1JPAA

Crystal structure of unphosphorylated ephb2 receptor tyrosine kinase and juxtamembrane region
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
299
structure length
273
Chain Sequence
KIFIDPFTFEDPNEAVREFAKEIDISCVKIEQVIGAGEFGEVCSGHLKLREIFVAIKTLKSGYTEKQRRDFLSEASIMGQFDHPNVIHLEGVVTKSTPVMIITEFMENGSLDSFLRQNDGQFTVIQLVGMLRGIAAGMKYLADMNYVHRDLAARNILVNSNLVCKVSDFPIRWTAPEAIQYRKFTSASDVWSYGIVMWEVMSYGERPYWDMTNQDVINAIEQDYRLPPPMDCPSALHQLMLDCWQKDRNHRPKFGQIVNTLDKMIRNPNSLKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords neural kinase, Nuk=Eph/Elk/Eck family receptor-like tyrosine
publication title Structural basis for autoinhibition of the Ephb2 receptor tyrosine kinase by the unphosphorylated juxtamembrane region.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transferase
total genus 85
structure length 273
sequence length 299
chains with identical sequence B
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2001-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 1jpaA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 1jpaA01
1VEBA 5HBJA 3KQ7A 3UZPA 3A62A 4F9WA 4RGJA 2YZAA 4Y85A 3VW8A 5HLNA 3WE4A 3E7VA 3LFSA 4GG7A 4IAIA 4NU1A 5BUIA 5C8NA 4U41A 1PXKA 4KUJA 2QOFA 5A4CA 2XIXA 5L6PA 2B0QA 4ZZMA 3FY0A 4TYIA 4DINA 2VTPA 3LE6A 5AUVA 2W0JA 1JKTA 4ZY6A 3Q6UA 3Q5ZA 2QOBA 4IJPA 4AOIA 3RNIA 3AT2A 2WOUA 5AX9A 4HPTE 2GTMA 4IQ6A 3IONA 5HOAA 5FP5A 1YOLA 4ZSEA 2X6DA 3QWKA 4TWNA 1KE9A 3TJCA 3E7OA 3RPYA 3CLYA 4XBRA 3I4BA 4NFMA 5BYYA 1KE6A 2PVKA 3NUUA 3VRYA 5TE0A 5KKRC 3PY0A 4FTOA 1Q4LA 5L2WA 3GU6A 4HGSA 5DRDA 3FZ1A 4ZTHA 2PZPA 2JFLA 3UIXA 3JPVA 4BCKA 2XNMA 2R3FA 1F3MC 2CCHA 2Y8OA 2X2LA 3CKXA 3R8ZA 4AW0A 5M51A 3H0YA 2KTYA 3ZUTA 4CLIA 3QXOA 1GOLA 5JGDA 4EYJA 3F88A 2WTVA 4J7BA 2CGWA 2HW7A 3UBDA 3DDQA 4L52A 2X7FA 4CFNA 3CTJA 4HZRA 3R8UA 1IAHA 2UZEA 5HX8A 4FK3A 5HICA 5CQWA 5DNRA 2WQBA 4FTTA 3SOCA 1EH4A 3NX8A 2XM8A 4TY1A 4FYNA 5C26A 2R0IA 3EOCA 2X8DA 4IZAA 2YIQA 5E8SA 1MQBA 4FOBA 4FIEA 4U6RA 5IUGA 1OPKA 3EN6A 4G3GA 2B52A 2UW9A 3PY1A 3F3ZA 3KB7A 4I1ZA 1PXPA 3DBQA 5JK3A 4JDIA 3UO5A 1JKSA 2W4KA 3F9NA 5JRSA 2YIXA 4O1PA 3EMGA 4YZMA 2WTJA 4FG8A 5EQPA 4JG7A 5AUWA 4YJSA 2BIYA 4WKQA 1B38A 4S33A 3W32A 3SC1A 3KK8A 4QMZA 5IUIA 3BLRA 4OTQA 3TZ8A 3V8WA 5AP0A 1R0EA 4NCTA 2C6MA 1H26A 4UYAA 3EB0A 4GYGA 3A8WA 3VS0A 2UZVA 4AGCA 1UKIA 4CCBA 4CT1A 1V1KA 4L68A 5D9HA 5KMLA 5DH3A 2J90A 3LW0A 2J5EA 4I23A 4D4RA 5K5NA 3TKUA 4QMOA 2CKQA 3LJ2A 3Q2JA 5M4IA 3VUGA 5FEDA 4U97A 2IW6A 4RVTA 2ZM1A 4R3CA 4EWHA 2IN6A 3CQUA 2VO3A 3LQ3A 3SKCA 2P2HA 4DA5A 3MWUA 3TKIA 2BFYA 3GP0A 4BHNA 3ZLYA 2BAJA 4BL1A 3BU6A 3OEZA 5LCKA 5HCYA 5DIAA 3R8MA 1H24A 3SX9A 4LQMA 4F0FA 4QMTA 3NNVA 5LMKC 1Y8GA 4AFEA 1ZLTA 4JDKA 4XLIA 2XK4A 5L2SA 2JEDA 3QQJA 1Q3WA 4HCTA 3R0TA 4W4VA 3TI1A 4QMNA 2BZHB 4NM0A 4F4PA 3QZGA 5EYMA 2WD1A 3GFEA 1XHAA 1XBCA 4OW8A 4O0RA 5BMSA 1JSVA 4EUUA 1LR4A 5AAFA 3FI8A 4FIFA 5E8TA 4UWYA 1J3HA 3AC5A 3LOKA 4DEHA 5I3RA 1WBPA 5AV4A 4PPCA 3RNYA 2R5TA 2WQOA 3PSDA 4FL3A 5H3QA 3F3VA 2XS0A 4AA4A 4GJ3A 4XG4A 4BDCA 4Q9SA 5HVYA 2PMOX 2R3RA 4O27B 5HU9A 3ACKA 4IAAA 4EH3A 4KIKA 4QMYA 4ALVA 3O17A 4IWOA 4D2VA 5KMNA 1B6CB 3PWYA 3HV3A 2OSCA 3IDPA 4GS6A 4V0GA 4P5ZA 2XCKA 4JQ8A 2UZNA 3F61A 5JT2A 4OT5A 4TN6A 3BQCA 3DLSA 3BHTA 3LJ1A 4E20A 2OZOA 4FA2A 3B8RA 4GSBA 5IDPA 5CLPA 2B1PA 3VW6A 2ITZA 5M53A 4L46A 4XS2A 4RFZA 3AC2A 4F6WA 2UW7A 3AT4A 3MPTA 2CGVA 3LCDA 3MH3A 4XG7A 4NTSA 3NYNA 4AOTA 2GS2A 2HELA 3C4FA 3DFCB 3W10A 5CEKA 2VTJA 2PVLA 3DTCA 1FQ1B 2VO6A 3PXYA 2AC5A 1L3RE 2OK1A 4G3EA 4E4LA 5KX8A 5CALA 3WE8A 3GT8A 4CTBA 3AG9A 1UU3A 1WVWA 3AMBA 5CZIA 1H1PA 4P7EA 4XG3A 2OH0E 4DE4A 4NH1A 1UWJA 3MIAA 4XP0A 3TXOA 3WBLA 3ZC6A 4F7NA 1PMVA 4QD6A 5CNOA 2C3JA 4EH6A 4GJ2A 2X81A 3TT0A 3HMNA 4NW5A 1Q3DA 4MWHA 2PMNX 3OY1A 3U8WA 3BLQA 3IW5A 4FG9A 5JSMA 4ANNA 4RVMA 3R9HA 4MXCA 1XBAA 1JQHA 4DBNA 3MVMA 2QO7A 1LUFA 3LKMA 3EZRA 5CT0A 4FKSA 4BGGA 2BHHA 2Z7RA 5DFPA 4RVLA 3AMAA 2ZV9A 2ZB0A 3R02A 3AC4A 3ZXTA 5GJGA 1M7NA 1Y57A 5I9WA 4MWIA 2ZMDA 4YHTA 5GIPE 5DLSA 3V01A 1HCLA 5IQEA 3G6GA 5F9EA 2XK6A 4NFNA 4UXQA 3RINA 3VBVA 4FSNA 3THBA 4AP7A 3EYHA 3QZIA 3QUDA 3DJ5A 3Q53A 2I0YA 4RX9A 3WZKA 4HNFA 2XYNA 3CJGA 4XV9A 3RK5A 2Q0BA 4YTCA 5LMBA 2VX1A 3PVBA 1VYZA 5HG7A 5GZ9A 4JIKA 2QD9A 5JZNA 4FKPA 2W96B 1XQZA 3AXWA 4AE9A 4IB0A 5TT7A 3UYTA 4PMPA 5CI6A 2P4IA 4DH7A 5J1VA 3QUPA 2PHKA 4LL0A 3SRVB 4DH1A 5L6OA 4MXAA 1DAYA 4YC3A 3TG1A 5AR8A 3CTHA 2G2FA 5DR9A 5HIEA 4GV1A 2O64A 1NA7A 3IKAA 4EYMA 4AA0A 3R28A 3IK3A 3GVUA 5HLPA 1M2QA 4IBMA 4OBQA 4Y5HA 3S3IA 2BKZA 2CHLA 2JDRA 2QOIA 3ZTXA 1CM8A 2XEZA 1PMUA 4XG6A 3OWJA 4RZWA 3BX5A 2C3LA 3WARA 3FSKA 3QD2B 4QMWA 5CVFA 5FEEA 5J9ZA 3FQHA 4HCVA 3A4PA 2YIWA 2HIWA 4U0IA 3TN8A 2YM8A 3TNWA 2ZMCA 2PZ5A 4GCJA 2VWWA 4EONA 3OG7A 4QMSA 5EH0A 4C2VA 4YJNA 2F7EE 3W1FA 3IPHA 3ZDUA 3HA6A 3LFEA 5HIDA 4DFZE 2W7XA 3EFKA 4ERWA 5AAGA 5KKRB 3COKA 2UW0A 4WNOA 4DGNA 3ZC5A 3TEIA 3KRJA 2C0TA 5HZNA 4KSQA 3DS6A 2PVYA 5E7RA 1H00A 2YM5A 3HA8A 3MVJA 4RIWA 4D4SA 1FINA 5KO1A 4YSJA 3ORTA 4I41A 2YAKA 3OCBA 3A7FA 3DCVA 3R8VA 4I5CA 3R6XA 4G6OA 2QG5A 3MGYA 3QKLA 5G6VA 4M0YA 4BFMA 4EK8A 2H34A 3HLLA 4F9CA 4CKJA 3TDVA 3NAXA 2C5YA 4FL1A 3KRXA 1L8TA 1T45A 5EHYA 4O38A 3D2IA 1YHSA 3UDBA 3CQWA 4Y72A 2PUIA 5FUTA 4YZCA 3OS3A 4H3PA 5K9IA 1GZ8A 2C6DA 1STCE 5CVGA 3MV5A 4KIOA 1U5RA 3VS6A 4BKJA 3QZFA 1SZMA 5H8GA 2BR1A 2R0UA 3HP2A 3LCSA 4FODA 3FHIA 3VUKA 1ZYCA 4RX7A 3DGKA 3MA6A 4BYJA 4G31A 3FMMA 5AP4A 4ANOA 3D7TB 4D2SA 3EFLA 3ZO2A 3UNZA 3QHRA 3SLSA 5LJJA 3DAEA 2EVAA 3OZ6A 4EK3A 1VZOA 4C59A 2HXLA 1M14A 2WU6A 2ZM3A 2PZIA 3R73A 3W2CA 2OKRA 3OW4A 2ERZE 4EZ5A 2YN8A 4USFA 5DHJA 1W8CA 3HNGA 3GNIB 2PVFA 5CU6A 2YA9A 3BHHA 5ACKA 3VBQA 3HL7A 4BCHA 4PTCA 5AA8A 3JR1A 4JBQA 4K33A 5AP3A 2X9EA 3DLZA 2O2UA 4EH4A 5GNKA 3DAJA 2IZTA 2WMSA 4RWLA 4UX9A 4LGGA 3MA3A 4IAFA 3KKVA 4WIHA 5HHWA 3ULZA 4BBFA 3DA6A 1IAJA 2FO0A 3MFTA 4F7JA 3OF0A 3BYVA 4M7IA 4L3LA 2OF4A 2YLEA 2NRYA 5JFVA 5IA1A 4QQTA 3E88A 5DEYA 3C0IA 4IWPA 4M13A 4TYEA 5HORA 1GZKA 2Y4PA 3VC4A 4V05A 2J0MB 1VR2A 3WF5A 4OTGA 3GQLA 4Z7GA 2J6MA 4Z16A 2WTCA 3QXPA 3EZVA 3NUXA 4FSZA 3UOHA 4WHZA 3KRRA 1B39A 2GHLA 3AT3A 5B2LA 5AR5A 4TNDA 4GK3A 5AP2A 4BTFA 5FDPA 1KE7A 4FV7A 4O7SA 2GNHA 4G6LA 5EM6A 4G16A 2WTDA 2UZUE 2XMYA 4L01A 3VS2A 4DEIA 3F7WA 1WVYA 2G2IA 2HZ0A 4QTBA 4YUQA 2UVZA 1UU8A 5HCXA 3R63A 2R9SA 3ZLWA 5IH6A 4ZEGA 2OJGA 3KVXA 4KKGA 2H8HA 4YO6A 2UW4A 3RTPA 3UIUA 5HO6A 3DTWA 1CTPE 2C47A 4NIFB 4C3RA 1UVRA 3N51A 1R1WA 5C27A 2I40A 4LRJA 1W83A 4BICA 3NMUF 3LMIA 1QMZA 2BVAA 4ENYA 3VNTA 5A4QA 4G9CA 4ZTSA 2EXMA 2X7OA 2QNJA 4ANSA 1NVSA 2R7BA 4ZSLA 5HCZA 2GMXA 3KRLA 5BVEA 3FMNA 3E8DA 3VS1A 4GUBA 4C4IA 4ZTNA 3V5TA 4CEGA 4OAVB 3NSZA 4GUEA 4C3FA 3QRTA 3UPZA 2B7AA 4KABA 4RC3A 1SNUA 4IWDA 3RCDA 3FE3A 3POOA 5EQYA 1M7QA 4YR8A 2VNYA 3B8QA 3ZZEA 4FSRA 5ANOA 2H6DA 4FSQA 4PQNA 2G9XA 3NUAA 4DH3A 2VTRA 5CF8A 3JY0A 4I6HA 3NS9A 3FI3A 3CGOA 2QR8A 2PPQA 4XBUA 4MK0A 4O7LA 4A9UA 5IU2A 3BV2A 4QTEA 4X3JA 2J0LA 5GINE 4AGUA 3GFWA 1I44A 3KXGA 4OT6A 2GHGA 3R7EA 3V5QA 5KHWA 4Q9ZA 3QL8A 3FYJX 4MD9E 2ZDTA 4M97A 3P08A 4KIKB 4L43A 3KFAA 3PYYA 2YZLA 5HE0A 3TZ7A 4K1BA 1YDRE 3CIKA 4KKEA 4LUEA 3KXHA 3PRFA 5DT0A 4U79A 3RK9A 4MAOA 1Y91A 3ZLXA 4A07A 4ASEA 2YDKA 3UMXA 4EZ3A 3COIA 4DFBA 4GMYA 3ATSA 3R01A 3L9PA 4QP3A 5EDQA 3MI9A 4QYFA 4BRXA 2RG6A 3LXLA 2XEYA 3FKLA 3Q52A 4BDAA 3ORLA 4BCJA 4ZTLA 1KV1A 1BYGA 4D4VA 4DAWA 3VS3A 4UMRA 5JMSA 4E7WA 4JJRA 4O81A 1PXOA 3ZO1A 4FBXA 5FDXA 2V62A 2JITA 1OGUA 3TCPA 5KMKA 1ZXEA 3G0EA 3NR9A 2F7ZE 5ANGA 3BYOA 4JR3A 1R39A 3ZMMA 4N57A 2WNTA 4RJ3A 3ANRA 3Q9WA 2XKFA 4GT3A 3OMVA 5KMOA 4FTIA 5CY3A 2HY81 3RAWA 4I94A 2B9FA 1RDQE 1ZZ2A 2XB7A 2XKCA 3EQPA 1FBNA 4CNHA 3OTVA 5CEQA 4EOLA 4M84A 4MQ1A 5LQFA 3LXPA 3CY3A 4ZIMA 1J7IA 3QTRA 4M69A 5CXZA 4WBOA 4TL0A 2BKKA 4NKSA 4QNYA 1H1QA 3H9OA 4FICA 4A06A 3R71A 3UYSA 2E9UA 4D5HA 4FUXA 2JAVA 1FGKA 2C6IA 3BGQA 4DHFA 4G5PA 4FTNA 4I21A 1Q97A 3OY3A 1PHKA 3RWPA 3ZS5A 3PLSA 5A4LA 3H3CA 5DEWA 1Z9XA 2QODA 3WYXA 2EU9A 3CTQA 1YHVA 4FIGA 4RIXA 4YHJA 4C36A 1BI7A 2PYWA 3QUEA 4BI1A 3QLGA 2GNJA 3LMHA 4ID7A 4N6YA 1YHWA 3L8PA 4JIAA 5L2QA 4U45A 2CJMA 1ZYSA 3Q4TA 4XOYA 4IHPA 3D9VA 4LI5A 1MUOA 4CFUA 4HPUE 4D2RA 3G5DA 5D7VA 3L8VA 4MH7A 4DH5A 4YMJA 5HX6A 4ZJVA 4RG0A 4RIOA 3ET7A 4YBKA 4QYHA 1OUKA 4IW0A 1ZOGA 2QR7A 4KD1A 4QP1A 4IX5A 5AFVA 3ZSHA 3U4UA 4O0TA 4FNZA 3PY3A 3MB7A 3DU8A 5KHXA 4LOQA 5HBEA 3GXLA 2GDOA 3FYKX 3UE4A 3RHXA 1H0VA 5DRBA 2Z7SA 3E8CA 4GK2A 4AN2A 5TKDA 4I6FA 4O7TA 3OW3A 5HEZA 2VWXA 1BL7A 5GZAA 4UYNA 3LZBA 5IQGA 2HAKA 3WYYA 5CSPA 4XMOA 2V7OA 5JFWA 3HRCA 3DB6A 2PUUA 3P7AA 2C6TA 3AGMA 4WO5A 1P4OA 4ZS4A 4PX6A 5E92A 3TL8A 4B9DA 2OJFE 3GCVA 4KINA 3FMLA 3FQEA 4KIPA 3F66A 5HNGA 1UNGA 3FJQE 3OBGA 3FLWA 4FTQA 3VS4A 4B6LA 1UV5A 4YLJA 4EH7A 1XH7A 1W0XC 3T9IA 3LCKA 3RVGA 4CZUA 5KMMA 1GIJA 3G15A 4ZZNA 1A06A 4EJNA 4JLCA 4XOZA 2F57A 4C62A 1AGWA 5JH6A 3BGPA 2HZ4A 4BIDA 2DUVA 3ODZX 4BDJA 1GZNA 5L2TA 2G1TA 3BYSA 2XP2A 1ATPE 2AYPA 3EJ1A 3O8TA 4MF1A 4CCUA 3EFWA 3KMMA 4FIHA 2BAQA 3RZFA 1QPEA 2XBJA 3KXXA 4UEUA 2VTLA 1H8FA 2XK3A 4FI1A 2OIDA 4EK4A 4IAYA 2XNOA 3KRWA 4EHEA 2O3PA 3RP9A 1OIQA 4JRVA 2QOHA 2YAAA 1K9AA 3UMWA 1YRPA 3W2PA 3TV7A 4MF0A 2GPHA 2XIZA 4L3JA 5D10A 2BILB 2WEIA 5H8EA 3GEQA 4ASZA 1HOWA 2OJIA 2YM6A 3A2CA 2C30A 3G33A 4M67A 4ENXA 5J79A 5K4IA 2WZJA 2B53A 2GQSA 3SGCA 3R30A 3CGFA 4BIEA 2J5FA 2VWVA 2VWIA 2XNBA 4JX7A 5DA3A 3L9MA 5AUZA 5FTQA 4E6DA 3BPRA 2A27A 4KNBA 2CNVA 2EUFB 2O5KA 4II5A 2XH5A 4PMMA 4PPBA 4JDHA 3FY2A 2YITA 2I0EA 2ONLA 4PL4A 2E9OA 3KF4A 3F3UA 4FGBA 1Q41A 2QKRA 2Y4IB 4ZJIA 2GQRA 3R1SA 3CPBA 4F0IA 2BPMA 3FC2A 5I3OA 4I24A 5HO8A 5KMIA 3Q4UA 2X7GA 4JDJA 5E8ZA 5CASA 3IECA 1M2RA 4L44A 4X2GA 3QC4A 3MW1A 3CS9A 2NP8A 2YCSA 3GBZA 4EOKA 2QONA 3WIKA 2GNGA 4DTBA 1JOWB 4M14A 4FEQA 3WIGA 3FLQA 3KU2A 3R7OA 3DQWA 4ANMA 1BMKA 3K5VA 4IE9A 5DGZA 1A9UA 3KULB 2E9NA 3D14A 3O96A 2Z7QA 5AR2A 3G0FA 5AUTA 3KVWA 4F9AA 1P4FA 3AC1A 2JLDA 3GUBA 4U9AA 5E1EA 4R78A 3R9RA 4CZTA 1YI3A 3GOKA 5J1WA 3BI6A 5HO7A 4DBXA 4QOXA 3ULIA 4GRBA 1TVOA 3FBVA 4WNPA 4I92A 1FOTA 4X2JA 2WMWA 4IFGA 4L9IA 4BDHA 4C58A 4CYJA 4DTKA 4I0TA 1SMHA 3KXMA 4FKQA 1H1RA 5IF1A 5M4FA 3PIXA 2QU6A 3EN5A 3TNQB 1TQIA 4E3CA 2HCKA 4I6QA 4IZ5A 3O23A 4UWBA 3TNHA 4ACGA 3ZM9A 2BIKB 3SW4A 4F64A 1OUYA 2WIPA 2QVSE 5JFSA 5FM3A 4DEGA 4O7NA 3I1AA 5JQ5A 4X3FC 3I60A 2F2UA 4CQGA 2PWLA 4QT1A 4C37A 4EC8A 1PXIA 3K2LA 4R3PA 4F6SA 4BIBA 4XLVA 2BRGA 4GH2A 2XNGA 4U5JA 3RM6A 4OTIA 4OTWA 2ESMA 2IZUA 3EYGA 2OFVA 3DBFA 3ZRKA 4QQJA 1REKA 4YGAA 5J7BA 2YACA 1XH9A 5HE1A 3BYUA 3E5AA 2IVVA 5M4UA 3I6UA 3R7GA 4BN1A 4FEUA 4ANBA 4D2PA 2C5NA 4C4GA 2IVTA 4ORKA 1GAGA 4I5MA 3FKNA 1KE5A 1OITA 3MPMA 4I5HA 2ACXA 3GU7A 3IGOA 5FP6A 3FEGA 3ID6C 3VF8A 3VRZA 4CFXA 2OIBA 1ZZLA 3ZZWA 4F65A 3FQSA 4IIRA 3FC1X 3EN7A 4F0GA 3D7ZA 4FYOA 3BEAA 5IQHA 2O0UA 3UOJA 4JG6A 2GNIA 5FM2A 4O86A 2RF9A 2WMRA 2OZAB 1REJA 2AC3A 4ZY4A 3VQHA 3TKHA 4HYHA 5E9EA 3QKKA 4RZVA 4K8AA 1BL6A 4EOJA 3JXWA 5DBXA 2W1ZA 1MRVA 5HNBA 2BRBA 2OJJA 4TYHA 3F5GA 4ANQA 3I7CA 3RPVA 4B7TA 1VJYA 2I7QA 2XK8A 3KC3A 3K5UA 5H8BA 4B4LA 4U44A 5DT4A 3C0HA 3N4VA 5A4TA 5EW3A 1E1VA 1WCCA 2X6EA 4XV1A 4XJ0A 3S4QA 2R4BA 4OBOA 4B0GA 4FSWA 3R1YA 3Q9ZA 4BCNA 2XBAA 4J99A 4DT9A 2W1HA 4QTDA 4W4YA 1NVRA 3CY2A 4NTTA 4UZHA 2WMBA 2Z2WA 5H2UA 4FVRA 2QOQA 5EW8A 2G15A 4GFGA 5IH4A 2WMUA 1GIIA 1P14A 4CGAA 1CKJA 1XH4A 2RL5A 5GIOE 5AMNA 3W18A 2WMVA 4DG2E 4RSSA 4Y83A 1APME 2ERKA 4G5JA 4UY9A 2BZKB 3K3JA 3BQRA 3F3TA 1XKKA 1ERKA 3OXTA 3PXKA 3TWJA 4YO4A 5DMZA 3R7IA 2BTRA 3GC7A 3Q32A 4YZNA 4YLKA 2BHEA 5AWMA 4DFXE 1ND4A 1JPAA 4D0XA 3A7GA 4J8NA 3LLAA 3ZUVA 1BLXA 3EQDA 3E63A 4HVIA 5CEOA 5KMJA 3W2OA 3BWJA 4AS0A 4Y46A 4N0SA 1NVQA 2R3OA 4YTHA 3DXQA 1ZY5A 4YC6A 4NCTC 4ZLOA 4NJ3A 3SXSA 4EI4A 2BCJA 1YXSA 3LQ5A 3QCXA 3GU8A 4IMYA 4CFFA 3KN6A 4L45A 1QL6A 4J8MA 4WRSA 2JDTA 3G6HA 3NNXA 2WO6A 1Q61A 3KXZA 1Q8YA 1WBNA 3G9NA 4E5AX 3QFVA 4CG9A 5BVKA 1DS5A 5DOSA 4QTAA 5CSVA 4EOSA 4IWQA 3UC3A 2HWOA 4C35A 2YM4A 4PL3A 5HGIA 4C4HA 3EQCA 1OPLA 4YJRA 4CYIA 3ZDIA 4ZMFA 3VBTA 4XEYA 3RALA 1ZY4A 4UN0C 5LVLA 5EM8A 2BDWA 2OICA 4KA3A 4C3PA 2UZTA 4DLIA 4MNEB 4A7CA 3DBCA 5JGBA 4CLJA 5LVNA 2I1MA 3FLZA 2CSNA 5M44A 4YJPA 2FGIA 3I0QA 4DEEA 5J9LA 2FH9A 3FV8A 4MEDA 3ORZA 1WBTA 3NYOA 4UV0A 3ENMA 3I79A 4LMNA 4PL5A 4QP4A 3QBNA 2Y9QA 4CZYB 1NXKA 4NK9A 3RZBA 4L3PA 5TF9A 4IZ7A 3T3VA 1V0OA 3JVSA 4PDOA 2QKWB 4D0WA 5BUEA 1FGIA 2R7IA 4ZP5A 4IAKA 2VO7A 3QD3A 1NY3A 2O8YA 3OC1A 3PJ1A 4X7QA 3SG8A 2WOTA 5IDNA 1JAMA 3Q6WA 4GU6A 5FG8A 5GJDA 3SW7A 4J97A 3C9WA 4RIYA 1IA9A 1JNKA 1SYKA 3EFJA 2R3JA 4AT5A 4EK6A 2OF2A 5CAOA 1W82A 3HV7A 4IVCA 3LLTA 3IO7A 3R9NA 4I22A 4K9YA 2SRCA 4C38A 3U54A 2P0CA 1IG1A 3DXNA 4EQCA 4DITA 2ETKA 3FZOA 5IMXA 3FZSA 1ZYLA 2C3KA 2WFYA 2UW5A 2OG8A 3PP0A 2WTKC 5CU2A 4EH2A 4EWQA 4J71A 4NKAA 5AJQA 4DH8A 2W17A 2V22A 3G90X 4JNWA 4NT4A 2VWZA 2XJ1A 4O7RA 2WU7A 4BDDA 4FVPA 3RJCA 2FVDA 4ANLA 3NW6A 3NZ0A 3QQFA 4NUSA 3MH1A 2C6EA 5IA4A 1YXTA 2ZJWA 3HECA 4C34A 5CF6A 4L42A 2ETMA 3RPSA 3ERKA 3V6SA 5EM7A 4LOPA 4D4YA 2CDZA 3QWJA 1OKZA 3ZU7A 4ACMA 3TZ9A 3I6WA 5L4QA 2CNQA 2FA2A 3MIYA 2EXCX 2GNFA 2VTNA 5F20A 3TJDA 5J5SA 3R00A 5BPYA 5F1ZA 1YI4A 1ZMVA 2VUWA 1W98A 2VX0A 2ZDUA 5IZFA 5GZ8A 4L6QA 4YLLA 1U54A 4FNYA 5IEVA 2WMXA 3ZSIA 3L9LA 3NGAA 5EM5A 1KOBA 5LOHA 4XV2A 4QTCA 3N4TA 4GFMA 1AD5A 2R3IA 3E3BX 3P5KA 4KAOA 4AXAA 5E90A 4UMPA 5K0XA 3PJ8A 5AR3A 4FKIA 4Q5EA 4ZSAA 2WKMA 3CXWA 2W1EA 4MXXA 3TDWA 3NUSA 4XNEA 5G1XA 4X3FB 3LIJA 4FT3A 4LV8A 5B7VA 4IEBA 4W9XA 4J96A 3IGGA 4I0SA 4XH6A 4RBLA 3I0OA 1URWA 3P7CA 2Y6MA 4PDSA 2C1AA 4IM0A 4XCUA 2WQEA 3BLHA 4FUYA 4ZTRA 2VWYA 5M4CA 2ITVA 4QYGA 4P4CA 5GHVA 4FKUA 4PDYA 2LAVA 5LVOA 4GKHA 1XH6A 3EIDA 3FHRA 5BUJA 4RPVA 3UOKA 5IA3A 2OXYA 4CSVA 3TIZA 2DWBA 2VGOA 3OXZA 4IB3A 3GC8A 3PA4A 5CAUA 4D55A 4WT6A 3GQIA 4OR5A 3PE1A 4CMUA 2BDJA 4FX3A 4QP8A 3FDNA 4A4XA 2ITOA 3DKCA 4U3ZA 3TM0A 4NJDA 2QQ7A 4FTLA 4E1ZA 4FK6A 1S9IA 5DT3A 4R3RA 5J7HA 3UQGA 3GCPA 1YVJA 4MQ2A 4EC9A 4KBCA 2ITUA 3CKWA 3GGFA 3P1AA 3QCYA 4TT7A 4U81A 2NPQA 5FXQA 4IX3A 4RMZA 4YJVA 3VQUA 3FPMA 3E92A 3PG1A 2GTNA 3QTUA 1OMWA 1KSWA 4FSMA 4OTDA 1ZWSA 3CBLA 4JOAA 4R7IA 3U6HA 3SG9A 4NWMA 4RA5A 2HWPA 3D5VA 4AW5A 2R3LA 5AIRA 4FSUA 3WZDA 4BDIA 4NM7A 2J51A 1YDTE 2OU7A 4GL9A 5EDRA 2QO2A 5A6OA 4QMMA 5ICPA 2UW8A 1F5QA 3E93A 4KB8A 4YZ9A 4AZVA 3BZ3A 4LFIA 3UPXA 3M2WA 2F9GA 3VHEA 2WMTA 3FMDA 2IZSA 2P33A 3BCEA 3JVRA 4FNXA 1ZOHA 1XH5A 3RPRA 4IJ9A 4E6QA 2GFSA 5B2KA 3EHAA 3UZTA 2BZIB 4OGRA 5CTPA 3TACA 3MFSA 4WUNA 4Z7HA 1QPJA 3SAYA 1H01A 5CANA 2HZNA 2QLQA 3DZQA 3HV4A 4RT7A 4UMTA 4X0MA 3COHA 5I4NA 5FTGA 2VGPA 4HVSA 5CS6A 3VJOA 1AQ1A 2J9MA 3MH2A 3HYHA 3FLYA 4EOOA 2IPXA 2BZJA 2WIHA 4R7BA 3PSBA 3NNWA 5CX9A 3DBEA 3HMOA 2HK5A 3V04A 3VN9A 4CFWA 1BUHA 5HD7A 2F4JA 1JWHA 2UZOA 3LFDA 4TYHB 5AUUA 1OM1A 4I5PA 2XIRA 3QZHA 3ORIA 5KZIA 5EI2A 3QTXA 3LQ8A 2RFSA 4BGHA 1RJBA 1Y6BA 3O2MA 3H0ZA 1GZOA 4MVFA 1QPCA 4YJQA 5IQIA 3FAAA 4LL5A 4O96A 2PZYA 5AR7A 4D9TA 4O84A 4FV8A 3BELA 3SD0A 3SDJA 1ZRZA 2YIYA 3ALNA 5AUXA 1OI9A 3LM0A 4KIQA 1MRUA 4YZDA 2W1GA 4E4NA 3R7VA 4NL0A 3C4CA 5IMEA 5LWMA 5M57A 2OXXA 2XK7A 4AZSA 4E5WA 4LGDA 3DK6A 4JAJA 1Q8UA 4BI0A 3LHJA 2YCQA 4O0SA 2ITNA 5HVKA 4R7HA 4DFUA 1PJKA 5CSWA 3QCQA 3QQGA 3WF7A 3KL8A 4CG8A 2VV9A 3W2QA 3CE3A 5HQ0A 3SXFA 4I0RA 5E8YA 4M0ZA 2PVMA 3V5LA 3UQCA 5IQCA 3HAMA 5I9XA 2JIVA 4FV4A 2YHVA 2JIIA 4O0WA 3FPQA 2I6LA 3WILA 4D28A 5E4HA 3P78A 2HY0A 1UWHA 2UZDA 2W06A 5ANIA 3VULA 4FKRA 5ANKA 5K5XA 3VAPA 4GK4A 2VTSA 4UB7A 2IVUA 3DQXA 4DEDA 3S00A 4C57A 4TWCA 4DFLA 1UU9A 3O0GA 4BBEA 1KOAA 4EORA 4ACHA 1M17A 4N4SA 5CAQA 3F82A 3TUDA 3ODYX 4FF8A 3CPCA 3O7LB 4RJ5A 3GENA 4CKIA 4EBVA 4FSYA 5I9UA 2WELA 4WG5A 2OI4X 3HUCA 4G2FA 4X2FA 3DOGA 1G8AA 3R22A 1DM2A 2WGJA 3P9JA 4I3ZA 1H1SA 4S34A 5IA5A 4F7LA 4D9UA 1U5QA 4BCMA 2H9VA 1GJOA 4IB1A 3EQHA 4V0GB 3DJ6A 2CKEA 3Q4ZA 4MKCA 2PVNA 4IX6A 5A9UA 4APPA 5HTCA 4FTUA 5M07A 4FOCA 3AOXA 5D41A 3SQQA 4NZWB 2ZYBA 3H10A 4UALA 3LM5A 3QALE 4EOIA 4G3DA 5HE3A 4AW1A 4EH9A 3KN5A 2W1IA 1X8BA 1JSTA 4HGTA 2WTKB 4XYFA 2RSVA 3EL7A 4JRNA 1NT2A 3ZFMA 3R2BA 4BCQA 2ITTA 3KF7A 2R3MA 3OBJA 4ITJA 1YKRA 3FMKA 3KCKA 4BBMA 2Z7LA 3B2TA 3ATTA 3U9CA 4U80A 2C6OA 4PV0A 2A4LA 2WEVA 3FI4A 3HGKA 1OKWA 3I7BA 3PA5A 4R8QA 2UVYA 1CMKE 2ZB1A 4ZLZA 3BWFA 5AR4A 5EKOA 4GEOA 4LM5A 4WG3A 3ZEPA 1ZYJA 3KXNA 3C5IA 4F7SA 3W2SA 4BTKA 3D94A 1ZARA 2RKUA 2XVDA 4FIJA 2CLXA 5DPVA 3OFMA 2CPKE 2J0KA 3GI3A 4KS7A 4PDPA 3PRIA 1Y8YA 2PE0A 4DGGA 5CEIA 4E8AA 3UJGA 3U87A 1PMEA 3NW5A 4C7TA 3PVWA 4O1OA 2PU8A 4ARKA 2OJ9A 4O7ZA 2UW3A 3D5XA 5ANEA 4IM3A 3UNJA 2Y6OA 2YISA 3IDCA 4PUZA 4AACA 5CEPA 3U9NA 5IH5A 4QPMA 4FEWA 1PXMA 4WNMA 1KWPA 4H3QA 1JLUE 3EKKA 5B2MA 4PNKA 1XR1A 3OOMA 5CSHA 2V55A 2JGZA 2YCRA 3IG7A 2YEXA 3QD4A 1CKIA 2VTHA 4GVJA 3RCJA 4FV1A 3SOAA 2J50A 3AD4A 2C0IA 4L00A 4QP7A 2A0CX 4GU9A 3CR0A 3OT3A 4R6VA 2WMAA 4GYIA 2E9VA 1IEPA 4KSPA 3I5ZA 3PXQA 2W1CA 5JKGA 3NVKI 4KWPA 2BALA 3H4JA 4EKLA 1H07A 4Y8DA 5AEPA 3MN3A 5HESA 3BKBA 4BTMA 5C8KA 3S2PA 3MY5A 5BVOA 3KCFA 4GT4A 4CKRA 2YM7A 5I9ZA 1YWVA 2VTMA 3R21A 2BRHA 2PMLX 4XG2A 2FB8A 4ALWA 3DJ7A 2G01A 4W9WA 3SHEA 2C5XA 2JBPA 3IDBA 2QHMA 5J95A 4IAZA 4NEUA 5EOBA 4WD5A 5C9CA 2FSMX 4BC6A 4YURA 3PFQA 3WI6A 4EHGA 4A4LA 3ENHA 3FZRA 3C7QA 4M12A 3W16A 1SVGA 4O83A 4YPDA 2E9PA 4MX9A 4NW6A 3UODA 4CTCA 4I6BA 2QI8A 1PXLA 5D7AA 5TR6A 4BHZA 4JI9A 3UO6A 4USEA 3BYMA 5FRIA 4DGOA 3HMPA 2XJ0A 3N9XA 4PY1A 3TNPC 3JY9A 5HG8A 3QTQA 5HTIA 4MXZA 3FSFA 2VAGA 4FG7A 3E62A 3ROCA 4MXYA 4K11A 1JSUA 4PF4A 4AA5A 5CWZA 1YWRA 5F4NA 3PSCA 4YHFA 4FGRA 4RIWB 2DS1A 4DG0E 4MYGA 2Q83A 1TKIA 4HNIA 2XNNA 3QQLA 5FWKK 1Q8WA 2B9IA 4W8DA 3A61A 3PZHA 4RC2A 3DZOA 3P23A 4HJOA 3DK3A 4K0YA 4AZFA 4YPSA 4BCFA 2EWAA 4JG8A 2JIUA 2R3PA 3QKMA 3PWDA 3U6IA 2XRWA 5AP1A 4G34A 1PKGA 2WQNA 4YZBA 3WZUA 3BHUA 4KBAA 3QAME 3GC9A 2PULA 1OL7A 2VO0A 5CAVA 3A60A 4R5YA 4QO9A 4EOQA 1QCFA 3VS7A 2G2HA 4I4EA 4C4FA 2VU3A 1YXVA 3MTFA 4CD0A 3F5XA 4QQCA 1DI8A 4KRDA 3DDPA 1R0PA 4DCEA 5AP6A 4XRJA 2BTSA 2C3IB 1H28A 4I93A 5ITAA 3N4UA 2JKOA 2ZOQA 1VYWA 4W8EA 2C6KA 3C13A 5CNNA 2YDJA 3UC4A 3FLNC 3UG2A 1MQ4A 3DNEA 1OL2A 2XF0A 5HU3A 5CI7A 3QQUA 3W8LA 1CSNA 2XK9A 3ZBXA 1BKXA 4IDVA 1Q62A 2R3HA 4P5QA 5K4JA 1SVHA 1OKVA 3QGYA 4O0XA 4IACA 4U40A 3PE2A 2RG5A 4PMSA 3Q4CA 2HOGA 2PSQA 5CU4A 5J87A 3P7BA 2VTIA 3IW8A 4M3QA 5IKWA 3QTIA 4FZ6A 5E1SA 5KNJA 4FMQA 1SVEA 2HZIA 3F69A 4E26A 3S95A 1DAWA 4F09A 3AQVA 3D5WA 2VTAA 4UBAA 3UTOA 2QURA 3RMFA 3W2RA 5HG9A 3LPBA 2P3GX 4WSYA 4N70A 4ERKA 3SRVA 4DGLC 4CMOA 1O9UA 4YBJA 3MH0A 3HUBA 4ZY5A 3OCTA 3VUTA 2VTQA 2X8EA 4BCPA 3NUNA 1LP4A 5EW9A 3KREA 4PP9A 5AAEA 5FBNC 4CVAA 3PLAE 3F5PA 3B2WA 4DEBA 2RFEA 3ZHPC 2C6LA 5C4LA 3NCGA 2GQGA 3QU0A 1K2PA 4NM3A 4RJ4A 4BTJA 4Q2AA 2ONLC 4FZFB 1JKLA 2WAJA 4YC8A 4F6UA 3V5WA 4O91A 3HAVA 2KULA 3MFRA 3PJ3A 2QHNA 3Q3BA 4ITIA 2VTTA 3V8TA 3L9NA 4XP3A 5A14A 4R1YA 3RKBA 4A4OA 3DAKA 3PXZA 2IJMA 4C8BA 3W33A 3W8QA 5EI8A 5IQDA 2BDFA 4M8TA 3Q60A 2OH4A 4GIHA 1MRYA 4JQEA 3F3WA 5EYDA 4CV9A 3G2FA 3TUCA 4APCA 5JQ8A 5LVPA 2B54A 3TV4A 1PKDA 4TWOA 5KBQA 4BI2A 4DF3A 5IPJA 4TNBA 2RFNA 4IDTA 5FGKA 3V8SA 4AAAA 2PMIA 4S2ZA 1WBSA 2F49A 2W4OA 5ANJA 3DT1A 1LEWA 5TOZA 4HOKA 4RWKA 4TPTA 3ZH8A 4BDFA 2XRUA 4BVUA 1G3NA 3I81A 3PIZA 4Z3VA 2YLFA 4BF2A 1BX6A 3TIYA 5DYJA 3BE2A 3ORMA 1FVRA 2JDSA 5C01A 3VHKA 1U4DA 2XUUA 5L2IA 4AX8A 4H3BA 1J91A 4TZRA 4JBVA 5T6KA 3TUBA 2ZVAA 4WG4A 5KUPA 1OL5A 3C4XA 3M1SA 2O65A 4LRMA 4RC4A 4FC0A 2W9FB 3JYAA 4AWIA 4OAUC 2IVSA 2A19B 4QMUA 3A8XA 3D7TA 5CSXA 2VWBA 3ZUUA 4LG4A 4XRLA 4EKKA 4H39A 3A7HA 2W05A 3ORKA 5AUYA 4O21A 4EOPA 4DYMA 2HW6A 4TYGA 4ZAUA 3KEXA 1W84A 3P4KA 3OROA 4OTRA 4BWKA 4J98A 3QTWA 3O51A 1PXJA 3GC0A 5C03A 3RPOA 4GVAA 1FMOE 4IVBA 3D15A 3LVPA 4JAIA 1DI9A 3FZTA 2GS6A 4ZLYA 3FZPA 3MFUA 1A48A 3FKOA 4I20A 3QD0A 1YDSE 3WF6A 5IA2A 2VWUA 5EFQA 4IC7A 4BZOA 3VBXA 3DB8A 4F1TA 5IQAA 3F5UA 3MS9A 4M68A 5F94A 2DYLA 3V51A 3ZOSA 5IQBA 2CN5A 2OIQA 3DFAA 4BCIA 5LMKA 2REIA 2X1NA 3PZEA 4FTCA 4ZXTA 4D5KA 1WAKA 2ITQA 1PRYA 2OLCA 3HV6A 5EG3A 4PTGA 5AV0A 2X0GA 1RW8A 5HG5A 4RQVA 1H1WA 3R8LA 2NO3A 3TTJA 4J52A 2UVXA 2WHBA 3HEGA 1JVPP 2YDIA 3H30A 4JXFA 4KBKA 2X4FA 4M69B 1PF8A 3LMGA 4A9RA 5HIBA 4EH5A 3NDMA 4ZTMA 5CU0A 4YSMA 5L3AA 4H05A 2GFCA 1OZ1A 3F7ZA 4AZWA 4FTMA 2DQ7X 5IUHA 3VUMA 4U7ZA 5BVNA 1Z5MA 4F9BA 3ZM4A 4NIFA 3RM7A 3PG3A 2JDVA 2IG7A 4O6EA 4CMTA 5FLFA 5L8JA 4RIXB 3UP7A 2A1AB 2BRNA 3VUDA 5IEXA 2OW3A 4J1RA 4FEXA 3R9OA 3UIBA 3NUPA 3S0OA 3PXRA 3BBTB 2JKMA 4FV9A 4D1SA 5HTBA 4BKZA 2XZSA 4OTPA 3GCUA 2QOLA 2BMCA 5EQEA 2PVRA 4F08A 4LV5A 4TKSA 4K18A 3O50A 4IZYA 3WZEA 2OXDA 2X9FA 4Z9LA 2B9JA 5LARA 4ACDA 1PYEA 3ANQA 5AV2A 3RBWA 3OTUA 4O22A 4BZDA 4D1ZA 3C4ZA 5CYIA 5BVDA 4QMPA 4A9SA 2FSOX 5I5ZA 4MD7E 4C33A 3MSSA 3CCNA 4LUDA 5HI2A 1SM2A 3DV3A 2R3KA 3LCTA 4HYUA 1OBDA 5DVRA 2C69A 4IVAA 3U4WA 5A46A 1Q8ZA 3BU3A 4D58A 2X4ZA 3LFCA 3OXIA 5ETCA 4FV6A 4BDGA 3SVVA 3A7JA 2B55A 1UKHA 3QQKA 3VJNA 4LGHA 4RFMA 1OIRA 2FUMA 3Q04A 3FI2A 4FE2A 3NWWA 1WBOA 3RI1A 4FKTA 5AV3A 4NYEA 3HKOA 3K54A 3P0MA 3HDMA 3OT8A 4EQMA 2FYSA 5E8UA 3BRBA 1H25A 1RQQA 3A99A 1H08A 3E87A 3KK9A 4FV5A 2QCSA 2CN8A 4BWXA 1YXUA 2PZRA 3KY2A 4CV8A 2X2MA 5LWNA 3R83A 2XIYA 1Q5KA 4KRCA 3EQIA 3DBDA 3VWAA 4L53A 4YJTA 5HD4A 3FXXA 2C5VA 1KE8A 4ZS0A 3TNIA 4P90A 4AFJA 4YTFA 3ZEWA 3PUPA 1ZOEA 4AN9A 2QG7A 2BAKA 1YWNA 2X2KA 1UU7A 4MXOA 5BMMA 3O8PA 1QPDA 3Q9YA 3LFQA 1P2AA 5I9VA 3DKOA 5L6WL 4F1MA 3ZYAA 5L8LA 5LVMA 3EN9A 4C4EA 5K0KA 1H4LA 3ELJA 3NPCA 4JL9A 4L8MA 1E9HA 2YERA 4FV0A 5EKNA 5BX0A 2JFMA 4WA9A 3HVCA 2Z02A 1XH8A 3FXWA 1XO2B 3HMIA 4AT3A 5J9YA 3T3UA 3BEGA 2OGVA 4FTRA 3GU5A 5ETFA 4EHVA 3DNDA 4RJ6A 3RGFA 4ZZOA 3IQ7A 2WXVA 1M2PA 4HYSA 4D1XA 1E1XA 4RJ7A 3GOPA 5AIKA 3VBWA 4X2KA 2UZLA 2Y7JA 4JQ7A 3NYVA 3VO3A 3ZONA 3ORNA 3ZBFA 5FXSA 4PWNA 2JBOA 2ZAZA 2CGUA 4E6AA 2QU5A 5T68A 5C4KA 3KMUA 2YFXA 4YNEA 2V0DA 5EHOA 4E6CA 3BV3A 2R3QA 4FT5A 3KGAA 4QYYA 4ZK5A 5CF4A 1Q8TA 3MVLA 2EB3A 3FL5A 3QCSA 4FT7A 4QQ5A 2BFXA 3VS5A 3MY1A 3SV0A 3OUNB 3QRJA 1I09A 2W1FA 1K3AA 5KZ0A 4YTIA 1OB3A 4HZSA 5FQDC 3PVUA 3GCSA 3FWQA 1YOMA 4DC2A 2CNUA 4HCUA 1BI8A 4JR7A 4NM5A 4G17A 2J2IB 4AW2A 5AP5A 4O7VA 3CQEA 5JN2A 2CCIA 4DN5A 3DPKA 2VRXA 4YJUA 3QF9A 4ITHA 4YNOA 4E5BA 4F99A 2PE2A 3UVQA 3LFFA 4AGDA 5A4EA 2H96A 3COMA 4AZEA 3PA3A 3MPAA 4XG8A 4EBWA 2CKOA 5JZJA 4O0YA 5EYCA 1WVXA 4FT9A 4ALUA 1ZMWA 1O6YA 4IADA 3LXKA 4FKLA 3H9FA 4ZJJA 3GU4A 2QOCA 3V5PA 1O6KA 4Y73A 3C51A 1HCKA 2OWBA 3RAKA 3U55A 3BGZA 4CFMA 4TRLA 1PXNA 2QC6A 1CKPA 1G8SA 1SNXA 5HNIX 4E93A 1OECA 3DKGA 2NRUA 3PXFA 3EQBA 1S9JA 3EKNA 3L1SA 2XCHA 5ETAA 5IISA 4FKWA 4FSTA 5DG5A 3E3PA 3LFAA 2B4SB 3MVHA 4CXAA 2JKQA 4G9RA 5C1QB 4IANA 2WMQA 4EH8A 3UZRA 3QRKA 1OIYA 4BGQA 4IFCA 2V5QA 4DEAA 3R1NA 3VUHA 4CT2A 3BBWA 2ITPA 3NCZA 4G1WA 4IC8A 3UO4A 2W4JA 4UMQA 1OKYA 2PVHA 5M09A 1WBVA 2PVJA 2W99B 2CLQA 4FKGA 5D1JA 1P5EA 4FT0A 2XJ2A 3POZA 4JBOA 4HVDA 5L8KA 2RGPA 1M52A 3M11A 3S1HA 3MESA 2C5OA 5DR2A 2O63A 5EK7A 4IB5A 1UA2A 3PP1A 4ZMEA 2QLUA 4FV3A 3RHKA 3PJ2A 4NSTA 5ETIA 4ACCA 2PTKA 3LXNA 3V5JA 3SA0A 2BUJA 4O0VA 3G51A 3ITZA 3M42A 4MBJA 3WF9A 4LRKA 3HX4A 4RVKA 3TTIA 1U46A 3A4OX 4QP9A 5EHLA 2UZBA 3ZCLA 4YJOA 2JAMA 2C1BA 3NVMB 2OBJA 4PTEA 4Y5QA 3HZTA 5LCJA 2IW8A 1TQMA 1WMKA 2C0OA 5AA9A 1J7UA 4C0TA 2W1DA 5I9YA 4R1VA 5DR6A 1XBBA 3EWHA 3IW4A 3L8XA 3HP5A 3CD8A 4FNWA 1OIUA 4WSQA 5BVFA 4I4FA 1Q24A 4U43A 3BU5A 2R2PA 1YI6A 3PIYA 5JFXA 5IQFA 4MBIA 5ACBC 3HRBA 4PPAA 2WTWA 5BYLA 3BIZA 2Y0AA 3UP2A 2GHMA 2YJRA 4RX5A 4O7YA 3FMHA 4GIIA 4GT5A 4EQUA 4R77A 2X39A 3LFNA 4WBBB 5E8VA 4ASXA 4BR3A 3UVRA 3ZO4A 2J7TA 3P86A 3RAIA 1CDKA 3KULA 1IA8A 4C02A 4XG9A 1H0WA 5M56A 5F95A 5KBRA 1J1BA 4FKJA 1PYXA 2J0IA 2UW6A 5BQ0A 4R5SA 3HRFA 3F2AA 4TXCA 3D4QA 3ZRLA 3LAUA 2IO6A 4O82A 4EOMA 5TO8A 4CFVA 4BDEA 4O2ZA 2WPAA 4X6RA 3FXZA 2PUNA 3F2NA 2W5AA 1YQJA 4QMQA 3CD3A 2XA4A 2Y4IC 3QX2A 2J4ZA 4QYEA 4Y95A 5CXHA 3RAHA 3II5A 5ANDA 2HENA 4DLJA 5JEBA 4JT3A 2F7XE 4H58A 4RFYA 4C2WA 4FV2A 2XKEA 4IX4A 1YOJA 4B8MA 3FMJA 3C1XA 4FL2A 5M08A 5A6NA 3FL4A 1ZAOA 2EB2A 2GSFA 1PW2A 3NYXA 4FZAB 2YM3A 4IM2A 4QMLA 3RWQA 1G5SA 3QTZA 5IG1A 4FEVA 2X8IA 4IH8A 2FSTX 3OWKA 4TTHB 4W4WA 5DE2A 2C4GA 1Z57A 3GB2A 4Q5HA 4CQEA 2GS7A 5K3YA 2V7AA 5KCVA 4S32A 3JUHA 3QA0A 3ZLSA 4BY9E 2QOKA 3UIMA 4O7WA 2WQMA 3E8EA 4WUAA 5FXRA 3DY7A 2F2CB 4AUAA 4DFYA 3D2KA 4QPSA 3OWLA 3T8OA 4BCGA 4HYIA 2CMWA 4OTHA 3D83A 3ACJA 3OP5A 4O2PA 3I5NA 4QP2A 3Q5IA 3AMYA 4WOVA 4FKVA 1FPUA 4P2KA 3Q9XA 2VX3A 2CKPA 3AC3A 1UNHA 4V01A 3OHTA 3R8PA 3UOLA 1GIHA 1O6LA 2I0HA 2UZWE 4PRJA 4OUCA 2CGXA 4FKOA 4RWIA 4G3FA 1WFCA 3T9TA 3R7UA 4FIIA 2E2BA 1RE8A 3LCOA 1YXXA 3O8UA 3NRMA 2B9HA 3ZRMA 3KA0A 4DCAA 3MJ2A 4L7SA 4FZ7A 2PUPA 4JX3A 2OZAA 3FUPA 2YABA 2YJSA 2W9ZB 4MNFA 2GNLA 5CT7A 5AV1A 4J53A 3EQGA 3QYZA 5HKMA 3GCQA 4EEVA 4QPAA 4F9YA 1PY5A 3ALOA 3P79A 1UNLA 4C61A 4EZ7A 2ETRA 4RQKA 4CRSA 4QNAA 3IOKA 4M15A 2HYYA 1IR3A 4D2WA 3ORPA 4RIYB 4V04A 4BZNA 1JKKA 3DK7A 2YWVA 5LXMA 4FZDB 5FD2A 3V3VA 1J7LA 3UG1A 5M06A 3OCGA 3ZFYA 3CC6A 5BVWA 3JS2A 3MB6A 3D0EA 3BHVA 4J95A 3BE9A 4X2NA 3MY0A 4S31A 4AOJA 3CEKA 2WB8A 4LYNA 4MBLA 4E4MA 4Z55A 1IASA 2UV2A 5H9BA 5HVJA 3PTGA 1KUTA 4RJ8A 4GW8A 4K6ZA 3OCSA 1NW1A 2VD5A 3VVHA 5C8MA 2LGCA 3C50A 3EQFA 1ZYDA 3CP9A 4M66A 3R04A 4MHAA 2W5HA 4GKIA 5I0BA 2YWPA 2Q0NA 3AGLA 3NAYA 1OPJA 2FSLX 2VZ6A 2OFUA 5CU3A 4UMUA 3EN4A 3H9RA 4AQCA 3ZO3A 4HVHA 4AN3A 3IS5A 2JD5A 3NUYA 3Q2MA 2ZM4A 4TW9A 4N6ZA 3REPA 4HVGA 3W55A 3Q96A 2YCFA 3HDNA 4LOOA 4S30A 3UNKA 3VUIA 3PDTA 2XIKA 2XM9A 4KS8A 4MTAA 3QTSA 4ONAA 5HE2A 3ETAA 4DFNA 5FBOA 1IRKA 2BROA 4AG8A 3IW7A 4BKYA 5GJFA 3FMEA 4AZTA 2P55A 4G3CA 1U54B 2YIRA 4U3YA 3QX4A 2RIOA 4XV3A 4BCOA 5HLWA 1OL6A 3QRIA 3ZFXA 2UUEA 1W7HA 5JRQA 5CF5A 3AC8A 1OBGA 1R3CA 2JC6A 4RLLA 5CAPA 2OO8X 1T46A 3QLFA 4GG5A 4ZTQA 4RA4A 3MYGA 5T3QA 5EYKA 4EUTA 5E8XA 2XNPA 3PPKA 1H27A 4JVGA 4HW7A 1F0QA 3IW6A 3OEFX 4FR4A 3VF9A 2WTIA 3C5UA 3RK7A 3QYWA 3MTLA 4RWJA 5D11A 2QOOA 4AU8A 4JS8A 3WZJA 4XX9A 5AM7A 4MNEA 4K2RA 4B99A 3MJ1A 3DXPA 5CVHA 2ZV2A 1MP8A 2PK9A 4F70A 4BB4A 1J1CA 2ITWA 3OOGA 3QGWA 3TZMA 4FVQA 4MD8E 2XYUA 3HV5A 3QRUA 5CZHA 1V0BA 2R3GA 1FVTA 3E8NA 3MDYA 3SXRA 2HXQA 4AF3A 5IA0A 1URCA 5D12A 3EQRA 5DI1A 4G6NA 4H36A 2QO9A 4E4XA 4MCVA 4AGWA 4UWCA 5A3XA 4ZSGA 5M55A 1GNGA 1Q99A 3F6XA 4QP6A 4U8ZA 2R3NA 4XUFA 3R1QA 4RLKA 5BYZA 4QMVA 5IEYA 1WBWA 2P2IA 2A2AA 4BYIA 4BWPA 3E64A 4A9YA 3LJ0A 4C4JA 2JKKA 5EDPA 1LEZA 2ZV7A 5AP7A 3WF8A 4RX8A 5J5TA 1FMKA 5CENA 2GCDA 2PL0A 3AD5A 5AX3A 2IZRA 2PE1A 5EOLA 5FTOA 3VIDA 2IW9A 3ZXZA 4B8LA 3F2RA 1ZMUA 2J0JA 5B0XA 4WRGA 4DGMA 3OWPA 4ASDA 4OLIA 3NIZA 2C68A 5JGAA 1PMNA 4QMXA 4UZDA 4X21A 3NNUA 5CQUA 3R7YA 3PPZA 2BRMA 2JDOA 4K77A 2Z8CA 4EJ7A 1FVVA 4AT4A 4F63A 3C0GA 3NW7A 5E91A 3U51A 4CRLA 3V6RA 3UVPA 3K3IA 2AUHA 2PY3A 2VTOA 4AE6A 1OVEA 2EXEA 3O71A 4H1MA 5E8WA 4EL9A 3NEWA 4L67A 4OTFA 4QRCA 4F1OA 4ZOGA 4U42A 2VNWA 4HGLA 4XP2A 3NLBA 3L8SA 3U6JA 3WOWA 3A7IA 2ITXA 1KV2A 2RFDA 3EH9A 4FTJA 3IOPA 1XJDA 4IXPA 4UXLA 1JBPE 4XHKB 5A54A 4JBPA 2ZV8A 3PPJA 3OD6X 4BDKA 3HMMA 5KE0A 5HBHA 3NIEA 5BNJA 4TYJA 2W5BA 3KMWA 4H1JA 4YU2A 2GU8A 1LPUA 3PJCA 3ROYA 4DG3E 4FTKA 4TWPA 3PVGA 1V0PA 3CSVA 3QHWA 3UGCA 1Y6AA 4PP7A 4RRVA 4USDA 2NNWB 4D2TA 3OUKA 4W4XA 5EI6A 5CEMA 3QC9A 2XNEA 5AADA 4PMTA 3AD6A 3ORXA 3BHYA 3ZSGA 3R9DA 4PNIA 4EHZA 1OL1A 3G9LX 4HGEA 4OBPA 4WNKA 3DKFA 5DN3A 5LMAA 4BDBA 4DTAA 3QA8A 2VN9A 3C4EA 4X6QC 4YP8A 4DT8A 5DWRA 5J8IA 5AM6A 4ZSJA 3O7LD 4X3FA 3FLSA 5FEQA 3QQHA 1XWSA 3OVVA 3R2YA 1YW2A 4GFOA 4L7FA 4O6LA 4EK5A 3UQFA 2I0VA 4KKHA 2R64A 1WZYA 2ITYA 4A9TA 3EL8A 3LFBA 1U59A 4FTAA 4IVDA 4LMUA 4O0UA 3TV6A 1R78A 3MBLA 1TQPA 2IWIA 1GY3A 3D5UA 4E73A 2XKDA 3CJFA 3C4WA 2Z60A 3VBYA
chains in the Genus database with same CATH superfamily
1VEBA 5HBJA 3KQ7A 3UZPA 3A62A 4F9WA 4RGJA 2YZAA 4Y85A 3VW8A 5HLNA 3WE4A 3E7VA 3LFSA 4GG7A 4IAIA 4NU1A 5BUIA 5C8NA 4U41A 1PXKA 4KUJA 2QOFA 5A4CA 2XIXA 5L6PA 2B0QA 4ZZMA 3FY0A 4TYIA 4DINA 2VTPA 3LE6A 5AUVA 2W0JA 1JKTA 4ZY6A 3Q6UA 3Q5ZA 2QOBA 4IJPA 4AOIA 3RNIA 3AT2A 2WOUA 5AX9A 4HPTE 2GTMA 4IQ6A 3IONA 5HOAA 5FP5A 1YOLA 4ZSEA 2X6DA 3QWKA 4TWNA 1KE9A 3TJCA 3E7OA 3RPYA 3CLYA 4XBRA 3I4BA 4NFMA 5BYYA 1KE6A 2PVKA 3NUUA 3VRYA 5TE0A 5KKRC 3PY0A 4FTOA 1Q4LA 5L2WA 3GU6A 4HGSA 5DRDA 3FZ1A 4ZTHA 2PZPA 2JFLA 3TYKA 3UIXA 3JPVA 4BCKA 2XNMA 2R3FA 1F3MC 2CCHA 2Y8OA 2X2LA 3CKXA 3R8ZA 4AW0A 5M51A 3H0YA 2KTYA 3ZUTA 4CLIA 3QXOA 1GOLA 5JGDA 4EYJA 3F88A 2WTVA 4J7BA 2CGWA 2HW7A 3UBDA 3DDQA 4L52A 2X7FA 4CFNA 3CTJA 4HZRA 3R8UA 1IAHA 2UZEA 5HX8A 4FK3A 5HICA 5CQWA 5DNRA 2WQBA 4FTTA 3SOCA 1EH4A 3NX8A 2XM8A 4TY1A 4FYNA 5C26A 2R0IA 3EOCA 2X8DA 4IZAA 2YIQA 5E8SA 1MQBA 4FOBA 4FIEA 4U6RA 5IUGA 1OPKA 3EN6A 4G3GA 2B52A 2UW9A 3PY1A 3F3ZA 3KB7A 4I1ZA 1PXPA 3DBQA 5JK3A 4JDIA 3UO5A 1JKSA 2W4KA 3F9NA 5JRSA 3W0QA 2YIXA 4O1PA 3EMGA 4YZMA 2WTJA 4FG8A 5EQPA 4JG7A 5AUWA 4YJSA 2BIYA 4WKQA 1B38A 4S33A 3W32A 3SC1A 3KK8A 4QMZA 5IUIA 4F78A 3BLRA 4OTQA 3TZ8A 3V8WA 5AP0A 1R0EA 4NCTA 2C6MA 1H26A 4UYAA 3EB0A 4GYGA 3A8WA 3VS0A 2UZVA 4AGCA 1UKIA 4CCBA 4CT1A 1V1KA 4L68A 5D9HA 5KMLA 5DH3A 2J90A 3LW0A 2J5EA 4I23A 4D4RA 5K5NA 3TKUA 4QMOA 2CKQA 3LJ2A 3Q2JA 5M4IA 3VUGA 5FEDA 4U97A 2IW6A 4RVTA 2ZM1A 4R3CA 4EWHA 2IN6A 3CQUA 2VO3A 3LQ3A 3SKCA 2P2HA 4DA5A 3MWUA 3TKIA 2BFYA 3GP0A 4BHNA 3ZLYA 2BAJA 4BL1A 3BU6A 3OEZA 5LCKA 4QDVA 5HCYA 5DIAA 3R8MA 1H24A 3SX9A 4LQMA 4F0FA 4QMTA 3NNVA 5LMKC 1Y8GA 4AFEA 1ZLTA 4JDKA 4XLIA 2XK4A 5L2SA 2JEDA 4I6LA 3QQJA 1Q3WA 4HCTA 3R0TA 4W4VA 3TI1A 4QMNA 2BZHB 4NM0A 4F4PA 3QZGA 5EYMA 2WD1A 3GFEA 1XHAA 1XBCA 4OW8A 3UDSA 4O0RA 5BMSA 1JSVA 4EUUA 1LR4A 5AAFA 3FI8A 4FIFA 5E8TA 4UWYA 1J3HA 3AC5A 3LOKA 4DEHA 5I3RA 1WBPA 5AV4A 4PPCA 3RNYA 2XANA 2R5TA 2WQOA 3PSDA 4FL3A 5H3QA 3F3VA 2XS0A 4AA4A 4GJ3A 4XG4A 4BDCA 4Q9SA 5HVYA 2PMOX 2R3RA 4O27B 5HU9A 3ACKA 4IAAA 4EH3A 4KIKA 4QMYA 4ALVA 3O17A 4IWOA 4D2VA 5KMNA 1B6CB 3PWYA 3HV3A 4FRFA 2OSCA 3IDPA 4GS6A 4V0GA 4P5ZA 2XCKA 4JQ8A 2UZNA 3F61A 5JT2A 4OT5A 4TN6A 3BQCA 3DLSA 3BHTA 3LJ1A 4E20A 2OZOA 4FA2A 3B8RA 4GSBA 5IDPA 5CLPA 2B1PA 3VW6A 2ITZA 5M53A 4L46A 4XS2A 4RFZA 3AC2A 4F6WA 2UW7A 3AT4A 3MPTA 2CGVA 3LCDA 3MH3A 4XG7A 4NTSA 3NYNA 4AOTA 2GS2A 2HELA 3C4FA 3DFCB 3W10A 3BLAA 5CEKA 2VTJA 2PVLA 3DTCA 1FQ1B 2VO6A 3PXYA 2AC5A 1L3RE 2OK1A 4G3EA 4E4LA 5KX8A 5CALA 3WE8A 3GT8A 4CTBA 3AG9A 1UU3A 1WVWA 3AMBA 5CZIA 1H1PA 4P7EA 4XG3A 2OH0E 4DE4A 4NH1A 1UWJA 3MIAA 4XP0A 3TXOA 3WBLA 3ZC6A 4F7NA 1PMVA 4QD6A 5CNOA 2C3JA 4EH6A 4GJ2A 2X81A 3TT0A 3HMNA 4NW5A 1Q3DA 4MWHA 2PMNX 3OY1A 3U8WA 3BLQA 3IW5A 4FG9A 5JSMA 2XARA 4ANNA 4RVMA 3R9HA 4MXCA 1XBAA 1JQHA 4DBNA 3MVMA 2QO7A 1LUFA 3LKMA 3EZRA 5CT0A 4FKSA 4BGGA 2BHHA 2Z7RA 5DFPA 4RVLA 3AMAA 2ZV9A 2ZB0A 3R02A 3AC4A 3ZXTA 5GJGA 1M7NA 1Y57A 5I9WA 4MWIA 2ZMDA 4YHTA 5GIPE 5DLSA 3V01A 1HCLA 5IQEA 3G6GA 5F9EA 2XK6A 4NFNA 4UXQA 3RINA 3VBVA 4FSNA 3THBA 4AP7A 3EYHA 3QZIA 3QUDA 3DJ5A 3Q53A 2I0YA 4RX9A 3WZKA 4HNFA 2XYNA 3CJGA 4XV9A 3RK5A 2Q0BA 4YTCA 5LMBA 2VX1A 3PVBA 1VYZA 5HG7A 5GZ9A 4JIKA 2QD9A 5JZNA 4FKPA 2W96B 1XQZA 3AXWA 4AE9A 4IB0A 5TT7A 3UYTA 4PMPA 5CI6A 2P4IA 4DH7A 5J1VA 3QUPA 2PHKA 4LL0A 3SRVB 4O4EA 4DH1A 5L6OA 4MXAA 4AXFA 1DAYA 4YC3A 3TG1A 5AR8A 3CTHA 2G2FA 5DR9A 5HIEA 4GV1A 2O64A 1NA7A 3IKAA 4EYMA 4AA0A 3R28A 3IK3A 3GVUA 5HLPA 1M2QA 4IBMA 4OBQA 4Y5HA 3S3IA 2BKZA 2CHLA 2JDRA 2QOIA 3ZTXA 1CM8A 2XEZA 1PMUA 4XG6A 3OWJA 4RZWA 3BX5A 2C3LA 3WARA 3FSKA 3QD2B 4QMWA 5CVFA 5FEEA 5J9ZA 3FQHA 4HCVA 3A4PA 2YIWA 2HIWA 4U0IA 3TN8A 2YM8A 3TNWA 2ZMCA 2PZ5A 4GCJA 2VWWA 4EONA 3OG7A 4QMSA 5EH0A 4C2VA 4YJNA 2F7EE 3W1FA 3IPHA 3ZDUA 3HA6A 3LFEA 5HIDA 4DFZE 2W7XA 3EFKA 4ERWA 5AAGA 5KKRB 3COKA 4FJVA 2UW0A 4WNOA 4DGNA 3ZC5A 3TEIA 3KRJA 2C0TA 5HZNA 4KSQA 3DS6A 2PVYA 5E7RA 1H00A 2YM5A 3HA8A 3MVJA 4RIWA 4D4SA 1FINA 5KO1A 4YSJA 3ORTA 4I41A 2YAKA 3OCBA 3A7FA 3DCVA 3R8VA 4I5CA 3R6XA 4G6OA 4MUQA 2QG5A 3MGYA 3QKLA 5G6VA 4M0YA 4BFMA 4EK8A 2H34A 3HLLA 4F9CA 4CKJA 3TDVA 3NAXA 2C5YA 4FL1A 3KRXA 3NFFB 1L8TA 1T45A 5EHYA 4O38A 3D2IA 1YHSA 3UDBA 3CQWA 4Y72A 2PUIA 5FUTA 4YZCA 3OS3A 4H3PA 5K9IA 1GZ8A 2C6DA 1STCE 5CVGA 3MV5A 4KIOA 1U5RA 3VS6A 4BKJA 3QZFA 1SZMA 5H8GA 2BR1A 2R0UA 3HP2A 3LCSA 4FODA 3FHIA 3VUKA 1ZYCA 4RX7A 3DGKA 3MA6A 4BYJA 4G31A 3FMMA 5AP4A 2IEWA 3D7TB 4ANOA 3EFLA 4D2SA 3ZO2A 3UNZA 3QHRA 3SLSA 5LJJA 3DAEA 2EVAA 3OZ6A 4EK3A 1VZOA 4C59A 2HXLA 1M14A 2WU6A 2ZM3A 2PZIA 4DHJA 3R73A 3W2CA 2OKRA 3OW4A 2ERZE 4EZ5A 2YN8A 4USFA 5DHJA 1W8CA 3HNGA 3GNIB 2PVFA 5CU6A 2YA9A 3BHHA 5ACKA 3VBQA 3HL7A 4BCHA 4PTCA 5AA8A 3JR1A 4JBQA 4K33A 5AP3A 2X9EA 3DLZA 2O2UA 4EH4A 5GNKA 3DAJA 2IZTA 2WMSA 4RWLA 4UX9A 1G8JA 4LGGA 3MA3A 4JMQA 4IAFA 3KKVA 4WIHA 5HHWA 3ULZA 4BBFA 3DA6A 1IAJA 2FO0A 3MFTA 4F7JA 3OF0A 3BYVA 4M7IA 4L3LA 2OF4A 2YLEA 2NRYA 5JFVA 5IA1A 4QQTA 3E88A 5DEYA 3C0IA 4IWPA 4M13A 4TYEA 5HORA 1GZKA 2Y4PA 3VC4A 4V05A 2J0MB 1VR2A 3WF5A 4OTGA 3GQLA 4Z7GA 3W0SA 2J6MA 4Z16A 2WTCA 3QXPA 3EZVA 3NUXA 4FSZA 3UOHA 4WHZA 3KRRA 1B39A 2GHLA 3AT3A 5B2LA 5AR5A 4TNDA 4GK3A 5AP2A 4BTFA 5FDPA 1KE7A 4FV7A 4O7SA 2GNHA 4G6LA 5EM6A 4G16A 2WTDA 2UZUE 2XMYA 4L01A 3VS2A 4DEIA 3F7WA 1WVYA 2G2IA 2HZ0A 4QTBA 4YUQA 2UVZA 1UU8A 5HCXA 3R63A 2R9SA 3ZLWA 5IH6A 4ZEGA 2OJGA 3KVXA 4KKGA 2H8HA 4YO6A 2UW4A 3RTPA 3UIUA 5HO6A 3DTWA 1CTPE 2C47A 4NIFB 4C3RA 1UVRA 3N51A 1R1WA 5C27A 2I40A 4LRJA 1W83A 4BICA 3NMUF 3LMIA 1QMZA 2BVAA 4ENYA 3VNTA 5A4QA 4G9CA 4ZTSA 2EXMA 2X7OA 2QNJA 4ANSA 1NVSA 2R7BA 4ZSLA 5HCZA 2GMXA 3KRLA 5BVEA 3FMNA 3E8DA 3VS1A 4GUBA 4C4IA 4ZTNA 3V5TA 4CEGA 4OAVB 3NSZA 4GUEA 4C3FA 3QRTA 3UPZA 2B7AA 4KABA 4RC3A 1SNUA 4IWDA 3RCDA 3FE3A 3POOA 5EQYA 1M7QA 4YR8A 2VNYA 3B8QA 3ZZEA 4FSRA 5ANOA 2H6DA 4FSQA 4PQNA 2G9XA 3NUAA 4DH3A 2VTRA 5CF8A 3JY0A 4I6HA 3NS9A 3FI3A 3CGOA 2QR8A 2PPQA 4XBUA 4MK0A 4O7LA 4A9UA 5IU2A 3BV2A 4QTEA 4X3JA 2J0LA 5GINE 4AGUA 3GFWA 1I44A 3KXGA 4OT6A 2GHGA 3R7EA 3V5QA 5KHWA 4Q9ZA 3QL8A 3FYJX 4MD9E 2ZDTA 4M97A 3P08A 4KIKB 4L43A 3KFAA 3PYYA 2YZLA 5HE0A 3TZ7A 4K1BA 1YDRE 3CIKA 4KKEA 4LUEA 3KXHA 3PRFA 5DT0A 4U79A 3RK9A 4MAOA 1Y91A 3ZLXA 4A07A 4ASEA 2YDKA 3UMXA 4EZ3A 3COIA 3UDTA 4DFBA 4GMYA 3ATSA 3R01A 3L9PA 4QP3A 5EDQA 3MI9A 4QYFA 4BRXA 2RG6A 3LXLA 2XEYA 3FKLA 3Q52A 4BDAA 3ORLA 4BCJA 4ZTLA 1KV1A 1BYGA 4D4VA 4DAWA 3VS3A 4UMRA 5JMSA 4E7WA 4JJRA 4O81A 1PXOA 3ZO1A 4FBXA 5FDXA 2V62A 2JITA 1OGUA 3TCPA 5KMKA 1ZXEA 3G0EA 3NR9A 2F7ZE 5ANGA 3BYOA 4JR3A 1R39A 3ZMMA 4N57A 2WNTA 4RJ3A 3ANRA 3Q9WA 2XKFA 4GT3A 3OMVA 5KMOA 4FTIA 5CY3A 2HY81 3RAWA 4I94A 2B9FA 1RDQE 1ZZ2A 2XB7A 2XKCA 3EQPA 1FBNA 4CNHA 3OTVA 5CEQA 4EOLA 4M84A 4MQ1A 5LQFA 3LXPA 3CY3A 4ZIMA 1J7IA 3PUFC 3QTRA 4M69A 5CXZA 4WBOA 4TL0A 2BKKA 4NKSA 2X0OA 4QNYA 1H1QA 3H9OA 4FICA 4A06A 3R71A 3UYSA 2E9UA 4D5HA 4FUXA 2JAVA 1FGKA 2C6IA 3BGQA 4DHFA 4G5PA 4FTNA 4I21A 1Q97A 3OY3A 1PHKA 3RWPA 3ZS5A 3PLSA 5A4LA 3H3CA 5DEWA 1Z9XA 2QODA 3WYXA 2EU9A 3CTQA 1YHVA 4FIGA 4RIXA 4YHJA 4C36A 1BI7A 2PYWA 3QUEA 4BI1A 3QLGA 2GNJA 3LMHA 4ID7A 4N6YA 1YHWA 3L8PA 4JIAA 5L2QA 4U45A 2CJMA 1ZYSA 3Q4TA 4XOYA 4IHPA 1G8KA 3D9VA 4LI5A 1MUOA 4CFUA 4HPUE 4D2RA 3G5DA 5D7VA 3L8VA 4MH7A 4DH5A 4YMJA 5HX6A 4ZJVA 3BL9A 4RG0A 4RIOA 3ET7A 4YBKA 4QYHA 1OUKA 1ST4A 4IW0A 1ZOGA 2QR7A 4KD1A 4QP1A 4IX5A 5AFVA 3ZSHA 3U4UA 4O0TA 4FNZA 3PY3A 3MB7A 3DU8A 5KHXA 4LOQA 5HBEA 3GXLA 2GDOA 3FYKX 3UE4A 3RHXA 1H0VA 5DRBA 2Z7SA 3E8CA 4GK2A 4AN2A 5TKDA 4I6FA 4O7TA 3OW3A 5HEZA 2VWXA 1BL7A 5GZAA 4UYNA 3LZBA 5IQGA 2HAKA 3WYYA 5CSPA 4XMOA 2V7OA 2NYAA 5JFWA 1W2DA 3HRCA 3DB6A 2PUUA 3P7AA 2C6TA 3AGMA 4WO5A 1P4OA 4ZS4A 4PX6A 5E92A 3TL8A 4B9DA 2OJFE 3GCVA 4KINA 3FMLA 3FQEA 4KIPA 3F66A 5HNGA 1UNGA 3FJQE 3OBGA 3FLWA 4FTQA 3VS4A 4B6LA 1UV5A 4YLJA 4EH7A 1XH7A 1W0XC 3T9IA 3LCKA 3RVGA 4CZUA 5KMMA 1GIJA 3G15A 4ZZNA 1A06A 4EJNA 4JLCA 4XOZA 2F57A 4C62A 1AGWA 5JH6A 3BGPA 2HZ4A 4BIDA 2DUVA 3ODZX 4BDJA 1GZNA 5L2TA 2G1TA 3BYSA 2XP2A 1ATPE 2AYPA 3EJ1A 3O8TA 4MF1A 4CCUA 3EFWA 3KMMA 4FIHA 2BAQA 3RZFA 1QPEA 2XBJA 3KXXA 4UEUA 2VTLA 1H8FA 2XK3A 4FI1A 2OIDA 4EK4A 4IAYA 2XNOA 3KRWA 4EHEA 2O3PA 3RP9A 1OIQA 4JRVA 2QOHA 2YAAA 1K9AA 3UMWA 1YRPA 3W2PA 3TV7A 4MF0A 2GPHA 2XIZA 4L3JA 5D10A 2BILB 2WEIA 5H8EA 3GEQA 4ASZA 1HOWA 2OJIA 2YM6A 3A2CA 2C30A 3G33A 4M67A 4ENXA 5J79A 5K4IA 2WZJA 2B53A 2GQSA 3SGCA 3R30A 3CGFA 4BIEA 2J5FA 2VWVA 2VWIA 2XNBA 4JX7A 5DA3A 3L9MA 5AUZA 5FTQA 4E6DA 3BPRA 2A27A 4KNBA 2CNVA 2EUFB 2O5KA 4II5A 2XH5A 4PMMA 4PPBA 4JDHA 3FY2A 2YITA 2I0EA 2ONLA 4PL4A 2E9OA 3KF4A 1W2FA 3F3UA 4FGBA 1Q41A 2QKRA 2Y4IB 4ZJIA 2GQRA 3R1SA 3CPBA 4F0IA 2BPMA 3FC2A 5I3OA 4I24A 5HO8A 5KMIA 4AXCA 3Q4UA 2X7GA 4JDJA 5E8ZA 5CASA 3IECA 1M2RA 4L44A 4X2GA 3QC4A 3MW1A 3CS9A 2NP8A 2YCSA 3GBZA 4EOKA 2QONA 3WIKA 2GNGA 4DTBA 1JOWB 4M14A 4FEQA 3WIGA 3FLQA 3KU2A 3R7OA 3DQWA 4ANMA 1BMKA 3K5VA 4IE9A 5DGZA 1A9UA 3KULB 2E9NA 3D14A 3O96A 2Z7QA 5AR2A 3G0FA 5AUTA 3KVWA 4F9AA 1P4FA 3AC1A 2JLDA 3GUBA 4U9AA 5E1EA 4R78A 3R9RA 4CZTA 1YI3A 3GOKA 5J1WA 3BI6A 5HO7A 4DBXA 4QOXA 3ULIA 4GRBA 1TVOA 3FBVA 4WNPA 4I92A 1FOTA 4X2JA 2WMWA 4IFGA 4L9IA 4BDHA 4C58A 4CYJA 4DTKA 4I0TA 1SMHA 3KXMA 4FKQA 1H1RA 5IF1A 5M4FA 3PIXA 2QU6A 3EN5A 3TNQB 1TQIA 4E3CA 2HCKA 4I6QA 4IZ5A 3O23A 4UWBA 3TNHA 4ACGA 3ZM9A 4LDTA 2BIKB 3SW4A 4F64A 1OUYA 2WIPA 2QVSE 5JFSA 5FM3A 4DEGA 4O7NA 3I1AA 5JQ5A 4X3FC 3I60A 2F2UA 4CQGA 2PWLA 4QT1A 4C37A 4EC8A 1PXIA 3K2LA 4R3PA 4F6SA 4BIBA 4XLVA 3ML1A 2BRGA 4GH2A 2XNGA 4U5JA 3RM6A 4OTIA 4OTWA 2ESMA 2IZUA 3EYGA 2OFVA 3DBFA 4QEBA 3ZRKA 4QQJA 4DDIA 1REKA 4YGAA 5J7BA 2YACA 1XH9A 5HE1A 3BYUA 3E5AA 2IVVA 5M4UA 3I6UA 3R7GA 4BN1A 4FEUA 4ANBA 4D2PA 2C5NA 4C4GA 2IVTA 4ORKA 1GAGA 4I5MA 3FKNA 1XMLA 1KE5A 1OITA 3MPMA 4I5HA 2ACXA 3GU7A 3IGOA 5FP6A 3FEGA 3ID6C 3VF8A 3VRZA 4CFXA 2OIBA 1ZZLA 2XAOA 3ZZWA 4F65A 3FQSA 4IIRA 3FC1X 3EN7A 4F0GA 3D7ZA 4FYOA 3BEAA 5IQHA 2O0UA 3UOJA 4JG6A 2GNIA 5FM2A 4O86A 2RF9A 2WMRA 2OZAB 1REJA 2AC3A 4ZY4A 3VQHA 3TKHA 4HYHA 5E9EA 3QKKA 4RZVA 4K8AA 1BL6A 4EOJA 3JXWA 5DBXA 2W1ZA 1MRVA 5HNBA 4BJJB 2BRBA 2OJJA 4TYHA 3F5GA 4ANQA 3I7CA 3RPVA 4B7TA 1VJYA 2I7QA 2XK8A 3KC3A 3K5UA 5H8BA 4B4LA 4U44A 5DT4A 3C0HA 3W0MA 3N4VA 5A4TA 3W0PA 5EW3A 1E1VA 1WCCA 2X6EA 4XV1A 4XJ0A 3S4QA 2R4BA 4OBOA 4B0GA 4FSWA 3R1YA 3Q9ZA 4BCNA 2XBAA 4J99A 4DT9A 2W1HA 4QTDA 4W4YA 1NVRA 3CY2A 4NTTA 4UZHA 2WMBA 2Z2WA 5H2UA 4FVRA 2QOQA 5EW8A 2G15A 4GFGA 5IH4A 2WMUA 1GIIA 1P14A 4CGAA 1CKJA 1XH4A 2RL5A 5GIOE 5AMNA 3W18A 2WMVA 4DG2E 4RSSA 4Y83A 1APME 2ERKA 4G5JA 4UY9A 2BZKB 3K3JA 3BQRA 3F3TA 1XKKA 1ERKA 3OXTA 3PXKA 3TWJA 4YO4A 5DMZA 3R7IA 2BTRA 3GC7A 3Q32A 4YZNA 4YLKA 2BHEA 5AWMA 4DFXE 1ND4A 1JPAA 4D0XA 3A7GA 4J8NA 3LLAA 3ZUVA 1BLXA 3EQDA 3E63A 4HVIA 5CEOA 5KMJA 3W2OA 3BWJA 4AS0A 4Y46A 4N0SA 1NVQA 2R3OA 4YTHA 3DXQA 1ZY5A 4YC6A 4NCTC 4ZLOA 4NJ3A 3SXSA 4EI4A 2BCJA 3BL7A 1YXSA 3LQ5A 3QCXA 3GU8A 4IMYA 4CFFA 3KN6A 4L45A 1QL6A 4J8MA 4WRSA 2JDTA 3G6HA 3NNXA 2WO6A 1Q61A 3KXZA 1Q8YA 1WBNA 3G9NA 4E5AX 3QFVA 4CG9A 5BVKA 1DS5A 5DOSA 4QTAA 5CSVA 4EOSA 4IWQA 3UC3A 2HWOA 4C35A 2YM4A 4PL3A 5HGIA 4C4HA 3EQCA 1OPLA 4YJRA 4CYIA 3ZDIA 4ZMFA 3VBTA 4XEYA 3RALA 1ZY4A 4UN0C 5LVLA 5EM8A 2BDWA 2OICA 4KA3A 4C3PA 2UZTA 4DLIA 4MNEB 4A7CA 3DBCA 5JGBA 4CLJA 5LVNA 2I1MA 3FLZA 2CSNA 5M44A 4YJPA 2FGIA 3I0QA 4DEEA 5J9LA 2FH9A 3FV8A 4MEDA 3ORZA 1WBTA 3NYOA 4UV0A 3ENMA 3I79A 4LMNA 4PL5A 4QP4A 3QBNA 3PFYA 2Y9QA 4CZYB 1NXKA 4NK9A 3RZBA 4L3PA 5TF9A 4IZ7A 3T3VA 1V0OA 3JVSA 4PDOA 2QKWB 4D0WA 5BUEA 1FGIA 2R7IA 4ZP5A 4IAKA 2VO7A 3QD3A 1NY3A 2O8YA 3OC1A 3PJ1A 4X7QA 3SG8A 2WOTA 5IDNA 1JAMA 3Q6WA 4GU6A 5FG8A 5GJDA 3SW7A 4J97A 3C9WA 4RIYA 1IA9A 1JNKA 1SYKA 3EFJA 2R3JA 4AT5A 4EK6A 2OF2A 5CAOA 1W82A 3HV7A 4IVCA 3LLTA 3IO7A 3R9NA 4I22A 4K9YA 2SRCA 4C38A 3U54A 2P0CA 1IG1A 3DXNA 4EQCA 4DITA 2ETKA 3FZOA 5IMXA 3FZSA 1ZYLA 2C3KA 2WFYA 2UW5A 2OG8A 3PP0A 2WTKC 5CU2A 4EH2A 4EWQA 4J71A 4NKAA 5AJQA 4DH8A 2W17A 2V22A 3G90X 4JNWA 4NT4A 2VWZA 2XJ1A 4O7RA 2WU7A 4BDDA 4FVPA 3RJCA 2FVDA 4ANLA 3NW6A 3NZ0A 3QQFA 4NUSA 3MH1A 2C6EA 5IA4A 1YXTA 2AEGA 2ZJWA 3HECA 4C34A 5CF6A 4L42A 2ETMA 3RPSA 3ERKA 3V6SA 5EM7A 4LOPA 4D4YA 2CDZA 3QWJA 1OKZA 3ZU7A 4ACMA 3TZ9A 3I6WA 5L4QA 2CNQA 2FA2A 3MIYA 2EXCX 2GNFA 2VTNA 5F20A 3TJDA 5J5SA 3R00A 5BPYA 5F1ZA 1YI4A 1ZMVA 2VUWA 1W98A 2VX0A 2ZDUA 5IZFA 5GZ8A 4L6QA 4YLLA 1U54A 4FNYA 5IEVA 2WMXA 3ZSIA 3L9LA 3NGAA 5EM5A 1KOBA 5LOHA 4XV2A 4QTCA 3N4TA 4GFMA 1AD5A 2R3IA 3E3BX 3P5KA 4KAOA 4AXAA 5E90A 4UMPA 5K0XA 3PJ8A 5AR3A 4FKIA 4Q5EA 4ZSAA 2WKMA 3CXWA 2W1EA 4MXXA 3TDWA 3NUSA 4XNEA 5G1XA 4X3FB 3LIJA 4FT3A 4LV8A 5B7VA 4IEBA 4W9XA 4J96A 3IGGA 4I0SA 4XH6A 4RBLA 3I0OA 1URWA 3P7CA 2Y6MA 4PDSA 2C1AA 4IM0A 4XCUA 2WQEA 3BLHA 4FUYA 4ZTRA 2VWYA 5M4CA 2ITVA 4QYGA 4P4CA 5GHVA 4FKUA 4PDYA 2LAVA 5LVOA 4GKHA 1XH6A 3EIDA 3FHRA 5BUJA 4RPVA 3UOKA 5IA3A 3AKKA 2OXYA 4CSVA 3TIZA 2DWBA 2VGOA 3OXZA 4IB3A 3GC8A 3PA4A 5CAUA 4D55A 4WT6A 3GQIA 4OR5A 3PE1A 4CMUA 2BDJA 4FX3A 4QP8A 3FDNA 4A4XA 2ITOA 3DKCA 4U3ZA 3TM0A 5BV3A 4NJDA 2QQ7A 4FTLA 4E1ZA 4FK6A 1S9IA 5DT3A 4R3RA 5J7HA 3UQGA 3GCPA 1YVJA 4MQ2A 4EC9A 4KBCA 2ITUA 3CKWA 3GGFA 3P1AA 3QCYA 4TT7A 4U81A 2NPQA 5FXQA 4IX3A 4RMZA 4YJVA 3VQUA 3FPMA 3E92A 3PG1A 2GTNA 3QTUA 1OMWA 1KSWA 4FSMA 4OTDA 1ZWSA 3CBLA 4JOAA 4R7IA 3U6HA 3SG9A 4NWMA 1TZDA 4RA5A 2HWPA 3D5VA 4AW5A 2R3LA 5AIRA 4FSUA 3WZDA 4BDIA 4NM7A 2J51A 1YDTE 2OU7A 4GL9A 5EDRA 2QO2A 5A6OA 4QMMA 5ICPA 2UW8A 1F5QA 3E93A 4KB8A 4YZ9A 4AZVA 3BZ3A 4LFIA 3UPXA 3M2WA 2F9GA 3VHEA 2WMTA 3FMDA 2IZSA 2P33A 3BCEA 3JVRA 4FNXA 1ZOHA 1XH5A 3RPRA 4IJ9A 4E6QA 2GFSA 5B2KA 3EHAA 3UZTA 2BZIB 4OGRA 5CTPA 3TACA 3MFSA 4WUNA 4Z7HA 1QPJA 3SAYA 1H01A 5CANA 2HZNA 2QLQA 3DZQA 3HV4A 4RT7A 4UMTA 4X0MA 3COHA 5I4NA 5FTGA 2VGPA 4HVSA 5CS6A 3VJOA 1AQ1A 2J9MA 3MH2A 3HYHA 3FLYA