4AA0A

P38alpha map kinase bound to cmpd 2
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
347
structure length
328
Chain Sequence
RPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Discovery of N-Cyclopropyl-4-Methyl-3-[6--(4-Methylpiperazin-1-Yl-4-Oxoquinazolin-3(4H)-Yl]Benzamide (Azd6703), a Clinical P38Alpha Map Kinase Inhibitor for the Treatment of Inflammatory Diseases
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords MITOGEN-ACTIVATED PROTEIN KINASE 14
total genus 109
structure length 328
sequence length 347
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2011-11-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4aa0A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4aa0A01
3LJ0A 2DQ7X 4PPCA 3KK8A 4AW1A 1J3HA 4RFMA 4TYHB 5DEWA 5DLSA 4AGWA 2XCKA 5A3XA 1OGUA 3SXRA 5BYLA 3PY3A 3ZHPC 3NYOA 3PJCA 4KBCA 4BC6A 2QODA 3BX5A 3HRBA 1BLXA 2B52A 4HPUE 4HCUA 3EN9A 2GNGA 3QRJA 3BHTA 1V0OA 3GU7A 2C5VA 2GNFA 3F9NA 3FMLA 4DFZE 2A27A 4RIYB 3DB8A 1JSUA 3Q96A 4FVPA 4I6BA 2PK9A 2X8DA 5AM7A 3D2IA 4BCOA 4O0UA 2FVDA 3E3PA 4D0WA 2C0OA 3AC8A 3NNXA 3O96A 2WOUA 4O7YA 2YM6A 1PJKA 3ZC5A 4LQMA 3ZO3A 5IA2A 1YDTE 2IZUA 2WEVA 3A7IA 3FXXA 3WE4A 4F0IA 3RINA 3WE8A 3Q4UA 2CLQA 5LMKC 2ITZA 3NW6A 3FMNA 3OG7A 3HP2A 3QKMA 4DFUA 2BHEA 4J1RA 3E7OA 4J8NA 5CQWA 2WGJA 3V6RA 1CTPE 2J51A 4OBQA 3TKHA 3VF9A 5ANKA 1YXUA 1ZY4A 2IWIA 2XJ1A 3THBA 5HKMA 2R3RA 1P2AA 4JVGA 4RWLA 4CG8A 4O27B 4C59A 4C4FA 2UW3A 3PPKA 2BR1A 4QYHA 2JBOA 3IW4A 3OTVA 2WPAA 4D5HA 2OU7A 2YM7A 3FYKX 4RIOA 3EZVA 4FTCA 4M0YA 3MPMA 1TVOA 1H07A 3EL7A 3C0IA 5DHJA 1IAHA 3FC2A 3LXKA 5CI7A 4ERWA 1H0VA 3R8MA 3DNDA 2IZSA 4YPDA 5M4CA 1ZWSA 1R1WA 4GFMA 5LARA 2GQSA 3ZBFA 3QD0A 3R01A 3KULA 4I92A 4L8MA 3V5QA 2W05A 3Q53A 3QTWA 4JIAA 4JJRA 4YUQA 2VTHA 3RAKA 4RJ7A 3WARA 1R3CA 4ZOGA 2PVHA 3NNWA 3L8XA 4U5JA 4PX6A 2VTPA 3LAUA 3QTIA 4V0GB 5KMIA 5IQGA 3FPMA 5EH0A 2Z2WA 3LCSA 4DG3E 1A9UA 4C61A 3P7AA 1ZOHA 1PYEA 3QGYA 1LP4A 5BYZA 1J7UA 4FV7A 3CP9A 4TNDA 5EQEA 2B54A 4S31A 3ZUTA 4BGHA 4ZY6A 4UY9A 5AIRA 1OPKA 2JFMA 1REJA 3C4ZA 2RG5A 2QO2A 4QYEA 4F7JA 1PKDA 3DDQA 3G6HA 4L52A 4JAJA 3OC1A 4XOYA 3NVMB 2WMUA 2WHBA 3GC8A 3VW8A 3UO5A 4NKAA 5BUIA 2WMVA 3UOLA 4NYEA 2ESMA 2C47A 5CVHA 2R7IA 1YHSA 4JG6A 2VWXA 2BTRA 1VYWA 3R1YA 4X2FA 4YMJA 1ZYJA 4EQMA 3D14A 3IW8A 4ARKA 1GAGA 3GC7A 3I60A 4YNEA 3QYWA 5IKWA 3UG1A 4LRMA 3R1NA 4AZTA 5I4NA 2ERZE 3P5KA 2VNWA 3UJGA 1CM8A 4FVQA 5AUZA 2Z60A 4M68A 3BV2A 3K2LA 2WIPA 1JLUE 3VBXA 4EQCA 3E8EA 4XBUA 4XOZA 3QUEA 4UWYA 4YJRA 3E64A 4DH5A 1ND4A 4IAYA 4G9CA 4DEGA 3UZRA 4TT7A 3FXWA 4U8ZA 4F7NA 4LRKA 2YWVA 5FQDC 5GIPE 2CDZA 2PE1A 4PDOA 3FKOA 2XK8A 3RWQA 3R9OA 3OT3A 5EM7A 5TR6A 3HV5A 1JQHA 4D2RA 2YIWA 3LQ3A 2B9FA 3DLZA 3R7EA 3VHEA 1M17A 4GG5A 4L67A 3SXFA 3JUHA 4NU1A 4XG6A 3T9TA 2BROA 3B2TA 3FBVA 2PE0A 2QOLA 1CSNA 4IC8A 3UG2A 3WZUA 5ETAA 4EK5A 3BYVA 3P7BA 4QRCA 5IQIA 4Y73A 4YGAA 1IRKA 4FTQA 5CYIA 5J8IA 3DK3A 5FEQA 4FKOA 4CGAA 3IGOA 3W2QA 4GIHA 3A62A 2X7FA 5TE0A 3RWPA 2CLXA 4X3FB 4J8MA 1H24A 3W2CA 2SRCA 2XP2A 4MD9E 1GZOA 3MVHA 4NM0A 2YDJA 1NVQA 3AD5A 4PL3A 4XNEA 1DI9A 5HVJA 5TT7A 4EBVA 5J7HA 1M52A 3O7LD 4O7LA 4EJ7A 3MV5A 4Z55A 4HW7A 5C8KA 3GU8A 3HRCA 2JEDA 3NGAA 4FL3A 4YU2A 3EFKA 3FI8A 2HXQA 3GQIA 4FKQA 4GUBA 4RIXB 3UYSA 4ENYA 3F82A 3U6HA 4GJ2A 4ZY5A 4EZ7A 3FLQA 3VUMA 3ACKA 2ZYBA 5LOHA 3E93A 3FY2A 5KMMA 2QOIA 1OVEA 3TIZA 4R3RA 5AX3A 2VTIA 3EQIA 1FINA 5EW9A 2BDWA 5EM5A 4RWJA 5IG1A 5JGAA 4QPMA 3PXQA 3DGKA 4C35A 4ASDA 5E8VA 3OXZA 4XV1A 3HNGA 3MA3A 4JAIA 2WEIA 5H3QA 5AWMA 3TZ9A 1JKTA 4BDEA 4O0XA 4YURA 3A61A 4XRJA 2OJIA 2R5TA 3WILA 4RBLA 3EQRA 3VHKA 3CR0A 3IDBA 5KX8A 2J5FA 2W1DA 3QWJA 2PHKA 3R22A 3CQWA 1OIYA 2C0IA 3VRZA 2XEYA 4PF4A 5HNGA 4OTRA 4ZJVA 4G1WA 3PLSA 2Z7RA 4HYUA 4B6LA 3LHJA 3RCJA 5ANJA 3A8WA 2UW4A 4HGSA 4NIFB 3BIZA 1XJDA 4GH2A 3SC1A 4HNFA 4K6ZA 1IA9A 4YSJA 5GHVA 3ID6C 3KVXA 2QONA 5EDQA 4TNBA 4MBJA 3I1AA 4B9DA 1ZRZA 2BKZA 2XNOA 2W4KA 1BI8A 2ZMCA 4FUYA 4FZ6A 4CYIA 3PY0A 3UPXA 4CT2A 4TL0A 3EQBA 4JDJA 4EH9A 3NLBA 1OUKA 2QQ7A 4FTOA 2PUNA 2YHVA 3I4BA 1G8SA 2R0IA 2WB8A 4G9RA 1PXIA 5HLPA 2C1BA 3PG3A 2VO0A 5EFQA 4BFMA 4JOAA 1VR2A 2Z7LA 2I40A 4L44A 3QUPA 4M8TA 4W9XA 3JVSA 4IEBA 3KF7A 4L3JA 4QYYA 5CXHA 4C4HA 3VS2A 4XLVA 3D7TB 2J4ZA 3OWKA 3MESA 4LL5A 4EWHA 3P4KA 5CZIA 2G9XA 4RC3A 1R39A 5IPJA 2JBPA 2BRBA 4FIIA 5CEMA 3G6GA 4G34A 3AQVA 3V5JA 4AFEA 3TM0A 3I6WA 5AAFA 3KY2A 3PVBA 1HOWA 1QPCA 3VUIA 2C6OA 3K3JA 3IOPA 3QCXA 1Q61A 4QNYA 4F0GA 3UQGA 5T68A 3QZGA 2C0TA 3K5UA 3MN3A 5ANIA 3MSSA 4DEIA 2ETMA 2VWUA 3PP1A 3TG1A 2C6DA 4U41A 2P3GX 4Z16A 5JEBA 3FHRA 2BFYA 4FR4A 4D2SA 4ORKA 3Q6WA 4WNMA 1Q8TA 2XNMA 4XV2A 2X7GA 4AACA 4F08A 3TKIA 3IS5A 4APPA 5I9YA 2PUIA 5HOAA 5DRDA 3MY1A 4P5ZA 2WIHA 2BZJA 1H01A 2XKCA 3GT8A 3NEWA 3TI1A 2WU7A 3R7UA 2J0LA 3QQUA 1J1BA 1WVYA 2WOTA 4F1OA 3NRMA 5IQHA 3C4WA 3EN7A 3QRTA 4QNAA 3QQJA 2GNIA 2YERA 3SXSA 4ZAUA 2OGVA 4JIKA 5FBNC 2C6LA 2RGPA 4FEXA 5JK3A 5LMBA 3QFVA 4DFYA 3G15A 3I5NA 4K1BA 4UN0C 1JOWB 4FZAB 4X2JA 3ROYA 3RTPA 2BAKA 3VRYA 3PJ2A 3ZO2A 4YBKA 2JIVA 5H2UA 4EYJA 4IX3A 4FTAA 4L46A 4YJTA 2J0IA 1KV1A 2RIOA 3RZBA 3M11A 5EQYA 1UU9A 1R0PA 2XEZA 3DBDA 3EQDA 3GC0A 4IM3A 3WF5A 3CXWA 3SX9A 1FMKA 2C68A 3PJ8A 3PE2A 4G6OA 5CAPA 2XF0A 4D5KA 3ZFXA 4KSQA 3PA4A 5AP6A 3UZPA 2BIKB 3R30A 3G9NA 3GUBA 2WTKB 3MS9A 4P90A 3FLYA 3KXZA 4AT3A 4ANMA 4QMYA 1ZYCA 1FVTA 4OTDA 5K5XA 3F6XA 4UXQA 2JKOA 4A4OA 3MWUA 2JKQA 3HX4A 4MXOA 3COHA 4RJ8A 4L43A 1I44A 2WQBA 4KIQA 5EHLA 1VZOA 5FBOA 5L6WL 5J7BA 1Q3DA 1G8AA 3FY0A 1Y6BA 2XBJA 2YCFA 3FZRA 2XIZA 1ZYSA 4YO6A 1PXMA 3WIGA 4BCQA 3PZEA 1PHKA 3QZFA 4EH6A 4FE2A 5CU4A 1MRUA 4F65A 3CEKA 4FG7A 4GU6A 4C2WA 4N57A 2X2MA 3A8XA 3UIBA 2E9PA 1YI6A 3MPAA 4BTMA 2R3OA 2RG6A 5GJFA 3B2WA 4CFWA 4QMMA 3MA6A 3COMA 5HO7A 2PZIA 2BUJA 1EH4A 2C3JA 2G1TA 1AGWA 1OL5A 2W99B 4Q9ZA 4FT5A 4YLJA 2F7ZE 3LFFA 4V0GA 4BTJA 4KA3A 5E1EA 2UZTA 4D4RA 3CE3A 3QC4A 4U45A 2BRHA 5I9UA 2QKRA 1GIJA 3MTLA 4BGGA 4FYNA 3QWKA 2VWWA 4BIDA 1W7HA 3O8UA 2OBJA 4YR8A 4MNEB 2XNPA 3NYVA 5ANGA 3DNEA 3DDPA 1U54B 3KFAA 4AF3A 2YM5A 4O7ZA 5I5ZA 1M2QA 4PP9A 4PY1A 4D9UA 3BV3A 3TDWA 4R1YA 1M7NA 5LMAA 4F99A 3LJ2A 4BBEA 5EYKA 4PWNA 3D5UA 3W2RA 4FT0A 4JS8A 4PDPA 5CANA 1E1VA 4O83A 4DA5A 2PVYA 4YLLA 5AV1A 5LVOA 5DYJA 4J97A 4O21A 2C4GA 3P0MA 5AM6A 4KB8A 4NFMA 5BVKA 3R63A 4L6QA 4WSYA 4QYGA 3ZH8A 3ZZEA 2XS0A 3GFEA 5CLPA 4C3RA 3UNKA 5C4KA 4JG7A 4U97A 4S34A 1ZAOA 5KMNA 4ERKA 4EK8A 1JKLA 3GXLA 4FSYA 5IU2A 4I3ZA 4M69B 4AAAA 3QD4A 3R6XA 3ZSIA 4A7CA 4RGJA 2I0EA 4IFGA 4X3FA 1Y8GA 3C1XA 1XH4A 3DK6A 4MXXA 5JRSA 3EOCA 4YTHA 3OD6X 4YHTA 3PWDA 2BZHB 2C6MA 3PA3A 2OJGA 3Q6UA 2VTMA 4G3EA 4I21A 4L68A 4D55A 3HA8A 4O0VA 1OBDA 4LRJA 4JG8A 5HBEA 2ZOQA 4O7NA 5ANEA 4FOBA 2GS6A 5CEQA 3AT2A 4I5PA 1KOAA 4G3FA 4YJVA 3ZDIA 4F9CA 4C4IA 1MUOA 3L9NA 4FZ7A 4IACA 4ZJIA 4YZDA 3HLLA 4M84A 3R9DA 3R71A 4IHPA 1FVRA 4E4NA 3OTUA 1OM1A 5DH3A 4PTGA 3FLSA 3DQWA 1DM2A 3O0GA 2Y0AA 4R7IA 3U9NA 4EK3A 4GK4A 3CIKA 1XH6A 4CYJA 3UOKA 4KWPA 5CT0A 3ZS5A 3SHEA 4F1MA 3ZXZA 3PRFA 1PF8A 4IADA 2WTKC 4FG9A 4F6UA 1XBCA 2P55A 4ZZMA 3BLQA 4XG3A 5CSVA 5A4LA 4DE4A 4AT4A 4YJPA 3IG7A 4IX4A 5HVKA 3DCVA 4DYMA 4YPSA 5EDRA 3QQKA 3LFBA 4KSPA 5BMMA 3LMHA 4LGGA 4W8EA 4LM5A 1GIIA 3VQUA 3LPBA 4IBMA 3R9NA 5A4EA 5FEEA 4AG8A 5BX0A 5CF6A 2FSMX 4TY1A 3ZFMA 3ALOA 3PXFA 3NYNA 4NJ3A 3PLAE 4FBXA 3DOGA 1URCA 3PXKA 3E8DA 4OTHA 4YNOA 3PVWA 3MGYA 1UNHA 1OZ1A 4C62A 1OKVA 4G3GA 3N9XA 2EXCX 1IASA 2PMNX 2ZDTA 4O0TA 3PFQA 5HG5A 1W98A 3KB7A 4RT7A 2YDIA 3FL5A 3LVPA 4Y46A 4YJNA 4I23A 1L3RE 2VRXA 3PXZA 4XHKB 2WD1A 3VS5A 2VD5A 1KE9A 4AE6A 3VBWA 2BRMA 1E1XA 3R21A 4JQ7A 3UNJA 3VJNA 1WZYA 2OF4A 4LUDA 3EB0A 4XUFA 3ZO1A 3ZRMA 4U6RA 1XWSA 3ZLSA 3AC2A 3DBQA 2WMXA 1QPEA 5A6OA 2RL5A 3PG1A 1OUYA 3DA6A 2RKUA 3UDBA 3F5GA 3FLWA 3R8VA 2RSVA 2ZDUA 3RK7A 3VIDA 2J9MA 3H3CA 3IPHA 2CNVA 3GOPA 4B8LA 2BDJA 1KWPA 3PUPA 4GW8A 2UW6A 3RK5A 2F57A 4E73A 1LEWA 3F3TA 3QQFA 2V22A 3ORIA 5M56A 3KULB 2F49A 3RBWA 2ERKA 2W4JA 4PNKA 5IA5A 3E5AA 3WF6A 3W2SA 3PY1A 4FTUA 4FL1A 3N4TA 3LQ8A 1XQZA 2Y7JA 2YISA 4MAOA 4FIFA 3PP0A 5EKOA 4A4LA 3EFWA 2QCSA 3V6SA 3W32A 1ERKA 4AU8A 2XKDA 4Z9LA 3GCVA 2H6DA 3OEZA 4CZTA 1U54A 2YABA 3CSVA 4CG9A 2JKMA 4FEUA 1W8CA 2YN8A 4RSSA 3IDCA 3V8TA 4AN3A 5JH6A 3B8RA 3KMMA 2BAQA 4CQEA 3L9PA 3QHRA 5CEOA 2JDRA 4ACDA 4IX5A 5HHWA 4D1ZA 2NPQA 3LFSA 3ET7A 4EOKA 3VUHA 2BKKA 4N4SA 5GJGA 3CBLA 4TWOA 2OLCA 3R7YA 1H27A 4LFIA 2A4LA 3QAME 2UW8A 3HV7A 3I7CA 1YI4A 3EN5A 4M69A 4M13A 1W82A 1WCCA 3TTIA 3U8WA 3QCQA 1H4LA 4PMMA 4RJ3A 3RAWA 1V1KA 4EOPA 3TUCA 1WBVA 4U9AA 3SW7A 1OKWA 4JDHA 3HYHA 4MH7A 3VWAA 3OBJA 1OL1A 5HORA 2PE2A 3PRIA 1ZZ2A 3QQLA 1ZZLA 2EU9A 4RA4A 2QHMA 4I4EA 4ZSGA 3FEGA 4H1JA 1F3MC 4YSMA 5LVNA 4R3PA 1AD5A 3P23A 4L7SA 4QMVA 4ZMFA 4RJ5A 4RIWB 4EH8A 3NUYA 5CASA 3NAXA 1YHVA 2WTVA 3LXPA 1JSVA 4P7EA 2R3HA 1WMKA 3DPKA 1OI9A 2QOKA 5HD7A 3QKLA 2E9NA 5JSMA 2VTJA 5EM6A 3RALA 5JGDA 5IQDA 3LCOA 3EKNA 4NKSA 4BI1A 4BTFA 4C3FA 4X3JA 4Q5EA 4UWCA 4AOTA 2Y4IC 4NT4A 4UBAA 1V0BA 3HMMA 3U51A 2R7BA 4QTEA 1FGKA 1F5QA 4ALWA 2XNGA 5AV4A 2YZAA 1JVPP 3LLAA 2NNWB 3BBTB 3T9IA 2C3IB 4ACHA 3KGAA 5ACBC 2ACXA 2QURA 5J5TA 2AUHA 2CCHA 2Q0BA 4BN1A 2R9SA 1YHWA 4O86A 4WIHA 3GI3A 1M2PA 1URWA 2X6EA 2QI8A 3U87A 4TYHA 2HW7A 3WF7A 3R0TA 4LMUA 4D1SA 2PZYA 4BBFA 5CSXA 1Y8YA 2ITPA 2C5OA 3FXZA 5F95A 4QMQA 3DZOA 4YC3A 4YO4A 3D5VA 4F0FA 1JNKA 4RLKA 3BCEA 2XK4A 1Q41A 3MIYA 2DS1A 3VBYA 4BKZA 2IG7A 3IO7A 5FTGA 2Z02A 3KRWA 4DINA 2PPQA 1ZYLA 3F5XA 4C36A 4J7BA 1R0EA 1IA8A 3R7OA 3C7QA 2HENA 4IW0A 3WZEA 3OROA 4FK3A 3Q9ZA 4OTPA 1QCFA 3OZ6A 1TQMA 1P14A 2RFNA 3P08A 4BWKA 3DKCA 4HZRA 3RZFA 3DK7A 4BI0A 5CEIA 3RHKA 4HYSA 3CKWA 1JSTA 4JI9A 4JX3A 5J9LA 5B2KA 2ITQA 4OLIA 4FZDB 3CTQA 4XV9A 3VAPA 4I6FA 4O1OA 3Q2MA 2VUWA 2OF2A 2ZV8A 3G2FA 5E8ZA 4DLIA 1LEZA 4KS8A 3QTZA 4FZFB 5EHYA 4DC2A 4E26A 5KO1A 4ASZA 2R3GA 1XBBA 3NW7A 3FKNA 5AR3A 3TV4A 4AZWA 4PPBA 2BHHA 2A0CX 2X81A 3D2KA 2HY0A 4EI4A 2R2PA 3LFNA 4UYNA 3NX8A 2OIBA 4XP3A 5HTIA 1FGIA 1LUFA 3T3UA 4ONAA 2OO8X 4ZXTA 3PXYA 3S2PA 1ZMVA 3IDPA 4ZIMA 4B8MA 4BIBA 5J95A 4KIKA 1Z9XA 3VS7A 3NCGA 3EQPA 5DT3A 4C33A 3KRLA 2F9GA 2WO6A 4KIPA 1L8TA 3O71A 1DS5A 3CY3A 3FMDA 2HWOA 3MY5A 3BPRA 5AV3A 5IQBA 4EHEA 3DBFA 4TPTA 3UC3A 5EQPA 4O82A 4RFYA 4PV0A 3SQQA 2J0KA 4K11A 4CEGA 5A54A 2QLUA 1Y91A 3U4UA 4KUJA 3ODYX 4NH1A 4TRLA 5EYDA 2X39A 4UYAA 5EW8A 2IW6A 3UNZA 2W06A 5IDPA 3FZSA 4I0RA 1CKPA 4CT1A 4WD5A 5IA0A 4PQNA 3UC4A 4IAIA 5AR7A 4R77A 2X6DA 5HU3A 4ACGA 2PVMA 3RI1A 4EH3A 2QOFA 2UVYA 1WAKA 4HOKA 3F5UA 4CZYB 5AUTA 5L8LA 1J91A 4TYIA 5FDPA 5TKDA 1FMOE 4A06A 3KU2A 3KXHA 2E2BA 2XVDA 3IOKA 4CRLA 3U54A 4FV1A 4ITHA 4KIKB 3PPJA 3FV8A 2YAAA 4J95A 2XIKA 2EXEA 5ANDA 4D2VA 4UALA 2UZLA 2ETKA 2V5QA 4QP2A 1SVHA 3QTUA 1H1WA 5IQAA 2PULA 3QQGA 4WG5A 4TN6A 3BU3A 1ZOGA 2ITNA 1Y57A 4BDGA 1APME 4CCBA 2UZWE 4LGHA 2XA4A 5DGZA 4GT3A 4IZYA 4L01A 2O8YA 2YACA 4DFBA 4S33A 1ZARA 4AFJA 4PNIA 1FPUA 3V5PA 1CKIA 4BWXA 1UNGA 2W5BA 5EOBA 2CNUA 2JDSA 3G33A 2YLEA 3EMGA 4JDIA 5E1SA 4NTTA 1NW1A 4CV8A 5BNJA 3ZUUA 5HGIA 3RVGA 4WBOA 3TL8A 3ZDUA 3L8VA 2R3NA 3RCDA 1YOLA 3DFCB 4KAOA 5IEVA 3GQLA 1U5RA 5HIBA 5HE2A 1JWHA 3LQ5A 3KK9A 3V04A 5IA4A 5J1WA 4QMWA 3SW4A 1PMUA 2GNHA 2X4FA 3SOAA 4EOLA 5CVFA 2HK5A 1DI8A 4L3LA 5C03A 4D4SA 5LWMA 2PVNA 4JR3A 5HX8A 4U0IA 3V5WA 4E93A 3HAMA 1O6LA 4G17A 1PXOA 2VTOA 4CNHA 1PYXA 2YIXA 3D9VA 4CMTA 4QP6A 4DEBA 3G0FA 5DT4A 4GUEA 2WMTA 3R2BA 1Q8WA 5IH6A 3AXWA 3QF9A 1I09A 3IONA 4CMOA 2O0UA 4AA5A 4PMTA 3RPYA 3S00A 2WKMA 4BICA 3CCNA 4WG3A 3ANQA 3KXMA 3TKUA 5CU0A 4V04A 1NY3A 3QCSA 2R3LA 2GHLA 2QG5A 3BZ3A 5K0KA 3FMHA 3VUGA 1UV5A 3LJ1A 5FM3A 3WZDA 3PIXA 4RIXA 4EHZA 4UZHA 5HIEA 4EH2A 4M66A 4IM2A 5AEPA 2VNYA 4Y72A 2O3PA 4JBPA 4ZTLA 4A9TA 1SYKA 2PMOX 4PL4A 5EI8A 2W5HA 4F6WA 1KE6A 5CSHA 3MJ2A 3KN5A 2A1AB 3HKOA 3Q4TA 1FOTA 2PTKA 4O0YA 3I0OA 4L00A 2OXYA 4YP8A 1IR3A 3EZRA 3IECA 3FE3A 4E3CA 3R04A 4R5YA 1YRPA 3FZ1A 4IWDA 5FDXA 2J90A 3ZEWA 3CGFA 3GOKA 4I93A 4TYJA 5AV2A 1WVWA 2NP8A 3BWJA 5HLWA 2GFSA 4WBBB 3O2MA 3FMMA 3GU4A 2CKEA 2XBAA 3TEIA 4U7ZA 2W96B 4I20A 2F7XE 2R64A 3KRXA 3O17A 5LQFA 4FTJA 2WQMA 4C02A 4CCUA 3LIJA 4QP1A 4XG7A 2UZNA 2BILB 1SZMA 3MFTA 2PVFA 3EH9A 1OIRA 5KMLA 3MVMA 5AUWA 3T8OA 2C6KA 4N0SA 3UBDA 3BELA 4IAKA 3UE4A 4C2VA 5EYMA 5EKNA 3AC4A 3NAYA 4F70A 3PWYA 5I9VA 2ZV2A 1XH7A 3C0HA 2HOGA 2VX3A 4XBRA 4GV1A 3QLGA 4DBNA 4FV2A 4OTQA 3M1SA 3DAKA 2XNEA 1RW8A 5BVWA 4DHFA 3H4JA 3HUCA 4YC6A 3PVGA 3NVKI 3S95A 4ZTQA 4DITA 2PUUA 2X9FA 3MB6A 3Q3BA 1PXNA 2BZKB 4GSBA 4AW0A 5CSPA 2Q83A 3A7HA 4BCKA 2UW9A 4AOIA 3AMYA 3RHXA 2ITTA 4UMUA 4OR5A 5HIDA 4USFA 5G6VA 3GVUA 4YC8A 2RFEA 4ZTSA 5C4LA 3FMJA 4EBWA 2YIRA 2WU6A 5K5NA 4MVFA 3EN6A 3TDVA 4QMXA 4EZ5A 3NMUF 2PZPA 4FSTA 5AAEA 4BYIA 1BYGA 4BCFA 4GEOA 4O0WA 3S4QA 3UGCA 4H58A 5M08A 3R7VA 4MWHA 2VGOA 2XKEA 4TTHB 3K54A 4OW8A 4X21A 4EL9A 3LMIA 3LZBA 2CHLA 4EH4A 5D9HA 4BDKA 4ZTRA 1TQPA 3DS6A 4EH5A 4C3PA 3BKBA 3V5TA 4RWKA 3PTGA 4PPAA 2UZUE 3DJ7A 4XCUA 4OBPA 3BBWA 4UXLA 4BDJA 4DH1A 3C5IA 1YVJA 2B4SB 2OI4X 3OT8A 4NFNA 2UZDA 4O38A 5LXMA 4YJSA 4U44A 4BTKA 5E8XA 4FV6A 4U81A 3V5LA 3TTJA 4U40A 3JY0A 5HBJA 5CU3A 5JN2A 4MD8E 2B7AA 5GINE 1UU7A 4WRGA 4PMPA 2BDFA 5HLNA 2Z8CA 2YLFA 3CJGA 3TNPC 5DWRA 2QO9A 1GOLA 4E6DA 2I6LA 2OICA 2W17A 4O7TA 3HP5A 3RPRA 5LVPA 5HG9A 4X2NA 2FA2A 5L3AA 3R8LA 3QU0A 2GQGA 4M12A 4WUNA 2OKRA 3DJ6A 2QOCA 3JXWA 3Q04A 4DGNA 4QMNA 2CKQA 5DFPA 2XK9A 1PXPA 4E4LA 5FLFA 4YHJA 3AMAA 4AP7A 1MQ4A 2EWAA 4PMSA 5E9EA 4O0SA 2WMBA 2W7XA 4IH8A 4KNBA 4BKYA 4HVHA 5J79A 1QL6A 1QMZA 4WKQA 5BVEA 4D4VA 2JFLA 3GB2A 2HAKA 4DTBA 3L8SA 5G1XA 4XG9A 5BVFA 1B39A 1Q24A 4I5MA 4KKGA 2CKOA 4BCPA 1JAMA 2OZAB 4FEVA 4II5A 5HG7A 4XEYA 5ETIA 5HEZA 4EOOA 3S1HA 4F9BA 1MP8A 4IVDA 4MX9A 4MBIA 5HG8A 5KKRC 2I0YA 2OWBA 3E3BX 3HVCA 5L2WA 5LVMA 3VQHA 4XYFA 2YJSA 5BUJA 4MNEA 3F2NA 1KE7A 3CS9A 4CFXA 4BDDA 2C5NA 1YDRE 4GKHA 3QTXA 3D5XA 2R0UA 3EHAA 4YJUA 5DR9A 2J2IB 3ITZA 1XH9A 1PMVA 1LPUA 1A48A 4ZSAA 4RRVA 3W16A 4WNOA 4ALVA 4RIYA 4X0MA 5CI6A 3S3IA 4C57A 4Y8DA 3F61A 2IO6A 4FT9A 4JXFA 1IG1A 4GVJA 2HZIA 3EFLA 2F2CB 4FSZA 5BVDA 1H1PA 5CXZA 2DUVA 4BCNA 3G90X 3OS3A 4F64A 5HNIX 4XX9A 3RM7A 2X8EA 3SVVA 3AOXA 3R00A 4BDFA 2PMLX 4CLJA 3IKAA 3BYMA 4FTTA 3DXNA 3F5PA 3IW5A 5AP4A 3D5WA 2OIDA 3PZHA 2YWPA 2ONLA 3UIXA 1U5QA 1BUHA 3H9OA 2GMXA 4FV0A 5ICPA 4PTEA 4L9IA 3UIMA 4C4GA 4P4CA 5A4TA 2YA9A 3EKKA 4LL0A 4ZSEA 3DXPA 4DTAA 2W1FA 1UU8A 5BUEA 3W1FA 2AC5A 5IQFA 1RJBA 4XJ0A 4YZCA 2VWVA 4X6RA 3F3UA 4QYFA 4E4XA 4BCMA 3SKCA 2PYWA 4NM5A 4AWIA 2ZVAA 5I3OA 4YJQA 3DB6A 3G51A 2GU8A 3UQCA 4XG2A 3ERKA 4HVGA 5LWNA 4IAFA 3BQCA 3EQHA 3MY0A 3OWPA 2VV9A 4CFMA 4CZUA 2VX1A 4F9AA 3ODZX 5GZ9A 2VTSA 3KA0A 3ZLXA 3NCZA 4IFCA 3QRUA 5FTOA 4XP0A 5I0BA 3P7CA 4QMZA 4FODA 3A7FA 4HGEA 5CSWA 3HDNA 1YOJA 4FKGA 4DLJA 2ITXA 3R02A 4FICA 4FEWA 2QU6A 3ORMA 5AR4A 4L42A 4EOSA 5LJJA 4LMNA 4W4XA 5CF5A 2B9IA 3WIKA 3LLTA 3OMVA 4RX9A 3AGMA 4LOOA 5E8TA 3VBQA 4FGRA 1UKHA 1V0PA 3F69A 3OWJA 3QX4A 3EWHA 5L2QA 4KINA 2UW7A 3VS6A 2WMAA 4O6LA 1J7LA 3UVPA 4U3ZA 4W4WA 5BYYA 4H3PA 5F94A 4F4PA 3FZPA 4M67A 2YFXA 4K8AA 3KN6A 3BHHA 5HESA 4IQ6A 4G16A 5HICA 4I0TA 4IWOA 1H25A 4MXCA 2PY3A 2WTIA 3ATSA 3LW0A 4JLCA 3SLSA 2O5KA 3D94A 5BQ0A 4RG0A 5H8BA 3AT3A 2DYLA 3IW7A 3NUNA 3VW6A 3ZONA 4M97A 5E8WA 4BVUA 4MBLA 3HL7A 2O64A 4DFNA 5JFWA 2VAGA 2C30A 3BU6A 3BWFA 3GU6A 3DT1A 4NCTC 4C37A 4D2WA 4JRVA 5HE0A 3DZQA 4QMTA 4DN5A 5J5SA 2UUEA 5HCZA 3D83A 4GMYA 1E9HA 4MXZA 4ASEA 2JDTA 4HPTE 4EQUA 5D12A 2ZM1A 2X7OA 5J9ZA 3RMFA 1GY3A 3CY2A 3VS1A 4EKKA 5CNOA 4CTBA 4IB3A 3FZOA 5GIOE 4BDIA 3JPVA 3A7JA 3PIZA 2ZV9A 4IVAA 4F1TA 3Q5ZA 2B1PA 4MYGA 4DBXA 2C6TA 2G2HA 1OKYA 3QTSA 5DBXA 4CXAA 5IEYA 5IA3A 2R3QA 4GRBA 4GK3A 4QMLA 4W8DA 1KUTA 3JR1A 5LCJA 4QP3A 2J6MA 4IB1A 1T45A 2X8IA 3NDMA 5D7VA 3QA8A 3D7TA 3OVVA 4C38A 3KQ7A 2PVKA 4GIIA 2X2LA 3BHVA 5AUUA 3AC5A 5ETCA 2JLDA 4A9UA 3KRJA 5L2TA 3HDMA 2QO7A 1MQBA 3RK9A 4FNZA 5KZ0A 5IH4A 4NEUA 3FQEA 4DEEA 4A07A 5M4IA 5ACKA 3VUDA 3W33A 4ANBA 3HV6A 3ACJA 4BF2A 4CTCA 2YM3A 2BMCA 2X4ZA 3ZU7A 5FWKK 3NUSA 4Y83A 3LFDA 2OJFE 2XK7A 3CC6A 2BCJA 2J5EA 2R3MA 4TXCA 3I7BA 5FXQA 1R78A 2BFXA 2QHNA 4BHZA 3GEQA 2YM4A 4FG8A 3O23A 3A99A 3U6JA 2HY81 4ZLZA 2Q0NA 3ENMA 3E63A 5AP1A 5IEXA 4UMPA 3UYTA 2UV2A 5CNNA 3KRRA 3DLSA 4DG0E 2AC3A 3DAJA 4RQKA 5D11A 2XKFA 3GFWA 3T3VA 4E5BA 4M7IA 2FSOX 3UP7A 4D28A 4Y5QA 2G2IA 3ROCA 4NW5A 3I6UA 2EVAA 3ULZA 1LR4A 4KBKA 4OTIA 4ZTHA 4ZZNA 1JPAA 4GS6A 5AR2A 1YXSA 4G31A 3FAAA 4MTAA 4EK4A 5CAUA 3SG9A 2XIYA 1Q8UA 4TYGA 3KL8A 5ETFA 4EOJA 1P4FA 5FP5A 5K9IA 3R9HA 3ORXA 3FKLA 4V01A 4NJDA 4Z7HA 4QQ5A 1S9IA 1H28A 3SAYA 4RJ6A 2R3KA 5IUIA 3GU5A 1OIQA 3ELJA 3OY3A 1VYZA 4BDHA 5M57A 5FEDA 3QXOA 3D15A 5C1QB 3NPCA 1GZ8A 1SMHA 5EDPA 2OSCA 3SOCA 5DPVA 3TWJA 3BYUA 5B2MA 4W9WA 4OGRA 2A19B 2EB2A 1MRYA 3VS4A 4F9WA 5L8JA 3ORTA 4R6VA 3MJ1A 4FSNA 5FXSA 4FL2A 4U3YA 5AR5A 4ZS0A 4JT3A 4O81A 3AG9A 1Q97A 5DRBA 4O7RA 2JITA 4RVMA 5CTPA 4U79A 4BDBA 3OCSA 3TZ7A 2UVZA 3ANRA 2QC6A 3EQCA 5CQUA 5J87A 4CLIA 4O7SA 5M06A 4USDA 4UMRA 4NL0A 5HNBA 1GJOA 2JDOA 4FF8A 3QC9A 2IPXA 1Q8ZA 3IGGA 3KF4A 3WYYA 4IB0A 4FA2A 3UZTA 1H00A 4LV8A 2FSLX 4RZWA 1GIHA 4FIJA 1YDSE 2XNBA 2OXDA 3MYGA 4DH3A 2R3FA 4PRJA 2Y4IB 1JKKA 2XK3A 4GFOA 4RWIA 3ZSGA 2GS2A 3BI6A 3DKFA 5CY3A 2I1MA 4DTKA 4M3QA 3DTWA 5DA3A 5HE1A 4BB4A 1YOMA 4N6YA 5H9BA 3MH1A 1X8BA 3BGQA 4IDTA 4JL9A 4TKSA 3RPVA 1K3AA 4GVAA 4KKEA 3ZM4A 4BZOA 4BCGA 4CFNA 2CKPA 3HAVA 2QVSE 3DQXA 3KEXA 3DFAA 3GP0A 4ZEGA 3OCGA 3I81A 3TNIA 3V51A 4EJNA 1PRYA 3F3ZA 5HO6A 4C7TA 3GCSA 4OBOA 1YQJA 1H8FA 1SM2A 4BBMA 2Y8OA 2UW5A 4PTCA 1XH5A 4TWCA 3WOWA 4E20A 4FNWA 4FNYA 3VULA 4ENXA 4Z7GA 5IF1A 3SGCA 4F6SA 4MEDA 3QCYA 5GZ8A 1IAJA 4ZTMA 4Z3VA 4U42A 3UO6A 4FTRA 4NZWB 4HVIA 3L8PA 3NW5A 4UMTA 4M15A 2XM9A 3NUXA 4FIHA 2ONLC 4EH7A 3VBVA 3QGWA 5AUXA 1KV2A 3DAEA 5HTCA 2RF9A 4APCA 3DKOA 4X2KA 2C3LA 2IVTA 2JDVA 4FV4A 4JNWA 1OIUA 3C4FA 2ZB1A 2PZRA 5AADA 4M14A 1XBAA 2GTNA 3W2OA 4AA4A 2QG7A 5CAQA 5A46A 1OB3A 3FMKA 3TJDA 4JBQA 4GL9A 4H3BA 1DAWA 2CMWA 3O8TA 5D1JA 3ZC6A 1BMKA 4NM3A 3OW4A 2VU3A 2WMQA 3FI3A 3HMOA 5EW3A 5HE3A 3CQEA 3RAIA 4CQGA 1GNGA 3R8PA 3MH3A 2HZNA 2W5AA 1VEBA 5C8MA 5KNJA 3MIAA 3NNVA 5C9CA 2F2UA 3C5UA 4BKJA 4O96A 3A60A 1BKXA 1B6CB 3DTCA 3V3VA 3ZO4A 2CNQA 4FV9A 2XNNA 4FTMA 5C26A 4YTIA 3LFEA 4EYMA 4FV8A 4QTBA 2BVAA 2VWZA 4RLLA 3TNQB 3WZJA 5CU2A 3RNIA 4F9YA 4ZY4A 4LYNA 4F09A 2R4BA 2IVUA 5E8SA 4AGCA 2GHGA 5B7VA 4C8BA 4L3PA 3A2CA 4WNKA 4G2FA 4WUAA 4I22A 1W83A 3FC1X 4QPAA 2WTCA 2B9JA 4NTSA 3FWQA 1DAYA 3TZ8A 3NR9A 2Y9QA 2KULA 2OJJA 4RPVA 2IZTA 3QTQA 5L6PA 5DR6A 3AC3A 2PUPA 1Q4LA 2YM8A 2NRUA 1UVRA 1QPDA 5EOLA 4TW9A 4MK0A 3QZIA 5I3RA 1W84A 1ZYDA 1WBTA 1J1CA 4RFZA 3VJOA 4FC0A 4ZLOA 4ZMEA 4AZSA 4FTNA 4YZ9A 1M7QA 3OCTA 5EG3A 2ITUA 3FYJX 3H30A 5I9XA 2J0MB 2Z7SA 2WNTA 4GT4A 4FKWA 2B0QA 3HRFA 4O1PA 4A9YA 3C4XA 4HYHA 3TUDA 3KMWA 1IEPA 3FZTA 3Q4ZA 1K9AA 1YKRA 5M51A 3WYXA 1KE8A 4IXPA 5E8UA 3TNHA 2PU8A 3R1SA 5IUGA 4UMQA 3LFQA 2GSFA 3PDTA 3OXTA 5EYCA 5B2LA 1UKIA 3EQFA 3SRVA 2F7EE 4CKJA 1PMNA 2BRNA 3QRKA 3Q9XA 4FKUA 4TWNA 4MXAA 2H9VA 4E6QA 4AXAA 2C1AA 4Y85A 5IQEA 3VO3A 3BHYA 5DIAA 4FI1A 5DN3A 3HV3A 4ZP5A 4WSQA 3UOJA 3LCDA 3ORPA 2GS7A 5FRIA 2BALA 3JY9A 3Q9YA 3R7GA 5AA8A 1A06A 3MVLA 4IVCA 4M0ZA 1U59A 5CX9A 3PVUA 4FEQA 4RVTA 4E4MA 1XHAA 3L1SA 4JQ8A 2I7QA 1H1RA 3ETAA 1CKJA 1Q3WA 4UZDA 2XIRA 4EK6A 1PXKA 2YCRA 2UZVA 4HCTA 4JDKA 4BRXA 4JR7A 1NXKA 4JQEA 2BTSA 3PSCA 3LCKA 3ZM9A 4RZVA 2DWBA 2UZOA 4G3DA 4RX7A 2VWBA 1SNXA 2VN9A 3ZZWA 5JRQA 4ANNA 4W4VA 4C4EA 5JMSA 5CF8A 5D41A 2OZAA 1WBPA 4C34A 4B99A 1OL6A 2CJMA 3IQ7A 2IW8A 4CKIA 2EB3A 2ETRA 3M42A 1WBOA 3REPA 2H8HA 2HW6A 2R3JA 4PL5A 1QPJA 1Q5KA 3QYZA 5CZHA 2NRYA 3AD6A 3R83A 5JZJA 3E62A 4I4FA 4U43A 4K2RA 3F66A 2X1NA 4J52A 5FUTA 2IN6A 4QQCA 4XP2A 4FYOA 3FHIA 3C50A 1ATPE 1HCLA 2WMSA 2XCHA 3R1QA 2WMWA 1UU3A 4FVRA 3ZRLA 2A2AA 3UVQA 4B0GA 5HZNA 3KC3A 5H8EA 1WBSA 2C6EA 2CPKE 2QKWB 4E8AA 4FX3A 4OT6A 4S30A 3QLFA 3HZTA 4NIFA 3POZA 1ZLTA 3OWLA 3ZLYA 4F63A 3JVRA 1NVSA 2E9VA 3PIYA 3RP9A 4Y5HA 4J53A 2FH9A 2ITYA 4CFFA 3V01A 2QLQA 3VF8A 3FJQE 4FSRA 4PDYA 3VN9A 4PP7A 2W0JA 3GNIB 4YZBA 5TO8A 3ZRKA 4B7TA 4MQ2A 2E9OA 3MH0A 4DEHA 5E7RA 2Y4PA 3DY7A 5BVNA 3QXPA 4CRSA 2FUMA 1TQIA 3NUPA 4DGLC 1WVXA 4NM7A 4FKTA 4EOQA 4UV0A 2J50A 3UMWA 4L53A 4ITIA 4BDCA 4FT7A 4W4YA 2IZRA 3UVRA 4HVSA 5E4HA 3C9WA 3F2AA 3P86A 3BHUA 4TWPA 1NT2A 4CSVA 4PDSA 4GU9A 5L4QA 1G5SA 4AGUA 2OZOA 3B8QA 3R73A 4MXYA 5B0XA 3Q32A 3NWWA 2CGWA 3F7WA 3I79A 3S0OA 5HTBA 3C4EA 2RFDA 3VS3A 2FO0A 4ANLA 3JS2A 4P2KA 3EIDA 4EKLA 1H1SA 5KMOA 1J7IA 4P5QA 3CTJA 4RQVA 4L7FA 3H0ZA 3OFMA 4KRDA 3BLRA 4FKVA 3TJCA 3FDNA 3AT4A 3ZXTA 3ZOSA 3ZMMA 1ZOEA 4I1ZA 5BVOA 4K77A 3EJ1A 2XK6A 2JD5A 3DKGA 1JKSA 1Q8YA 2WZJA 1PXLA 3EYGA 4BWPA 2W1EA 3QX2A 4AE9A 1B38A 4O0RA 2QR8A 3W55A 2QOQA 4U80A 4FMQA 4AZFA 5KHWA 3NUUA 4D0XA 1ZMUA 4FKLA 4EWQA 1NVRA 5JQ8A 4QMSA 5HD4A 3KMUA 4K0YA 2W4OA 2X9EA 4ZTNA 5LMKA 4O22A 4EEVA 2KTYA 1O6YA 4RA5A 5AX9A 2FYSA 1XH8A 4G3CA 5FD2A 2NO3A 4BYJA 5AIKA 4HGTA 3OP5A 4MF0A 5IISA 3BYOA 4H05A 4QD6A 4RVLA 4HGLA 5JFVA 3DU8A 1G3NA 3MFUA 4H1MA 4ID7A 4LI5A 3ZYAA 2UVXA 5D7AA 4QQJA 2O65A 4QQTA 3UMXA 2ITWA 5LVLA 2C5XA 4MHAA 4X2GA 3QUDA 1H0WA 3VUTA 4A9RA 4RX5A 3MW1A 3I5ZA 4DEAA 4GT5A 3ORZA 3P9JA 4QTCA 4WNPA 5CEKA 5JFSA 2ZM3A 2GHMA 3RKBA 4HVDA 5JZNA 5CWZA 2CN8A 4KD1A 5CENA 4GYIA 2IVSA 2WQOA 2YDKA 2GCDA 4K18A 4FGBA 5ITAA 1SNUA 3PXRA 3ULIA 4H39A 4OTGA 4ZSJA 5E8YA 2O63A 4DGMA 3MDYA 4GYGA 3KXGA 2WTWA 2OJ9A 3F7ZA 4RIWA 5M55A 3TUBA 2UW0A 4FIGA 4NK9A 4DCAA 1KSWA 2W9ZB 4HYIA 1K2PA 4GCJA 2V7AA 4J96A 2OXXA 4MQ1A 5AP3A 1XO2B 3KXNA 4DEDA 5IMXA 4H3QA 3BEGA 4FKRA 3CTHA 4EC8A 3FQHA 2QR7A 2VTQA 4E6AA 4CKRA 3QD2B 1SVEA 5L8KA 1H1QA 1BI7A 2BAJA 5DE2A 5DT0A 3RPOA 3SG8A 1YWVA 2PVJA 4GG7A 5FTQA 4ACMA 3ZUVA 1O6KA 2OW3A 2VGPA 3OHTA 4L45A 5CAVA 3N51A 3MTFA 4R8QA 5DOSA 4LOQA 3UTOA 5DMZA 1TKIA 4KIOA 4CVAA 5AUVA 3R28A 2ZAZA 3MB7A 4HZSA 2P2IA 2QNJA 3C0GA 3QRIA 3Q52A 2QD9A 2YIYA 3FI4A 4UWBA 4FKPA 3LE6A 4AW5A 2Y6OA 3QD3A 2VZ6A 3OOMA 3VUKA 2CN5A 3HGKA 3DJ5A 2WMRA 4QP4A 4AOJA 2WQEA 5HCXA 3E8NA 3BQRA 4D58A 3W10A 3KCKA 4NCTA 5IA1A 3OXIA 5DNRA 2X2KA 3H10A 1KE5A 3TCPA 4J99A 5F9EA 4YHFA 2VTRA 2XJ2A 5M07A 4MCVA 4FSUA 1CMKE 4ANSA 4DFXE 5FXRA 1GZNA 4AZVA 1F0QA 1O9UA 4BCJA 4WOVA 3CKXA 3EQGA 1PXJA 2XB7A 4DCEA 3DXQA 4I0SA 2XUUA 4IZ5A 1U46A 2IVVA 2REIA 4FT3A 5L6OA 3AC1A 5KMJA 3BE9A 2GFCA 3Q4CA 3RGFA 1P5EA 4MNFA 4RMZA 4BZNA 5AUYA 2P4IA 5IZFA 4GKIA 3OCBA 4O84A 4FV5A 3FMEA 3G0EA 5IMEA 3CD8A 5J9YA 3C4CA 2GDOA 3MVJA 1OL2A 2VO7A 3IW6A 4R3CA 4WRSA 3UPZA 4FNXA 4CV9A 4YJOA 1FVVA 4D4YA 4X3FC 5AAGA 4X7QA 2OFUA 2VO6A 1MRVA 5F20A 4UEUA 3WI6A 4EORA 4ANOA 5FG8A 4EHVA 5IH5A 2OIQA 1AQ1A 3BEAA 2ZM4A 3O8PA 4A9SA 4FK6A 4ALUA 5K3YA 3HMPA 4RVKA 5DVRA 1FQ1B 3II5A 4E1ZA 4RJ4A 3JYAA 5DI1A 3Q2JA 4IWPA 3I0QA 3FLZA 4IIRA 4WHZA 3QQHA 4TZRA 1YWRA 3GCPA 2YAKA 2HXLA 4Q9SA 2JAMA 3EN4A 2VO3A 3AMBA 2C69A 1KOBA 2HZ4A 4QMUA 1BL6A 4HJOA 1Y6AA 2VWYA 3ALNA 5AA9A 4ZJJA 4EONA 2WTJA 2BZIB 1NA7A 4LUEA 2CGUA 4O2ZA 4EOIA 4YTFA 5BMSA 4I41A 3QBNA 2C6IA 4IZ7A 4E7WA 4UX9A 2PVLA 3G9LX 1CDKA 4B4LA 4FUXA 3UO4A 1Z5MA 4ANQA 3HMIA 5A14A 4EZ3A 3MFSA 3Q9WA 4Q2AA 3MH2A 2IJMA 3RJCA 2W9FB 2IW9A 5L2SA 5IUHA 1RDQE 3E87A 1UA2A 3H9RA 3RNYA 3V8WA 4AQCA 5KCVA 3N4VA 1REKA 3E92A 4AN9A 2QU5A 4IZAA 4K33A 4RC2A 4WT6A 4A4XA 3GENA 3NUAA 4R78A 3FL4A 4R7HA 2GTMA 5I9WA 3HMNA 3TXOA 3TACA 1W0XC 3M2WA 4IAAA 5BPYA 4YZNA 3QL8A 2PSQA 5ANOA 3ZBXA 3NSZA 4QO9A 4BI2A 2V7OA 2YCSA 3KVWA 2HZ0A 1YI3A 4NWMA 3VC4A 4FTLA 5F4NA 5KHXA 3PJ1A 4MF1A 3FSKA 4XLIA 4BHNA 2VX0A 2OH4A 2YEXA 4I5HA 4EHGA 4O6EA 2BPMA 1WBWA 3PPZA 4GJ3A 2QOBA 4I5CA 5M53A 3KREA 3U9CA 1HCKA 5C8NA 4IC7A 5M44A 2GNJA 3VNTA 3G5DA 3Q60A 4Q5HA 4C58A 2XJ0A 3WZKA 3TZMA 4LOPA 4G5JA 3TN8A 5FP6A 1YWNA 2JC6A 2YJRA 4E5WA 1ZMWA 3VVHA 4WA9A 4KABA 4YLKA 5JQ5A 3ORKA 3HUBA 2PVRA 5AJQA 3ZLWA 4E6CA 4ZLYA 4ZSLA 2G01A 4IAZA 4ITJA 1P4OA 5L2IA 4FSQA 4IB5A 2W1CA 4QPSA 3R7IA 2GNLA 3D7ZA 3IK3A 3BRBA 5KUPA 3QA0A 1OL7A 1XKKA 3QZHA 3N4UA 2WFYA 4D1XA 1M14A 3LM5A 4HNIA 5EI2A 4DGGA 5HX6A 2YCQA 3F3WA 2GPHA 2XM8A 4IJPA 1JBPE 3UP2A 2WTDA 4DH8A 2OFVA 3K3IA 4YZMA 4AN2A 3CPBA 4CMUA 5FM2A 5HO8A 5IDNA 1T46A 3C51A 5DEYA 4QMPA 4KKHA 4BCHA 1UWJA 5A4QA 2W1ZA 3OEFX 3R2YA 5HBHA 3D0EA 4I6QA 4IVBA 2WQNA 5KBRA 3FSFA 4GK2A 5JFXA 2E9UA 3OOGA 1Q99A 3CLYA 2W1HA 3OBGA 5HVYA 2JIIA 3W8QA 1OPJA 3GCQA 2XRWA 4IM0A 4OTWA 2J7TA 4DH7A 4RC4A 2B9HA 3BLHA 5IQCA 3COKA 3FLNC 3NIEA 3SRVB 2QOHA 3SDJA 3P1AA 5A4CA 5JT2A 3CPCA 4QP7A 4USEA 3UODA 4YTCA 4IJ9A 2XIXA 3E88A 1OPLA 3LCTA 4QOXA 5T6KA 4DT8A 4BGQA 2V0DA 3PE1A 1BX6A 2VTTA 1ZY5A 4OTFA 4JRNA 3ZCLA 5M4UA 4PUZA 5EI6A 5AP7A 1M2RA 3CJFA 1BL7A 5GNKA 4AA0A 1PW2A 3QKKA 4CFVA 3NZ0A 4I6HA 4XV3A 4FIEA 3POOA 2YZLA 3R8ZA 4E5AX 4QT1A 5KBQA 3LXLA 2P33A 4XG4A 5M4FA 3PYYA 2RFSA 4N70A 3BGZA 3FUPA 3SD0A 1Q62A 5K4JA 1RQQA 4BCIA 3BU5A 4MKCA 4DGOA 1XR1A 5AV0A 2OH0E 4G6NA 3GBZA 2C3KA 4OT5A 3W8LA 3HEGA 2B53A 4AS0A 3H0YA 3D4QA 3CGOA 3R8UA 4CFUA 4ASXA 3LKMA 3WBLA 4C0TA 4OUCA 2V62A 4R7BA 2O2UA 2HWPA 1Z57A 2VTLA 5K0XA 3OUNB 4KS7A 5K4IA 5DR2A 3EYHA 5CEPA 5J1VA 3WF8A 4O7VA 3GGFA 4JBVA 2HIWA 3BE2A 3VBTA 3RAHA 2EUFB 3P78A 1OITA 2PZ5A 1H08A 4XS2A 5AFVA 4GFGA 3ZEPA 4H36A 1WBNA 4NW6A 3QHWA 4KBAA 2G2FA 5FGKA 3TT0A 5TF9A 2XYUA 2JKKA 4D2TA 3ZSHA 1RE8A 2EXMA 4J71A 3HV4A 2XMYA 5CF4A 4IDVA 1STCE 5EK7A 5CALA 5HU9A 4Y95A 2AYPA 2ZB0A 1YXTA 4S2ZA 4OAUC 5LCKA 3OY1A 2WXVA 4NSTA 4V05A 1YXVA 4OAVB 3C13A 5KMKA 4R5SA 4XRLA 4EUTA 3TIYA 3LM0A 4IMYA 3OF0A 2HELA 3BGPA 3FPQA 3PSDA 2YIQA 4O7WA 3TV6A 2FB8A 4LG4A 4YBJA 4KRCA 5M09A 2PWLA 4ZK5A 2XZSA 3R9RA 4DFLA 3DV3A 5AMNA 4O2PA 4C4JA 1OECA 3W2PA 4QTDA 3RM6A 5AP0A 5D10A 4DF3A 3E8CA 3LFCA 5TOZA 2F4JA 2I0VA 2G15A 3PSBA 4J98A 1H26A 1PKGA 4BZDA 3GC9A 3E7VA 2XRUA 2V55A 5E91A 3VS0A 3ZFYA 3NS9A 5CU6A 2BRGA 3MBLA 4ZS4A 3FQSA 1WFCA 3CQUA 3HECA 4I24A 4RX8A 2LAVA 3A4PA 4FSMA 1SVGA 5KZIA 5GZAA 2CCIA 2C5YA 4FKSA 3AGLA 4XH6A 3O51A 3UOHA 4BDAA 4XG8A 4FTKA 5T3QA 2B55A 3ATTA 3PA5A 4BIEA 1S9JA 4FSWA 2ZJWA 3OUKA 3QALE 5GJDA 3GCUA 2YITA 4FTIA 4G6LA 2CGXA 5AP5A 2I0HA 5CT7A 2VWIA 3CD3A 5AP2A 3WF9A 4FKJA 5HCYA 4AW2A 5JGBA 3F3VA 3A4OX 4QMOA 2WELA 5E92A 2ITOA 2VTAA 2BIYA 3K5VA 3LXNA 4K9YA 5EHOA 1YW2A 4IE9A 5AR8A 4WG4A 4N6ZA 4D9TA 5KKRB 2LGCA 3L9MA 3LFAA 4EUUA 2FSTX 3NYXA 4BY9E 5E90A 5I9ZA 3W18A 4DT9A 3COIA 5JKGA 4DG2E 4FKIA 4F7LA 4JBOA 2WAJA 3H9FA 5A9UA 3UIUA 3DBCA 4QP8A 3SV0A 3Q5IA 4CD0A 5EM8A 1UNLA 4MD7E 5C27A 4EC9A 4D2PA 3ORNA 4IWQA 5KE0A 4LV5A 1GZKA 2HCKA 2P2HA 3NNUA 4S32A 3MFRA 3KXXA 4IX6A 2JAVA 2Y6MA 4QP9A 3O50A 2OG8A 3L9LA 3MI9A 2P0CA 4X6QC 3EL8A 3DBEA 4I94A 4IANA 2CSNA 2ZV7A 1UWHA 5A6NA 4ACCA 3MPTA 3P79A 3PJ3A 4G5PA 3SA0A 1OBGA 4QTAA 1PY5A 2PL0A 3LOKA 2JGZA 3EFJA 3U55A 3ORLA 4FV3A 3BYSA 2UZEA 3FI2A 3O7LB 5CVGA 2CGVA 2QOOA 2FGIA 2Z7QA 5DG5A 4BR3A 4EOMA 2PMIA 1OMWA 5CS6A 2ZMDA 5H8GA 3F88A 4WO5A 4AZEA 4AGDA 4LGDA 4UB7A 3UQFA 4NUSA 1U4DA 2HYYA 1OKZA 2UZBA 3QTRA 3KCFA 4HCVA 4AT5A 2XYNA 2W1GA 2GQRA 3NIZA 3LMGA 2W1IA 4DAWA 2J0JA 3ZTXA 1ZXEA 2XH5A 3AD4A 4R1VA 4BL1A 4JX7A 5C01A 3U6IA 1PMEA 4F7SA 3A7GA 4FOCA 5HI2A 3U4WA 3F2RA 2R3IA 1FBNA 3HA6A 2H96A 1VJYA 3OW3A 2OK1A 1YXXA 4AX8A 4ZZOA 3V8SA 2JIUA 3TV7A 5CAOA 4TYEA 2X0GA 3TNWA 4AUAA 2R3PA 4MWIA 3RPSA 2H34A 3ENHA 4XMOA 5HQ0A 5F1ZA 2VTNA 3KKVA 4O91A 2ITVA
chains in the Genus database with same CATH superfamily
3LJ0A 2DQ7X 4PPCA 3KK8A 4AW1A 1J3HA 4RFMA 4TYHB 5DEWA 5DLSA 4AGWA 2XCKA 5A3XA 1OGUA 3SXRA 5BYLA 3PY3A 3ZHPC 3NYOA 3PJCA 4KBCA 4BC6A 2QODA 3BX5A 3HRBA 1BLXA 2B52A 4HPUE 4HCUA 3EN9A 2GNGA 3QRJA 3BHTA 1V0OA 3GU7A 2C5VA 2GNFA 3F9NA 3FMLA 4DFZE 2A27A 4RIYB 3DB8A 1JSUA 3Q96A 4FVPA 4I6BA 2PK9A 2X8DA 5AM7A 3D2IA 4BCOA 4O0UA 2FVDA 3E3PA 4D0WA 2C0OA 3AC8A 3NNXA 3O96A 2WOUA 4O7YA 4BJJA 2XAOA 2YM6A 1PJKA 3ZC5A 4LQMA 3ZO3A 5IA2A 1YDTE 2IZUA 2WEVA 3A7IA 3FXXA 3WE4A 4F0IA 3RINA 3WE8A 3Q4UA 2CLQA 5LMKC 2ITZA 3NW6A 3FMNA 3OG7A 3HP2A 3QKMA 4DFUA 2BHEA 4J1RA 3E7OA 4J8NA 5CQWA 2WGJA 3V6RA 1CTPE 2J51A 4OBQA 3TKHA 3VF9A 2X0OA 5ANKA 1YXUA 1ZY4A 2IWIA 2XJ1A 3THBA 5HKMA 2R3RA 1P2AA 4JVGA 4RWLA 4CG8A 4O27B 4C59A 4C4FA 2UW3A 3PPKA 2BR1A 4QYHA 2JBOA 3IW4A 3OTVA 2WPAA 4D5HA 2OU7A 2YM7A 3FYKX 4RIOA 3EZVA 4FTCA 4M0YA 3MPMA 1TVOA 1H07A 3EL7A 3C0IA 5DHJA 1IAHA 3FC2A 3LXKA 5CI7A 4ERWA 1H0VA 3R8MA 3DNDA 2IZSA 4YPDA 5M4CA 1ZWSA 1R1WA 4GFMA 5LARA 2GQSA 3ZBFA 3QD0A 3R01A 3KULA 4I92A 4L8MA 3V5QA 2W05A 3Q53A 3QTWA 4JIAA 4JJRA 4O4DA 4YUQA 2VTHA 3RAKA 4RJ7A 3WARA 1R3CA 4ZOGA 2PVHA 3NNWA 3L8XA 4U5JA 4PX6A 2VTPA 3LAUA 3QTIA 4V0GB 5KMIA 5IQGA 3FPMA 5EH0A 2Z2WA 3LCSA 4DG3E 1A9UA 4C61A 3P7AA 1ZOHA 1PYEA 3QGYA 1LP4A 5BYZA 1J7UA 4FV7A 3CP9A 4TNDA 5EQEA 2B54A 4S31A 3ZUTA 4BGHA 4ZY6A 4UY9A 5AIRA 1OPKA 2JFMA 1REJA 3C4ZA 2RG5A 2QO2A 4QYEA 4F7JA 1PKDA 3DDQA 3G6HA 4L52A 4JAJA 3OC1A 4XOYA 3NVMB 2WMUA 2WHBA 3GC8A 3VW8A 3UO5A 4NKAA 5BUIA 2WMVA 3UOLA 4NYEA 2ESMA 2C47A 5CVHA 2R7IA 1YHSA 4JG6A 2VWXA 2BTRA 1VYWA 3R1YA 4X2FA 4YMJA 1ZYJA 4EQMA 3D14A 3IW8A 4ARKA 1GAGA 3GC7A 3I60A 4YNEA 3QYWA 5IKWA 3UG1A 4LRMA 3R1NA 4AZTA 5I4NA 2ERZE 3P5KA 2VNWA 3UJGA 4DHIB 1CM8A 4FVQA 5AUZA 2Z60A 4M68A 3BV2A 3K2LA 2WIPA 1JLUE 3VBXA 4EQCA 3E8EA 4XBUA 4XOZA 3QUEA 4UWYA 4YJRA 3E64A 4DH5A 1ND4A 4IAYA 4G9CA 4DEGA 3UZRA 4TT7A 3FXWA 4U8ZA 4F7NA 4LRKA 2YWVA 5FQDC 5GIPE 2CDZA 2PE1A 4PDOA 3FKOA 2XK8A 3RWQA 3R9OA 3OT3A 5EM7A 5TR6A 3HV5A 1JQHA 4D2RA 2YIWA 3LQ3A 2B9FA 3DLZA 3R7EA 3VHEA 1M17A 4GG5A 4L67A 3SXFA 3JUHA 4NU1A 4XG6A 3T9TA 2BROA 3B2TA 3FBVA 2PE0A 2QOLA 1CSNA 4IC8A 3UG2A 3WZUA 5ETAA 4EK5A 3BYVA 3P7BA 4QRCA 5IQIA 4Y73A 4YGAA 1IRKA 4FTQA 5CYIA 5J8IA 3DK3A 5FEQA 4FKOA 4CGAA 3IGOA 3W2QA 4GIHA 3A62A 2X7FA 5TE0A 3RWPA 2CLXA 4X3FB 4J8MA 1H24A 3W2CA 2SRCA 2XP2A 4MD9E 1GZOA 3MVHA 3ML1A 4NM0A 2YDJA 1NVQA 3AD5A 4PL3A 4XNEA 1DI9A 5HVJA 5TT7A 4EBVA 5J7HA 1M52A 3O7LD 4O7LA 4EJ7A 3MV5A 4Z55A 4HW7A 5C8KA 3GU8A 3HRCA 2JEDA 3NGAA 4FL3A 4YU2A 3EFKA 3FI8A 2HXQA 3GQIA 4FKQA 4GUBA 4RIXB 3UYSA 4ENYA 3F82A 3U6HA 4GJ2A 4ZY5A 4EZ7A 3FLQA 3VUMA 3ACKA 2ZYBA 5LOHA 3E93A 3FY2A 5KMMA 2QOIA 1OVEA 3TIZA 4R3RA 5AX3A 2VTIA 3EQIA 1FINA 5EW9A 2BDWA 5EM5A 4RWJA 5IG1A 5JGAA 4QPMA 3PXQA 3DGKA 4C35A 4ASDA 5E8VA 3OXZA 4XV1A 3HNGA 3MA3A 4JAIA 2WEIA 5H3QA 5AWMA 3TZ9A 1JKTA 4BDEA 4O0XA 4YURA 3A61A 4XRJA 4FJVA 2OJIA 2R5TA 3WILA 4RBLA 3EQRA 3VHKA 3CR0A 3IDBA 5KX8A 2J5FA 2W1DA 3QWJA 2PHKA 3R22A 3CQWA 1OIYA 2C0IA 3VRZA 2XEYA 4PF4A 5HNGA 4OTRA 4ZJVA 4G1WA 3PLSA 2Z7RA 4HYUA 4B6LA 3LHJA 3RCJA 5ANJA 3A8WA 2UW4A 4HGSA 4NIFB 3BIZA 1XJDA 4GH2A 3SC1A 4HNFA 4K6ZA 1IA9A 4YSJA 5GHVA 3ID6C 3KVXA 2QONA 5EDQA 4TNBA 4MBJA 3I1AA 4B9DA 1ZRZA 2BKZA 2XNOA 2W4KA 1BI8A 2ZMCA 4FUYA 4FZ6A 4CYIA 3PY0A 3UPXA 4CT2A 4TL0A 3EQBA 4JDJA 4EH9A 3NLBA 1OUKA 2QQ7A 4FTOA 2PUNA 2YHVA 3I4BA 1G8SA 2R0IA 2WB8A 4G9RA 1PXIA 5HLPA 2C1BA 3PG3A 2VO0A 5EFQA 4BFMA 4JOAA 1VR2A 2Z7LA 2I40A 4L44A 3QUPA 4M8TA 4W9XA 3JVSA 1G8JA 4IEBA 3KF7A 4L3JA 4QYYA 5CXHA 4C4HA 3VS2A 4XLVA 3D7TB 2J4ZA 3OWKA 3MESA 4LL5A 4EWHA 3P4KA 5CZIA 2G9XA 4RC3A 2AQXA 1R39A 5IPJA 2JBPA 2BRBA 4FIIA 5CEMA 3G6GA 4G34A 3AQVA 3V5JA 4AFEA 3TM0A 3I6WA 5AAFA 3KY2A 3PVBA 1HOWA 1QPCA 3VUIA 2C6OA 3K3JA 3IOPA 3QCXA 1Q61A 4QNYA 4F0GA 3UQGA 5T68A 3QZGA 3W0MA 2C0TA 3K5UA 3MN3A 5ANIA 3MSSA 4AXFA 4DEIA 2ETMA 2VWUA 3PP1A 3TG1A 2C6DA 4U41A 2P3GX 4Z16A 5JEBA 3FHRA 2BFYA 4FR4A 4D2SA 4ORKA 3Q6WA 4WNMA 1Q8TA 2XNMA 4XV2A 2X7GA 4AACA 4F08A 3TKIA 3IS5A 4APPA 5I9YA 2PUIA 5HOAA 5DRDA 3MY1A 4P5ZA 2WIHA 2BZJA 1H01A 2XKCA 3GT8A 3NEWA 3TI1A 2WU7A 3R7UA 2J0LA 3QQUA 1J1BA 1WVYA 2WOTA 4F1OA 3NRMA 5IQHA 3C4WA 3EN7A 3QRTA 4QNAA 3QQJA 2GNIA 2YERA 3SXSA 4ZAUA 4AQKA 2OGVA 4JIKA 5FBNC 2C6LA 2RGPA 4FEXA 5JK3A 5LMBA 3QFVA 4DFYA 3G15A 3I5NA 4K1BA 4UN0C 1JOWB 4FZAB 4X2JA 3ROYA 3RTPA 2BAKA 3VRYA 3PJ2A 3ZO2A 4YBKA 2JIVA 5H2UA 4EYJA 4IX3A 4FTAA 4L46A 4YJTA 2J0IA 1KV1A 2RIOA 3RZBA 3M11A 3TMOA 5EQYA 1UU9A 1R0PA 2XEZA 3DBDA 3EQDA 3GC0A 4IM3A 3WF5A 3CXWA 3SX9A 1FMKA 2C68A 3PJ8A 3PE2A 4G6OA 5CAPA 2XF0A 4D5KA 3ZFXA 4KSQA 3PA4A 5AP6A 3UZPA 2BIKB 3R30A 3G9NA 3GUBA 2WTKB 3UDTA 3MS9A 4P90A 3FLYA 3KXZA 4AT3A 4ANMA 4QMYA 1ZYCA 1FVTA 4OTDA 5K5XA 3F6XA 4UXQA 2JKOA 4A4OA 3MWUA 2JKQA 3HX4A 4MXOA 3COHA 4RJ8A 4L43A 1I44A 2WQBA 4KIQA 5EHLA 1VZOA 5FBOA 5L6WL 5J7BA 1Q3DA 1G8AA 3FY0A 1Y6BA 2XBJA 2YCFA 3FZRA 2XIZA 1ZYSA 4YO6A 1PXMA 3WIGA 4BCQA 3PZEA 1PHKA 3QZFA 4EH6A 4FE2A 5CU4A 1MRUA 4F65A 3CEKA 4FG7A 4GU6A 4C2WA 4N57A 2X2MA 3A8XA 3UIBA 2E9PA 1YI6A 3MPAA 4BTMA 2R3OA 2RG6A 5GJFA 3B2WA 4CFWA 4QMMA 3MA6A 3COMA 5HO7A 2PZIA 2BUJA 1EH4A 2C3JA 2G1TA 1AGWA 1OL5A 2W99B 4Q9ZA 4FT5A 4YLJA 2F7ZE 3LFFA 4V0GA 4BTJA 4KA3A 5E1EA 2UZTA 4D4RA 3CE3A 3QC4A 4U45A 2BRHA 5I9UA 2QKRA 1GIJA 3MTLA 4BGGA 4FYNA 3QWKA 2VWWA 4BIDA 1W7HA 3O8UA 2OBJA 4YR8A 4MNEB 2XNPA 3NYVA 5ANGA 3DNEA 3DDPA 1U54B 3KFAA 4AF3A 2YM5A 4O7ZA 5I5ZA 1M2QA 4PP9A 4PY1A 4D9UA 3BV3A 3TDWA 4R1YA 1M7NA 5LMAA 4F99A 3LJ2A 4BBEA 5EYKA 4PWNA 3D5UA 3W2RA 4FT0A 4JS8A 4PDPA 5CANA 1E1VA 4O83A 4DA5A 2PVYA 4YLLA 5AV1A 5LVOA 5DYJA 4J97A 4O21A 2C4GA 3P0MA 5AM6A 4KB8A 4NFMA 5BVKA 3PUFC 3R63A 4L6QA 4WSYA 4QYGA 3ZH8A 3ZZEA 2XS0A 3GFEA 5CLPA 4C3RA 3UNKA 5C4KA 4JG7A 4U97A 4S34A 1ZAOA 5KMNA 4ERKA 4EK8A 1JKLA 3GXLA 4FSYA 5IU2A 4I3ZA 4M69B 4AAAA 3QD4A 3R6XA 3ZSIA 4A7CA 4RGJA 2I0EA 4IFGA 4X3FA 1Y8GA 3C1XA 1XH4A 3DK6A 4MXXA 5JRSA 3EOCA 4YTHA 3OD6X 4YHTA 3PWDA 2BZHB 2C6MA 3PA3A 2OJGA 3Q6UA 2VTMA 4G3EA 4I21A 4L68A 4D55A 3HA8A 4O0VA 1OBDA 4LRJA 4JG8A 5HBEA 2ZOQA 4O7NA 5ANEA 4FOBA 2GS6A 1W2FA 3AT2A 4I5PA 1KOAA 4G3FA 4YJVA 5CEQA 3ZDIA 4F9CA 4C4IA 1MUOA 3L9NA 4FZ7A 4IACA 4ZJIA 4YZDA 3HLLA 4M84A 3R9DA 3R71A 4IHPA 1FVRA 4E4NA 3OTUA 1OM1A 5DH3A 4PTGA 3FLSA 3DQWA 1DM2A 3O0GA 2Y0AA 4R7IA 3U9NA 4EK3A 4GK4A 3CIKA 1XH6A 4CYJA 3UOKA 4KWPA 5CT0A 3ZS5A 3SHEA 4F1MA 3ZXZA 3PRFA 1PF8A 4IADA 2WTKC 4FG9A 4F6UA 1XBCA 2P55A 4ZZMA 3BLQA 4XG3A 5CSVA 5A4LA 4DE4A 4AT4A 4YJPA 3IG7A 4IX4A 5HVKA 3DCVA 4DYMA 4YPSA 5EDRA 3QQKA 3LFBA 4KSPA 5BMMA 3LMHA 4LGGA 4W8EA 4LM5A 1GIIA 3VQUA 3LPBA 4IBMA 3R9NA 5A4EA 5FEEA 4AG8A 5BX0A 5CF6A 2FSMX 4TY1A 3ZFMA 3ALOA 3PXFA 3NYNA 4NJ3A 3PLAE 4FBXA 3DOGA 1URCA 3PXKA 3E8DA 4OTHA 4YNOA 3PVWA 3MGYA 1UNHA 1OZ1A 4C62A 1OKVA 4G3GA 3N9XA 2EXCX 1IASA 2PMNX 2ZDTA 4O0TA 3PFQA 5HG5A 1W98A 3KB7A 4RT7A 2YDIA 3FL5A 3LVPA 4Y46A 4YJNA 4I23A 1L3RE 2VRXA 3PXZA 4XHKB 2WD1A 3VS5A 2VD5A 1KE9A 4AE6A 3VBWA 2BRMA 1E1XA 3R21A 4JQ7A 3UNJA 3VJNA 1WZYA 2OF4A 4LUDA 3EB0A 4XUFA 3ZO1A 3ZRMA 4U6RA 1XWSA 3ZLSA 3AC2A 3DBQA 2WMXA 1QPEA 5A6OA 2RL5A 3PG1A 1OUYA 3DA6A 2RKUA 3UDBA 3F5GA 3FLWA 3R8VA 2RSVA 2ZDUA 3RK7A 3VIDA 2J9MA 3H3CA 3IPHA 2CNVA 3GOPA 4B8LA 2BDJA 1KWPA 3PUPA 4GW8A 2UW6A 3RK5A 2F57A 4E73A 1LEWA 3F3TA 3QQFA 2V22A 3ORIA 5M56A 3KULB 2F49A 3RBWA 2ERKA 2W4JA 4PNKA 5IA5A 3E5AA 3WF6A 3W2SA 3PY1A 4FTUA 4FL1A 3N4TA 3LQ8A 1XQZA 2Y7JA 2YISA 4MAOA 4FIFA 3PP0A 5EKOA 4A4LA 3EFWA 2QCSA 3V6SA 3W32A 1ERKA 4AU8A 2XKDA 4Z9LA 3GCVA 2H6DA 3OEZA 4CZTA 1U54A 2YABA 3CSVA 4CG9A 2JKMA 4FEUA 1W8CA 2YN8A 4RSSA 3IDCA 3V8TA 4AN3A 5JH6A 3B8RA 3KMMA 2BAQA 4CQEA 3L9PA 1W2DA 3QHRA 2JDRA 4ACDA 5CEOA 4IX5A 5HHWA 4D1ZA 2NPQA 3LFSA 3ET7A 4EOKA 3VUHA 2BKKA 4N4SA 5GJGA 3CBLA 4TWOA 2OLCA 3PFYA 3R7YA 1H27A 4LFIA 2A4LA 3QAME 2UW8A 3HV7A 3I7CA 1YI4A 3EN5A 4M69A 4M13A 1W82A 1WCCA 3TTIA 3U8WA 3QCQA 1H4LA 4PMMA 4RJ3A 3RAWA 1V1KA 4EOPA 3TUCA 1WBVA 4U9AA 3SW7A 1OKWA 4JDHA 3HYHA 4MH7A 3VWAA 3OBJA 1OL1A 5HORA 2PE2A 3PRIA 1ZZ2A 3QQLA 1ZZLA 3KIOC 2EU9A 4RA4A 2QHMA 4I4EA 4ZSGA 3FEGA 4H1JA 1F3MC 4YSMA 5LVNA 4R3PA 1AD5A 3P23A 4L7SA 4QMVA 4ZMFA 4RJ5A 4RIWB 4EH8A 3NUYA 5CASA 3NAXA 1YHVA 2WTVA 3LXPA 1JSVA 4P7EA 2R3HA 1WMKA 3DPKA 1OI9A 2QOKA 5HD7A 3QKLA 2E9NA 5JSMA 2VTJA 5EM6A 3RALA 5JGDA 5IQDA 3LCOA 3EKNA 4NKSA 4BI1A 4BTFA 4C3FA 4X3JA 4Q5EA 4UWCA 4AOTA 2Y4IC 4NT4A 4UBAA 1V0BA 3HMMA 3U51A 2R7BA 4QTEA 1FGKA 1F5QA 4ALWA 2XNGA 5AV4A 2YZAA 1JVPP 3LLAA 2NNWB 3BBTB 3T9IA 2C3IB 4ACHA 3KGAA 5ACBC 2ACXA 2QURA 5J5TA 2AUHA 2CCHA 2Q0BA 4BN1A 2R9SA 1YHWA 4O86A 4WIHA 3GI3A 1M2PA 1URWA 2X6EA 2QI8A 3U87A 4TYHA 2HW7A 3WF7A 3W0PA 3R0TA 4LMUA 4D1SA 3W0QA 2PZYA 4BBFA 5CSXA 1Y8YA 2ITPA 2C5OA 3FXZA 5F95A 4QMQA 3DZOA 4YC3A 4YO4A 3D5VA 4F0FA 1JNKA 4RLKA 3BCEA 2XK4A 1Q41A 3MIYA 2DS1A 3VBYA 4BKZA 2IG7A 3IO7A 5FTGA 2Z02A 3KRWA 4DINA 2PPQA 1ZYLA 3F5XA 4C36A 4J7BA 1R0EA 1IA8A 3R7OA 3C7QA 2HENA 4IW0A 3WZEA 3UDSA 3OROA 4FK3A 3Q9ZA 4OTPA 1QCFA 3OZ6A 1TQMA 1P14A 2RFNA 3P08A 4BWKA 3DKCA 4HZRA 3RZFA 3DK7A 4BI0A 5CEIA 3RHKA 4HYSA 3CKWA 1JSTA 4JI9A 4JX3A 5J9LA 5B2KA 2ITQA 4OLIA 4FZDB 3CTQA 4XV9A 3VAPA 4I6FA 4O1OA 3Q2MA 2VUWA 2OF2A 2ZV8A 3G2FA 5E8ZA 4DLIA 1LEZA 4KS8A 3QTZA 4FZFB 5EHYA 4DC2A 4E26A 5KO1A 4ASZA 2R3GA 1XBBA 3NW7A 3FKNA 5AR3A 3TV4A 4AZWA 4PPBA 2BHHA 2A0CX 2X81A 3D2KA 2HY0A 4EI4A 2R2PA 3LFNA 4UYNA 3NX8A 2OIBA 4XP3A 5HTIA 1FGIA 1LUFA 3T3UA 4ONAA 2OO8X 4ZXTA 3PXYA 3S2PA 1ZMVA 3IDPA 4ZIMA 4B8MA 4BIBA 5J95A 4KIKA 1Z9XA 3VS7A 3NCGA 3EQPA 5DT3A 4C33A 3KRLA 2F9GA 2WO6A 4KIPA 1L8TA 3O71A 1DS5A 3CY3A 3FMDA 2HWOA 3MY5A 3BPRA 5AV3A 5IQBA 4EHEA 3DBFA 4TPTA 3UC3A 5EQPA 4O82A 4RFYA 4PV0A 3SQQA 2J0KA 4K11A 4CEGA 5A54A 2QLUA 1Y91A 3U4UA 4KUJA 3ODYX 4NH1A 4TRLA 5EYDA 2X39A 4UYAA 5EW8A 2IW6A 3UNZA 2W06A 5IDPA 3FZSA 4I0RA 1CKPA 4CT1A 4WD5A 5IA0A 4PQNA 3UC4A 4IAIA 5AR7A 4R77A 2X6DA 5HU3A 4ACGA 2PVMA 3RI1A 4EH3A 2QOFA 2UVYA 1WAKA 4HOKA 3F5UA 4CZYB 5AUTA 5L8LA 1J91A 4TYIA 5FDPA 5TKDA 1FMOE 4A06A 3KU2A 3KXHA 2E2BA 2XVDA 3IOKA 4CRLA 3U54A 4FV1A 4ITHA 4KIKB 3PPJA 3FV8A 2YAAA 4J95A 2XIKA 2EXEA 5ANDA 3UIXA 4UALA 2UZLA 4D2VA 2ETKA 2V5QA 4QP2A 1SVHA 3QTUA 1H1WA 5IQAA 2PULA 3QQGA 4WG5A 4TN6A 3BU3A 1ZOGA 2ITNA 1Y57A 4BDGA 1APME 4CCBA 2UZWE 4LGHA 2XA4A 5DGZA 4GT3A 4IZYA 4L01A 2O8YA 2YACA 4DFBA 4S33A 1ZARA 4AFJA 4PNIA 1FPUA 3V5PA 1CKIA 4BWXA 1UNGA 2W5BA 5EOBA 2CNUA 2JDSA 3G33A 1OGYA 2YLEA 3EMGA 4JDIA 5E1SA 4NTTA 1NW1A 4CV8A 5BNJA 3ZUUA 5HGIA 3RVGA 4WBOA 3TL8A 3ZDUA 3L8VA 2R3NA 3RCDA 1YOLA 3DFCB 4KAOA 5IEVA 1ST0A 3GQLA 1U5RA 5HIBA 5HE2A 1JWHA 3LQ5A 3KK9A 3V04A 5IA4A 5J1WA 4QMWA 3SW4A 1PMUA 2GNHA 2X4FA 3SOAA 4EOLA 5CVFA 2HK5A 1DI8A 4L3LA 5C03A 4D4SA 5LWMA 2PVNA 4JR3A 5HX8A 4U0IA 3V5WA 4E93A 3HAMA 1O6LA 4G17A 1PXOA 2VTOA 4CNHA 1PYXA 2YIXA 3D9VA 4CMTA 4QP6A 4DEBA 3G0FA 5DT4A 4GUEA 2WMTA 3R2BA 1Q8WA 5IH6A 3AXWA 3QF9A 1I09A 3IONA 4CMOA 2O0UA 4AA5A 4PMTA 3RPYA 3S00A 2WKMA 4BICA 3CCNA 4WG3A 3ANQA 3KXMA 3TKUA 5CU0A 4V04A 1NY3A 3QCSA 2R3LA 2GHLA 2QG5A 3BZ3A 5K0KA 3FMHA 3VUGA 1UV5A 3LJ1A 5FM3A 3WZDA 3PIXA 4RIXA 4EHZA 4UZHA 5HIEA 4EH2A 4M66A 4IM2A 5AEPA 2VNYA 4Y72A 2O3PA 4JBPA 4ZTLA 4A9TA 1SYKA 2PMOX 4PL4A 5EI8A 2W5HA 4F6WA 1KE6A 4QEBA 5CSHA 3MJ2A 3KN5A 2A1AB 3HKOA 3Q4TA 1FOTA 2PTKA 4O0YA 3I0OA 4L00A 2OXYA 4YP8A 1IR3A 3EZRA 3IECA 3FE3A 4E3CA 3R04A 4R5YA 1YRPA 3FZ1A 4IWDA 5FDXA 2J90A 3ZEWA 3CGFA 3GOKA 4I93A 4TYJA 5AV2A 1WVWA 2NP8A 3BWJA 5HLWA 2GFSA 4WBBB 3O2MA 3FMMA 3GU4A 2CKEA 2XBAA 3TEIA 4U7ZA 2W96B 4I20A 2F7XE 2R64A 3KRXA 3O17A 5LQFA 4FTJA 2WQMA 4C02A 4CCUA 3LIJA 4QP1A 4XG7A 2UZNA 2BILB 1SZMA 3MFTA 2PVFA 3EH9A 1OIRA 5KMLA 3MVMA 5AUWA 3T8OA 2C6KA 4N0SA 3UBDA 3BELA 4IAKA 3UE4A 4C2VA 5EYMA 5EKNA 3AC4A 3NAYA 4F70A 3PWYA 5I9VA 2ZV2A 1XH7A 3C0HA 2HOGA 2VX3A 4XBRA 4GV1A 3QLGA 4DBNA 4FV2A 4OTQA 3M1SA 3DAKA 2XNEA 1RW8A 5BVWA 4DHFA 3H4JA 3HUCA 4YC6A 3PVGA 3NVKI 3S95A 4ZTQA 4DITA 2PUUA 2X9FA 3MB6A 3Q3BA 1PXNA 2BZKB 4GSBA 4AW0A 5CSPA 2Q83A 3A7HA 4BCKA 2UW9A 4AOIA 3AMYA 3RHXA 2ITTA 4UMUA 4OR5A 5HIDA 4USFA 5G6VA 3GVUA 4YC8A 2RFEA 4ZTSA 5C4LA 3FMJA 4EBWA 2YIRA 2WU6A 5K5NA 4MVFA 3EN6A 3TDVA 4QMXA 4EZ5A 3NMUF 2PZPA 4FSTA 5AAEA 4BYIA 1BYGA 4BCFA 4GEOA 4O0WA 3S4QA 3UGCA 4H58A 5M08A 3R7VA 4MWHA 2VGOA 2XKEA 4TTHB 3K54A 4OW8A 4X21A 4EL9A 3LMIA 3LZBA 2CHLA 4EH4A 5D9HA 4BDKA 4ZTRA 1TQPA 3DS6A 4EH5A 4C3PA 3BKBA 3V5TA 4RWKA 3PTGA 4PPAA 2UZUE 3DJ7A 4XCUA 4OBPA 3BBWA 4UXLA 4BDJA 4DH1A 3C5IA 1YVJA 2B4SB 2OI4X 3OT8A 4NFNA 2UZDA 4O38A 5LXMA 4YJSA 4U44A 4BTKA 5E8XA 4FV6A 4U81A 3V5LA 3TTJA 4U40A 3JY0A 5HBJA 5CU3A 5JN2A 4MD8E 2B7AA 5GINE 1UU7A 4WRGA 4PMPA 2BDFA 5HLNA 2Z8CA 2YLFA 3CJGA 3TNPC 5DWRA 2QO9A 1GOLA 4E6DA 2I6LA 2OICA 2W17A 4O7TA 3HP5A 3RPRA 5LVPA 5HG9A 4X2NA 2FA2A 5L3AA 3R8LA 3QU0A 2GQGA 4M12A 4WUNA 2OKRA 3DJ6A 3O5AA 2QOCA 3JXWA 3Q04A 4DGNA 4QMNA 2CKQA 5DFPA 2XK9A 1PXPA 4E4LA 5FLFA 4YHJA 3AMAA 4AP7A 1MQ4A 2EWAA 4PMSA 5E9EA 4O0SA 2WMBA 2W7XA 4IH8A 4KNBA 4BKYA 4HVHA 5J79A 1QL6A 1QMZA 4WKQA 5BVEA 4D4VA 2JFLA 3GB2A 2HAKA 4DTBA 3L8SA 5G1XA 4XG9A 5BVFA 1B39A 1Q24A 4I5MA 4KKGA 2CKOA 4BCPA 1JAMA 2OZAB 4FEVA 4II5A 5HG7A 4XEYA 5ETIA 5HEZA 4EOOA 3S1HA 4F9BA 1MP8A 4IVDA 4MX9A 4MBIA 5HG8A 5KKRC 2I0YA 2OWBA 3E3BX 3HVCA 5L2WA 5LVMA 3VQHA 4XYFA 2YJSA 5BUJA 4MNEA 3F2NA 1KE7A 3CS9A 4CFXA 4BDDA 2C5NA 1YDRE 4GKHA 3QTXA 3D5XA 2R0UA 3EHAA 4YJUA 5DR9A 2J2IB 3ITZA 1XH9A 1PMVA 1LPUA 1A48A 4ZSAA 4RRVA 3W16A 4WNOA 4ALVA 4RIYA 4X0MA 5CI6A 3S3IA 4C57A 4Y8DA 3F61A 2IO6A 4FT9A 4JXFA 1IG1A 4GVJA 2HZIA 3EFLA 2F2CB 4FSZA 5BVDA 1H1PA 5CXZA 2DUVA 4BCNA 3G90X 3OS3A 4F64A 5HNIX 4XX9A 3RM7A 2X8EA 3SVVA 3AOXA 3R00A 4BDFA 2PMLX 4CLJA 3IKAA 3BYMA 4FTTA 3DXNA 3F5PA 3IW5A 5AP4A 3D5WA 2OIDA 3PZHA 2YWPA 2A98A 2ONLA 1U5QA 1BUHA 3H9OA 2GMXA 4FV0A 5ICPA 4PTEA 4L9IA 4AXCA 3UIMA 4C4GA 4P4CA