4AA0A

P38alpha map kinase bound to cmpd 2
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
347
structure length
328
Chain Sequence
RPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MITOGEN-ACTIVATED PROTEIN KINASE 14
publication title The Discovery of N-Cyclopropyl-4-Methyl-3-[6--(4-Methylpiperazin-1-Yl-4-Oxoquinazolin-3(4H)-Yl]Benzamide (Azd6703), a Clinical P38Alpha Map Kinase Inhibitor for the Treatment of Inflammatory Diseases
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 109
structure length 328
sequence length 347
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2011-11-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4aa0A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4aa0A01
2XIXA 1M7NA 3PWYA 4EH5A 5A4QA 4D9UA 2HXLA 4IAZA 5H3QA 3C5UA 4PMSA 3UOKA 3A7FA 4U79A 3R0TA 1LEWA 3Q9ZA 4FIHA 3SDJA 1HCLA 4EQCA 4F6WA 3PXKA 3UMWA 3BEGA 1MUOA 1Y91A 4QMZA 4XG4A 3OBGA 5FRIA 2WU6A 3LFFA 3Q5IA 4BI2A 5IH5A 4YHFA 1Q8YA 4NTTA 2ETRA 3EOCA 4G2FA 3ETAA 5IF1A 2ZMDA 5ANIA 4TKSA 5K5XA 4C33A 3MIYA 1SVHA 3BV3A 2W1DA 5A4CA 4UWYA 5LVMA 4MX9A 1OPLA 1UWHA 4QYGA 3PPZA 3VWAA 1XQZA 3BHUA 3EKKA 3FBVA 1SYKA 4KKEA 3P78A 4NUSA 4CZYB 4F70A 3P79A 3CSVA 2XIKA 4CG9A 4DBNA 2C1BA 5EKOA 4PRJA 3QAME 3TZ9A 2GNHA 4BGHA 3AC2A 4OLIA 3TJDA 1L8TA 2XIRA 5M4FA 1W8CA 2XBAA 3FMDA 2CDZA 3EQGA 3H9FA 1W98A 4APPA 3GCVA 3FI2A 5AUYA 3VUDA 2VZ6A 2WMAA 3MVHA 2XKEA 4E5AX 1JSUA 2V7OA 4WKQA 3KXNA 5BVNA 4D4VA 3OTVA 4GYGA 4JX7A 4CV9A 2QLQA 3LIJA 2EUFB 5EI8A 4EOJA 2XH5A 4D2WA 5CF8A 2W05A 2FUMA 4B7TA 4R1YA 4FEUA 4IIRA 3IOKA 5A6OA 4FSNA 2ITOA 2UZWE 4AA5A 4UWBA 3OT8A 3IW7A 4IWPA 5HG7A 3PG1A 3TXOA 4U44A 3DQXA 2PU8A 4O38A 4EK4A 3QQHA 4U43A 3WF9A 4E6AA 1UWJA 3DS6A 4BGGA 4M67A 2OJ9A 3OF0A 5M09A 1ATPE 3LMGA 3MGYA 3MH0A 4G3CA 4FEWA 3QF9A 3W32A 3FPMA 5IQCA 3IPHA 4LOPA 3TG1A 3DZOA 5FM2A 5HX8A 3MPMA 4ACGA 5HLNA 5AV1A 2PZ5A 5EDQA 3MSSA 2X2KA 5DT4A 3I81A 3ZU7A 1KE6A 4F1MA 2UZVA 3LAUA 3SG8A 4XG9A 2R3HA 2WQBA 3HLLA 3TI1A 4DFLA 2OBJA 1R0PA 2RKUA 3EWHA 3C4EA 3NAYA 3DLZA 2IVUA 4R7HA 2UZOA 4XX9A 3R9RA 4A06A 1V0OA 2B52A 3R2BA 4P7EA 1VEBA 2ZM3A 2BHEA 3QX4A 2BALA 4MXCA 4FNZA 5DH3A 1SZMA 1YXSA 5CWZA 4BYIA 5AP4A 5HU9A 4WNPA 4XP2A 1NY3A 5AAFA 4FTMA 3R8UA 3IECA 3ZTXA 4FTKA 4QMLA 4AFJA 1XKKA 4F99A 1P4FA 3F2AA 3MW1A 2RFNA 2YM6A 1GZKA 3LHJA 3LFCA 4AS0A 1ZYSA 5J1WA 1YKRA 5KMKA 3WZEA 5AP0A 4FTRA 4LGGA 5C01A 4AZFA 4O21A 3VULA 3PUPA 4M68A 1YOMA 1IRKA 5AA8A 2PMNX 2W9ZB 4FKOA 4WD5A 4X3FA 5F95A 5CEPA 4YHJA 4D9TA 3L1SA 1ZYDA 2WU7A 3I7BA 3LFQA 2VV9A 1NA7A 4FG8A 4IWDA 3RMFA 4PMPA 2VO3A 3CY2A 3PPKA 4XNEA 1YXTA 3FMHA 2G2FA 2QCSA 3V01A 2OWBA 4L00A 4DGNA 2R3QA 4OBOA 1PXNA 4E6DA 4IEBA 5L2TA 4MBJA 3C4ZA 2OSCA 3I1AA 3EQPA 2QKWB 4X21A 5A9UA 4S2ZA 4XV1A 2GPHA 3ENMA 4O1PA 3R9NA 5M44A 4JS8A 1FINA 2VN9A 4ZP5A 2ONLA 4ASDA 3RAWA 4HVDA 3IW8A 3OOGA 3G90X 3IKAA 1JNKA 4FZAB 4AGUA 1E1XA 3HV7A 3V5QA 4IB3A 3CLYA 3OXIA 3GNIB 3RNIA 2VX3A 3V3VA 4IAFA 4AOJA 2EWAA 5HQ0A 3L8SA 2C3LA 2I0YA 4DT8A 1LEZA 3LJ1A 5GJFA 4WSQA 1G3NA 2QO9A 2W4JA 2O64A 4Z7HA 3DCVA 1WBSA 3E7VA 3OCBA 4Z3VA 4WG4A 4MAOA 3O0GA 2JKKA 4IAYA 4B8MA 1XH5A 2H8HA 5AEPA 2IZTA 3NW6A 4HNIA 2WMTA 4IZAA 4QYEA 5FXQA 4J97A 3QWJA 4CZUA 4EUUA 4EZ3A 3PJ3A 3UYSA 5DR9A 5ETFA 5KNJA 4FG7A 4M3QA 5CAUA 3NYXA 3D94A 5FXSA 4ERWA 3N4TA 1M52A 2CPKE 3WYXA 2I1MA 4FBXA 5J8IA 4GL9A 3ORKA 4RWLA 4AT3A 5AM7A 3RVGA 4LUDA 2XIZA 4JNWA 4O22A 5EDRA 3UP7A 1NVSA 2QONA 3P4KA 1CKJA 3R02A 4C02A 2QNJA 5HEZA 2UW7A 4KS8A 5IMEA 2EXCX 3EL7A 1OUKA 4DLIA 4TL0A 2WQEA 4MCVA 4BCJA 1OPKA 1H00A 2RSVA 4S33A 2XZSA 3CCNA 4F4PA 3CEKA 4GV1A 2X0GA 4P2KA 4MXAA 3F5UA 4DEAA 2XCKA 4C4GA 3JS2A 1FVVA 5CQWA 1H8FA 3FHIA 5HNBA 3BGZA 3L9NA 3W2SA 3TKUA 3HGKA 5J9ZA 3DLSA 4RIWA 3R7YA 4CNHA 5IQGA 5CI6A 4MD9E 3MJ1A 4ZJJA 5EYKA 4IWOA 2WMXA 5IH4A 2YCFA 2OICA 1H0VA 2XYUA 5JFVA 1JVPP 2UZNA 4GFMA 3ZS5A 4YSJA 2WB8A 4GFGA 2OFUA 2R3PA 5IA3A 3K5UA 3N51A 2EU9A 2ZV2A 4O7WA 4ZSGA 3MVJA 5AAEA 3CBLA 2G2IA 3W2QA 4BY9E 3PY0A 3ZRLA 4ZY5A 3D7TB 3F6XA 1PHKA 3MA3A 5DNRA 4RJ7A 3KRJA 4Q9SA 2W17A 2OXDA 4AUAA 2HWPA 4FA2A 1H24A 1SNXA 4ZJIA 4EH7A 4Y95A 5AUUA 2BKKA 3UG1A 3DAKA 3LOKA 2CSNA 5IISA 4ZK5A 5HG9A 2B9HA 4N6YA 4PDOA 4O6LA 4I6QA 4UV0A 1OKYA 4TYEA 3ANQA 3COHA 1B39A 5CI7A 3RZFA 5F9EA 5J9LA 1H4LA 4LGHA 4BFMA 3SA0A 2GDOA 5KHWA 1Q3WA 5CXHA 3KXGA 3UQGA 2BAKA 2HYYA 4KSQA 2WKMA 3OCGA 4F08A 2J5FA 1M2RA 2UZDA 4QMVA 4ZTLA 4F9CA 5KBRA 5DT3A 5L6PA 4FSWA 3TDWA 4DTBA 4I5MA 3O96A 4DFXE 4FICA 1FMKA 3PA3A 5HVYA 4U5JA 5TKDA 3QL8A 3UP2A 2X39A 1NVQA 4O7SA 2OZOA 3S4QA 3HV6A 3MFTA 4R3RA 3NVKI 4ZTQA 2R3JA 3DXPA 4O7VA 2X9FA 1IA9A 1W7HA 2OJGA 2VTOA 3A4PA 3GU4A 3KRWA 3NUYA 4RX7A 5T3QA 5I0BA 2J7TA 4ZTMA 3H30A 2XNMA 3CJGA 2IVSA 3PE1A 4S34A 5AR2A 5ETCA 5EM6A 5FD2A 5HE3A 4D5HA 2QOQA 4ZY6A 5M56A 3ZLSA 2C0TA 2IW6A 4AP7A 4DN5A 4U6RA 1XBAA 2YZAA 3QKMA 4UB7A 2Z7LA 3S2PA 2XEYA 4OBQA 4NZWB 4UY9A 3FJQE 1LUFA 2YISA 4RVTA 3RPYA 3S95A 3PJ2A 3GCPA 3CKWA 3QQJA 4GSBA 2YLFA 2O8YA 4F7SA 4XG2A 3TKIA 4X2GA 4FKWA 3RALA 4F1TA 3PVUA 5HO7A 1HOWA 3O7LD 4FTJA 3DY7A 3KFAA 5DYJA 3DZQA 3HRFA 2QHMA 2P0CA 1URCA 4YLLA 2BZIB 3A2CA 3GC9A 3KF7A 4J1RA 4O2ZA 5AP2A 3EQIA 4WNMA 4DITA 5GZ8A 1UU3A 3UO6A 3CXWA 4IJ9A 3RHKA 1Q24A 4ZZOA 2GNIA 4G5JA 3VVHA 2ZOQA 4K77A 2DS1A 3OOMA 5IA2A 4BDJA 1XH9A 3QD4A 2GHMA 4HCVA 5CLPA 4CEGA 3ANRA 3CIKA 3O7LB 4JXFA 5E8ZA 2WGJA 3QLFA 2GFCA 4IWQA 3ZC6A 4AZVA 4RC4A 4KRDA 5D41A 2C6OA 5FLFA 4QMNA 2BILB 2CN8A 3TIZA 2PVRA 5AADA 2VNYA 3R1QA 4I4FA 2J51A 1UU9A 5CU6A 5EM5A 2R7BA 2C6KA 5I9UA 3R8PA 1OITA 3ZLYA 3ZO1A 4C38A 4CCBA 1G5SA 5M55A 3QRKA 2C69A 2O65A 5AR3A 4ZXTA 5LCKA 4QQCA 5A14A 5CEKA 5IEVA 2X7OA 2YERA 4WNKA 5J9YA 5DFPA 4FTQA 4NM7A 4KS7A 4QMXA 5AP6A 5IH6A 2A0CX 3E93A 2HW7A 4O27B 2R2PA 3IW6A 4WIHA 4ZTRA 4YZMA 1WVXA 3HMMA 3D9VA 4XRLA 3NNUA 4XV2A 4FT3A 5HTBA 4AZWA 5E9EA 3KRXA 4KKGA 3AMAA 2YAKA 3AC5A 2OF2A 2PMOX 5AUTA 1WBOA 4FK6A 2J0KA 3GGFA 2J5EA 4R7IA 3QFVA 3CQEA 4YC3A 2ZV9A 4UBAA 1W83A 4FV9A 2Z7RA 1UNLA 1YHWA 5IA1A 3GFWA 3BGQA 5CT0A 3NMUF 1JSTA 4D1SA 5JFSA 4PDSA 2XF0A 3ERKA 4GT5A 4C34A 2HY0A 5CVFA 5CASA 1FGIA 4F9BA 3AG9A 4FF8A 4JDJA 1URWA 4YLKA 4EBWA 2PE1A 2XVDA 4KIKA 3A99A 4UYAA 3HA8A 4JG8A 4HPTE 4DFYA 4BZOA 2NNWB 4FSQA 3MH3A 1REJA 3C4WA 3EKNA 4GU9A 4AN9A 5IQDA 4N0SA 4NW6A 2NRUA 4D2VA 1Q97A 3PTGA 3RKBA 4HYSA 4MTAA 5IA0A 4OGRA 3EYGA 3RPRA 5DR2A 3QCSA 4C4HA 4ZTSA 3VUHA 1CM8A 2KTYA 4CFMA 5BYLA 1K9AA 2YIYA 2GS7A 5CAQA 4FTOA 2YJRA 5J5TA 3RINA 3PYYA 5A54A 4HZRA 2OW3A 5G6VA 4AQCA 1W82A 3AGMA 2W96B 3SV0A 5HG5A 1NT2A 3QTXA 2WXVA 4CMOA 2JDTA 4DG2E 4YJQA 2QKRA 4YSMA 1H1QA 4UMTA 2IW8A 4UXLA 4QMOA 4LGDA 1JQHA 3DBFA 4O91A 3DAJA 4S32A 4MWHA 3OXZA 4I92A 5LVNA 4FNWA 1M14A 3V6SA 4W8EA 1BMKA 4D4RA 3SD0A 5CU0A 3QTZA 1WBVA 3GI3A 4ENXA 3DB6A 5H8EA 5LWNA 5BPYA 3EQFA 4BTKA 1M2QA 3KVWA 2B4SB 4AN2A 4HYHA 4TYJA 2GCDA 5JSMA 5D9HA 3TTIA 2GMXA 2YLEA 3TT0A 3W33A 4APCA 3COKA 5HD4A 3EQRA 3ORNA 2Z7QA 2VWWA 1JKTA 2Q0NA 2R3LA 3I5NA 4BF2A 4YBKA 3F5PA 2YEXA 3SW4A 1UVRA 3W55A 5BUEA 3KCKA 2X81A 2O0UA 4X2JA 5H2UA 5CEOA 1KE7A 3QCYA 3OROA 4USEA 2UVYA 4U9AA 4DEDA 4A7CA 4M0YA 1J91A 3MFRA 3FZTA 4GCJA 2OZAA 3E63A 5DPVA 1UNHA 5HD7A 3ZFMA 5D12A 4DG0E 5DLSA 3L8XA 3CE3A 2XUUA 5AP3A 3RBWA 4JL9A 4MK0A 5C03A 1ZOHA 3W2OA 2X1NA 3EN9A 5EYDA 4FC0A 1B38A 1Q62A 4ANSA 1W84A 2B9FA 4NTSA 1Q4LA 3BIZA 4FV1A 3PZEA 4OTWA 1OL2A 4FKLA 1GZOA 4Q2AA 5IA5A 4FVQA 4ANOA 3UJGA 2XKDA 3AT4A 1KE8A 3FY2A 3F3ZA 4TWNA 4WA9A 3WF7A 5HTCA 3LLTA 3B8QA 1Z5MA 2G01A 2C6EA 5T68A 4FZ6A 3PZHA 3TV7A 2WHBA 4GVJA 5AIKA 4BICA 4TPTA 3MWUA 4QMUA 5EM7A 1IA8A 2C6DA 3JYAA 4EOIA 5IEYA 4WO5A 2HW6A 3MH1A 4ACCA 3H10A 4MWIA 2YM5A 1XBBA 5HE1A 3ZHPC 4B4LA 2O63A 2VTTA 3HNGA 3FZSA 5L8JA 3LXLA 4W4VA 2PUPA 2PMIA 4D0WA 3HRCA 2GS2A 3P0MA 2B53A 4FZ7A 4CT2A 3MFUA 3ZSHA 4FGRA 2CKOA 5L2QA 1ZMVA 3P86A 2XS0A 4TY1A 3RPVA 2HZ4A 3CGOA 5HLWA 1Q8TA 2Z60A 4DA5A 4JDKA 2QU5A 4JRVA 4L46A 5H8GA 4C37A 3C1XA 2CNQA 4G6OA 4ZMEA 2ZM1A 5EK7A 4F64A 2WMRA 3GU7A 3PIZA 4FSTA 2BMCA 5DGZA 3P23A 1PXLA 4EONA 1Q5KA 3DKCA 2ZV8A 2JDRA 3FMKA 3PY3A 4I41A 4O0RA 4O6EA 5AR5A 5FEDA 2RG6A 5AUWA 1F3MC 5FWKK 4HGEA 2W4OA 3VS3A 4ARKA 1J7LA 1T46A 4BDDA 1CSNA 3EZVA 3E3BX 4EQUA 3COMA 3FL5A 3PDTA 4NIFB 3UIMA 3NUNA 3HUBA 3U8WA 4WHZA 5E8UA 3TNWA 5HCYA 4C3PA 5I3RA 3MB6A 3NCZA 3E8CA 5ANGA 4EOKA 4MXYA 5KX8A 3U4WA 3OW4A 1PYXA 4OTIA 5M07A 5CU3A 4MQ2A 3SOAA 2R0UA 4MXXA 4OTGA 5L6WL 1H08A 2C6MA 3HMOA 3W1FA 4UWCA 4GUEA 1PXPA 5AAGA 1DS5A 4EC9A 2H96A 4QP6A 1J3HA 2GNJA 2W1CA 3KU2A 4WBBB 4X2FA 1Z9XA 2QLUA 4PQNA 4DH5A 4BCOA 1G8AA 2J0JA 4C62A 1JSVA 4C4IA 5CAVA 1A06A 3FLWA 1OL1A 1ZRZA 3VW8A 3KCFA 5IU2A 1IASA 3FZRA 1E1VA 2F57A 3PJ8A 3ZONA 3Q6WA 3MESA 4HCUA 4J95A 2ESMA 3P08A 2J0LA 3MJ2A 3OWKA 5I4NA 1B6CB 3H9OA 3BU5A 3I79A 3TV4A 4OT6A 3AD5A 4NM3A 3A8XA 3Q52A 5FM3A 3ACJA 2X4FA 4K9YA 4AGDA 2VGOA 4D1ZA 4D55A 4I22A 3HMPA 1TKIA 4CFVA 4YZNA 5JMSA 4I94A 3D83A 2WEVA 4EWHA 1YI4A 3UBDA 4A4OA 3HRBA 3P7BA 3D4QA 2JD5A 3G2FA 4XEYA 4AA0A 4BDFA 3RI1A 4CXAA 3WF5A 3Q32A 3R22A 3HECA 3C51A 4MYGA 4EQMA 2VTHA 3F69A 2WELA 2YITA 5HCXA 5K4IA 4X0MA 3Q9XA 3CD8A 3PA4A 4J99A 3NNVA 3TJCA 3UQFA 4RX8A 1PXJA 2V0DA 4BDKA 4XUFA 4EOMA 4BBEA 2PVMA 2WQNA 3Q9WA 4FKUA 3O17A 2PVFA 4FKGA 1ZWSA 2VTQA 3ID6C 3RCDA 5AWMA 5AUVA 1PMEA 3VW6A 2FB8A 4PPBA 3MS9A 2UW6A 4QTDA 3MTLA 2V62A 3UNKA 2C6TA 1X8BA 2G1TA 3AD6A 3NNXA 3W2RA 5CU4A 3F88A 3EZRA 4IACA 5ANOA 4O84A 2JFLA 2OZAB 3QTUA 5GZ9A 3FI4A 3O50A 5AP7A 1YHVA 4GJ2A 4RJ6A 4DEHA 2BTRA 3C50A 4C7TA 4G3EA 2JKOA 2YJSA 2OIBA 4BI1A 2LGCA 4QP9A 4ID7A 4DYMA 4PTCA 2JFMA 2XNGA 3T9TA 4BDEA 3AD4A 3QTSA 2RFEA 3GXLA 4LL5A 4RMZA 5IA4A 3D5XA 5IDNA 5DR6A 1NXKA 4QP2A 3TACA 3TN8A 5HE0A 4C4FA 3HDMA 1ZZ2A 2XK4A 3ZSGA 3FUPA 5HLPA 2CLXA 5HOAA 4IVDA 1LP4A 4L53A 3NCGA 2IWIA 5FEQA 3V6RA 4E4XA 3ZSIA 4V05A 2C3KA 1U59A 4H1JA 3IDCA 4GKIA 3GB2A 3S00A 3F3UA 1FVTA 3L9MA 3KULB 3RK7A 3QD2B 4AF3A 4YUQA 4JJRA 4RLLA 5F20A 4ZLYA 4R7BA 3PIXA 3SC1A 3R7EA 5BMMA 4X3FC 3ZBXA 4BBMA 2ZV7A 3H0YA 2E9OA 4HYUA 2V55A 2REIA 4FIGA 3U6HA 2ITXA 2X4ZA 4YJUA 4BWPA 4PP9A 2W1FA 4GJ3A 4PL3A 3QZFA 5TO8A 5AMNA 5CEIA 2YFXA 3UVQA 4CSVA 3ALNA 3VF8A 4DFZE 3TCPA 4TYHB 3VUTA 2YM7A 2Q0BA 3IDPA 4YZBA 2OLCA 3REPA 2QC6A 2JAVA 4CG8A 4ZS0A 2FO0A 2JEDA 5H9BA 4DC2A 3SRVB 4KA3A 5CX9A 2OJFE 1BL6A 5A3XA 4HVIA 1R39A 1BL7A 2WTWA 1OZ1A 2VTNA 4M97A 3VJOA 4UMQA 4YTHA 2VTSA 2UZUE 1GIHA 4TNDA 2XKCA 4V0GA 2ONLC 3RM6A 1PXIA 3ZFYA 3E3PA 4BCKA 2GQRA 2WZJA 2AC5A 4MNFA 4O81A 3W2CA 1HCKA 4EEVA 3R7VA 3QZGA 4KRCA 3HVCA 4WRGA 4KAOA 5E92A 5EQEA 1XH6A 3QQFA 1GZ8A 2C68A 3FZPA 5D10A 5A4EA 4XP3A 4L8MA 2AUHA 2CHLA 4FKSA 4ACDA 4II5A 1OBGA 3MFSA 2UW8A 4GG5A 2BAJA 1QPDA 3T8OA 4EZ5A 4G3FA 4XMOA 1V0PA 2BFXA 4HJOA 4YMJA 3KRLA 5HI2A 5KMNA 3NX8A 2IZUA 3MV5A 5IUGA 3FKOA 4TRLA 3SW7A 4C35A 2H6DA 4J8MA 4IXPA 5DWRA 3JY9A 4NWMA 3KXZA 1H0WA 4JAJA 4LL0A 4QTAA 3DQWA 2F4JA 2UUEA 3E64A 3QHWA 2ACXA 3T3UA 1YVJA 5FP6A 4DINA 3UQCA 2BRMA 2YWPA 3TDVA 4PTGA 1WBNA 4FV7A 4IC8A 3QZHA 2A27A 3ZO3A 5CY3A 4N57A 5KMJA 4YJVA 3RPOA 1PRYA 3M42A 2E2BA 3VHKA 2OGVA 2PVHA 5K9IA 4FV4A 2IJMA 3ROYA 4U97A 3HP2A 2CGWA 3ALOA 2HK5A 3PRIA 2XJ2A 3NIEA 4QQ5A 4NCTA 1UKHA 2C5VA 2G2HA 5CF6A 1O6LA 1STCE 2PTKA 3DTCA 3S3IA 1OIQA 3DFCB 2YCSA 3OC1A 2VTAA 4EHEA 5BVWA 1J7UA 4A4XA 3C5IA 3LFDA 4BIEA 5LARA 4QNYA 2P2HA 3HKOA 1BKXA 4RIXA 4ZEGA 3OCTA 1O6KA 4CVAA 2WOTA 3C0IA 3G0EA 4QP3A 1GIIA 4RJ4A 3RWPA 2XJ1A 4P4CA 5E8YA 2IZSA 4O0SA 3L8VA 4IVCA 4RIOA 4BHZA 4RQKA 2I0EA 3HV4A 2WMWA 4NFMA 1OKZA 2VTRA 4CFNA 2C5YA 3GENA 3OP5A 3PIYA 1OPJA 4KNBA 4FGBA 3U9CA 3I4BA 4NEUA 2W4KA 4ITJA 4Y8DA 5E8WA 4BGQA 2G15A 4JOAA 4U3YA 1CKIA 2XCHA 3LW0A 2XB7A 4HGLA 4NK9A 5JQ8A 2BPMA 4OTHA 1GAGA 2X6EA 4U3ZA 5J7BA 1P5EA 4FL1A 1OKVA 2YHVA 3SXSA 4EJNA 3E88A 1U54A 4IDTA 4UX9A 1OECA 5C8MA 4I5PA 3W16A 1H27A 3DB8A 5I9YA 2QG7A 3BLHA 4ZJVA 3TL8A 4H1MA 3ZO2A 2WMVA 1M17A 3EYHA 4LYNA 4EHVA 1U5QA 2Z02A 3ACKA 3LFNA 3DNEA 1QPEA 4GYIA 2BHHA 3UG2A 3QYZA 2XNNA 2R7IA 2JC6A 5CT7A 4DTKA 5IG1A 3JVRA 4K6ZA 2BIKB 4NL0A 4RQVA 4RZWA 1ZY5A 3U55A 3ZBFA 4CCUA 3NUUA 3R01A 4FL2A 1U46A 2IW9A 1WBPA 2B7AA 3SXRA 2JKMA 3TZ7A 3OEFX 4FKTA 4E7WA 4D2TA 3QRJA 4BVUA 4CFUA 2QD9A 3M1SA 2UW9A 4A9UA 5HIBA 3WF6A 4BTJA 2VWBA 3QRUA 5HGIA 2PUUA 5CENA 4EK6A 5CAPA 2W9FB 4EOSA 3NNWA 2OIQA 3R7GA 5IQFA 1Q61A 1YWNA 4M7IA 4PL5A 4H36A 4ZOGA 3D2KA 4GIHA 3FXXA 4O2PA 3W8QA 5ANEA 3HYHA 4JAIA 3DK3A 5FTQA 4GFOA 4FUYA 4FSMA 4GS6A 4OTDA 4EH8A 5J1VA 3ULZA 2YWVA 4TXCA 4C59A 4KBCA 1REKA 3KN6A 4WG5A 2X8DA 1UU8A 1ZOGA 1ZLTA 3VQUA 2R3RA 4AXAA 3NS9A 5HIDA 3FMNA 5JGBA 3QRIA 3MH2A 3RCJA 1MP8A 3DK6A 5C9CA 4C4JA 4O96A 3IQ7A 3LM0A 4GEOA 3WF8A 4A9TA 4FTCA 4JBOA 5JRQA 5KKRC 4L3LA 1ZXEA 4CGAA 3DTWA 2GTNA 1OI9A 1L3RE 5DRBA 5E7RA 3VQHA 3NDMA 4FTLA 4IJPA 4FTAA 4FV0A 4RVKA 5E1EA 5EI2A 3ORTA 3MY1A 4YP8A 2OXYA 4E6CA 4FIIA 2OIDA 3GT8A 3WIKA 3NUXA 1GNGA 4V04A 4QOXA 4JBQA 2JBPA 2VGPA 1OKWA 4W4XA 4YZDA 4YNOA 3Q53A 4MBIA 4UZDA 4MNEA 2J50A 4AGWA 2CMWA 4K0YA 4U45A 3S1HA 2BDWA 3D14A 4JR3A 3LXPA 4R6VA 2CKPA 2CLQA 3FL4A 3R1NA 2PVLA 5EW9A 2YDKA 3R6XA 4E1ZA 3UIBA 5DBXA 3KB7A 4FKPA 1BI8A 3HAVA 5KZ0A 1H1WA 5GNKA 3O8PA 3D7ZA 4Y46A 4BN1A 3NEWA 4IZ5A 3BRBA 2BCJA 5AR7A 4ANQA 2BRBA 2FSMX 2CJMA 1NW1A 1GZNA 4X3FB 1YHSA 3OZ6A 2PUNA 4LV5A 3LVPA 2VTLA 3E8NA 2Y9QA 1PMNA 5B2MA 4JIKA 1RE8A 4GK3A 4BCIA 3E8EA 4KB8A 3R71A 3ZRKA 3VBQA 4W9WA 2QOIA 3NSZA 2C5XA 3OY3A 3UZPA 3UYTA 5M4UA 1H1PA 4DFUA 5L3AA 3A7IA 4Q5EA 4A9SA 4Q9ZA 4DGLC 1PMVA 3F3WA 4EWQA 1AQ1A 4PMMA 4O83A 3WZKA 2PK9A 2XMYA 3HDNA 4AW0A 4AX8A 3HV5A 2VRXA 5EM8A 4BDGA 2XNEA 3TUDA 3RTPA 1OL6A 5B2LA 4D58A 1PJKA 4GH2A 1MQ4A 3TKHA 2PSQA 3I7CA 4IDVA 1MRVA 3D5UA 3WILA 1YDTE 4IZ7A 1YQJA 3NUAA 4LV8A 3DBCA 4ZTNA 3H0ZA 3KMUA 2C1AA 4KD1A 2R3IA 3UNJA 3CQWA 4L7SA 2QOKA 3OEZA 2Q83A 3QCXA 4DAWA 3QA0A 4MD8E 2BDJA 2BR1A 2Z7SA 4FTIA 1U54B 4FIJA 4JQEA 5E8SA 5KZIA 2QURA 3CR0A 1VJYA 3D15A 3F61A 4U42A 4C2WA 5HNIX 3G15A 5IQHA 5CTPA 4C3FA 3KXHA 4G3GA 4UXQA 3PRFA 1FPUA 4M69A 3TZ8A 4D2PA 2PE2A 5JGDA 5KBQA 4JG7A 3QTIA 3ZLWA 3PSBA 2WMBA 2ZMCA 4FL3A 2DYLA 5J95A 4E4LA 2PPQA 4ZZMA 3GBZA 2QHNA 4I0SA 1OMWA 4IW0A 5CXZA 3PPJA 3Q04A 4RG0A 4FKVA 4FUXA 2IVTA 1FBNA 3F3TA 4BWKA 3SKCA 4QMTA 3QC9A 5IMXA 2R9SA 5DT0A 3KXXA 3U87A 4AZTA 3QLGA 4OTQA 3DBDA 1XBCA 4RSSA 3IONA 4EYMA 4D4YA 5K0KA 4D2SA 3I6UA 5KHXA 4CT1A 3PVWA 2VO6A 5FEEA 3O23A 5EHYA 3VS5A 3ZUUA 3HA6A 4FSRA 3KN5A 4JT3A 4YJSA 4F6UA 3IG7A 4Z7GA 3RZBA 3B2TA 4BZDA 1XH7A 2GS6A 5AV0A 4W8DA 3ZRMA 2XNBA 3O2MA 4GVAA 3POOA 3BYSA 5FGKA 3F2NA 2R3KA 4F0GA 2O5KA 3BEAA 4JX3A 2BROA 2QOCA 4PDPA 4PX6A 4AA4A 3CKXA 4F7NA 5C4KA 4XYFA 4BZNA 4QRCA 4YO6A 4RIWB 3C4XA 3QTRA 2BUJA 4NKSA 3NIZA 3OWJA 2HY81 4F9AA 4HVSA 1Q8WA 3KVXA 4Y72A 4FEXA 5B2KA 4M14A 3P5KA 5LMAA 4O7YA 3FYJX 3ZMMA 2WNTA 1R3CA 4EH3A 5F4NA 4FIEA 4ZSJA 2FSLX 3ZUVA 2HZIA 3F2RA 1P14A 2B1PA 2FSOX 2VWXA 3DA6A 3EFWA 2XM8A 5EHLA 4ASEA 4BL1A 4RRVA 3QCQA 4EOQA 2I6LA 4OR5A 3TWJA 5KE0A 5BUIA 3FLYA 1YOJA 2XNPA 3ELJA 4YO4A 1WZYA 4DH3A 5DEWA 4O7TA 1WFCA 3PXYA 2BRGA 4PDYA 4KUJA 4OTPA 4H3QA 5JZJA 5C8KA 4MF1A 2IPXA 4DTAA 5M06A 5AM6A 3LQ8A 4GK2A 4PTEA 2B55A 3WE8A 3BLQA 1M2PA 2JDSA 2ZB0A 4IBMA 5ETIA 1H26A 4AW2A 3QXOA 4ZLOA 4KBAA 2WAJA 3LFEA 1PMUA 3LFAA 4IH8A 5BUJA 5LXMA 1VYWA 4HVGA 5AUXA 5M57A 4XHKB 5AV3A 2EXEA 5BQ0A 4XV9A 1WVYA 4RVLA 5BVEA 2WD1A 3KL8A 4IANA 4BDBA 4HPUE 4GIIA 3VAPA 2ITTA 3M2WA 4Y83A 4C8BA 2VWVA 5HORA 1YXUA 4TYIA 4RA5A 4HYIA 4CFWA 4ZIMA 3A61A 2XK3A 4XG3A 2QOFA 1DI9A 1DI8A 2YM4A 3Q2MA 4FIFA 4USFA 4G5PA 3R9OA 1ZZLA 3PXZA 4F09A 3ZH8A 1UU7A 1APME 2QI8A 1KOBA 2Z2WA 2Y0AA 2C0IA 3IDBA 3LM5A 4YLJA 5FQDC 5IEXA 2HOGA 5LVLA 3PJCA 1JKLA 5CU2A 4BHNA 5A4TA 4AE6A 5HVKA 2ITQA 1H1SA 4M0ZA 2ITUA 4NW5A 3IS5A 3BE2A 5K5NA 1K2PA 2XNOA 4NJ3A 4YZCA 3U54A 3VRZA 4IB0A 5ACBC 4O7LA 3R73A 4G6LA 3QD3A 4FTTA 2J9MA 4JQ8A 4KABA 3WIGA 4CFFA 1UNGA 3R7IA 4F7LA 4BIDA 3MYGA 1IAHA 5AUZA 5KCVA 1LR4A 2BIYA 2QO7A 5CNOA 3R63A 1WVWA 1YDSE 2OK1A 2XEZA 5CSWA 1RJBA 3P1AA 5I3OA 1OBDA 5FDPA 1Q3DA 5GIPE 5JFWA 2QR8A 4QMWA 4BI0A 2ZJWA 3EL8A 2BTSA 3BYMA 2PZIA 4IB1A 4I6HA 4L42A 4NM0A 3SLSA 3UPXA 3VRYA 5IDPA 2PWLA 4FT5A 5B0XA 2Y4IC 2WIHA 3Q6UA 5KKRB 3NYNA 2P33A 4ZAUA 1PXOA 2E9UA 2XK6A 4KINA 5J87A 3F5GA 3A7GA 5HBEA 4BB4A 5CF4A 4ZS4A 1SM2A 1R1WA 2QOOA 3B2WA 3PSCA 4LG4A 3RNYA 4BKJA 4ZMFA 4DEEA 3PFQA 4HOKA 4AZSA 2XBJA 4K1BA 4CKIA 4KWPA 4QPMA 5GJDA 3BQRA 3CPBA 3ZDUA 3K3JA 4YJRA 4GU6A 2C30A 4FT7A 3QTWA 4BWXA 4PNKA 3LFBA 3DJ6A 4DT9A 2XK7A 2YM8A 4F63A 4CV8A 3I6WA 4RPVA 4AFEA 4QMQA 3AMBA 5EW8A 3C4FA 4H39A 5ANKA 5EYMA 3ZLXA 4EORA 4E6QA 4IX6A 2NP8A 3PXFA 4RWIA 3BYOA 2HZ0A 1WAKA 3NYVA 3F66A 3HEGA 3JVSA 4PMTA 3BHTA 3PVBA 2XK9A 1CTPE 4L43A 4D0XA 5IQEA 4DG3E 4OAVB 3UVPA 5I9VA 2VX1A 1Q8ZA 3PG3A 5LOHA 3VS1A 2WMQA 1BI7A 4DCAA 2PVYA 4C36A 3O8UA 1KV2A 2C3JA 3BKBA 3H4JA 3BU6A 4IE9A 4YHTA 2OG8A 2X8EA 4J52A 2VAGA 3GU6A 4QNAA 4EH2A 5IQAA 5AFVA 2CNUA 4DGOA 3DBQA 1FGKA 4DEGA 4M13A 4EUTA 2CKQA 5E8VA 4AOIA 2UZEA 4CFXA 2W06A 5HBHA 2VTJA 4YNEA 4QTEA 1YRPA 5C1QB 4D28A 2R3OA 3E7OA 4NM5A 3OVVA 3RK9A 4YJPA 4CMUA 4RWKA 4FVRA 4Y85A 4UEUA 5HTIA 3V5LA 4RVMA 4AU8A 4QO9A 4X3JA 5JKGA 5IQIA 2GQGA 3CY3A 4KIPA 4KIKB 5LMKA 2F49A 3R8MA 3ZXZA 2FSTX 3NYOA 3GOPA 1PY5A 3OT3A 1UKIA 4XLVA 4WNOA 4DEBA 4FKJA 4DFBA 3DJ5A 2UW4A 3ENHA 2QO2A 3OFMA 5FDXA 3ZCLA 2PVJA 2J90A 4MQ1A 3AQVA 3VBXA 4E26A 3UVRA 3PXRA 3A8WA 2I7QA 2EB2A 3A7HA 3QQUA 4BDHA 5ICPA 4ONAA 5J79A 2WTKC 3HUCA 3ITZA 4K11A 4XOYA 4YTFA 4R3PA 3SQQA 2O3PA 4WUNA 2FH9A 4X2NA 4FK3A 2ERKA 3BI6A 3OS3A 1K3AA 4L9IA 2JDVA 3CJFA 5AP1A 3FPQA 4FZDB 4QD6A 3FMEA 3PVGA 4G31A 3QQKA 4FSZA 4I93A 3BQCA 3PP1A 4QQTA 3UO4A 3BHHA 3UOJA 2RG5A 3FQHA 4RIYA 3CQUA 2E9PA 2IVVA 3NGAA 3GOKA 3RJCA 3NR9A 3WZUA 3UIUA 2GQSA 2C47A 3MPTA 3ZXTA 2I0HA 4B6LA 4O0WA 4H05A 2WFYA 2VUWA 4BDCA 4TWPA 4DLJA 4GT4A 4Y73A 3TNQB 3IK3A 3QYWA 3TIYA 4QMYA 3BCEA 3BX5A 3VUIA 3P9JA 3THBA 3WARA 5JK3A 3NPCA 4NSTA 5G1XA 4NU1A 4K2RA 4WOVA 3GQLA 3AC8A 3QGYA 4I24A 4ZY4A 4NJDA 4DH1A 4IC7A 5BMSA 3UOHA 4HW7A 3TTJA 4E73A 3PA5A 2OKRA 1RQQA 4G6NA 5HO8A 5HICA 4OBPA 4BCHA 3R28A 2QVSE 5M51A 2I40A 4L6QA 3LMHA 3U9NA 4YZ9A 1JKKA 4KIOA 4B9DA 2PE0A 2YIRA 3JPVA 5TOZA 4BCPA 4D1XA 3FWQA 2YAAA 5BX0A 3FY0A 3OG7A 2HAKA 4K18A 3N9XA 1YI3A 2OF4A 3V04A 2WO6A 3LQ5A 3OY1A 5CSPA 1Q8UA 3BWJA 5GJGA 4I5HA 3FMJA 3LCDA 3KK8A 3MY0A 5LVOA 3UGCA 1J1BA 1WCCA 4IFGA 3HAMA 3MVLA 4EBVA 3OXTA 5BYZA 1ZMUA 1YI6A 3FLZA 4PWNA 3F7WA 3DXQA 3FMLA 2QQ7A 3CS9A 2W1EA 3T3VA 4E5BA 5EQPA 3TM0A 2FYSA 1YOLA 4G17A 2W5HA 3G33A 3BE9A 3V51A 3QHRA 3DJ7A 4RWJA 3K3IA 3VUMA 4YJOA 4I1ZA 3ZFXA 3F3VA 4XJ0A 4FT9A 3RP9A 3ROCA 3CGFA 2BKZA 3VS2A 2X7GA 4RFZA 3OHTA 4XV3A 5JZNA 2QR7A 4FVPA 3ZM9A 1P2AA 5AX3A 5LMBA 3FZOA 5I9XA 4F1OA 4H3PA 4GW8A 2PVNA 2YIXA 4FV6A 1OL5A 3GC8A 4RA4A 3UO5A 1JAMA 4HZSA 2PZRA 4TW9A 3FLSA 1OGUA 3V5WA 4PV0A 1YWRA 2GNGA 1PKDA 5EW3A 4IM2A 3F9NA 2OI4X 4NCTC 4RJ3A 4I5CA 3QD0A 4RJ8A 2C5OA 3M11A 3NZ0A 4XG8A 3VF9A 4MXZA 2W5AA 4PUZA 1BYGA 3VUGA 2J6MA 5C8NA 4ZSAA 4FSYA 1JWHA 2Y6MA 3LE6A 2WTDA 4QP1A 3FQEA 2EXMA 5HG8A 2F9GA 4YTCA 2RF9A 3GUBA 3UTOA 4AW1A 4F9YA 3FAAA 1JKSA 5D7AA 5F94A 1R0EA 1FVRA 4QYHA 5CYIA 4FYNA 1VZOA 4BCNA 4O82A 5ACKA 3O8TA 2UZBA 3V8TA 4CQEA 3R9DA 1KE9A 5DOSA 5IUIA 2NRYA 5DRDA 5HZNA 4XCUA 3TUCA 3E8DA 3O71A 2JBOA 3N4UA 2JIVA 3K54A 3VBTA 5E1SA 5M08A 4LOOA 3UOLA 2F2CB 1DM2A 4M66A 4BDIA 4ANMA 3MY5A 3FLQA 3LXNA 4EH6A 4O1OA 1XR1A 4BC6A 2R3FA 2SRCA 2FVDA 1QL6A 3DT1A 3HP5A 4FI1A 3UIXA 2Y4IB 4U8ZA 3LCOA 3R7OA 5HNGA 3C0GA 3MN3A 2PVKA 4QP4A 5FG8A 3RM7A 4E20A 3QQGA 3WYYA 1A9UA 5E8TA 3LPBA 2QOHA 1H28A 2HENA 3UE4A 4EHZA 3KREA 5A46A 4TWCA 2FGIA 2QOLA 3OCSA 3Q4ZA 3QBNA 3EQDA 3RAIA 3W10A 3FZ1A 1PXMA 2W99B 4D2RA 1I09A 3U4UA 3CTQA 3GU8A 3GCUA 2WMUA 4FOCA 2OU7A 5FP5A 1H25A 3BBWA 3FMMA 5D11A 3KRRA 3QU0A 3SHEA 1PW2A 4RIYB 3U51A 2CGVA 3NUPA 4I4EA 4LQMA 2HWOA 3ORXA 4NH1A 4O0VA 3TNPC 1PYEA 2H9VA 3OD6X 5LJJA 2E9VA 4CMTA 4NYEA 3DDPA 4BTMA 3BLRA 3I0OA 5I5ZA 1ZAOA 4MBLA 3D7TA 1TQPA 1ZYCA 5L2WA 3VS4A 4EK5A 2DUVA 4BIBA 4WBOA 4CKRA 2PY3A 4TWOA 4AG8A 3ZOSA 3FHRA 1AD5A 3OWPA 1GJOA 5KO1A 5C4LA 3EQBA 4TN6A 4KSPA 3ATSA 2WTIA 4CZTA 3QX2A 3MTFA 4G3DA 4U0IA 2YDIA 3BGPA 2YABA 4F9WA 2RGPA 3IGOA 3FLNC 4V01A 5DIAA 3DFAA 2VWUA 3Q60A 3GCQA 4FZFB 4GK4A 3AGLA 4R8QA 3E62A 3FKNA 4L01A 4DBXA 4FX3A 4L45A 3L9PA 5E8XA 2E9NA 2B0QA 4P5QA 5D1JA 3S0OA 4XOZA 2NPQA 3EN5A 3BYVA 3LCSA 3E87A 2CN5A 3ZYAA 4EH4A 1R78A 2J0IA 1BLXA 2F7XE 4O0YA 4P5ZA 4RC2A 3IGGA 4X6RA 4B99A 2ZDUA 4X6QC 4DF3A 3KMWA 4HGSA 5TF9A 2NO3A 2OFVA 3VHEA 2CGUA 3ZEWA 3AC3A 5JRSA 2XP2A 3PE2A 4UN0C 1IEPA 3FXZA 1YW2A 4FKIA 3ZUTA 3GCSA 3SX9A 2R64A 3DNDA 4MHAA 3D5VA 4M12A 5EHOA 2HCKA 2BRNA 3EJ1A 4F7JA 2ZAZA 4AGCA 4XLIA 4YJNA 3ZDIA 4JBVA 2HIWA 4HNFA 5CSHA 4EI4A 2WTKB 3T9IA 1KUTA 4R5SA 4CTCA 5KMIA 5AX9A 3SAYA 4A9YA 3FEGA 3JR1A 4G34A 4JIAA 4B0GA 3Q4CA 3ODYX 3R9HA 1YXVA 5KUPA 3GC7A 2B54A 5DHJA 1ND4A 5LCJA 3DV3A 3SGCA 3FSKA 2BRHA 4O7RA 4EH9A 2W1IA 2ZB1A 5FUTA 3VUKA 5DMZA 3E92A 1CKPA 3MVMA 3L9LA 5JEBA 4YC8A 5IUHA 3BU3A 2H34A 2ZVAA 4GKHA 4UZHA 2WQMA 3II5A 5M53A 3VC4A 1OM1A 3A62A 3EH9A 4AE9A 3VS6A 3DAEA 4QTBA 4ZSLA 4U7ZA 4KKHA 4PPCA 3HMNA 1KWPA 2C6IA 2V7AA 3IW5A 4XH6A 5DI1A 1BUHA 1MRUA 1V1KA 3VO3A 4FKQA 1OIYA 2XJ0A 3PSDA 3BYUA 3FI3A 2F2UA 3VBWA 4O0XA 4AZEA 4DEIA 2X6DA 3FQSA 2OH4A 2UZLA 5CANA 3P7AA 2WTCA 4JDIA 5K4JA 4BRXA 4TTHB 4V0GB 4F0FA 4X7QA 5CAOA 4I6BA 5BVKA 4PL4A 2Y8OA 1T45A 2WIPA 2KULA 4DH8A 4BTFA 5E90A 4CLIA 3LZBA 4FMQA 5ANDA 5FBNC 4D4SA 1WBWA 2A1AB 3A4OX 5GIOE 3FSFA 4FR4A 4ALUA 4XRJA 5EQYA 1V0BA 3TUBA 3BHYA 3G5DA 3AMYA 3LCTA 4K33A 4I0TA 3BBTB 2ITYA 4JRNA 5IPJA 1KE5A 5AA9A 3EB0A 2P3GX 2PZYA 4BKZA 4JG6A 4CTBA 4EC8A 1E9HA 2BZHB 1OVEA 3DU8A 3FC1X 4WUAA 3TNIA 5I9WA 5EOLA 4L67A 3Q9YA 3JY0A 2BDFA 4DCEA 5J5SA 1JOWB 3DXNA 4H3BA 1RDQE 4GMYA 4I6FA 4ITHA 4S31A 3R7UA 4FEVA 2Y4PA 4N70A 3R83A 2VO7A 4OAUC 4Z9LA 2GHGA 3BWFA 3KGAA 3VS7A 4RX5A 2ZM4A 2RFSA 3BZ3A 2V22A 4CD0A 4FV8A 4G9CA 2R5TA 3UODA 4JVGA 4IMYA 4J96A 1XHAA 4KIQA 4RX9A 1Q41A 2VWYA 3ORMA 2XKFA 2VU3A 4G16A 1QCFA 2QG5A 5CEMA 2YIWA 3PLSA 3TEIA 3FKLA 4HGTA 2A19B 5EDPA 2RL5A 3QC4A 3DBEA 3G51A 5DA3A 2GNLA 5HHWA 2BAQA 2EVAA 5ANJA 2QODA 5EH0A 4IVAA 4QP7A 4EZ7A 5L2SA 2QOBA 3HZTA 5LQFA 3JUHA 1ZMWA 3GQIA 2RIOA 4ORKA 1ERKA 4PNIA 4YURA 4YGAA 3G9NA 4L44A 3F5XA 4JDHA 4YR8A 1FOTA 5CF5A 2WQOA 4FOBA 3EN4A 3WBLA 4O0UA 3GFEA 3QUDA 4P90A 3N4VA 2R0IA 5HE2A 4IM3A 5L8LA 3NW7A 4W9XA 4C4EA 4F6SA 2UVZA 3HMIA 4J7BA 4LRJA 5L8KA 4IZYA 5GINE 3KQ7A 3NWWA 3VN9A 4A07A 4MEDA 4ANLA 4RIXB 3GP0A 2YN8A 3ODZX 5TE0A 4QP8A 4A4LA 4RZVA 4YC6A 3KEXA 1Z57A 3DKOA 5DN3A 4AT4A 4CQGA 3RGFA 3FXWA 5KMOA 2WOUA 3VJNA 1KV1A 4QYFA 3UC3A 1QPJA 3AT2A 2YACA 3H9RA 4C3RA 4EYJA 2V5QA 4L52A 1BX6A 3OWLA 4AAAA 3DKFA 3EFJA 3KMMA 4FKRA 2ZDTA 3C0HA 4ACHA 3OW3A 4I23A 2VX0A 3V5TA 3LLAA 3B8RA 2ITNA 3TV6A 3AXWA 3FYKX 1LPUA 2ETMA 5IKWA 3SOCA 2HZNA 5IQBA 3G6GA 3NLBA 4C57A 2CCHA 2O2UA 3AC4A 3DOGA 4H58A 5E91A 4C58A 3UZTA 4QMSA 4YTIA 2VTIA 3C4CA 5LVPA 5DE2A 3FDNA 1U4DA 5C27A 4EKLA 3Q4UA 4PF4A 2W1HA 2VTPA 3WE4A 2GNFA 2WEIA 4F0IA 2VTMA 4ANNA 4IQ6A 1SVGA 2WTJA 1PKGA 4Y5HA 1OB3A 5HIEA 4O86A 2YCQA 4XP0A 3V5PA 4AACA 2J4ZA 3GEQA 4Q5HA 2W7XA 3KXMA 5L4QA 3MIAA 1KSWA 2QU6A 2YZLA 4TYGA 3OUKA 4RFYA 3ORPA 3IO7A 1Y8YA 3G0FA 3QRTA 5BYYA 1XH8A 2ZYBA 5TR6A 3TZMA 2LAVA 1H01A 2R3MA 4YPDA 4DGMA 1CMKE 4UMPA 3MPAA 4XG6A 5M4IA 2XM9A 2CNVA 3EN6A 4XS2A 4FODA 4BCMA 4RT7A 4I0RA 5EOBA 2ERZE 3WOWA 5ITAA 4GRBA 3OTUA 2XIYA 4IAAA 4FNYA 4R78A 1TQIA 3G9LX 3EHAA 5CVGA 4LMNA 2CKEA 4QPSA 4AWIA 3U6JA 4GT3A 4X2KA 4NT4A 4ZTHA 4PPAA 2UZTA 5C26A 3LMIA 3BELA 4BCFA 1J7IA 4ACMA 3AC1A 4EHGA 5AV4A 4JLCA 4QT1A 3QUPA 4MD7E 5GHVA 4TNBA 4CYJA 5B7VA 5JGAA 2C6LA 4O7ZA 4OT5A 3QUEA 3PP0A 4L3JA 1KOAA 3MA6A 5CSXA 4ERKA 3R8LA 5BVDA 3DGKA 1Q99A 2WPAA 4LRMA 2YIQA 4FTNA 1SMHA 3LKMA 2CCIA 4Z55A 1FQ1B 3D5WA 5H8BA 4MH7A 3R8ZA 4USDA 1VR2A 3FV8A 5ETAA 3ORIA 2BZJA 5JFXA 2DWBA 2IO6A 3ZM4A 4FSUA 4OTRA 3KK9A 4JR7A 3C7QA 1CDKA 3LQ3A 4MNEB 4E5WA 2F7EE 2YM3A 2ITVA 2W1ZA 2BZKB 4U41A 4LI5A 3I5ZA 3I0QA 5AR4A 3WZDA 3LXKA 4I20A 4J8NA 4NIFA 3AOXA 5FTGA 1NVRA 4MVFA 5CZIA 5AR8A 4EK8A 2B9IA 2YCRA 1S9JA 3UC4A 1MQBA 5K0XA 4BR3A 2WTVA 4FV2A 4I21A 3VBYA 2G9XA 3C9WA 1SVEA 4RBLA 4QMPA 3MI9A 1XO2B 4WSYA 3QQLA 1Y8GA 1J1CA 1Y6BA 3GU5A 5K3YA 1P4OA 1S9IA 2PHKA 2GTMA 4FT0A 1EH4A 4Y5QA 4EKKA 3QZIA 2GFSA 1JPAA 1GIJA 2ITPA 4WT6A 3WI6A 4J53A 3K2LA 2P55A 3R04A 3VBVA 3PXQA 4G9RA 4M84A 3CTHA 5DVRA 4F65A 5HU3A 1TQMA 4FE2A 1OIRA 3COIA 1U5RA 3VNTA 5LWMA 4R1VA 4RFMA 4LOQA 5AJQA 4LUEA 4Z16A 4S30A 5FBOA 2F7ZE 4U40A 2P2IA 4D5KA 3ET7A 5DEYA 4DH7A 4IFCA 4UMRA 5A6NA 3R21A 2XRUA 4RJ5A 2R4BA 4OTFA 4UMUA 2XYNA 4WG3A 3HX4A 2B9JA 3UMXA 4FNXA 3EMGA 4I3ZA 4RC3A 4L68A 4R5YA 4WRSA 2C5NA 4W4WA 4B8LA 2Y7JA 3ORLA 1F5QA 3RPSA 4BYJA 4C2VA 4GG7A 3OBJA 4DGGA 5D7VA 3RWQA 4CRLA 3OMVA 5JT2A 3V8WA 4ASZA 5LMKC 1M7QA 3CD3A 4ASXA 3U6IA 4XG7A 4J71A 4EOOA 3KY2A 4M15A 4YU2A 2ITZA 2JGZA 4LMUA 5F1ZA 1AGWA 4CKJA 2OJIA 4LM5A 4BCGA 1Y6AA 2VO0A 3KKVA 3KC3A 2AYPA 4UALA 4G1WA 1G8SA 4ITIA 2WMSA 2X7FA 1PF8A 3TNHA 3F82A 2W1GA 2GU8A 3LJ0A 4M69B 5L6OA 2VWIA 4C0TA 3VS0A 4LFIA 3OUNB 3ZZEA 2EB3A 3EFKA 3CTJA 3SG9A 3MB7A 1OUYA 2ITWA 5HBJA 4YBJA 4AN3A 1UA2A 3EIDA 3JXWA 4LRKA 3RAKA 2AC3A 2IZRA 2R3GA 4L7FA 4E3CA 3P7CA 2IG7A 3W2PA 4BBFA 3CPCA 1H1RA 5KMLA 1ZOEA 4NKAA 3ZZWA 5CNNA 5EFQA 5CS6A 2X8IA 4GUBA 3KF4A 4RLKA 1TVOA 4AOTA 2JDOA 3DK7A 4HVHA 3C13A 4EOPA 2R3NA 4R3CA 3RHXA 4BKYA 2JIIA 4TT7A 4BCQA 1JLUE 3RK5A 3VIDA 1MRYA 1ZYJA 2VD5A 3QKKA 4MF0A 4OW8A 5HCZA 5HO6A 3ZO4A 1UV5A 5EKNA 3V5JA 3BPRA 2OJJA 3NW5A 3W8LA 2J2IB 2PMLX 2RFDA 1GOLA 3DPKA 5FTOA 2PYWA 5GZAA 3FE3A 2X2LA 2I0VA 1YXXA 4U80A 5AIRA 4AT5A 5IZFA 2GHLA 3V8SA 4CYIA 4FV5A 3R2YA 3CC6A 4JQ7A 3UDBA 2DQ7X 2ETKA 3Q3BA 5J7HA 5AV2A 5HVJA 4IX3A 5CVHA 4HCTA 5KMMA 3UZRA 1XWSA 2UVXA 1JBPE 2YA9A 3BHVA 3FI8A 3KULA 5CSVA 2CGXA 2PUIA 1QPCA 2UW3A 3MDYA 3R30A 3KA0A 3G6HA 4JI9A 4EL9A 1OIUA 4XBRA 3K5VA 4FEQA 3FC2A 4EK3A 3LJ2A 4IHPA 4W4YA 4YJTA 4JBPA 4TZRA 1XJDA 5HKMA 4J98A 2JLDA 3IOPA 1F0QA 5EYCA 5TT7A 4ALVA 3QGWA 3CP9A 4TYHA 3PLAE 3PJ1A 4ZLZA 5L2IA 4IADA 3R1SA 3EQCA 4IAKA 5FXRA 4AW5A 2C3IB 3SRVA 2JAMA 5AP5A 5CZHA 3SVVA 2JKQA 5DG5A 4DE4A 1A48A 2BFYA 4ZZNA 1DAYA 1YDRE 2IN6A 3A7JA 1O6YA 4E4NA 4ANBA 3O51A 3R1YA 4ZSEA 4R77A 1W0XC 1DAWA 2YDJA 3EN7A 3Q4TA 3D2IA 3QWKA 5EI6A 2Y6OA 4IVBA 4FV3A 3MBLA 3SXFA 2UW0A 3NVMB 4DHFA 5A4LA 4PP7A 3QXPA 4OUCA 4FTUA 2HXQA 5I9ZA 4E93A 1RW8A 4RGJA 5M4CA 3R00A 1ZY4A 2JIUA 4IX5A 3R8VA 3ZEPA 2FA2A 5JN2A 3QALE 4IX4A 4C61A 3WZJA 3ATTA 3HV3A 4QMMA 1ZARA 3NAXA 4A9RA 1Y57A 2X9EA 5T6KA 3NUSA 2HELA 3QTQA 4K8AA 4MKCA 3DDQA 4QYYA 4N4SA 3DKGA 3EFLA 4E4MA 1WBTA 2OH0E 1FMOE 3LFSA 4N6ZA 4PY1A 2VWZA 2A2AA 2Z8CA 4QPAA 2JITA 3AT3A 3GVUA 3HL7A 2PL0A 4UYNA 3IW4A 4O0TA 3UNZA 1XH4A 2X2MA 4M8TA 4QTCA 2XRWA 2XA4A 3H3CA 3Q96A 4E8AA 5BVOA 2W5BA 3Q5ZA 4FG9A 4CLJA 1VYZA 1WMKA 1GY3A 1SNUA 4NFNA 1O9UA 5JQ5A 3F7ZA 3PY1A 5HESA 5CEQA 3ULIA 2P4IA 4U81A 3A60A 3NRMA 3ZC5A 4EJ7A 5EG3A 3ORZA 1I44A 4CRSA 3RAHA 1ZYLA 2UW5A 4O7NA 4IB5A 2PZPA 4ENYA 1IG1A 3BV2A 3POZA 5CQUA 4YPSA 3PWDA 4KBKA 2PULA 4BDAA 5BVFA 5JH6A 1YWVA 1PXKA 1H07A 2A4LA 2GSFA 2OXXA 2J0MB 3L8PA 3Q2JA 4EOLA 2C4GA 3QA8A 1IR3A 4L3PA 5BNJA 2BVAA 4DFNA 3D0EA 4QQJA 2VNWA 5HX6A 1QMZA 4MXOA 2C0OA 3I60A 2XK8A 3QKLA 1OL7A 2OO8X 3LCKA 2W0JA 3W18A 5E4HA 4XBUA 1IAJA 3GC0A 4ALWA 4IM0A 3UPZA 4IAIA 3EQHA 2UV2A 5CALA 4FYOA 3E5AA
chains in the Genus database with same CATH superfamily
2XIXA 1M7NA 3PWYA 4EH5A 5A4QA 4D9UA 2HXLA 4IAZA 5H3QA 3C5UA 4PMSA 3UOKA 4O4BB 3A7FA 4U79A 3R0TA 1LEWA 3Q9ZA 4FIHA 3SDJA 1HCLA 4EQCA 4F6WA 3PXKA 3UMWA 3BEGA 1MUOA 1Y91A 4QMZA 4XG4A 3OBGA 5FRIA 2WU6A 3LFFA 3Q5IA 4BI2A 5IH5A 4YHFA 1Q8YA 4NTTA 2ETRA 3EOCA 4G2FA 3ETAA 5IF1A 2ZMDA 5ANIA 4TKSA 5K5XA 4C33A 3MIYA 1SVHA 3BV3A 2W1DA 5A4CA 4UWYA 5LVMA 4MX9A 1OPLA 1UWHA 4QYGA 3PPZA 3VWAA 1XQZA 3BHUA 3EKKA 3FBVA 1SYKA 4KKEA 3P78A 4NUSA 4CZYB 4F70A 3P79A 3CSVA 2XIKA 4CG9A 4DBNA 2C1BA 5EKOA 4PRJA 3QAME 3TZ9A 2A98A 2GNHA 4BGHA 3AC2A 4OLIA 3TJDA 1L8TA 2XIRA 5M4FA 1W8CA 2XBAA 3FMDA 4AXCA 2CDZA 3EQGA 3H9FA 1W98A 4APPA 3GCVA 3FI2A 5AUYA 3VUDA 2VZ6A 2WMAA 3MVHA 2XKEA 4E5AX 1JSUA 2V7OA 4WKQA 3KXNA 5BVNA 4D4VA 3OTVA 4GYGA 4JX7A 4CV9A 2QLQA 3LIJA 2EUFB 5EI8A 4EOJA 2XH5A 4D2WA 5CF8A 2W05A 2FUMA 4B7TA 4R1YA 4FEUA 4IIRA 3IOKA 5A6OA 4FSNA 2ITOA 2UZWE 4AA5A 4UWBA 3OT8A 3IW7A 4IWPA 5HG7A 4JMQA 3PG1A 3TXOA 4U44A 3DQXA 2PU8A 4O38A 4EK4A 3AKLA 3QQHA 4U43A 3WF9A 4E6AA 1UWJA 3DS6A 4BGGA 4M67A 2OJ9A 3OF0A 5M09A 1ATPE 3LMGA 3MGYA 3MH0A 4G3CA 4FEWA 3QF9A 3W32A 3FPMA 5IQCA 3IPHA 4LOPA 3TG1A 3DZOA 5FM2A 5HX8A 3MPMA 4ACGA 5HLNA 5AV1A 2PZ5A 5EDQA 3MSSA 2X2KA 5DT4A 3I81A 3ZU7A 1KE6A 4F1MA 3TM0A 2UZVA 3LAUA 3SG8A 4XG9A 2R3HA 2WQBA 3HLLA 3TI1A 4DFLA 2IEWA 2OBJA 1R0PA 2RKUA 3EWHA 3C4EA 3NAYA 3DLZA 2IVUA 4R7HA 2UZOA 4XX9A 3R9RA 4A06A 1V0OA 2B52A 3R2BA 4P7EA 1ST0A 1VEBA 2ZM3A 2BHEA 3QX4A 2BALA 4MXCA 4FNZA 5DH3A 1SZMA 1YXSA 5CWZA 4BYIA 5AP4A 5HU9A 4WNPA 4XP2A 1NY3A 5AAFA 4FTMA 3R8UA 2X0QA 3IECA 3ZTXA 4FTKA 4QMLA 4AFJA 1XKKA 4F99A 1P4FA 3F2AA 3MW1A 2RFNA 2YM6A 1GZKA 3LHJA 3LFCA 4AS0A 1ZYSA 5J1WA 1YKRA 5KMKA 3WZEA 5AP0A 4FTRA 4LGGA 5C01A 4AZFA 4O21A 3VULA 3PUPA 4M68A 1YOMA 1IRKA 5AA8A 2PMNX 2W9ZB 4FKOA 4WD5A 4X3FA 5F95A 5CEPA 4YHJA 4D9TA 3L1SA 1ZYDA 3UDSA 2WU7A 3I7BA 3LFQA 2VV9A 1NA7A 4FG8A 4IWDA 3RMFA 4PMPA 2VO3A 3CY2A 3PPKA 4XNEA 1YXTA 3FMHA 2G2FA 2QCSA 3V01A 2OWBA 4L00A 4DGNA 2R3QA 4OBOA 1PXNA 4E6DA 4IEBA 5L2TA 4MBJA 3C4ZA 2OSCA 3I1AA 3EQPA 2QKWB 4X21A 5A9UA 4S2ZA 4XV1A 2GPHA 3ENMA 4O1PA 3R9NA 5M44A 4JS8A 1FINA 2VN9A 4ZP5A 2ONLA 4ASDA 3RAWA 4HVDA 3IW8A 3OOGA 3G90X 3IKAA 1JNKA 4FZAB 4AGUA 1E1XA 3HV7A 3V5QA 4IB3A 3CLYA 3OXIA 3GNIB 3RNIA 2VX3A 3V3VA 4IAFA 4AOJA 2EWAA 5HQ0A 4QDVA 3L8SA 2C3LA 2I0YA 4DT8A 1LEZA 3LJ1A 5GJFA 4WSQA 1G3NA 2QO9A 2W4JA 2O64A 4Z7HA 3DCVA 1WBSA 3E7VA 3OCBA 4Z3VA 4WG4A 4MAOA 3O0GA 2JKKA 4IAYA 4B8MA 1XH5A 2H8HA 5AEPA 2IZTA 3NW6A 4HNIA 2WMTA 4IZAA 4QYEA 5FXQA 4J97A 3QWJA 4CZUA 4EUUA 4EZ3A 3PJ3A 3UYSA 5DR9A 5ETFA 5KNJA 4FG7A 4M3QA 5CAUA 3NYXA 3D94A 5FXSA 4ERWA 3N4TA 1M52A 2CPKE 3WYXA 2I1MA 4FBXA 5J8IA 4GL9A 3ORKA 4RWLA 4AT3A 5AM7A 3RVGA 4LUDA 2XIZA 4JNWA 4O22A 5EDRA 3UP7A 1NVSA 2QONA 3P4KA 1CKJA 3R02A 4C02A 2QNJA 5HEZA 2UW7A 4KS8A 5IMEA 2EXCX 3EL7A 1OUKA 4DLIA 4TL0A 2WQEA 4MCVA 4BCJA 1OPKA 1H00A 2RSVA 4S33A 2XZSA 3CCNA 4F4PA 3CEKA 4GV1A 2X0GA 4P2KA 4MXAA 3F5UA 4DEAA 2XCKA 4C4GA 3JS2A 1FVVA 5CQWA 1H8FA 3FHIA 5HNBA 3BGZA 3L9NA 3W2SA 3TKUA 3HGKA 5J9ZA 3DLSA 4RIWA 3R7YA 4CNHA 5IQGA 5CI6A 4MD9E 3MJ1A 4ZJJA 5EYKA 4IWOA 2WMXA 5IH4A 2YCFA 2OICA 1H0VA 2XYUA 5JFVA 1JVPP 2UZNA 4GFMA 4O4FA 3ZS5A 4YSJA 2WB8A 4GFGA 2OFUA 2R3PA 5IA3A 3K5UA 3N51A 2EU9A 2ZV2A 4O7WA 4ZSGA 3MVJA 5AAEA 3CBLA 2G2IA 3W2QA 4BY9E 3PY0A 3ZRLA 4ZY5A 3D7TB 3F6XA 1PHKA 3MA3A 5DNRA 4RJ7A 3KRJA 4Q9SA 2W17A 2OXDA 4AUAA 2HWPA 4FA2A 1H24A 1SNXA 4ZJIA 4EH7A 4Y95A 5AUUA 2BKKA 3UG1A 3DAKA 3LOKA 2CSNA 5IISA 4ZK5A 5HG9A 2B9HA 4N6YA 4PDOA 4O6LA 4I6QA 4UV0A 1OKYA 4TYEA 3ANQA 3COHA 1B39A 5CI7A 3RZFA 5F9EA 5J9LA 1H4LA 4LGHA 4BFMA 3SA0A 2GDOA 5KHWA 1Q3WA 5CXHA 3KXGA 3UQGA 2BAKA 2HYYA 4KSQA 2WKMA 3OCGA 4F08A 2J5FA 1M2RA 2UZDA 4QMVA 4ZTLA 4F9CA 5KBRA 5DT3A 5L6PA 4FSWA 3TDWA 4DTBA 4I5MA 3O96A 4DFXE 4FICA 1FMKA 3PA3A 5HVYA 4U5JA 5TKDA 3QL8A 3UP2A 2X39A 1NVQA 4O7SA 2OZOA 3S4QA 1VLRA 3HV6A 3MFTA 4R3RA 3NVKI 4ZTQA 2R3JA 3DXPA 4O7VA 2X9FA 1IA9A 1W7HA 2OJGA 2VTOA 3A4PA 3GU4A 3KRWA 3NUYA 4RX7A 5T3QA 5I0BA 2J7TA 4ZTMA 3H30A 2XNMA 3CJGA 2IVSA 3PE1A 4S34A 5AR2A 5ETCA 5EM6A 5FD2A 5HE3A 4D5HA 2QOQA 4ZY6A 5M56A 3ZLSA 2C0TA 2IW6A 4AP7A 4DN5A 4U6RA 1XBAA 2YZAA 3QKMA 4UB7A 2Z7LA 3S2PA 2XEYA 4OBQA 4NZWB 4UY9A 3FJQE 1LUFA 2YISA 4RVTA 3RPYA 4O4CA 3PJ2A 3GCPA 3S95A 3CKWA 3QQJA 4GSBA 2YLFA 2O8YA 4F7SA 4XG2A 3TKIA 4X2GA 4FKWA 3RALA 4F1TA 3PVUA 5HO7A 1HOWA 3O7LD 4FTJA 3DY7A 3KFAA 5DYJA 3DZQA 3HRFA 2QHMA 2P0CA 1URCA 4YLLA 2BZIB 3A2CA 3GC9A 3KF7A 4J1RA 4O2ZA 5AP2A 3EQIA 4WNMA 4DITA 5GZ8A 1UU3A 3UO6A 3CXWA 4IJ9A 3RHKA 1Q24A 4ZZOA 2GNIA 4G5JA 3VVHA 2ZOQA 4K77A 2DS1A 3OOMA 5IA2A 4BDJA 1XH9A 3QD4A 2GHMA 4HCVA 5CLPA 4CEGA 3ANRA 3CIKA 3O7LB 4JXFA 5E8ZA 2WGJA 3QLFA 2GFCA 4IWQA 3ZC6A 4AZVA 4RC4A 4KRDA 5D41A 2C6OA 5FLFA 4QMNA 2BILB 2CN8A 3TIZA 2PVRA 5AADA 2VNYA 3R1QA 4I4FA 2J51A 1UU9A 5CU6A 5EM5A 2R7BA 2C6KA 5I9UA 3R8PA 1OITA 3ZLYA 3ZO1A 4C38A 4CCBA 1G5SA 5M55A 3QRKA 2C69A 2O65A 5AR3A 4ZXTA 5LCKA 4QQCA 5A14A 5CEKA 5IEVA 2X7OA 2YERA 4WNKA 5J9YA 5DFPA 4FTQA 4DHJA 4NM7A 4KS7A 4QMXA 5AP6A 5IH6A 2A0CX 3E93A 2HW7A 4O27B 2R2PA 3IW6A 4WIHA 4ZTRA 4YZMA 1WVXA 3HMMA 3D9VA 4XRLA 3NNUA 4XV2A 4FT3A 5HTBA 2X0PA 4AZWA 5E9EA 3KRXA 4KKGA 3AMAA 2YAKA 3AC5A 2OF2A 2PMOX 5AUTA 1WBOA 4FK6A 2J0KA 3GGFA 2J5EA 4R7IA 3QFVA 3CQEA 4YC3A 2ZV9A 4UBAA 1W83A 4FV9A 2Z7RA 1UNLA 1YHWA 5IA1A 3GFWA 3BGQA 5CT0A 3NMUF 1JSTA 4D1SA 5JFSA 4PDSA 2XF0A 3ERKA 4GT5A 4C34A 2HY0A 5CVFA 5CASA 1FGIA 4F9BA 3AG9A 4FF8A 4JDJA 1URWA 4YLKA 4EBWA 2PE1A 2XVDA 4KIKA 3A99A 4UYAA 3HA8A 4JG8A 4HPTE 4DFYA 4BZOA 2NNWB 4FSQA 3MH3A 1REJA 3C4WA 3EKNA 4GU9A 4AN9A 5IQDA 4N0SA 4NW6A 2NRUA 4D2VA 1Q97A 3PTGA 3RKBA 4HYSA 4MTAA 5IA0A 4OGRA 3EYGA 3RPRA 5DR2A 3QCSA 4C4HA 4ZTSA 3VUHA 1CM8A 2KTYA 4CFMA 5BYLA 1K9AA 2YIYA 2GS7A 5CAQA 4FTOA 2YJRA 5J5TA 3RINA 3PYYA 5A54A 4HZRA 2OW3A 5G6VA 4AQCA 1W82A 3AGMA 2W96B 3SV0A 5HG5A 1NT2A 3BL9A 3QTXA 2WXVA 4CMOA 2JDTA 4DG2E 4YJQA 2QKRA 4YSMA 1H1QA 4UMTA 2IW8A 4UXLA 4QMOA 4LGDA 1JQHA 3DBFA 4O91A 3DAJA 4S32A 4MWHA 3OXZA 4I92A 5LVNA 4FNWA 1M14A 3V6SA 4W8EA 1BMKA 4D4RA 3SD0A 5CU0A 3QTZA 1WBVA 3GI3A 4ENXA 3DB6A 5H8EA 5LWNA 2X0OA 5BPYA 3EQFA 4BTKA 1M2QA 3KVWA 2B4SB 4AN2A 4HYHA 4TYJA 2GCDA 5JSMA 5D9HA 3TTIA 2GMXA 2YLEA 3TT0A 3W33A 4APCA 3COKA 5HD4A 3EQRA 3ORNA 3P5JC 2Z7QA 2VWWA 1JKTA 2Q0NA 2R3LA 3I5NA 4BF2A 4YBKA 3F5PA 2YEXA 3SW4A 1UVRA 3W55A 5BUEA 3KCKA 2X81A 2O0UA 4X2JA 5H2UA 5CEOA 1KE7A 3QCYA 3OROA 4USEA 2UVYA 4U9AA 4DEDA 4A7CA 4M0YA 1J91A 3MFRA 3FZTA 4GCJA 2OZAA 3E63A 5DPVA 1UNHA 5HD7A 3ZFMA 5D12A 4DG0E 5DLSA 3L8XA 3CE3A 2XUUA 5AP3A 3RBWA 4JL9A 4MK0A 5C03A 1ZOHA 3W2OA 2X1NA 3EN9A 5EYDA 4FC0A 1B38A 1Q62A 4ANSA 1W84A 2B9FA 4NTSA 1Q4LA 3BIZA 4FV1A 3PZEA 4OTWA 1OL2A 4FKLA 1GZOA 4Q2AA 5IA5A 4FVQA 4ANOA 3UJGA 2XKDA 3AT4A 1KE8A 3FY2A 3F3ZA 4TWNA 4WA9A 3WF7A 5HTCA 3LLTA 3B8QA 1Z5MA 2G01A 2C6EA 5T68A 4FZ6A 3PZHA 3TV7A 2WHBA 4GVJA 5AIKA 4BICA 4TPTA 3MWUA 4QMUA 5EM7A 1IA8A 2C6DA 3JYAA 4EOIA 5IEYA 4WO5A 2HW6A 3MH1A 4ACCA 3H10A 4MWIA 2YM5A 1XBBA 5HE1A 3ZHPC 4B4LA 2O63A 4AXFA 2VTTA 3HNGA 3FZSA 5L8JA 3LXLA 4W4VA 2PUPA 2PMIA 4D0WA 3HRCA 2GS2A 3P0MA 2B53A 4FZ7A 4CT2A 3MFUA 3ZSHA 4FGRA 2CKOA 5L2QA 1ZMVA 3P86A 2XS0A 4TY1A 3RPVA 2HZ4A 3CGOA 5HLWA 1Q8TA 2Z60A 4DA5A 4JDKA 2QU5A 4JRVA 4L46A 5H8GA 4C37A 3C1XA 2CNQA 4G6OA 4ZMEA 2ZM1A 5EK7A 4F64A 2WMRA 3GU7A 3PIZA 4FSTA 2BMCA 5DGZA 3P23A 1PXLA 4EONA 1Q5KA 3DKCA 2ZV8A 2JDRA 3FMKA 3PY3A 4I41A 4O0RA 4O6EA 5AR5A 5FEDA 2RG6A 5AUWA 1F3MC 5FWKK 4HGEA 2W4OA 3VS3A 4ARKA 1J7LA 1T46A 4BDDA 1CSNA 3EZVA 3E3BX 4EQUA 3COMA 3FL5A 3PDTA 4NIFB 3UIMA 3NUNA 3HUBA 4BJJB 3U8WA 4WHZA 5E8UA 3TNWA 5HCYA 4C3PA 5I3RA 3MB6A 3NCZA 3E8CA 5ANGA 4EOKA 4MXYA 5KX8A 3U4WA 3OW4A 1PYXA 4OTIA 5M07A 5CU3A 4MQ2A 3SOAA 2R0UA 4MXXA 4OTGA 5L6WL 1H08A 2C6MA 3HMOA 3W1FA 4UWCA 3AKJA 4GUEA 1PXPA 5AAGA 1DS5A 4EC9A 2H96A 4QP6A 1J3HA 2GNJA 2W1CA 3KU2A 4WBBB 4X2FA 1Z9XA 2QLUA 4PQNA 4DH5A 4BCOA 1G8AA 2J0JA 4C62A 1JSVA 4C4IA 5CAVA 1A06A 3FLWA 1OL1A 1ZRZA 3VW8A 3KCFA 5IU2A 1IASA 3FZRA 1E1VA 2F57A 3PJ8A 3ZONA 3Q6WA 3MESA 4HCUA 4J95A 2ESMA 3P08A 2J0LA 3MJ2A 3OWKA 5I4NA 1B6CB 3H9OA 3BU5A 3I79A 3TV4A 4OT6A 3AD5A 4NM3A 3A8XA 3Q52A 5FM3A 3ACJA 2X4FA 4K9YA 4AGDA 2VGOA 4D1ZA 4D55A 4I22A 3HMPA 1TKIA 4CFVA 4YZNA 5JMSA 4I94A 3D83A 2WEVA 4EWHA 1YI4A 3UBDA 4A4OA 2ZFYA 3HRBA 3P7BA 3D4QA 2JD5A 3G2FA 4XEYA 4AA0A 4BDFA 3RI1A 4CXAA 3WF5A 3Q32A 3R22A 3HECA 3C51A 4MYGA 4EQMA 2VTHA 3F69A 2WELA 2YITA 5HCXA 5K4IA 4X0MA 3Q9XA 3CD8A 3PA4A 4J99A 3NNVA 3TJCA 3UQFA 4RX8A 1PXJA 2V0DA 4BDKA 4XUFA 4EOMA 4BBEA 2PVMA 2WQNA 3Q9WA 4FKUA 3O17A 2PVFA 4FKGA 1ZWSA 2VTQA 3ID6C 3RCDA 5AWMA 5AUVA 1PMEA 3VW6A 2FB8A 4PPBA 3MS9A 2UW6A 4QTDA 3MTLA 2V62A 3UNKA 2C6TA 1X8BA 2G1TA 3AD6A 3NNXA 3W2RA 5CU4A 2NYAA 3F88A 3EZRA 4IACA 5ANOA 4O84A 2JFLA 2OZAB 3QTUA 5GZ9A 3FI4A 3O50A 5AP7A 1YHVA 4GJ2A 4RJ6A 4DEHA 2BTRA 3C50A 4C7TA 3KIOC 4G3EA 2JKOA 2YJSA 2OIBA 4BI1A 2LGCA 4QP9A 4ID7A 4DYMA 4PTCA 2JFMA 2XNGA 3T9TA 4BDEA 3AD4A 3QTSA 2RFEA 3GXLA 4LL5A 4RMZA 5IA4A 3D5XA 5IDNA 5DR6A 1NXKA 4QP2A 3TACA 3TN8A 5HE0A 4C4FA 3HDMA 1ZZ2A 2XK4A 3ZSGA 3FUPA 5HLPA 2CLXA 5HOAA 4QEBA 4IVDA 1LP4A 4L53A 3NCGA 2IWIA 5FEQA 3V6RA 4E4XA 3ZSIA 4V05A 2C3KA 1U59A 4H1JA 3IDCA 4GKIA 3GB2A 3S00A 3F3UA 1FVTA 3L9MA 3KULB 3RK7A 3QD2B 4AF3A 4YUQA 4JJRA 4RLLA 5F20A 4ZLYA 4R7BA 3PIXA 3SC1A 3R7EA 5BMMA 4X3FC 3ZBXA 4BBMA 2ZV7A 3H0YA 4AAYA 2E9OA 4HYUA 2V55A 2REIA 4FIGA 3U6HA 2ITXA 2X4ZA 4YJUA 4BWPA 4PP9A 2W1FA 4GJ3A 4PL3A 3QZFA 2AQXA 5AMNA 5CEIA 2YFXA 5TO8A 3UVQA 3ALNA 3VF8A 4CSVA 3TCPA 4DFZE 4TYHB 3VUTA 2YM7A 2Q0BA 3IDPA 4YZBA 2OLCA 3REPA 2QC6A 2JAVA 4CG8A 4ZS0A 2FO0A 2JEDA 5H9BA 4DC2A 3SRVB 4KA3A 4AXEA 5CX9A 2OJFE 1BL6A 5A3XA 4HVIA 1R39A 1BL7A 2WTWA 1OZ1A 2VTNA 4M97A 3VJOA 4UMQA 4YTHA 2VTSA 2UZUE 1GIHA 4TNDA 2XKCA 4V0GA 2ONLC 3RM6A 1PXIA 3ZFYA 3E3PA 4BCKA 2GQRA 2WZJA 2AC5A 4MNFA 4O81A 3W2CA 1HCKA 4EEVA 3R7VA 3QZGA 4KRCA 3HVCA 4WRGA 4KAOA 5E92A 5EQEA 1XH6A 3QQFA 1GZ8A 2C68A 3FZPA 5D10A 5A4EA 2XANA 4XP3A 4L8MA 2AUHA 2CHLA 4FKSA 4ACDA 4II5A 1OBGA 3MFSA 2UW8A 4GG5A 2BAJA 1QPDA 3T8OA 4EZ5A 4G3FA 4XMOA 1V0PA 2BFXA 4HJOA 4YMJA 3KRLA 5HI2A 5KMNA 3NX8A 2IZUA 3MV5A 5IUGA 3FKOA 4TRLA 3SW7A 4C35A 2H6DA 4J8MA 4IXPA 5DWRA 3JY9A 4NWMA 3KXZA 1H0WA 4JAJA 4LL0A 4QTAA 3DQWA 2F4JA 2UUEA 3E64A 3QHWA 2ACXA 3T3UA 4MUQA 1YVJA 5FP6A 4DINA 3UQCA 2BRMA 3PUFC 2YWPA 3TDVA 4PTGA 1WBNA 4FV7A 4IC8A 3QZHA 2A27A 3ZO3A 5CY3A 4N57A 5KMJA 4YJVA 3RPOA 1G8JA 1PRYA 3M42A 2E2BA 3VHKA 2OGVA 2PVHA 5K9IA 4FV4A 2IJMA 3BL7A 3ROYA 4U97A 3HP2A 2CGWA 3ALOA 2HK5A 3PRIA 2XJ2A 3NIEA 4QQ5A 4NCTA 1UKHA 2C5VA 2G2HA 5CF6A 1O6LA 1STCE 2PTKA 3DTCA 3S3IA 1OIQA 3DFCB 2YCSA 3OC1A 2VTAA 4EHEA 5BVWA 1J7UA 4A4XA 3C5IA 3LFDA 4BIEA 5LARA 4QNYA 2P2HA 3HKOA 1BKXA 4RIXA 4ZEGA 3OCTA 1O6KA 4CVAA 2WOTA 3C0IA 3G0EA 4QP3A 1GIIA 4RJ4A 3RWPA 2XJ1A 4P4CA 5E8YA 2IZSA 4O0SA 3L8VA 4IVCA 4RIOA 4BHZA 4RQKA 2I0EA 3HV4A 2WMWA 4NFMA 1OKZA 2VTRA 4CFNA 2C5YA 3GENA 3OP5A 3PIYA 1OPJA 4KNBA 4FGBA 3U9CA 3I4BA 4NEUA 2W4KA 4ITJA 4Y8DA 5E8WA 4BGQA 4DHIB 2G15A 4JOAA 4U3YA 1CKIA 2XCHA 3LW0A 2XB7A 4HGLA 4NK9A 5JQ8A 2BPMA 4OTHA 4AQKA 1GAGA 2X6EA 4U3ZA 5J7BA 1P5EA 4FL1A 1OKVA 2YHVA 3SXSA 4EJNA 3E88A 1U54A 4IDTA 4UX9A 1OECA 5C8MA 4I5PA 3W16A 3O5AA 1H27A 3DB8A 5I9YA 2QG7A 3BLHA 4ZJVA 3TL8A 4H1MA 3ZO2A 2WMVA 1M17A 3EYHA 4LYNA 4EHVA 1U5QA 2Z02A 3ACKA 3LFNA 3DNEA 1QPEA 4GYIA 2BHHA 3UG2A 3QYZA 2XNNA 2R7IA 2JC6A 5CT7A 4DTKA 5IG1A 5BV3A 3JVRA 4K6ZA 2BIKB 4NL0A 4QDEA 4RQVA 4RZWA 1ZY5A 3U55A 3ZBFA 4CCUA 3NUUA 3R01A 4FL2A 1U46A 2IW9A 1WBPA 2B7AA 3SXRA 2JKMA 3TZ7A 3OEFX 4FKTA 4E7WA 4D2TA 3QRJA 4BVUA 4CFUA 2QD9A 3M1SA 2UW9A 4A9UA 5HIBA 3WF6A 4BTJA 2VWBA 3QRUA 5HGIA 2PUUA 5CENA 4EK6A 5CAPA 2W9FB 4EOSA 3NNWA 2OIQA 3R7GA 5IQFA 1Q61A 1YWNA 4M7IA 4PL5A 4H36A 4ZOGA 3D2KA 4GIHA 3FXXA 4O2PA 3W8QA 5ANEA 3HYHA 4JAIA 3DK3A 5FTQA 4F78A 4GFOA 4FUYA 4FSMA 4GS6A 4OTDA 4EH8A 5J1VA 3ULZA 2YWVA 4TXCA 4C59A 4KBCA 1REKA 3KN6A 4WG5A 2X8DA 1UU8A 1ZOGA 1ZLTA 3VQUA 2R3RA 4AXAA 3NS9A 5HIDA 3FMNA 5JGBA 3QRIA 3MH2A 3RCJA 1MP8A 3DK6A 5C9CA 4C4JA 4O96A 3IQ7A 3LM0A 4GEOA 3WF8A 4A9TA 4FTCA 4JBOA 5JRQA 5KKRC 4L3LA 1ZXEA 4CGAA 3DTWA 2GTNA 1OI9A 1L3RE 5DRBA 5E7RA 3VQHA 3NDMA 4FTLA 4IJPA 4FTAA 4FV0A 4RVKA 5E1EA 5EI2A 3ORTA 3MY1A 4YP8A 2OXYA 4E6CA 4FIIA 2OIDA 3GT8A 3WIKA 3NUXA 1GNGA 4V04A 4QOXA 4JBQA 2JBPA 2VGPA 1OKWA 4W4XA 4YZDA 4YNOA 3Q53A 4MBIA 4UZDA 4MNEA 2J50A 4AGWA 2CMWA 4K0YA 4U45A 3S1HA 2BDWA 3D14A 4JR3A 3LXPA 4R6VA 2CKPA 2CLQA 3FL4A 3R1NA 2PVLA 5EW9A 2YDKA 3R6XA 4E1ZA 3UIBA 2XAMA 5DBXA 3KB7A 3TYKA 4FKPA 1BI8A 3HAVA 5KZ0A 1H1WA 5GNKA 3O8PA 3BLAA 3D7ZA 4Y46A 1G8KA 4BN1A 3NEWA 4IZ5A 3BRBA 2BCJA 5AR7A 4ANQA 2BRBA 2FSMX 2CJMA 1NW1A 1GZNA 4X3FB 1YHSA 3OZ6A 2PUNA 4LV5A 3LVPA 2VTLA 3E8NA 2Y9QA 1PMNA 5B2MA 4JIKA 1RE8A 4GK3A 4BCIA 3E8EA 4KB8A 3R71A 3ZRKA 3VBQA 4W9WA 2QOIA 3NSZA 2C5XA 3OY3A 3UZPA 3UYTA 5M4UA 1H1PA 4DFUA 5L3AA 3A7IA 4Q5EA 4A9SA 4Q9ZA 4DGLC 1PMVA 3F3WA 4EWQA 1AQ1A 4PMMA 4O83A 3WZKA 2PK9A 2XMYA 3HDNA 4AW0A 4AX8A 3HV5A 2VRXA 5EM8A 4BDGA 2XNEA 3TUDA 3RTPA 1OL6A 5B2LA 4D58A 1PJKA 4GH2A 1MQ4A 3TKHA 2PSQA 3I7CA 4IDVA 1MRVA 3D5UA 3WILA 1YDTE 4IZ7A 1YQJA 3NUAA 4LV8A 3DBCA 4ZTNA 3H0ZA 3KMUA 2C1AA 4KD1A 2R3IA 3UNJA 3CQWA 4L7SA 2QOKA 3OEZA 2Q83A 3QCXA 4DAWA 3QA0A 4MD8E 2BDJA 2BR1A 2Z7SA 4FTIA 1U54B 4FIJA 4JQEA 5E8SA 5KZIA 2QURA 3CR0A 1VJYA 3D15A 3F61A 4U42A 4C2WA 5HNIX 3G15A 5IQHA 5CTPA 4C3FA 3KXHA 4G3GA 4UXQA 3PRFA 1FPUA 4M69A 3TZ8A 4D2PA 2PE2A 5JGDA 5KBQA 4JG7A 3QTIA 3ZLWA 3PSBA 2WMBA 2ZMCA 4FL3A 2DYLA 5J95A 4E4LA 2PPQA 4ZZMA 3GBZA 2QHNA 4I0SA 1OMWA 4IW0A 5CXZA 3PPJA 3Q04A 4RG0A 4FKVA 4FUXA 2IVTA 1FBNA 3F3TA 4BWKA 3SKCA 4QMTA 3QC9A 5IMXA 2R9SA 5DT0A 3KXXA 3U87A 4AZTA 3QLGA 4OTQA 3DBDA 1XBCA 4RSSA 3IONA 4EYMA 4D4YA 5K0KA 4D2SA 3I6UA 5KHXA