3UG1A

Crystal structure of the mutated egfr kinase domain (g719s/t790m) in the apo form
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
322
structure length
296
Chain Sequence
EAPNQALLRILKETEFKKIKVLSSGTVYKGLWIPEGEKVKIPVAIKESPKANKEILDEAYVMASVDNPHVCRLLGICLTSTVQLIMQLMPFGCLLDYVREHKDNIGSQYLLNWCVQIAKGMNYLEDRRLVHRDLAARNVLVKTPQHVKITDFGLAKLLGAEEKEYHAEGGKVPIKWMALESILHRIYTHQSDVWSYGVTVWELMTFGSKPYDGIPASEISSILEKGERLPQPPICTIDVYMIMVKCWMIDADSRPKFRELIIEFSKMARDPQRYLVIQGDDEEDMDDVVDADEYLI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords Epidermal growth factor receptor
publication title Structural basis for the altered drug sensitivities of non-small cell lung cancer-associated mutants of human epidermal growth factor receptor
pubmed doi rcsb
source organism Homo sapiens
total genus 86
structure length 296
sequence length 322
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2011-11-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3ug1A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3ug1A01
3GU6A 5ETFA 5T3QA 3WARA 3ORIA 4RMZA 3TNPC 1JWHA 3MFRA 2JDOA 1GNGA 1PXOA 2QOQA 3PZHA 3WE8A 1RDQE 3UVPA 2C6KA 5IMEA 3OTUA 2C1BA 3HRCA 4AOJA 3PSCA 4DH8A 3VS0A 4DLJA 5TF9A 2XK6A 4FIGA 2X6EA 3OW3A 5JFXA 5E9EA 4PMTA 4WG3A 2PUUA 4O0SA 4NFMA 3C5IA 2W1HA 4UZHA 1G8SA 3RALA 4YJOA 4C4IA 5J8IA 2BCJA 1CKJA 3FZTA 4ZTMA 2R0IA 3DXQA 5IEXA 5DT4A 4DCAA 4WRGA 3I1AA 4FZDB 5KMLA 2X6DA 4UMTA 4Z7HA 4H3BA 2O0UA 5FGKA 2Y4IB 3HGKA 3WBLA 2GNGA 4FTQA 3EWHA 5I9YA 4BICA 2FO0A 2J7TA 3ZSIA 4YPDA 4G16A 4FSQA 3QRUA 4ID7A 5I9UA 5A46A 2BRBA 4CFUA 4IJ9A 1RW8A 3UOLA 5LQFA 4AP7A 2R2PA 3RINA 4DF3A 3VS6A 1NVSA 3WF8A 4E3CA 4ZSAA 2VX0A 1XQZA 5LCKA 4CZUA 2X81A 1H28A 2ZM3A 3CD8A 4QMPA 3QQGA 2YM3A 5TE0A 3ANRA 4K0YA 2B0QA 4FV2A 2F7XE 3CGOA 4DTKA 4Z9LA 2XEZA 2OH0E 2QLQA 4FOCA 4GJ2A 1K2PA 3VS1A 4IX5A 3CXWA 4DAWA 4JVGA 4QNAA 3TI1A 1BMKA 5HX8A 1MRUA 2EXEA 2PUIA 3RM6A 5EG3A 3D0EA 1M17A 1W98A 4FNWA 5ETIA 5L4QA 3GI3A 2BKZA 3COMA 4EEVA 4DGNA 4EH4A 3BE9A 3FLZA 3HDMA 2VTQA 4FKJA 4RC2A 2BDJA 4YC8A 5DR6A 3SVVA 4BB4A 1OL5A 1MUOA 1I44A 3UOHA 4O0TA 4FKPA 5JGAA 3R2YA 5M44A 3R8ZA 2UZBA 3AXWA 3LCKA 4KIKB 3EYHA 3MPTA 4NW5A 3VBVA 3MB6A 4YURA 4FNXA 4UWBA 5H9BA 1Y8YA 4MNEA 5HIBA 4IVCA 2QOKA 3UMXA 3W2OA 4EUUA 3FEGA 3EIDA 5EFQA 2ZM1A 4XOZA 5CSHA 1PXNA 1Q62A 4LL5A 1YDTE 4FV5A 4H3QA 4MH7A 3IO7A 2BAQA 3ORLA 1V0PA 3QZHA 4I3ZA 4W9WA 4WT6A 3NDMA 4CEGA 1UVRA 3EQGA 4CV9A 3GC8A 4O22A 5IU2A 4GUEA 3OOGA 4FKQA 4BCGA 2Z2WA 4K1BA 3T9IA 2G2FA 5J7HA 1BL6A 4I4EA 4RRVA 4ZZNA 3L9LA 4FIEA 4FSRA 2J5EA 3FZ1A 5DI1A 4OBOA 4AG8A 1CMKE 4TY1A 1UNGA 2J9MA 2PVKA 3I7BA 3NGAA 4AUAA 1BUHA 3VO3A 3NYXA 5IA2A 4KKGA 3I79A 2C0OA 5IUGA 4UBAA 2QNJA 3HEGA 4JDHA 1BL7A 2X8EA 3PWDA 3VC4A 4L3JA 4PPAA 5FD2A 4CKJA 3QUPA 3Q96A 1PXIA 4J97A 3JR1A 4L46A 4I6BA 5L6WL 4RJ4A 3BYVA 3QX2A 3SAYA 4S2ZA 4ZTNA 4IADA 4LG4A 2V7OA 1P14A 4DGGA 3BZ3A 4KUJA 3R71A 5G6VA 2WZJA 3ZU7A 5CZIA 3Q4CA 4AW0A 1PMNA 3HL7A 3IW6A 3SC1A 3VHEA 4E20A 4M66A 4FSZA 1FVRA 5M53A 4EOQA 4X2NA 3PE1A 4JIAA 2JLDA 4YJTA 5B2KA 5KZIA 5AR8A 3ZZEA 4QQJA 3U8WA 2QG5A 4A9YA 3G33A 3U54A 3HMPA 3VBTA 2LAVA 2REIA 1LUFA 5K9IA 4FSYA 5CF4A 5F95A 4JT3A 4XG4A 1JPAA 3O17A 3A4PA 3QXOA 3GFEA 4WNPA 4ACGA 4AOTA 3HDNA 2C5VA 4MNEB 2C5YA 4BDDA 2AC5A 2XKFA 4BGQA 2QI8A 2HZNA 2RFSA 4E4LA 4FG7A 2PYWA 5CSWA 4I5PA 1PW2A 3AC3A 3CQWA 5GZ9A 3BKBA 3BQCA 4FK3A 3A8WA 4ZY6A 2X2KA 3DTWA 1H8FA 3LFCA 3FDNA 3BHUA 3R28A 1CM8A 5IG1A 3BYOA 2OXYA 3UYTA 3O71A 2BIYA 5A4TA 3F88A 4PP9A 5LARA 4FUYA 5JT2A 3ZBXA 4W8DA 2BR1A 4QTDA 2VTHA 4LMUA 4CCUA 2WPAA 3RGFA 4F09A 3BEAA 2JC6A 2VGPA 2IVUA 3CQUA 3MY5A 1UU7A 2NRUA 1UU8A 4O7VA 4NIFA 3CSVA 2OI4X 3ALNA 3EKKA 3EMGA 3ZH8A 1WCCA 3ZDIA 2WMQA 3HUCA 2E9UA 4NUSA 1U59A 2Z7SA 5LMBA 3RNIA 4AGDA 4GMYA 4D2TA 2C1AA 4JG7A 3RPOA 4EH6A 4CMUA 2WMAA 4DYMA 4D5HA 4G3CA 5AUTA 3EFLA 4AW5A 3VF8A 3I6UA 4TZRA 1MQBA 3K5UA 5CZHA 4RIWB 4OLIA 3QALE 3MS9A 3DBFA 4AS0A 4O6EA 5L6PA 3E5AA 5JFWA 2GHGA 4FG8A 4RWLA 1Q8UA 4CXAA 4WOVA 3I5NA 3O96A 2R4BA 3MFUA 3AOXA 4E6AA 5C8NA 1OL7A 4M3QA 1H08A 3CQEA 2I0HA 4HVGA 4FTTA 4RQVA 4PY1A 3CS9A 5CEOA 2YZLA 2A4LA 4JL9A 3ORPA 2YITA 4P2KA 4C02A 4DN5A 3OW4A 1EH4A 4CRLA 4BI1A 4ZJVA 4AZSA 4L43A 3OBJA 2QOHA 2QQ7A 4OTQA 1XH8A 3Q9YA 3FMHA 4E6QA 3H4JA 1AQ1A 1M2RA 4QTEA 5IZFA 4FTLA 2ITVA 3ACKA 3PPKA 3QA8A 3VWAA 3F2RA 4P4CA 4FSNA 2OU7A 4K77A 1F5QA 2PHKA 4EOPA 3HV3A 4PWNA 3FQSA 2YWVA 5FDPA 5AUZA 5K3YA 3KRXA 4TW9A 2RG6A 3WF9A 4AZFA 3HA8A 3PSBA 5C1QB 3NIEA 4DH5A 3F3WA 3R01A 5ANKA 3LHJA 2CKEA 2J0JA 3EOCA 4NCTA 3P7BA 2XM8A 3RM7A 2X7FA 4X3JA 5IUHA 4PDYA 3PP1A 5D11A 5IQFA 3B8QA 2G01A 3I0QA 3H10A 4UYNA 3R8LA 2GFSA 4G34A 4TWPA 2FA2A 4HYUA 4RJ8A 5DGZA 3ZM9A 3UPXA 5FEEA 4NFNA 2PSQA 4MNFA 3Q52A 2EVAA 5JZJA 4FVPA 2V5QA 1YHVA 3O0GA 2GNIA 3MVHA 4I6QA 4A4LA 4CTBA 2BZJA 3DFAA 1DAYA 5DT0A 4FTUA 3L9NA 5KBRA 4RIYA 4M0ZA 2X9EA 1Q99A 2OXDA 1XKKA 2YCFA 1OPJA 1APME 1J7LA 5DRDA 4FTKA 4RX9A 4QP6A 5FDXA 4V05A 2XNNA 5CY3A 3F2AA 4ZIMA 3MJ2A 5EI6A 3ID6C 5AA8A 2J6MA 4EH5A 4YZMA 3COKA 3MGYA 5HEZA 4I1ZA 3O50A 4BZOA 2HY0A 2VTSA 4H1MA 4PNKA 2GS7A 2UZOA 5D12A 3Q6WA 4FMQA 5EDQA 4KABA 4F08A 5JSMA 3QRTA 2RFDA 4BZNA 4FK6A 5JK3A 3PXFA 4EUTA 3ZYAA 2BZIB 3M42A 4NH1A 3M11A 5EQEA 2XK7A 3NX8A 3VBWA 2YWPA 5C8KA 3MWUA 5BUJA 2IWIA 4BFMA 1FBNA 3BRBA 3ZCLA 3VS7A 3HRFA 4NTTA 4R5YA 2XKCA 5HE3A 4WRSA 4GK3A 5AADA 2VTRA 4O7RA 1NW1A 4O38A 1FGKA 3WZUA 5BQ0A 3DZOA 2VN9A 4IDVA 3S1HA 3LE6A 4QD6A 5IDPA 4QMVA 4C3PA 1REJA 3QCYA 1UKIA 3VULA 4BN1A 1H1WA 2ETMA 2ZDTA 4YHTA 3LFBA 3PP0A 4Y5QA 4MXYA 5A3XA 5CAOA 3RK9A 3NYNA 4K9YA 2BROA 5LMAA 4ENXA 3KF4A 3QTXA 3SX9A 3P0MA 3KCKA 3KMUA 3CIKA 3PRFA 4RLLA 4ZJIA 2XYNA 4G3EA 1SMHA 4D2VA 2UVXA 2OZAA 1ZOHA 1R78A 3SKCA 4C3FA 4DTBA 3NR9A 3FKOA 3O7LB 3VUKA 2F9GA 4DA5A 2X0GA 2YJRA 2RG5A 4UALA 3EN4A 4QTCA 5BX0A 1PXLA 1OPKA 3QC9A 2Z02A 3QGWA 1YXSA 3UE4A 4C62A 1OL6A 3FLWA 4A9UA 3BI6A 5CX9A 5E8XA 2I0VA 4PF4A 5A4QA 4H05A 3PYYA 2FSTX 4AA4A 2PZPA 3ZO1A 5CU0A 4LOOA 2PUNA 4XG2A 4D58A 4F63A 3FMNA 4NJ3A 4MWIA 4JJRA 3R9OA 4QYFA 2HW6A 4RQKA 4X6QC 4C61A 4IVDA 2C6DA 1YOLA 4DC2A 2OJIA 3A2CA 3DZQA 4S34A 4BDCA 4XLVA 3BGPA 3JYAA 5AR2A 3TL8A 4Y72A 4JBPA 4EJNA 5J9YA 5EDRA 2H8HA 3FSFA 2ZV8A 3ZLWA 4MF0A 1UA2A 5A54A 3R1QA 4JIKA 2YFXA 3EB0A 4YGAA 4APCA 4RX5A 5HTBA 5JGBA 4ANMA 3NVMB 4I22A 3IGOA 2C3LA 5FRIA 5HBHA 3QQHA 2PTKA 2I6LA 3HMNA 3W33A 1H1SA 4X2GA 2C3JA 3S95A 5DYJA 4NEUA 1IAJA 4JNWA 2FUMA 1GY3A 3VRZA 3HECA 5TO8A 3R30A 4XEYA 5J7BA 2XIYA 4B8LA 3GCVA 3IOPA 2O64A 2RIOA 3W2RA 4BY9E 4KS7A 2Q83A 3I4BA 3R8VA 4ACHA 1OBGA 3KU2A 2QO9A 5I9ZA 3GEQA 3MDYA 3GP0A 5AWMA 4EHEA 4E6CA 4EK3A 4FEUA 4DT9A 3QKLA 3RAHA 2CNQA 3KVXA 4PDOA 5EM8A 5L2QA 3C4WA 4BCIA 2OZAB 4O84A 3DU8A 4MEDA 5LVPA 3GNIB 5M4UA 4G2FA 3NRMA 3FMKA 4QMXA 3EH9A 4FV1A 3CR0A 2VAGA 1YI6A 3PLSA 5HQ0A 4QP4A 3GC0A 3GCPA 3AGLA 4J8NA 1ZYLA 2XJ0A 3HAVA 4QYEA 4RIXA 2C5OA 3FMMA 3QRJA 2VRXA 4Z16A 4XUFA 4LV5A 4S30A 2WEIA 4IC8A 4WG5A 4L3PA 2CHLA 4I94A 3DBDA 3BYUA 3OCSA 1JKTA 3SA0A 5AX3A 3U6JA 3HAMA 4USFA 1R0PA 3HP2A 3JVRA 3BWFA 3U51A 4DITA 2P3GX 4HVSA 3R22A 5HIEA 3QD4A 5A6NA 4D4RA 4GH2A 3L8XA 3DJ5A 4ZSEA 1YQJA 4G5PA 3D4QA 5AP0A 4BDGA 3E8CA 3RPYA 5K5XA 4A9TA 4UZDA 4GG5A 3GCSA 4A9SA 4EKKA 4QP3A 2B1PA 4I6HA 4ZLOA 2UW9A 1GZ8A 3A62A 5HNGA 4HZRA 3AGMA 4CYJA 4ALVA 3BYSA 5BUEA 3BBWA 4BR3A 4MYGA 4JDIA 3F3UA 1Z5MA 4OTGA 3DB6A 4II5A 4JDJA 4JBVA 5H3QA 2R64A 4GT5A 2IPXA 2GS6A 4QOXA 4BCQA 2X2MA 4A4XA 4IMYA 3PFQA 1IG1A 4FSMA 4D1XA 3QCXA 5KBQA 1XH4A 3CKXA 2PVNA 1OBDA 2XUUA 2E2BA 4JLCA 4A7CA 5FXQA 3R7GA 5C8MA 4JG8A 4EOJA 3FYKX 2YAAA 3LAUA 3ZSGA 2VU3A 1ZAOA 4WHZA 5L2WA 2A19B 4H36A 4N70A 3UNZA 3NAYA 2ITNA 3QC4A 1GJOA 4OTRA 5AJQA 4J99A 3K3JA 3Q4ZA 1Y91A 5EM7A 3TZMA 4C8BA 5LVOA 4FTCA 4YO4A 3KA0A 3I7CA 2C3IB 4X2FA 5IH5A 3F7ZA 1SZMA 2W96B 3K5VA 3P7AA 1H01A 2A1AB 2YCQA 4OW8A 5LCJA 3EKNA 3GFWA 1IA8A 5CALA 3A7FA 3KFAA 4I0SA 4L3LA 3RMFA 4A9RA 3NSZA 3R7OA 3NIZA 4D55A 3LKMA 4BF2A 5F20A 2J0IA 4XG8A 3O23A 3OXTA 5EHYA 5KHXA 3QTIA 2XH5A 4IAIA 3TTIA 4NCTC 3QF9A 4R3RA 4F9AA 4M13A 5E8ZA 4D0XA 2XCKA 4ZSLA 5KMNA 5CI7A 3NCZA 3N4VA 3OMVA 3SRVA 4YPSA 2WTKB 2YAKA 3TKHA 5D10A 5FQDC 4J71A 3FYJX 4I0RA 1W83A 4DFZE 3REPA 4FT7A 4RJ6A 5C03A 4CRSA 5A4LA 3QD2B 3PIXA 3CTQA 4KBKA 3SQQA 1JKSA 1PYEA 2P4IA 4IWOA 4O7WA 1OIRA 3VN9A 4JX7A 3LFNA 3CBLA 4ITJA 2YISA 4BRXA 2JAVA 5GINE 4YTFA 1JSUA 4HYSA 3NYVA 1M14A 5FM2A 2ETKA 2WTDA 2YHVA 4ZSJA 2EXCX 3QAME 5KNJA 1R0EA 2YLFA 3NVKI 1QPDA 2ITUA 4LGHA 4CQGA 3CTJA 3GXLA 3CP9A 3ZUVA 4GV1A 2BTRA 3C4EA 3E3BX 4FV8A 4IE9A 4WSYA 5L6OA 5CENA 1Z57A 1NY3A 2IW8A 4PNIA 4DFUA 4YJNA 1OUKA 4AU8A 2XNMA 4MQ1A 2J5FA 3LQ5A 3ZM4A 3DTCA 5DEYA 2IZRA 3A61A 4O1PA 3UG2A 1FMOE 2WMRA 1CKPA 3D7TA 5CU3A 5JRSA 1M2QA 5HHWA 2VWBA 3PPZA 2HAKA 3FI2A 3OF0A 4TNDA 2B9IA 2HZIA 1WBOA 3O51A 3ULIA 5IF1A 4L8MA 1J3HA 4FG9A 3AMYA 4AE9A 2PVYA 5B0XA 5KMIA 4C34A 2B52A 3FHIA 2VTJA 5CEKA 3GU5A 5LVNA 2HIWA 4LGDA 3S3IA 4EK6A 4F6UA 2G2HA 3DT1A 4AN2A 2EXMA 2ACXA 4PX6A 5EI8A 4LL0A 1DAWA 3K54A 3HNGA 3PXKA 2HWOA 4L7SA 5IQHA 2BHHA 5DR2A 4OTFA 2ZV7A 3KXGA 3LFAA 3LXPA 4FYNA 1JLUE 4LUDA 5IA5A 5GZ8A 1PXMA 5DNRA 2ERKA 3HV4A 5EHOA 4YR8A 3DDPA 3GOKA 2J2IB 3HLLA 4OBQA 3SRVB 4JBOA 3R6XA 4HGLA 2H9VA 2G2IA 2WTIA 3AT2A 4D1SA 4GVJA 2W1CA 5GJGA 4EHVA 4PTCA 4FT9A 4BCOA 2Z7QA 3G51A 4RT7A 3PRIA 2VO7A 5HTIA 2ITXA 2NP8A 3C4XA 2QKWB 2VO0A 4NU1A 2FVDA 3U4UA 3VBXA 2A27A 2WELA 4BCJA 3E88A 2JDSA 1BKXA 4I20A 5BYZA 2H96A 2V0DA 2NNWB 1OKWA 2PE1A 4G6LA 3LJ0A 5I3RA 4MD8E 3THBA 4O86A 3P7CA 3POZA 2BPMA 3N4UA 2RFEA 4U40A 2BTSA 4RIOA 4KKHA 4QYHA 3R8MA 4DEHA 3LJ1A 3FPMA 4USDA 5E7RA 4IZYA 4IHPA 1B38A 4AF3A 4FZ6A 3U4WA 4F65A 2C4GA 4ZXTA 3WF7A 5L2IA 4YJUA 1FVTA 3ITZA 4GU9A 4TN6A 2E9PA 1SVHA 5JFVA 5KHWA 2XK3A 2WXVA 4DG2E 5J1WA 4L67A 5FXSA 4YJRA 4M97A 4EBVA 3L8VA 4PP7A 5AEPA 4ACMA 2EWAA 5LWNA 4FV4A 2UZDA 4Q5EA 1JOWB 4FKGA 4ITIA 2IVSA 3HMIA 3MTLA 4GS6A 4KIKA 3D7TB 4NTSA 5CT7A 2ITWA 2YIQA 5CNOA 1FQ1B 4IX6A 5DT3A 4O2ZA 4GT4A 4O0WA 3QQLA 5EQYA 3E8DA 2Y4PA 3CJFA 3D7ZA 5L8KA 4QMSA 2BIKB 2WFYA 1A48A 5DWRA 2NO3A 3SV0A 2VNYA 3R7YA 5CSPA 5I9VA 1M52A 3GB2A 1WBVA 5AR7A 4GSBA 3V5PA 3MVJA 4KWPA 3R0TA 2XKEA 4YJSA 3LMHA 4FV3A 4RC4A 5HO7A 4G3DA 3K2LA 2CKPA 5M51A 3R04A 3OCGA 2WB8A 3S2PA 4YMJA 1ZMUA 2OJFE 4MX9A 4E8AA 2BUJA 2WTJA 2Y9QA 4HOKA 5CEPA 5LMKA 4RJ5A 5F1ZA 4BWPA 4CKIA 4PRJA 5IH6A 4OAUC 1YDRE 3FQHA 4EOSA 2OBJA 3MA3A 3EQHA 4NKSA 4XV3A 5AP5A 3FZRA 4QTBA 3QQJA 3DJ6A 4E4XA 3S00A 3UQCA 5HVYA 2WQMA 2ITQA 2W1ZA 3PUPA 4IM3A 3TV4A 3KL8A 1DI9A 4X7QA 2F49A 4DEIA 3LM5A 2CKQA 3JVSA 4RG0A 3ROYA 2W4KA 3NUNA 3DLZA 4NZWB 3LFQA 2ZJWA 5E92A 5D1JA 3VVHA 4IIRA 3BV2A 4RWJA 4PL5A 4EKLA 5EOBA 4RZVA 5IA3A 3FMJA 1PXKA 1Q8WA 4NT4A 2JITA 5EYDA 3RJCA 5JFSA 4IDTA 3LMGA 4BYJA 3MY1A 4ASDA 4D1ZA 2CGVA 4MK0A 1H00A 4C57A 2F2CB 1KE8A 3HZTA 1U4DA 3A7IA 4FVRA 3WF5A 5EW8A 5AR3A 4IAYA 3MESA 3VQUA 5BVKA 2EB3A 3JS2A 2YIWA 3SGCA 3CCNA 1WBNA 3D83A 4FNZA 2I1MA 5AV0A 2R3RA 4ANBA 5HU9A 4RPVA 3Q2MA 5AP3A 4E6DA 3D9VA 1WBWA 4XS2A 4YHJA 1GZOA 2JBPA 4FV6A 4KA3A 3DKCA 4FIHA 4G5JA 4BCPA 4FL3A 2CKOA 2RFNA 1FVVA 4R78A 3A7HA 4WKQA 4TL0A 5IEVA 4Z3VA 4LOQA 4J7BA 4N0SA 3RAIA 2RF9A 3IQ7A 4EH2A 3E93A 2CLXA 1PMVA 3KKVA 3CC6A 2HWPA 3BV3A 4L44A 2YCSA 4BCKA 5IQIA 3NPCA 1KSWA 2BFXA 3SG8A 4EQMA 4NWMA 5I3OA 4WBBB 5IQEA 4V0GA 2O63A 3VS3A 1Q3DA 4KB8A 5JQ8A 1L8TA 4HNIA 3N51A 3UMWA 2BRHA 5H8BA 5M4IA 1H0VA 1H27A 5CVHA 3ORKA 3PVWA 3ZLXA 1WFCA 2FSOX 4O7NA 1XH7A 1OGUA 4K6ZA 3ANQA 3UQGA 4ZK5A 3EQDA 3VUIA 3ZXZA 3MSSA 3FV8A 4R3CA 4XP0A 1YWRA 4EWHA 4OAVB 5L2TA 2GTNA 2ITZA 3D5XA 4QP9A 4IC7A 2XJ1A 5ETAA 3ZFYA 5HTCA 2A0CX 4X6RA 4JQ8A 3TV7A 4N6YA 4IXPA 4UXQA 3QLGA 1P5EA 3DXNA 2UZUE 3LFFA 5BUIA 3RVGA 5ACKA 4CGAA 4KIOA 4CLJA 4MXXA 1UU3A 2J51A 3G2FA 4FSTA 3VS4A 3UNJA 4QP8A 2W9ZB 3ZEPA 2X7OA 4XX9A 4ASEA 5M4CA 1ZY5A 4EHGA 2P0CA 1ND4A 2R3IA 3PLAE 5HD4A 4I5HA 2BRMA 1I09A 3W2QA 1GZNA 2Y7JA 4EZ5A 3WE4A 3ZO4A 4GK2A 4RIWA 4H58A 5AR4A 3AT4A 4FL1A 3TNIA 3TUCA 4ZOGA 3BYMA 3DBQA 4DEGA 2HCKA 2UW3A 4YP8A 2UW4A 3ATSA 1W82A 1WMKA 3N9XA 3PJCA 3EFKA 3PXQA 3LOKA 2QOBA 3PWYA 5HLWA 4GW8A 2W0JA 4ITHA 4U44A 2HY81 5J5SA 2OLCA 5FP5A 3P79A 2EB2A 3QYWA 4AZTA 4C3RA 1FPUA 4JX3A 3AC2A 5AM6A 4UN0C 5IH4A 3ZDUA 3FQEA 5M08A 3FY2A 3ZO2A 3ZTXA 4GVAA 3NUUA 2BDWA 1G5SA 1STCE 3ENHA 1S9JA 5HNBA 2GNJA 3QQUA 4U6RA 4Y73A 4Y95A 4YSMA 5H8EA 2CDZA 3FWQA 2R3PA 4D2PA 2DYLA 2YIRA 3PVGA 2ZB0A 5EM5A 2QKRA 1IEPA 4FICA 4BDEA 3UDBA 2OG8A 3PY0A 2WU7A 4W4VA 3LXKA 3GQIA 2UW8A 3D2KA 5A14A 1CKIA 4O0UA 4V0GB 4YZDA 2IO6A 4HVHA 3ATTA 4RZWA 2VX1A 3ENMA 1GIJA 3VAPA 3NAXA 3VNTA 4CFXA 2W5BA 4FKUA 4FBXA 4FI1A 5F9EA 4X2KA 5CNNA 2WOUA 3QX4A 5E90A 4FGBA 4AWIA 3F5GA 1KV2A 4YBKA 2PE0A 3ZO3A 1XHAA 5JMSA 1VYZA 5AUVA 1ZY4A 4IB0A 4O83A 3HMMA 4FKIA 3VHKA 1YWNA 3NUSA 4QMYA 5DMZA 1JAMA 3CKWA 4LFIA 3KEXA 5EQPA 3PXRA 2VTTA 2X2LA 3KULA 1ZWSA 4R1VA 4UMRA 2OFVA 2V55A 2ITTA 2Q0NA 3UPZA 5EI2A 2QHMA 2R5TA 2C3KA 5AR5A 4C4GA 4C4JA 3SW7A 4FKTA 4BDHA 3LXNA 3OFMA 2X39A 4DGMA 3TXOA 2I7QA 2P2IA 3HV5A 2X1NA 3DK7A 4HYIA 5KMOA 4Y85A 3EFWA 3DQWA 4CV8A 2Y4IC 3U9CA 5M09A 4Q9ZA 2QOIA 4BTKA 4YTHA 2WTCA 3QGYA 2BRNA 3CLYA 3V6SA 5BNJA 3C1XA 1PHKA 4MTAA 1WBSA 3GC7A 3PIYA 3MFTA 4XP2A 4XMOA 3QKKA 5L8JA 3GT8A 4R5SA 4K18A 4M12A 5GNKA 1PJKA 1ZXEA 1U5QA 2VTLA 3BHYA 2OICA 2SRCA 4C38A 2OF2A 3QA0A 3QZGA 3T8OA 3ZRMA 4D4YA 4FEWA 2HK5A 5M56A 5FLFA 3M1SA 2PZRA 4KINA 4RJ7A 4ZY5A 5KKRB 1SVGA 4X21A 4LQMA 5HICA 3ZOSA 3ERKA 3UG1A 4CD0A 2WNTA 4JQ7A 3POOA 3QRIA 4TKSA 4GKIA 4OR5A 3TIZA 1JBPE 3VUTA 3PY3A 2PE2A 4MXAA 3VS5A 3HMOA 3WOWA 4U41A 1KE7A 1DI8A 2HOGA 5G1XA 4IB3A 3IONA 2HW7A 5TKDA 3V5TA 4BKJA 4FIIA 4KRDA 5CAQA 1PKGA 4ORKA 4LYNA 5H2UA 5HG9A 4AZWA 1FINA 4X0MA 2B9HA 3BU5A 1M7NA 3Q2JA 1E9HA 1LP4A 3UIMA 5AFVA 2Z7LA 4IX3A 4O1OA 2YM5A 5HE2A 2YDJA 3O8PA 5C27A 5LOHA 4LGGA 2VTIA 4O7LA 2W1IA 4DFBA 5AV1A 3UOJA 4IANA 4IBMA 3W18A 1YKRA 1HCLA 3KULB 3LFSA 3ODZX 2CCHA 3EQCA 4JR3A 5AV4A 4XLIA 2XNGA 4XRJA 5CASA 4R8QA 5BPYA 4FKOA 5LVMA 3F6XA 1OL2A 5JZNA 3IDBA 4H1JA 4ZJJA 2WMBA 5CAPA 3TUDA 4UWYA 2XJ2A 2YDIA 3NCGA 3QD3A 3RWQA 4RFYA 4BWXA 4XH6A 1OL1A 4MBLA 5A4CA 5LMKC 2UZVA 3KC3A 4XNEA 4DFLA 3C13A 3PG1A 3OVVA 3HA6A 3TEIA 5IISA 3JXWA 3PTGA 3V3VA 4L01A 5KZ0A 5CF8A 4QPAA 5TOZA 2HYYA 2BDFA 4QMOA 4USEA 3MV5A 3ETAA 4JAIA 5K4IA 3BIZA 5E8YA 3ULZA 4XP3A 1OIUA 4Y46A 1ZOEA 5DN3A 4QMMA 3GOPA 5FTOA 4RWIA 2GU8A 1PF8A 4J8MA 3F5PA 3W55A 4D2SA 2VO6A 5E91A 4G9CA 2WEVA 3F2NA 5FG8A 3C0IA 1E1XA 1K9AA 4EZ7A 1H26A 4F7JA 3KK9A 4IWQA 5EW9A 4L42A 4YC3A 4YZNA 4IZ5A 3AMAA 3CGFA 1YHSA 2B54A 4CZYB 3BGQA 3WZDA 5J9ZA 2YERA 3QFVA 3P4KA 4ANOA 4EORA 3II5A 4FZFB 5TR6A 1XR1A 1CSNA 1NVQA 3KRWA 3Q5ZA 3G90X 4R7IA 5CSVA 1DM2A 4HPUE 3MY0A 3ROCA 4FKWA 4P7EA 4N57A 2WTWA 5FUTA 3TUBA 2YEXA 4BBEA 5CU4A 1QPJA 2W9FB 5HO8A 5JGDA 1PMUA 5JN2A 4ZY4A 4FZ7A 3EQFA 3EN9A 5KMKA 5HG7A 3IPHA 3ZFMA 2NRYA 5EDPA 3FI3A 5AAGA 2BAKA 3JY0A 3FMDA 1H0WA 3SXFA 2WIHA 2YM4A 3OZ6A 2J0KA 5D9HA 5J9LA 4ZTHA 3DPKA 4F0GA 2PVMA 3DS6A 3BHHA 3WI6A 1PRYA 2GNLA 4BDJA 3C5UA 3HX4A 4HZSA 3U87A 4F70A 2C0TA 1OUYA 3F5UA 3FLQA 5DRBA 3UBDA 3DBCA 3ZUTA 5HO6A 3WYXA 4J98A 4F9BA 5CS6A 1TKIA 2XIZA 2VWIA 4RC3A 2JDVA 4I24A 2JKOA 4JAJA 4WIHA 3PVUA 4U7ZA 4UB7A 3TNQB 4BHNA 4E5WA 3UQFA 2O5KA 4RFZA 3R8PA 4EK4A 5BVWA 4CYIA 2HENA 2C68A 5HVJA 2V22A 3CY3A 3OY1A 3KXMA 1OB3A 5BVNA 1ZOGA 2WMTA 3V8WA 4XBRA 1KE5A 3NW6A 3QRKA 4IACA 4XV2A 3LW0A 3FXZA 4FTOA 1UWHA 2WKMA 4FSUA 1R3CA 1URCA 3HVCA 3W8QA 4CVAA 3RKBA 4U9AA 5DIAA 3SXRA 4O82A 3WZEA 1YW2A 4TT7A 3V51A 3TKUA 5DH3A 3SHEA 5CVFA 4DG0E 4E5AX 1IASA 3F3ZA 3R1SA 2UZWE 2PUPA 3R21A 4RA4A 3B2WA 4FTAA 3A99A 4FIFA 4EWQA 4OT5A 5CVGA 4TYJA 1JKKA 4CFNA 1A06A 3UZRA 3W10A 2PULA 2JDTA 4FF8A 2QR7A 3ORMA 4FC0A 3TJCA 4AW2A 1UNLA 2W05A 3F7WA 1A9UA 1XH9A 2QVSE 4AGCA 3UNKA 4G9RA 3MIYA 3NUYA 3U9NA 2PK9A 2QHNA 4Y5HA 3BLHA 2XIRA 3N4TA 4BIEA 2FSMX 3FPQA 5B7VA 2A2AA 4UYAA 3UC3A 4D9TA 2VTMA 1QPEA 5I9WA 3UC4A 1Y6BA 3V01A 4AXAA 1XBCA 1PXJA 2OJGA 3EQPA 3MN3A 4ACDA 4ZMEA 1SYKA 4ERKA 4Q5HA 4J52A 2CSNA 3G9NA 3QWKA 5D7VA 5C01A 1PY5A 5J87A 2PWLA 4XV1A 4EH3A 3NW7A 4TYGA 4C2WA 2R3HA 2UW6A 3H0YA 4O0VA 1REKA 4DEBA 4M67A 3NMUF 4KNBA 3SW4A 1VR2A 3PJ1A 3CPBA 2XCHA 3TZ9A 4L00A 1XBBA 2JD5A 4IAKA 4F0FA 3RK5A 3F5XA 3DK3A 3OY3A 3AC1A 3NNXA 3QD0A 3Q60A 3MBLA 2OJ9A 2YCRA 3QCSA 3P9JA 3U55A 2HZ4A 1KOBA 4FTNA 2WQBA 2YA9A 2FYSA 2B9JA 1QPCA 4OTWA 3QTQA 3TKIA 3ZZWA 1H07A 2VZ6A 4QPSA 2F7ZE 3CY2A 4CNHA 3Q6UA 3WIGA 2RL5A 1GZKA 3LCDA 3RNYA 1CTPE 3Q4TA 2VV9A 2XBJA 4GIIA 4BGGA 2WQNA 4IWPA 3UZTA 2W17A 2QLUA 5AP1A 1XH6A 4ZS4A 5L8LA 5LVLA 1Q5KA 3QQFA 3QZFA 4IB5A 4U79A 3OT3A 2BZKB 3LM0A 1KV1A 3MB7A 2OKRA 3P1AA 3RBWA 5KO1A 4KS8A 5ANOA 2P55A 3DBEA 3FKLA 2J4ZA 4QQCA 4H3PA 5T6KA 4AFJA 5CANA 2OK1A 3L8SA 5HD7A 4WNKA 3R9NA 3ZC5A 1YXXA 2QO7A 4GYIA 3SDJA 3BX5A 1Q97A 4YJQA 3EHAA 5ANIA 4AT4A 1O9UA 3BLQA 3BPRA 1W84A 3A60A 3H30A 3OEZA 4HGTA 4RVTA 2WQEA 3JPVA 3OD6X 4HYHA 2BMCA 3KRRA 3W2CA 1GAGA 1YDSE 3M2WA 4TYEA 4JDKA 3TCPA 3R9RA 5DLSA 3OHTA 2CGWA 3O8UA 2GCDA 4MKCA 5FXRA 5HNIX 4PV0A 4UWCA 1ZARA 5EKNA 4I92A 3TIYA 2R7IA 4IAZA 4MXZA 5IKWA 1W0XC 3S0OA 3G9LX 4RFMA 5BVFA 3BQRA 5GHVA 3VW8A 3D94A 2VWUA 3LLTA 3ZC6A 4FKRA 3VW6A 1MP8A 2OF4A 5AUYA 3LXLA 1G3NA 4M15A 4YJVA 5CWZA 4O7ZA 3OG7A 2VWYA 2WMWA 4QTAA 4QP7A 3EFJA 4A4OA 4KIQA 5CEIA 4S31A 5LWMA 3PIZA 3C50A 4ANQA 4DT8A 2XNOA 3F69A 3TZ7A 4CFFA 4G17A 2XIXA 4FTIA 2Z7RA 4HPTE 3ORZA 5KMMA 2BFYA 2J0MB 4P90A 3IKAA 3QTRA 3ZMMA 2VO3A 3KY2A 1Q24A 2QOFA 4FT5A 4O7TA 1SVEA 4NM0A 3C9WA 4KSQA 4TNBA 2X8DA 3KXZA 2ZVAA 1ERKA 5KX8A 4RA5A 5C4KA 2PVLA 2Y6MA 3KB7A 4M68A 5CTPA 4V01A 4Y8DA 4WNMA 4EH7A 1LEZA 4B4LA 2DWBA 1H25A 1WZYA 2E9OA 3FMLA 4XRLA 4W4WA 5EYCA 3OP5A 3KMMA 4OTPA 5CU2A 4PMMA 2YDKA 4ASXA 4YLLA 4ZTLA 3Q32A 5AP7A 5HESA 3NNVA 1T45A 2GQGA 4M0YA 4P5ZA 3RWPA 4F6SA 3Q04A 1PXPA 4XV9A 3A8XA 4WBOA 5FEQA 2XM9A 3WZJA 3DKOA 4YNOA 2R0UA 5IMXA 2GHLA 2XB7A 5CAUA 2B9FA 4MHAA 4W8EA 4ZEGA 3NUPA 4CFMA 4AGUA 2QOLA 4UX9A 3DAJA 1PYXA 5BYYA 2WO6A 4IM2A 2AUHA 3TTJA 3VBQA 5IQCA 2VTAA 4YLJA 3R1NA 2UZEA 5HIDA 4RSSA 4M8TA 3DGKA 1B6CB 5EH0A 1ZZ2A 4P5QA 2C6LA 3O8TA 4FODA 4ZTRA 3UYSA 4BI2A 3BU6A 2GS2A 2ZV2A 4K33A 2ITPA 4HJOA 4PUZA 3AC8A 4ZTQA 3ZEWA 3Q3BA 2BVAA 5CXHA 4EI4A 2C0IA 2BILB 5EYKA 2HXQA 1GIHA 2XK4A 3WIKA 2YZAA 4U3YA 2WTVA 2PZIA 2ONLA 4JR7A 3TNHA 3RPRA 2OJJA 2ZDUA 3PG3A 3Q5IA 1JSTA 3BGZA 3E8EA 2PMOX 5K0KA 4BCMA 4AQCA 4EJ7A 2OGVA 3R02A 1P4OA 2VWVA 2XKDA 1OM1A 4BCHA 3HV6A 3G0FA 3W2PA 4EOIA 4F9WA 3GU4A 4QMLA 4HCTA 4QQTA 3PXYA 4FYOA 4XJ0A 3OWPA 2C47A 4ALWA 4TYHA 2JFLA 4ZLZA 3UZPA 3FY0A 4DEEA 3PA3A 2QD9A 4IZAA 2JDRA 4O91A 5KE0A 2R3MA 4GUBA 3V5JA 1ZLTA 3OCBA 3ACJA 4CFWA 3B8RA 4EC8A 5DVRA 3Q9XA 2R3QA 5CF6A 2WMXA 2IVTA 2QU5A 3GU8A 4FOBA 2Y8OA 3EL7A 2GNHA 3QHRA 5ANGA 3DOGA 4U3ZA 2X4ZA 2VWWA 2XIKA 4J1RA 4IW0A 4D28A 4PQNA 4OT6A 1RE8A 4GRBA 4G6OA 2JIVA 2R3OA 4R3PA 2CJMA 1ZRZA 2ITOA 5I9XA 3D5WA 1OZ1A 3LFDA 2QOOA 3GVUA 1SNUA 4DE4A 1Q61A 4RLKA 4AGWA 5HGIA 4DINA 4GFGA 4BDFA 4MXCA 3V8SA 4BBFA 4C35A 1R1WA 2XF0A 4AN9A 3IECA 1WVWA 1OKZA 2IZUA 3NUXA 5FWKK 3PPJA 4U97A 5H8GA 4CMTA 4ZMFA 4BC6A 4EC9A 4DEDA 3HRBA 4E4NA 2FB8A 4NK9A 4ARKA 2W99B 5CQWA 4MF1A 3QQKA 2WMUA 2EU9A 1T46A 2XBAA 1XJDA 2OW3A 3IW5A 4IB1A 3MPMA 3R00A 3MH2A 4DEAA 1XWSA 2JBOA 4FV9A 4J95A 5C9CA 1V1KA 3DNEA 3QTWA 5AA9A 4M69B 3H0ZA 4C2VA 5FBOA 3RCJA 3DDQA 3EN7A 3P86A 5CYIA 3QU0A 3FLNC 5ANJA 3CEKA 4IVAA 3LCSA 1YRPA 5IUIA 4BCFA 3TDVA 3VS2A 2ZMDA 2R3NA 3ORTA 3IW4A 4QP1A 2XS0A 4YU2A 3FI8A 1OECA 3GU7A 3JY9A 5EK7A 5GZAA 4FEVA 5GIPE 2VNWA 2XA4A 3QZIA 4RX8A 5EHLA 4RBLA 3MIAA 4F0IA 4TYHB 4ANNA 5F4NA 3F9NA 3HP5A 2BKKA 4C59A 2Z8CA 1KE9A 4MWHA 4FV0A 5T68A 3VUMA 4DH7A 4EH8A 4F6WA 5E8TA 1Y57A 3OXIA 5DEWA 1KE6A 1E1VA 1UWJA 2XZSA 5FM3A 2GFCA 2GSFA 3KCFA 4KBAA 4O2PA 4ONAA 5CSXA 3Q9WA 3KXNA 1JVPP 3MVMA 4I5CA 4XG9A 4BWKA 1BLXA 2YM7A 2R3FA 4B0GA 4MBJA 4UEUA 3V8TA 2WTKC 1Q8YA 4AA0A 5KUPA 3P23A 4EOKA 4FVQA 1PKDA 5HG8A 2R3GA 3F3VA 2H6DA 1JNKA 5HI2A 4U43A 2XNEA 3PSDA 4L9IA 3ZUUA 4R6VA 3DV3A 4LI5A 3OT8A 4X2JA 3NLBA 1XO2B 1IAHA 4AACA 3KK8A 2P33A 2YLEA 3E8NA 4WUNA 1ZMVA 4EQCA 3DLSA 4GCJA 1WVYA 4JXFA 4B7TA 4UMUA 5M06A 4AZVA 2R9SA 3MA6A 5EM6A 4KKEA 1YXTA 4JQEA 4YSJA 3NYOA 3NS9A 5D7AA 5ANEA 4YTIA 1U54A 4F7SA 3F66A 4L7FA 4IFGA 3BEGA 4Y83A 3QWJA 2UW7A 2YIXA 3F61A 4BKZA 3IS5A 4D2RA 1O6LA 2OWBA 4ZSGA 3VIDA 1YI4A 3I6WA 3MFSA 4ALUA 4GIHA 3P08A 3ZLYA 4D4SA 1KWPA 5FTQA 4PPCA 3G6GA 4EK5A 5B2LA 3TWJA 3PDTA 5E4HA 1KOAA 2C69A 2FH9A 5CU6A 3FL5A 1UKHA 2XK9A 2QONA 4KRCA 3D14A 4CT2A 2O8YA 4B8MA 1UU9A 3E62A 3UIXA 5ACBC 1RQQA 3QUDA 5I5ZA 4YLKA 3LCTA 2JEDA 4HVDA 3C0HA 4FUXA 4UMPA 3OBGA 4IX4A 4YZBA 2QG7A 5ICPA 3ZONA 3WF6A 4DGLC 2PMLX 3EZRA 3JUHA 2YIYA 3FLYA 3ORNA 4O96A 3KN5A 4A07A 3UP2A 2C6OA 1JQHA 3GCUA 2W5AA 2YABA 4EK8A 3SOAA 1VJYA 1URWA 3UVRA 4AFEA 3DK6A 3H9OA 3VJNA 4LUEA 4J53A 3OROA 4U81A 2JKMA 4HCVA 3RPVA 4EOLA 2UVZA 2JKKA 3D5UA 4F1TA 4BHZA 4AOIA 4BVUA 1TQMA 2I0EA 3AC5A 3IGGA 4LV8A 5I0BA 4FKVA 4C36A 1Y8GA 5JEBA 2VUWA 1YXVA 2GPHA 1QMZA 4F64A 3BHTA 2BAJA 4FA2A 2UZLA 5AIKA 2F4JA 2I0YA 3EL8A 2C6IA 3GUBA 4PTEA 4S33A 3O7LD 5BMMA 3VUDA 1NA7A 4CTCA 1U54B 4B99A 4MD7E 1Y6AA 2G9XA 2GDOA 3L9PA 3R1YA 4D4VA 4U0IA 4W4YA 3I0OA 3I5ZA 2PU8A 5HCZA 3EN5A 3MYGA 4KSPA 3NNWA 4OUCA 3TACA 2PMNX 2ERZE 2RGPA 4C4FA 3KF7A 4IJPA 3OTVA 4QRCA 5IQDA 3AD5A 2WMSA 5FTGA 1AD5A 1M2PA 5HLPA 2WOTA 3VQHA 2C6EA 3MTFA 3ODYX 3V6RA 5JQ5A 2CGXA 2I40A 3L9MA 4BTJA 2UW0A 4XG3A 4FL2A 4IQ6A 4IWDA 3FZOA 3PZEA 1H1PA 4K11A 3WILA 2OFUA 4FR4A 3RHKA 5HCYA 3T9TA 4CCBA 4U5JA 4GU6A 3MH0A 4UY9A 3EQBA 2DUVA 5ANDA 4DG3E 2CLQA 4I6FA 4M7IA 1Q3WA 5GJFA 5K0XA 2VTOA 4XBUA 5AAFA 1OIQA 3QTSA 2W06A 4NM5A 2ONLC 3HUBA 5AUUA 3VRYA 3CD3A 2J50A 3DFCB 5HVKA 5FBNC 1Q4LA 3PXZA 5IQBA 3EQRA 4MXOA 4KAOA 4NSTA 1RJBA 1SM2A 4G31A 5DE2A 5AP6A 2R3KA 4L53A 4C4EA 4YUQA 2UV2A 3ZBFA 5M4FA 4QQ5A 3ZRKA 4ZP5A 2CN5A 4I0TA 3FZSA 1Q8TA 5JRQA 1YVJA 3QL8A 3KREA 1ZYCA 3MPAA 5AAEA 2PVFA 4C7TA 3C4FA 3VF9A 4EBWA 2IN6A 4FTMA 3IOKA 4IAAA 2JIIA 3UO6A 2E9NA 4BZDA 5AM7A 3FZPA 3UVQA 5EYMA 2KTYA 4QMUA 4RGJA 3K3IA 4XG7A 4AT3A 4GJ3A 3IW8A 3W32A 2ETRA 4JS8A 5ITAA 3FLSA 4WO5A 4H39A 4PDSA 4W4XA 5AP2A 2F7EE 3DJ7A 2X8IA 2HZ0A 1IA9A 2GTMA 4X3FA 2IW9A 1BYGA 1VEBA 4C0TA 4NKAA 4GKHA 3BELA 2GQRA 2DQ7X 4ERWA 3DQXA 3W16A 3NUAA 2IW6A 4FEXA 1O6KA 2OXXA 3UP7A 4IM0A 1KUTA 3FAAA 2AYPA 4HVIA 5GIOE 1OPLA 3OWLA 3RPSA 3LFEA 2CCIA 2G15A 3LPBA 4NM7A 1BI8A 3DAKA 4EOMA 1HCKA 3ORXA 4TWOA 4C33A 2VX3A 3E64A 3TDWA 5E1EA 4QPMA 3CPCA 1JSVA 2YM6A 4AW1A 2PZYA 3RZFA 4CLIA 2KULA 2VD5A 2IG7A 4QO9A 4BIDA 4YC6A 2RSVA 4YJPA 3A7JA 4NL0A 2QODA 5AV2A 2J90A 3IDCA 3LIJA 4W9XA 4ASZA 1TQPA 3F3TA 2WAJA 3QTZA 2C6MA 2F57A 1UV5A 4FIJA 4R77A 1V0BA 3CE3A 1H1QA 3R7VA 4NIFB 4YNEA 4V04A 4QYYA 3VUHA 2GMXA 4BI0A 3AQVA 1ATPE 2OIBA 2W1FA 4XCUA 3UODA 3FBVA 1IR3A 4HGEA 1YOMA 5D41A 4DGOA 4AN3A 2CPKE 2JGZA 2OO8X 2CMWA 2ZB1A 4WSQA 4D9UA 4I4FA 3MH3A 3BE2A 2XNPA 4MAOA 1NVRA 2ITYA 4JRNA 3COIA 4PTGA 3S4QA 2WGJA 2C5NA 5HE0A 2HELA 3PJ2A 5A9UA 2F2UA 5LXMA 1W8CA 3LVPA 1S9IA 4L45A 3UGCA 5IEYA 1LPUA 1VZOA 3TNWA 4ZZMA 2Y0AA 5IA1A 4CT1A 4X3FB 3R8UA 2W4JA 2UW5A 1VYWA 4GYGA 1NXKA 1M7QA 4EOOA 4C58A 1YOJA 1ZYJA 4Q2AA 1V0OA 3PY1A 2BALA 1DS5A 4EONA 1NT2A 1YXUA 4FTJA 2C5XA 4R1YA 1CDKA 1ZZLA 3RK7A 1QL6A 3D2IA 3T3VA 1Z9XA 2XK8A 4FKSA 4GL9A 4J96A 5JKGA 2WHBA 3E87A 4MVFA 3E7VA 2JFMA 4BDAA 3ET7A 3QYZA 3UOKA 4FKLA 4G3GA 3I60A 3T3UA 4GEOA 4D0WA 1OIYA 2C6TA 5HZNA 5M07A 2VWZA 3DCVA 4DH3A 3GENA 3TN8A 3FSKA 3AG9A 4O81A 3HKOA 4BDBA 2PY3A 5BVDA 3BWJA 4A06A 4LOPA 4M84A 3D5VA 4DH1A 3OC1A 2NPQA 3R73A 5IA4A 3PA5A 2XYUA 5EOLA 1Q8ZA 4BYIA 1BI7A 3E63A 4JI9A 5CXZA 1MQ4A 5DOSA 3GQLA 3RAKA 2QO2A 4DHFA 4NW6A 3ELJA 4BTMA 4DBNA 3U6IA 3CJGA 3BCEA 4KD1A 1G8AA 3DA6A 4Q9SA 4RVKA 4F9YA 2QCSA 3E7OA 4WA9A 4E4MA 4G3FA 3TV6A 4CQEA 2R3JA 3G15A 2G1TA 1WBTA 3A4OX 4DLIA 5LJJA 1GOLA 5F94A 4RVLA 3R63A 4TRLA 4RIYB 4G1WA 3HYHA 4I21A 2IZSA 5AUXA 4F99A 3RAWA 1FOTA 4OTHA 2GQSA 4QT1A 4EZ3A 5ETCA 4XOYA 2QC6A 3Q53A 4JBQA 4U42A 4WUAA 5AMNA 4QMWA 5HBEA 3BBTB 2CNVA 4PL4A 4O7SA 1OI9A 1H4LA 2H34A 5E1SA 2ZMCA 5AP4A 1L3RE 2ZAZA 2VTPA 4TPTA 1LEWA 2ZOQA 2OIDA 3L1SA 3W8LA 4U8ZA 1H24A 3TJDA 4AE6A 5JH6A 2CN8A 3BLRA 1J7UA 5EW3A 2O3PA 4BL1A 5KKRC 1GIIA 4PMSA 3DXPA 2LGCA 1F0QA 4OBPA 5IA0A 4EHZA 5L2SA 4K8AA 4RWKA 2ESMA 1B39A 3ZHPC 3LJ2A 4E73A 3V5WA 4EH9A 5CEMA 2W1GA 1W7HA 5AX9A 3LMIA 2IZTA 2PVJA 2YM8A 3FKNA 2XNBA 3P5KA 4DFYA 5I4NA 4TXCA 3KGAA 4HCUA 4D5KA 1J91A 4OTIA 5HLNA 1OVEA 4CG8A 2UZNA 3RP9A 2YN8A 4KIPA 4IEBA 3CTHA 2DS1A 4XHKB 5CAVA 3DKGA 4GK4A 3G0EA 4YZ9A 5DFPA 1H1RA 3ZSHA 2O2UA 3DAEA 4FT3A 4YZCA 5IPJA 3OUNB 3SXSA 4E93A 5BMSA 2C30A 3QXPA 4RX7A 4CKRA 4ENYA 4O6LA 3SD0A 3GBZA 1ZYSA 3VJOA 3F82A 1J1BA 4GG7A 5HU3A 4CMOA 3AD6A 3TZ8A 3RHXA 1YHWA 4LRKA 2PL0A 1QCFA 5HG5A 2OH4A 3EJ1A 3EN6A 4E1ZA 4QMTA 1P4FA 4U80A 4D2WA 1R39A 4WNOA 4WG4A 1J7IA 4EYJA 4DTAA 2HXLA 3QLFA 3SG9A 5AUWA 1FMKA 4I41A 4FGRA 3FC2A 3U6HA 2ZM4A 3PVBA 4NM3A 5J5TA 4EYMA 2UUEA 5CT0A 2B4SB 4RJ3A 3MH1A 4JRVA 2FSLX 3PJ8A 2R3LA 1AGWA 4AT5A 4APPA 4FSWA 4IFCA 3KQ7A 2FGIA 2UVYA 3OS3A 1LR4A 2IJMA 5AIRA 4ZZOA 4S32A 4YTCA 1ZMWA 2J0LA 4E7WA 4O0XA 3IW7A 4YHFA 3UJGA 3D15A 4JG6A 3FI4A 4TWCA 2GNFA 4I93A 5DPVA 5IQGA 4C4HA 3GCQA 4NYEA 3KRLA 3B2TA 3KVWA 2UZTA 1Q41A 4PL3A 2PZ5A 3W1FA 1P2AA 4QMNA 2VWXA 2AC3A 2XRWA 1TQIA 3R83A 4LM5A 4TWNA 3UIUA 5CEQA 2YACA 2VTNA 4FEQA 3IG7A 1U46A 3HV7A 3UO4A 4EQUA 4O0YA 5J95A 4DFXE 5M57A 3BHVA 5HCXA 1ZYDA 4MQ2A 3RZBA 3AT3A 2XMYA 3R9HA 4L68A 5E8SA 4BIBA 2E9VA 3I81A 4UMQA 4X3FC 3AMBA 2Y6OA 2ZV9A 4OTDA 4E26A 2GHMA 4Z7GA 1BX6A 2O65A 3LLAA 1F3MC 3C4CA 4HNFA 3G5DA 1WBPA 4PDPA 2XP2A 3KXXA 4N4SA 4EL9A 4IAFA 3FJQE 3IK3A 1XH5A 2B7AA 3Q9ZA 4QMZA 4CFVA 5HX6A 5K5NA 3NNUA 4TTHB 5FEDA 3OUKA 5A4EA 3FMEA 4QNYA 3RI1A 3LCOA 3ZRLA 2V7AA 1FGIA 3OCTA 3ZLSA 3LQ3A 3FE3A 2PMIA 3NWWA 3Q4UA 4B6LA 3PJ3A 3TM0A 4O0RA 4UXLA 3FHRA 2JKQA 3H9FA 5IQAA 3LQ8A 3EQIA 4RIXB 5DA3A 1JKLA 4R7HA 3TG1A 4ACCA 2QURA 5KMJA 4MBIA 5C26A 5DR9A 5L3AA 3V5QA 3C51A 4C37A 3E3PA 1X8BA 3AC4A 3C7QA 3QHWA 4TYIA 3R7UA 4BCNA 4CZTA 2XVDA 5DHJA 4GT3A 4L6QA 5J1VA 4UV0A 1SNXA 2CNUA 5CI6A 4LRMA 4NJDA 1K3AA 3DB8A 3KRJA 3QUEA 4MCVA 4QP2A 4YO6A 2WD1A 4FE2A 4ZAUA 4DBXA 1J1CA 3MW1A 5M55A 4FNYA 3AD4A 3MVLA 4IH8A 2R7BA 4IZ7A 3P78A 2PPQA 5HORA 4AX8A 1MRYA 5KCVA 2JIUA 3GGFA 3MJ1A 3DNDA 3FL4A 1HOWA 4FT0A 3SOCA 4QYGA 3OOMA 5E8WA 3R7IA 4LMNA 3FUPA 4ANLA 4BDKA 2QU6A 4PPBA 4OGRA 3A7GA 3TT0A 1OKVA 4BGHA 4XG6A 3GC9A 1OKYA 1WVXA 2VGOA 3OXZA 4AA5A 1YWVA 4F4PA 1O6YA 3C4ZA 1UNHA 4MD9E 5A6OA 4R7BA 1U5RA 3NW5A 3H3CA 2WIPA 2Z60A 4F7NA 3VBYA 3PA4A 4GFOA 3QBNA 1OMWA 2WQOA 5FP6A 4O7YA 5GJDA 5HOAA 3WZKA 3ZXTA 4FX3A 3FXXA 4F1OA 2Q0BA 1PMEA 3MI9A 3ZFXA 2EUFB 4CSVA 4N6ZA 3DY7A 4ZTSA 4GFMA 2OZOA 4HGSA 1XBAA 2JAMA 3C0GA 3G6HA 3KMWA 3UIBA 4B9DA 4BTFA 4JOAA 5CLPA 5E8VA 2QOCA 4BKYA 4L52A 4ZLYA 5K4JA 2WMVA 3DKFA 4M14A 5HBJA 4ANSA 3IDPA 4G6NA 4YBJA 5EKOA 3WYYA 5IDNA 4M69A 4FZAB 2XEYA 1TVOA 5J79A 4K2RA 2B53A 5C4LA 2W5HA 4WD5A 3QKMA 3OWKA 3PE2A 2IVVA 2BZHB 2PVRA 2RKUA 5DBXA 2ZYBA 3LZBA 4AZEA 3FXWA 4F1MA 5HKMA 2X7GA 5TT7A 3L8PA 5AV3A 4I5MA 4O27B 1IRKA 1MRVA 2P2HA 3QCQA 4LRJA 5BVOA 3ZS5A 1YI3A 4I23A 2OSCA 4HW7A 2XRUA 2W1DA 3FC1X 4CG9A 5BYLA 3W2SA 3OEFX 3RTPA 3KN6A 3NEWA 5CQUA 5B2MA 2W1EA 3NZ0A 4IVBA 2V62A 2BRGA 3COHA 3H9RA 3VUGA 2WU6A 5HE1A 4F9CA 4PMPA 4XYFA 3R9DA 4O21A 3QTUA 4U45A 3BU3A 3EYGA 3RCDA 5CF5A 4BBMA 2X9FA 2OIQA 4RVMA 4AAAA 3ALOA 3KXHA 4BDIA 3V04A 2W7XA 4ZS0A 2X4FA 1WAKA 5DG5A 5E8UA 4E5BA 4F7LA 3E92A 3EZVA 3R2BA 2QR8A 4FV7A 3V5LA 4DCEA 4FTRA 4Z55A 4DFNA 3OWJA 3R7EA 2BHEA 2W4OA 3O2MA 3SLSA 1OITA 2CGUA 2PVHA 3UO5A 2YJSA 5BVEA 3UTOA 2B55A 4QMQA 4KBCA
chains in the Genus database with same CATH superfamily
3GU6A 5ETFA 5T3QA 3WARA 3ORIA 4RMZA 3TNPC 1JWHA 3MFRA 2JDOA 1GNGA 1PXOA 2QOQA 3PZHA 3WE8A 1RDQE 3UVPA 2C6KA 5IMEA 3OTUA 2C1BA 3HRCA 4AOJA 3PSCA 4DH8A 3VS0A 4DLJA 5TF9A 4AXDA 2XK6A 4FIGA 2X6EA 3OW3A 5JFXA 5E9EA 4PMTA 4WG3A 2PUUA 4O0SA 4NFMA 3C5IA 2W1HA 4O4FA 4UZHA 1G8SA 3RALA 4YJOA 4C4IA 5J8IA 2BCJA 1CKJA 3FZTA 4ZTMA 2R0IA 3DXQA 5IEXA 5DT4A 4DCAA 4WRGA 3I1AA 4FZDB 5KMLA 2X6DA 4UMTA 4Z7HA 4H3BA 4BJJB 2O0UA 5FGKA 2Y4IB 3HGKA 3WBLA 2GNGA 4FTQA 3EWHA 5I9YA 4BICA 2FO0A 2J7TA 3ZSIA 4YPDA 4G16A 4FSQA 3QRUA 1ST0A 4ID7A 5I9UA 5A46A 2BRBA 4CFUA 4IJ9A 1RW8A 3UOLA 5LQFA 4AP7A 2R2PA 3RINA 4DF3A 3VS6A 1NVSA 3WF8A 4E3CA 4ZSAA 2VX0A 1XQZA 5LCKA 3NFFB 4CZUA 2X81A 1H28A 2ZM3A 3CD8A 4QMPA 3QQGA 2YM3A 5TE0A 3ANRA 4K0YA 2B0QA 4FV2A 2F7XE 3CGOA 4DTKA 4Z9LA 2XEZA 2OH0E 2QLQA 4FOCA 4GJ2A 1K2PA 3VS1A 4IX5A 3CXWA 4DAWA 4JVGA 4QNAA 3TI1A 1BMKA 5HX8A 1MRUA 2EXEA 2PUIA 3RM6A 5EG3A 3D0EA 2IF8A 1M17A 1W98A 4FNWA 5ETIA 5L4QA 3GI3A 2BKZA 3COMA 4EEVA 4DGNA 4EH4A 3BE9A 3FLZA 3HDMA 2VTQA 4FKJA 4RC2A 2BDJA 4YC8A 5DR6A 3SVVA 4BB4A 1OL5A 1MUOA 1I44A 3UOHA 4O0TA 4FKPA 5JGAA 3R2YA 5M44A 3R8ZA 2UZBA 3BL7A 3AXWA 3LCKA 4KIKB 3EYHA 3MPTA 4NW5A 3VBVA 3MB6A 4YURA 4FNXA 4UWBA 5H9BA 1Y8YA 4MNEA 5HIBA 4IVCA 2QOKA 3UMXA 3W2OA 4EUUA 3FEGA 3EIDA 5EFQA 2ZM1A 4XOZA 5CSHA 1PXNA 1Q62A 4LL5A 1YDTE 4FV5A 4H3QA 4MH7A 3IO7A 2BAQA 3ORLA 1V0PA 3QZHA 4I3ZA 4W9WA 4WT6A 3NDMA 4CEGA 1UVRA 3EQGA 4CV9A 3GC8A 4O22A 5IU2A 4GUEA 3OOGA 4FKQA 4BCGA 2Z2WA 4K1BA 3T9IA 2G2FA 5J7HA 1BL6A 4I4EA 4RRVA 4ZZNA 3L9LA 4FIEA 4FSRA 2J5EA 3FZ1A 5DI1A 4OBOA 4AG8A 1CMKE 4TY1A 1UNGA 2J9MA 2PVKA 3I7BA 3NGAA 4AUAA 1BUHA 3VO3A 3NYXA 5IA2A 4KKGA 3I79A 2C0OA 5IUGA 4UBAA 2QNJA 3HEGA 4JDHA 1BL7A 2X8EA 3PWDA 3VC4A 4L3JA 4PPAA 5FD2A 4CKJA 3QUPA 3Q96A 1PXIA 4J97A 3JR1A 4L46A 4I6BA 5L6WL 4RJ4A 3BYVA 3QX2A 3SAYA 4S2ZA 4ZTNA 4IADA 2XAOA 4LG4A 2V7OA 1P14A 4DGGA 3BZ3A 4KUJA 3R71A 5G6VA 2WZJA 3ZU7A 5CZIA 3Q4CA 4AW0A 1PMNA 3HL7A 3IW6A 3SC1A 3VHEA 4E20A 4M66A 4FSZA 1FVRA 5M53A 4EOQA 4X2NA 3PE1A 4JIAA 2JLDA 4YJTA 5B2KA 5KZIA 5AR8A 3ZZEA 4QQJA 3U8WA 2QG5A 4A9YA 3G33A 3U54A 3HMPA 3VBTA 2LAVA 2REIA 1LUFA 5K9IA 4FSYA 5CF4A 5F95A 4JT3A 4XG4A 1JPAA 3O17A 3A4PA 3QXOA 3GFEA 4WNPA 4ACGA 4AOTA 3HDNA 2C5VA 4MNEB 2C5YA 4BDDA 2AC5A 2XKFA 4BGQA 2QI8A 2HZNA 2RFSA 4E4LA 4FG7A 2PYWA 5CSWA 4I5PA 1PW2A 3AC3A 3CQWA 5GZ9A 3BKBA 3BQCA 4FK3A 3A8WA 4ZY6A 2X2KA 3DTWA 1H8FA 3LFCA 3FDNA 3BHUA 3R28A 1CM8A 5IG1A 3BYOA 2OXYA 3UYTA 3O71A 2BIYA 5A4TA 3F88A 4PP9A 5LARA 4FUYA 5JT2A 3ZBXA 4W8DA 4O4DA 2BR1A 4QTDA 2VTHA 4LMUA 4CCUA 2WPAA 3RGFA 4F09A 3BEAA 2JC6A 2VGPA 2IVUA 3CQUA 3MY5A 1UU7A 2NRUA 1UU8A 4O7VA 4NIFA 3CSVA 2OI4X 3ALNA 3EKKA 3EMGA 3ZH8A 1WCCA 3ZDIA 2WMQA 3HUCA 2E9UA 4NUSA 1U59A 2Z7SA 5LMBA 3RNIA 4AGDA 4GMYA 4D2TA 2C1AA 4JG7A 3RPOA 4EH6A 4CMUA 2WMAA 4DYMA 4D5HA 4G3CA 5AUTA 3EFLA 4AW5A 3VF8A 3I6UA 4TZRA 1MQBA 3K5UA 5CZHA 4RIWB 4OLIA 3QALE 3MS9A 3DBFA 4AS0A 4O6EA 5L6PA 3E5AA 5JFWA 2GHGA 4FG8A 4RWLA 1Q8UA 4CXAA 4WOVA 3I5NA 3O96A 2R4BA 3MFUA 3AOXA 4E6AA 5C8NA 1OL7A 4M3QA 1H08A 3CQEA 2I0HA 4HVGA 4FTTA 4RQVA 4PY1A 3CS9A 5CEOA 2YZLA 2A4LA 4JL9A 3ORPA 2YITA 4P2KA 4C02A 4DN5A 3OW4A 1EH4A 4CRLA 4BI1A 4ZJVA 4AZSA 4L43A 3OBJA 2QOHA 2QQ7A 4OTQA 1XH8A 3Q9YA 3FMHA 4E6QA 3H4JA 1AQ1A 1M2RA 4QTEA 5IZFA 4FTLA 2ITVA 3ACKA 3PPKA 3QA8A 3VWAA 3F2RA 4P4CA 4FSNA 2OU7A 4K77A 1F5QA 2PHKA 4EOPA 3HV3A 4PWNA 3FQSA 2YWVA 5FDPA 5AUZA 5K3YA 3KRXA 4TW9A 2RG6A 3WF9A 4AZFA 3HA8A 3PSBA 5C1QB 3NIEA 4DH5A 3F3WA 3R01A 5ANKA 3LHJA 2CKEA 2J0JA 3EOCA 4NCTA 3P7BA 2XM8A 3RM7A 2X7FA 4X3JA 5IUHA 4PDYA 3PP1A 5D11A 5IQFA 3B8QA 2G01A 3I0QA 3H10A 4UYNA 3R8LA 2GFSA 4G34A 4TWPA 2FA2A 4HYUA 4RJ8A 5DGZA 3ZM9A 3UPXA 5FEEA 4NFNA 2PSQA 4MNFA 3Q52A 2EVAA 5JZJA 4FVPA 2V5QA 1YHVA 3O0GA 2GNIA 3MVHA 4I6QA 4A4LA 4CTBA 2BZJA 3DFAA 1DAYA 5DT0A 4FTUA 3KIOC 3L9NA 5KBRA 4RIYA 4M0ZA 2X9EA 1Q99A 2OXDA 1XKKA 2YCFA 1OPJA 1APME 1J7LA 5DRDA 4FTKA 4RX9A 4QP6A 5FDXA 4V05A 2XNNA 5CY3A 3F2AA 4ZIMA 3MJ2A 2AQXA 5EI6A 5AA8A 2J6MA 4EH5A 4YZMA 3ID6C 3COKA 3MGYA 5HEZA 4I1ZA 3O50A 4BZOA 2HY0A 2VTSA 4H1MA 4PNKA 2GS7A 2UZOA 5D12A 3Q6WA 4FMQA 5EDQA 4KABA 4F08A 5JSMA 3QRTA 2RFDA 4BZNA 4FK6A 5JK3A 3PXFA 4EUTA 3ZYAA 2BZIB 3M42A 4NH1A 3M11A 5EQEA 2XK7A 3NX8A 3VBWA 2YWPA 5C8KA 3MWUA 5BUJA 2IWIA 4BFMA 1FBNA 3BRBA 3ZCLA 3VS7A 3HRFA 4NTTA 4R5YA 2XKCA 5HE3A 4WRSA 4GK3A 5AADA 2VTRA 4O7RA 1NW1A 4O38A 1FGKA 3WZUA 5BQ0A 3DZOA 2VN9A 4IDVA 3S1HA 3LE6A 4QD6A 5IDPA 4QMVA 4C3PA 1REJA 3QCYA 3AKJA 1UKIA 3VULA 4BN1A 1H1WA 2ETMA 2ZDTA 4YHTA 3LFBA 3PP0A 4Y5QA 4MXYA 5A3XA 5CAOA 3RK9A 3NYNA 4K9YA 1ST4A 2BROA 5LMAA 4ENXA 3KF4A 3QTXA 3SX9A 3P0MA 3KCKA 3KMUA 3CIKA 3PRFA 4RLLA 4ZJIA 2XYNA 4G3EA 1SMHA 4D2VA 2UVXA 2OZAA 1ZOHA 1R78A 3SKCA 4C3FA 4DTBA 3NR9A 3FKOA 3O7LB 3VUKA 2F9GA 4DA5A 2X0GA 2YJRA 3BL9A 2RG5A 4UALA 3EN4A 4QTCA 5BX0A 1PXLA 1OPKA 3QC9A 2Z02A 3QGWA 1YXSA 3UE4A 4C62A 1OL6A 3FLWA 4A9UA 3BI6A 5CX9A 5E8XA 2I0VA 4PF4A 5A4QA 4H05A 3PYYA 2FSTX 4AA4A 2PZPA 3ZO1A 5CU0A 4LOOA 2PUNA 4XG2A 4D58A 4F63A 3FMNA 4NJ3A 4MWIA 4JJRA 3R9OA 4QYFA 2HW6A 4RQKA 4X6QC 4C61A 4IVDA 2C6DA 1YOLA 4DC2A 2OJIA 3A2CA 3DZQA 4S34A 4BDCA 4XLVA 3BGPA 3JYAA 5AR2A 3TL8A 4Y72A 4JBPA 4EJNA 5J9YA 5EDRA 2H8HA 3FSFA 2ZV8A 3ZLWA 4MF0A 1UA2A 4AXEA 5A54A 3R1QA 4JIKA 2YFXA 3EB0A 4YGAA 4APCA 4RX5A 5HTBA 5JGBA 4ANMA 3NVMB 4I22A 3IGOA 2C3LA 5FRIA 5HBHA 3QQHA 2PTKA 2I6LA 3HMNA 3W33A 1H1SA 4X2GA 2C3JA 3S95A 5DYJA 3W0SA 4NEUA 1IAJA 4JNWA 2FUMA 1GY3A 3VRZA 3HECA 5TO8A 3R30A 4XEYA 5J7BA 2XIYA 4B8LA 3GCVA 3IOPA 2O64A 2RIOA 3W2RA 4BY9E 4KS7A 2Q83A 3I4BA 3R8VA 4ACHA 1OBGA 3KU2A 2QO9A 5I9ZA 3GEQA 3MDYA 3GP0A 5AWMA 4EHEA 4E6CA 4EK3A 4FEUA 4DT9A 3QKLA 3RAHA 2CNQA 3KVXA 3TYKA 4PDOA 5EM8A 5L2QA 3C4WA 4BCIA 2OZAB 4O84A 3DU8A 4MEDA 5LVPA 3GNIB 5M4UA 4G2FA 3NRMA 3FMKA 4QMXA 3EH9A 4FV1A 3CR0A 2VAGA 1YI6A 3PLSA 5HQ0A 4QP4A 3GC0A 3GCPA 3AGLA 4J8NA 1ZYLA 2XJ0A 3HAVA 4QYEA 4RIXA 2C5OA 3FMMA 3QRJA 2VRXA 4Z16A 4XUFA 4LV5A 4S30A 2WEIA 4IC8A 4WG5A 4L3PA 2CHLA 4I94A 3DBDA 3BYUA 3OCSA 1JKTA 3SA0A 5AX3A 3U6JA 3HAMA 4USFA 1R0PA 3HP2A 3JVRA 3BWFA 3U51A 4DITA 2P3GX 4HVSA 3R22A 5HIEA 3QD4A 5A6NA 4D4RA 4GH2A 3L8XA 3DJ5A 4ZSEA 1YQJA 4G5PA 3D4QA 5AP0A 4BDGA 3E8CA 3RPYA 5K5XA 4A9TA 4UZDA 4GG5A 3GCSA 4A9SA 4EKKA 4QP3A 2B1PA 4I6HA 4ZLOA 2UW9A 1GZ8A 3A62A 3O5AA 5HNGA 4HZRA 3AGMA 4CYJA 4ALVA 3BYSA 5BUEA 3BBWA 4BR3A 4MYGA 4JDIA 3F3UA 1Z5MA 4OTGA 3DB6A 4II5A 4JDJA 4JBVA 5H3QA 2R64A 4GT5A 2IPXA 2GS6A 4QOXA 4BCQA 2X2MA 4A4XA 4IMYA 3PFQA 1IG1A 4FSMA 4D1XA 3QCXA 5KBQA 1XH4A 3CKXA 2PVNA 1OBDA 2XUUA 2E2BA 4JLCA 4A7CA 5FXQA 3R7GA 5C8MA 4JG8A 4EOJA 3FYKX 2YAAA 3LAUA 3ZSGA 2VU3A 1ZAOA 4WHZA 5L2WA 2A19B 4H36A 4N70A 3UNZA 3NAYA 2ITNA 3QC4A 1GJOA 4OTRA 5AJQA 4J99A 3K3JA 3Q4ZA 1Y91A 5EM7A 3TZMA 4C8BA 5LVOA 4FTCA 4YO4A 3KA0A 3I7CA 2C3IB 4X2FA 5IH5A 3F7ZA 1SZMA 2W96B 3K5VA 3P7AA 1H01A 2A1AB 2YCQA 4OW8A 5LCJA 3EKNA 3GFWA 1IA8A 5CALA 3A7FA 3KFAA 4I0SA 4L3LA 3RMFA 4A9RA 3NSZA 3R7OA 3NIZA 4D55A 3LKMA 4BF2A 5F20A 2J0IA 4XG8A 3O23A 3OXTA 5EHYA 5KHXA 3QTIA 2XH5A 4IAIA 3TTIA 4NCTC 3QF9A 4R3RA 4F9AA 3TMOA 4M13A 5E8ZA 4D0XA 2XCKA 4ZSLA 5KMNA 5CI7A 3NCZA 3N4VA 3OMVA 3SRVA 4YPSA 2WTKB 2YAKA 3TKHA 5D10A 5FQDC 4J71A 3FYJX 4I0RA 1W83A 4DFZE 3REPA 4FT7A 4RJ6A 5C03A 4CRSA 5A4LA 3QD2B 3PIXA 3CTQA 4KBKA 3SQQA 1JKSA 1PYEA 2P4IA 4IWOA 4O7WA 1OIRA 3VN9A 4JX7A 3LFNA 3CBLA 4ITJA 2YISA 4BRXA 2JAVA 5GINE 4YTFA 1JSUA 4HYSA 3NYVA 1M14A 5FM2A 2ETKA 2WTDA 2YHVA 4ZSJA 2EXCX 3QAME 5KNJA 1R0EA 2YLFA 3NVKI 1QPDA 2ITUA 4LGHA 4CQGA 3CTJA 3GXLA 3CP9A 3ZUVA 4GV1A 2BTRA 3C4EA 3E3BX 4FV8A 4IE9A 4WSYA 5L6OA 5CENA 1Z57A 1NY3A 2IW8A 4PNIA 4DFUA 4YJNA 1OUKA 4AU8A 2XNMA 4MQ1A 2J5FA 3LQ5A 3ZM4A 3DTCA 5DEYA 2IZRA 3A61A 4O1PA 3UG2A 1FMOE 2WMRA 1CKPA 3D7TA 5CU3A 5JRSA 1M2QA 5HHWA 2VWBA 3PPZA 2HAKA 3FI2A 3OF0A 4TNDA 2B9IA 2HZIA 1WBOA 3O51A 3ULIA 5IF1A 4L8MA 1J3HA 4FG9A 3AMYA 4AE9A 2PVYA 5B0XA 5KMIA 4C34A 2B52A 3FHIA 2VTJA 5CEKA 3GU5A 5LVNA 2HIWA 4LGDA 3S3IA 4EK6A 4F6UA 2G2HA 3DT1A 4AN2A 2EXMA 2ACXA 4PX6A 5EI8A 4LL0A 1DAWA 3K54A 3HNGA 3PXKA 2HWOA 4L7SA 5IQHA 2BHHA 5DR2A 4OTFA 2ZV7A 3KXGA 4BJJA 3LFAA 3LXPA 4FYNA 1JLUE 4LUDA 5IA5A 5GZ8A 1XMMA 1PXMA 5DNRA 2ERKA 3HV4A 5EHOA 4YR8A 3DDPA 3GOKA 2J2IB 3HLLA 4OBQA 3SRVB 4JBOA 3R6XA 4HGLA 2H9VA 2G2IA 2WTIA 3AT2A 4D1SA 4GVJA 2W1CA 5GJGA 4EHVA 4PTCA 4FT9A 4BCOA 2Z7QA 3G51A 4RT7A 3PRIA 2VO7A 5HTIA 2ITXA 2NP8A 3C4XA 2QKWB 2VO0A 4NU1A 2FVDA 3U4UA 3VBXA 2A27A 2WELA 4BCJA 3E88A 2JDSA 1BKXA 4I20A 5BYZA 2H96A 2V0DA 2NNWB 1OKWA 2PE1A 4G6LA 3LJ0A 5I3RA 4MD8E 3THBA 4O86A 3P7CA 3POZA 2BPMA 3N4UA 2RFEA 4U40A 2BTSA 4RIOA 4KKHA 1XMLA 4QYHA 3R8MA 4DEHA 3LJ1A 3FPMA 4USDA 5E7RA 4IZYA 4IHPA 1B38A 4AF3A 4FZ6A 3U4WA 4F65A 2C4GA 4ZXTA 3WF7A 5L2IA 4YJUA 1FVTA 3ITZA 4GU9A 4TN6A 2E9PA 1SVHA 5JFVA 5KHWA 2XK3A 2WXVA 4DG2E 5J1WA 4L67A 5FXSA 4YJRA 4M97A 4EBVA 3L8VA 4PP7A 5AEPA 4ACMA 2EWAA 5LWNA 4FV4A 2UZDA 4Q5EA 1JOWB 4FKGA 4ITIA 2IVSA 3HMIA 3MTLA 4GS6A 4KIKA 3D7TB 4NTSA 5CT7A 3W0MA 2ITWA 2YIQA 5CNOA 1FQ1B 4IX6A 5DT3A 4O2ZA 4GT4A 4O0WA 3QQLA 5EQYA 3E8DA 2Y4PA 3CJFA 3D7ZA 5L8KA 4QMSA 2BIKB 2WFYA 1A48A 5DWRA 2NO3A 3SV0A 2VNYA 3R7YA 5CSPA 5I9VA 3W0PA 1M52A 3GB2A 1WBVA 5AR7A 4GSBA 3V5PA 3MVJA 4KWPA 3R0TA 2XKEA 4YJSA 3LMHA 4FV3A 4RC4A 5HO7A 4G3DA 3K2LA 2CKPA 5M51A 3R04A 3OCGA 3W0OA 2WB8A 3S2PA 4YMJA 1ZMUA 2OJFE 4MX9A 4E8AA 2BUJA 2WTJA 4AQKA 2Y9QA 4HOKA 5CEPA 5LMKA 4RJ5A 5F1ZA 4BWPA 4DDIA 4CKIA 4PRJA 5IH6A 4OAUC 1YDRE 3FQHA 4EOSA 2OBJA 3MA3A 3EQHA 4NKSA 4XV3A 5AP5A 3FZRA 4QTBA 3QQJA 3DJ6A 4E4XA 3S00A 3UQCA 5HVYA 4QDVA 2WQMA 2ITQA 2W1ZA 3PUPA 4IM3A 3TV4A 3KL8A 1DI9A 4X7QA 2F49A 4DEIA 3LM5A 2CKQA 3JVSA 4RG0A 3ROYA 2W4KA 3NUNA 3DLZA 4NZWB 3LFQA 2ZJWA 5E92A 5D1JA 3VVHA 4IIRA 3BV2A 4RWJA 4PL5A 4EKLA 5EOBA 4RZVA 5IA3A 3FMJA 1PXKA 1Q8WA 4NT4A 2JITA 5EYDA 3RJCA 5JFSA 4IDTA 3LMGA 4BYJA 3MY1A 4ASDA 4D1ZA 2CGVA 4MK0A 1H00A 4C57A 2F2CB 1KE8A 3HZTA 1U4DA 3A7IA 4FVRA 3WF5A 5EW8A 5AR3A 4IAYA 3MESA 3VQUA 5BVKA 2EB3A 3JS2A 2YIWA 3SGCA 3CCNA 1WBNA 3D83A 4FNZA 2I1MA 5AV0A 2R3RA 4ANBA 5HU9A 4RPVA 3Q2MA 5AP3A 4E6DA 3D9VA 1WBWA 4XS2A 4YHJA 1GZOA 2JBPA 4FV6A 4KA3A 3DKCA 4FIHA 4G5JA 4BCPA 4FL3A 2CKOA 2RFNA 1FVVA 4R78A 3A7HA 4WKQA 4TL0A 5IEVA 4Z3VA 4LOQA 4J7BA 4N0SA 3RAIA 2RF9A 3IQ7A 4EH2A 3E93A 2CLXA 1PMVA 3KKVA 3CC6A 2HWPA 3BV3A 4L44A 2YCSA 4BCKA 5IQIA 3NPCA 1KSWA 2BFXA 3SG8A 4EQMA 4NWMA 5I3OA 4WBBB 5IQEA 4V0GA 2O63A 3VS3A 1Q3DA 4KB8A 5JQ8A 1L8TA 4HNIA 3N51A 3UMWA 2BRHA 5H8BA 5M4IA 1H0VA 1H27A 5CVHA 3ORKA 3PVWA 3ZLXA 1WFCA 2FSOX 4O7NA 1XH7A 1OGUA 4K6ZA 3ANQA 3UQGA 4ZK5A 3EQDA 3VUIA 3ZXZA 3MSSA 3FV8A 4R3CA 4XP0A 1YWRA 4EWHA 4OAVB 5L2TA 2GTNA 2ITZA 3D5XA 4QP9A 4IC7A 2XJ1A 5ETAA 3ZFYA 5HTCA 2A0CX 4X6RA 4JQ8A 3TV7A 4N6YA 4IXPA 4UXQA 3QLGA 1P5EA 3DXNA 2UZUE 3LFFA 5BUIA 3RVGA 5ACKA 4CGAA 4KIOA 4CLJA 4MXXA 1UU3A 2J51A 3G2FA 4FSTA 3VS4A 3UNJA 4QP8A 2W9ZB 3ZEPA 2X7OA 4XX9A 4ASEA 5M4CA 1ZY5A 4EHGA 2P0CA 4DDGA 1ND4A 2R3IA 3PLAE 5HD4A 4I5HA 2BRMA 1I09A 3W2QA 1GZNA 2Y7JA 4EZ5A 4AXFA 3WE4A 3ZO4A 4GK2A 4RIWA 4H58A 5AR4A 3AT4A 4FL1A 3TNIA 3TUCA 4ZOGA 3BYMA 3DBQA 4DEGA 2HCKA 2UW3A 4YP8A 2UW4A 3ATSA 1W82A 1WMKA 3N9XA 3PJCA 3EFKA 3PXQA 3LOKA 2QOBA 3PWYA 5HLWA 1W2DA 4GW8A 2W0JA 4ITHA 4U44A 2HY81 5J5SA 2OLCA 5FP5A 3P79A 2EB2A 3QYWA 4AZTA 4C3RA 1FPUA 4JX3A 3AC2A 5AM6A 4UN0C 5IH4A 3ZDUA 3FQEA 5M08A 3FY2A 3ZO2A 3ZTXA 4GVAA 3NUUA 2BDWA 1G5SA 1STCE 3ENHA 1S9JA 5HNBA 2GNJA 3QQUA 4U6RA 4Y73A 4Y95A 4YSMA 5H8EA 2CDZA 3FWQA 2R3PA 4D2PA 2DYLA 2YIRA 3PVGA 2ZB0A 5EM5A 2QKRA 1IEPA 4FICA 4BDEA 3UDBA 2OG8A 3PY0A 3UDTA 2WU7A 4W4VA 3LXKA 3GQIA 2UW8A 3D2KA 5A14A 1CKIA 4O0UA 4V0GB 4YZDA 2IO6A 4HVHA 3ATTA 4RZWA 2VX1A 3ENMA 1GIJA 3VAPA 3NAXA 3VNTA 4CFXA 2W5BA 4FKUA 4FBXA 4FI1A 5F9EA 4X2KA 5CNNA 2WOUA 3QX4A 5E90A 4FGBA 4AWIA 3F5GA 1KV2A 4YBKA 2PE0A 3ZO3A 1XHAA 5JMSA 1VYZA 5AUVA 1ZY4A 4IB0A 4O83A 3HMMA 4FKIA 3VHKA 1YWNA 3NUSA 4QMYA 5DMZA 1JAMA 3CKWA 4LFIA 3KEXA 5EQPA 3PXRA 2VTTA 2X2LA 3KULA 1ZWSA 4R1VA 4UMRA 2OFVA 2V55A 2ITTA 2Q0NA 3UPZA 5EI2A 2QHMA 2R5TA 2C3KA 5AR5A 4C4GA 4C4JA 3SW7A 4FKTA 4BDHA 3LXNA 3OFMA 2X39A 4DGMA 3TXOA 2I7QA 2P2IA 3HV5A 2X1NA 3DK7A 4HYIA 5KMOA 4Y85A 3EFWA 3DQWA 4CV8A 2Y4IC 3U9CA 2XANA 5M09A 4Q9ZA 2QOIA 4BTKA 4YTHA 2WTCA 3QGYA 2BRNA 3CLYA 3V6SA 5BNJA 3C1XA 1PHKA 4MTAA 1WBSA 3GC7A 3PIYA 3MFTA 4XP2A 4XMOA 3QKKA 5L8JA 3GT8A 4R5SA 4K18A 4M12A 5GNKA 1PJKA 1ZXEA 1U5QA 2VTLA 3BHYA 2OICA 2SRCA 4C38A 2OF2A 3QA0A 3QZGA 3T8OA 3ZRMA 4D4YA 4FEWA 2HK5A 5M56A 5FLFA 3M1SA 2PZRA 4KINA 4RJ7A 4ZY5A 5KKRB 1SVGA 4X21A 4LQMA 5HICA 3ZOSA 3ERKA 3UG1A 4CD0A 2WNTA 4JQ7A 3POOA 3QRIA 4TKSA 4GKIA 4OR5A 3TIZA 1JBPE 3VUTA 3PY3A 2PE2A 4MXAA 3VS5A 3HMOA 3WOWA 4U41A 1KE7A 4O4BB 1DI8A 2HOGA 5G1XA 4IB3A 3IONA 2HW7A 5TKDA 3V5TA 4BKJA 4FIIA 4KRDA 5CAQA 1PKGA 4ORKA 4LYNA 5H2UA 5HG9A 4AZWA 1FINA 4X0MA 2B9HA 3BU5A 1M7NA 3Q2JA 1E9HA 1LP4A 3UIMA 5AFVA 2Z7LA 4IX3A 4O1OA 2YM5A 5HE2A 2YDJA 3O8PA 5C27A 5LOHA 4LGGA 2VTIA 4O7LA 2W1IA 4DFBA 5AV1A 3UOJA 4IANA 4IBMA 3W18A 1YKRA 1HCLA 3KULB 3LFSA 3ODZX 2CCHA 3EQCA 4JR3A 5AV4A 4XLIA 2XNGA 4XRJA 5CASA 4R8QA 5BPYA 4FKOA 5LVMA 3F6XA 1OL2A 5JZNA 3IDBA 4H1JA 4ZJJA 2WMBA 5CAPA 3TUDA 4UWYA 2XJ2A 2YDIA 3NCGA 3QD3A 3RWQA 4RFYA 4BWXA 4XH6A 1OL1A 2X0QA 4MBLA 5LMKC 2UZVA 3KC3A 4XNEA 4DFLA 3C13A 3PG1A 3OVVA 3HA6A 3TEIA 5IISA 3JXWA 3PTGA 3V3VA 4L01A 5KZ0A 5CF8A 4QPAA 5TOZA 2HYYA 2BDFA 4QMOA 4USEA 3MV5A 3ETAA 4JAIA 5K4IA 3BIZA 5E8YA 3ULZA 4XP3A 1OIUA 4Y46A 3NFGB 1ZOEA 5DN3A 4QMMA 3GOPA 5FTOA 4RWIA 2GU8A 1PF8A 4J8MA 3F5PA 3W55A 4D2SA 2VO6A 5E91A 4G9CA 2WEVA 3F2NA 5FG8A 3C0IA 1E1XA 1K9AA 4EZ7A 3PFYA 1H26A 4F7JA 3KK9A 4IWQA 5EW9A 4L42A 4YC3A 4YZNA 4IZ5A 3AMAA 3CGFA 1YHSA 2B54A 4CZYB 3BGQA 3WZDA 5J9ZA 2YERA 3QFVA 3P4KA 4ANOA 4EORA 3II5A 4FZFB 5TR6A 1XR1A 1CSNA 1NVQA 3KRWA 3Q5ZA 3G90X 4R7IA 5CSVA 2XAMA 1DM2A 4HPUE 3MY0A 3ROCA 4FKWA 4P7EA 4N57A<