4QA 4ZXTA 3K2LA 2GNFA 4RA4A 3NCZA 1G8AA 3E8NA 4ZTLA 4ZIMA 3ID6C 4HGSA 4NM0A 4NEUA 4LUEA 2CKQA 3KEXA 3FMJA 4B8LA 2XIXA 5DA3A 4BICA 3IG7A 4DH5A 4E6DA 3W2SA 4O4FA 1RJBA 4ZY6A 4B99A 5CU6A 2EXCX 2PVMA 2QR8A 5HVKA 4QQ5A 2GNHA 4DC2A 2YM5A 2Y9QA 4L53A 2UW0A 4DFYA 3F66A 4H36A 1KOAA 5EM6A 4BGQA 3R02A 4O81A 3W2CA 3T9TA 3WF8A 1E1XA 1Q3WA 2WD1A 3E3BX 4I41A 3FZOA 3SOCA 2C3JA 4BCFA 5IEXA 3B8RA 3FL4A 5M07A 1JOWB 4NTSA 4TY1A 4DG3E 3QBNA 3EOCA 3S3IA 4USFA 5KBRA 3BYUA 5B2KA 5D11A 1PXNA 2VTTA 2X0OA 3NUUA 3BPRA 4MH7A 4HW7A 5DFPA 3PWYA 3G15A 4IIRA 3TJDA 5CI6A 4E6CA 5IQGA 4AX8A 2GHGA 5FEQA 1NVRA 3TWJA 4O7LA 3NW7A 4RJ5A 3RHKA 3S95A 4CFVA 2W06A 5DRDA 3TEIA 3WF5A 3M1SA 3E7OA 5IG1A 4X2FA 5D12A 2C68A 3QLGA 4XP2A 3TDWA 2JDRA 3R1SA 5CWZA 2CGXA 4KS8A 4FTRA 4E7WA 5ANKA 3P23A 2EXEA 4EUTA 1GIIA 4E5WA 2YLFA 3VAPA 4WG5A 4MKCA 3GI3A 5K0XA 2X6DA 2WTCA 5HKMA 4QMZA 3F3VA 3HV5A 4IAIA 4E4MA 3A7IA 4GS6A 4HCTA 4X3FB 3VVHA 2XM9A 1PMVA 4QTDA 4W8DA 4B7TA 1WAKA 2PSQA 2PZYA 3SXRA 2NYAA 3LMGA 3DNEA 4TWOA 1WBNA 3W2RA 4YJQA 4PMTA 4F0IA 4FNYA 3NUSA 4X3FC 5M08A 4AZTA 4E8AA 1BYGA 5T68A 2PULA 3KXNA 3I5NA 4MTAA 4E4LA 2VD5A 3OCGA 2XAOA 2W05A 5KKRB 4IVBA 3LPBA 3QTZA 4NK9A 5CVHA 4JDHA 4L43A 4YZDA 3OBGA 2ITXA 4CMOA 5KCVA 4IDVA 4MXOA 4R77A 3P79A 5D10A 3D9VA 4XLVA 1OIUA 1REJA 3GFWA 1YXXA 5IU2A 3IOKA 3ZU7A 2UZOA 3TV4A 2ITVA 2PMLX 5AAGA 4CQGA 4NM5A 3Q5ZA 3E63A 2GNGA 3R9DA 1G3NA 2OJFE 1U5RA 2VWXA 5A46A 3ATTA 3R01A 5B7VA 4NFMA 4ITHA 5AV3A 5BUIA 4PPBA 2A98A 3EB0A 3LXNA 2XJ2A 5EG3A 2XKDA 4EH4A 2VTIA 4BWPA 3IGOA 3PY0A 2JEDA 2CKPA 3F6XA 4ZSAA 4D4SA 5JZJA 1WCCA 1BI8A 4AZFA 3PG3A 2RG6A 5AR4A 3KIOC 1BL7A 3VNTA 3AKLA 4ZJIA 4FTKA 4O6LA 3NR9A 3ZEPA 3BIZA 3PYYA 4FOBA 4FGRA 3FHRA 4BGHA 3OOMA 5I3OA 4AA4A 4O0RA 3EZRA 2LAVA 4M15A 5CSHA 1Y8YA 1PY5A 3PY1A 4NCTA 4XP3A 4ZTHA 4BR3A 5CVFA 2OZAB 3QD3A 2ITUA 4C62A 3QA8A 5ANEA 4EOLA 3WF6A 4XG2A 1MUOA 4O0UA 4XNEA 4A4OA 1PRYA 2VTHA 2PE2A 4D55A 4NW6A 1XH9A 2ZJWA 3R1NA 3KK8A 2BDWA 4V05A 5HTIA 2A0CX 2XVDA 4GYGA 3AD6A 4FV4A 1QCFA 4XYFA 1CKPA 2OO8X 3TV7A 2H8HA 2XBAA 4O27B 5FDXA 3UODA 5CTPA 2J2IB 4HVDA 5LWMA 4G1WA 3ZLYA 4O84A 4BYJA 4CMTA 2P3GX 1ZYDA 4FSZA 3SQQA 4YMJA 2XZSA 4BJJB 2E9PA 2HELA 4U42A 3TZ9A 5JQ5A 4E73A 1A48A 4DGLC 4C36A 1YOJA 2QOHA 5IMEA 2QOFA 4UZDA 5HVYA 3BHHA 2F9GA 3D15A 3QQHA 4MBIA 5ANIA 4JOAA 4LFIA 3UVQA 2C5YA 2Y4IB 1PKDA 4QMXA 3D5WA 4BIEA 1KOBA 3PIZA 3QCXA 4I6FA 1OI9A 2HZIA 1H25A 3CE3A 4BL1A 4BHZA 2ZV8A 4E4XA 1ZMUA 3UMXA 1IA9A 3PXKA 1YHVA 3PVWA 3VBQA 4IX5A 5KUPA 2Y4IC 5BVNA 2KTYA 4MBLA 5KBQA 4J95A 4GJ2A 2ERKA 4ANMA 4FIFA 4GV1A 3DXQA 4QMPA 3QRJA 4S32A 5GNKA 4DTAA 4MAOA 4ZLYA 4ANBA 4O7RA 4AZVA 5CENA 3R8LA 3HMPA 4TWCA 4XG6A 2XK8A 4F1OA 2REIA 1OL5A 4USDA 2B9IA 2YM4A 3W10A 1Q41A 2EVAA 3VS5A 4L42A 2XUUA 4WNOA 3LCKA 4XG8A 3BL7A 4FL2A 2VTQA 3AOXA 3OROA 2VWIA 2W1EA 2WHBA 3R2YA 4L3LA 4YR8A 3WYYA 3KXZA 4O21A 4TRLA 1DI9A 1Q24A 5HO6A 2XKCA 4AT5A 3QTIA 3DB6A 5E8YA 5FBOA 4MXZA 4WIHA 5J1VA 1Q97A 4UBAA 4CFXA 4PF4A 2QOIA 3FLQA 4EH5A 1OKZA 2BAQA 4L01A 3WF9A 4H1JA 4QDEA 3CPBA 4QTBA 2QG7A 4G9RA 5LVNA 4GU9A 1KE6A 2OIBA 4WRSA 3LJ2A 3EQPA 3SOAA 1MQBA 4WA9A 3UOJA 4IX6A 3JPVA 4FNZA 2JKQA 4N4SA 4GT5A 2B7AA 1WVXA 4ID7A 2UW6A 3OMVA 1YDTE 3R73A 2XIZA 2I1MA 2J90A 3O5AA 3QA0A 1MRUA 3QU0A 4JQ8A 3C0GA 4TPTA 4FV6A 4WO5A 3NUYA 4C3RA 5CANA 4NIFB 2W0JA 5H8GA 3VBVA 4ZY5A 1E9HA 1OL7A 4BTFA 2QOOA 1SVHA 1UU3A 2NO3A 2YFXA 2PVFA 3UC3A 3O23A 3CY3A 3SA0A 3MI9A 4G6LA 2QOLA 4FICA 1W84A 5EH0A 3FPQA 4ACHA 2Z7RA 3MJ1A 4WNPA 5K4IA 3COHA 4JI9A 4F9WA 3A60A 3IPHA 2W1GA 3PPJA 4X3FA 5CEQA 4ONAA 4YNEA 2X6EA 4E26A 3V5PA 3MVHA 3HA6A 4R1YA 4BZOA 3PXRA 3QRTA 4JS8A 3VJNA 3ATSA 3MESA 4KBCA 4BYIA 4PP9A 3LXKA 4B0GA 1TQIA 2WTIA 4MD8E 2W1DA 2VZ6A 4I4EA 4Q2AA 2FGIA 3PZEA 3RAWA 5A9UA 4FSYA 5FTGA 4Z7HA 4RLLA 3UC4A 2PMNX 1OKWA 4F7SA 1YXVA 4CSVA 2JKMA 3BHTA 5CF6A 5D7AA 3NYVA 2HENA 4TWNA 3LXLA 3LMHA 4S34A 2V62A 2E9VA 5CEPA 3RALA 1NXKA 2YM6A 4C4FA 2B9JA 2KULA 3W2PA 2YN8A 1Q3DA 3IDCA 4Z7GA 4AZSA 5EKOA 4DFZE 1OPKA 5D9HA 5ETCA 4QT1A 5HIDA 4CCUA 2C6TA 2H96A 2IVSA 4C8BA 2QOCA 3RPYA 2Y8OA 4FTQA 1QPCA 5HBHA 3VONA 4EOSA 5DMZA 2CMWA 2IPXA 5H9BA 3CSVA 4XLIA 3I6WA 4JBPA 1J7LA 4X0MA 4W4WA 3OTUA 3P4KA 3WILA 4EONA 3SVVA 4DTBA 4D2TA 4CFWA 4O6EA 4QP6A 4GVJA 4C02A 1ZXEA 1ZARA 3ZSIA 3TT0A 3OVVA 3PP1A 3RAKA 2ZM4A 2F7ZE 3WBLA 1CTPE 1NT2A 4RC4A 1SM2A 3NUPA 4X2JA 3IW5A 4FKLA 3PG1A 4CTBA 4YZCA 1YQJA 3BU6A 5IPJA 1STCE 3QXPA 3Q32A 4QMOA 2GNIA 3BYSA 3HDMA 4RJ6A 4DG2E 5HX8A 4IAKA 4D1SA 2OZAA 3DGKA 2YM8A 4C2WA 5HBEA 4EEVA 2JDVA 4KIKB 5LCJA 4FSWA 5FTQA 3UNKA 2R3GA 3KN5A 4IAFA 4BCGA 3GNIB 4R3PA 3GU7A 3AD4A 4L67A 2WMQA 4IQ6A 5AV2A 5HG7A 3DTCA 1H1WA 1ST4A 4GCJA 5IMXA 3KK9A 3LFDA 3DZOA 3B2WA 4ZSLA 1U46A 3F7ZA 4O0XA 3FZSA 4MHAA 3A62A 3EQHA 3F61A 4CFFA 2OIQA 2C3LA 3K5UA 1XKKA 2UW8A 1XHAA 4FIEA 3ZC5A 1H07A 3MWUA 2JBOA 2X7FA 4MWHA 4DEAA 1T46A 1UU9A 5EOBA 3VBXA 4BJJA 1UVRA 3OZ6A 4UMQA 3U9NA 4O86A 2B1PA 2CPKE 3ORMA 5BVKA 5HZNA 5F1ZA 2HZ0A 2IJMA 5ETIA 4EH2A 3DT1A 2V5QA 3DDPA 3MW1A 4FEXA 1R39A 5FEDA 3QUDA 4KINA 4DH8A 2IG7A 3VUIA 2R3IA 2FSTX 4FSUA 4O0YA 4ZOGA 5A6OA 2WQMA 1YHSA 4ASEA 1ZMWA 4F65A 4WNKA 5AR2A 4HCVA 3QKLA 3LM0A 3BBWA 3QYWA 1OECA 2Q0BA 3BKBA 2QURA 2YJSA 4I21A 2WPAA 4IM2A 4NUSA 4ZJJA 4CVAA 2Z60A 4UV0A 4PRJA 4F99A 2ITTA 4GK4A 4BBFA 4QYGA 2YACA 3EKNA 3VQUA 3FXWA 3WOWA 2VGPA 4I3ZA 2ZM3A 4J7BA 3RKBA 3MYGA 3V5LA 5LCKA 4CNHA 4YLJA 3HUCA 1GOLA 2OZOA 4H3PA 4FVRA 2BTSA 3C5UA 3H0YA 1CMKE 2YHVA 2VWZA 5LVMA 3V5WA 2UV2A 3C0IA 3BV3A 2YJRA 1A06A 2W1FA 3GFEA 4RVMA 4KIQA 3UE4A 3ZDIA 3Q6WA 5AJQA 4F1MA 3ML1A 5AIKA 4O4CA 1REKA 4RVKA 5BYLA 4YNOA 1W2CA 3O51A 4Y5HA 4YC6A 4CKRA 4RX5A 2XANA 4LV7A 3IQ7A 5HNIX 2C47A 3FKLA 3UDBA 2JIIA 4OTRA 4FT0A 3G6GA 3NYXA 5C8MA 5JK3A 1JWHA 1ZOHA 4RWJA 3DBEA 1JLUE 4RIXB 4G34A 2XK6A 4NFNA 5TE0A 4B9DA 4EKLA 3E87A 3QC4A 1UNGA 4L44A 1ERKA 3TN8A 3T9IA 4GIHA 5J8IA 4AXAA 1Y57A 4P5ZA 4BHNA 4F0FA 3OXZA 3PPZA 4LGGA 3DAKA 2PTKA 4RX8A 3Q4UA 4UMPA 5JN2A 5CQWA 3LHJA 4FZFB 3GCVA 4W9WA 3TV6A 1OPJA 3HV7A 2CN8A 2VX3A 4S31A 5EW9A 5DR6A 3SRVA 1ST0A 5EK7A 3ANRA 4B6LA 4OTIA 4AW0A 4D9TA 4CKJA 4DGOA 3G9LX 1OPLA 4D2SA 4QMNA 4QQJA 3RWPA 4XX9A 2B53A 3FHIA 3N4TA 4JQEA 1ZYSA 4QQCA 3TI1A 3WE4A 1XR1A 2FSLX 2OI4X 3FKNA 3QCYA 3THBA 2C3KA 4DH1A 3H10A 3GU8A 2E9NA 2Y0AA 2XKFA 2XNNA 3RPVA 2AQXA 3IDPA 3OHTA 4F70A 3FQSA 4C3FA 1WBPA 5L8KA 5CU0A 2R3FA 4X7QA 5AP1A 3EQCA 1HCKA 3PJCA 1XMMA 5M51A 3BL9A 1Q8WA 1KE5A 2QCSA 2XIYA 3PPKA 2CHLA 4DH3A 3Q52A 3R6XA 4YGAA 3Q04A 4BCHA 4JBQA 5HE1A 4BCMA 4PMSA 4ZS0A 4U79A 2W9FB 3E64A 4PWNA 3UVRA 4BDKA 2VO3A 4MQ1A 4A4XA 4FR4A 1R0PA 5LMAA 3U51A 2UUEA 2C6EA 2CCHA 1ZZ2A 2BZIB 2C6LA 5TT7A 3MPMA 1J91A 2XRWA 2F7EE 4OBOA 3TNHA 3VWAA 4FKVA 2Z7QA 1XWSA 3AC3A 3QQLA 4Y95A 5GHVA 3V8TA 4YTFA 5IA4A 4CLJA 2QODA 5AUXA 2IW8A 3PDTA 5CASA 2UW4A 3R7YA 1B6CB 1WBWA 2F2UA 5J95A 5FM3A 3UQGA 3S00A 4B8MA 5BMSA 1OMWA 2PY3A 4FODA 3RWQA 2IVTA 2JIUA 4NH1A 1ZYCA 2QKRA 3CQEA 3MH0A 5CSPA 5IQIA 4FIHA 1H26A 2QO9A 3GP0A 4I92A 4LQMA 4U41A 4IAZA 3VIDA 3FLZA 4O7WA 1TQPA 3FMDA 3WZUA 4JIKA 2HY0A 4DG0E 2VN9A 5JH6A 3P7BA 4XCUA 1FGKA 4FSNA 1Q8YA 4QP2A 2ZMCA 3TDVA 2XNMA 3D14A 4BKYA 3RM7A 3UG2A 4CT2A 1WZYA 3I5ZA 5CU3A 5G6VA 3NZ0A 2XS0A 2OG8A 3COKA 4GH2A 4I0RA 4MF0A 4D2PA 4F08A 4KS7A 5FXSA 3FDNA 4EK8A 3LCOA 3QC9A 4G5JA 2ITNA 4R7IA 5CYIA 4FSMA 3VO3A 4A9RA 5CF5A 4BCPA 5JZNA 4QPAA 3NRMA 2R3PA 4FKUA 4KIKA 3VBYA 4AOTA 3DBCA 5I3RA 3DKOA 3JS2A 4BI2A 4ANOA 5A4TA 3GQIA 3TXOA 2WAJA 3F3WA 3O8TA 3BX5A 4RFYA 4U5JA 2YCRA 2XRUA 3E3PA 4FZ6A 3FWQA 5HTBA 1GIHA 4U45A 2PZ5A 1LUFA 4E1ZA 4FTAA 4YJNA 3AD5A 3C4XA 5HORA 3R63A 3TM0A 3R7OA 3LLTA 4BIBA 4R1VA 1JKLA 5HNGA 4N6YA 4NM3A 3OWLA 3R7VA 4WT6A 5K9IA 3MH3A 5E91A 2PVKA 1O9UA 1SMHA 4KNBA 4FEVA 4JX3A 1I44A 3NS9A 2ITPA 3LW0A 1J3HA 2B0QA 5AV4A 3R2BA 4L46A 3SW7A 1PYXA 2J0JA 3W55A 4DLJA 4UALA 4WRGA 3ZXTA 1PYEA 4MD9E 4AFJA 2R7BA 5M4UA 4KBAA 2ITQA 3S2PA 1FMKA 4AW5A 4CV8A 3EIDA 4EOMA 2QQ7A 2WQOA 3CEKA 3MA3A 4X2NA 3LIJA 3BE9A 3CTHA 2BMCA 3JXWA 5KHXA 1DS5A 5K0KA 5IISA 1GY3A 1PXMA 3W0NA 2XA4A 4I5PA 4A9SA 3C0HA 4RPVA 5TF9A 2GFSA 2VO7A 3DBFA 3PLSA 3W1FA 4F4PA 1GZOA 4I4FA 4LMNA 5HQ0A 5M53A 4OBPA 3ULIA 4EWQA 4ANNA 1JVPP 4DEDA 3U4UA 4M69B 2X9EA 4PTCA 4U81A 4K1BA 3NSZA 2J50A 3F3UA 4IZAA 4C4HA 4K33A 4E20A 5M4CA 4BVUA 4J96A 4FKPA 3UOHA 4HJOA 5DN3A 2OLCA 4UMRA 1PMNA 5IA2A 4MWIA 4BDEA 5ETAA 1ZYJA 3OP5A 4F6UA 4DHZA 3UNJA 4P5QA 1V0OA 2YCFA 5F4NA 4QRCA 3VS2A 1ZAOA 3EYGA 2JIVA 2Y4PA 3NEWA 3TNPC 3LKMA 5IQBA 4EC9A 2R3KA 2Y6OA 3MFUA 4I94A 4RIWB 3PXQA 4CZUA 3Q4CA 1KUTA 3FL5A 1UWJA 3A7JA 3ZH8A 3UYSA 3CBLA 4ACCA 3FI2A 3NW5A 3FPMA 3E7VA 5DEWA 1ZOGA 4YTIA 3CPCA 3PE1A 3ZLSA 4QO9A 4M67A 3W18A 2RFEA 1IAJA 4NT4A 3LQ3A 3QQJA 5EHLA 1XH5A 2PZRA 3JY9A 4QMMA 2B9HA 4W4VA 3ZRLA 2IN6A 5E8SA 1MP8A 1YXSA 3F5UA 3II5A 2WZJA 3DCVA 3ZUVA 4XUFA 2VWWA 1LEWA 2R3OA 4I22A 1GNGA 4DYMA 3KL8A 4O1PA 4RFZA 2X8EA 3D7TB 3NVMB 3ZSHA 4YLLA 2EU9A 2G1TA 5IQAA 3CCNA 5CALA 5JT2A 3F7WA 3QD0A 3VHEA 4GRBA 4O7YA 3QZIA 1M2QA 3QUPA 3R7UA 2CGUA 4IACA 5J9ZA 3ETAA 2XCHA 3C4EA 3OEFX 3P7AA 4M7IA 5LWNA 2W5BA 2ITWA 3H9OA 5IF1A 1W83A 4FZ7A 2JFLA 4K2RA 4HYUA 2P33A 3RM6A 3S0OA 1OVEA 4UYAA 2FB8A 4OLIA 1KV1A 3QF9A 2VO0A 5CNOA 4AGDA 3DKFA 5M56A 2YIQA 3I7CA 5HCXA 3GB2A 1F5QA 3W8LA 5L8JA 2VU3A 2DQ7X 4EH9A 3QX2A 2YERA 3L8PA 3RCJA 1TZDA 3HRCA 2YDJA 3QAME 4FL3A 4E5BA 2PWLA 2ZV2A 3S1HA 5CS6A 4ANLA 5EOLA 1MQ4A 4KB8A 5E8VA 4KSQA 4JRVA 4C34A 3G0EA 2UZLA 2X2KA 3QD2B 3W0SA 4EYJA 3MH1A 3LOKA 3R00A 4G3DA 4YBJA 3EJ1A 4GEOA 4ZSGA 2YCQA 4AGCA 3ZFMA 3GUBA 3K3JA 3BHUA 2AEGA 2XJ0A 3MTFA 4R5YA 4HNIA 3QTWA 4J53A 3NNXA 3OBJA 3GU6A 3RK7A 2C5NA 2UZVA 4QNAA 1LPUA 4FMQA 5HIBA 4Q9ZA 5GIOE 1T45A 3ORTA 2X0PA 5HE2A 4J52A 2W7XA 2V55A 3TIZA 5ANGA 4EOPA 1BL6A 4FKWA 4FKSA 4Y5QA 3CP9A 2I0HA 3LFFA 2QONA 2PVNA 4HGEA 3D83A 4FTLA 4U9AA 5AUZA 4A4LA 4TWPA 4M8TA 5DNRA 2HXLA 5F95A 3VRYA 2XYNA 4ZZMA 3BZ3A 2B54A 3NX8A 4EZ3A 4IAAA 2C6DA 4GMYA 4EQUA 3QCQA 3AC2A 3QUEA 3PTGA 5FP5A 4ZLZA 3UO4A 4M14A 3MJ2A 3OCTA 4I0SA 1WBTA 4RQVA 5HU9A 3P86A 4FZDB 4YZMA 3OUNB 1U4DA 5E8XA 4PPAA 5D7VA 5E92A 2X7GA 4L7SA 4RIYB 4JDKA 4F1TA 2OGVA 5CAOA 2VTSA 4OT6A 5AUWA 5EDPA 3KGAA 3HA8A 4QYFA 5KKRC 1JKKA 2HYYA 2WFYA 3FMLA 5J7HA 4IADA 2WMXA 4WD5A 3COMA 2W4KA 3DDQA 2W99B 2GCDA 2ZAZA 3ORLA 4KABA 4A7CA 2YIRA 2PHKA 3BLRA 4O38A 4EOQA 3NLBA 4L68A 3OWKA 4LDTA 2X8DA 3CY2A 4YZ9A 3ZXZA 4BB4A 4DBNA 4OW8A 1ZWSA 4NU1A 4W9XA 2J51A 4H3BA 2IZTA 2CLQA 5IEYA 5C26A 4FTOA 4FVQA 3E8CA 3F88A 4QYYA 2F4JA 2WEIA 4RZVA 3MB6A 5CNNA 3R7IA 3R1YA 1KSWA 4W4YA 5M06A 4DGMA 5HEZA 4FKQA 3C4FA 4CFUA 2PMOX 2BHEA 3V6SA 4QMTA 3AMBA 5HHWA 3QWJA 4G9CA 4C58A 3WYXA 3HVCA 5AADA 3C5IA 3MFSA 2BAJA 4UX9A 4LOOA 5HCYA 2GFCA 1BKXA 4MD7E 4TYJA 4F6WA 3EWHA 5L2IA 3LFQA 2JITA 2OFVA 2XEYA 3SV0A 2GU8A 3RZBA 4AA5A 2WMBA 3VHKA 4YJRA 4RJ4A 5FP6A 1L8TA 5IA3A 4L3PA 3ZS5A 4P4CA 4XV3A 3PXZA 3P5KA 3IDBA 3BLQA 3QZHA 3A4PA 4GUBA 2J0IA 5ANDA 3MSSA 5CEMA 5HGIA 1W0XC 3O96A 4M69A 1OIRA 3O7LD 3EQGA 2UW3A 2UVXA 1M2PA 3MY5A 2WMSA 1FVVA 5BYZA 1ZZLA 3R8VA 4IX3A 2O0UA 2VX1A 3ET7A 4AWIA 2QG5A 3PJ3A 4HGTA 3AKKA 2UVYA 3KKVA 4FV5A 4N70A 4ENXA 5AIRA 2YWVA 5JFSA 3FI3A 3KXHA 4NSTA 5CAVA 4M66A 1O6KA 3HDNA 4R78A 1PXKA 2O3PA 4ZP5A 3OW4A 5C8NA 4GSBA 3F2AA 3I6UA 3S4QA 1S9JA 3P5JC 4ZTMA 4C0TA 5AR7A 2IO6A 5M4FA 3R9OA 2BCJA 1XMLA 3DBQA 3KXXA 5T6KA 2YZLA 1H8FA 4QNYA 4O0VA 4XMOA 4EHEA 2CNQA 4EI4A 2XB7A 5J79A 3DAEA 4RWLA 3FY2A 5E90A 1OL1A 4OBQA 1DAYA 3FV8A 2WO6A 5HG9A 5LXMA 4BBMA 5IUHA 1QPDA 1U54A 1H1RA 4WNMA 5EQEA 1SVGA 1FVTA 3IECA 4D2VA 5EI2A 3UJGA 4EK5A 4R8QA 1XBCA 1LEZA 4K0YA 3JUHA 4YLKA 5D1JA 4OGRA 1YI6A 2PE1A 4FSTA 2G01A 3W33A 3ZTXA 3L9LA 2CSNA 5M55A 4O7SA 2GPHA 4CG9A 3F82A 2I40A 5DEYA 2JAVA 5CVGA 3OTVA 4Z9LA 3TKIA 4F9YA 4AN9A 3FLYA 2WTKB 3BGPA 2HAKA 3DLSA 4L9IA 4NTTA 3POOA 1RE8A 2PU8A 2RFSA 4KA3A 2IW9A 5G1XA 2OU7A 3FEGA 2ZMDA 4PL5A 3Q5IA 4EBVA 2O2UA 3SC1A 1QPEA 2JKOA 3GOKA 4V01A 3R28A 3CJGA 4FG8A 3HP5A 3UQFA 2WTKC 1PHKA 5I9YA 3HMMA 1URWA 1V0BA 4NM7A 3RP9A 3EQFA 2J0MB 1CSNA 3E8EA 2VWBA 4ASZA 5DG5A 1FVRA 3EQDA 4I5CA 2J0KA 4FV2A 4WSYA 4XP0A 2O8YA 5GZ9A 3HEGA 3HRFA 3I7BA 4X6RA 4O0WA 3GC8A 2WQBA 4KBKA 3PLAE 3VS6A 3KRWA 2W1HA 1VJYA 5CU2A 3KMUA 5C8KA 3KVXA 1NVSA 2F7XE 2PPQA 2XNBA 2JDOA 4KKGA 1GZKA 2GNJA 5E9EA 1TQMA 3R8PA 5LVPA 4RLKA 4LRMA 2CKOA 5DIAA 5AP4A 2J9MA