1JPAA

Crystal structure of unphosphorylated ephb2 receptor tyrosine kinase and juxtamembrane region
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
299
structure length
273
Chain Sequence
KIFIDPFTFEDPNEAVREFAKEIDISCVKIEQVIGAGEFGEVCSGHLKLREIFVAIKTLKSGYTEKQRRDFLSEASIMGQFDHPNVIHLEGVVTKSTPVMIITEFMENGSLDSFLRQNDGQFTVIQLVGMLRGIAAGMKYLADMNYVHRDLAARNILVNSNLVCKVSDFPIRWTAPEAIQYRKFTSASDVWSYGIVMWEVMSYGERPYWDMTNQDVINAIEQDYRLPPPMDCPSALHQLMLDCWQKDRNHRPKFGQIVNTLDKMIRNPNSLKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords neural kinase, Nuk=Eph/Elk/Eck family receptor-like tyrosine
publication title Structural basis for autoinhibition of the Ephb2 receptor tyrosine kinase by the unphosphorylated juxtamembrane region.
pubmed doi rcsb
source organism Mus musculus
total genus 85
structure length 273
sequence length 299
chains with identical sequence B
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2001-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 1jpaA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 1jpaA01
2X8IA 2X39A 3DJ5A 2J5EA 3PVBA 4C36A 5JQ8A 4I0SA 3DXQA 2PL0A 4JBQA 3OF0A 3FHIA 4G6LA 3IGOA 4I22A 5KZ0A 3HDNA 4BB4A 3I7CA 4M7IA 2UZUE 5M57A 1LP4A 3GNIB 2PVRA 3PA3A 3KA0A 5DT3A 3NUPA 4B7TA 5CU3A 4BYIA 1XWSA 4RX7A 3F5GA 3KN6A 2I0EA 3UG1A 4CGAA 3ANRA 3GB2A 1JLUE 3LQ8A 4WIHA 2XBJA 4QMPA 5CQUA 3EFKA 5EYCA 4ZY4A 2J51A 1Q4LA 4QT1A 4DTAA 3CXWA 5BVWA 2OFUA 1JSUA 4MXAA 5DBXA 5CAPA 2BR1A 3KK8A 2GTNA 1URCA 4F6WA 5DIAA 3UIMA 3SG8A 1OZ1A 3ZU7A 2PVKA 3K2LA 4FZDB 2CNVA 4WO5A 4O0SA 3C4ZA 2W99B 5DHJA 3RWQA 3U87A 5CI7A 1FGIA 3LCTA 2C3LA 3QYWA 3DQWA 4NFNA 3I5ZA 2G01A 3Q52A 3G90X 5AR4A 5FG8A 5FEEA 4YU2A 3W2SA 2X6EA 4R7HA 4U81A 1XHAA 1K2PA 2QODA 3K3IA 4FKJA 3PZEA 3QXOA 4K18A 5J5SA 5IUHA 4R3CA 4CZYB 5IH6A 4P90A 4UWYA 2QO2A 5AP7A 4ZK5A 4RVMA 4JNWA 3HRBA 5FDXA 4F63A 4M12A 5LVPA 1XO2B 5TKDA 4PDPA 2VTHA 1OIUA 1ATPE 3FZTA 2ZV8A 2R0IA 2WMRA 1EH4A 3BU3A 4DFNA 5FTOA 5FP5A 4LRJA 3R83A 2ZDTA 1DM2A 2VWVA 3R7EA 3BE9A 3CKWA 4PTCA 4UZDA 2QOLA 4RQVA 3DKFA 2XK8A 2B4SB 2C0TA 3DPKA 4RIOA 5KO1A 4IAKA 5HICA 4S32A 1S9IA 2Z8CA 4HVSA 4WUNA 4BKYA 3DB8A 3LJ2A 4U80A 5HNBA 3NUUA 4BIBA 2YM8A 4O7TA 4I6FA 4PMPA 2BFYA 3R7OA 5DRBA 5L6WL 3ZUTA 2XIZA 4KS8A 5I9ZA 5AR8A 3LFQA 3ENHA 3VS0A 2VN9A 4FV0A 2DWBA 4JVGA 4C37A 2CGVA 2QLQA 2X0GA 3ODYX 3TJDA 3S3IA 4BTFA 4D4RA 2XK3A 5E1SA 3V01A 3MB6A 2W1FA 4DHFA 4F6SA 4QTCA 5AA9A 5JGAA 4G3EA 4C58A 3FQHA 1IG1A 2CDZA 3QTZA 1YOMA 2R3JA 4M14A 2OF2A 3TUDA 3G51A 1YHWA 3CBLA 2CKQA 3I5NA 4E6QA 2WAJA 2WD1A 2VTSA 4QTAA 3R71A 2ESMA 1M17A 5AP4A 4ZJIA 5LMKC 3UNJA 4FTTA 4DH5A 5AUTA 1HOWA 3FAAA 4TY1A 4O7WA 2A4LA 4J71A 2QHNA 4EC8A 3G5DA 5KBRA 1WAKA 2C3IB 3HA8A 3DBQA 3QHRA 4OBQA 4QYHA 5JH6A 3FMJA 3C0GA 1OBGA 4YPSA 2UZLA 4L7FA 3KB7A 5J9YA 4RFMA 1UU8A 4DFUA 2WMBA 2X6DA 4M68A 2REIA 5GNKA 3GI3A 5AUWA 3WYYA 3QRJA 1UU9A 2QOHA 2H8HA 1M14A 4ACMA 2WMXA 5M56A 5EI6A 3QFVA 4QO9A 2KULA 5KUPA 2BCJA 4BDAA 2UVXA 4XBUA 2BRBA 2VTAA 1PXIA 3Q5IA 4L43A 4IFGA 3BQRA 4FMQA 5J87A 3T9TA 3VNTA 2VX1A 3O96A 3UTOA 3LMHA 3TJCA 3ZDUA 3KULA 3WOWA 5K0XA 5EH0A 3LFDA 2X7OA 4GK3A 4QYFA 2AYPA 5BMMA 4YJNA 4F08A 1V1KA 1JSVA 4P7EA 3OCTA 2G2HA 4GVJA 2ITWA 4EHEA 3KCKA 1HCKA 2VUWA 4F64A 4O7LA 3KXXA 2OF4A 4QPSA 3ZLYA 1SVEA 4WSQA 5AV3A 4ZZNA 3QAME 3VS1A 4DGNA 3UO6A 3OBJA 1U46A 3GU5A 5DG5A 4JBOA 1ZYSA 3LMGA 3SRVA 5HE1A 2JDTA 2YCFA 1WCCA 4IXPA 3W1FA 1R39A 4R77A 1O6YA 3K54A 4TWCA 4XG4A 4ERKA 3ZUUA 5I0BA 3CTQA 2CSNA 5CASA 3HAVA 1Q8UA 5EW8A 2J50A 5JGDA 4QMOA 3EMGA 3Q6UA 5JK3A 4FTNA 2GSFA 2QOCA 3ATSA 3RAWA 1W7HA 4H39A 3OWLA 2XNNA 5B2MA 3SOAA 3AC3A 3DK3A 1BX6A 4FTMA 3NS9A 4Q9ZA 1Q5KA 2VTNA 3ZDIA 3ZSGA 4BTMA 4FTRA 1PMVA 4RLKA 2HY81 4TYHB 2QURA 4CG9A 5CXHA 4I93A 5K4JA 4KKEA 4WHZA 5L2TA 4FK3A 2UZBA 4ZZMA 4BCPA 4QPMA 4FODA 3ORXA 2JFMA 4FTUA 3TNHA 3COIA 3V3VA 3WF6A 2W1ZA 5TT7A 4ALVA 4CTBA 3MFTA 3I6WA 4DTKA 5HO6A 5HO7A 5IQFA 1Y6AA 1BUHA 3ORKA 4MD8E 2EVAA 3QD3A 3PXRA 4KRDA 3RALA 3FI8A 4YO4A 2PZ5A 3VUDA 3OTUA 4FVPA 2ZV2A 3ORIA 2E2BA 4U79A 4XP0A 3UODA 4RWJA 5EQYA 4W4XA 4C2WA 4CCBA 2J0LA 3OUNB 2JEDA 3MH2A 4C3FA 2JKMA 3UVPA 5IA4A 3Q3BA 1MRVA 2E9VA 4XG2A 4KIPA 4S33A 4GU9A 4Y73A 3GOPA 3AC1A 3SKCA 4GL9A 3MFSA 4F4PA 4ZTQA 3KRWA 3QWJA 4QQ5A 4QP8A 3C50A 5H8GA 3V5QA 2B54A 3AGLA 3EKKA 4RJ5A 5EK7A 3DCVA 1PXPA 5AV4A 4CT2A 3BGZA 3MFRA 4OTIA 4BWKA 3OCBA 1WVYA 3SDJA 2ZV9A 3VUHA 1H8FA 2XK4A 2ONLC 4H1JA 4I6QA 4X0MA 1NXKA 4LYNA 5FRIA 2PMIA 3FPQA 4YUQA 3DNDA 4PV0A 4A9YA 3QTSA 5HESA 3UZPA 5JN2A 2X9FA 5C4LA 2VWWA 4F9CA 4AU8A 5DOSA 2W5BA 3FE3A 4OTPA 4WNMA 4S2ZA 1YI6A 4W4YA 4KSQA 4EHZA 3UYSA 1ND4A 3SAYA 4EK8A 2CKEA 2WTCA 2XYUA 5EG3A 4IEBA 3TEIA 4ZXTA 1B6CB 4P5QA 5I3RA 4DE4A 4EH7A 3FMHA 3FMEA 5CT0A 4EH3A 2OZOA 4U3YA 4JDKA 3NLBA 4OR5A 5CEQA 5E92A 4J99A 5IEVA 3DLZA 3VHKA 2G15A 5EW3A 4KNBA 1M2QA 3Q2MA 4EYJA 3KRXA 5A4TA 5HG5A 3U6IA 3BGPA 2CGXA 5IQAA 3DKOA 4V0GB 5CNNA 3JUHA 5D41A 4ANSA 2Q83A 3DK6A 4XG9A 3PXZA 1PY5A 1GIHA 2I0VA 2FSLX 4L7SA 2A27A 2VGOA 4D1ZA 5CENA 2Y4IB 3EFLA 2R3OA 3PPJA 1OUYA 2WTDA 1U4DA 2ZB0A 4U45A 4D55A 4C3RA 4Z7HA 3I0OA 4XMOA 4GRBA 4AE9A 2EXCX 4UN0C 3UZTA 2XF0A 5GZAA 3DY7A 5IQIA 2GNLA 3I60A 3MB7A 3PLSA 3U55A 2R3IA 4HCVA 3R8PA 3ZHPC 3R00A 2UW4A 5J79A 2XKFA 4NCTC 3FBVA 4PDSA 4U97A 5BPYA 2PULA 4AZWA 2OH4A 3BYMA 5DH3A 1WBNA 2P2IA 3LXNA 2X2MA 4BICA 2Z7LA 2W96B 1F5QA 4GFOA 5ANGA 2XM9A 3ZSHA 2UUEA 3CLYA 3PG1A 4L00A 4O27B 4CRLA 4F9BA 5ICPA 2ITYA 2R9SA 2YCRA 4W8EA 4BIDA 3W8QA 2P0CA 3C7QA 5HG7A 3DA6A 3U6JA 4DEHA 2UZEA 3ZTXA 4BCNA 2C5VA 1AD5A 4MVFA 4G9RA 1WBPA 3VS4A 4KWPA 2OLCA 2PMLX 1PF8A 1ERKA 5AP6A 5FTQA 3V5TA 3ORNA 3DNEA 3H9OA 3PYYA 4GEOA 3VW6A 2YIXA 4D1SA 4DEBA 3F2RA 3E7VA 3OW4A 2XB7A 4BCQA 3K5UA 3ANQA 5CF6A 1H1SA 4ZLYA 2HELA 4IAAA 2W4KA 3TNIA 4FGRA 3IGGA 2WPAA 2C5YA 4XLVA 1A48A 3O51A 5E8TA 1FGKA 4MK0A 1W98A 2XNMA 2C1AA 5FEDA 3BLQA 5GIPE 3UPXA 4RIWB 2UW9A 2P2HA 2HZ0A 5BYLA 3L8VA 1J3HA 2WTKB 4UBAA 4FNYA 4XP2A 4ACDA 3W10A 3R2YA 3R9OA 3FWQA 4MXZA 1JQHA 1JWHA 3E7OA 1LEWA 4Y83A 3C0HA 4J53A 4FUXA 2ONLA 1YXTA 4FTCA 5JFWA 3TUCA 1JAMA 3QL8A 2BTRA 4CSVA 3P23A 4DGLC 2ZV7A 4XHKB 5IF1A 1FPUA 1YI4A 3E92A 5ANEA 4C3PA 4QMNA 1YHVA 4YJSA 1GAGA 1XQZA 1ZAOA 4IX3A 5L2IA 1YOLA 5A4LA 4FV9A 4FI1A 3IPHA 5C1QB 2DS1A 1IEPA 1KV2A 2JDRA 5AUVA 3R8LA 3WZDA 3TZ7A 4FV8A 3VS5A 3MW1A 5E8VA 4LL0A 4PNKA 4PL3A 4RPVA 2RFEA 2W4OA 2XRUA 4ZS0A 3V8WA 3C13A 3MH1A 3UGCA 3FMLA 3MY1A 4K9YA 4BTJA 4TZRA 4BTKA 4FT0A 2Y8OA 5AEPA 1XH5A 3WIGA 3UIXA 3UC4A 3RPVA 1O9UA 3R02A 3IW6A 4IX4A 4HVIA 4KKHA 3OWPA 1XR1A 2PWLA 3NYXA 4O81A 4D9UA 5AUYA 4FSUA 5HNIX 2BDWA 3FJQE 1Q99A 4LG4A 3OHTA 4FT3A 5AR5A 2PUIA 5EI2A 5F20A 3OTVA 4GT4A 2GPHA 3CJFA 3CIKA 4O1OA 4AG8A 3W32A 3F5UA 2GHLA 1IASA 1YQJA 2J6MA 3F2NA 3R63A 4QRCA 4ANMA 3IDCA 3E93A 4JBVA 4MF1A 3QA8A 4IWOA 4X21A 4G2FA 4CFNA 5JSMA 4HGLA 5C8MA 4YJTA 5GIOE 1PMNA 4DGMA 5A4EA 2YIYA 3FI4A 5JEBA 3NNVA 4EJNA 3E3PA 4RC4A 1YXSA 3II5A 1X8BA 4E4MA 3CD3A 3R7UA 4XV9A 3ORTA 4I3ZA 2OWBA 2YERA 3SD0A 3SV0A 2VTRA 3KK9A 4ZJJA 4A9UA 4QP7A 4I21A 3RPSA 5DEWA 2VWZA 4QMVA 5HEZA 3ODZX 5FGKA 4LI5A 3TXOA 4EEVA 4RX5A 4KBKA 3E8EA 5FWKK 5IA2A 3E88A 3MDYA 4HYSA 3MA3A 4ITIA 4TYHA 3WZEA 4YNEA 4ZTSA 3QD2B 1SNUA 4HJOA 3DBFA 4XG3A 5FEQA 5KMJA 4CZUA 3QRIA 4EL9A 4EZ7A 3HUBA 5E8ZA 4EOQA 2OJ9A 3IS5A 4AGWA 2WMAA 3RI1A 3NZ0A 3SXSA 1M52A 3FLNC 3B2TA 2W1IA 4FSNA 4C4HA 3BQCA 2HK5A 3SLSA 3ACJA 1Z9XA 3LXLA 4NJDA 3W2CA 4CNHA 3Q9ZA 4EH5A 1YXUA 4ZZOA 5JFXA 2VNWA 5I9WA 4Q9SA 2SRCA 4CYIA 2XA4A 1Q24A 5A3XA 5IISA 2HENA 3F69A 3A7FA 3HV3A 1MP8A 3IO7A 3BI6A 3KXHA 4OTQA 4XOZA 4CMTA 5IEYA 2YM4A 1IA9A 3OC1A 5J8IA 3OCSA 3ORLA 4X2GA 1UU3A 4KIQA 5AJQA 1JBPE 2DUVA 4YMJA 5KMLA 1W83A 4EOIA 4DITA 2BKKA 4WG5A 5E90A 1VYWA 2ITVA 5FQDC 5AP3A 5FXQA 2YHVA 3C0IA 4XLIA 3FZOA 3MTFA 3GBZA 5TF9A 3QF9A 3WF5A 3PJ8A 4TWPA 3TG1A 4FGBA 4O0YA 1G8SA 3IOKA 1CTPE 4I5CA 3PRIA 4JJRA 3CGOA 3R8UA 1ZOEA 3Q32A 4V05A 3SX9A 4BI0A 5L8LA 2WTKC 3ROYA 4XH6A 2YM5A 2J2IB 3PJ3A 3R9NA 3KQ7A 2WIPA 3VULA 3PE2A 4C4FA 1HCLA 4CQEA 4ZLOA 5A54A 5IPJA 4WG3A 3KY2A 3M1SA 4X3FC 4L67A 4AN2A 2CN8A 3GCPA 2YIQA 5TO8A 5A6OA 3IK3A 3OXZA 5EQEA 2B9FA 4R6VA 5HBHA 5HVYA 2GHMA 2CPKE 2OI4X 2R3HA 3G15A 4FVRA 3FXZA 3TCPA 4UMRA 3D7TB 4IJPA 4O7SA 4B4LA 2JDOA 2IG7A 4IM0A 4R3PA 5AM6A 4U8ZA 3RCJA 4EJ7A 3CE3A 4IZ5A 4MD7E 2ZM4A 3ALNA 3LLTA 5K9IA 3CTJA 2E9PA 3RPOA 5JRSA 2W1GA 1PXNA 5C03A 4IQ6A 4FL3A 4PNIA 1WZYA 3QZHA 2RL5A 5I9VA 3R1YA 4ITJA 4XUFA 1W8CA 2B9HA 4M84A 4OT6A 4AN3A 3TKHA 5CEMA 2BALA 3RPRA 4NWMA 4HOKA 3TUBA 4A9RA 2XIYA 2XKDA 1QPCA 3D2IA 3OXIA 4UYNA 5TR6A 4E20A 4N70A 5A4CA 3S95A 2VTOA 4JR7A 5L2SA 4V0GA 4C33A 3NSZA 3HL7A 1REJA 5HIEA 4F6UA 3F2AA 4U6RA 3V04A 2HIWA 1YKRA 2X7GA 3NDMA 4YTIA 5FM3A 2PYWA 3VQUA 4FNXA 3P08A 4I92A 4I94A 2OIQA 5LVNA 2XNGA 3EQRA 4IB5A 5CX9A 2QKWB 4AP7A 4OW8A 3QC4A 3COHA 3IW4A 5AP0A 4K11A 3LFEA 1OITA 4QMWA 2FA2A 3PXYA 4S34A 5DN3A 3R0TA 3SXFA 3AG9A 4YZ9A 1L3RE 2CCHA 4L9IA 4MHAA 3LFCA 4PUZA 3PP1A 4FV2A 5LVLA 3P0MA 3R8VA 2PUNA 4NK9A 3ELJA 3C9WA 4WRGA 3D94A 3SQQA 5HIDA 3ZCLA 1JOWB 3AC4A 2QQ7A 4FSZA 4IWDA 1ZMWA 3HMIA 3RZFA 2BKZA 1GIIA 1H08A 3PY3A 3R73A 4R78A 1H07A 4IDVA 3UG2A 5A14A 2HWOA 3NGAA 2YJRA 1OECA 3PJ1A 4FIFA 4UXLA 2WOTA 1OKZA 3RPYA 4ANBA 2WXVA 4IACA 4CXAA 2VWBA 3CJGA 4D5HA 2XIRA 5IQCA 3FC1X 4J8MA 4IWPA 1RDQE 3CTHA 2CNQA 4IZAA 3Q9YA 3BHTA 3FKOA 3W2RA 3DZQA 3QQJA 3NEWA 4QPAA 1FMKA 4FKOA 4X7QA 3R9RA 4ZMFA 1GNGA 3COMA 2VTJA 3QXPA 3QCSA 2O2UA 2GTMA 2W5AA 4RG0A 1H26A 4YTCA 4FV6A 4IB0A 4RIWA 1Q8TA 3BBWA 5CF5A 1VYZA 2JLDA 1UKIA 3EZRA 1RE8A 3LCKA 2W5HA 4RZWA 4RC3A 3G0FA 3LJ0A 4QQCA 3R1SA 1BMKA 4TWNA 5D11A 3JXWA 3ZSIA 4S31A 4ASZA 3JVSA 1M7QA 2F7ZE 2WELA 2B1PA 3IONA 4X2FA 3D83A 1B38A 3VF8A 1H01A 1FVVA 3ZFMA 4F0IA 3G33A 2NRYA 5L2WA 4QP1A 3PWYA 3KXGA 4M69B 3EQHA 5TE0A 2Z7QA 4ANQA 2HZIA 5CI6A 2EUFB 4OBPA 4BYJA 3CEKA 2BRGA 2JIUA 1J7LA 4DCAA 2HCKA 5GHVA 3ZM4A 2YN8A 3FZRA 1ZOGA 4CMOA 4C38A 5HGIA 2HZNA 3EL8A 3RJCA 3L9PA 2XKCA 3LFNA 5AAGA 3HA6A 3R22A 1UWJA 3SOCA 3MPMA 3ULIA 3AMBA 3S2PA 3LXKA 2JDSA 5CANA 4BR3A 3PIYA 4TT7A 1V0PA 3UE4A 1FMOE 5DR2A 3QRKA 3DQXA 4N6YA 4DFZE 1YOJA 3W2PA 3V8SA 2XEYA 5CAUA 1Y8GA 3UP7A 3TNPC 3BU6A 2Q0NA 4XNEA 2W1DA 4HZRA 5AX3A 4BCHA 4MXOA 1WVXA 3NUXA 4YPDA 3R9HA 4F7SA 3NUNA 1PXLA 2OSCA 2A1AB 5CVGA 3LE6A 3FLQA 2R3NA 5KMMA 1H0WA 4APPA 3VIDA 1UVRA 3F9NA 4KB8A 1PYEA 2X2KA 5M53A 1ZOHA 3V8TA 2GNJA 4U41A 4I24A 2YJSA 3CD8A 3NRMA 4EK4A 4YBJA 5AFVA 2C0IA 4R5SA 5BVDA 2XJ1A 4DT8A 2WHBA 1TKIA 2RKUA 3GU6A 1CMKE 2C6DA 4RSSA 5HI2A 4YJVA 3RP9A 5HLNA 4AZFA 4FV1A 3ATTA 2R3KA 4QYYA 4TYEA 3W2QA 4HVDA 5ETFA 3QQLA 4JQEA 4OAVB 4H3QA 3QALE 5DRDA 4TL0A 5JFVA 5HX8A 3VWAA 3VBYA 2X7FA 4BBFA 2VRXA 1YWRA 2X9EA 3EYGA 3ITZA 5H9BA 4DFLA 4NM5A 2VU3A 4MTAA 3TZMA 3DXPA 3U54A 1CDKA 2XKEA 2WB8A 1XBBA 3DOGA 2CJMA 5IEXA 1BL6A 3UVQA 3PDTA 2CGWA 3LM0A 4O0VA 4KAOA 4MBIA 3HEGA 4A4OA 2BAQA 5F1ZA 3GGFA 5DYJA 3QCYA 4O0WA 3ZO3A 2PSQA 3DU8A 4L3JA 1UNLA 1TVOA 2BZIB 3FC2A 3F3WA 4U44A 4FKUA 5A46A 2CNUA 3BWFA 4HYUA 2BILB 3AMAA 3TIZA 2R3MA 4I5PA 3W18A 3OY1A 3L1SA 4EZ5A 4HVGA 4DH8A 3JVRA 4NM3A 3I79A 4ACHA 4QMUA 4G3FA 4CTCA 2W9ZB 2YIRA 5AAFA 2YA9A 3H4JA 3O17A 2GFSA 4HYHA 4ZOGA 3RM6A 2HZ4A 4JLCA 5E8XA 1XJDA 3ZM9A 4MEDA 4QOXA 3FMKA 5E7RA 4PP7A 5HE0A 4YTFA 5E8WA 5AV0A 4DG2E 4WD5A 3WF7A 4PDOA 3ZONA 4BIEA 3IW5A 3K5VA 3REPA 4EBVA 2XK6A 3FLZA 5KHWA 3A61A 4L53A 3ZEPA 4RLLA 4BDFA 1VEBA 3OFMA 4EI4A 4QP3A 1TQMA 5DEYA 4H36A 3TN8A 5IQDA 4WOVA 1OIRA 3NUYA 1S9JA 4MNFA 4FG7A 5GZ8A 1Y6BA 3AT4A 2Y6OA 3ORZA 4H58A 2YWVA 3P7AA 4FZAB 2PE2A 2YDIA 4D2RA 4O7NA 2WQNA 4Q2AA 3E8NA 1OL2A 4QYEA 3OT3A 4B8LA 3EQPA 3S0OA 4D4SA 3IQ7A 2XNBA 4AFJA 2GNIA 5FUTA 4F9YA 2BRNA 3OXTA 2ZMCA 3E87A 2ITOA 4TPTA 4O38A 4TNDA 3U9CA 4ALUA 4EOSA 4O7VA 4OTGA 3D7TA 2UW5A 2ERKA 2R7BA 1PXJA 4MCVA 3Q9XA 3GCVA 4Z3VA 3ZRKA 4NZWB 2Y0AA 1E1VA 3FYKX 4EC9A 5M07A 5I5ZA 2VTIA 3QQHA 3L9NA 1UKHA 4MWHA 3OVVA 2WU7A 4ZLZA 5CAOA 1OL1A 2JIIA 4NEUA 3ZO4A 4DTBA 2I1MA 4XYFA 2OJFE 4KA3A 3TV4A 3L8XA 4CYJA 2EXMA 3KMWA 2PVLA 5E1EA 2OO8X 2VTPA 3M2WA 1M7NA 3DTCA 1PRYA 2J90A 2UW6A 5BYZA 5EM5A 3H9RA 3NYVA 2XRWA 3PSDA 3EB0A 4DA5A 1YVJA 3AC2A 3SGCA 1PXOA 4LM5A 3BELA 2I0HA 1QCFA 4GSBA 4DYMA 3TZ9A 3Q9WA 4JDJA 1CM8A 2C5NA 3KXNA 1OKWA 4F0GA 3NMUF 5B0XA 2R5TA 3F3UA 3ZZEA 4E5BA 2UW7A 4O6EA 3FL5A 2ZB1A 4J8NA 4NIFB 2R4BA 4D2WA 4G6OA 4EOLA 5LQFA 4JT3A 3PY0A 5IUIA 3RM7A 3U4WA 5F9EA 1ZARA 2WQOA 4R5YA 5M09A 3FLWA 3H0YA 4M66A 3C5UA 4NTSA 3LFBA 3RK7A 4ANOA 3IOPA 3PVWA 4O82A 3UZRA 4GK2A 3A4OX 4ZTLA 4D5KA 2JFLA 4RJ7A 4FEVA 3SW4A 5IH5A 1Q61A 3UOHA 5HE3A 2HXLA 3GQLA 4FKLA 5CSWA 5HBEA 2QOIA 3PY1A 3PG3A 3COKA 2BRMA 4G5PA 4UB7A 2CN5A 3MA6A 5ANOA 4O84A 4W4WA 2PK9A 4EQUA 4ZJVA 5LMKA 3F3ZA 3BV3A 3O2MA 4R8QA 3NUAA 5FLFA 2ZM1A 2PVHA 5GZ9A 1H1QA 3R21A 4L01A 4UEUA 2FSOX 2QVSE 4V04A 5EM6A 2XM8A 4DEAA 1J7UA 2XZSA 1DAYA 3BCEA 3GENA 3RNYA 4TYIA 3ZLXA 4DFBA 4NJ3A 4NM0A 4GG5A 4AFEA 4C59A 4ZTMA 3N9XA 2X4FA 4G3GA 2PVYA 2EB3A 5AV1A 2DQ7X 2JBPA 3MJ2A 3NCGA 5HLPA 4QTDA 4TN6A 1T45A 3EYHA 3BHUA 4BGGA 5DT0A 1WBOA 2BZKB 3VUMA 3VRYA 4BHZA 2WTJA 1PKGA 5FTGA 3QQKA 2UW8A 3RTPA 4IADA 5BVOA 2H34A 3VBTA 3TM0A 5DPVA 2CLQA 3MJ1A 4L44A 3KRRA 1YW2A 1SMHA 3KGAA 2W1CA 4M69A 1KOAA 1K3AA 4F7LA 2WZJA 3RMFA 3NNUA 5M4UA 3T3UA 3NX8A 2R3LA 4J95A 4WNKA 2G2IA 1WBVA 2ERZE 5KBQA 1WFCA 1NY3A 2QG5A 3AGMA 3A4PA 3LHJA 4NM7A 1XBCA 4KBCA 4IC8A 5CVHA 3UIUA 2YISA 3GP0A 3E62A 4PPAA 1JKSA 4IH8A 4DGGA 2X81A 4EOKA 1OL5A 4DEIA 5IA3A 4BL1A 2ZYBA 5HOAA 3DFCB 4I4EA 3C4FA 3TZ8A 4ZTRA 2R3GA 4PWNA 5E8YA 4N4SA 4I6BA 4BWXA 4WA9A 3SVVA 3KREA 4AW5A 3LAUA 3MGYA 4Y85A 2PZYA 2C47A 3FY0A 3S1HA 4RZVA 3UQCA 2Q0BA 2VO3A 4HPTE 1M2RA 2IWIA 2O3PA 2YZAA 5CALA 1NVRA 4M67A 1YRPA 4ZSAA 3HZTA 5IH4A 1NVQA 3OOGA 3KXMA 3OT8A 3MV5A 4BDJA 2AC3A 4NYEA 3BIZA 4DT9A 2P4IA 2ETRA 3FMNA 4Z9LA 4GUBA 1VR2A 2WNTA 1H27A 4IM2A 4X3JA 5G1XA 1U59A 2GS7A 1SZMA 4CFVA 2H6DA 1ZMVA 4CKRA 4RWKA 3P79A 3TNWA 2XIXA 2WMWA 3BYOA 3SC1A 1ZYDA 3WZKA 5IA0A 1Q3DA 2WEVA 3CP9A 4FZFB 1PMEA 3HECA 4AW0A 4F1TA 3PUPA 4EWHA 4O86A 4FX3A 4F09A 2ITZA 4CMUA 2YM3A 3OWKA 3MIAA 4FIIA 4YZBA 1YDTE 4NU1A 4FUYA 3HP2A 3ACKA 4E26A 2GNGA 4AOJA 3OWJA 5ACBC 2IPXA 1YHSA 3VJOA 1Q62A 2J0JA 1WMKA 2VTLA 3LOKA 3QTUA 5DT4A 4DINA 3GU4A 5IU2A 4JDIA 5CAQA 3C4CA 3GQIA 3ERKA 5EDRA 2BIKB 3GEQA 4YJPA 4FKWA 4AT3A 4G16A 4LOQA 3VQHA 1FBNA 2PVNA 4YHFA 3AOXA 3HMNA 4EOMA 5CF8A 4JXFA 3V5JA 5M51A 3QZGA 4B0GA 3FI2A 2W0JA 3I4BA 4BKJA 3UDBA 2QO7A 5ANDA 4GUEA 4A4XA 3CY2A 4ONAA 3QTIA 3RNIA 5JKGA 4WUAA 4IJ9A 2BFXA 2O5KA 3TNQB 2BHHA 2OXDA 2E9NA 4RVLA 1BI8A 2BTSA 3BLRA 3PJ2A 4V01A 4KSPA 1AQ1A 3HV5A 4X3FB 3VS3A 2FO0A 3RVGA 4E4XA 3ZXZA 1P4OA 3QYZA 3LVPA 5T6KA 4HPUE 4BCMA 4MQ1A 3VUGA 3KMMA 2PUUA 4C4IA 3DAKA 5I3OA 4IVAA 1OVEA 3DGKA 4KKGA 2OICA 3PWDA 4L3LA 4ZSLA 2XCHA 4I5HA 3LFAA 4QP2A 2NPQA 4PPCA 4XG7A 2PVFA 5K5NA 4FSRA 3BYUA 2W1HA 3U51A 2R3QA 3H0ZA 3DJ7A 3G9NA 2J0KA 4U3ZA 4FYNA 4OUCA 4F0FA 2NNWB 4FR4A 2XJ0A 2HAKA 3TV6A 4O2PA 4CQGA 1IAHA 2WMSA 3RHKA 4U9AA 3KKVA 5M08A 4Y46A 4FSMA 2CCIA 2XUUA 4CZTA 5AA8A 4OAUC 4R3RA 4IVCA 1STCE 3ZRLA 3DK7A 5EDQA 4FTIA 1BL7A 2V22A 3VBWA 5CY3A 1ZY5A 3QTQA 4TKSA 3ORMA 1GZ8A 3EZVA 4GV1A 2GCDA 2IVTA 4LUDA 3HRCA 4QP4A 2RSVA 5AAEA 3HV7A 4FZ7A 4B99A 4I41A 4ORKA 2B7AA 3NW6A 4BC6A 3A2CA 4M3QA 4WT6A 2IJMA 4BI2A 1OPLA 1KWPA 4MH7A 2WMTA 4FSYA 4FIHA 4KIOA 1PHKA 3O23A 4JBPA 5EHOA 3IDBA 2C6TA 4OTRA 4QTBA 4A9SA 4UMUA 3FQSA 4NCTA 4JX3A 2QOBA 3ID6C 3FQEA 3O50A 4A07A 1P4FA 4RWIA 2VAGA 3R7GA 4L8MA 2QG7A 5A4QA 4PQNA 4O0RA 5LJJA 4AS0A 2BDJA 3F5PA 4PDYA 2W7XA 4K6ZA 4RFZA 2NP8A 3F66A 3MVHA 4AA0A 2GS2A 2IVUA 4NH1A 5LWMA 1JKLA 1BYGA 3BRBA 3DFAA 4YZNA 5B7VA 5HO8A 1XH8A 3AD5A 3JS2A 4K33A 3DAJA 4NIFA 2WMUA 4UMPA 3R2BA 2XK7A 4F7NA 1GY3A 1E9HA 5EW9A 2I0YA 4EQMA 3S00A 2PUPA 2OU7A 2V7OA 5E9EA 2F57A 3E8DA 5KHXA 3UNZA 3P86A 2BPMA 5FP6A 4IM3A 1JKTA 3AT2A 1O6KA 4QMQA 3TL8A 1Q97A 4NKAA 1PMUA 5C26A 3ZRMA 3NR9A 3OMVA 1UNGA 2AUHA 3R1NA 5L6PA 5CSXA 3FL4A 3PTGA 2RF9A 1H4LA 5CVFA 5C27A 4O0XA 4YC8A 2H9VA 5EM8A 5J9LA 3TDWA 4GS6A 5HTCA 4XRLA 4MYGA 3MPTA 5L2QA 5BVNA 5T68A 2LAVA 2UV2A 4ARKA 3BHYA 3ZBXA 4E93A 1Q3WA 2XIKA 2IZSA 3KU2A 4GT3A 4TW9A 3QKMA 2YM7A 4YBKA 3BEAA 3MIYA 2WTIA 4ZSEA 5D10A 3FDNA 3NUSA 4MXCA 3QKKA 3NWWA 4CV9A 3HAMA 2PY3A 5EOLA 5DMZA 4UV0A 3VBQA 3PLAE 1LUFA 3LM5A 3ZZWA 2YDKA 5KKRC 3PZHA 1H00A 3VUIA 3EN5A 4RA4A 3VC4A 4JAIA 4X2NA 4FA2A 2F4JA 3FXXA 5CSHA 2VTQA 4E5WA 1LEZA 1XBAA 4R1YA 1IRKA 5I9UA 5KMIA 2YLEA 5AR7A 3D2KA 4MBJA 4E4LA 5BUIA 3EQBA 2R3FA 5LMBA 4PMTA 4FV7A 1NT2A 1ZWSA 2CGUA 4CRSA 2HY0A 3NYOA 4JRNA 5KCVA 2OH0E 1Q8WA 3F3TA 5HD7A 3UPZA 4TNBA 2VO7A 3PPZA 3EIDA 4RRVA 3A8WA 4EUUA 3WF8A 5CXZA 2OJIA 3HP5A 4G1WA 1APME 4ZAUA 4AZVA 1JKKA 2ITXA 3VW8A 3NNXA 4KINA 5J95A 4FF8A 4C02A 4X2JA 1R0EA 2J0IA 3R7YA 4AGUA 3E3BX 4BI1A 2UZTA 4RJ6A 3OUKA 4RGJA 3W16A 5BYYA 1Z57A 3GUBA 2E9OA 4G31A 5ACKA 3W55A 3D5WA 2WOUA 3MVMA 3NPCA 3TI1A 2ITPA 2GMXA 3EQCA 1FQ1B 3OG7A 4E6AA 2I7QA 1R78A 2V7AA 5CT7A 4FEWA 3CS9A 2X8DA 4AUAA 4QYGA 2P55A 4RIYB 2W9FB 4HYIA 5HQ0A 1KV1A 5EOBA 4H1MA 3CSVA 4RJ4A 4MD9E 3PFQA 5HIBA 3NVMB 4CV8A 1TQPA 2PU8A 4FIGA 2CMWA 2WMVA 3BLHA 4J97A 2PZIA 4UX9A 3QUEA 3RAKA 5GINE 2UZDA 4RWLA 2XBAA 5K3YA 3WILA 4C62A 4EH4A 3CGFA 2YAAA 4R1VA 3RK5A 4BCKA 4F1MA 4DG3E 3CKXA 4CFMA 5IDPA 2VO6A 4E6DA 3EWHA 5IQEA 4EH6A 3TT0A 5HG8A 4FL1A 5DWRA 2OG8A 4P2KA 3DDPA 5BQ0A 4AACA 3BKBA 3A99A 3BZ3A 1F3MC 3MY5A 3P1AA 4GJ2A 5BNJA 1PJKA 1NVSA 3BX5A 3BPRA 4UMTA 4H05A 2UW3A 4I6HA 3WBLA 2WMQA 4Y8DA 1B39A 4FKIA 2FVDA 3EH9A 1CSNA 4QNYA 1YDRE 3Q4TA 4G3DA 2BRHA 3C4EA 1YWNA 3R28A 3NW5A 4WG4A 4BDCA 3FHRA 3RWPA 4LGGA 4IMYA 1UA2A 3DJ6A 2C6KA 3HGKA 4I0TA 4QP6A 4BCGA 2FB8A 3LFSA 2F7EE 3AD6A 3CPCA 3FI3A 3LKMA 4QNAA 4N57A 3HUCA 2ZVAA 2I40A 2VGPA 4TXCA 5AUUA 2NRUA 2QR8A 4ZTHA 4G9CA 3KRJA 4XX9A 5AV2A 1OGUA 3U6HA 4ZMEA 3DS6A 4E3CA 2VWIA 1Y91A 3IW7A 2YCQA 4IAIA 3H3CA 4BRXA 4CFFA 4EOOA 5IQHA 4UALA 3UBDA 4JRVA 4LOOA 2F7XE 2ITTA 1ZLTA 2UZNA 4G3CA 1OIYA 3HRFA 3P7BA 5BVFA 1SVGA 2QOQA 3R04A 4L6QA 2OGVA 5DE2A 5LOHA 3H30A 2OK1A 5HU3A 2VNYA 3UOJA 4J7BA 3F6XA 4GVAA 4FTOA 4FL2A 2F2UA 4PPBA 3ZC6A 3KN5A 3QA0A 3LPBA 3O7LD 4XP3A 5EHLA 4X3FA 5BUJA 2YEXA 5BX0A 1U54B 3K3JA 1P14A 4K8AA 3UOKA 2QONA 2WTWA 3EL7A 2RG5A 3FEGA 4NW6A 3FV8A 4KS7A 4XRJA 4DEDA 5C01A 1KOBA 3Q4ZA 4FV4A 3T9IA 4YJRA 2G9XA 4C4GA 3RK9A 3BEGA 3P9JA 3BGQA 4Y5HA 3I81A 1MRYA 4DLIA 4CKJA 4BDIA 2P3GX 1UU7A 1O6LA 4O1PA 3EN4A 4MQ2A 4MNEB 4RX9A 5E91A 4JG7A 5T3QA 5DR9A 1KE8A 3DV3A 1OKYA 3KVXA 3P78A 4LL5A 3GC7A 3QUDA 5K4IA 5CLPA 2GNHA 2G1TA 4RIXB 3ZUVA 4ASEA 2YCSA 5GJGA 4IIRA 4O7ZA 1J91A 5D7VA 3QLGA 1FVRA 3OZ6A 2J7TA 1NA7A 3G2FA 5IA5A 5KMOA 3GXLA 4Q5HA 4KUJA 4EHGA 1UWHA 2QOFA 2QCSA 4BCOA 4EBWA 4GKIA 2HYYA 4CLJA 2FSTX 2YITA 3BYVA 4IWQA 4PL4A 3PXKA 3QGWA 3PVGA 1OL6A 4EH2A 2B55A 4IB3A 4W9WA 2RFSA 1VJYA 2PE0A 4Q5EA 4YLKA 5DI1A 4EOPA 2B9JA 3OEZA 3VBVA 1BI7A 1OPJA 4HNIA 2Y6MA 4A9TA 2PZRA 4FSQA 1J1CA 5B2LA 4JAJA 3T8OA 5CEPA 4D2TA 3DB6A 2Z7SA 3A7IA 4DH3A 3BV2A 1PKDA 3TACA 3ENMA 4Z7GA 3QQGA 2B53A 3PIZA 2NO3A 4HGSA 2FYSA 2QO9A 2QU5A 5HCXA 3B8RA 2PVMA 3HDMA 3PRFA 4GG7A 4XBRA 5F95A 3E5AA 3D5XA 3ZO1A 4NKSA 4AW1A 2QLUA 2OXYA 2IVVA 2HW6A 4FKTA 4O22A 2UZWE 4TYJA 3I1AA 4X6RA 3WF9A 5CAVA 4ZTNA 4CG8A 2UVYA 4ZY6A 3UYTA 1R3CA 4HNFA 4NT4A 4FKPA 4QMZA 3SHEA 1H1WA 2Z2WA 3QD4A 4BDHA 4F70A 1ZYCA 4HVHA 3C4WA 4APCA 4BGHA 4B8MA 3KCFA 4ZS4A 3RGFA 4NFMA 4YSJA 4DH1A 4M8TA 4JOAA 4YZCA 1Q41A 2GQGA 4DBNA 4FT7A 4Z55A 5EKNA 2YABA 5E8UA 5GJFA 3FYJX 4JS8A 3GVUA 3FXWA 2VWXA 1REKA 5HKMA 3I0QA 1OB3A 3DKGA 4USDA 3VVHA 2IO6A 4TRLA 3ORPA 4FTKA 2C6MA 4WBBB 4DH7A 2HWPA 3IG7A 4O7YA 3NVKI 1SM2A 3M42A 4C34A 2C3KA 3CQEA 3WIKA 3LMIA 2F2CB 2O8YA 4IB1A 2R2PA 2WKMA 3JYAA 3PA5A 4QD6A 5AP5A 3UMWA 4HW7A 3HX4A 3Q4UA 2IVSA 3BYSA 4I4FA 3R1QA 2GDOA 3BHHA 2ZAZA 2XVDA 5CEKA 2YACA 3NIEA 3D0EA 4PF4A 2J4ZA 5J9ZA 4M15A 4LV5A 3HVCA 3H10A 4GMYA 3QUPA 2P33A 3NNWA 4FG8A 3G6HA 4C4JA 3ZS5A 3UO4A 3FLYA 3NYNA 4J52A 5AADA 2X2LA 3QTWA 3EJ1A 4DG0E 4ZP5A 3LCSA 5CU6A 5EYKA 3P7CA 4AF3A 3LLAA 3EHAA 3LQ3A 4B9DA 3AMYA 3GT8A 4XV2A 4FEXA 3LIJA 2ACXA 3PPKA 5HTIA 2C30A 4E8AA 1ZZ2A 1QPDA 2PMNX 3L8SA 3OW3A 4LGDA 3HMOA 5EHYA 3VS7A 3A7JA 3TDVA 1V0OA 2V62A 3DXNA 4UYAA 5ETIA 2OIBA 3R30A 3O0GA 4U0IA 4L46A 2W06A 5LARA 2OBJA 4QMMA 1ZY4A 4EK6A 4PX6A 2Z60A 4PL5A 3WARA 1I09A 3MY0A 4J96A 4LMNA 3SG9A 4MBLA 4D2VA 4GIIA 5C4KA 4IZYA 4GH2A 5FXRA 3QKLA 5AP1A 5DVRA 1A06A 5BMSA 3FMDA 2OJGA 4XG8A 1R1WA 2C68A 2O0UA 3AXWA 3V5WA 2Y7JA 3MESA 2YLFA 4DBXA 1R0PA 3MBLA 5ANJA 1WVWA 2RIOA 3DZOA 3H9FA 4RC2A 4MAOA 3ALOA 4EORA 3FY2A 4XV1A 5KMNA 3JPVA 2R7IA 2OJJA 4KIKB 4OTHA 2UZVA 2JIVA 4O96A 1U5QA 2AC5A 3DBEA 4C57A 3DDQA 3OROA 5HD4A 3MFUA 4QMLA 3CQWA 3C5IA 4RIYA 4QMYA 3VHEA 2Z02A 4D28A 4FKRA 3ULZA 2FUMA 1JPAA 3VBXA 3FKLA 4JIKA 2ZDUA 1YXXA 3WE8A 4DAWA 4NL0A 2QR7A 1DI8A 4WKQA 2RG6A 3D15A 4E6CA 3C51A 3NW7A 3M11A 5AMNA 2X8EA 2HOGA 4CVAA 1GOLA 3WZUA 3L8PA 3EN6A 5KZIA 2GFCA 5J5TA 3DLSA 4II5A 3U8WA 2QC6A 4EH9A 1KE7A 4GFGA 3MH3A 2XH5A 4BFMA 5EM7A 1DI9A 5A9UA 4FICA 3GCQA 4BBMA 3O8PA 2C0OA 2LGCA 4FKSA 5AIRA 1H1RA 4CLIA 3P4KA 4D4YA 4L68A 3A8XA 5I4NA 1M2PA 3D5UA 3F61A 1H24A 3G9LX 4GKHA 4IZ7A 4L52A 4OTWA 3A7GA 2JKKA 3QD0A 3N4TA 4QP9A 1KSWA 4MWIA 2O63A 1H25A 3E63A 4IANA 5AIKA 1W84A 4QMSA 4QQJA 4BDDA 4FOBA 2GQRA 5AUZA 4E7WA 3VJNA 4H3PA 2JD5A 3KXZA 4U5JA 3DBCA 3QRUA 4BDBA 4AE6A 1RQQA 2JITA 2ETMA 4O91A 4XV3A 5EDPA 5DGZA 2WQMA 3D14A 3OOMA 4PP9A 4FTQA 4IW0A 3U9NA 4CD0A 2VX0A 3EQGA 5EKOA 3THBA 2ETKA 4YLJA 3L9MA 2PMOX 1YXVA 3FUPA 2BVAA 2WFYA 3KC3A 3PSBA 2XNOA 4GK4A 4YJOA 3UOLA 2CLXA 2HXQA 4X6QC 3KEXA 4IBMA 4IVDA 2OIDA 3MN3A 4QMXA 4ZEGA 5FDPA 3QX4A 5EQPA 3F5XA 3OD6X 3QLFA 5ANIA 4C0TA 4L42A 4BCFA 2ZM3A 5HTBA 5IG1A 2C6OA 3CR0A 4JG6A 4W8DA 2ITQA 1OPKA 4ZIMA 4BDKA 1GIJA 3SW7A 4ASXA 5IQBA 4EYMA 1U54A 3AC5A 5IMEA 3D4QA 4AOTA 4LQMA 3GU8A 2YAKA 2Z7RA 5ETAA 3RZBA 1RJBA 2W4JA 4NSTA 4IX6A 4IDTA 4YZDA 4FTJA 1KE9A 4AGDA 1Z5MA 2PPQA 3V5PA 5G6VA 4XOYA 4BWPA 1W0XC 4RFYA 3TIYA 5FXSA 4QMTA 2YDJA 3Q53A 4B6LA 4CFWA 4C8BA 4FKVA 1I44A 3O7LB 4AT4A 4YHTA 3UO5A 2J9MA 3A62A 1G5SA 2VWYA 3TKUA 2JAVA 4MNEA 5HVKA 3GCSA 4FSTA 3CCNA 4XJ0A 4CKIA 4RIXA 3HMPA 3PSCA 2CKPA 3QZFA 4EK5A 4MX9A 4XCUA 4N0SA 4NW5A 3ZBFA 2OZAB 2YZLA 1PXMA 2EB2A 4LFIA 3OEFX 2VX3A 4G5JA 2JKOA 4JL9A 4YHJA 3S4QA 2VTMA 4F9WA 4FYOA 4EHVA 5LCJA 1Y57A 3RBWA 3MVJA 3I7BA 4C2VA 1VZOA 1NW1A 1YDSE 5HVJA 4W9XA 2G2FA 4WSYA 5FBNC 4F65A 2A2AA 5AP2A 4BBEA 3QCQA 1GJOA 5EFQA 4DCEA 3Q04A 1XH9A 3LZBA 5D9HA 3NIZA 3R6XA 2JBOA 4UXQA 3R01A 3PP0A 3EFJA 4C4EA 4F9AA 2WO6A 2XNEA 2FH9A 2OW3A 5HCZA 5J7BA 2QD9A 3VUKA 3GCUA 2X1NA 1H28A 2BAJA 5K5XA 2YIWA 3CC6A 3UC3A 5C8KA 1BKXA 2A19B 1GZKA 2PVJA 1SNXA 3PE1A 4G17A 3VUTA 4DGOA 3KF7A 3MYGA 1Q8ZA 3ZO2A 3UMXA 2QOKA 3FSKA 3ET7A 1ZRZA 4MF0A 4IFCA 3NCZA 3KF4A 4HCUA 4YTHA 5LCKA 2QKRA 4A4LA 1T46A 3ZH8A 3MTLA 2WQEA 4OT5A 2C4GA 4YURA 1GZNA 1KE6A 5F94A 1H1PA 3R8ZA 5HG9A 4Z16A 3KL8A 1J1BA 5JFSA 1IA8A 1CKPA 2BUJA 3PJCA 3QGYA 4UWCA 1CKJA 4GW8A 2WTVA 4LRKA 5IUGA 5HX6A 5AM7A 3ZLWA 5M06A 4KRCA 1LR4A 1WBSA 5CWZA 4FTAA 2QU6A 1W82A 5D12A 4O6LA 2W1EA 4RJ8A 4XG6A 3A60A 4E5AX 4LGHA 4O83A 3EQDA 4BN1A 4FC0A 4UY9A 2EXEA 5M44A 3RHXA 5JMSA 4AAAA 3A7HA 3F88A 3FZPA 3KFAA 3LCOA 3POOA 4O0UA 3R8MA 5I9YA 4FG9A 5KKRB 3O8TA 4DN5A 2HW7A 2B52A 4FNZA 3CY3A 1G3NA 4WBOA 3WI6A 2VZ6A 3E64A 4FOCA 4IVBA 3ZYAA 4DFYA 3LJ1A 5CTPA 4P4CA 1DS5A 3R7IA 5C9CA 2XEZA 2XMYA 4HZSA 2IZTA 1PW2A 3IKAA 4WNOA 4E73A 4F99A 2UVZA 2IZUA 4HGTA 4P5ZA 5FM2A 2UW0A 2VO0A 3EKNA 4K0YA 5M55A 4PY1A 4FK6A 1DAWA 5CSPA 4NTTA 5LVOA 3QHWA 4CEGA 3LXPA 3HV4A 4AQCA 4IAFA 4F7JA 4FKQA 4G6NA 4LOPA 4AT5A 2XYNA 3BHVA 3ETAA 5LMAA 4UMQA 1PXKA 5LVMA 2GNFA 3V5LA 4D2PA 3RKBA 3Q96A 3KMUA 1PYXA 3FZ1A 3FPMA 3UP2A 4CFUA 1ZZLA 3FLSA 4IC7A 3ZFXA 1SVHA 1LPUA 5L6OA 5HU9A 5B2KA 3UQFA 4C35A 3B8QA 3I6UA 1H0VA 3D5VA 3WZJA 4BF2A 4FVQA 4MKCA 2FSMX 2A0CX 4GYGA 4Y72A 4YJUA 2YWPA 2IZRA 1CKIA 2XCKA 4EONA 4M0YA 5M4FA 3WYXA 5CU2A 3F7ZA 2IN6A 4PTGA 2JDVA 3QQFA 4LV8A 1MRUA 2C6IA 3V51A 3FZSA 4WNPA 3POZA 4KIKA 3PVUA 3MS9A 3SXRA 3IECA 2ZOQA 2FGIA 2QHMA 4TWOA 4ZY5A 2RFNA 4I23A 4RVTA 3VS6A 3ZFYA 4DC2A 3QRTA 4USFA 1FOTA 5IZFA 4D0WA 1XKKA 4I5MA 4L45A 3D7ZA 3T3VA 3O71A 3GFEA 2R3RA 4RA5A 3WE4A 4BHNA 3DKCA 4FIJA 3RAIA 5L4QA 4N6ZA 4USEA 1IAJA 3B2WA 3NAYA 3U4UA 2RGPA 1FINA 4S30A 5CU4A 5HE2A 4KD1A 3LFFA 3ZXTA 4BDGA 2IW8A 5JZNA 5M4CA 3TTJA 5HLWA 4K77A 3QC9A 2BAKA 2PTKA 2ZMDA 4K2RA 4BDEA 4DF3A 5CNOA 3HKOA 5FD2A 3MH0A 4ANNA 2F9GA 3N51A 4FBXA 5CZHA 3UNKA 5LWNA 1OL7A 4G34A 1XH4A 2KTYA 2PZPA 5FBOA 3AQVA 3GC9A 3Q4CA 4EOJA 3IW8A 4JIAA 2B0QA 4J98A 4U7ZA 5JT2A 2ZJWA 4BZDA 1BLXA 2EWAA 3LQ5A 3UQGA 1OBDA 2JGZA 3HMMA 3RCDA 1MQBA 2J5FA 4JG8A 4PMMA 4YP8A 5IDNA 2V5QA 3QX2A 3QZIA 2BDFA 3BU5A 2QI8A 3BWJA 4FKGA 2E9UA 4YC3A 4W4VA 5TOZA 1AGWA 5KMKA 4U40A 3OBGA 3D9VA 3MSSA 1SYKA 3PXFA 4JI9A 4GFMA 4M0ZA 4JDHA 4K1BA 5EYDA 3ZC5A 2QNJA 4BVUA 5M4IA 5HBJA 4XS2A 3AD4A 4GU6A 2C5XA 5ITAA 4YJQA 3KRLA 3QBNA 3UJGA 4J1RA 1E1XA 4NUSA 5J7HA 3VAPA 4TYGA 3OCGA 2F49A 5EI8A 5H8EA 2PE1A 3EFWA 4YLLA 2C3JA 5AUXA 1YI3A 4IX5A 4D1XA 2Y4IC 3FMMA 1OM1A 2IW6A 1JSTA 4ASDA 1U5RA 2BROA 3DT1A 4GYIA 2C6LA 2O65A 2XP2A 3VO3A 1JNKA 2ITNA 4LRMA 2VWUA 4UZHA 4Y95A 4YGAA 5AR2A 3BBTB 4FNWA 3C1XA 4FV5A 3QU0A 4MXYA 5CEIA 5CYIA 3GC0A 5D7AA 4PTEA 4ZSGA 4YSMA 4IHPA 3TTIA 4ENYA 3VRZA 1K9AA 2WQBA 3Q6WA 5DNRA 5IQGA 4JQ8A 4MXXA 4Y5QA 2JKQA 5L8JA 5BUEA 4EK3A 4DLJA 4ALWA 4FEUA 3R9DA 3VF9A 5A6NA 4O0TA 4D58A 1OIQA 5KE0A 2C5OA 2VV9A 3QCXA 5J1VA 5C8NA 4BZOA 3ZLSA 5ANKA 2OXXA 1Y8YA 3RINA 4EH8A 2W17A 2H96A 4UWBA 1ZYLA 5KNJA 4IAYA 2BZJA 3TKIA 4LMUA 4O2ZA 1P2AA 1V0BA 2XK9A 4YC6A 4EZ3A 4BY9E 2OFVA 3UIBA 5DLSA 2R64A 3P5KA 4FT5A 3TV7A 3SA0A 3BE2A 2J0MB 1KUTA 2GHGA 3QTXA 4GIHA 5CU0A 4D4VA 3GC8A 4CT1A 3CPBA 3Q2JA 4QQTA 1XH7A 1OMWA 1QPJA 2V55A 4OTFA 3W8LA 4R7IA 3V6SA 4GT5A 1OUKA 2RFDA 3F7WA 4EWQA 4RVKA 2OZAA 3O8UA 4WRSA 4A7CA 2JAMA 4AXAA 2X4ZA 5D1JA 5K0KA 4EKLA 3OP5A 4BGQA 2PHKA 1MUOA 2Y9QA 4RJ3A 1OKVA 2XS0A 5E8SA 5AR3A 5AX9A 4D2SA 3QQUA 2VD5A 4ERWA 1J7IA 2R3PA 3VN9A 2C1BA 4ACCA 3ZOSA 4QTEA 1XH6A 5E4HA 4EUTA 5HHWA 4FE2A 2DYLA 3KULB 4FEQA 4A06A 3IDPA 3N4VA 1F0QA 4OGRA 3OY3A 5DFPA 4C7TA 4HGEA 4PRJA 5HORA 3W33A 5IKWA 1YWVA 5F4NA 2VTTA 4F1OA 4AW2A 3G6GA 4EQCA 5H3QA 4FTLA 2V0DA 5H8BA 4ID7A 2GQSA 2WIHA 3EN7A 3AC8A 4AOIA 2IW9A 4FV3A 3SRVB 3UVRA 3NAXA 4YZMA 4ANLA 4ZSJA 3FKNA 5EYMA 3VS2A 4EKKA 1MQ4A 5H2UA 4YR8A 3KVWA 5CF4A 2WEIA 5JGBA 4H3BA 4BKZA 1UV5A 5IMXA 3LW0A 5JRQA 5J1WA 3TWJA 2BIYA 2BZHB 2YM6A 1ZMUA 1OI9A 2EU9A 4RMZA 5L3AA 3EN9A 4YNOA 4AX8A 4CCUA 3F82A 4U43A 5JZJA 4I0RA 4OLIA 1ZYJA 4M97A 5IA1A 4AN9A 5LXMA 2XJ2A 4PMSA 5CZIA 1A9UA 1GZOA 1TQIA 3G0EA 3MWUA 4IAZA 3R7VA 4E1ZA 4C61A 5KX8A 3C4XA 3V6RA 3ZMMA 4BZNA 4XEYA 5CQWA 4OTDA 4JQ7A 4JR3A 5DA3A 5L8KA 1IR3A 2JC6A 3EQIA 3Q5ZA 4HCTA 4ACGA 4BCIA 4FIEA 2W05A 4O21A 5HZNA 5AWMA 2GU8A 3DAEA 3GU7A 4RQKA 4BCJA 5I9XA 2O64A 3W2OA 4I20A 4RX8A 4YO6A 1ZXEA 4AGCA 3HNGA 4CFXA 1G8AA 2Y4PA 1Q8YA 3HV6A 4ITHA 5HNGA 3MPAA 4U42A 4D9TA 2C69A 3L9LA 3FSFA 5ETCA 1WBTA 3ROCA 4ENXA 1L8TA 4GCJA 3JY9A 2CHLA 1UNHA 4D0XA 1URWA 3PIXA 3QTRA 2XNPA 3HYHA 4X2KA 3E8CA 3MVLA 4DEEA 4M13A 2GS6A 5BVKA 2R0UA 2I6LA 4OBOA 4IE9A 1KE5A 2OKRA 3GFWA 2UZOA 4DFXE 5JQ5A 5CEOA 4AA4A 5BVEA 4FT9A 3N4UA 4DEGA 4O7RA 2YFXA 5CS6A 3RAHA 3LCDA 5HCYA 1FVTA 1QL6A 3DBDA 4GJ3A 4AA5A 4KBAA 4JX7A 2QOOA 3PXQA 4I1ZA 4AZEA 4RBLA 3PA4A 4AWIA 1QMZA 3HLLA 3EOCA 3EQFA 3JY0A 4AZTA 2WGJA 2WU6A 3GOKA 5GJDA 4E4NA 3MI9A 4KABA 1P5EA 3ZEWA 2BHEA 3JR1A 3F3VA 2ITUA 4R7BA 3OS3A 4AZSA 4L3PA 2C6EA 2BMCA 3Q60A 4FSWA 4TTHB 5DR6A 2B9IA 5CSVA 3DTWA 3QWKA 1WBWA 3AT3A 1QPEA 3CQUA 1JVPP 4FZ6A 2CKOA 1RW8A 4RT7A 4LUEA
chains in the Genus database with same CATH superfamily
2X8IA 2X39A 3DJ5A 2J5EA 3PVBA 4C36A 5JQ8A 4I0SA 3DXQA 2PL0A 4JBQA 3OF0A 3FHIA 4G6LA 3IGOA 4I22A 5KZ0A 3HDNA 4BB4A 3I7CA 4M7IA 2UZUE 5M57A 1LP4A 3GNIB 2PVRA 3PA3A 3KA0A 5DT3A 3NUPA 4B7TA 5CU3A 4BYIA 1XWSA 4RX7A 3F5GA 3KN6A 2I0EA 3UG1A 4CGAA 3ANRA 3GB2A 1JLUE 3LQ8A 4WIHA 2XBJA 4QMPA 5CQUA 3EFKA 5EYCA 4ZY4A 2J51A 1Q4LA 4QT1A 4DTAA 3CXWA 5BVWA 2OFUA 1JSUA 4MXAA 5DBXA 5CAPA 2BR1A 3KK8A 2GTNA 1URCA 4F6WA 2XARA 5DIAA 3UIMA 3SG8A 1OZ1A 3ZU7A 2PVKA 3K2LA 4FZDB 2CNVA 4WO5A 4O0SA 3C4ZA 2W99B 5DHJA 3RWQA 3U87A 5CI7A 1FGIA 3LCTA 2C3LA 3QYWA 3DQWA 4NFNA 3I5ZA 2G01A 3Q52A 3G90X 5AR4A 5FG8A 5FEEA 4YU2A 3W2SA 2X6EA 4R7HA 4U81A 1XHAA 1K2PA 2QODA 3K3IA 4FKJA 3PZEA 3QXOA 4K18A 5J5SA 5IUHA 2X0PA 4R3CA 4CZYB 5IH6A 4P90A 4UWYA 2QO2A 5AP7A 4ZK5A 4RVMA 4JNWA 3HRBA 5FDXA 4F63A 4M12A 3P5JC 5LVPA 1XO2B 5TKDA 4PDPA 2VTHA 1OIUA 1ATPE 3FZTA 2ZV8A 2R0IA 2WMRA 1EH4A 3BU3A 4DFNA 5FTOA 5FP5A 4LRJA 3R83A 2ZDTA 1DM2A 2VWVA 3R7EA 3BE9A 3CKWA 4PTCA 4UZDA 2QOLA 4RQVA 3DKFA 2XK8A 2B4SB 2C0TA 3DPKA 4RIOA 5KO1A 4DDGA 4IAKA 5HICA 4S32A 1S9IA 2Z8CA 4HVSA 4WUNA 4BKYA 3DB8A 3LJ2A 4U80A 5HNBA 3NUUA 4BIBA 2YM8A 4O7TA 4I6FA 4PMPA 2BFYA 3R7OA 5DRBA 5L6WL 3ZUTA 2XAOA 2XIZA 4KS8A 5I9ZA 5AR8A 3LFQA 3ENHA 3VS0A 2VN9A 4FV0A 2DWBA 4JVGA 4C37A 2CGVA 2QLQA 2X0GA 3ODYX 3TJDA 3S3IA 4BTFA 4D4RA 2XK3A 5E1SA 3V01A 3MB6A 3W0MA 2W1FA 4DHFA 4F6SA 4QTCA 5AA9A 5JGAA 4G3EA 4C58A 3FQHA 1IG1A 2CDZA 3QTZA 1YOMA 2R3JA 4M14A 2OF2A 3TUDA 3G51A 1YHWA 3CBLA 2CKQA 3I5NA 4E6QA 2WAJA 2WD1A 2VTSA 4QTAA 3R71A 2ESMA 1M17A 5AP4A 4ZJIA 5LMKC 3UNJA 4FTTA 4DH5A 5AUTA 1HOWA 3FAAA 4TY1A 4O7WA 2A4LA 4J71A 2QHNA 4EC8A 3G5DA 5KBRA 1WAKA 2C3IB 3HA8A 3DBQA 3QHRA 4OBQA 4QYHA 5JH6A 3FMJA 3C0GA 1OBGA 4YPSA 2UZLA 4L7FA 3KB7A 5J9YA 4RFMA 1UU8A 4DFUA 2WMBA 2X6DA 4M68A 2REIA 5GNKA 3GI3A 1OGYA 5AUWA 3WYYA 3QRJA 1UU9A 2QOHA 2H8HA 1M14A 4ACMA 2WMXA 5M56A 5EI6A 3QFVA 4QO9A 2KULA 5KUPA 2BCJA 4BDAA 2UVXA 4XBUA 2BRBA 2VTAA 1PXIA 3Q5IA 4L43A 4IFGA 3BQRA 4FMQA 5J87A 3T9TA 3VNTA 2VX1A 3O96A 3UTOA 3LMHA 3TJCA 3ZDUA 3KULA 3WOWA 5K0XA 5EH0A 3LFDA 2X7OA 4GK3A 4QYFA 2AYPA 5BMMA 4YJNA 4F08A 1V1KA 1JSVA 4P7EA 3OCTA 2G2HA 4GVJA 2ITWA 4EHEA 3KCKA 1HCKA 2VUWA 4F64A 4O7LA 3KXXA 2OF4A 4QPSA 3ZLYA 1SVEA 4WSQA 5AV3A 4ZZNA 3QAME 3VS1A 4DGNA 3UO6A 3OBJA 1U46A 3GU5A 5DG5A 4JBOA 1ZYSA 3LMGA 3SRVA 5HE1A 2JDTA 2YCFA 1WCCA 4IXPA 3W1FA 1R39A 4R77A 1O6YA 3K54A 4TWCA 2ZFYA 4XG4A 4ERKA 3ZUUA 5I0BA 3CTQA 2CSNA 5CASA 3HAVA 1Q8UA 5EW8A 2J50A 5JGDA 4QMOA 3EMGA 3Q6UA 5JK3A 4FTNA 2GSFA 2QOCA 3ATSA 3RAWA 1W7HA 4H39A 3OWLA 2XNNA 5B2MA 3SOAA 3AC3A 3DK3A 1BX6A 4FTMA 3NS9A 4Q9ZA 1Q5KA 2VTNA 3ZDIA 3ZSGA 4BTMA 4FTRA 1PMVA 4RLKA 2HY81 4TYHB 2QURA 4CG9A 5CXHA 4I93A 5K4JA 4KKEA 4WHZA 5L2TA 4FK3A 2UZBA 4ZZMA 4BCPA 4QEBA 4QPMA 4FODA 1G8KA 3ORXA 2JFMA 4FTUA 3TNHA 3COIA 3V3VA 3WF6A 2W1ZA 5TT7A 4ALVA 4CTBA 3MFTA 3I6WA 1G8JA 4DTKA 4QDVA 5HO6A 5HO7A 5IQFA 1Y6AA 2A98A 1BUHA 3ORKA 4MD8E 2EVAA 3QD3A 3PXRA 4KRDA 3RALA 3FI8A 4YO4A 2PZ5A 3VUDA 3OTUA 3AKKA 4FVPA 2ZV2A 3ORIA 2E2BA 4U79A 4XP0A 3UODA 4RWJA 5EQYA 4W4XA 4C2WA 4CCBA 2J0LA 3OUNB 2JEDA 3MH2A 4C3FA 2JKMA 3UVPA 1W2CA 5IA4A 3Q3BA 1MRVA 2E9VA 4XG2A 4KIPA 4S33A 4GU9A 4Y73A 3GOPA 3AC1A 3SKCA 4GL9A 3MFSA 4F4PA 4ZTQA 3KRWA 3QWJA 4QQ5A 4QP8A 3C50A 5H8GA 3V5QA 2B54A 3AGLA 3EKKA 4RJ5A 5EK7A 3DCVA 1PXPA 5AV4A 4CT2A 3BGZA 3MFRA 4OTIA 4BWKA 3OCBA 1WVYA 3SDJA 2ZV9A 3VUHA 1H8FA 2XK4A 2ONLC 4H1JA 4I6QA 4X0MA 1NXKA 4LYNA 5FRIA 2PMIA 3FPQA 4YUQA 3DNDA 4PV0A 4A9YA 3QTSA 5HESA 3UZPA 5JN2A 2X9FA 5C4LA 2VWWA 4F9CA 4AU8A 5DOSA 2W5BA 3FE3A 4OTPA 4WNMA 4S2ZA 1YI6A 4W4YA 4KSQA 4EHZA 3UYSA 1ND4A 3SAYA 4EK8A 2CKEA 2WTCA 2XYUA 5EG3A 4IEBA 3TEIA 4ZXTA 1B6CB 4P5QA 5I3RA 4DE4A 4EH7A 3FMHA 3FMEA 5CT0A 4EH3A 2OZOA 4U3YA 4JDKA 3NLBA 4OR5A 5CEQA 5E92A 4J99A 5IEVA 3DLZA 3W0RA 3VHKA 2G15A 5EW3A 4KNBA 1M2QA 3Q2MA 4EYJA 3KRXA 5A4TA 5HG5A 3U6IA 3BGPA 2CGXA 5IQAA 3DKOA 4V0GB 5CNNA 3JUHA 5D41A 4ANSA 2Q83A 3DK6A 4XG9A 3PXZA 1PY5A 1GIHA 4MUQA 2I0VA 2FSLX 4L7SA 2A27A 2VGOA 4D1ZA 5CENA 2Y4IB 3EFLA 2R3OA 3PPJA 1OUYA 2WTDA 1U4DA 2ZB0A 4U45A 4D55A 4C3RA 4Z7HA 3I0OA 4XMOA 4GRBA 4AE9A 2EXCX 4UN0C 3UZTA 2XF0A 5GZAA 3DY7A 5IQIA 2GNLA 3I60A 3MB7A 3PLSA 3U55A 2R3IA 4HCVA 3R8PA 3ZHPC 3R00A 2UW4A 5J79A 2XKFA 4NCTC 3FBVA 4PDSA 4U97A 5BPYA 2PULA 4AZWA 2OH4A 3BYMA 5DH3A 1WBNA 2P2IA 3LXNA 2X2MA 4BICA 2Z7LA 2W96B 1F5QA 4GFOA 5ANGA 2XM9A 3ZSHA 2UUEA 3CLYA 3PG1A 4L00A 4O27B 4CRLA 4F9BA 5ICPA 2ITYA 2R9SA 2YCRA 4W8EA 4BIDA 3W8QA 2P0CA 3C7QA 5HG7A 3DA6A 3U6JA 4DEHA 2UZEA 3ZTXA 4BCNA 2C5VA 1AD5A 4MVFA 2AEGA 4G9RA 1WBPA 3VS4A 4KWPA 2OLCA 2PMLX 1PF8A 1ERKA 5AP6A 5FTQA 3V5TA 3ORNA 3DNEA 3H9OA 3PYYA 4GEOA 3VW6A 2YIXA 4D1SA 4DEBA 3F2RA 3E7VA 3OW4A 2XB7A 4BCQA 3K5UA 3ANQA 5CF6A 1H1SA 4ZLYA 2HELA 4IAAA 2W4KA 3TNIA 4FGRA 3IGGA 2WPAA 2C5YA 4XLVA 1A48A 3O51A 5E8TA 1FGKA 4MK0A 1W98A 2XNMA 2C1AA 5FEDA 3BLQA 5GIPE 3UPXA 4RIWB 2UW9A 2P2HA 2HZ0A 5BYLA 3L8VA 1J3HA 2WTKB 4UBAA 4FNYA 4XP2A 4ACDA 3W10A 3R2YA 3R9OA 3FWQA 4MXZA 1JQHA 1JWHA 3E7OA 1LEWA 4Y83A 3C0HA 4J53A 4FUXA 2ONLA 1YXTA 4FTCA 5JFWA 3TUCA 1JAMA 3QL8A 2BTRA 4CSVA 3P23A 4DGLC 2ZV7A 4XHKB 5IF1A 1FPUA 1YI4A 3E92A 5ANEA 4C3PA 4QMNA 1YHVA 4YJSA 1GAGA 1XQZA 1ZAOA 4IX3A 5L2IA 1YOLA 5A4LA 4FV9A 4FI1A 3VONA 3IPHA 5C1QB 2DS1A 1IEPA 1KV2A 2JDRA 5AUVA 3R8LA 3WZDA 3TZ7A 4FV8A 3VS5A 2NYAA 3MW1A 5E8VA 4LL0A 4PNKA 4PL3A 4RPVA 2RFEA 2W4OA 2XRUA 4ZS0A 3V8WA 3C13A 3MH1A 3UGCA 3FMLA 3MY1A 4K9YA 3NFGB 4AXEA 4BTJA 4TZRA 4BTKA 4FT0A 2Y8OA 5AEPA 1XH5A 3WIGA 3UIXA 4I6LA 3UC4A 3RPVA 1O9UA 4DHJA 3R02A 3IW6A 4IX4A 4HVIA 4KKHA 3OWPA 1XR1A 2PWLA 3NYXA 4O81A 4D9UA 5AUYA 4FSUA 5HNIX 2BDWA 3FJQE 1Q99A 4LG4A 3OHTA 4FT3A 5AR5A 2PUIA 5EI2A 5F20A 3OTVA 4GT4A 2GPHA 3CJFA 3CIKA 4O1OA 4AG8A 3W32A 3F5UA 2GHLA 1IASA 1YQJA 2J6MA 3F2NA 3R63A 4QRCA 4ANMA 3IDCA 3E93A 4JBVA 2IF8A 4MF1A 3QA8A 4IWOA 4X21A 4G2FA 4CFNA 5JSMA 4HGLA 5C8MA 4YJTA 5GIOE 1PMNA 4DGMA 5A4EA 2YIYA 3FI4A 5JEBA 3NNVA 4EJNA 3E3PA 4RC4A 1YXSA 3II5A 1X8BA 4E4MA 3CD3A 3R7UA 4XV9A 3ORTA 4I3ZA 2OWBA 2YERA 3SD0A 3SV0A 2VTRA 3KK9A 4ZJJA 4A9UA 4QP7A 4I21A 3RPSA 5DEWA 2VWZA 4QMVA 5HEZA 3ODZX 5FGKA 4LI5A 3TXOA 4EEVA 4RX5A 4KBKA 3E8EA 5FWKK 5IA2A 3E88A 4DHIB 3MDYA 4HYSA 3MA3A 4ITIA 4TYHA 3WZEA 4YNEA 4ZTSA 3QD2B 1SNUA 4HJOA 3DBFA 4XG3A 5FEQA 5KMJA 4CZUA 3QRIA 4EL9A 4EZ7A 3HUBA 5E8ZA 4EOQA 2OJ9A 3IS5A 4AGWA 2WMAA 3RI1A 3NZ0A 3SXSA 1M52A 3FLNC 3B2TA 2W1IA 4FSNA 4C4HA 3BQCA 2HK5A 3SLSA 3ACJA 1Z9XA 3LXLA 4NJDA 3W2CA 4CNHA 3Q9ZA 4EH5A 1YXUA 4ZZOA 5JFXA 2VNWA 5I9WA 4Q9SA 2SRCA 4CYIA 2XA4A 1Q24A 5A3XA 5IISA 2HENA 3F69A 3A7FA 3HV3A 1MP8A 3IO7A 3BI6A 3KXHA 4OTQA 4XOZA 4CMTA 5IEYA 2YM4A 1IA9A 3OC1A 5J8IA 3OCSA 3ORLA 4X2GA 1UU3A 4KIQA 5AJQA 1JBPE 2DUVA 4YMJA 5KMLA 1W83A 4EOIA 4DITA 2BKKA 4WG5A 5E90A 1VYWA 2ITVA 5FQDC 5AP3A 5FXQA 2YHVA 3C0IA 4XLIA 3FZOA 3MTFA 3GBZA 5TF9A 3QF9A 3WF5A 3PJ8A 4TWPA 3TG1A 4FGBA 4O0YA 1G8SA 3IOKA 1CTPE 4I5CA 3PRIA 4JJRA 3CGOA 3R8UA 1ZOEA 3Q32A 4V05A 3SX9A 4BI0A 5L8LA 2WTKC 3ROYA 4XH6A 2YM5A 2J2IB 3PJ3A 3R9NA 3KQ7A 2WIPA 3VULA 3PE2A 4C4FA 1HCLA 4CQEA 4ZLOA 5A54A 5IPJA 4WG3A 3KY2A 3M1SA 4X3FC 4L67A 4AN2A 2CN8A 3GCPA 2YIQA 5TO8A 5A6OA 3IK3A 3OXZA 5EQEA 2B9FA 4R6VA 5HBHA 5HVYA 2GHMA 2CPKE 2OI4X 2R3HA 3G15A 4FVRA 3FXZA 3TCPA 4UMRA 3D7TB 4IJPA 4O7SA 4B4LA 2JDOA 2IG7A 4IM0A 3UDZA 4R3PA 5AM6A 4U8ZA 3RCJA 2XANA 4EJ7A 3CE3A 4IZ5A 4MD7E 2ZM4A 3ALNA 3LLTA 5K9IA 3CTJA 2E9PA 3RPOA 5JRSA 2W1GA 1PXNA 5C03A 4IQ6A 4FL3A 4PNIA 1WZYA 3QZHA 2RL5A 5I9VA 3R1YA 4ITJA 4XUFA 1W8CA 2B9HA 4M84A 4OT6A 4AN3A 3TKHA 5CEMA 2BALA 3RPRA 4NWMA 4HOKA 3TUBA 4A9RA 2XIYA 2XKDA 1QPCA 3D2IA 3OXIA 4UYNA 5TR6A 4E20A 4N70A 5A4CA 3S95A 2VTOA 4JR7A 5L2SA 4V0GA 4C33A 3NSZA 3HL7A 1REJA 5HIEA 4F6UA 3F2AA 4U6RA 3V04A 2HIWA 1YKRA 2X7GA 3NDMA 4YTIA 5FM3A 2PYWA 3VQUA 4FNXA 3P08A 4I92A 4I94A 2OIQA 5LVNA 2XNGA 3EQRA 4IB5A 5CX9A 2QKWB 4AP7A 4OW8A 3QC4A 3COHA 3IW4A 5AP0A 4K11A 3LFEA 1OITA 4QMWA 2FA2A 3PXYA 4S34A 5DN3A 3R0TA 3SXFA 3AG9A 4YZ9A 1L3RE 2CCHA 4L9IA 4MHAA 3LFCA 4PUZA 3PP1A 4FV2A 5LVLA 3P0MA 3R8VA 2PUNA 4NK9A 3ELJA 3C9WA 4WRGA 3D94A 3SQQA 5HIDA 2X0QA 3ZCLA 1JOWB 3AC4A 2QQ7A 4FSZA 4IWDA 1ZMWA 3HMIA 3RZFA 2BKZA 1GIIA 1H08A 3PY3A 3R73A 4R78A 1H07A 4IDVA 3UG2A 5A14A 2HWOA 3NGAA 2YJRA 1OECA 3PJ1A 4FIFA 4UXLA 2WOTA 1OKZA 3RPYA 4ANBA 2WXVA 4IACA 4CXAA 2VWBA 3CJGA 4D5HA 2XIRA 5IQCA 3FC1X 4J8MA 4IWPA 1RDQE 3CTHA 2CNQA 4IZAA 3Q9YA 3BHTA 3FKOA 3W2RA 3DZQA 3QQJA 3NEWA 4QPAA 1FMKA 4FKOA 4X7QA 3R9RA 4ZMFA 1GNGA 3COMA 2VTJA 3QXPA 3QCSA 2O2UA 1TFFA 2GTMA 2W5AA 4RG0A 1H26A 4YTCA 4FV6A 4IB0A 4RIWA 1Q8TA 3BBWA 5CF5A 1VYZA 2JLDA 1UKIA 3EZRA 4AXCA 1RE8A 3LCKA 2W5HA 4RZWA 4RC3A 3G0FA 3LJ0A 4QQCA 3R1SA 1BMKA 4TWNA 5D11A 3JXWA 3ZSIA 4S31A 4ASZA 3JVSA 1M7QA 2F7ZE 2WELA 2B1PA 3IONA 4X2FA 3D83A 1B38A 3VF8A 1H01A 1FVVA 3ZFMA 4F0IA 3G33A 2NRYA 5L2WA 4QP1A 3PWYA 3KXGA 4M69B 3EQHA 5TE0A 1XMLA 2Z7QA 4ANQA 2HZIA 5CI6A 2EUFB 4OBPA 4BYJA 3CEKA 2BRGA 2JIUA 1J7LA 4DCAA 2HCKA 5GHVA 3ZM4A 2YN8A 3FZRA 1ZOGA 4CMOA 4C38A 5HGIA 2HZNA 3EL8A 3RJCA 3L9PA 2XKCA 3LFNA 5AAGA 3HA6A 3R22A 1UWJA 3SOCA 3MPMA 3ULIA 3AMBA 3S2PA 3LXKA 2JDSA 5CANA 4BR3A 3PIYA 4TT7A 1V0PA 3UE4A 1FMOE 5DR2A 3QRKA 3DQXA 4N6YA 4DFZE 1YOJA 3W2PA 3V8SA 2XEYA 5CAUA 1Y8GA 3UP7A 3TNPC 3BU6A 2Q0NA 4XNEA 2W1DA 4HZRA 5AX3A 4BCHA 4MXOA 1WVXA 3NUXA 4YPDA 3R9HA 4F7SA 3NUNA 1PXLA 2OSCA 2A1AB 5CVGA 3LE6A 3FLQA 2R3NA 5KMMA 1H0WA 4APPA 3VIDA 1UVRA 3F9NA 4KB8A 1PYEA 2X2KA 5M53A 1ZOHA 3V8TA 2GNJA 4U41A 4I24A 2YJSA 3CD8A 3NRMA 4EK4A 4YBJA 5AFVA 2C0IA 4R5SA 5BVDA 2XJ1A 4DT8A 2WHBA 1TKIA 2RKUA 3GU6A 1CMKE 2C6DA 4RSSA 5HI2A 4YJVA 3RP9A 5HLNA 4AZFA 4FV1A 3ATTA 2R3KA 4QYYA 4TYEA 3W2QA 4HVDA 5ETFA 3QQLA 4JQEA 4OAVB 4H3QA 3QALE 5DRDA 4TL0A 5JFVA 5HX8A 3VWAA 3VBYA 2X7FA 4BBFA 2VRXA 1YWRA 2X9EA 3EYGA 3ITZA 5H9BA 4DFLA 4NM5A 2VU3A 4MTAA 3TZMA 3DXPA 3U54A 1CDKA 2XKEA 2WB8A 1XBBA 3DOGA 2CJMA 5IEXA 1BL6A 3UVQA 3PDTA 2CGWA 3LM0A 4O0VA 4KAOA 4MBIA 3HEGA 4A4OA 2BAQA 5F1ZA 3GGFA 5DYJA 3QCYA 4O0WA 3ZO3A 2PSQA 3DU8A 4L3JA 1UNLA 1TVOA 2BZIB 3FC2A 3F3WA 4FRFA 4FKUA 4U44A 5A46A 2CNUA 3BWFA 3NFFB 4HYUA 2BILB 3AMAA 3TIZA 2R3MA 4I5PA 3W18A 3OY1A 3L1SA 4EZ5A 4HVGA 4DH8A 3JVRA 4NM3A 3I79A 4ACHA 4QMUA 4G3FA 4CTCA 2W9ZB 2YIRA 5AAFA 2YA9A 3H4JA 3O17A 2GFSA 4HYHA 4ZOGA 3RM6A 2HZ4A 4JLCA 5E8XA 1XJDA 3ZM9A 4MEDA 4QOXA 3FMKA 5E7RA 4PP7A 5HE0A 4YTFA 5E8WA 5AV0A 4DG2E 4WD5A 3WF7A 4PDOA 3ZONA 4BIEA 3IW5A 3K5VA 3REPA 4EBVA 2XK6A 3FLZA 5KHWA 3A61A 4L53A 3ZEPA 4RLLA 4BDFA 1VEBA 3OFMA 4EI4A 4QP3A 1TQMA 5DEYA 4H36A 3TN8A 5IQDA 4WOVA 1OIRA 3NUYA 1S9JA 4MNFA 4FG7A 5GZ8A 1Y6BA 3AT4A 2Y6OA 3ORZA 4H58A 2YWVA 1VLRA 3P7AA 4FZAB 2PE2A 2YDIA 4D2RA 4O7NA 2WQNA 4Q2AA 3E8NA 1OL2A 4QYEA 3OT3A 4B8LA 3EQPA 3S0OA 4D4SA 3IQ7A 2XNBA 4AFJA 2GNIA 5FUTA 4F9YA 2BRNA 3OXTA 2ZMCA 3E87A 2ITOA 4TPTA 4O38A 4TNDA 3U9CA 4ALUA 4EOSA 4O7VA 4OTGA 3D7TA 2UW5A 2ERKA 2R7BA 1PXJA 4MCVA 3Q9XA 3GCVA 4Z3VA 3ZRKA 4NZWB 2Y0AA 1E1VA 3FYKX 4EC9A 5M07A 5I5ZA 2VTIA 3QQHA 3L9NA 1UKHA 4MWHA 3OVVA 2WU7A 4ZLZA 5CAOA 2XALA 1OL1A 2JIIA 4NEUA 3ZO4A 4DTBA 2I1MA 4XYFA 4F78A 2OJFE 4KA3A 3TV4A 3L8XA 4CYJA 2EXMA 3KMWA 2PVLA 5E1EA 2OO8X 2VTPA 3M2WA 1M7NA 3DTCA 1PRYA 2J90A 2UW6A 5BYZA 5EM5A 3H9RA 3NYVA 2XRWA 3PSDA 3EB0A 4DA5A 1YVJA 3AC2A 3SGCA 1PXOA 4LM5A 3BELA 2I0HA 1QCFA 4GSBA 4DYMA 3TZ9A 3Q9WA 4JDJA 1CM8A 2C5NA 3KXNA 1OKWA 4F0GA 3NMUF 5B0XA 2R5TA 3F3UA 3ZZEA 4E5BA 2UW7A 4O6EA 3FL5A 2ZB1A 4J8NA 4NIFB 2R4BA 4D2WA 4G6OA 4EOLA 5LQFA 4JT3A 3PY0A 5IUIA 3RM7A 3U4WA 5F9EA 1ZARA 2WQOA 4R5YA 5M09A 3FLWA 3H0YA 4M66A 3C5UA 4NTSA 4BJJB 3LFBA 3RK7A 4ANOA 3IOPA 3PVWA 4O82A 3UZRA 4GK2A 3A4OX 4ZTLA 4D5KA 4DHZA 2JFLA 4RJ7A 4FJVA 4FEVA 3SW4A 5IH5A 1Q61A 3UOHA 5HE3A 2HXLA 3GQLA 4FKLA 5CSWA 5HBEA 2QOIA 3PY1A 3PG3A 3COKA 2BRMA 4G5PA 4UB7A 2CN5A 3MA6A 5ANOA 4O84A 4W4WA 2PK9A 4EQUA 4ZJVA 5LMKA 3F3ZA 3BV3A 3O2MA 4R8QA 3NUAA 5FLFA 2ZM1A 2PVHA 5GZ9A 1H1QA 3R21A 4L01A 4UEUA 2FSOX 2QVSE 4V04A 5EM6A 2XM8A 4DEAA 1J7UA 2XZSA 1DAYA 3BCEA 3GENA 3RNYA 4TYIA 3ZLXA 4DFBA 4NJ3A 4NM0A 4GG5A 4AFEA 4C59A 4ZTMA 3N9XA 2X4FA 4G3GA 2PVYA 2EB3A 5AV1A 2DQ7X 2JBPA 3MJ2A 3NCGA 5HLPA 4QTDA 4TN6A 1T45A 3EYHA 3BHUA 4BGGA 5DT0A 1WBOA 2BZKB 3VUMA 3VRYA 4BHZA 2WTJA 1PKGA 5FTGA 3QQKA 2UW8A 3RTPA 4IADA 5BVOA 2H34A 3VBTA 3TM0A 5DPVA 2CLQA 3MJ1A 4L44A 3KRRA 1YW2A 1SMHA 3KGAA 2W1CA 4M69A 1KOAA 1K3AA 2X0OA 4F7LA 2WZJA 3RMFA 3NNUA 5M4UA 3T3UA 3NX8A 2R3LA 4J95A 4WNKA 2G2IA 1WBVA 2ERZE 4O4EA 5KBQA 1WFCA 1NY3A 2QG5A 3AGMA 3A4PA 3LHJA 4NM7A 1XBCA 4KBCA 4IC8A 5CVHA 3UIUA 2YISA 3GP0A 3E62A 4PPAA 1JKSA 4IH8A 4DGGA 2X81A 4EOKA 1OL5A 4DEIA 5IA3A 4BL1A 2IEWA 2ZYBA 5HOAA 3DFCB 4I4EA 3C4FA 3TZ8A 4ZTRA 2R3GA 4PWNA 5E8YA 4N4SA 4I6BA 4BWXA 4WA9A 3SVVA 3KREA 4AW5A 3LAUA 3MGYA 4Y85A 2PZYA 2C47A 3FY0A 3S1HA 4RZVA 3UQCA 2Q0BA 2VO3A 4HPTE 1M2RA 2IWIA 2O3PA 2YZAA 5CALA 1NVRA 4M67A 1YRPA 4ZSAA 3HZTA 5IH4A 1NVQA 3OOGA 3KXMA 3OT8A 3MV5A 4BDJA 2AC3A 4NYEA 3BIZA 4DT9A 2P4IA 2ETRA 3FMNA 4Z9LA 4GUBA 1VR2A 2WNTA 1H27A 4IM2A 4X3JA 5G1XA 1U59A 2GS7A 1SZMA 4CFVA 2H6DA 1ZMVA 4CKRA 4RWKA 3P79A 5BV3A 3TNWA 2XIXA 2WMWA 3BYOA 3SC1A 1ZYDA 3WZKA 5IA0A 1Q3DA 2WEVA 1W2FA 3CP9A 4FZFB 1PMEA 3HECA 4AW0A 4F1TA 3PUPA 4EWHA 4O86A 4FX3A 4F09A 2ITZA 4CMUA 2YM3A 3OWKA 3MIAA 4FIIA 4YZBA 1YDTE 4NU1A 4FUYA 3HP2A 3ACKA 4E26A 2GNGA 4AOJA 3OWJA 5ACBC 2IPXA 1YHSA 3VJOA 1Q62A 2J0JA 1WMKA 2VTLA 3LOKA 3QTUA 5DT4A 4DINA 3GU4A 5IU2A 4JDIA 5CAQA 3C4CA 3GQIA 3ERKA 5EDRA 2BIKB 3GEQA 4YJPA 4FKWA 4AT3A 4G16A 4LOQA 3VQHA 4O4CA 2PVNA 4YHFA 1FBNA 3AOXA 3HMNA 4EOMA 5CF8A 4JXFA 3V5JA 5M51A 3QZGA 4B0GA 3FI2A 2W0JA 3I4BA 4BKJA 3UDBA 2QO7A 5ANDA 4GUEA 4A4XA 3CY2A 4ONAA 3QTIA 3RNIA 5JKGA 4WUAA 4IJ9A 2BFXA 2O5KA 3TNQB 2BHHA 2OXDA 2E9NA 4RVLA 1BI8A 2BTSA 3BLRA 3PJ2A 4V01A 4KSPA 1AQ1A 3HV5A 4X3FB 3VS3A 2FO0A 3RVGA 4E4XA 3ZXZA 1P4OA 3QYZA 3LVPA 5T6KA