3UG1A

Crystal structure of the mutated egfr kinase domain (g719s/t790m) in the apo form
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
322
structure length
296
Chain Sequence
EAPNQALLRILKETEFKKIKVLSSGTVYKGLWIPEGEKVKIPVAIKESPKANKEILDEAYVMASVDNPHVCRLLGICLTSTVQLIMQLMPFGCLLDYVREHKDNIGSQYLLNWCVQIAKGMNYLEDRRLVHRDLAARNVLVKTPQHVKITDFGLAKLLGAEEKEYHAEGGKVPIKWMALESILHRIYTHQSDVWSYGVTVWELMTFGSKPYDGIPASEISSILEKGERLPQPPICTIDVYMIMVKCWMIDADSRPKFRELIIEFSKMARDPQRYLVIQGDDEEDMDDVVDADEYLI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Epidermal growth factor receptor
publication title Structural basis for the altered drug sensitivities of non-small cell lung cancer-associated mutants of human epidermal growth factor receptor
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 86
structure length 296
sequence length 322
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2011-11-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3ug1A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3ug1A01
2GQSA 2A2AA 4ZLOA 4L3JA 3MH1A 1OUYA 3LMHA 4JOAA 5C8MA 4E93A 2UZUE 1UKHA 4YJRA 5ETCA 4EUTA 5BUIA 5GJGA 3UZTA 3KULB 1WBWA 3QUEA 2VWUA 3HRCA 4AXAA 1IAHA 3LJ0A 4HZRA 2I1MA 4IZAA 4M69A 5CU3A 4C7TA 3DKOA 3IW6A 4FV6A 3BWFA 4ALUA 2C6IA 2EWAA 3UODA 2V5QA 4U0IA 1AD5A 4TYEA 5EHLA 2YCSA 3U51A 5KMMA 2V62A 3QTXA 3II5A 3TCPA 4DFZE 1Q99A 3AC3A 3NVMB 3WILA 2R2PA 1HCKA 2OO8X 4ANMA 4HOKA 2ERZE 5HBHA 3I7BA 4BDCA 5CU2A 3QU0A 4LRJA 3E64A 1W7HA 4Y46A 4CFWA 1H4LA 2X7GA 3MSSA 4LRMA 3F5PA 1KV1A 2ITWA 4BZDA 3GNIB 3ORLA 3EIDA 3K3JA 3UNZA 2WTJA 4HZSA 5HESA 1IA8A 1R1WA 2JEDA 4NK9A 2W05A 3BCEA 3PXQA 3UPXA 4IC7A 5IA5A 4YO4A 4DGOA 3QBNA 3ACJA 2JIVA 1I44A 4S2ZA 2GNLA 1Q8ZA 1OBDA 2WD1A 4X2FA 4W8DA 3OT8A 3FUPA 4NCTC 4L53A 3R83A 5CSXA 3QYWA 4ARKA 2FGIA 2UV2A 4Q9SA 3ZRMA 2IVTA 4GSBA 2XK4A 2R3NA 2BRBA 4TWOA 2QG7A 2YIXA 4WBBB 2UW4A 3DFAA 5FBNC 3R04A 5I9UA 5CENA 4M8TA 5EOBA 1MRVA 4MHAA 3QX2A 2VGOA 3DT1A 2WMSA 4JBQA 4BCQA 4QQTA 3LMIA 4BY9E 3E8NA 3WE8A 1GJOA 4AS0A 1OMWA 1SYKA 3OUNB 3P08A 3WZJA 4FKPA 5GJDA 4JRNA 3I81A 2AC3A 2X2KA 3PG1A 3LLTA 4GVAA 3TEIA 4O7LA 3RPOA 2CGWA 3HA8A 3TNWA 4ERWA 2OXYA 5CXHA 4HCVA 2C69A 3UC3A 3O96A 3WZUA 4EOKA 5A54A 4ANQA 2GCDA 3PSDA 4JL9A 3DBDA 3W8LA 4BN1A 3CS9A 3SX9A 3VNTA 2I7QA 2B52A 2PUNA 1E1XA 3RTPA 2QOOA 5DIAA 4ASEA 4MWIA 1W82A 5D1JA 4HVIA 1FGKA 4E1ZA 5K5XA 4IX5A 3OG7A 3QQKA 4X3JA 4OT6A 4NEUA 2W4JA 3S0OA 1IASA 4XUFA 4EOIA 5H8BA 4K77A 4FK3A 4QMXA 2BRGA 4FTTA 2E9NA 5E92A 4RMZA 2Y4IB 2XRUA 3TDVA 2R3FA 1XR1A 4RFMA 4XP3A 3DY7A 3CSVA 3A7IA 2QOFA 1IAJA 2BCJA 5D41A 2OSCA 2IJMA 2VWIA 4RT7A 4ZP5A 3VS2A 4BDFA 5IQBA 4PL5A 1YXVA 3GU6A 2XIYA 3BYMA 5DEYA 1UNGA 4N6YA 4E73A 4U40A 4D2WA 5FXSA 3LQ3A 4LOQA 5JMSA 3KULA 5IA0A 1F0QA 2OI4X 3TN8A 1PW2A 4RVLA 3EFKA 4BI0A 2XEZA 4ZSAA 1NY3A 3BI6A 3LFEA 3IOPA 4O0UA 2B1PA 1XHAA 1PXLA 3GOPA 3CE3A 4U79A 4FG7A 3AQVA 4I5CA 4A7CA 1NW1A 3RM7A 4OBPA 3AC2A 4CFMA 5IEXA 5KNJA 4CG9A 3EQCA 2W9FB 1LR4A 2WU7A 3SQQA 3NIZA 3UC4A 4O7YA 3U87A 4HNIA 3QLGA 1OKYA 3DDQA 3IW5A 2ZB1A 3EMGA 5HVYA 3ZFYA 4AW2A 4U45A 1H07A 4AW5A 4NH1A 3AT4A 1YOLA 3HGKA 3PLSA 4USDA 3PE2A 4WUAA 3HMMA 3VUGA 4BB4A 2X9EA 4CG8A 1WVYA 4FZ7A 4D0XA 2VRXA 2OBJA 3PSBA 4DAWA 2UW0A 1MUOA 3HDNA 5LCKA 3R8MA 2RFDA 2W1DA 4PMTA 4EQMA 1KV2A 5CT0A 5BPYA 3SW4A 3WZDA 3IGGA 2R3OA 3MYGA 4E3CA 1ZXEA 3FYKX 3AD5A 5AA9A 4EH2A 5T68A 3PWYA 4ZS4A 1ZYDA 2OH4A 4BBFA 3PE1A 3QCXA 3UVPA 2CNUA 3E62A 4TNDA 2A4LA 5AEPA 1Q3DA 4K0YA 4UX9A 4LL0A 3VUIA 2BKKA 5EYDA 5AR8A 3ZUTA 1Q41A 4G3CA 4J53A 1JWHA 4IVCA 2PVKA 4XG3A 3O8TA 4ZTSA 5FEDA 3WYXA 1YW2A 2XIXA 5AUWA 3UP7A 3VHKA 3KREA 4JIKA 2XVDA 1R0PA 5AX9A 4GK2A 3QGYA 4FL1A 1BX6A 3GP0A 3KXGA 3NW6A 4QYFA 4BVUA 4IIRA 4CV9A 4EC9A 4ZY5A 3LCTA 3VIDA 1XWSA 3LXKA 4E20A 5H2UA 4G31A 3OY3A 3OUKA 2VUWA 2PZYA 5CXZA 4C4IA 1QPEA 3ZLWA 3RAIA 3DTCA 3G0FA 3HV7A 4E6AA 4IEBA 4DC2A 5FEQA 4EK6A 2BALA 4YJVA 2QO9A 3HL7A 3FQSA 3P7AA 4MQ2A 3RCDA 4E5BA 1OL7A 5A4LA 5AAGA 3OTUA 3N4TA 4YR8A 4WKQA 4G5JA 3RJCA 4RC2A 4G3DA 3A62A 3TV6A 2H96A 2Y8OA 4O96A 3FQEA 4YLLA 1BUHA 4ZMFA 2VTQA 4AW0A 4BDAA 3MGYA 3KXNA 3HV5A 3H0YA 3P4KA 5C27A 4DH3A 2Z7LA 2W7XA 4O7RA 5EDRA 5BUJA 1JNKA 3MIAA 5LVMA 3V04A 2PE1A 1JLUE 1MQBA 5E91A 2WELA 3S00A 4FKGA 4D55A 2X7FA 5FP6A 5CANA 5E8VA 4Z7HA 5D7VA 3E3PA 3LCSA 3RALA 4QMZA 3A99A 1JSUA 1ZOEA 2X8EA 3Q4CA 2OKRA 2JBPA 5AUTA 5B7VA 2C5XA 2GHLA 3BE9A 2ZVAA 3BX5A 3S95A 4UN0C 5HHWA 4U42A 4BCIA 2UZLA 3OCSA 5F9EA 4M0ZA 1PYXA 4RC3A 4ENXA 2CDZA 2GNGA 3MB7A 5DE2A 2VAGA 4U81A 3MFUA 4QP2A 1BLXA 1R39A 4GU9A 1JVPP 4BIDA 4R78A 3MY5A 3C5IA 2I6LA 3GC0A 3L8XA 1PHKA 1FMOE 2BHHA 4R6VA 3ZZWA 1HCLA 5DLSA 3UP2A 3U6JA 4I0RA 4CEGA 3EKKA 3U9CA 2GFCA 3MY1A 4QP7A 1ZRZA 3B8RA 3KVWA 3MH0A 3R1NA 2DYLA 2C6EA 5A3XA 4MXXA 5M08A 4WRSA 2OIDA 5LMKA 3D7TB 4ANBA 1UVRA 5AM7A 5IA2A 3EN9A 3BV3A 4XV2A 3BPRA 3KA0A 3FZTA 3FSFA 4NW5A 5HE1A 1GIJA 2GNHA 3R73A 2PHKA 2VTAA 5CT7A 3RBWA 2AYPA 4CFVA 4GT4A 4ZZMA 4BHNA 3UOHA 3Q6WA 3PIZA 4TTHB 2HYYA 3WZEA 5LJJA 3A4PA 3IDCA 5LVLA 5TR6A 3O7LB 2G2HA 2PE2A 4O91A 3QCSA 3FZOA 4GIIA 5HE3A 4OTRA 2J9MA 4GW8A 1I09A 3SHEA 1J1BA 2X81A 4WNKA 5DGZA 4BDEA 5GHVA 1H26A 3BHYA 3QLFA 4J95A 5AAFA 3RZBA 2HY0A 3AC1A 5KBRA 3DGKA 3E5AA 3MJ1A 4FV1A 4OAVB 1OIYA 4IJ9A 2GSFA 2YITA 4AE9A 4E6CA 4ZLZA 2JDTA 2XK3A 3SW7A 1ZMUA 4XV3A 2W5BA 4TRLA 4E4XA 3R1SA 4DG3E 4DFYA 4K1BA 4IQ6A 4U3YA 3DLZA 3U55A 2VTOA 4K9YA 5J79A 4WBOA 5AR2A 1RJBA 4XV1A 5K0KA 3ZO2A 2QOCA 4I0SA 4FSUA 4NFNA 4JT3A 3KRJA 2XEYA 4MBJA 1IG1A 2GU8A 2WXVA 5FG8A 5L2IA 4I22A 3D9VA 3EFJA 4QYGA 3RM6A 2X8IA 1PMUA 5E90A 3W1FA 2EU9A 4Y8DA 5M55A 4TYHB 4YJUA 4EH3A 2OW3A 1J7LA 2B9FA 2VO0A 1YQJA 1QL6A 3PRIA 4X3FB 2PVMA 4YNOA 3SG9A 2XBAA 2UZDA 1VYWA 4FTOA 3LQ8A 4QTAA 4RFYA 4ZSLA 5HZNA 5JGBA 2XNNA 4APCA 2YEXA 2CN8A 3P78A 5CVHA 1V1KA 4G9RA 3HKOA 5FXQA 3RWQA 4C34A 4PDPA 3JR1A 4EH8A 3HRBA 3PIXA 4F7JA 1SNUA 4PPCA 5E8XA 1X8BA 2VO6A 5A46A 2JIUA 2WTDA 4FOCA 4YTCA 4EBWA 3ROCA 1Q62A 1BI8A 1KOBA 3VJNA 4O0XA 3GC7A 4TW9A 5EW3A 3QCYA 1L3RE 2VWZA 4FZDB 4AN2A 3QWJA 4W4XA 4XBUA 4BBMA 4EKKA 3FLNC 4CV8A 2YM5A 4FG8A 2AC5A 2ITOA 2OXXA 2ZV9A 4O7ZA 5EKNA 5M53A 3E92A 2GS6A 5IEVA 2WQBA 4DE4A 4IBMA 4YGAA 3VN9A 4XG8A 2JAMA 2ZM1A 1ND4A 5KMIA 3W2OA 5LVPA 2BPMA 2UVXA 3ROYA 4OTPA 3EYHA 3W8QA 1O6LA 1KE5A 2J51A 3CY3A 5KHXA 4M12A 4GMYA 2JDOA 2VZ6A 3SXRA 3D7TA 4RIOA 3NUXA 2CSNA 2YDIA 4JG7A 2QD9A 3FJQE 5E1EA 4UMTA 4A4OA 4BYJA 4D9UA 4Y73A 4JR3A 4XRLA 3COKA 3IDBA 4GK4A 4I6FA 5EW8A 5EYMA 3I60A 4EK4A 1Q97A 3BYVA 2UZTA 4MD9E 2PYWA 3H9OA 2G1TA 4TL0A 3ZDUA 2WU6A 4IX4A 2F57A 1H8FA 2JKMA 4H05A 4DFBA 2GQRA 2WNTA 1M7NA 4UEUA 4X2JA 3COMA 2HCKA 2Z7QA 5F4NA 4AWIA 5CAQA 1UU7A 3HA6A 4YZDA 5EW9A 5GINE 2R3LA 3I7CA 4FV9A 4MBIA 1XBBA 2OXDA 3V5PA 3D5VA 1H27A 2BVAA 3LM5A 4HNFA 2QODA 3RAWA 4EK5A 3LM0A 2I40A 3LFAA 2C3KA 2VGPA 1H0WA 1XH9A 2W1FA 2UZBA 2QR8A 4QMTA 3DS6A 4P5ZA 1WBOA 4NKSA 3GCSA 1WZYA 4N6ZA 2NP8A 3IG7A 1UNHA 3FHIA 1FVTA 3OOGA 4JX7A 5D10A 5I9ZA 4GUBA 3HVCA 1APME 4KIPA 5IH4A 4FVRA 3SKCA 3OW3A 5CEQA 2GNFA 1OIRA 2WMRA 2ONLC 4JDJA 4LFIA 4LYNA 4MF1A 4C4FA 3CTHA 2UVYA 3Q6UA 4K18A 3C4CA 4GYIA 5TF9A 4O0TA 3NCZA 3KVXA 4ZAUA 3I5ZA 3V5LA 5ACKA 4BWXA 5CI6A 2YCFA 2E9OA 3EN4A 4IFCA 4KKEA 2G15A 2CHLA 4I5PA 4DITA 2QHNA 3W16A 4CZUA 5BQ0A 3CP9A 4CKRA 3IW8A 3Q2JA 3UQGA 4D1XA 4IM0A 4H1JA 4TYHA 4I41A 1RQQA 2I0HA 4GCJA 3VBVA 4C57A 1F3MC 3RPYA 3P0MA 4L00A 3KK8A 4X3FA 3V01A 4CSVA 4PUZA 4F9CA 5LVNA 4XEYA 4TKSA 4DT9A 4LUEA 4MNEB 3G51A 3ORKA 2BROA 5FGKA 3VUKA 2YM7A 4BHZA 1OI9A 4QNAA 3R8LA 1E1VA 3MI9A 3CBLA 3MVHA 2UW3A 3QTSA 1XH5A 4AN9A 3KMMA 5M09A 2JFLA 2DWBA 4O6LA 4EBVA 5AUUA 2CLQA 3EQIA 4FG9A 5F20A 4OTIA 5D11A 2XKDA 4GG7A 2W4KA 3PJ2A 3ANRA 3ATTA 2QHMA 3OBGA 3NNWA 3VS3A 3C4WA 1H1QA 5FWKK 1JPAA 2JDSA 4X21A 4DA5A 4OBQA 4XOYA 3F5UA 4YBJA 4RX5A 2C3LA 5A14A 2EB3A 4R5YA 3CGFA 5ANGA 4CMUA 2GDOA 2VTLA 1P4OA 3PIYA 3FZRA 1PMNA 3VW8A 3ZLSA 3HZTA 3RHXA 1VYZA 1XJDA 2XYNA 2YA9A 2WIHA 3GC8A 3LAUA 3Q4UA 1VEBA 3PPZA 5AP1A 5L2QA 2XIKA 3R7EA 3OTVA 3DNDA 3PY3A 2YWVA 3P23A 2VNYA 3QCQA 2YABA 3LFDA 1RDQE 4OTWA 4ZK5A 5C8KA 1M52A 1LEZA 2WOUA 2PMOX 2W1GA 4R7HA 2WZJA 2BIYA 1FINA 3OXZA 3PXKA 4NFMA 5HD4A 3PJCA 5FQDC 3R01A 2UZNA 3C51A 1VR2A 3TIYA 5KMOA 1OVEA 4BZOA 2OF4A 2YISA 3OWKA 3DB6A 4M3QA 2PVJA 4UXLA 2RGPA 3UZPA 4E7WA 5KHWA 4I4EA 1FBNA 3HAMA 3QWKA 3TV7A 1DAWA 5CSHA 4RBLA 2W1IA 3RAHA 3TZMA 5LXMA 2ZOQA 3PXRA 1WBNA 2PZIA 4ZOGA 2PVLA 4FK6A 5IQEA 5J9YA 4DGMA 3RGFA 3LFQA 4JAJA 4W9WA 3AT3A 1NVSA 5DT4A 1JKLA 3KMWA 3VHEA 1PMVA 3TKIA 4KAOA 4HVSA 1MRYA 5FM2A 4XP0A 3CIKA 4MH7A 4BCGA 4O83A 4GJ2A 3KF4A 4FI1A 3PWDA 2KULA 1QMZA 4FTAA 3FEGA 2RFEA 4YJOA 2QC6A 3R9OA 4G2FA 5GJFA 5AX3A 4BKZA 4IB1A 3N51A 3QF9A 3JPVA 3DLSA 5EQEA 5KBQA 5J1WA 5JGAA 2FYSA 3NDMA 5EYKA 4FGBA 3R9DA 3UOKA 1JKSA 3EQHA 4EQUA 4CTBA 2GQGA 3ORMA 4H39A 5BVDA 2ITUA 1WBPA 2WHBA 4C02A 5CF8A 2UVZA 5IA4A 4L67A 5LOHA 1XH6A 3OCGA 2C5OA 3B2WA 4IAIA 1TQMA 1Q8UA 3UZRA 4MBLA 4EOPA 3VBXA 4M68A 3WF8A 4S31A 4JNWA 2YZAA 5JT2A 3CQEA 4RWKA 5CEOA 3VAPA 4FSWA 5AV4A 4O82A 4IZYA 2VU3A 1IEPA 3MFRA 3HUBA 4QMWA 3POZA 4OTDA 1M2PA 3DXNA 4J99A 5I9WA 3MVJA 1UV5A 2C4GA 4NM7A 2ITTA 4MNEA 1JSVA 2WMQA 3OT3A 3PVGA 4PMPA 5LVOA 4NTSA 4FKWA 5HIEA 3CEKA 3LZBA 4NU1A 4AP7A 3DTWA 2I0VA 4G1WA 1O9UA 5FUTA 2O0UA 4M15A 5EDPA 1XBAA 2O8YA 2R0UA 2WMUA 2OJGA 4C58A 4RX7A 4ZTLA 5E8SA 4FL2A 1ZLTA 4M97A 3U8WA 1SVEA 3DCVA 4PP7A 5EM5A 2YDJA 4ZS0A 5EI2A 2E9UA 3FV8A 4V0GB 4WNPA 4J7BA 4C4EA 3EL8A 4F0IA 4NWMA 4DFXE 2PZPA 3C4EA 4CFUA 3GU4A 3OP5A 5CNOA 5HE2A 1OKVA 1J7UA 4N4SA 3CXWA 3FLQA 5IQGA 1OL2A 1P5EA 4JDKA 4QPSA 3TL8A 5M07A 1XO2B 4LMNA 1M2QA 2ZV7A 3UPZA 4UY9A 4RJ6A 4MVFA 4KIKB 3H9FA 4R7BA 5B2MA 5JGDA 1PXPA 2QOQA 3ETAA 3UYSA 1OIQA 4B9DA 3P79A 3EKNA 5AV2A 3VUTA 4TYGA 3SV0A 3KY2A 4U8ZA 4IHPA 3TKHA 4IANA 4O2ZA 4PDYA 5EI6A 4ASXA 5KUPA 4QMPA 4JS8A 2W9ZB 5B0XA 5EQYA 2FA2A 3UQFA 3N9XA 4DH1A 3RAKA 3PVUA 3ZSIA 3VBQA 3VBYA 4FV0A 4F1MA 3PPJA 4FV7A 2QOIA 5IDPA 4U5JA 4RVTA 4OBOA 4B4LA 2JAVA 4W4VA 4U41A 2PUPA 3ZSHA 4BCMA 3NZ0A 2R3MA 4IM2A 4FNZA 5DH3A 4HPUE 3NGAA 5J1VA 4EOQA 4ZSGA 1CMKE 3JUHA 4NTTA 5BVWA 1YDRE 3COIA 3P1AA 2G01A 5JQ8A 3R2BA 2WQOA 4FSNA 2HZ4A 1U59A 1YWNA 4KA3A 1OL6A 5DRDA 2PVHA 4PL4A 2CNVA 2XIZA 1EH4A 2CGVA 1B39A 2VTTA 4YPSA 3H30A 1IRKA 4AQCA 2B4SB 1GY3A 2BRHA 2R3PA 3H9RA 3OEFX 2BTRA 5HO8A 4CFXA 3TNQB 3E8EA 4QTEA 4FICA 3C7QA 2IZRA 2OFVA 3CPCA 3N4UA 4EWQA 2PVFA 5G1XA 4ANSA 2HZNA 5JH6A 4QP3A 2XM8A 4PRJA 3G9NA 4EONA 3DZOA 1SZMA 2Z2WA 3Q52A 3QQGA 5HNIX 1PXOA 5GZ8A 5BMSA 3L8VA 4R3CA 3CKWA 2NRUA 3H10A 4FKIA 3NLBA 4QPMA 1YVJA 5AUZA 1R78A 3Q4TA 3QRJA 3Q9ZA 4KNBA 4QTDA 4TT7A 4F6SA 1G5SA 4RFZA 4FZAB 4CMTA 3OZ6A 3WE4A 4ACCA 2JKKA 4J97A 3C9WA 2YLFA 4H3QA 4BF2A 4RGJA 4AZTA 2YIYA 4BC6A 4Q2AA 4FKQA 3O23A 4YZNA 3W2CA 4O22A 1H1PA 2ITZA 2JBOA 3BLHA 4KRDA 3QKLA 3SA0A 3ELJA 2OK1A 3CTJA 2P33A 3RKBA 4NT4A 4FEUA 1H0VA 5KE0A 3K5UA 4C4HA 1SVGA 3KU2A 2I0YA 3PSCA 4FUYA 5C4LA 2B53A 1ZMVA 3F3ZA 3O7LD 3PJ1A 4IFGA 2FVDA 2WTVA 4OR5A 4V0GA 5I9YA 2VTMA 4LOPA 3G0EA 2X0GA 1FVVA 3TZ7A 4EUUA 5J7HA 1FPUA 1Z5MA 2QOKA 3OWJA 2A1AB 5DWRA 4ITJA 4WUNA 3WZKA 3ZSGA 2VD5A 5IMEA 4RZVA 3A7HA 4Z16A 5DHJA 4E5AX 3COHA 4YURA 3MDYA 5CQWA 4FNXA 5EHYA 3F5GA 2JKOA 3NYOA 3FLWA 4ZJJA 2H6DA 4DBNA 1NXKA 3OCTA 3Q9WA 4QTCA 4O7TA 1GZOA 1J1CA 4KIOA 2PMIA 1B6CB 3FPMA 4RPVA 4YHFA 5M4IA 5EI8A 4KIKA 4UZDA 5L2TA 4F64A 3OHTA 4PDSA 4HYUA 1K2PA 2E9PA 3ZEPA 3W2RA 4IB5A 4HYIA 5LWMA 4F63A 4TZRA 5CZHA 4F4PA 4ASZA 5BUEA 5AP4A 4EC8A 4LM5A 4M84A 2VTRA 2O5KA 3V5WA 5C03A 3MWUA 2DQ7X 4L45A 2Y0AA 4J52A 5T3QA 4NCTA 3NPCA 3MFSA 3VQHA 2O65A 4FUXA 4ITIA 4LGGA 4AG8A 2GTNA 4WSQA 4YU2A 4NW6A 2R7BA 2ZV2A 2R64A 2WEVA 5EG3A 4AZVA 3HLLA 4DLJA 2GPHA 5E7RA 1LP4A 1WBSA 3KL8A 4GG5A 4MAOA 3V8SA 2VWVA 4RJ5A 1G8AA 4FNYA 5L2SA 2EVAA 2XKFA 3FZSA 1KOAA 5E8UA 2VTJA 3ZXTA 5GIOE 3GFEA 5KZ0A 2G9XA 4I93A 4DH7A 5A6OA 4YJSA 1VZOA 2DUVA 3QRKA 2PULA 2E9VA 4WSYA 5KMNA 4YHTA 1U4DA 4TYIA 5DA3A 3LKMA 3GC9A 5FDXA 3WF9A 4RG0A 2HY81 2XK8A 4KSQA 4QYYA 4BCOA 4D2VA 4R1VA 1ERKA 3M2WA 4QMNA 5D7AA 1OECA 1H24A 3FY0A 2Z7SA 3UJGA 5BYZA 4YSJA 4KS8A 3LFFA 4KRCA 5K5NA 4ANNA 2W06A 4XMOA 3NIEA 3RPVA 4QT1A 2YIWA 5E8WA 2VX1A 3VS1A 3EN6A 3ZZEA 1XQZA 1SNXA 4LMUA 2PTKA 2IN6A 2ITYA 2QG5A 2VTNA 4MK0A 4E6QA 3QHRA 3C0IA 4IX6A 4MYGA 4GYGA 3ULZA 4D58A 4EOJA 1YHWA 2WQEA 3C4ZA 1T45A 3ALNA 3D5XA 4D4RA 2P2HA 3D2KA 2UZOA 3Q53A 4PTCA 1H1SA 3O8UA 2J0LA 4QRCA 2OFUA 2WMWA 1BYGA 3TZ8A 1GZ8A 5BVFA 5JRQA 3DK6A 4N57A 2WB8A 3AT2A 3PPKA 3GT8A 3LE6A 1M7QA 5CI7A 5ANOA 1UWJA 3Q60A 4GIHA 2PU8A 4O81A 3RMFA 3ZRKA 5CU4A 2C0TA 2CKEA 3F82A 3PUPA 4YTHA 1PXMA 4L44A 3VS6A 3BEGA 4AGCA 4G17A 3R7UA 4AT4A 4O21A 4BDGA 5DBXA 4JR7A 4CFNA 5ETAA 2WGJA 1JKTA 4YMJA 3QXOA 4QMLA 4B8MA 1ZZ2A 2YM6A 3OBJA 3F69A 2WOTA 5AWMA 3OVVA 5HG5A 5JRSA 1PRYA 1OUKA 2IZUA 4IXPA 4EHZA 2VTSA 5ANEA 3QL8A 4R8QA 1U46A 3ITZA 3GB2A 5AAEA 1REKA 3QUDA 3HRFA 1HOWA 2F7EE 4B6LA 2YACA 4D1ZA 4E6DA 3H4JA 1AGWA 3EYGA 4JBOA 5AV0A 4IWQA 3K2LA 2WMTA 3NR9A 4EZ5A 4H3PA 2YLEA 3DBFA 4C8BA 3U6IA 4A9UA 4IC8A 2UW5A 1ZYCA 3NRMA 4ACDA 4AE6A 1Z57A 4FIGA 2CN5A 4LGDA 4WA9A 4APPA 4S30A 1L8TA 2Y4PA 4GEOA 4V05A 5FLFA 1NVQA 2HZIA 1WMKA 2RG5A 3O17A 1OM1A 4DEIA 2J0JA 3LW0A 5D9HA 4EHEA 5TOZA 4EJNA 5IQFA 3B2TA 1UNLA 3E8DA 2PZRA 5E8ZA 4DFNA 5M51A 4GUEA 4JBPA 3KRRA 3IGOA 4L01A 4OT5A 3VC4A 3VWAA 1Y57A 2WMXA 2WTKC 5IU2A 3E63A 4NZWB 2ZMDA 4XJ0A 4C38A 5FD2A 3C4XA 4YBKA 2B54A 2W1ZA 5FTQA 4F65A 4ACHA 5CTPA 3BHVA 4I5MA 4G3EA 3KXZA 5DR6A 2JLDA 2BIKB 2J0KA 3CCNA 3A7FA 2OJ9A 4D1SA 3UVQA 4C0TA 3MVLA 1H08A 3EN5A 3ODYX 2IZTA 1V0PA 3HUCA 3RVGA 3A2CA 1OITA 4FA2A 1G3NA 1H28A 1KWPA 1QPCA 3V8TA 3DBQA 5CVGA 1PXJA 3PRFA 2PZ5A 1RW8A 3SXFA 3MTLA 3VRYA 3VUDA 4EH6A 3HMNA 3FMJA 2B9IA 3PYYA 5ANJA 2PSQA 4IVBA 3C1XA 3LJ1A 4BCHA 2CCHA 3FZPA 3AMBA 3TUBA 2XJ0A 4L46A 1ATPE 3KQ7A 4NIFB 3DQWA 5LCJA 1ZY4A 4MQ1A 3W18A 2O2UA 4UXQA 4QMQA 3QXPA 4UMPA 2CMWA 2X9FA 1CSNA 2JD5A 3FMKA 4LUDA 1KE9A 4ZIMA 3U9NA 4II5A 4C3PA 4EH5A 4F1OA 4ZTNA 3F66A 3UIBA 4ZMEA 4X2NA 3IW7A 5ANDA 4OW8A 3F2NA 2YM4A 2ITNA 3ACKA 4FC0A 5AUXA 3EQDA 4DINA 2WO6A 2JDVA 3ZC5A 2W1EA 3CJFA 4YHJA 5BYYA 2EXEA 2XZSA 4CNHA 1Y6BA 4DGNA 5FEEA 3W2SA 3R71A 2QI8A 3BV2A 2OZAB 3KKVA 5E8YA 2QVSE 2J5FA 4YJPA 3T8OA 5HO7A 2W99B 5LWNA 4FTIA 3DAKA 2BDJA 1Y6AA 3ORZA 1V0OA 5EH0A 1J91A 3ZFMA 4O6EA 3SAYA 3LXPA 3JXWA 4CZTA 4AZFA 4EOOA 2YIQA 2B55A 1GOLA 1U5QA 3C0GA 4G34A 4P5QA 5KMJA 1BI7A 4BTFA 1JQHA 4F9AA 4OAUC 4XS2A 3FMEA 5IDNA 5KMLA 4BDJA 4BIEA 3DV3A 4E8AA 4TWPA 1YHSA 1RE8A 3JVSA 4XHKB 4U43A 3RNIA 1OKWA 4F9BA 3WF7A 3QD2B 3FDNA 4NJDA 3S4QA 4PQNA 1YWVA 3QA0A 4YTIA 2R7IA 3E3BX 2J50A 1YXXA 2W17A 4RWLA 4NUSA 2XJ2A 1H01A 5CU6A 3G6HA 2C0OA 4XLVA 5FTGA 2JDRA 1R0EA 2ZJWA 4K2RA 1FQ1B 2UW7A 2WMAA 4JX3A 2Z7RA 3MIYA 4KKHA 3MPMA 1B38A 4QOXA 3T3VA 2H8HA 4BCJA 2CGUA 3TDWA 1KUTA 4BDBA 2I0EA 3OCBA 4TPTA 3THBA 5IMXA 3FI8A 4HYHA 2OJJA 2UZWE 2C3JA 3BQCA 3EZRA 3SLSA 2XCHA 3VBTA 1WBTA 3EB0A 2J6MA 4RVMA 5AP3A 3CD8A 4FKJA 4IADA 3LCOA 4UWBA 4MXCA 5FTOA 2A19B 4QMOA 3EWHA 5DPVA 5J5SA 4JAIA 3Q04A 3ZHPC 1NT2A 5CU0A 4JXFA 1UWHA 3QX4A 3ZM4A 3KRXA 4AGDA 3OROA 4FTKA 4JJRA 1OPLA 1CKIA 2VN9A 3U4WA 3FZ1A 3VW6A 5FDPA 4OTGA 4U80A 4DG0E 3PXFA 5JFSA 4R3RA 3QQJA 3GXLA 3VQUA 1DAYA 3VF8A 4BI2A 4E26A 2YZLA 1URCA 1UU8A 3CC6A 3I1AA 1Q3WA 4BIBA 2VX3A 4Y5HA 3MPTA 3I79A 5HTCA 1GZNA 3HECA 5CSWA 2QU6A 4IAFA 4XX9A 4Y85A 4DTAA 1SMHA 4MXZA 2BILB 5C8NA 5AADA 2ETMA 3UNKA 1VJYA 4E4NA 2C3IB 1ZAOA 2XNBA 4YO6A 5BNJA 4ZTQA 4CYJA 3D94A 3G90X 4AT5A 2CKPA 4NIFA 2V7OA 3TNPC 4KD1A 3BWJA 4FL3A 4XOZA 3W55A 2BZJA 3C50A 5CWZA 4NYEA 4W4YA 3QC9A 4EOMA 4YLKA 4DCAA 2HW7A 3CQUA 4J98A 4JQEA 5D12A 5CLPA 5HORA 5DNRA 2YAKA 3R8ZA 1YOMA 3NWWA 3TTIA 2QOBA 3KK9A 4FT0A 3FMLA 4OLIA 4G16A 3ANQA 5A9UA 3FXXA 5HCYA 3ZONA 5HCXA 4EZ7A 5IUHA 5CVFA 2ZMCA 4KSPA 4GKHA 1CKJA 5M4CA 3NUNA 2XK7A 3UG2A 4UWYA 3GCPA 5FBOA 4TN6A 3QD4A 4M7IA 4RJ4A 3QTUA 2WTCA 4KB8A 2VWWA 2ZDTA 1OZ1A 4AFEA 4QMSA 5GIPE 3DDPA 1M14A 4IZ7A 5IUGA 2QONA 3POOA 3F3VA 1F5QA 4GK3A 2QNJA 3N4VA 4YTFA 2RFSA 4CLIA 3F9NA 2UW9A 4MD8E 4DHFA 3KMUA 4F9WA 2DS1A 1JKKA 3PG3A 2RF9A 4E5WA 3LQ5A 4IAYA 4C33A 4YJQA 5H8GA 1ZMWA 4NSTA 4YLJA 1Q8TA 4CKJA 4FMQA 5HOAA 4EORA 4C2WA 1H25A 2HK5A 4FR4A 4RIYB 4RC4A 1XH7A 4RWIA 5J7BA 4H3BA 1OIUA 1PKGA 4DF3A 4BZNA 4Z7GA 4OTQA 3UQCA 4HYSA 3ZYAA 4C4JA 4DEDA 4U44A 3O50A 4ZJVA 3TKUA 1ZWSA 2F49A 2PY3A 4DH8A 4D0WA 1M2RA 1OL1A 4ID7A 4XBRA 4AX8A 3Q32A 4RX8A 3ZU7A 4ZSEA 2ITXA 3F7WA 5LMBA 3CD3A 4IB0A 4U7ZA 4W9XA 1DM2A 4O1PA 4X7QA 4DEAA 2QO7A 3C4FA 4QPAA 3MJ2A 3EQRA 3BGQA 3GGFA 4ZTHA 3SD0A 1G8SA 1PXKA 2YN8A 3JVRA 2FSOX 4ZJIA 5HTIA 5HGIA 1TVOA 2R3KA 3R1YA 5CY3A 3TNHA 1DI9A 3QRTA 5AM6A 1ZYSA 4JLCA 4F09A 3Q4ZA 1YWRA 4XCUA 3NW7A 3WIGA 4O0RA 3AC8A 1YHVA 4FEQA 4O86A 2WQMA 2YCQA 3PA5A 4C37A 1YKRA 5AV1A 4DLIA 4DYMA 4YZCA 3AD6A 3MA6A 5TKDA 2UZVA 4XLIA 4DEHA 5DRBA 4WHZA 4DGGA 2BFYA 3IDPA 2FB8A 3CKXA 4CXAA 1CM8A 4FGRA 3EH9A 4H58A 4YC8A 5IQHA 3WOWA 3O71A 1IA9A 2OJIA 5CZIA 5J9LA 3NUAA 1MP8A 1FMKA 2B7AA 4R5SA 4Y95A 4DBXA 4I6BA 3QQLA 3GCQA 2ONLA 3P5KA 4FTCA 3BBTB 3QALE 3RCJA 5IQCA 4L6QA 2YJSA 5EOLA 3EFLA 2XNMA 4EK3A 3RPRA 2P0CA 4FTJA 4MF0A 4P2KA 1WVWA 1Q5KA 3OY1A 4BCKA 2R0IA 3MH3A 1LEWA 1PY5A 1QCFA 4N70A 5BYLA 4FT3A 4IAKA 5EM8A 4A9RA 4C2VA 2RL5A 4DFLA 4MTAA 3LMGA 1K9AA 5A6NA 1Q24A 4O7NA 2YFXA 3LFSA 3MVMA 4AUAA 4WOVA 3DU8A 2ZM3A 3DOGA 4FYNA 1OPJA 5BX0A 3RP9A 3C5UA 5E9EA 1KE6A 2XNGA 5I3OA 4ACGA 3GI3A 4F99A 5M44A 4H36A 2X7OA 3ZTXA 3ZRLA 1W98A 2C5VA 4M69B 4F6WA 4QMVA 2OLCA 2OZOA 4F6UA 4QP6A 2PMLX 4PP9A 4QMUA 5KCVA 2KTYA 3V5QA 3PY1A 3BU6A 3T9TA 5A4EA 4UMRA 2WIPA 4S32A 3I4BA 2ITQA 4O0VA 2B9HA 3Q9YA 2EB2A 3EOCA 4OTHA 1XBCA 4USEA 5ITAA 5E4HA 3V6RA 4MCVA 1U5RA 4ENYA 3DAEA 2HOGA 4Y83A 1OPKA 4LV8A 4DGLC 5IQIA 3FAAA 2PE0A 4JI9A 4CMOA 3S2PA 5DVRA 2QKRA 4U3ZA 2GTMA 3SVVA 5BMMA 1GNGA 4U9AA 3VS7A 3PP1A 4RIYA 3L8SA 5HICA 1ZY5A 2EUFB 2BTSA 4FZFB 4KKGA 4HW7A 4USFA 1ZYLA 4BCFA 4J8MA 1Q61A 2J7TA 2YERA 4EEVA 3D14A 3R02A 4AA5A 4PPAA 3W2PA 3MESA 3FL5A 2PUIA 3FMMA 3TUCA 5JFXA 3DJ7A 4GFOA 4NKAA 5K4IA 4FV4A 5IQDA 1ZOHA 3L9MA 4UMUA 3R63A 3NMUF 3AXWA 4NJ3A 3DBCA 4XRJA 4AFJA 2FSLX 3LHJA 2P3GX 3A8WA 1QPDA 3VJOA 2Z8CA 2J90A 4D2TA 3F61A 2J0IA 3VF9A 3HMIA 5DN3A 2GNJA 5IKWA 4HGTA 1CDKA 4PMMA 4EK8A 2R3GA 2XP2A 5JFVA 4F7SA 4PY1A 4G6OA 4CRSA 4YZMA 5IG1A 3O0GA 3HMOA 4HVGA 3W33A 4AT3A 3UMXA 4BI1A 4O27B 3NEWA 3PY0A 2IZSA 2VTIA 4BR3A 2YM8A 4FX3A 2R3IA 2UUEA 4ITHA 5I9VA 4NM0A 4RWJA 2RFNA 4AZEA 2NPQA 4RLKA 1A9UA 3F88A 4RZWA 5EHOA 4B7TA 5C01A 3EJ1A 4HGLA 3ALOA 3BZ3A 4FIIA 4V04A 5E8TA 5HVKA 2BAKA 4O0SA 1JAMA 3ZO4A 1S9JA 4A4LA 4AZSA 5HVJA 2X2LA 3ZC6A 2F4JA 5EK7A 4Q9ZA 3VBWA 3B8QA 1J7IA 4CKIA 5HG8A 2LGCA 1YXTA 4O1OA 2W1HA 5JSMA 4DCEA 5ANKA 4M13A 3R7IA 2X4FA 3OXTA 4LV5A 3UIUA 3E93A 4X6QC 2GFSA 5TE0A 2HAKA 1OB3A 4FKUA 3DZQA 4IDVA 4K11A 4RJ8A 3UNJA 4CT2A 4V01A 2ERKA 4I0TA 4GKIA 2HENA 2OU7A 4XG9A 3DK3A 4BKYA 3PZHA 3BE2A 4I4FA 3ZCLA 3RI1A 5F94A 1BMKA 2WAJA 4O84A 4K33A 5LMAA 4DH5A 4QP4A 3R8UA 3S3IA 2QQ7A 3UMWA 5DT0A 2GNIA 4O0YA 2FUMA 2BRNA 3UGCA 5KMKA 1GIIA 4M14A 3PVWA 4FKTA 4I20A 4UWCA 5AP7A 4FE2A 2IVUA 3ZLYA 4RA5A 4RRVA 5IPJA 5JQ5A 4RIXB 4ORKA 3KXXA 3FLYA 2RIOA 3R1QA 4EOSA 1XH8A 4FNWA 1A06A 1V0BA 3QTIA 2WEIA 3IECA 5I4NA 3D5UA 2BDFA 4WD5A 3OW4A 4FT7A 4Z9LA 5GNKA 3H3CA 4FSTA 3MS9A 3Q9XA 3FC1X 2NRYA 1UU3A 3ORPA 3R6XA 3KRWA 4A9TA 4FT9A 5HU3A 1XKKA 3GQLA 3EZVA 3L9NA 3PJ8A 4FKOA 3Q2MA 3DJ5A 3KF7A 3RPSA 4S33A 3VVHA 3NW5A 4D5HA 4JG6A 3ZS5A 1A48A 4FTRA 4RSSA 4I6HA 5B2LA 5HX6A 3DPKA 3ET7A 1DI8A 3IONA 2Y9QA 3G6GA 3M42A 4FKVA 2X1NA 3WYYA 5B2KA 3BU5A 4UYAA 4RX9A 2XUUA 1M17A 2C0IA 2VO3A 3UO5A 3REPA 5DT3A 4FEXA 3R22A 2WMVA 3BELA 3HX4A 3D2IA 2CLXA 3KXHA 4GT3A 3QAME 4EJ7A 5CEPA 4HVDA 3AMYA 5IA3A 4F0GA 4TYJA 3DXQA 3ORNA 3PA4A 5J87A 1PF8A 4WG4A 4K6ZA 3GCUA 4KS7A 4WIHA 3QTQA 4FVPA 4H1MA 3UIXA 4BCPA 5IH6A 5K3YA 4EQCA 2VX0A 2J5EA 1LPUA 2UW6A 3NCGA 3R21A 5CAUA 4G6LA 4UMQA 3A61A 3ENHA 4GU6A 4IACA 5KKRB 3K54A 5JN2A 3LFCA 2IO6A 4ANLA 3PZEA 4G9CA 5CAOA 5L8JA 3OMVA 3CR0A 4F7NA 3P9JA 4IH8A 2XA4A 5IH5A 4YC3A 2YAAA 3NNUA 3FSKA 4G3FA 5CSVA 3ATSA 4L8MA 4HCTA 3KXMA 4C4GA 5T6KA 3R7OA 4GRBA 4GS6A 4NM5A 2PMNX 4MWHA 5CX9A 3BYSA 2OIQA 4C61A 4CCUA 2QLUA 4O7SA 3C0HA 3IKAA 2W4OA 4MD7E 4JQ8A 4PV0A 1W8CA 4RA4A 5HG7A 3V51A 4NL0A 4LOOA 4LGHA 1BKXA 3G33A 2BRMA 2IW8A 4AOIA 2IW6A 4AGWA 5HD7A 2QOHA 2ITPA 3ZH8A 3FKOA 3NUYA 4U97A 3IW4A 3ODZX 2C6KA 5BVEA 4MXOA 3IS5A 4HPTE 4L7FA 3VS4A 5AR3A 3V6SA 3MW1A 1WBVA 3AG9A 2PK9A 2HWOA 2BAQA 3AGMA 3Q3BA 4FSZA 3TIZA 3FPQA 4YPDA 3NUPA 4GT5A 3KGAA 5BVOA 3FMDA 2VTHA 3M11A 4KABA 4Z3VA 2C1BA 5CSPA 1JOWB 1Q8WA 3F3WA 4ZLYA 2C6TA 4MXAA 5LARA 4RIXA 2XM9A 5EYCA 4DTKA 4IDTA 5HEZA 3KFAA 3DNEA 2C1AA 3G5DA 3GUBA 4O2PA 2W96B 3A8XA 2JITA 4RIWB 4AOTA 2CCIA 2REIA 2A0CX 4FTLA 1WCCA 2Q0NA 3NS9A 2RG6A 4L42A 3VS5A 4AA0A 3FC2A 2JFMA 2VWYA 4AACA 5CAPA 3FI3A 2Y4IC 4MXYA 4W4WA 3BLQA 2VO7A 2QR7A 4MNFA 4BL1A 3FMNA 3JYAA 2VWXA 3FLSA 3NAYA 3OF0A 3NYVA 4IE9A 2FO0A 3AD4A 4JG8A 5KZIA 2BZIB 2PVYA 4PWNA 2IPXA 4FEVA 3R7YA 3OD6X 5L8LA 4R1YA 1FVRA 2QKWB 2SRCA 4P4CA 3R9HA 3ZO3A 3ZOSA 3E7VA 3BGZA 4FV8A 3AOXA 1SM2A 3DKCA 3P7CA 4BGGA 5C26A 4GVJA 2XYUA 5H9BA 2ZYBA 5CYIA 3FY2A 1WAKA 3MY0A 3RK7A 1SVHA 4BICA 3UO6A 1ZYJA 1REJA 1NA7A 3NYXA 1KSWA 4D2RA 3GFWA 3UOJA 1NVRA 3QC4A 1UU9A 2XMYA 1PMEA 3QYZA 1STCE 4GJ3A 3QRIA 2PVNA 4I5HA 2GMXA 4L3LA 3TI1A 2IVSA 2WTKB 1XH4A 3AGLA 4XG7A 5CEMA 3BBWA 4P90A 2VNWA 3LLAA 4JVGA 1WFCA 1KE7A 2R3JA 4FSQA 2UW8A 4HCUA 3LCKA 4PL3A 5EFQA 5K0XA 5DFPA 3ZMMA 2JKQA 3ERKA 4YUQA 4F08A 5I0BA 3PFQA 3V3VA 4AOJA 4W8EA 5LMKC 5AR5A 2V0DA 3PTGA 3QZFA 4DFUA 5CEIA 4IJPA 4DTBA 5AMNA 2Y6MA 4IWPA 2ESMA 3FLZA 5HI2A 1PXNA 2X2MA 3F3TA 5FP5A 2H34A 2QU5A 3Q96A 5F1ZA 5HQ0A 3MN3A 5JK3A 3I0OA 4FODA 3PDTA 3WIKA 4J1RA 5L4QA 4LRKA 1JSTA 1CTPE 3RWPA 5L6WL 3OWPA 3OS3A 3FKLA 4UYNA 3LIJA 4L9IA 3LXNA 4ZY4A 2GHMA 4I92A 4PPBA 3EL7A 3ULIA 4YZBA 5HBJA 3DKFA 4XV9A 3NNVA 3DFCB 5AIRA 2W5AA 3TTJA 2BZHB 4UZHA 4EH7A 4B8LA 4Q5EA 3BHUA 4EYJA 5EQPA 5HBEA 4UB7A 5CQUA 2V55A 4LG4A 3V8WA 2LAVA 2CJMA 3MFTA 4C3FA 3UDBA 4FTUA 3MPAA 3UTOA 3CQWA 2HIWA 4FZ6A 4QQ5A 3ZBFA 2OF2A 3L8PA 4BTJA 3FXWA 2CGXA 3Q5IA 4LL5A 4YZ9A 2J4ZA 5CF4A 4FKSA 3HV4A 4CCBA 3IQ7A 4QQJA 5LQFA 4QTBA 3Q5ZA 3TG1A 2QURA 3DBEA 3G2FA 5IZFA 2R4BA 3JY0A 4RJ3A 1LUFA 4AW1A 4BBEA 2XNOA 3FI2A 4FIEA 4R3PA 2ITVA 2RKUA 4QMMA 2XNEA 5I9XA 4CZYB 3AC4A 4Y5QA 4KBKA 3R9RA 4X6RA 4RIWA 4O0WA 2C6MA 3I6WA 4KWPA 4UBAA 5HU9A 2P4IA 2HZ0A 4TNBA 4I94A 4XP2A 2WPAA 4YJNA 4A9YA 2XK9A 2HWPA 4N0SA 2XKCA 3SXSA 1URWA 3UVRA 5F95A 4D2SA 4TWNA 4D2PA 3P86A 4S34A 5JZJA 2VV9A 4CD0A 4F9YA 3CLYA 2QO2A 5TO8A 5L6OA 3AMAA 4KINA 1YDSE 4XH6A 3PXYA 1U54B 4C35A 3O8PA 3TXOA 3GU7A 1O6KA 3TJCA 1Z9XA 4M0YA 2W0JA 3RINA 4FIJA 4ZZNA 3NAXA 3BQRA 3SOAA 3K5VA 2YM3A 4JDIA 2ZDUA 5AA8A 4NM3A 4EZ3A 3RK5A 3HDMA 4I23A 5GZ9A 4IAZA 4RLLA 5AV3A 4AA4A 4XG4A 3PXZA 3QD0A 3UO4A 4J8NA 2C30A 5K9IA 4ACMA 3A60A 3FQHA 3GU8A 2CKQA 3GBZA 5AUYA 5HE0A 4BDDA 3QTWA 4PTGA 5AUVA 4L43A 5CS6A 5CF6A 4UV0A 3DXPA 2BUJA 4WG3A 2XF0A 2YIRA 3IO7A 1PKDA 3FWQA 5A4QA 2V7AA 2E2BA 3NX8A 4FKLA 3NVKI 2B9JA 4PMSA 4FIFA 3VUHA 4QNYA 4C36A 3ID6C 3ZM9A 4KBAA 2HXQA 4HGSA 4QYHA 4OGRA 1BL7A 4J96A 2ZAZA 4AGUA 3DB8A 3HYHA 3OOMA 3QQHA 2ZV8A 2YHVA 4JIAA 2J0MB 4OUCA 1E9HA 4I1ZA 5A4CA 1OKZA 4RJ7A 3U6HA 2JC6A 2H9VA 3FL4A 2WFYA 3CPBA 3WBLA 3QD3A 3U4UA 2QCSA 3NNXA 4CRLA 3D7ZA 3HAVA 4I24A 5DYJA 2CPKE 2R9SA 4FV3A 1T46A 4BGQA 3DA6A 3AC5A 5EDQA 4ZZOA 4R77A 5ANIA 3KRLA 4PNKA 2F2CB 2OGVA 2OWBA 4O38A 4I21A 3TM0A 4X2GA 3GU5A 3ZUVA 4D4VA 2NO3A 3ZUUA 3R28A 4IZ5A 3QQFA 4KIQA 5JZNA 5ACBC 4EH4A 5DI1A 2BMCA 4DEEA 5C1QB 5FRIA 4XG6A 5CF5A 2F2UA 3A4OX 3EQFA 3UE4A 2J2IB 5M56A 4LQMA 2C5YA 4PX6A 4WRGA 4DG2E 2XS0A 3GENA 4QQCA 2A27A 3D83A 5HO6A 4BWPA 5FM3A 4XG2A 4WG5A 2NNWB 3NYNA 1P14A 4IB3A 1Y8YA 2BHEA 4IWDA 4PF4A 2C47A 3FMHA 1Y8GA 4JQ7A 5AP5A 5AJQA 2G2IA 3TWJA 4XNEA 5KO1A 2BAJA 2XRWA 4ZXTA 1CKPA 1W0XC 3PJ3A 4QP8A 5M4UA 4CVAA 3HP2A 3EQBA 3P7BA 5HG9A 2C5NA 3BHHA 3M1SA 4BFMA 1FGIA 1PJKA 3KCKA 3QQUA 4P7EA 5G6VA 4FT5A 3QZIA 3R7GA 3QZGA 4A4XA 5DOSA 4FSMA 3QZHA 4HVHA 4QP1A 5HLNA 2OH0E 4HGEA 5EM7A 4X3FC 4ZTRA 2W1CA 2IW9A 5L3AA 2BR1A 4M67A 5BVKA 1K3AA 4YC6A 4DN5A 4X0MA 4CLJA 4TY1A 4OTFA 3FI4A 3BEAA 3R30A 2XBJA 3F3UA 1U54A 4BGHA 2IVVA 3MB6A 4GH2A 5HKMA 3IOKA 4WNMA 1TQPA 3V5JA 4EKLA 1OL5A 4FVQA 2WMBA 5DR2A 4IM3A 2F7XE 1BL6A 3SRVB 4EOLA 2OZAA 3QKMA 4IWOA 4CQEA 5AP0A 4CT1A 4D28A 3MH2A 3HMPA 5C4KA 5FXRA 4G6NA 3WARA 1H00A 3NUUA 4EYMA 4D9TA 1R3CA 3RNYA 3TUDA 1GAGA 4PNIA 3CJGA 4K8AA 4QD6A 3VO3A 4BYIA 4FSYA 3LOKA 4QYEA 3RK9A 3ZBXA 4C3RA 3E88A 1W83A 1YXUA 5HLWA 2X39A 5M06A 3LPBA 3G9LX 3LVPA 2X8DA 3BU3A 4GL9A 2XJ1A 3R0TA 4FTNA 3A7JA 4B99A 3TV4A 5HX8A 2W5HA 3QRUA 1ZZLA 4PTEA 3MV5A 4GFMA 2PUUA 4EHVA 5HNBA 5A4TA 3KC3A 4FSRA 3GOKA 5CALA 4JDHA 2C6LA 3ZDIA 5HTBA 3CY2A 4C62A 2JGZA 5L8KA 2P55A 2IWIA 3R9NA 4ANOA 2YDKA 3LCDA 5CNNA 1S9IA 3L9PA 3O2MA 3R8VA 4L68A 4F7LA 3BHTA 4FOBA 3ZO1A 3E87A 4FF8A 2XK6A 3S1HA 3ORIA 2ZB0A 2HXLA 3I6UA 2EXCX 4E4MA 4FBXA 4X2KA 3VULA 3DKGA 2GHGA 1PYEA 2Q0BA 3BYOA 3R8PA 3F6XA 3IK3A 3D5WA 4ALWA 4ERKA 2XIRA 5HIBA 2R3QA 4EHGA 1YOJA 2PL0A 3MTFA 3LJ2A 2BFXA 1OGUA 2C68A 3JY9A 4FTQA 5HCZA 3T3UA 1W84A 2IG7A 3U54A 1J3HA 2AUHA 5DR9A 2O63A 5H3QA 3R00A 2OG8A 2WTWA 4BKJA 3TNIA 3ORXA 4EL9A 4BTMA 5CASA 5CEKA 3GVUA 3BLRA 3KEXA 3PP0A 3EFWA 3QHWA 5EKOA 5GZAA 2XNPA 4PDOA 2C6DA 3BIZA 3E8CA 4WO5A 4ZTMA 3FE3A 1Q4LA 3DJ6A 4HJOA 3FYJX 4ONAA 3F2AA 1YI6A 4RQVA 3SG8A 2YWPA 4IAAA 2HELA 3I0QA 2FH9A 5IQAA 5ICPA 4G3GA 3ZFXA 5ETIA 1Q8YA 4FTMA 4IX3A 2JIIA 4WNOA 3TACA 3W10A 5JEBA 4DEGA 4BCNA 2XKEA 2Z60A 5KKRC 2FSTX 3V5TA 3SDJA 4MX9A 1Y91A 5H8EA 4J71A 1YI3A 3UOLA 3D4QA 3H0ZA 3KB7A 4FYOA 2PVRA 4A9SA 4AZWA 2RSVA 3I5NA 2F9GA 2XB7A 4ZY6A 3SGCA 3JS2A 2VWBA 3VRZA 2BKZA 3EQGA 4BDHA 3ORTA 2X6DA 3D15A 4ZEGA 1H1WA 4DEBA 2HW6A 2CKOA 4LI5A 1P2AA 1TQIA 4R7IA 2XH5A 2OICA 5DMZA 4FV5A 4XYFA 4FKRA 4B0GA 4GFGA 2ETRA 4BWKA 3GEQA 4QMYA 4UALA 2P2IA 5DG5A 3SRVA 3F2RA 4IMYA 4F0FA 5JKGA 4RQKA 3CTQA 5JFWA 5CAVA 2BDWA 5IEYA 5J5TA 2QOLA 3DAJA 3T9IA 3QA8A 4IW0A 1IR3A 4L52A 1PXIA 2Y7JA 5IISA 2X4ZA 2Y6OA 4JRVA 2CNQA 3QTZA 4EH9A 1AQ1A 5AIKA 3C13A 2PPQA 4RVKA 3UBDA 3WI6A 3WF6A 5EM6A 2R3HA 4I6QA 3SC1A 4BDIA 2R5TA 4F70A 3F5XA 4DT8A 3UYTA 3VS0A 3ZLXA 3LXLA 3MA3A 2X6EA 1YDTE 5L2WA 3BRBA 3OXIA 3MBLA 3EHAA 2R3RA 2O3PA 5AP6A 5HLPA 5J8IA 5TT7A 3PA3A 2WQNA 3BKBA 3EN7A 1FOTA 3FHRA 2F7ZE 4Y72A 4E4LA 4YNEA 3TT0A 4KUJA 2WTIA 3D0EA 3TJDA 2YJRA 4F1TA 2V22A 3ZEWA 5AFVA 4Q5HA 2ETKA 4CQGA 3FKNA 5HNGA 3ZXZA 1UA2A 5KX8A 3QFVA 1GIHA 1YI4A 2XCKA 2OJFE 2WKMA 3HP5A 1TKIA 4ALVA 1MQ4A 2VTPA 1H1RA 3HEGA 4BDKA 4KBCA 3NSZA 4BTKA 3QUPA 4AU8A 5M57A 5BVNA 3K3IA 1WVXA 5IF1A 2ZM4A 5ETFA 3L1SA 5C9CA 4I3ZA 4ASDA 3L9LA 3R2YA 4IVAA 4CYIA 3SOCA 3R7VA 3RZFA 3QTRA 3KN6A 4Z55A 3FBVA 2B0QA 3QGWA 3QKKA 3UG1A 3DK7A 1QPJA 3BYUA 4JBVA 4A07A 4AAAA 4BRXA 4TXCA 3UIMA 2QLQA 2C6OA 4O7WA 3FXZA 4D5KA 4EI4A 2O64A 4CTCA 5K4JA 5IUIA 3A7GA 1DS5A 1GZKA 3CGOA 3GQIA 3F7ZA 4MEDA 4U6RA 1YXSA 2FSMX 5AR4A 5J95A 4O7VA 4TWCA 3VUMA 5J9ZA 3KN5A 4C59A 5L6PA 5AR7A 2GS7A 1ZOGA 4L7SA 2ACXA 5DEWA 3LFBA 4YJTA 3HV3A 1ZARA 3W2QA 4D4YA 4YSMA 3HNGA 4AF3A 3OC1A 3LFNA 4QP9A 1JBPE 3OWLA 1OBGA 3O51A 1O6YA 4EWHA 3WF5A 4M66A 4AN3A 4CFFA 4IVDA 3G15A 4CGAA 5E1SA 2Z02A 5M4FA 5HIDA 1MRUA 4FV2A 4WT6A 5AP2A 2G2FA 3OFMA 4MKCA 5I3RA 3OEZA 4FEWA 4L3PA 5I5ZA 3RHKA 2BZKB 2GS2A 2OIBA 4ZSJA 2Q83A 4G5PA 4QO9A 3GCVA 2PWLA 3NUSA 3EQPA 3ENMA 3DQXA 4GV1A 3IPHA 1KE8A 1YRPA 3TZ9A 3W32A 2EXMA 3PLAE 3BGPA 2UZEA 1P4FA 3KCFA 2YCRA 4FIHA 4D4SA 3HV6A 3PVBA 3E7OA 1UKIA 4YP8A 5IA1A 4A06A
chains in the Genus database with same CATH superfamily
2GQSA 2A2AA 4ZLOA 4L3JA 3MH1A 1OUYA 3LMHA 4JOAA 5C8MA 4E93A 2UZUE 1UKHA 4YJRA 5ETCA 4EUTA 5BUIA 5GJGA 3UZTA 3KULB 1WBWA 3QUEA 2VWUA 3HRCA 4AXAA 1IAHA 3LJ0A 4HZRA 2I1MA 4IZAA 4M69A 5CU3A 4C7TA 3DKOA 3IW6A 4FV6A 3BWFA 4ALUA 2C6IA 2EWAA 3UDZA 3UODA 2V5QA 4U0IA 1AD5A 4TYEA 5EHLA 2YCSA 3U51A 5KMMA 2V62A 3QTXA 3II5A 3TCPA 4DFZE 1Q99A 3AC3A 3NVMB 3WILA 2R2PA 1HCKA 2OO8X 4ANMA 4HOKA 2ERZE 5HBHA 2XARA 3I7BA 4BDCA 5CU2A 3QU0A 4LRJA 3E64A 1W7HA 4Y46A 4CFWA 1H4LA 2X7GA 3MSSA 4LRMA 3F5PA 1KV1A 2ITWA 4BZDA 3GNIB 3ORLA 3EIDA 3K3JA 3UNZA 2WTJA 4HZSA 5HESA 1IA8A 1R1WA 2JEDA 4NK9A 2W05A 3BCEA 3PXQA 3UPXA 4IC7A 5IA5A 4YO4A 3TMOA 4DGOA 3QBNA 3ACJA 2JIVA 1I44A 4S2ZA 2GNLA 1Q8ZA 1OBDA 2WD1A 4X2FA 4W8DA 3OT8A 3FUPA 4NCTC 4L53A 3R83A 5CSXA 3QYWA 4ARKA 2FGIA 2UV2A 4Q9SA 3ZRMA 2IVTA 4GSBA 2XK4A 2R3NA 2BRBA 4TWOA 2QG7A 2YIXA 4WBBB 2UW4A 3DFAA 5FBNC 3R04A 5I9UA 5CENA 4M8TA 5EOBA 1MRVA 4MHAA 3QX2A 2VGOA 3DT1A 2WMSA 4JBQA 4BCQA 4QQTA 3LMIA 4BY9E 3E8NA 3WE8A 1GJOA 4AS0A 1OMWA 1SYKA 4DHIB 3OUNB 3P08A 3WZJA 4FKPA 5GJDA 4JRNA 3I81A 2AC3A 2X2KA 3PG1A 3LLTA 4GVAA 3TEIA 4O7LA 3RPOA 2CGWA 2X0PA 3HA8A 3TNWA 4ERWA 2OXYA 5CXHA 4HCVA 2C69A 3UC3A 3O96A 3WZUA 4EOKA 5A54A 4ANQA 2GCDA 3PSDA 4JL9A 3DBDA 3W8LA 4BN1A 3CS9A 3SX9A 3VNTA 2I7QA 2B52A 2PUNA 1E1XA 3RTPA 2QOOA 5DIAA 4ASEA 4MWIA 1W82A 5D1JA 4HVIA 1FGKA 4E1ZA 5K5XA 4IX5A 3OG7A 3QQKA 4X3JA 4OT6A 4NEUA 2W4JA 3S0OA 1IASA 4XUFA 4EOIA 5H8BA 4K77A 4FK3A 4QMXA 2BRGA 4FTTA 2E9NA 5E92A 4RMZA 2Y4IB 2XRUA 3TDVA 2R3FA 1XR1A 4RFMA 4XP3A 3DY7A 3CSVA 3A7IA 2QOFA 1IAJA 2BCJA 5D41A 2OSCA 2IJMA 2VWIA 4RT7A 4ZP5A 3VS2A 4BDFA 5IQBA 4PL5A 1YXVA 3GU6A 2XIYA 3BYMA 5DEYA 1UNGA 4N6YA 4E73A 4U40A 4D2WA 5FXSA 3LQ3A 4LOQA 5JMSA 3KULA 3W0PA 5IA0A 1F0QA 2OI4X 3TN8A 1PW2A 4RVLA 3EFKA 4BI0A 2XEZA 4ZSAA 1NY3A 3BI6A 3LFEA 3IOPA 4O0UA 2B1PA 1XHAA 1PXLA 3GOPA 3CE3A 4U79A 4FG7A 3AQVA 4I5CA 4A7CA 1NW1A 3RM7A 4OBPA 3AC2A 4CFMA 5IEXA 5KNJA 4CG9A 3EQCA 2W9FB 1LR4A 2WU7A 3SQQA 3NIZA 3UC4A 4O7YA 3U87A 4HNIA 3QLGA 1OKYA 3DDQA 3IW5A 2ZB1A 3EMGA 5HVYA 3ZFYA 4AW2A 4U45A 1H07A 4AW5A 4NH1A 3AT4A 1YOLA 3HGKA 3PLSA 4USDA 3PE2A 4WUAA 3HMMA 3VUGA 4BB4A 2X9EA 4CG8A 1WVYA 4FZ7A 4D0XA 2VRXA 2OBJA 3PSBA 4DAWA 2UW0A 1MUOA 3HDNA 5LCKA 3R8MA 2RFDA 2W1DA 4PMTA 4EQMA 1KV2A 5CT0A 5BPYA 3SW4A 3WZDA 3IGGA 2R3OA 3MYGA 4E3CA 1ZXEA 3FYKX 3AD5A 5AA9A 4EH2A 5T68A 3PWYA 4ZS4A 1ZYDA 2OH4A 4BBFA 3PE1A 3QCXA 3UVPA 2CNUA 3E62A 4TNDA 2A4LA 5AEPA 1Q3DA 4K0YA 4UX9A 4LL0A 3VUIA 2BKKA 5EYDA 5AR8A 3ZUTA 1Q41A 4G3CA 4J53A 1JWHA 4IVCA 2PVKA 4XG3A 3O8TA 4ZTSA 5FEDA 3WYXA 1YW2A 2XIXA 5AUWA 3UP7A 3VHKA 3KREA 4JIKA 2XVDA 1R0PA 5AX9A 4GK2A 3QGYA 4FL1A 1BX6A 3GP0A 3KXGA 3NW6A 4QYFA 4BVUA 4IIRA 4CV9A 4EC9A 4ZY5A 3LCTA 3VIDA 1XWSA 3LXKA 4E20A 5H2UA 4G31A 3OY3A 3OUKA 2VUWA 2PZYA 5CXZA 4C4IA 1QPEA 3ZLWA 3RAIA 3DTCA 3G0FA 3HV7A 4E6AA 4IEBA 4DC2A 5FEQA 4EK6A 2BALA 4YJVA 2QO9A 3HL7A 3FQSA 3P7AA 4MQ2A 3RCDA 4E5BA 1OL7A 5A4LA 5AAGA 3OTUA 3N4TA 4O4FA 4YR8A 4WKQA 4G5JA 3RJCA 4RC2A 4G3DA 3A62A 3TV6A 2H96A 2Y8OA 4O96A 3FQEA 4YLLA 1BUHA 4ZMFA 2VTQA 4AW0A 4BDAA 3MGYA 3KXNA 3HV5A 3H0YA 3P4KA 5C27A 4DH3A 2Z7LA 2W7XA 4O7RA 5EDRA 5BUJA 1JNKA 3MIAA 5LVMA 3V04A 2PE1A 1JLUE 1MQBA 5E91A 2WELA 3S00A 4O4DA 4FKGA 4D55A 2X7FA 5FP6A 5CANA 4FJVA 5E8VA 4Z7HA 5D7VA 3E3PA 3LCSA 3RALA 4QMZA 3A99A 1JSUA 1ZOEA 2X8EA 3Q4CA 2OKRA 2JBPA 5AUTA 5B7VA 2C5XA 2GHLA 3BE9A 2ZVAA 3BX5A 3S95A 4UN0C 5HHWA 4U42A 4BCIA 2UZLA 3OCSA 5F9EA 4M0ZA 1W2FA 1PYXA 4RC3A 4ENXA 2CDZA 2GNGA 3MB7A 5DE2A 2VAGA 4U81A 3MFUA 4QP2A 1BLXA 1R39A 4GU9A 1JVPP 4BIDA 4R78A 3MY5A 3C5IA 2I6LA 3GC0A 3L8XA 1PHKA 1FMOE 2BHHA 4R6VA 3ZZWA 1HCLA 5DLSA 3UP2A 3U6JA 4I0RA 4CEGA 3EKKA 3U9CA 2GFCA 3MY1A 4QP7A 1ZRZA 3B8RA 3KVWA 3MH0A 3R1NA 2DYLA 2C6EA 5A3XA 4MXXA 5M08A 4WRSA 2OIDA 5LMKA 3D7TB 4ANBA 1UVRA 5AM7A 5IA2A 3EN9A 3BV3A 4XV2A 3BPRA 3KA0A 3FZTA 3FSFA 4NW5A 5HE1A 1GIJA 2GNHA 3R73A 2PHKA 2VTAA 5CT7A 3RBWA 2AYPA 4CFVA 4GT4A 4ZZMA 4BHNA 3UOHA 3Q6WA 3PIZA 4TTHB 2HYYA 3WZEA 5LJJA 3A4PA 3IDCA 5LVLA 5TR6A 3O7LB 2G2HA 2PE2A 4C4FA 4O91A 3QCSA 3FZOA 4GIIA 5HE3A 4OTRA 2J9MA 4GW8A 1I09A 3SHEA 1J1BA 2X81A 4WNKA 5DGZA 4BDEA 5GHVA 1H26A 3BHYA 3QLFA 4J95A 5AAFA 3RZBA 2HY0A 3AC1A 5KBRA 3DGKA 3E5AA 3MJ1A 4FV1A 4OAVB 1OIYA 4DDIA 4IJ9A 2GSFA 2YITA 4AE9A 4E6CA 4ZLZA 2JDTA 2XK3A 3SW7A 1ZMUA 4XV3A 2W5BA 4TRLA 4E4XA 3R1SA 4JMQA 4DG3E 4DFYA 4K1BA 4IQ6A 4U3YA 3DLZA 3U55A 2VTOA 4K9YA 5J79A 4WBOA 5AR2A 1RJBA 4XV1A 5K0KA 3ZO2A 2QOCA 4I0SA 4FSUA 4NFNA 4JT3A 3KRJA 2XEYA 4MBJA 1IG1A 2GU8A 2WXVA 5FG8A 5L2IA 4I22A 3D9VA 3EFJA 4QYGA 3RM6A 2X8IA 4AXDA 1PMUA 5E90A 3W1FA 2EU9A 4Y8DA 5M55A 4TYHB 4YJUA 4EH3A 2OW3A 1J7LA 2B9FA 2VO0A 1YQJA 1QL6A 3PRIA 4X3FB 2PVMA 4YNOA 3SG9A 2XBAA 2UZDA 1VYWA 4FTOA 3LQ8A 4QTAA 4RFYA 4ZSLA 5HZNA 5JGBA 2XNNA 4APCA 2YEXA 2CN8A 3P78A 5CVHA 1V1KA 4G9RA 3HKOA 5FXQA 3RWQA 4C34A 4PDPA 3JR1A 4EH8A 3HRBA 3PIXA 4F7JA 1SNUA 4PPCA 5E8XA 1X8BA 2VO6A 5A46A 2JIUA 2WTDA 4FOCA 4YTCA 4EBWA 3ROCA 1Q62A 1BI8A 1KOBA 3VJNA 4O0XA 3GC7A 4TW9A 5EW3A 3QCYA 1L3RE 2VWZA 4FZDB 4AN2A 3QWJA 4W4XA 4XBUA 4BBMA 4EKKA 3AKJA 3FLNC 4CV8A 2YM5A 4FG8A 2AC5A 2ITOA 2OXXA 2ZV9A 4O7ZA 5EKNA 5M53A 1W2DA 2NYAA 3E92A 2GS6A 5IEVA 2WQBA 3PUFC 4DE4A 4IBMA 4YGAA 3VN9A 4XG8A 2JAMA 2ZM1A 1ND4A 5KMIA 3W2OA 5LVPA 2BPMA 2UVXA 3ROYA 4OTPA 3EYHA 3W8QA 1O6LA 1KE5A 2J51A 3CY3A 5KHXA 4M12A 4GMYA 2JDOA 2VZ6A 3SXRA 3D7TA 4RIOA 3NUXA 2CSNA 2YDIA 4JG7A 2QD9A 3FJQE 5E1EA 4UMTA 4A4OA 4BYJA 4D9UA 4Y73A 4JR3A 4XRLA 3COKA 3IDBA 4GK4A 4I6FA 5EW8A 5EYMA 3I60A 4EK4A 1Q97A 3BYVA 2UZTA 4MD9E 2PYWA 3H9OA 2G1TA 4TL0A 3ZDUA 2WU6A 4IX4A 2F57A 1H8FA 2JKMA 4H05A 4DFBA 2GQRA 2WNTA 1M7NA 4UEUA 4X2JA 3COMA 2HCKA 2Z7QA 5F4NA 4AWIA 5CAQA 1UU7A 3HA6A 4YZDA 5EW9A 5GINE 2R3LA 3I7CA 4FV9A 4MBIA 1XBBA 2OXDA 3V5PA 3W0MA 3UDSA 3D5VA 1H27A 2BVAA 3LM5A 4HNFA 2QODA 3RAWA 4EK5A 3LM0A 2I40A 3LFAA 2C3KA 2VGPA 1H0WA 1XH9A 2W1FA 2UZBA 2QR8A 4QMTA 3DS6A 4P5ZA 1WBOA 4NKSA 3GCSA 1WZYA 4N6ZA 2NP8A 3IG7A 1UNHA 3FHIA 1FVTA 3OOGA 4JX7A 5D10A 5I9ZA 4GUBA 3HVCA 1APME 4KIPA 5IH4A 4FVRA 3SKCA 3OW3A 5CEQA 2GNFA 1OIRA 2WMRA 2ONLC 1W2CA 4JDJA 4LFIA 4LYNA 4MF1A 3CTHA 2UVYA 3Q6UA 4K18A 3C4CA 4GYIA 5TF9A 4O0TA 3NCZA 3KVXA 4ZAUA 3I5ZA 3V5LA 5ACKA 4BWXA 5CI6A 2YCFA 2E9OA 3EN4A 4IFCA 4KKEA 2G15A 2CHLA 4I5PA 4DITA 2QHNA 3W16A 4CZUA 5BQ0A 3CP9A 4CKRA 3IW8A 3Q2JA 3UQGA 4D1XA 4IM0A 4H1JA 4TYHA 4I41A 1RQQA 2I0HA 4GCJA 3VBVA 4C57A 1F3MC 3RPYA 3P0MA 4L00A 3KK8A 4X3FA 3V01A 4CSVA 4PUZA 4F9CA 4O4BB 4XEYA 5LVNA 4TKSA 4DT9A 4LUEA 4MNEB 3G51A 3ORKA 2BROA 5FGKA 3VUKA 2YM7A 4BHZA 1OI9A 4QNAA 3R8LA 1E1VA 3MI9A 3CBLA 3MVHA 2UW3A 3QTSA 1XH5A 4AN9A 3KMMA 5M09A 2JFLA 2DWBA 4O6LA 4EBVA 5AUUA 2CLQA 3EQIA 4FG9A 5F20A 4OTIA 5D11A 2XKDA 4GG7A 2W4KA 3PJ2A 3ANRA 3ATTA 2QHMA 3OBGA 3NNWA 3VS3A 3C4WA 1H1QA 5FWKK 1JPAA 2JDSA 4X21A 4DA5A 4OBQA 4XOYA 3F5UA 4YBJA 4RX5A 2C3LA 5A14A 2EB3A 3W0SA 2IEWA 4R5YA 3CGFA 5ANGA 4CMUA 2GDOA 2VTLA 1P4OA 3PIYA 3FZRA 1PMNA 2XALA 3VW8A 3ZLSA 3HZTA 3RHXA 1VYZA 1XJDA 2XYNA 2YA9A 2WIHA 3GC8A 3LAUA 3Q4UA 1VEBA 3PPZA 5AP1A 5L2QA 2XIKA 3R7EA 3OTVA 3DNDA 3PY3A 2YWVA 3P23A 2VNYA 3QCQA 2YABA 3LFDA 1RDQE 4OTWA 4ZK5A 5C8KA 1M52A 1LEZA 2WOUA 2PMOX 2W1GA 4R7HA 2WZJA 2BIYA 1FINA 3OXZA 3PXKA 4NFMA 5HD4A 3PJCA 5FQDC 3R01A 2UZNA 3C51A 1VR2A 3TIYA 4LDTA 5KMOA 1OVEA 4BZOA 2OF4A 2YISA 3OWKA 3DB6A 4M3QA 2PVJA 4UXLA 2RGPA 3UZPA 4E7WA 5KHWA 3TYKA 4I4EA 1FBNA 3HAMA 3QWKA 3TV7A 1DAWA 5CSHA 4RBLA 2W1IA 3RAHA 3TZMA 5LXMA 2ZOQA 3PXRA 1WBNA 2PZIA 4ZOGA 2PVLA 4FK6A 5IQEA 5J9YA 4DGMA 3RGFA 3LFQA 4JAJA 4W9WA 3AT3A 1NVSA 5DT4A 1JKLA 3KMWA 3VHEA 1PMVA 3TKIA 4KAOA 4HVSA 1MRYA 5FM2A 4XP0A 3CIKA 4MH7A 4BCGA 4O83A 3UDTA 4GJ2A 3KF4A 4FI1A 3PWDA 2KULA 1QMZA 4FTAA 3FEGA 2RFEA 4YJOA 2QC6A 3R9OA 4G2FA 5GJFA 5AX3A 4BKZA 3AKKA 4IB1A 3N51A 3QF9A 4DHZA 3JPVA 3DLSA 5EQEA 5KBQA 5J1WA 5JGAA 2FYSA 3NDMA 5EYKA 4FGBA 3R9DA 3UOKA 1JKSA 3EQHA 4EQUA 4CTBA 2GQGA 3ORMA 4H39A 5BVDA 2ITUA 1WBPA 2WHBA 4C02A 5CF8A 2UVZA 5IA4A 4L67A 5LOHA 1XH6A 3OCGA 2C5OA 3B2WA 4IAIA 1TQMA 1Q8UA 3UZRA 4MBLA 4EOPA 3VBXA 4M68A 3WF8A 4S31A 4JNWA 2YZAA 5JT2A 3CQEA 4RWKA 5CEOA 3VAPA 4FSWA 5AV4A 4O82A 4IZYA 2VU3A 1IEPA 3MFRA 3HUBA 4QMWA 3POZA 4OTDA 1M2PA 3DXNA 4J99A 5I9WA 3MVJA 1UV5A 2C4GA 4NM7A 2ITTA 4MNEA 1JSVA 2WMQA 3OT3A 3PVGA 4PMPA 5LVOA 4NTSA 4FKWA 5HIEA 3CEKA 3LZBA 4NU1A 4AP7A 3DTWA 2I0VA 4G1WA 1O9UA 5FUTA 2O0UA 4M15A 5EDPA 1XBAA 2O8YA 2R0UA 2WMUA 2OJGA 4C58A 4RX7A 4ZTLA 5E8SA 4FL2A 1ZLTA 4M97A 3U8WA 1SVEA 3DCVA 4PP7A 5EM5A 2YDJA 4ZS0A 5EI2A 2E9UA 3FV8A 4V0GB 4WNPA 4J7BA 4C4EA 3EL8A 4F0IA 4NWMA 4DFXE 2PZPA 3C4EA 4CFUA 3GU4A 3OP5A 5CNOA 5HE2A 1OKVA 1J7UA 4N4SA 3CXWA 3FLQA 5IQGA 1OL2A 1P5EA 4JDKA 4QPSA 3TL8A 5M07A 1XO2B 4LMNA 1M2QA 2ZV7A 3UPZA 4UY9A 4RJ6A 4MVFA 4KIKB 3H9FA 4R7BA 5B2MA 5JGDA 1PXPA 2QOQA 3ETAA 3UYSA 1OIQA 4B9DA 3P79A 3EKNA 5AV2A 3VUTA 4TYGA 3SV0A 3KY2A 4U8ZA 4IHPA 3TKHA 4IANA 4O2ZA 4PDYA 5EI6A 4ASXA 5KUPA 4QMPA 4JS8A 2W9ZB 5B0XA 5EQYA 2FA2A 3UQFA 3N9XA 4DH1A 3RAKA 3PVUA 3ZSIA 3VBQA 3VBYA 4FV0A 4F1MA 3PPJA 4FV7A 2QOIA 5IDPA 4U5JA 4RVTA 4OBOA 4B4LA 2JAVA 4W4VA 4U41A 2PUPA 3ZSHA 4BCMA 3NZ0A 2R3MA 4IM2A 4FNZA 5DH3A 4HPUE 3NGAA 5J1VA 4EOQA 4ZSGA 1CMKE 3JUHA 4NTTA 5BVWA 1YDRE 3COIA 3P1AA 2G01A 5JQ8A 3R2BA 2WQOA 4FSNA 2HZ4A 1U59A 1YWNA 4KA3A 1OL6A 5DRDA 2PVHA 4PL4A 2CNVA 2XIZA 1EH4A 2CGVA 1B39A 2VTTA 4YPSA 3H30A 1IRKA 4AQCA 2B4SB 1GY3A 2BRHA 2R3PA 3H9RA 3OEFX 2BTRA 5HO8A 4CFXA 3TNQB 3E8EA 4QTEA 4FICA 3C7QA 2IZRA 2OFVA 3CPCA 3N4UA 4EWQA 2PVFA 5G1XA 4ANSA 2HZNA 5JH6A 4QP3A 2XM8A 4PRJA 3G9NA 4EONA 3DZOA 1SZMA 2Z2WA 3Q52A 3QQGA 5HNIX 1PXOA 5GZ8A 5BMSA 3L8VA 4R3CA 3CKWA 2NRUA 3H10A 4FKIA 3NLBA 4QPMA 1YVJA 5AUZA 1R78A 3Q4TA 3QRJA 3Q9ZA 4KNBA 4QTDA 4TT7A 4F6SA 1G5SA 4RFZA 4FZAB 4CMTA 3OZ6A 3WE4A 4ACCA 2JKKA 4J97A 3C9WA 2YLFA 4H3QA 4BF2A 4RGJA 4AZTA 2YIYA 4BC6A 4Q2AA 4FKQA 3O23A 4YZNA 3W2CA 4O22A 1H1PA 2ITZA 2JBOA 3BLHA 4KRDA 3QKLA 3SA0A 3ELJA 2OK1A 3CTJA 2P33A 3RKBA 4NT4A 4FEUA 1H0VA 5KE0A 3K5UA 4C4HA 1SVGA 3KU2A 2I0YA 3PSCA 4FUYA 5C4LA 2B53A 1ZMVA 3F3ZA 3O7LD 3PJ1A 4IFGA 2FVDA 2WTVA 4OR5A 4V0GA 5I9YA 2VTMA 4LOPA 3G0EA 2X0GA 1FVVA 3TZ7A 4EUUA 5J7HA 3NFFB 1FPUA 1Z5MA 2QOKA 3OWJA 2A1AB 5DWRA 4ITJA 4WUNA 3WZKA 3ZSGA 2VD5A 5IMEA 4RZVA 3A7HA 4Z16A 5DHJA 4E5AX 3COHA 4YURA 3MDYA 5CQWA 4FNXA 5EHYA 3F5GA 2JKOA 3NYOA 3FLWA 4ZJJA 2H6DA 4DBNA 1NXKA 3OCTA 3Q9WA 4QTCA 4O7TA 1GZOA 1J1CA 4KIOA 2PMIA 1B6CB 3FPMA 4RPVA 4YHFA 5M4IA 5EI8A 4KIKA 4UZDA 5L2TA 4F64A 3OHTA 4PDSA 4HYUA 1K2PA 2E9PA 3ZEPA 3W2RA 4IB5A 4HYIA 5LWMA 4F63A 4TZRA 5CZHA 4F4PA 4ASZA 5BUEA 5AP4A 4EC8A 4LM5A 4M84A 2VTRA 2O5KA 3V5WA 5C03A 3MWUA 2DQ7X 4L45A 2Y0AA 4J52A 5T3QA 4NCTA 3NPCA 3MFSA 3VQHA 2O65A 4FUXA 4ITIA 4LGGA 4AG8A 2GTNA 4WSQA 4YU2A 4NW6A 2R7BA 2ZV2A 2R64A 2WEVA 5EG3A 4AZVA 3HLLA 4DLJA 2GPHA 5E7RA 1LP4A 1WBSA 3KL8A 4GG5A 4MAOA 3V8SA 2VWVA 4RJ5A 1G8AA 4FNYA 5L2SA 2EVAA 2XKFA 3FZSA 1KOAA 5E8UA 2VTJA 3ZXTA 5GIOE 3GFEA 5KZ0A 2G9XA 4I93A 4DH7A 5A6OA 4YJSA 1VZOA 2DUVA 3QRKA 2PULA 2E9VA 4WSYA 5KMNA 4YHTA 1U4DA 4TYIA 5DA3A 3LKMA 3GC9A 5FDXA 3WF9A 4RG0A 2HY81 2XK8A 4KSQA 4QYYA 4BCOA 4D2VA 4R1VA 1ERKA 3M2WA 4QMNA 5D7AA 1OECA 1VLRA 1H24A 3FY0A 2Z7SA 3UJGA 5BYZA 4YSJA 4KS8A 3LFFA 4KRCA 5K5NA 4ANNA 2W06A 4XMOA 3NIEA 3RPVA 4QT1A 2YIWA 5E8WA 2VX1A 3VS1A 3EN6A 3ZZEA 1XQZA 1SNXA 4LMUA 2PTKA 2IN6A 2ITYA 2QG5A 2VTNA 4MK0A 4E6QA 3QHRA 3C0IA 4IX6A 4MYGA 4GYGA 3ULZA 4D58A 4EOJA 1YHWA 2WQEA 3C4ZA 1T45A 3ALNA 3D5XA 4D4RA 2P2HA 3D2KA 4AAYA 2UZOA 3Q53A 4PTCA 1H1SA 3O8UA 2J0LA 4QRCA 2OFUA 2WMWA 1BYGA 3TZ8A 1GZ8A 5BVFA 5JRQA 3DK6A 4N57A 2WB8A 3AT2A 3PPKA 3GT8A 3LE6A 1M7QA 5CI7A 5ANOA 1UWJA 3Q60A 4GIHA 2PU8A 4O81A 3RMFA 3ZRKA 5CU4A 2C0TA 2CKEA 3F82A 3PUPA 4YTHA 1PXMA 4L44A 3VS6A 3BEGA 4AGCA 4G17A 3PFYA 3R7UA 4AT4A 4O21A 4BDGA 5DBXA 4JR7A 4CFNA 5ETAA 2WGJA 1JKTA 4YMJA 3QXOA 4QMLA 4B8MA 1ZZ2A 2YM6A 3OBJA 3F69A 2WOTA 5AWMA 3OVVA 5HG5A 3W0QA 5JRSA 1PRYA 1OUKA 2IZUA 4IXPA 4EHZA 2VTSA 5ANEA 3QL8A 4R8QA 1U46A 3ITZA 3GB2A 5AAEA 1REKA 3QUDA 3HRFA 1HOWA 2F7EE 4B6LA 2YACA 4D1ZA 4E6DA 3H4JA 1AGWA 3EYGA 4JBOA 5AV0A 4IWQA 3K2LA 2WMTA 3NR9A 4EZ5A 4H3PA 2YLEA 3DBFA 4C8BA 3U6IA 4A9UA 4IC8A 2UW5A 1ZYCA 3NRMA 4ACDA 4AE6A 1Z57A 4FIGA 2CN5A 4LGDA 4WA9A 4APPA 4S30A 1L8TA 2Y4PA 4GEOA 4V05A 5FLFA 1NVQA 2HZIA 1WMKA 2RG5A 3O17A 1OM1A 4DEIA 2J0JA 3LW0A 5D9HA 4EHEA 5TOZA 4EJNA 5IQFA 3B2TA 1UNLA 3E8DA 2PZRA 5E8ZA 4DFNA 5M51A 4GUEA 4JBPA 3KRRA 3IGOA 4L01A 4OT5A 3VC4A 3VWAA 1Y57A 2WMXA 2WTKC 5IU2A 3E63A 4NZWB 2ZMDA 4XJ0A 4C38A 5FD2A 3C4XA 4YBKA 2B54A 2W1ZA 2A98A 5FTQA 4F65A 4ACHA 5CTPA 3BHVA 4I5MA 4G3EA 3KXZA 5DR6A 2JLDA 2BIKB 2J0KA 3CCNA 3A7FA 2OJ9A 4D1SA 3UVQA 4C0TA 3MVLA 1H08A 3EN5A 3ODYX 2IZTA 1V0PA 3HUCA 3RVGA 3A2CA 1OITA 4FA2A 1G3NA 1H28A 1KWPA 1QPCA 3V8TA 3DBQA 5CVGA 1PXJA 3PRFA 2PZ5A 1RW8A 3SXFA 3MTLA 3VRYA 3VUDA 4EH6A 3HMNA 3FMJA 2B9IA 3PYYA 5ANJA 2PSQA 4IVBA 3C1XA 3LJ1A 4BCHA 2CCHA 3FZPA 3AMBA 3TUBA 2XJ0A 3ML1A 4L46A 1ATPE 3KQ7A 4NIFB 3DQWA 5LCJA 1ZY4A 4MQ1A 3W18A 2O2UA 4UXQA 4QMQA 3QXPA 4UMPA 2CMWA 2X9FA 1CSNA 2JD5A 3FMKA 4LUDA 1KE9A 4ZIMA 3U9NA 4II5A 4C3PA 4EH5A 4F1OA 4ZTNA 3F66A 3UIBA 4ZMEA 4X2NA 3IW7A 5ANDA 4OW8A 3F2NA 2YM4A 2ITNA 3ACKA 4FC0A 1ST0A 5AUXA 3EQDA 2XANA 4DINA 2WO6A 2JDVA 3ZC5A 2W1EA 3CJFA 4YHJA 5BYYA 2EXEA 2XZSA 4CNHA 1Y6BA 4DGNA 5FEEA 3W2SA 3R71A 2QI8A 3BV2A 2OZAB 3KKVA 5E8YA 2QVSE 2J5FA 4YJPA 3T8OA 5HO7A 2W99B 5LWNA 4FTIA 3DAKA 2BDJA 1Y6AA 3ORZA 1V0OA 5EH0A 1J91A 3ZFMA 4O6EA 3SAYA 3LXPA 3JXWA 4CZTA 4AZFA 4EOOA 2YIQA 2B55A 1GOLA 1U5QA 3C0GA 4G34A 4P5QA 5KMJA 1BI7A 4BTFA 1JQHA 4F9AA 4OAUC 4XS2A 3FMEA 5IDNA 5KMLA 4BDJA 4BIEA 3DV3A 4E8AA 4TWPA 1YHSA 1RE8A 3JVSA 4XHKB 4U43A 3RNIA 1OKWA 4F9BA 3WF7A 3QD2B 3FDNA 4NJDA 3S4QA 4PQNA 1YWVA 3QA0A 4YTIA 2R7IA 3E3BX 2J50A 1YXXA 2W17A 4RWLA 4NUSA 2XJ2A 1H01A 5CU6A 3G6HA 2C0OA 4XLVA 5FTGA