3UG1A

Crystal structure of the mutated egfr kinase domain (g719s/t790m) in the apo form
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
322
structure length
296
Chain Sequence
EAPNQALLRILKETEFKKIKVLSSGTVYKGLWIPEGEKVKIPVAIKESPKANKEILDEAYVMASVDNPHVCRLLGICLTSTVQLIMQLMPFGCLLDYVREHKDNIGSQYLLNWCVQIAKGMNYLEDRRLVHRDLAARNVLVKTPQHVKITDFGLAKLLGAEEKEYHAEGGKVPIKWMALESILHRIYTHQSDVWSYGVTVWELMTFGSKPYDGIPASEISSILEKGERLPQPPICTIDVYMIMVKCWMIDADSRPKFRELIIEFSKMARDPQRYLVIQGDDEEDMDDVVDADEYLI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Epidermal growth factor receptor
publication title Structural basis for the altered drug sensitivities of non-small cell lung cancer-associated mutants of human epidermal growth factor receptor
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 86
structure length 296
sequence length 322
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2011-11-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3ug1A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3ug1A01
1WVXA 5CEKA 2CNQA 2QKRA 3UNZA 2PMIA 2XIYA 2O63A 3DFAA 4QTAA 2VTHA 3MVJA 3ZLWA 3P7BA 3HP2A 1Q4LA 4FGRA 4FKRA 3ZEPA 3JXWA 2WTJA 4TYEA 2HYYA 4FIGA 4YJNA 3UMXA 4CRLA 4DFYA 3AOXA 4X2JA 4U79A 4X3FA 5FBOA 5H8EA 3VRZA 3LMHA 3L9MA 2YM8A 4LV8A 4RLLA 2GFSA 5EI8A 1Q8UA 1PXLA 2WMVA 4I4FA 3DQWA 5HCXA 3KXHA 4FF8A 4QQTA 2NPQA 2WQBA 3UG2A 4CV8A 3I6UA 4CFWA 5A14A 4H05A 5IH6A 3F82A 3RALA 3QHWA 4XLVA 3TXOA 4QPSA 2XNBA 2OF4A 4I5CA 1FVRA 4CSVA 5C4KA 3OROA 5GINE 3QUPA 4TYIA 2ITXA 1Q97A 3VULA 4C59A 2JKKA 4MF0A 2V7OA 3E92A 4FTTA 5A54A 3E8EA 4NCTA 3FMLA 4QMQA 5IQHA 4ZTRA 4C0TA 4GK4A 4FTNA 2F57A 2YM3A 3MVLA 2VTRA 1J1CA 1YI3A 2CGUA 2QO9A 3RWPA 5J9ZA 1JKSA 4IEBA 5HD7A 2W4OA 4YLJA 4CEGA 3ENMA 3R04A 3UVQA 3A8XA 5JH6A 3GC8A 1OPJA 5IDPA 4LQMA 3ID6C 5DRDA 3R0TA 1NT2A 2P0CA 5H2UA 1ZWSA 2NRUA 3VS0A 3UQCA 5IU2A 1YRPA 2IVUA 5CU4A 3BLQA 4LUDA 4BHNA 1WBPA 3R1QA 3OOGA 1PMUA 1JKKA 1GZKA 3F6XA 4YR8A 3KFAA 1JWHA 4HCUA 1WBVA 2XJ1A 3BKBA 3FY2A 4F9CA 3R9RA 2W06A 3PY1A 3U87A 3DBDA 4YGAA 3BE9A 3C5IA 5IMXA 3S00A 1BL6A 2PVFA 4EJ7A 3A60A 3E93A 3SC1A 1OKZA 3EFLA 3TG1A 2P3GX 4BDDA 5EDPA 4IWDA 4ZTLA 2HY0A 2A27A 3KF4A 3PXFA 4FT3A 3GC7A 5HKMA 2R64A 3RM7A 4OTRA 3UIXA 4C58A 3C1XA 3COHA 2ZDUA 3LJ1A 4IACA 3LFDA 3RCDA 4V0GB 1CMKE 4XV3A 2YITA 4G3EA 1O6LA 3MA3A 3HRCA 2F2UA 3LM5A 3AT3A 5K5XA 4QMOA 3ORMA 1YQJA 1KV1A 4IAFA 5I4NA 2OLCA 5IQEA 2UZDA 5BYZA 1PKGA 4LOOA 4RIXB 3S2PA 4NUSA 1GZ8A 1OUKA 1A48A 3OVVA 4QMLA 1LP4A 4FSWA 2W1IA 5HO6A 3OT8A 4JL9A 3RJCA 4D9UA 2E9VA 4E7WA 2VWXA 3R8PA 3NYXA 1K3AA 3BHHA 4MAOA 4CLIA 4CZYB 2CGVA 5AJQA 2OF2A 1U5RA 3C7QA 3NUUA 4RC2A 3RGFA 2QU6A 5AX9A 4D55A 3R21A 5HX8A 4FKSA 2VTQA 4ALWA 3R71A 4QD6A 3D2IA 3R8MA 3MV5A 4UMQA 3ORNA 4J7BA 5IH4A 3BELA 4LMUA 2FA2A 4PNKA 2VGOA 3F69A 3QTSA 4P5QA 3QYZA 4FV4A 2UVXA 4BCKA 3NYVA 5IA1A 4H39A 5EKOA 3IKAA 2HW7A 5HLPA 3NWWA 5BVNA 5D41A 2UW4A 4MXZA 4GYGA 3LFCA 4ZP5A 3UE4A 4PPCA 2ITQA 2Z7LA 4W8DA 2PE1A 2XNGA 1OIRA 3HECA 3GOPA 5EFQA 4O1PA 4DEGA 3JS2A 4EWQA 4R3PA 4DCAA 4AGCA 4FV9A 5BPYA 2OI4X 4F6UA 1OL1A 3EH9A 4LOQA 3EFWA 3W2OA 3ZU7A 3PE2A 2PVRA 4YLLA 5GZ9A 4OAVB 5AX3A 3R7OA 3ZRLA 3DFCB 2GNIA 3IQ7A 1OBDA 4YP8A 2W9ZB 1XH4A 2F4JA 4MH7A 3SW7A 2QOBA 5DVRA 4DINA 3P86A 4J53A 2FO0A 4NW6A 3QD2B 3FZPA 4QQ5A 4ALVA 4W4VA 1XHAA 4A9UA 4CV9A 1R0PA 4ZY6A 1YWVA 1B38A 3OBJA 1H01A 1HCLA 2R3JA 1OIYA 1Y6AA 5ETIA 3RPYA 3UOLA 5ACBC 5C1QB 3O0GA 5ETFA 2OGVA 4KSPA 2R0UA 4F08A 2C6MA 3P78A 3DAEA 5H8BA 4LGGA 3EQBA 4XX9A 3W8QA 3KN5A 3I7CA 2ZM3A 3DJ6A 2PVKA 3QRKA 4FI1A 4E8AA 2PULA 3ERKA 3EZRA 1BUHA 4JQ7A 3BU3A 5D7VA 3NNXA 5I0BA 2NRYA 3BWJA 3MSSA 4Y8DA 2A2AA 4JXFA 3VWAA 4C62A 1G5SA 4KIOA 5L6WL 3EJ1A 4A7CA 2QR7A 4BKYA 3ZFMA 2QOIA 4K11A 2C4GA 4BDAA 1SNXA 3QTXA 4G31A 4Y5QA 4YBKA 4ZOGA 4G9RA 2G01A 4OBQA 5EYKA 1OIQA 4QYGA 4YUQA 4H1JA 4YTCA 2X1NA 1KUTA 3FKNA 5CF6A 3UYTA 3DXQA 4IZ7A 3CQWA 2QONA 1PF8A 3KK9A 2J7TA 2OKRA 2YN8A 2WMXA 4TNDA 5CVHA 3LKMA 4IWQA 4NK9A 2GNJA 5HCYA 4EK5A 4O0RA 5JFXA 2J51A 4O7VA 2VN9A 2IO6A 2QHNA 2RIOA 3L9PA 4JLCA 4PTGA 3QHRA 1XH6A 3G6HA 4RLKA 3RBWA 3ZLYA 5HE2A 3PSCA 4R77A 4DFNA 3TDWA 4NEUA 4QP8A 1S9IA 3FMJA 4PPBA 5AUWA 2XK4A 4EJNA 5AMNA 3F3VA 3C4CA 3OT3A 3ZOSA 5IH5A 1GZOA 3QAME 2JDOA 3C0IA 4G3CA 4ZEGA 3E3PA 3UPXA 5FTGA 4FV3A 4LL0A 4U44A 4ID7A 4EQUA 2PUPA 1KE8A 3VW6A 5AFVA 2ONLC 1U5QA 3MPTA 4G3FA 4KSQA 1IAHA 4KAOA 3MH1A 4TXCA 2PHKA 3QTIA 4ANOA 4E4LA 1KE7A 4BTJA 3OCSA 4QT1A 3OEFX 4U45A 3JPVA 4DBNA 1P4FA 4E3CA 4CQEA 5AAGA 1WBSA 5EW8A 1FPUA 2H9VA 2WQOA 4IAIA 4IFCA 2ZB0A 1H1SA 3R2BA 3ROYA 2ERKA 2V22A 1H0VA 2EB3A 3D5XA 4RWKA 4ACHA 5EHOA 1ZYLA 1JLUE 4XMOA 1GIJA 3SG9A 2OJ9A 2Q83A 2ZB1A 3FLQA 5CASA 4FTMA 3VS7A 1PJKA 1H1RA 2BZIB 2ITWA 4QNAA 4RT7A 5AP4A 4NM7A 4EQCA 4DAWA 1H00A 4M15A 2Q0BA 1XH8A 2YDIA 4DEHA 3P1AA 4EONA 5FEEA 3HV5A 5HE0A 4NL0A 5E1EA 4XLIA 1V0OA 2W0JA 4XG3A 4AXAA 3HMPA 5KE0A 4FKJA 2QLUA 4JAIA 3C0HA 3E88A 2Y8OA 4BDKA 4EBWA 4NFNA 3EYHA 5L2IA 5L6OA 5AUXA 4UX9A 3S0OA 2Y6OA 4QMUA 4FSTA 4BFMA 5FP6A 4F0GA 4EOKA 4OTPA 5IA4A 2QNJA 5E8TA 3EOCA 4MXOA 3WIGA 4E5AX 4IB5A 4BN1A 3AD6A 3DCVA 4IMYA 1VZOA 3EQGA 2F7EE 4DTAA 4M3QA 4UMRA 5IEVA 1DI9A 4GG5A 4ENYA 3I5ZA 3V8TA 4BCMA 4TYHA 4XG6A 5E8SA 5JSMA 1OBGA 3DA6A 4A9TA 4Q2AA 5ANIA 5HBHA 3D2KA 3TL8A 3GQLA 4HVIA 1J91A 3K54A 4RVMA 2Y7JA 3NCGA 4FV0A 4IW0A 1SMHA 4C4IA 5GZAA 5ANOA 2LAVA 4CMTA 5C26A 3FZRA 3VUGA 1QPJA 3DK3A 5EDRA 3DKGA 3FV8A 2XM8A 4U43A 5CT0A 4PUZA 4EBVA 5LCJA 3BHYA 4KIQA 3ZXZA 4ZS4A 4XP2A 3VUHA 1BX6A 4DT9A 4O0WA 3IDPA 1W84A 2WQEA 3UO4A 4AE6A 3HGKA 5CYIA 5HG7A 3DTWA 4DH1A 4JVGA 4ANNA 2C6KA 3HX4A 4BTFA 2EXEA 4AW5A 4AP7A 3WBLA 5DYJA 1UNHA 4GEOA 3LOKA 2B4SB 3LQ5A 1R0EA 5AP6A 2OZOA 4FT7A 3D5WA 5HE1A 3UZTA 2PZYA 3QQHA 1UWHA 3V5LA 4O2PA 2YM4A 1TQPA 3BYSA 5HVJA 3R8UA 4IZYA 4TY1A 4YJQA 2JFLA 1WBOA 2VWWA 3V04A 4BI0A 4IXPA 4JBVA 4JBQA 5KZIA 1QPDA 3BYOA 5BVEA 1M14A 4K9YA 2J0LA 5AUZA 3PXRA 4H3BA 2PVMA 2X8IA 3WILA 5I3RA 3LFAA 4U40A 5LMKA 3DTCA 2UVYA 3UQGA 4CGAA 5T68A 1BMKA 5FDPA 3FKOA 4EK4A 1GNGA 2CPKE 4AU8A 4NSTA 1PXKA 3SD0A 1CDKA 3VUKA 3DGKA 2Z8CA 3FPMA 3JVSA 3E62A 4R5SA 3RPSA 3KK8A 2B53A 4ANSA 2E9UA 5IA2A 2R3IA 5DNRA 2OFVA 2C6OA 1NY3A 4DFBA 4G5PA 2FUMA 1R3CA 4ZAUA 2G2IA 1KV2A 2IVVA 2XK3A 3ETAA 4UB7A 2VO3A 1ZZLA 4KIKB 4N6ZA 3GCQA 2EWAA 3V5QA 4CFVA 4CG8A 2HWOA 3FL5A 4LRJA 3PVUA 3I7BA 2JBOA 4FVPA 4K33A 2WU7A 3VW8A 4DG0E 5IF1A 5HOAA 5LVPA 4GYIA 4ALUA 3F2RA 2OJFE 4GMYA 4D2VA 4CFUA 1UNGA 3FMDA 3GQIA 3O8PA 3TTIA 3UMWA 1VJYA 4GT4A 5CTPA 3EWHA 3Q4CA 3DKOA 3PVBA 1R78A 2UW7A 3R00A 5CQUA 5TT7A 3IGOA 3OP5A 3U8WA 4L3PA 2WIPA 4F6WA 2W1GA 4QNYA 3VS5A 5IA0A 3QTQA 4E4MA 4A4XA 4FZDB 4ZIMA 4DGOA 3Q96A 4DHFA 5CXZA 1PY5A 2UVZA 3C9WA 2XYUA 5HLWA 2NO3A 4L42A 3VBQA 3DY7A 5LVOA 3CGOA 3EQIA 1WVYA 4IFGA 3GEQA 2IN6A 3ORIA 1E1VA 3KY2A 4ZSLA 2BTRA 3EQCA 4FG8A 2OBJA 3ROCA 3QGWA 4WSQA 5ANKA 4Z9LA 2F7ZE 5KNJA 2CDZA 1YDSE 3IPHA 2C1AA 3P7AA 1Y91A 4N4SA 4C34A 3HDMA 3ORLA 2Y0AA 4CLJA 3Q6WA 2J0KA 2WTDA 3IW8A 2ITYA 5FEQA 5JGAA 4NFMA 3SXRA 5AR4A 2CHLA 3QTWA 3Q9ZA 3W10A 3N4VA 3II5A 3TEIA 2KULA 4BI2A 2J90A 4DH3A 4X6RA 4DGLC 3UYSA 4WHZA 3R1YA 5AR3A 3QQFA 5BYLA 1DAYA 3BGPA 3QKLA 4FSYA 3HRBA 4WRSA 3HMOA 1V0PA 5DI1A 1JSVA 2ZYBA 3F3UA 4S30A 2XEYA 4K0YA 5CEMA 5K9IA 3F5PA 3DPKA 1OPLA 1NXKA 2XKCA 4KD1A 5CLPA 2X81A 3C4EA 4CCUA 3BGQA 1TKIA 1LR4A 2YJRA 5DH3A 1XH5A 2F2CB 1YXSA 5LMAA 4EOIA 5HTCA 4ACGA 3KXMA 3FKLA 3FEGA 4F0FA 3F5XA 4FKWA 3DB8A 3PY3A 4OTFA 3WYXA 4GL9A 3IO7A 3THBA 3PXQA 4L53A 4DFUA 4O7NA 2W99B 3QBNA 3MPMA 2YA9A 3LQ8A 4Y85A 2HOGA 3PLSA 4HVGA 3BWFA 4CG9A 3R1SA 4GVAA 4C36A 4C37A 3DB6A 3R73A 3KXGA 5JT2A 1YWNA 4D1ZA 2ETMA 1MRVA 3E5AA 3C4FA 4PQNA 3EN4A 5HCZA 4YU2A 2R4BA 3KB7A 4O84A 3TKHA 3QRTA 3L9LA 3HP5A 1URCA 1R39A 3IDCA 3LXKA 4RVTA 3VHEA 2PMLX 3DV3A 3VS3A 3C0GA 3PG3A 3HAVA 4AE9A 1ZMWA 1PKDA 3ET7A 5HTBA 1K2PA 4O7SA 3KVWA 4JJRA 4WKQA 3TNWA 4JX3A 3A62A 3CGFA 3LFEA 5D1JA 4GV1A 4TPTA 3DAKA 3KXZA 3T8OA 5CAVA 3H4JA 4OAUC 3HL7A 2ITOA 5B7VA 4EOMA 3DNEA 3P23A 4FTKA 1SNUA 1EH4A 1WBWA 2C69A 2YHVA 2ZV7A 3PWYA 4FKVA 4IAKA 1NW1A 3D7TB 3T9IA 1M2QA 4N6YA 2FVDA 4ACCA 4C2VA 4D5HA 2VO0A 3UG1A 2ETKA 3ZM4A 3MN3A 5JMSA 5M53A 4F99A 1MP8A 4YNEA 5AIRA 1F5QA 3D0EA 2BZJA 5AA9A 3FMNA 4CTBA 4HZSA 3SG8A 2IW9A 2RG5A 5JFSA 3QRUA 5AV2A 2C3KA 2J0IA 5CZIA 4E5BA 4B7TA 1JBPE 3ZTXA 4YZCA 5FTQA 4R1VA 4PPAA 3BBTB 3HV3A 2RFDA 3MJ1A 1ZLTA 3PE1A 4N0SA 4I21A 3NNVA 3VJOA 3PZEA 4O2ZA 3Q3BA 4M84A 2X7GA 4FKLA 4FKTA 4JX7A 5ANJA 1IA8A 5HG9A 3TJCA 4D5KA 3NIZA 2AUHA 4F7NA 5DBXA 4FVRA 1PXIA 5I5ZA 3RINA 4USEA 4Y83A 1YWRA 2XB7A 1WVWA 2XK7A 3HUBA 3GC0A 2ESMA 2VNWA 3OUKA 3N4UA 3NS9A 3MFUA 4RWIA 2F7XE 4P2KA 2R3NA 4F9YA 5BMSA 4X0MA 3T3UA 3NZ0A 1H25A 4KKGA 4AWIA 2GS2A 4GIHA 5GIOE 4BZOA 4TWPA 1IEPA 1GIHA 4KS8A 2OWBA 4TL0A 2XRUA 4MNEB 5JQ8A 4JG7A 3NUNA 3BHUA 2VTOA 2I1MA 5DA3A 4J97A 2W17A 3BYVA 3MGYA 3MI9A 2WHBA 4WRGA 4QYFA 4IVAA 4RVKA 4DN5A 4MK0A 2UW3A 1QL6A 4LOPA 5ACKA 4RRVA 5T3QA 3Q52A 3FMHA 1PMEA 3PVWA 1OL7A 3CQEA 3ZC5A 5FUTA 3OOMA 4LRMA 1K9AA 3A7HA 3HRFA 4I94A 4BCPA 4WIHA 3REPA 4DYMA 2WXVA 3FHIA 2YCSA 3PSBA 3U9CA 4JQEA 3CD8A 2CSNA 4QTBA 2W1CA 4FZFB 4EOJA 5GJDA 2J9MA 2BAJA 2C5NA 5E4HA 4IC7A 3EQDA 5JKGA 4YJTA 5AP3A 3CPBA 4BDJA 5IUIA 3LFNA 4L6QA 3R7VA 4YHTA 1P14A 5DRBA 3Q5IA 4Z7GA 4GT3A 3NUXA 4DFZE 1ZY4A 5IQCA 4GRBA 1J7UA 2C30A 5CZHA 3W2SA 3PJ2A 3NW6A 4IX5A 4NTSA 3BE2A 2C0TA 2YIXA 1XH9A 4E6AA 2LGCA 3P08A 3R8ZA 4UWCA 5KMMA 3FI2A 1TVOA 3ULIA 4L67A 4I6QA 2PUIA 1U59A 4C2WA 1LPUA 2G2FA 3ZONA 3Q4TA 4L7FA 4OT6A 1CKPA 4IHPA 4OTIA 4Y46A 4G3GA 3ZLXA 3H9RA 3M1SA 3TKIA 4EL9A 5IPJA 1ZYCA 3QZGA 4C3FA 2ONLA 4FTCA 4O1OA 2GQSA 2YFXA 4WUNA 4IAYA 3HYHA 2V55A 3GVUA 1ZOGA 2PMOX 4B99A 1Q8TA 4QMTA 3NVMB 2QU5A 2RG6A 4U3YA 3MESA 2QOKA 2PL0A 4K8AA 3A7GA 3F5UA 4UALA 3N9XA 5DR9A 3VN9A 1Q8YA 2E9PA 4GJ2A 3ZDUA 2WKMA 3PZHA 3MB6A 3ZO3A 4CD0A 4KBKA 5I9YA 2SRCA 4FKQA 5HQ0A 2WGJA 2WTKB 2B9HA 3D4QA 4XOZA 3O7LD 4G6NA 4WNMA 4DEBA 5BUEA 3AGLA 4HYUA 4BDIA 3BGZA 3I60A 4EH8A 3VIDA 2JDVA 3OD6X 4ZMFA 3RPOA 3MH2A 3ALOA 4FIIA 2JIIA 4MWIA 1UU3A 2HCKA 3ZO4A 2HXLA 2WTKC 3IOPA 4GFGA 5M4CA 3L8SA 4PDYA 2QOHA 2YCRA 3CD3A 3R7YA 3NGAA 3WF6A 3CS9A 4RSSA 4WNOA 5F94A 5K4IA 3NUSA 2DWBA 4FKPA 4YC8A 1BL7A 5J87A 4R7IA 3G6GA 1UU9A 5K5NA 3QQUA 4UYAA 4LYNA 4JDIA 2WNTA 4YLKA 2QODA 4YZMA 1UWJA 3R7IA 3PDTA 2JDSA 4C35A 2XIRA 2WTWA 3LCKA 4AA5A 5HNGA 3OXZA 4G17A 4RJ5A 3D7ZA 5LXMA 2PTKA 2CN8A 2HAKA 2OO8X 3OCTA 2I0VA 5HI2A 4CZTA 4DC2A 4IM0A 4OR5A 5A6OA 3HV6A 2C1BA 5KUPA 4FL2A 4CFNA 3CXWA 3L8XA 2CJMA 4C4GA 2YACA 3E64A 4I5MA 2OZAB 1F0QA 3LXLA 3O51A 2PUNA 5CAUA 1FOTA 1WBTA 4YZ9A 1WBNA 3WZJA 4BC6A 4NIFB 2QO7A 4PV0A 4F63A 3VHKA 4M68A 3ORKA 4F1TA 4BIBA 5M51A 1PRYA 2YZLA 1WCCA 2BAKA 3IGGA 3KU2A 4HPUE 4XV9A 3SRVB 4C02A 3TDVA 1YOJA 3ANQA 1OUYA 2O65A 4O7TA 2GNHA 4QP6A 3CEKA 3DXNA 2VTNA 2XNMA 4RC4A 3CKWA 2XNNA 5BVFA 3JYAA 4BCGA 5FEDA 5ITAA 3SGCA 3WZDA 5JZNA 3ZFXA 3KRRA 3BU6A 4GCJA 1IASA 3DKCA 3Q4UA 4UV0A 5FM3A 3MPAA 2BVAA 4FSUA 4L3LA 4CNHA 1JAMA 5GJFA 3LMIA 3O2MA 5A4QA 1NA7A 3VVHA 5C01A 4MVFA 3CTJA 3TI1A 3Q6UA 3NUAA 5A6NA 4WO5A 5HU3A 2ITTA 2IW6A 4A4OA 4RX8A 5BVDA 2UZUE 4DEEA 5CU0A 2DUVA 2Z7SA 1M2RA 4AUAA 2B1PA 5AP7A 2BPMA 3KL8A 1YDTE 1OL6A 3VUIA 4KKHA 2VZ6A 4BCHA 5J79A 2YAKA 1SM2A 5IQAA 2BDJA 2DYLA 4RMZA 4I6BA 4NJDA 3D15A 3UDBA 4DH8A 5CU6A 4IAZA 2UZOA 4GKHA 4QTCA 5EM6A 4ORKA 1YXTA 3DJ7A 5HG5A 3QFVA 3RPVA 3TCPA 4FZ7A 2XKFA 4ASZA 3ZM9A 1YVJA 2ZM1A 5KMIA 2WTVA 4FOBA 1XR1A 4RA4A 5A46A 4CXAA 3IW6A 3PVGA 3SXFA 4DE4A 3W55A 3MS9A 4OBOA 5E8WA 4Z7HA 4I93A 5DLSA 3Q04A 2OG8A 3AQVA 4ZTHA 2VX0A 5CSHA 4ZJIA 1ZOEA 4QMZA 2HZIA 5DT4A 2GFCA 2YIWA 3ZUVA 2GHLA 3GNIB 4DGMA 4H3QA 3EQRA 2WIHA 4APPA 3TZMA 1DAWA 1O6KA 2YLEA 1Q24A 4MNFA 4RGJA 2GPHA 3O71A 1ZOHA 3BZ3A 1S9JA 4NM5A 1Q8WA 2CKPA 3G0EA 4O0VA 5TO8A 3OF0A 1M17A 4BL1A 2IG7A 4O83A 4BTMA 4D2WA 4YURA 2WMUA 3NX8A 4W8EA 1IAJA 4R3CA 4XG8A 2QG5A 4AW0A 4LGDA 3RP9A 4BGHA 4D9TA 2X7FA 3QCSA 4ONAA 5LJJA 4CMOA 4JAJA 4B9DA 3ODZX 3EB0A 2BILB 2JAVA 4R5YA 4MD8E 4C33A 2BDWA 5CSPA 3GCSA 5KMKA 4E4XA 3G5DA 5EHYA 3DU8A 3TNPC 4C4JA 2OFUA 2QKWB 3QD4A 3FSFA 4MD7E 5CF4A 1V0BA 5FLFA 4DGNA 2W1HA 3NMUF 3AT2A 2UZBA 3DAJA 3Q32A 5AAFA 3VBWA 5IUHA 3QCYA 4RVLA 3GFEA 4TNBA 4BDEA 4DH5A 2CLQA 3DJ5A 4EHZA 3W2RA 3AD4A 4ZLZA 3OEZA 3SX9A 3MY0A 4S34A 4F0IA 3EKNA 2B9JA 4C61A 3IK3A 4I6HA 3O96A 2QOOA 4NJ3A 4YJPA 3QF9A 5GJGA 3PXYA 4D2PA 3ZSIA 4EI4A 2WD1A 3P9JA 4HNFA 3AT4A 5AR5A 3GI3A 4Q9ZA 5IDNA 5FM2A 4AA0A 4QTEA 4F6SA 3ACKA 2JDRA 2YCFA 4I0RA 3LCDA 4J1RA 5D9HA 2W4KA 2QOFA 3HMIA 1KOBA 4E20A 2VWIA 4DFLA 4FIJA 5CVGA 4R6VA 3FI8A 3VQUA 4WSYA 2WMTA 2UZVA 4AA4A 4O0TA 5FWKK 3TIZA 3U6IA 2RF9A 2HENA 2OXDA 1P2AA 4EORA 3PPKA 3RAHA 4JNWA 4GU9A 3VBYA 4R8QA 5F1ZA 3PTGA 4WD5A 4OUCA 5AWMA 2F9GA 3ULZA 4M66A 3OUNB 2RL5A 5HIBA 2XBAA 4IWPA 4MEDA 3TZ7A 3JR1A 2OIDA 4AF3A 5DIAA 5AP2A 2W1ZA 5AM6A 2BR1A 3KEXA 4XBRA 1YOLA 2PSQA 2RSVA 3H0ZA 4QPMA 3PP0A 2H34A 3CQUA 5H9BA 3QKKA 2ITPA 4M12A 4XNEA 3A4OX 3LLTA 2JAMA 1UA2A 2B54A 2VWVA 4HPTE 2DS1A 4ITHA 3PY0A 2V7AA 4PF4A 4I5PA 4QMXA 4ZTQA 3VF8A 4BDBA 1YW2A 3OMVA 2QURA 5AM7A 4DLJA 2CLXA 4B6LA 4UZHA 3KRXA 4AOIA 4L44A 2PVLA 5HICA 4RJ6A 3ZS5A 2UW8A 5ANGA 4FMQA 4UXLA 4PP9A 1NVQA 3NDMA 3NSZA 2X9EA 2BZHB 4NKAA 4WT6A 4ASDA 5IQBA 4OTDA 4QP7A 5DT0A 4P90A 1IR3A 4FVQA 2OK1A 1OVEA 3PYYA 4QYHA 4G16A 5A4EA 5DG5A 3GXLA 3U54A 5J95A 2CKQA 3VQHA 5GIPE 3DNDA 4D0XA 4ITIA 3ELJA 5HLNA 4L3JA 4EC9A 4XEYA 5J8IA 2W7XA 2JBPA 3FMKA 3O23A 2A0CX 3Q9YA 3HKOA 5EHLA 2XNOA 3Q2MA 3S3IA 4GG7A 3WF5A 3ZRMA 2W05A 4RWJA 1UU7A 3QX2A 4X21A 2BFYA 4JT3A 3BEAA 1IA9A 5KMLA 4EQMA 4GH2A 5C03A 3RK5A 3LVPA 1Q61A 4L9IA 3RNYA 1ZARA 2GNGA 3BHTA 3QCXA 4HYHA 3E3BX 4QMVA 4GUBA 5T6KA 5EDQA 2ACXA 3MIAA 5TKDA 2VWZA 4UYNA 5KZ0A 4EOSA 2VTMA 4RBLA 5LVNA 4TWNA 4MBLA 4R1YA 4O7ZA 3GCVA 2ITUA 2R3MA 4EH4A 3GGFA 2CNVA 2CMWA 1XKKA 2OH0E 4IIRA 1G8AA 3BV3A 3NUPA 4CRSA 4J8NA 4YZNA 2JKMA 3WARA 4QYEA 4RJ3A 1MQ4A 4XG4A 3NNUA 2XNPA 3R30A 3QQLA 3PA3A 1OKVA 4TN6A 4C3PA 4RX9A 5HVYA 2B7AA 3RHXA 2W4JA 2BDFA 2X39A 1REJA 4FV2A 4O38A 3PA5A 3K5UA 4UMTA 4AZWA 4BDCA 1V1KA 3LCOA 3R8LA 2E9NA 4XP3A 4PY1A 2DQ7X 3O7LB 3ZXTA 3QWKA 2WFYA 1Y57A 3NEWA 4YBJA 2X6DA 2WQMA 3QZHA 4L68A 5ETAA 3U4WA 4I22A 4C3RA 2XZSA 1IG1A 4EH9A 4HVSA 3MYGA 4TWOA 3IG7A 4RIOA 4ZSJA 2OXYA 4EZ5A 2R5TA 2C0IA 1W7HA 3BCEA 2PZPA 3RAWA 3UTOA 5H3QA 3NPCA 5AUTA 3C51A 4NTTA 3VUTA 1KOAA 3GT8A 4X2GA 3UO5A 3ZLSA 1H1QA 3U9NA 3H30A 2XH5A 5B2MA 2VTLA 5CNNA 4C7TA 4U9AA 3EKKA 3GU6A 4MX9A 2XP2A 2VWUA 4IB3A 4JDHA 2X4ZA 4IBMA 4J52A 5KHXA 4E26A 2G1TA 3FLNC 3JY9A 4KBAA 5EW3A 3LE6A 3QUDA 4U97A 4H1MA 4U6RA 5EQYA 2JC6A 3L8PA 3AGMA 1SYKA 5AAEA 4X2FA 1Q99A 2PUUA 3AC1A 3U6HA 1JNKA 3ZRKA 3GBZA 4RQKA 4U0IA 1FGKA 1YXUA 1JKLA 2J5EA 2QG7A 3PRIA 2UW0A 4EHVA 1PXOA 2I0YA 5A9UA 2UZWE 1OGUA 3UOKA 2YAAA 3OG7A 4RG0A 3CPCA 4CTCA 1I09A 1OMWA 2Z2WA 2IZSA 5M55A 2XCKA 3QKMA 3QU0A 3ORPA 2ZM4A 4E4NA 3FDNA 2G9XA 2WMBA 3TNIA 4I4EA 1PW2A 3QC4A 1ZMVA 1FMOE 3Q5ZA 1M7QA 2BRNA 2QCSA 4M0ZA 4ANLA 2OIBA 3RVGA 4D1SA 5M57A 4P7EA 4DG2E 2XIXA 4FEVA 3PPZA 4BWXA 4P4CA 4OW8A 4BRXA 3H10A 5C8MA 4F70A 3VBTA 3KCKA 4OTGA 4D4RA 4DG3E 3QCQA 5LMBA 3UNJA 5HESA 5IISA 4HGEA 5A4CA 3MDYA 4ZZNA 3W8LA 4E1ZA 3SLSA 4G1WA 3K3JA 4QO9A 3FHRA 2HIWA 4NWMA 4QMPA 3CBLA 5DN3A 4RIYB 3E7VA 4W9WA 2WPAA 2V62A 3LJ2A 5ANEA 5E7RA 5HGIA 3W2CA 3ZH8A 3C4ZA 4XP0A 3KGAA 3WI6A 3UC3A 1FVTA 5BNJA 3EYGA 3D94A 4B8MA 3LQ3A 4EH6A 1MRUA 3PFQA 4U7ZA 4RIWB 1JOWB 2AC3A 3OWJA 4USFA 3FJQE 4GJ3A 3AMYA 4MBJA 1P4OA 4AZFA 2ZV2A 3U6JA 3IW7A 2R3OA 4ANQA 3QC9A 4FE2A 3SQQA 2BRGA 3EN6A 3PJ3A 3RZBA 3VS6A 3KMWA 2WMQA 4O0XA 2GSFA 3DK7A 3EN7A 1URWA 1YHSA 3E63A 4XCUA 4QMWA 3IDBA 3W32A 2VTJA 4YC6A 2W5AA 3R9NA 4A06A 4PL5A 4HYIA 5TR6A 2REIA 2BMCA 4B8LA 5HE3A 3V5PA 1O6YA 3W18A 2C6IA 2R3GA 1ZY5A 5IA5A 4G5JA 4FKGA 1JPAA 2YM6A 4GW8A 2JIVA 4CVAA 2WEIA 3PRFA 3BV2A 2YM5A 4I0TA 4YTHA 1H07A 3UOHA 4H58A 2O8YA 3TM0A 4PWNA 4BCQA 3V6SA 1OKWA 4FNWA 5KBRA 3C4XA 2R3LA 3CY2A 4YSJA 2V5QA 3LLAA 4PMMA 4FTRA 2G2HA 2X2MA 5K4JA 3F2AA 4WUAA 3EHAA 2OZAA 4RFZA 4J8MA 4LFIA 2HZNA 4YJRA 1VYZA 4M13A 5B0XA 2ZDTA 4D2SA 3VUDA 1FGIA 3NNWA 3PXKA 4D28A 5LVMA 2C5XA 4YSMA 4CZUA 5F9EA 4K18A 3FY0A 3SRVA 4N57A 4TZRA 2XVDA 3PG1A 3F9NA 4DFXE 4JR3A 3EQHA 4QMMA 3V3VA 4BBFA 1U54B 4O96A 3UGCA 1ZYJA 2X0GA 2X2LA 4O0UA 4JBOA 2WMWA 1XO2B 5E91A 4EOOA 4BHZA 4OT5A 4LV5A 3LXPA 3ALNA 1DM2A 1YI4A 3O8TA 4GU6A 2EU9A 3SOCA 3ZEWA 2QO2A 3P7CA 3SV0A 3CR0A 5EM5A 3KRJA 3KF7A 4CYIA 3HUCA 3G0FA 4JI9A 2WELA 4L00A 3H3CA 3S4QA 2HW6A 2IWIA 2XK6A 4L45A 4QRCA 2XMYA 5L2WA 3Q2JA 4V0GA 1F3MC 5FP5A 3G90X 4YO6A 3D9VA 3OFMA 4DGGA 1YHVA 5CU3A 4EK6A 1PYXA 4R7HA 3T3VA 5KBQA 5F20A 4M67A 4QQCA 3R01A 1RW8A 1WZYA 2BAQA 4M14A 4RIXA 3NW7A 3QLGA 3UZPA 2OXXA 3Q4ZA 3V5WA 4M69B 3HMNA 3COMA 4I41A 5TF9A 4RX7A 3E8CA 3Q9WA 3WF8A 4FKIA 4YZBA 3WZKA 5ETCA 3UQFA 2XKDA 1SVGA 4HW7A 4U3ZA 3TV4A 2Z02A 2RFEA 5JGBA 5I3OA 2X6EA 2OJJA 4CQGA 5DFPA 4U80A 3RI1A 2C6LA 5CEPA 4MTAA 3I5NA 3DDPA 3OZ6A 3HMMA 3R83A 4UY9A 4PRJA 4BF2A 4IJPA 4TYJA 4CKJA 5LWMA 4M0YA 3ZO1A 1OL5A 5G6VA 1ZAOA 1AD5A 5GNKA 5AA8A 2XBJA 3P0MA 3PUPA 4QP1A 3F3TA 5IUGA 5IMEA 2B0QA 3DBFA 4NT4A 1PYEA 4FOCA 4ZTNA 3TNQB 5JQ5A 1QCFA 3FI3A 3EN9A 5EKNA 3COKA 1LEZA 3MH0A 4IZ5A 4EOQA 3RM6A 1FINA 3RWQA 5KMOA 3VNTA 2YDKA 4H36A 1YKRA 3OCBA 2GS7A 3OS3A 5DT3A 3GU7A 2XS0A 4QP2A 4FSNA 3HZTA 3ZSGA 4BGQA 1HOWA 2GQGA 1H08A 4HGLA 3FXZA 4ZLOA 5J9YA 5L2SA 4K1BA 3TKUA 4E6CA 3IW5A 2VV9A 3ZZEA 2IPXA 3U55A 5E8XA 3IOKA 3OXTA 3CKXA 4WBOA 4JRNA 2Y4PA 3R7GA 3UC4A 1OPKA 3OXIA 3PJ8A 5EI6A 1ZYSA 3FQHA 4A07A 3DLZA 4EH7A 5HBJA 1L8TA 4YJOA 3OW3A 4HJOA 5HD4A 2P4IA 5IKWA 2W1EA 2J50A 3RNIA 1H26A 5JRSA 1ERKA 1Q3DA 4DEAA 5BUIA 2ERZE 2QHMA 2B9IA 1Y8YA 3QD0A 1O9UA 4XHKB 4ZLYA 2UV2A 1QPCA 3DK6A 2C0OA 4MXCA 4IVBA 3P4KA 4FSMA 4FV1A 2CGWA 5B2KA 1DS5A 1DI8A 5K3YA 3V8WA 3IS5A 5CSVA 2J5FA 5E8YA 3PPJA 1WFCA 3MWUA 5CEQA 1STCE 4BCNA 5LQFA 3ZO2A 4ZMEA 4FSQA 5FQDC 3K2LA 2HZ0A 4JQ8A 3RKBA 2VWYA 4M97A 5E1SA 2PMNX 3ZHPC 4A9RA 3EIDA 2Z7QA 2JEDA 4JBPA 4ZZMA 3AC3A 3RK7A 4EUTA 3GUBA 4NM0A 2XJ0A 5DR6A 2A19B 4IH8A 5KCVA 4PDSA 2OICA 2VTTA 3FAAA 1B39A 4D58A 5I9ZA 2QD9A 5DGZA 5IZFA 4EOPA 2VGPA 5J1WA 3BHVA 4PL4A 2X4FA 1QMZA 3PXZA 4GFOA 1PXNA 4I3ZA 4IDVA 4OGRA 4YNOA 4O91A 4E6DA 3R63A 4MQ2A 3GP0A 4CFXA 2Y4IB 5E8VA 2I0HA 3BLHA 5J5TA 3CTHA 3ZBFA 3PLAE 2IVSA 3EQPA 3KMUA 1NVRA 3ORTA 4PTEA 3OBGA 4TT7A 2Y4IC 4LMNA 2X7OA 4DF3A 4K2RA 2EXCX 3IW4A 4I0SA 1GIIA 4RC3A 3G33A 3C50A 5GZ8A 5FG8A 3G15A 4YZDA 1MQBA 2OJGA 4BIEA 4DA5A 4E6QA 1CSNA 2GQRA 4J95A 5CSXA 2IZTA 3P5KA 3DBCA 4K77A 4O6EA 2J0JA 4FUXA 4MXAA 4D2RA 5CSWA 4D1XA 1IRKA 2JLDA 4WNKA 5C8NA 2NP8A 5D10A 1YXVA 4D2TA 5E90A 2VU3A 3IONA 2PY3A 1TQIA 2BTSA 4FTOA 5IEXA 3AC5A 5EOBA 5KMJA 2YZAA 2WAJA 4XBUA 4O21A 4QP3A 2W5BA 3UIUA 4AGDA 3OHTA 5M56A 3BPRA 1E9HA 3E87A 1PMVA 5CAOA 2QOCA 2WOUA 4X2NA 5A3XA 2YIQA 2C3JA 4L8MA 3NCZA 1BLXA 5FGKA 3SAYA 3LHJA 5FXRA 5CI6A 2UZTA 4FTQA 5C8KA 4KS7A 2C3IB 3COIA 4JOAA 1KSWA 3DLSA 4WG4A 3N4TA 3I1AA 3KULB 3FI4A 4GUEA 4IB1A 2J4ZA 2EXMA 2Z60A 3FC2A 3QA0A 4AACA 4V01A 5L4QA 5K0XA 4EK3A 3GCPA 3FE3A 3QTUA 4M8TA 1M52A 3UBDA 3JY0A 2BRBA 2CCHA 3KKVA 4XUFA 4YPDA 3W1FA 4IWOA 2GTNA 4RZWA 2I6LA 4XJ0A 1OIUA 4AX8A 3NR9A 5K0KA 2QVSE 1TQMA 4PMTA 2R0IA 1Q8ZA 1XJDA 4LUEA 3PJ1A 4WBBB 3WE8A 3QLFA 1JSTA 3QGYA 1LUFA 2WMRA 4ZTSA 4BBMA 5IA3A 4BWPA 3L8VA 3UP2A 2CNUA 4UBAA 2WTCA 2IW8A 4PMPA 4FEQA 4FBXA 4OLIA 5I9UA 3V5JA 2WEVA 3K5VA 2BCJA 2BFXA 2C6TA 1Z5MA 5JRQA 2WOTA 4YTFA 2C5VA 1Z9XA 4BYJA 4FYOA 5C27A 1RE8A 3GCUA 3QTZA 4FL3A 4FNZA 4QP4A 2O0UA 1XH7A 4LM5A 3WZEA 3ZYAA 1CKIA 1G8SA 1VR2A 4FK6A 4RJ4A 4BKJA 4FSRA 2R3PA 3QD3A 3U51A 2OJIA 1ZMUA 3LW0A 2B55A 4AN2A 2GU8A 3I81A 5C4LA 1AQ1A 1U46A 2YISA 2VTPA 1B6CB 4ZS0A 3GB2A 3FQEA 3BI6A 4O7YA 5J9LA 2W1FA 2XUUA 2JGZA 5EK7A 4B0GA 5B2LA 3CY3A 1JSUA 3OWKA 3UIBA 5AUVA 3ODYX 2PWLA 1L3RE 2XA4A 4X3JA 4F65A 3FSKA 4AW1A 4I6FA 2WO6A 4RA5A 4BICA 3MFRA 3SOAA 3BEGA 3QUEA 3MFSA 5KO1A 3N51A 1H1PA 3TZ9A 1J3HA 4K6ZA 5DE2A 5AV3A 1YDRE 2Q0NA 3H9OA 2H96A 4FG9A 4FTJA 4YHJA 5AV1A 4BCIA 3OY3A 1PMNA 3POOA 1RJBA 4S31A 4OTWA 3TV7A 4EHEA 3DOGA 5AIKA 5HIEA 3NUYA 4F9WA 1OECA 4JIKA 4YJSA 1I44A 3F66A 5JEBA 3OTVA 2GS6A 3O17A 2QI8A 3FBVA 3ZDIA 3EMGA 2XNEA 4BR3A 3QX4A 3TNHA 4IE9A 5CAQA 4RFMA 4H3PA 4IADA 2VRXA 4W9XA 3V8SA 2YDJA 3NYNA 3I6WA 3KVXA 1YHWA 1CKJA 5CT7A 1W82A 2J0MB 3UJGA 4EKKA 1KWPA 2PZ5A 4HVHA 1KE6A 5CS6A 4FKUA 5ANDA 1FQ1B 2PVHA 4FEXA 4KIKA 2FSOX 5GHVA 3R6XA 1A06A 3QQJA 3RAIA 1SZMA 3PWDA 3BYUA 3R9OA 1X8BA 3ORXA 3NVKI 3L1SA 3TACA 4Q9SA 3RTPA 4CYJA 4W4YA 1FMKA 1UV5A 2ZV9A 2X9FA 3HEGA 4NW5A 3LPBA 1E1XA 4WG5A 4OTHA 4AQCA 1ZYDA 1LEWA 2PK9A 3BIZA 4JR7A 4EOLA 4RIYA 4DT8A 4BDFA 1BI7A 4AZSA 5TE0A 1W8CA 4A9YA 3PIZA 2E2BA 3V51A 4UN0C 4BCJA 4PDOA 3KREA 5IQFA 3TN8A 2OIQA 4GFMA 2XIZA 2GMXA 3VF9A 2JFMA 3QRJA 5EYCA 2ETRA 3SA0A 4RIWA 5CWZA 3FMEA 5AUYA 3QYWA 4KWPA 3LIJA 2X8EA 3MFTA 3QRIA 2NNWB 4O0YA 1BKXA 3ZBXA 4D4YA 4R7BA 3CLYA 3D14A 2BHEA 4GVJA 3E8NA 3R1NA 4KNBA 2AC5A 3CP9A 3BYMA 4MCVA 4O0SA 2UZNA 4EUUA 2H6DA 1H1WA 3D5UA 3DT1A 4J96A 2HWPA 4FEWA 4F9BA 4MYGA 3HDNA 4DTKA 4XRJA 2HELA 2VX3A 3WF9A 4BCFA 4PDPA 4ZSEA 5HIDA 5AUUA 4ZK5A 3AG9A 3FZTA 2WMAA 3MIYA 4G2FA 1M7NA 4FTIA 1KE9A 4R78A 2Y6MA 2RFNA 5J1VA 1GY3A 4XYFA 3H0YA 2J2IB 2RFSA 3WOWA 2ZOQA 4GT5A 5AV0A 2JKOA 3GOKA 3NIEA 2GNFA 3OW4A 4RJ7A 3KA0A 3FZOA 4TKSA 4DTBA 4JDKA 2OU7A 3W2PA 4MF1A 2GDOA 5BMMA 2J6MA 3G51A 3EL8A 4KIPA 2BALA 3ZUUA 1ZZ2A 2YCQA 1OI9A 3FMMA 4Q5EA 2IZUA 4BDGA 4GK2A 5IQGA 4FA2A 4Y95A 5AP1A 2BKZA 4HGTA 1PXJA 5AR8A 3F7ZA 4YJUA 5HU9A 5EOLA 1H4LA 3ZMMA 4BIDA 3MA6A 5L8JA 2F49A 2A1AB 3RK9A 4BCOA 3RAKA 5M4IA 3NRMA 5A4LA 3OWLA 3F3ZA 4CT2A 4BY9E 4RFYA 4X2KA 3MJ2A 5FTOA 5LARA 5KMNA 5L6PA 3PIXA 4S2ZA 1U54A 3K3IA 4NKSA 3B2WA 3UOJA 5DR2A 2W5HA 3E7OA 1MUOA 5HX6A 5E9EA 2QOQA 2XYNA 1UKIA 4UXQA 4M7IA 4ERKA 3FZSA 4BWKA 3TV6A 3SXSA 3ZZWA 4C57A 4IX3A 5JZJA 4FNYA 2CN5A 1Z57A 1Q62A 4L52A 4YMJA 2C5YA 5L8LA 3MVMA 4IAAA 2WMSA 2Y9QA 3RCJA 4DEDA 2PYWA 4GK3A 5CEIA 1A9UA 4ASEA 3CJFA 2IJMA 3FUPA 4JIAA 3DBQA 4QPAA 4FT9A 3SVVA 1JQHA 4C4HA 4KINA 4BTKA 4DBXA 3A7IA 4O81A 3BLRA 4YTIA 2H8HA 5BVOA 2C68A 3KXNA 5KHWA 4L43A 4M69A 3ENHA 4U41A 4EC8A 2VO6A 2Z7RA 3DBEA 3FC1X 3CTQA 4FV6A 3KC3A 4IC8A 4RJ8A 4X3FB 2VAGA 1XQZA 2WTIA 3QQKA 3V6RA 5LOHA 5D12A 3OCGA 4AS0A 5M4FA 4IQ6A 4QTDA 2GHGA 2OSCA 2VD5A 3D7TA 2W1DA 5CEOA 3TJDA 3IECA 4G9CA 2FSLX 3QA8A 3MTLA 1H8FA 4X3FC 5F4NA 3FXXA 1OZ1A 5EQEA 1BI8A 2FH9A 1CTPE 1VEBA 4ZTMA 2FSTX 3LCSA 4QQJA 2WU6A 3E8DA 3W2QA 4MWHA 2HK5A 1PXMA 3CC6A 5CQWA 4QYYA 2O3PA 2R3QA 4LGHA 1ATPE 1GAGA 2CCIA 2FYSA 4XV1A 4A4LA 4CCBA 4F1OA 5C9CA 4Z55A 2PPQA 1Q41A 4Y73A 2QQ7A 1WMKA 3FPQA 5D11A 4AGUA 3NW5A 3MW1A 2OW3A 2YABA 1J7LA 4FX3A 3DDQA 4W4WA 4FSZA 5EYDA 2R7BA 3M11A 5FBNC 5L2TA 4NCTC 3RMFA 3WE4A 3FLZA 4W4XA 2ITNA 3ITZA 2JIUA 4CT1A 3EN5A 4J98A 1FVVA 2YM7A 4JS8A 4V05A 4BI1A 2R3KA 2E9OA 3FLYA 4D0WA 2VNYA 3I79A 2C6DA 3LFBA 2XIKA 4KBCA 3A7FA 3OTUA 4HGSA 1MRYA 2R9SA 4MNEA 3VUMA 3TUCA 4FV5A 2O64A 4AG8A 3F88A 3QWJA 2XJ2A 1ZXEA 1PXPA 3R22A 4FTAA 2QOLA 3LXNA 3I0OA 3WYYA 3AC4A 4YO4A 5EYMA 1OM1A 5CAPA 5HHWA 4FZ6A 3EFKA 5AP0A 4ZY5A 2VTSA 3GU8A 3AMAA 4F7JA 4XS2A 3I0QA 4MKCA 3A7JA 4F4PA 3SKCA 4LI5A 4XH6A 3ATTA 5LWNA 4HVDA 4XG9A 4EWHA 2C3LA 4WA9A 2BHHA 3BRBA 4XOYA 4AFJA 5IG1A 5HO8A 3LCTA 4AT5A 4DLIA 1KE5A 4WNPA 4FGBA 4FC0A 2BIKB 4KKEA 3UODA 3NAXA 4KABA 4CKIA 3TUBA 3FL4A 3HVCA 4XV2A 1RDQE 2FSMX 2UZEA 2XRWA 3NAYA 5HEZA 3VJNA 5I9WA 5JK3A 3LAUA 4KA3A 2B52A 3D5VA 4XG7A 4HZRA 4A9SA 3HAMA 5HG8A 4HCVA 1T45A 4QMSA 5BVWA 3ATSA 2R2PA 5HNIX 4ANBA 5FD2A 3TZ8A 1XBAA 3LZBA 3LM0A 3QQGA 4FEUA 2CGXA 4L46A 2VX1A 3KQ7A 1G3NA 4ZY4A 4UWBA 4XG2A 5LCKA 5J5SA 5HTIA 2JDTA 3UVRA 4IANA 3WIKA 2XCHA 5JN2A 3R9HA 3FQSA 2BIYA 3UO6A 3PSDA 1SVHA 3S1HA 3MH3A 2ITZA 3F3WA 3KXXA 3I4BA 2I40A 1PHKA 3R7UA 4EH3A 4WOVA 4FIFA 2VO7A 3LFFA 5AR2A 1OKYA 3LFSA 3AD5A 1JKTA 4FG7A 4AGWA 4MQ1A 5AEPA 3ORZA 3EZVA 5CX9A 2IVTA 4EZ3A 2PVNA 4DH7A 3JUHA 3EQFA 4LRKA 5BQ0A 2AYPA 4RWLA 3TTJA 4FR4A 3M2WA 4R3RA 4ENXA 3HLLA 2X2KA 4TW9A 4BDHA 4O7LA 2ZJWA 5HBEA 4AOTA 3TT0A 3A61A 4BB4A 4CFFA 4QOXA 1OITA 3DQXA 2IZRA 3HV7A 2QC6A 3BBWA 3OY1A 2XF0A 5EI2A 5AV4A 3FLWA 3SW4A 4AW2A 4F7SA 2HXQA 4BZDA 3C5UA 4EH5A 5TOZA 3U4UA 1H27A 3G2FA 1H24A 4CMUA 2VTIA 5LVLA 1OB3A 2GCDA 4II5A 2JITA 4C4FA 4FK3A 3FWQA 1SVEA 2BROA 1YI6A 5E92A 5JFVA 3ZC6A 1REKA 2P2IA 2I7QA 4O82A 1FBNA 2XK9A 2RKUA 4Z16A 4KB8A 5EH0A 2PZIA 4YJVA 5DEYA 4ACMA 1Q3WA 3R2YA 4JDJA 4USDA 5EQPA 1YOMA 2PZRA 5J7BA 5DWRA 2I0EA 2B9FA 4I24A 3ZFYA 2YWVA 2PE0A 3PIYA 4AOJA 4MXYA 4FTUA 3HNGA 4ACDA 4C38A 1R1WA 2WZJA 4FODA 4RQVA 1ZRZA 2UW5A 4ZJJA 4AN9A 3V01A 3CE3A 2PVJA 4G3DA 4ZZOA 1P5EA 2PU8A 4LG4A 3KULA 4I5HA 4RZVA 2ITVA 4TYGA 4DEIA 3KN6A 3OWPA 4FV8A 4FUYA 3W33A 5AADA 2UZLA 2WQNA 3HV4A 5DMZA 5G1XA 3GU4A 2BUJA 4U5JA 4U81A 3VBXA 1J7IA 1QPEA 2P2HA 3VBVA 5KKRB 4MXXA 5CENA 3WZUA 5EM8A 2JD5A 2P33A 3O50A 1JVPP 3AC2A 2CKEA 2XEZA 3QZFA 4PMSA 4NIFA 3VRYA 2YEXA 3D83A 4ERWA 4HOKA 5M06A 4FV7A 3S95A 4EKLA 5KKRC 1GZNA 3DKFA 4X7QA 5I9XA 3A8WA 4BVUA 4DITA 3VO3A 5BYYA 3ZUTA 4UMUA 3F7WA 3PP1A 4S32A 1UVRA 3FYKX 4FNXA 4Q5HA 4E5WA 4NU1A 5CNOA 3UPZA 2G15A 4LL5A 4AT3A 4QMYA 3A4PA 4G34A 3GENA 1Q5KA 5CALA 1M2PA 4FT0A 3VAPA 2UUEA 3UVPA 2FB8A 3VS2A 4RPVA 4GS6A 1GJOA 3ZSHA 4D4VA 3QL8A 3EFJA 1WAKA 4GKIA 5FXSA 4I1ZA 2WB8A 3Q53A 2XKEA 4AAAA 4Y72A 4O22A 4P5ZA 5L8KA 4BGGA 4XRLA 4CFMA 1HCKA 4FZAB 4UMPA 4U42A 4MHAA 4TWCA 3MY1A 3G9LX 1CM8A 4HNIA 2YERA 3LFQA 3DS6A 3FXWA 3T9TA 4IZAA 3BQRA 4EYMA 2EUFB 2YIYA 3EL7A 1W83A 4DCEA 4E73A 2ZMDA 3LJ0A 1RQQA 4UEUA 4F7LA 4ANMA 3DXPA 4F9AA 3R8VA 5L2QA 4C4EA 1UNLA 2PE2A 2W96B 4UWYA 3B2TA 2EVAA 3UNKA 4IB0A 4BZNA 3GC9A 3Q9XA 4NH1A 5CANA 5FXQA 5JFWA 3F5GA 4Y5HA 3FLSA 4F09A 4AZTA 4EYJA 2ZV8A 5M4UA 5IEYA 2YWPA 3CSVA 4UZDA 4N70A 5F95A 4O7WA 1UKHA 3MB7A 4JRVA 4IM3A 3OC1A 4KRCA 3Q60A 4FTLA 4YPSA 4AFEA 3GFWA 3A99A 4AZEA 3SHEA 4TTHB 2BZKB 2YIRA 3AXWA 3GU5A 3QALE 3VC4A 3VS1A 4I20A 3TUDA 4QMNA 4JG8A 5CXHA 3R7EA 4O7RA 4HYSA 2FGIA 2C47A 2HY81 3A2CA 3AC8A 3KRWA 4PX6A 3QZIA 1BYGA 3M42A 4ZSGA 4APCA 5DEWA 2YJSA 5ICPA 2V0DA 3HA8A 1H0WA 3POZA 2VWBA 3O8UA 2ZVAA 4J71A 3RHKA 3NLBA 1APME 2GHMA 3JVRA 2P55A 5H8GA 3C4WA 4OTQA 4ZXTA 4F1MA 3DZQA 4TYHB 5HZNA 4PP7A 3PJCA 3WF7A 4IM2A 3B8RA 5EM7A 3MBLA 4FYNA 2C6EA 2R3HA 1H28A 1ND4A 4QP9A 1XBCA 3SDJA 5CU2A 4EEVA 3UP7A 2ZAZA 5DPVA 4FKOA 4F64A 4S33A 2X8DA 4ZSAA 3RPRA 1T46A 1NVSA 3VS4A 4JG6A 2HZ4A 1GOLA 1XBBA 4PL3A 4IX4A 5IQDA 3UIMA 5AP5A 5FRIA 3F61A 3H9FA 3KMMA 3MY5A 4V04A 4HCTA 3QTRA 5CVFA 3PA4A 4MD9E 4PNIA 4GIIA 2UW6A 4RX5A 5HNBA 4IVCA 3RZFA 3QXOA 3R9DA 5KX8A 4EH2A 4NM3A 4G6LA 3ZCLA 1YXXA 3F2NA 5HVKA 2ZMCA 3L9NA 4D4SA 3BQCA 4I92A 2PVYA 5DHJA 3HA6A 3R28A 5CF8A 2EB2A 4C8BA 1UU8A 2QR8A 4MBIA 4AT4A 5HORA 4EZ7A 2A4LA 2BRMA 4L7SA 4FT5A 3LMGA 4FICA 2C5OA 2BRHA 4G6OA 3DZOA 5M44A 3P79A 1W98A 1Y6BA 4ZJVA 1Y8GA 3MVHA 3G9NA 2O5KA 2CKOA 3MTFA 5EW9A 4YC3A 4O86A 4GSBA 2YLFA 5CF5A 5M08A 3NYOA 4I23A 4CKRA 4NYEA 2BKKA 3BU5A 4EHGA 3ANRA 4OBPA 4L01A 5E8ZA 2XM9A 4B4LA 4KUJA 5FDXA 1J1BA 4J99A 3KCFA 4BKZA 5IQIA 5D7AA 5L3AA 5LMKC 3UZRA 5CY3A 2QLQA 3TIYA 4ASXA 3CCNA 4BYIA 3ACJA 3CIKA 4TRLA 2JKQA 3CJGA 4NZWB 2RGPA 3V5TA 5BVKA 4FIHA 4PTCA 2VTAA 2R7IA 3B8QA 4IDTA 5EG3A 2XK8A 3C13A 2R3RA 4ITJA 5CI7A 5A4TA 5AR7A 2VUWA 5JGDA 4IJ9A 4WG3A 2UW9A 4FIEA 1XWSA 5BX0A 4O27B 4U8ZA 5BUJA 4E93A 3QXPA 4BBEA 5M07A 3W16A 4Z3VA 1U4DA 5M09A 1VYWA 4AZVA 2KTYA 4KRDA 5I9VA 3BX5A 4X6QC 5J7HA 4IX6A 4EK8A 4YHFA 2O2UA 3FYJX 4FL1A 2GNLA 4O6LA 5E8UA 3TWJA 3KRLA 3FZ1A 1OL2A 2OH4A 4ARKA 1AGWA 3AMBA 3R02A 2GTMA 2R3FA 4AN3A 1W0XC 4IVDA 5HO7A 5DOSA 2W9FB
chains in the Genus database with same CATH superfamily
1WVXA 5CEKA 2CNQA 2QKRA 3UNZA 2PMIA 2XIYA 2O63A 3DFAA 4QTAA 2VTHA 3MVJA 3ZLWA 3P7BA 3HP2A 1Q4LA 4FGRA 4FKRA 3ZEPA 3JXWA 2WTJA 4TYEA 2HYYA 4FIGA 4YJNA 3UMXA 4CRLA 4DFYA 3AOXA 4X2JA 4U79A 2X0PA 4X3FA 5FBOA 5H8EA 3VRZA 3LMHA 3L9MA 2YM8A 4LV8A 4RLLA 2GFSA 5EI8A 1Q8UA 1PXLA 2WMVA 4I4FA 3DQWA 5HCXA 3KXHA 4FF8A 4QQTA 2NPQA 2WQBA 3UG2A 4CV8A 4LDTA 3I6UA 4CFWA 5A14A 4H05A 5IH6A 3F82A 3RALA 3NFGB 3QHWA 4XLVA 3TXOA 4QPSA 2XNBA 2OF4A 4I5CA 1FVRA 4CSVA 5C4KA 3OROA 5GINE 3QUPA 4TYIA 2ITXA 1Q97A 3VULA 4C59A 2JKKA 4MF0A 2V7OA 3E92A 4FTTA 5A54A 3E8EA 4NCTA 3FMLA 4QMQA 5IQHA 4ZTRA 4C0TA 4GK4A 4FTNA 2F57A 2YM3A 3MVLA 2VTRA 1J1CA 1YI3A 2CGUA 2QO9A 3RWPA 5J9ZA 1JKSA 4IEBA 5HD7A 2W4OA 4YLJA 4CEGA 3ENMA 3R04A 3UVQA 3A8XA 5JH6A 3GC8A 1OPJA 5IDPA 4LQMA 3ID6C 5DRDA 3R0TA 1NT2A 2P0CA 5H2UA 1ZWSA 2NRUA 3VS0A 3UQCA 5IU2A 1YRPA 2IVUA 5CU4A 3BLQA 4LUDA 4BHNA 1WBPA 3R1QA 3OOGA 1PMUA 1JKKA 1GZKA 3F6XA 4YR8A 3KFAA 1JWHA 4HCUA 1WBVA 2XJ1A 3BKBA 3FY2A 4F9CA 3R9RA 2W06A 3PY1A 3U87A 3DBDA 4YGAA 3BE9A 3C5IA 5IMXA 3S00A 1BL6A 2PVFA 4EJ7A 3A60A 3E93A 3SC1A 1OKZA 3EFLA 3TG1A 2P3GX 4BDDA 5EDPA 4IWDA 4ZTLA 2HY0A 2A27A 3KF4A 3PXFA 4FT3A 3GC7A 5HKMA 2R64A 3RM7A 4OTRA 3UIXA 4C58A 3C1XA 3COHA 2ZDUA 3LJ1A 4IACA 3LFDA 3RCDA 4V0GB 1CMKE 4XV3A 2YITA 4G3EA 1O6LA 3MA3A 3HRCA 2F2UA 3LM5A 3AT3A 5K5XA 4QMOA 3ORMA 1YQJA 1KV1A 4IAFA 5I4NA 1XMLA 2OLCA 5IQEA 2UZDA 5BYZA 1PKGA 4LOOA 4RIXB 3S2PA 4NUSA 1GZ8A 1OUKA 1A48A 3OVVA 4QMLA 1LP4A 2AQXA 4FSWA 2W1IA 5HO6A 3OT8A 2AEGA 4JL9A 1W2FA 4QDVA 3RJCA 4D9UA 2E9VA 4E7WA 2VWXA 3R8PA 3NYXA 1K3AA 3BHHA 4MAOA 4CLIA 4CZYB 2CGVA 5AJQA 2OF2A 1U5RA 3C7QA 3NUUA 4RC2A 3RGFA 2QU6A 5AX9A 4D55A 3R21A 5HX8A 4FKSA 2VTQA 4ALWA 3R71A 4QD6A 3D2IA 3R8MA 3MV5A 4UMQA 3ORNA 4J7BA 5IH4A 3BELA 4LMUA 2FA2A 4PNKA 2VGOA 3F69A 3QTSA 4P5QA 3QYZA 4FV4A 2UVXA 4BCKA 3NYVA 5IA1A 4H39A 5EKOA 3IKAA 2HW7A 5HLPA 3NWWA 5BVNA 5D41A 2UW4A 4MXZA 3W0MA 4GYGA 4JMQA 3LFCA 4ZP5A 3UE4A 4PPCA 2ITQA 2Z7LA 4W8DA 2PE1A 2XNGA 1OIRA 3HECA 3GOPA 5EFQA 4O1PA 4DEGA 3JS2A 4EWQA 4R3PA 4DCAA 4AGCA 4FV9A 5BPYA 2OI4X 4F6UA 1OL1A 3EH9A 4LOQA 3EFWA 3W2OA 3ZU7A 3PE2A 2PVRA 4YLLA 5GZ9A 4OAVB 5AX3A 3R7OA 3ZRLA 3DFCB 2GNIA 3IQ7A 1OBDA 4YP8A 2W9ZB 1XH4A 2F4JA 4MH7A 3SW7A 2QOBA 5DVRA 4DINA 3P86A 4J53A 2FO0A 4NW6A 3QD2B 3FZPA 4QQ5A 4ALVA 4W4VA 1XHAA 4A9UA 4CV9A 1R0PA 4ZY6A 1YWVA 1B38A 3OBJA 1H01A 1HCLA 2R3JA 1OIYA 1Y6AA 5ETIA 3RPYA 3UOLA 3BL9A 5ACBC 5C1QB 3O0GA 5ETFA 2OGVA 4KSPA 2R0UA 4F08A 2C6MA 3P78A 3DAEA 5H8BA 4LGGA 3EQBA 4XX9A 2IEWA 3KN5A 3I7CA 2ZM3A 3DJ6A 2PVKA 3QRKA 4FI1A 3W8QA 2PULA 3ERKA 3EZRA 5BV3A 1BUHA 4JQ7A 3BU3A 5D7VA 3NNXA 5I0BA 2NRYA 3BWJA 3MSSA 4Y8DA 2A2AA 4JXFA 3VWAA 4C62A 1G5SA 4KIOA 5L6WL 3EJ1A 4A7CA 2QR7A 4BKYA 3ZFMA 2QOIA 4K11A 2C4GA 4BDAA 1SNXA 3QTXA 4G31A 4Y5QA 4YBKA 4ZOGA 4G9RA 2G01A 4OBQA 5EYKA 1OIQA 4QYGA 4YUQA 4H1JA 4YTCA 2X1NA 1KUTA 3FKNA 5CF6A 3UYTA 3DXQA 4IZ7A 3CQWA 2QONA 1PF8A 3KK9A 2J7TA 2OKRA 2YN8A 2WMXA 4TNDA 5CVHA 3LKMA 4IWQA 4NK9A 2GNJA 5HCYA 4EK5A 4O0RA 5JFXA 2J51A 4O7VA 2VN9A 2IO6A 2QHNA 2RIOA 3L9PA 4JLCA 4PTGA 3QHRA 1XH6A 3G6HA 4RLKA 3RBWA 3ZLYA 5HE2A 3PSCA 4R77A 4DFNA 3TDWA 4NEUA 4QP8A 1S9IA 3FMJA 4PPBA 5AUWA 2XK4A 4EJNA 5AMNA 3F3VA 3C4CA 3OT3A 3ZOSA 5IH5A 1GZOA 3QAME 2JDOA 3C0IA 4G3CA 4ZEGA 3E3PA 3UPXA 5FTGA 4FV3A 4LL0A 4U44A 4ID7A 4EQUA 2PUPA 1KE8A 3VW6A 5AFVA 2ONLC 1U5QA 3MPTA 4G3FA 4KSQA 1IAHA 4KAOA 3MH1A 4TXCA 2PHKA 3QTIA 4ANOA 4E4LA 1KE7A 4BTJA 3OCSA 4QT1A 3OEFX 4U45A 3JPVA 4DBNA 1P4FA 4E3CA 4CQEA 5AAGA 1WBSA 5EW8A 1FPUA 2H9VA 2WQOA 4IAIA 4IFCA 2ZB0A 1H1SA 3R2BA 3ROYA 2ERKA 2V22A 1H0VA 2EB3A 3D5XA 4RWKA 4ACHA 5EHOA 1ZYLA 1JLUE 4XMOA 1GIJA 3SG9A 2OJ9A 2Q83A 2ZB1A 3FLQA 5CASA 4FTMA 3VS7A 1PJKA 1H1RA 2BZIB 2ITWA 4QNAA 4RT7A 5AP4A 4NM7A 4EQCA 4DAWA 1H00A 4M15A 2Q0BA 1XH8A 2ZFYA 2YDIA 4DEHA 3P1AA 4EONA 5FEEA 3HV5A 5HE0A 4NL0A 5E1EA 2XARA 4XLIA 1V0OA 2W0JA 4XG3A 4AXAA 3HMPA 5KE0A 4FKJA 2QLUA 4JAIA 3C0HA 3E88A 2Y8OA 4BDKA 4EBWA 4NFNA 3EYHA 5L2IA 5L6OA 5AUXA 4O4EA 4UX9A 3S0OA 2Y6OA 4QMUA 4FSTA 4BFMA 5FP6A 4F0GA 4EOKA 4OTPA 5IA4A 2QNJA 5E8TA 3EOCA 4MXOA 3WIGA 4E5AX 1VLRA 4IB5A 4BN1A 3AD6A 3DCVA 4IMYA 1VZOA 3EQGA 2F7EE 4DTAA 4M3QA 4UMRA 5IEVA 1DI9A 4GG5A 4ENYA 3I5ZA 3V8TA 4BCMA 4TYHA 4XG6A 5E8SA 5JSMA 1OBGA 3DA6A 4A9TA 4Q2AA 5ANIA 5HBHA 3D2KA 3TL8A 3GQLA 4HVIA 1J91A 3K54A 4RVMA 2Y7JA 3NCGA 4FV0A 4IW0A 1SMHA 4C4IA 5GZAA 5ANOA 2LAVA 4CMTA 5C26A 3FZRA 3VUGA 1QPJA 3DK3A 5EDRA 3DKGA 3FV8A 2XM8A 4U43A 5CT0A 4PUZA 4EBVA 5LCJA 3BHYA 4KIQA 3ZXZA 4ZS4A 4XP2A 3VUHA 1BX6A 4DT9A 4O0WA 3IDPA 1W84A 2WQEA 3UO4A 4AE6A 3HGKA 5CYIA 5HG7A 3DTWA 4DH1A 4JVGA 4ANNA 2C6KA 3HX4A 4BTFA 2EXEA 4AW5A 4AP7A 3WBLA 5DYJA 1UNHA 4GEOA 3LOKA 2B4SB 3LQ5A 1R0EA 5AP6A 2OZOA 4FT7A 3D5WA 5HE1A 3W0QA 3UZTA 2PZYA 3QQHA 1UWHA 3V5LA 4O2PA 2YM4A 1TQPA 3BYSA 5HVJA 3R8UA 4IZYA 4TY1A 4YJQA 2JFLA 1WBOA 2VWWA 3V04A 4BI0A 4IXPA 4JBVA 4JBQA 5KZIA 1QPDA 3BYOA 5BVEA 1M14A 4K9YA 3UDTA 2J0LA 5AUZA 3PXRA 4H3BA 2PVMA 2X8IA 3WILA 5I3RA 3LFAA 4U40A 5LMKA 3DTCA 2UVYA 3O5AA 3UQGA 4CGAA 5T68A 1BMKA 5FDPA 3FKOA 4EK4A 1GNGA 2CPKE 4AU8A 4NSTA 1PXKA 3SD0A 1CDKA 3VUKA 3DGKA 2Z8CA 3FPMA 3JVSA 3E62A 4R5SA 3RPSA 3KK8A 2B53A 4ANSA 2E9UA 5IA2A 2R3IA 5DNRA 2OFVA 2C6OA 1NY3A 4DFBA 4G5PA 2FUMA 1R3CA 4ZAUA 2G2IA 1KV2A 2IVVA 2XK3A 3ETAA 4UB7A 2VO3A 1ZZLA 4KIKB 4N6ZA 3GCQA 2EWAA 3V5QA 4CFVA 4CG8A 2HWOA 3FL5A 4LRJA 3PVUA 3I7BA 2JBOA 4FVPA 4K33A 2WU7A 3VW8A 4DG0E 5IF1A 1OGYA 5HOAA 5LVPA 4GYIA 4ALUA 3F2RA 2OJFE 4GMYA 4D2VA 4CFUA 1UNGA 3FMDA 3GQIA 3O8PA 3TTIA 3UMWA 1VJYA 4GT4A 5CTPA 3EWHA 3Q4CA 3DKOA 3PVBA 1R78A 2UW7A 3R00A 5CQUA 5TT7A 3IGOA 3OP5A 3U8WA 4L3PA 2WIPA 4F6WA 2W1GA 4QNYA 3VS5A 5IA0A 3QTQA 4E4MA 4A4XA 4FZDB 4ZIMA 4DGOA 3Q96A 4DHFA 5CXZA 1PY5A 2UVZA 3C9WA 2XYUA 5HLWA 2NO3A 4L42A 3VBQA 3DY7A 5LVOA 3CGOA 3EQIA 1WVYA 4IFGA 3GEQA 2IN6A 3ORIA 1E1VA 3KY2A 4ZSLA 2BTRA 3EQCA 4FG8A 2OBJA 3ROCA 3QGWA 4WSQA 5ANKA 4Z9LA 2F7ZE 5KNJA 2CDZA 1YDSE 3IPHA 2C1AA 3P7AA 1Y91A 4N4SA 4C34A 3HDMA 3ORLA 2Y0AA 4CLJA 3Q6WA 2J0KA 2WTDA 3IW8A 2ITYA 5FEQA 2A98A 5JGAA 4NFMA 3SXRA 5AR4A 4AXDA 2CHLA 3QTWA 3Q9ZA 3W10A 3N4VA 3II5A 3TEIA 2KULA 4BI2A 2J90A 4DH3A 4X6RA 4DGLC 3UYSA 4WHZA 3R1YA 5AR3A 3QQFA 5BYLA 1DAYA 3BGPA 3QKLA 4FSYA 3HRBA 4WRSA 3HMOA 1V0PA 5DI1A 1JSVA 2ZYBA 3F3UA 4S30A 2XEYA 4K0YA 5CEMA 5K9IA 3F5PA 3DPKA 1OPLA 1NXKA 2XKCA 4KD1A 5CLPA 2X81A 3C4EA 4CCUA 3BGQA 1TKIA 1LR4A 2YJRA 5DH3A 1XH5A 2F2CB 1YXSA 5LMAA 4EOIA 5HTCA 4ACGA 3KXMA 3FKLA 3FEGA 4F0FA 3F5XA 4FKWA 3DB8A 3PY3A 4OTFA 3WYXA 4GL9A 3IO7A 3THBA 3PXQA 4L53A 4BJJA 4DFUA 4O7NA 2W99B 3QBNA 3MPMA 2YA9A 3LQ8A 4Y85A 2HOGA 3PLSA 4HVGA 3BWFA 4CG9A 3R1SA 4GVAA 4C36A 4C37A 3DB6A 3R73A 3KXGA 5JT2A 1YWNA 4D1ZA 2ETMA 1MRVA 3E5AA 3C4FA 4PQNA 3EN4A 5HCZA 4YU2A 2R4BA 3KB7A 4O84A 3TKHA 3QRTA 3L9LA 3HP5A 1URCA 1R39A 3IDCA 3LXKA 4RVTA 3VHEA 2PMLX 3DV3A 3VS3A 3C0GA 3PG3A 3HAVA 4AE9A 1ZMWA 1PKDA 3ET7A 5HTBA 1K2PA 4O7SA 3KVWA 4JJRA 4WKQA 3TNWA 4JX3A 3A62A 3CGFA 3LFEA 5D1JA 4GV1A 4TPTA 3DAKA 3KXZA 3T8OA 5CAVA 3H4JA 4OAUC 3HL7A 2ITOA 5B7VA 4EOMA 3DNEA 3P23A 4FTKA 1SNUA 1EH4A 1WBWA 2C69A 2YHVA 2ZV7A 3PWYA 4FKVA 4IAKA 2XAOA 1NW1A 3D7TB 3T9IA 1M2QA 4N6YA 2FVDA 4ACCA 4C2VA 4D5HA 2VO0A 3UG1A 2ETKA 3ZM4A 3MN3A 5JMSA 5M53A 4F99A 1MP8A 4YNEA 5AIRA 1F5QA 3D0EA 2BZJA 5AA9A 3FMNA 4CTBA 4HZSA 3SG8A 2IW9A 2RG5A 5JFSA 3QRUA 5AV2A 2C3KA 2J0IA 5CZIA 4E5BA 4B7TA 1JBPE 3ZTXA 4YZCA 4O4BB 4R1VA 4PPAA 3BBTB 3HV3A 2RFDA 3MJ1A 1ZLTA 3PE1A 4N0SA 4I21A 3NNVA 3VJOA 3PZEA 4O2ZA 3Q3BA 4M84A 2X7GA 4FKLA 4FKTA 4JX7A 5ANJA 1IA8A 5HG9A 3TJCA 4D5KA 3NIZA 2AUHA 4F7NA 5DBXA 4FVRA 1PXIA 5I5ZA 3RINA 4USEA 4Y83A 1YWRA 2XB7A 1WVWA 2XK7A 3HUBA 3GC0A 2ESMA 2VNWA 3OUKA 3N4UA 3NS9A 3MFUA 4RWIA 2F7XE 4P2KA 2R3NA 4F9YA 5BMSA 4X0MA 3T3UA 3NZ0A 1H25A 4KKGA 4AWIA 2GS2A 4GIHA 5GIOE 4BZOA 4TWPA 1IEPA 1GIHA 4KS8A 2OWBA 4TL0A 2XRUA 4MNEB 5JQ8A 4JG7A 3NUNA 3BHUA 2VTOA 2I1MA 5DA3A 4J97A 2W17A 3BYVA 3MGYA 3MI9A 2WHBA 4WRGA 4QYFA 4IVAA 4RVKA 4DN5A 4MK0A 2UW3A 1QL6A 4LOPA 3VONA 5FTQA 4RRVA 5ACKA 3Q52A 3FMHA 5T3QA 3PUFC 1PMEA 3PVWA 1OL7A 3CQEA 3ZC5A 5FUTA 3OOMA 4LRMA 1K9AA 3A7HA 3HRFA 4I94A 4BCPA 4WIHA 3REPA 4DYMA 2WXVA 3FHIA 2YCSA 3PSBA 3U9CA 4JQEA 3CD8A 2CSNA 4QTBA 2W1CA 4FZFB 4EOJA 5GJDA 2J9MA 2BAJA 2C5NA 5E4HA 4IC7A 3EQDA 5JKGA 4YJTA 5AP3A 3CPBA 4BDJA 5IUIA 3LFNA 4L6QA 3R7VA 4YHTA 1P14A 5DRBA 3Q5IA 4Z7GA 4GT3A 3NUXA 4DFZE 1ZY4A 5IQCA 4GRBA 1J7UA 2C30A 5CZHA 3W2SA 3PJ2A 3NW6A 4IX5A 4NTSA 3BE2A 2C0TA 2YIXA 1XH9A 4E6AA 2LGCA 3P08A 3R8ZA 4UWCA 5KMMA 3FI2A 1TVOA 3ULIA 4L67A 4I6QA 2PUIA 1U59A 4C2WA 1LPUA 2G2FA 3ZONA 3Q4TA 4L7FA 4OT6A 1CKPA 4IHPA 4OTIA 4Y46A 4G3GA 3ZLXA 3H9RA 3M1SA 3TKIA 4EL9A 5IPJA 1ZYCA 3QZGA 4C3FA 2ONLA 4FTCA 4O1OA 2GQSA 2YFXA 4WUNA 4IAYA 3HYHA 2V55A 3GVUA 1ZOGA 2PMOX 4B99A 1Q8TA 4QMTA 3NVMB 2QU5A 2RG6A 4U3YA 3MESA 2QOKA 2PL0A 4K8AA 3A7GA 3F5UA 4UALA 3N9XA 5DR9A 3VN9A 1Q8YA 2E9PA 4GJ2A 3ZDUA 2WKMA 3PZHA 3MB6A 3ZO3A 4CD0A 4KBKA 5I9YA 2SRCA 4FKQA 5HQ0A 2WGJA 2WTKB 2B9HA 3D4QA 4XOZA 3O7LD 4G6NA 4WNMA 4DEBA 5BUEA 3AGLA 4HYUA 4BDIA 3BGZA 3I60A 4EH8A 3VIDA 2JDVA 3OD6X 4ZMFA 3RPOA 3MH2A 3ALOA 4FIIA 2JIIA 4DDIA 4MWIA 1UU3A 2HCKA 3ZO4A 2HXLA 2WTKC 3IOPA 4GFGA 5M4CA 3L8SA 4PDYA 2QOHA 2YCRA 3CD3A 3R7YA 3NGAA 3WF6A 3CS9A 4RSSA 4WNOA 5F94A 5K4IA 3NUSA 2DWBA 4FKPA 4YC8A 1BL7A 5J87A 4R7IA 3G6GA 1UU9A 5K5NA 3QQUA 4UYAA 4LYNA 4JDIA 2WNTA 4YLKA 2QODA 4YZMA 1UWJA 3R7IA 3PDTA 2JDSA 4C35A 2XIRA 2WTWA 3LCKA 4AA5A 5HNGA 3OXZA 4G17A 4RJ5A 3D7ZA 5LXMA 2PTKA 2CN8A 2HAKA 2OO8X 3OCTA 2I0VA 5HI2A 4CZTA 4DC2A 4IM0A 4OR5A 5A6OA 3HV6A 2C1BA 5KUPA 4FL2A 4CFNA 3CXWA 3L8XA 2CJMA 4C4GA 2YACA 3E64A 4I5MA 2OZAB 1F0QA 3LXLA 3O51A 2PUNA 5CAUA 1FOTA 1WBTA 4YZ9A 1WBNA 3WZJA 4BC6A 4NIFB 2QO7A 4PV0A 4F63A 3VHKA 4M68A 3ORKA 4F1TA 4BIBA 5M51A 1PRYA 2YZLA 1WCCA 2BAKA 3IGGA 3KU2A 4HPUE 4XV9A 3SRVB 4C02A 3TDVA 1YOJA 4O4FA 3ANQA 1OUYA 2O65A 4O7TA 2GNHA 4QP6A 3CEKA 3DXNA 2VTNA 2XNMA 4RC4A 3CKWA 2XNNA 5BVFA 3JYAA 4BCGA 5FEDA 5ITAA 3SGCA 3WZDA 5JZNA 3ZFXA 3KRRA 3BU6A 4GCJA 1IASA 3DKCA 3Q4UA 4UV0A 5FM3A 3MPAA 2BVAA 4FSUA 4L3LA 4CNHA 1JAMA 5GJFA 3LMIA 3O2MA 5A4QA 1NA7A 3VVHA 5C01A 4MVFA 3CTJA 3TI1A 3Q6UA 3NUAA 5A6NA 4WO5A 5HU3A 2ITTA 2IW6A 4A4OA 4RX8A 5BVDA 2UZUE 4DEEA 5CU0A 2DUVA 2Z7SA 1M2RA 4AUAA 2B1PA 5AP7A 2BPMA 3KL8A 1YDTE 1OL6A 3VUIA 4KKHA 2VZ6A 4BCHA 5J79A 2YAKA 1SM2A 5IQAA 2BDJA 2DYLA 4RMZA 4I6BA 4NJDA 3D15A 3UDBA 4DH8A 3W0SA 5CU6A 4IAZA 2UZOA 4GKHA 4QTCA 5EM6A 4ORKA 1YXTA 3DJ7A 5HG5A 3QFVA 3RPVA 3TCPA 4FZ7A 2XKFA 4ASZA 3ZM9A 1YVJA 2ZM1A 5KMIA 2WTVA 4FOBA 1XR1A 4RA4A 5A46A 4CXAA 3IW6A 3PVGA 3SXFA 4DE4A 3W55A 3MS9A 4OBOA 5E8WA 4Z7HA 4I93A 5DLSA 3Q04A 2OG8A 3AQVA 4ZTHA 2VX0A 5CSHA 4ZJIA 1ZOEA 4QMZA 2HZIA 5DT4A 2GFCA 2YIWA 3ZUVA 2GHLA 3GNIB 4DGMA 4H3QA 3EQRA 2WIHA 4APPA 3TZMA 1DAWA 1O6KA 2YLEA 1Q24A 4MNFA 4RGJA 2GPHA 3O71A 1ZOHA 3BZ3A 1S9JA 4NM5A 1Q8WA 2CKPA 3G0EA 4O0VA 5TO8A 3OF0A 1M17A 4BL1A 2IG7A 4O83A 4BTMA 4D2WA 4YURA 2WMUA 3NX8A 4W8EA 1IAJA 4R3CA 4XG8A 2QG5A 4AW0A 4LGDA 3RP9A 4BGHA 4D9TA 2X7FA 3QCSA 4ONAA 5LJJA 4CMOA 4JAJA 4B9DA 3ODZX 3EB0A 2BILB 2JAVA 4FRFA 4R5YA 4MD8E 4C33A 2BDWA 5CSPA 3GCSA 5KMKA 4E4XA 3G5DA 5EHYA 3DU8A 3TNPC 4C4JA 2OFUA 2QKWB 3QD4A 3FSFA 4MD7E 5CF4A 1V0BA 5FLFA 4DGNA 2W1HA 3NMUF 3AT2A 2UZBA 3DAJA 3Q32A 5AAFA 1G8KA 3VBWA 5IUHA 3QCYA 4RVLA 3GFEA 4TNBA 4BDEA 4DH5A 2CLQA 3DJ5A 4EHZA 3W2RA 3AD4A 4ZLZA 3OEZA 3SX9A 3MY0A 4S34A 4F0IA 3EKNA 2B9JA 4C61A 3IK3A 4I6HA 3O96A 2QOOA 4NJ3A 4YJPA 3QF9A 5GJGA 3PXYA 4D2PA 3ZSIA 4EI4A 2WD1A 3P9JA 4HNFA 3AT4A 5AR5A 3GI3A 4Q9ZA 5IDNA 5FM2A 4AA0A 4QTEA 4F6SA 3ACKA 2JDRA 2YCFA 4I0RA 3LCDA 4J1RA 5D9HA 2W4KA 2QOFA 3HMIA 1KOBA 4E20A 2VWIA 4DFLA 4FIJA 5CVGA 4R6VA 3FI8A 3VQUA 4WSYA 2WMTA 2UZVA 4AA4A 4O0TA 5FWKK 3TIZA 3U6IA 2RF9A 3P5JC 2HENA 2OXDA 1P2AA 4EORA 3PPKA 3RAHA 4JNWA 4GU9A 3VBYA 4R8QA 5F1ZA 3PTGA 4WD5A 4OUCA 5AWMA 2F9GA 3ULZA 4M66A 3OUNB 2RL5A 5HIBA 2XBAA 4IWPA 4MEDA 3TZ7A 3JR1A 2OIDA 4AF3A 5DIAA 5AP2A 2W1ZA 5AM6A 2BR1A 3KEXA 4XBRA 1YOLA 2PSQA 2RSVA 3H0ZA 4QPMA 3PP0A 2H34A 3CQUA 5H9BA 3QKKA 2ITPA 4M12A 4XNEA 3A4OX 3LLTA 2JAMA 1UA2A 2B54A 2VWVA 4HPTE 2DS1A 4ITHA 3PY0A 2V7AA 4PF4A 4I5PA 4QMXA 4ZTQA 3VF8A 4BDBA 1YW2A 3OMVA 2QURA 5AM7A 4DLJA 2CLXA 4B6LA 4UZHA 3KRXA 4AOIA 4L44A 2PVLA 5HICA 4RJ6A 3ZS5A 2UW8A 5ANGA 4FMQA 4UXLA 4PP9A 1NVQA 3NDMA 3NSZA 2X9EA 2BZHB 4NKAA 4WT6A 4ASDA 5IQBA 4OTDA 4QP7A 5DT0A 4P90A 1IR3A 4FVQA 2OK1A 1OVEA 3PYYA 4QYHA 4G16A 5A4EA 5DG5A 3GXLA 3U54A 5J95A 2CKQA 3VQHA 5GIPE 3DNDA 4D0XA 4ITIA 3ELJA 5HLNA 4L3JA 4EC9A 4XEYA 5J8IA 2W7XA 2JBPA 3FMKA 3O23A 2A0CX 3Q9YA 3HKOA 5EHLA 2XNOA 3Q2MA 3S3IA 4GG7A 3WF5A 3ZRMA 2W05A 4RWJA 1UU7A 3QX2A 4X21A 2BFYA 4JT3A 3BEAA 1IA9A 5KMLA 4EQMA 4GH2A 5C03A 3RK5A 3LVPA 1Q61A 4L9IA 3RNYA 1ZARA 2GNGA 3BHTA 3QCXA 4HYHA 3E3BX 3AKKA 4QMVA 4GUBA 5T6KA 5EDQA 2ACXA 3MIAA 5TKDA 2VWZA 4UYNA 5KZ0A 4EOSA 2VTMA 4RBLA 5LVNA 4TWNA 4MBLA 4R1YA 4O7ZA 3GCVA 2ITUA 2R3MA 4EH4A 3GGFA 2CNVA 2CMWA 1XKKA 2OH0E 4IIRA 1G8AA 3BV3A 3NUPA 4CRSA 4J8NA 4YZNA 2JKMA 3WARA 4QYEA 4RJ3A 1MQ4A 4XG4A 3NNUA 2XNPA 3R30A 3QQLA 3PA3A 1OKVA 4TN6A 4C3PA 4RX9A 5HVYA 2B7AA 3RHXA 2W4JA 2BDFA 2X39A 1REJA 4FV2A 4O38A 3PA5A 3K5UA 4UMTA 4AZWA 4BDCA 1V1KA 3LCOA 3R8LA 2E9NA 4XP3A 4PY1A 2DQ7X 3O7LB 3ZXTA 3QWKA 2WFYA 1Y57A 3NEWA 4YBJA 2X6DA 2WQMA 3QZHA 4L68A 5ETAA 3U4WA 4I22A 4C3RA 2XZSA 1IG1A 4EH9A 4HVSA 3MYGA 4TWOA 3IG7A 4RIOA 4ZSJA 2OXYA 4EZ5A 4AXFA 2R5TA 2C0IA 1W7HA 3BCEA 2PZPA 3RAWA 3UTOA 5H3QA 3NPCA 5AUTA 3C51A 3W0NA 4NTTA 3VUTA 1KOAA 3GT8A 4X2GA 3UO5A 3ZLSA 1H1QA 3U9NA 3H30A 2XH5A 5B2MA 2VTLA 5CNNA 4C7TA 4U9AA 3EKKA 3GU6A 4MX9A 2XP2A 2VWUA 4IB3A 4JDHA 2X4ZA 4IBMA 4J52A 5KHXA 4E26A 2G1TA 3FLNC 3JY9A 4KBAA 5EW3A 3LE6A 3QUDA 4U97A 4H1MA 4U6RA 5EQYA 2JC6A 3L8PA 3AGMA 1SYKA 5AAEA 4X2FA 1Q99A 2PUUA 3AC1A 3U6HA 1JNKA 3ZRKA 3GBZA 4RQKA 4U0IA