4AA0A

P38alpha map kinase bound to cmpd 2
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
347
structure length
328
Chain Sequence
RPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords MITOGEN-ACTIVATED PROTEIN KINASE 14
publication title The Discovery of N-Cyclopropyl-4-Methyl-3-[6--(4-Methylpiperazin-1-Yl-4-Oxoquinazolin-3(4H)-Yl]Benzamide (Azd6703), a Clinical P38Alpha Map Kinase Inhibitor for the Treatment of Inflammatory Diseases
pubmed doi rcsb
source organism Homo sapiens
total genus 109
structure length 328
sequence length 347
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2011-11-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4aa0A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4aa0A01
2BPMA 5AM7A 3OWKA 3DAKA 3E92A 3U6HA 4Q5EA 4RLKA 1NVRA 4D9UA 3MI9A 4E26A 3QU0A 5HNIX 5DI1A 3HDMA 5FXRA 5CI7A 5ACBC 4AWIA 3I0QA 5C9CA 4F6SA 2R3IA 2VN9A 2CCHA 3KA0A 4FIIA 5FP6A 2JDRA 4IB0A 2YM6A 3RPYA 4F64A 4TYGA 3FMHA 1IAHA 3UP7A 1DAYA 2X9EA 4RFZA 5GHVA 2OI4X 4AX8A 2RL5A 4D4VA 3AC5A 4K9YA 4FK3A 5J87A 3VUDA 4CMUA 2UUEA 2B0QA 4UMUA 1WBOA 2WU6A 4O0VA 4RBLA 3UYTA 4DN5A 2R3LA 2YACA 4C3RA 4FC0A 2HW6A 5A4QA 2CGWA 2C0IA 5B2MA 5TF9A 5BUJA 1S9JA 5KE0A 4O7SA 4AACA 3VULA 3RAHA 4FI1A 4NSTA 2KULA 3RGFA 2JFMA 4A4LA 4DG3E 4H3PA 3WI6A 3P08A 4OBOA 5BYZA 1XR1A 3TZ9A 4DCEA 2W1CA 2BRMA 5GNKA 4ZJJA 2YCFA 4A9TA 2XKCA 4JDJA 4Z7GA 3GQLA 5J8IA 3LFAA 3GU4A 5IMEA 2W1EA 2X39A 4L3LA 4D58A 1WBNA 2Y8OA 2J0LA 1HCLA 4CYIA 4ONAA 3VS2A 1WCCA 2ITNA 2P2IA 5J5TA 5CY3A 3ALNA 5J9ZA 5FUTA 4FNWA 2OH0E 4CG9A 4GFOA 3ZSIA 3Q2JA 3C4WA 3QLGA 1B38A 2UZOA 2XMYA 5DHJA 3CTQA 4EQCA 2PZRA 3LCOA 3MPMA 4IC8A 4U3YA 5HIBA 2C5YA 2OFUA 2R3RA 4Q9SA 4F7SA 2XM9A 4JDIA 2YCQA 3ZFYA 2JKOA 3NX8A 5C4KA 5F94A 5E8ZA 2CMWA 2ZOQA 3AD5A 4ZEGA 5CWZA 3RAIA 3CPBA 3ORIA 5EHLA 3ANRA 3BGQA 1RW8A 4DFLA 3PY1A 4DGOA 4FBXA 4EH6A 4BDCA 4WUAA 3CD8A 5IEYA 4U40A 4XNEA 3R7OA 1NVSA 4ORKA 2OXXA 3TIYA 3VAPA 4FT3A 3ZDIA 4BCNA 3R7GA 4LI5A 3S2PA 2EXEA 4AFJA 2F7XE 5ETIA 4YZDA 3AG9A 2V0DA 2R7BA 2YIQA 2ZM1A 5C27A 4EOMA 5FDPA 2EUFB 1XQZA 4GK2A 2I6LA 5LCKA 3LLAA 2RFNA 2IG7A 3LFFA 2IVVA 1KE6A 1OKZA 4DFNA 1UU3A 5JFSA 2FA2A 3O8TA 5CEKA 3FYKX 2XJ0A 3R9OA 1UWHA 2WMSA 3VUKA 4OW8A 3O8PA 4MWHA 4Y95A 5CXZA 4C38A 4GIHA 1ZY4A 2R3HA 4IZ5A 4XUFA 3RAKA 3S00A 3FLQA 2G1TA 3DFAA 5AM6A 2UVXA 3SC1A 5KMLA 4ALVA 4DBNA 1OIYA 2P3GX 5ANIA 5AR8A 3UNZA 5T68A 5HBHA 1OIRA 4TL0A 3CSVA 3MYGA 3ZH8A 5HCZA 1MRUA 5AR2A 4BCFA 5LMBA 3B8QA 4EYJA 3F88A 2YWPA 4P5ZA 3HUBA 4C4EA 4RJ7A 4DH7A 3HP2A 4JIAA 1PMUA 3C5IA 3LOKA 3E63A 4LOOA 1OIQA 4HZSA 1PXIA 1YXUA 4CNHA 5CAOA 3P23A 4BHNA 4O7WA 4XG9A 4MXXA 2C68A 4BCMA 3JVRA 3O0GA 3PY0A 4IWOA 4DGNA 4J53A 1F3MC 1JWHA 2ACXA 3BYUA 2FVDA 4I5PA 3MS9A 2PZPA 4M3QA 5IA1A 3I7BA 2XNPA 3ORXA 4EOPA 2YLEA 4R8QA 4TWCA 5E8XA 3KQ7A 3NIZA 3Q32A 3COKA 4S33A 4YMJA 2R3FA 4WHZA 2R3GA 2UW6A 1WZYA 1FGKA 2WTIA 4FV5A 5D12A 2OJIA 3RNIA 3VIDA 3Q6UA 3SRVA 1WBSA 4U45A 3CLYA 2C30A 3VJNA 1H07A 4O0RA 2YIYA 4YJQA 2X81A 5AR7A 2XVDA 2ETMA 3KMWA 4YTHA 5AV0A 2O64A 5D41A 5LMKC 3QA8A 1IEPA 2P2HA 4K11A 1I09A 1KE9A 2HWOA 3TJCA 5KMJA 5A4CA 4GIIA 3W8QA 1WAKA 3VS3A 5HE2A 5AUUA 4KD1A 3LJ0A 1QCFA 4K18A 2NO3A 2XIZA 4LM5A 4UWBA 4UY9A 3SLSA 3QC9A 5CENA 3IPHA 3DK6A 4R5SA 4KNBA 5HZNA 2OBJA 4E4MA 2XZSA 3ACKA 3BHUA 3PJ2A 3TNWA 4NKAA 3CTHA 2PWLA 3HMPA 2EXCX 3OOMA 3FMNA 4FSNA 3SRVB 3EQBA 4FK6A 2X0GA 2WTDA 4Q5HA 5EOBA 3ROYA 4B9DA 4I21A 4RVKA 4O7LA 3PZHA 4FSTA 4TPTA 2BDWA 4UN0C 2W5AA 5IH4A 3CQUA 1J1BA 3KVXA 4UXLA 2RKUA 4MKCA 4MD7E 5K5XA 4DEAA 2I1MA 5CVFA 4OTFA 3QRIA 3DA6A 4QTEA 4NM7A 1KV2A 2AYPA 4CFUA 5CVGA 3ZZWA 3EQIA 3W2RA 4BCQA 5A6OA 4AGWA 2VWXA 4LFIA 2BIYA 4N70A 4O0TA 3JS2A 4XLIA 1Z5MA 4RC2A 5LOHA 4XBRA 5DEWA 5FQDC 3UOHA 3FC2A 4FGBA 4G9CA 4II5A 4FV8A 3UO6A 1SVEA 3HMNA 4AZSA 3CBLA 3RHXA 3C50A 4I22A 4IWDA 4O1PA 4F99A 3QQHA 2X4FA 3W2SA 1PXKA 4F65A 2B9FA 4E1ZA 3RMFA 3WE8A 2B55A 5HCYA 4CRSA 4EK8A 3MJ1A 5JGDA 4JBVA 4J98A 1LPUA 1QPEA 1Q41A 2WQBA 4IAIA 5AV3A 5EM8A 1V0BA 3UGCA 4DAWA 3JVSA 5CX9A 4XX9A 3QUPA 2WEVA 2J0IA 2IW8A 4NW6A 4FKRA 4F6WA 2QOIA 3DKGA 5CT0A 5JMSA 1URCA 4DLJA 5AFVA 1OITA 2PL0A 1B39A 1W98A 2VAGA 5HLNA 4D0XA 5CAUA 2GMXA 4XYFA 5HIEA 3LFCA 1AD5A 4RIYA 1CSNA 3ITZA 2Z7LA 1W82A 3Q3BA 4L7FA 4OTRA 4PTCA 2PUUA 3FQEA 2JIUA 2VO7A 3P1AA 4G34A 2VWIA 3LFSA 3PA4A 3GC7A 5CZHA 3TXOA 3UJGA 4A07A 4AZWA 3ZLSA 1M52A 1M2PA 2J0KA 5KHXA 4X3JA 2B54A 3LIJA 4BBMA 1GZOA 4ZTMA 4I20A 3PXZA 3D9VA 2OLCA 4XRJA 4ZS4A 2JAVA 2BFXA 4FV4A 4YZBA 5BNJA 4QMYA 4EOIA 2XKEA 3HYHA 2ESMA 4M84A 1ND4A 4WBOA 2YZLA 2B9IA 1O6YA 4DEDA 2A0CX 3MFSA 1XH5A 5K9IA 5HO6A 5M55A 3TKIA 4TYIA 4H05A 3VN9A 5AX3A 1NXKA 2C69A 3Q9YA 1PXJA 3F6XA 4JI9A 3DXPA 4JG6A 4MWIA 5M08A 4K2RA 3HV5A 5LXMA 5JKGA 4PX6A 2CN8A 4RQKA 4FKIA 3LJ2A 3I0OA 3DNEA 5AP0A 4C4HA 4RIYB 5EI8A 2WO6A 1WFCA 4RG0A 3PSBA 3V6RA 3ELJA 4IX4A 3GEQA 3BBWA 3ORPA 3C13A 3DAJA 4GSBA 4L43A 5CNOA 5CEMA 2XNMA 3Q60A 4EQUA 2VTIA 2WKMA 3OBGA 4KKHA 4DHFA 3E62A 4PNKA 1UU7A 4R3RA 4DTKA 2ITXA 3UPXA 5IQBA 2JIIA 1BLXA 2QG7A 5HVYA 3D83A 1PXMA 4O22A 1JBPE 3OS3A 4F1MA 4F7NA 3CEKA 3NNVA 5JGAA 4FYNA 2BILB 2VV9A 3C4FA 1YI3A 3I5ZA 2YCRA 4OTQA 5IQAA 3O96A 4NFNA 4LYNA 4UALA 4YURA 3P78A 5AA9A 5JH6A 2ZM4A 4JRNA 3LCKA 4PDYA 3N51A 4Z16A 1IASA 2WMWA 4BI2A 2VTMA 2XIXA 4BDDA 5CU0A 2W1FA 4OGRA 3RHKA 3ZBXA 2F7ZE 1YDRE 3OUKA 4L52A 2G15A 4QTAA 1BI8A 4PQNA 4PTGA 4DE4A 4MQ1A 4AP7A 1OKYA 2JD5A 4QOXA 5FM2A 5IKWA 4AAAA 4E6AA 4EBWA 4BCJA 4WBBB 5A9UA 4X2NA 4EHVA 3CGFA 4O0SA 1Q8ZA 2OGVA 3DGKA 4I24A 5CAVA 1OPKA 4EZ3A 4N0SA 5HKMA 4F0IA 1GIJA 3GOPA 4L45A 2EU9A 2XK6A 4ANNA 3RM7A 3NUAA 4U80A 3FMMA 4L01A 1GNGA 4USDA 3M1SA 2PE2A 4HPTE 1CMKE 1V0OA 2XBAA 5DMZA 3FXXA 4C7TA 3RNYA 4X3FA 3UG1A 5M06A 4EOQA 3R1NA 2CKOA 3ZRLA 1GZ8A 4D2VA 4I4EA 5DR9A 2VWWA 3AC2A 3EMGA 3Q4CA 4W9WA 3WYXA 1OZ1A 3Q6WA 1XKKA 4G3EA 4TXCA 3WZEA 5IQIA 3DOGA 4O0UA 4IM0A 1GZNA 4S2ZA 4JOAA 3DK3A 4MBIA 5J79A 4XG7A 2OWBA 2WFYA 2BTRA 3DBFA 3O8UA 5DH3A 4BTKA 3A62A 4KB8A 4V05A 4QP8A 4GYGA 4AN3A 4C34A 3TCPA 4BDKA 3IW7A 3F2NA 2J50A 3KCFA 5AR3A 3T3VA 4XLVA 3DDQA 4BKZA 4OTDA 5M53A 2C47A 4YPSA 4RJ8A 5FP5A 1H1SA 4NTTA 3TNIA 4FSWA 4EUTA 3HZTA 4PPBA 4GFMA 3PLSA 4DEIA 4A9YA 4BBEA 2R0IA 3BE2A 4QYHA 2QU5A 2YZAA 4K77A 2X8DA 2XYUA 4X3FB 1YDTE 3LFBA 3K3JA 4TWNA 1LR4A 3FUPA 3MJ2A 3KEXA 3U4WA 3NW5A 4E6DA 4F0FA 4HZRA 3VUGA 3Q2MA 4IANA 1YOJA 3FL5A 3MW1A 3QLFA 3WARA 2UV2A 4O86A 2Z7QA 4BDHA 2HY0A 2R2PA 4X0MA 5LVNA 4W4WA 3AC8A 3TG1A 2BTSA 1XWSA 4AFEA 2PVYA 2HWPA 3COHA 4YTIA 5FD2A 4ZK5A 4E5BA 4C57A 2CPKE 1OUYA 3NUSA 1BMKA 2XYNA 4EOSA 2R0UA 3VS6A 4YJVA 2W1GA 4C62A 4YLLA 4RJ6A 5DT0A 1BKXA 3GI3A 3O23A 4BCHA 2JITA 4KIKA 2WMUA 2J0MB 3HDNA 4GMYA 5M07A 2Z8CA 3RM6A 2E9UA 3HA6A 2QOKA 5FBNC 3BHYA 4PDSA 2BKZA 3T9TA 3K5UA 1R39A 5IQFA 5C1QB 5F95A 3F5UA 4M12A 2WTCA 4BICA 2BRGA 1H1QA 4HJOA 3LFDA 4YHTA 3BELA 5D11A 5LCJA 3WZKA 1W8CA 2EB3A 3QUDA 4A9RA 4K8AA 5A46A 2XCHA 2XRUA 4IVDA 3COMA 2HZNA 5CVHA 4DLIA 4GYIA 2GNGA 4YJTA 5K0KA 3ULIA 5AUXA 5HORA 5AP6A 1CKPA 1U5RA 2X9FA 5HTBA 3A4PA 5GIOE 3CQEA 2WMRA 2RFEA 3HECA 4XV9A 4RZVA 4TWPA 4IXPA 2QODA 2VWUA 3A60A 3F61A 5L6WL 5I4NA 3F2AA 3FAAA 1J7UA 3R1YA 4WOVA 5A3XA 2ZYBA 4KIQA 5C8MA 4D4SA 4E4NA 2BZJA 4F9AA 4KIKB 5M56A 3BZ3A 4EZ7A 3N9XA 4FV7A 3U9NA 5LWMA 3M2WA 3KMMA 3MDYA 4BDAA 1WBWA 2F57A 3HV6A 3PPKA 4O0YA 1YWRA 1J7LA 1H1PA 2GS7A 2UZEA 2XIRA 4HGLA 4I23A 4O96A 4OTWA 1E1VA 2A27A 3VBTA 2GFSA 3LFQA 5CU3A 4RRVA 4AA4A 4ASXA 3BE9A 5HBJA 4FZ7A 1E9HA 2WQNA 3NW7A 4NT4A 5JQ8A 3U6JA 1ZOHA 3T3UA 4DGLC 2UVZA 4UWYA 4M13A 4YSMA 3EQHA 1MQBA 3GXLA 4FUXA 4I0SA 1OPLA 3R8VA 1PXOA 3R01A 3C4EA 1ZYSA 3EN6A 4PF4A 2UZLA 4ZSLA 3CP9A 3QHWA 1WVXA 3MSSA 4BWKA 2GNHA 4CKJA 2P33A 4U9AA 4UX9A 5EI6A 1GJOA 2CGVA 3VQHA 5J1VA 4C61A 4XG3A 4CG8A 2XK4A 5AUWA 5I9VA 4C33A 3QTSA 5GJGA 4FOBA 4NWMA 4CFVA 4FNZA 4GKIA 4FKLA 4AGUA 3F66A 2PSQA 2XUUA 2BAQA 4MXAA 4YPDA 3ZFMA 4HYHA 3KXXA 4O91A 4QQ5A 3HX4A 3KRRA 1ZYCA 5CEQA 1TKIA 3CJFA 4O7VA 3KXMA 4AGDA 3V04A 1QMZA 1FVRA 2X7OA 5EG3A 5B2LA 2XNEA 2JKQA 4FV6A 4IFGA 4F4PA 3ORKA 3AGMA 3PWYA 3ZLXA 4YZNA 3Q53A 5AAGA 2BROA 1OVEA 3BIZA 2LGCA 2X2KA 5KMNA 5CI6A 3VHEA 2V55A 3QCQA 3W8LA 3CE3A 2A1AB 3DPKA 1XJDA 4ZSJA 2OZAA 2W96B 3DY7A 4ZLZA 3F5GA 2YM3A 2FSOX 3QQGA 1U59A 3GOKA 5B0XA 4JDKA 4UEUA 3EH9A 3JY9A 2QR8A 4BY9E 2FSTX 2J5FA 3LE6A 3ZUVA 3VVHA 4PRJA 1FMOE 2EXMA 5HE3A 4D1SA 2RGPA 4F7JA 3H3CA 4OT6A 4C3PA 5I3RA 3UOKA 4GKHA 3LKMA 3RPVA 4JL9A 3PRIA 1R0EA 4ANQA 4I0TA 5IPJA 3KU2A 3UNJA 3BLHA 2YEXA 3DLSA 1PXLA 4G16A 3OP5A 3CC6A 3POOA 2C6MA 5H8GA 4FTQA 2Y9QA 5CU2A 5AP7A 4AW1A 4W8DA 4CFWA 4N57A 3O71A 4QMQA 3EZRA 4QMNA 2GSFA 4JRVA 3AMAA 3NYVA 3RI1A 2BAJA 5I9YA 1OPJA 3IW4A 3EN5A 5F20A 5J9LA 2QU6A 2PUIA 3LZBA 3KB7A 4AA0A 2OZAB 4BFMA 4FMQA 2CNUA 5BVOA 2PVFA 4AN2A 1ZLTA 2IJMA 2R3PA 2YISA 3DAEA 3DBEA 3E8CA 3PP1A 1IG1A 2X2MA 4WO5A 4X2JA 5HHWA 3RWQA 3RWPA 4A4XA 2XK7A 2ZM3A 4YBJA 2IZSA 2V7OA 5M51A 3GENA 3D0EA 1FMKA 3ZLWA 1BL7A 4CVAA 1CKJA 1HCKA 2BMCA 4Z9LA 2OJGA 3KFAA 5E8SA 5AUTA 3FI8A 3OCGA 2I0VA 3EN7A 3QTIA 4IZ7A 2BAKA 2R64A 4BZOA 3CKXA 3OMVA 4B6LA 5ANOA 3QD3A 4FIHA 4FKQA 4IBMA 4WNKA 3PVGA 4DG2E 4FVPA 2JDVA 3UYSA 3FI3A 3PXFA 3A61A 3OXTA 4HCUA 1Z9XA 3FXWA 4GL9A 4EH8A 2YIWA 3OOGA 1WBTA 2C4GA 5HG9A 4YJPA 3KRJA 3PSDA 4ZOGA 3II5A 5AP2A 4PY1A 4RWJA 4L44A 1RQQA 5BMMA 2C3KA 2R3MA 2GNLA 4NCTA 3W10A 4DT9A 3QKLA 1QL6A 3D7TA 4BKYA 3LLTA 4NFMA 3L8PA 2OJJA 3DJ7A 4CRLA 3HV3A 2C6LA 4KBCA 3ZO1A 2W7XA 5BVFA 3DU8A 1H27A 2Y6OA 1YXXA 4GU9A 4QTBA 3ZHPC 4FTOA 3VC4A 4FIEA 4F70A 3D5XA 4AUAA 5KCVA 3IDPA 3NUPA 5A4TA 5EM5A 5AUZA 4CMTA 3H9FA 5EH0A 2VTQA 4ZSEA 3ZOSA 3LCDA 3QX4A 3R63A 4XV2A 4CQEA 4FODA 4FT7A 4ERKA 3JUHA 1PRYA 4F1OA 3PWDA 3H4JA 1XHAA 4NL0A 2W1IA 3SDJA 3PP0A 1ZARA 3BLQA 5HGIA 3GC8A 4HYSA 4G5JA 4CSVA 4RX7A 2NP8A 3FMEA 4YLJA 5H2UA 3UQFA 2GTMA 4RT7A 2XF0A 4TW9A 3FKLA 3I79A 3VBWA 2C3IB 3HRBA 3Q5ZA 3DDPA 4AA5A 3GNIB 2QOFA 4R6VA 2RF9A 2Y4PA 3R28A 4QMUA 3GU7A 3ZDUA 1WMKA 1W83A 5HBEA 4EI4A 4FTAA 3D7TB 4ITHA 2WMXA 2XB7A 5AP3A 4EOKA 4BRXA 2UZWE 4OTIA 3TUBA 4KRCA 4MXOA 3RCJA 4ANMA 2PVJA 3T9IA 4YU2A 3R2YA 3LMGA 2DS1A 3NAYA 1WBVA 4QD6A 3ALOA 5IQHA 4ZJIA 5KUPA 2V5QA 3NUXA 2EWAA 3HP5A 3FQHA 3F7ZA 3QCXA 2GQSA 3PJCA 4DF3A 2Z60A 4U44A 3G9NA 5LMAA 3FY2A 3IW8A 4L6QA 2VWBA 2DYLA 3Q9XA 3WF5A 3DJ5A 4HVHA 2QOBA 2VUWA 2QG5A 4GJ3A 4RFYA 4I6HA 1IR3A 1P4FA 4W4XA 5EI2A 2GHGA 4R1YA 5AR5A 1FOTA 4YJRA 4HVSA 3QHRA 4AGCA 1REKA 3AQVA 2GPHA 3VJOA 4RJ4A 3QTRA 3TDVA 3GT8A 2QONA 2XRWA 3DV3A 3PJ1A 5G1XA 4APCA 4OAUC 4D4RA 4FTIA 4FVRA 2B9HA 4ZZNA 3QUEA 2ZB1A 1UNLA 2QURA 3WF9A 4ERWA 3CR0A 3R1QA 4YUQA 3LQ3A 4FZFB 3TWJA 4S34A 3QFVA 1PYEA 2FB8A 2X7FA 5EDRA 4UMRA 4MQ2A 5DYJA 5CAPA 5EDPA 3JYAA 4Z55A 3BEAA 1MQ4A 1Y8GA 4FT0A 1DI9A 5FEEA 4EZ5A 2Q83A 2ITOA 1TQIA 3KXZA 3FZPA 4YNOA 2NPQA 4QMMA 3IO7A 4ZLOA 5IISA 4YTFA 1YKRA 2JFLA 4KKEA 3R2BA 5L8JA 3UOJA 5BVEA 1GIHA 2PULA 4MK0A 2J90A 3DB8A 5IH5A 2SRCA 4J8MA 4YZCA 3RBWA 4L3PA 5LVPA 3EFJA 3FHIA 4EH7A 3LM5A 3KL8A 3ZO4A 4RQVA 1R1WA 2PMOX 4BI0A 4IVBA 2R7IA 3KCKA 4IAKA 5I9WA 4UWCA 4BTFA 3F82A 3PJ8A 4OR5A 1DI8A 3R83A 3MVLA 4QNAA 4WIHA 3U9CA 1OL2A 1UVRA 5CAQA 3C7QA 3R0TA 3IGOA 5DT4A 4E7WA 1PYXA 2JGZA 1K9AA 1R0PA 4XG6A 3R6XA 3OWPA 4HNFA 4DEGA 3L1SA 1V1KA 4PDPA 2XA4A 1K2PA 4XJ0A 3GQIA 3CS9A 4E4LA 2PMIA 5A4LA 3ZTXA 1Q24A 1NVQA 5HX6A 4N4SA 2VU3A 2VWVA 5EQPA 4FL3A 3GB2A 1J1CA 5IQDA 4UV0A 3QTQA 3KXGA 5EDQA 2XS0A 5AIKA 4APPA 3MA6A 2OK1A 2X4ZA 3Q5IA 1SVHA 3AXWA 3MBLA 1PY5A 3MPTA 1JKKA 3OTVA 4JBOA 4G31A 4GG5A 3ZS5A 2C6IA 2FSMX 3NZ0A 4IDVA 4LRJA 3RK5A 5BX0A 3ZU7A 3WF8A 3K3IA 4BDFA 4D28A 2PY3A 3BX5A 1NA7A 3QL8A 2IW6A 2B52A 4GT5A 1FVVA 4L42A 3ZXTA 3SVVA 1GAGA 1SMHA 4FICA 4V0GA 4AE6A 1YWVA 3NNWA 5CEPA 3UO5A 4X2FA 5LVMA 3FY0A 2VD5A 3VUIA 1ZMWA 4G6NA 4AW2A 4O21A 3I60A 4NUSA 1H28A 1Q5KA 4QPMA 3QX2A 3S1HA 3W33A 3UZRA 5G6VA 3UIBA 2NRUA 3EYHA 5JZNA 4D1XA 3VS0A 4Z7HA 5CF5A 3UIMA 5KKRB 2OF4A 3NEWA 2VNWA 3VS4A 5IH6A 2OW3A 2WIHA 3FYJX 2I7QA 4JAIA 3RPSA 5HX8A 3HVCA 5AWMA 3TKHA 4E5AX 3LJ1A 1B6CB 3VUHA 2BDJA 1YOMA 3OT3A 4M7IA 3IDBA 3VBYA 3NYOA 4P2KA 1TVOA 3FI4A 4HGSA 3GCPA 3MIAA 3DQXA 4WA9A 3WIKA 1H1RA 2G01A 5HIDA 4W9XA 2EB2A 4XBUA 4J52A 3FMLA 2B7AA 4BDGA 4C37A 2R3OA 5GZ9A 4AW5A 3FL4A 4FTUA 5CALA 2VTOA 4V0GB 4FT9A 3E7OA 1X8BA 3LVPA 3TIZA 3V5JA 2XIKA 3O2MA 3F3UA 3VS1A 1O6KA 4FKTA 2J51A 4L68A 5E4HA 5TR6A 2PVLA 3MVMA 4YHFA 3WOWA 2ETRA 4ANSA 3QRKA 5KX8A 3BYSA 3F3TA 2VTJA 3AOXA 1Q99A 2YHVA 3EJ1A 2QCSA 3KK8A 4L9IA 5M4FA 3TDWA 5HICA 1U54A 2XCKA 3OWLA 2QC6A 5AJQA 1P4OA 1OL6A 3MPAA 4U42A 3B2TA 3Q9WA 5F1ZA 3R8MA 3VNTA 5IF1A 2YDKA 4XCUA 4BBFA 2BFYA 3C0GA 5IUGA 3DLZA 4YNEA 3ZO2A 2HAKA 4PMTA 2JLDA 4O1OA 4CFXA 3BKBA 4D2PA 3JR1A 4EL9A 5KMIA 4TT7A 4GK4A 5BYLA 4TN6A 5GJFA 1J91A 2OXYA 4FSRA 4RZWA 2QLUA 4PMPA 5CF4A 2YIXA 4XMOA 5AP5A 4FT5A 5I0BA 4UXQA 4DBXA 3PZEA 3QRTA 4FEVA 2W9FB 3HMIA 3PG3A 2XJ1A 3I5NA 4D4YA 2VO0A 3UIUA 4ZSAA 4R78A 4IJPA 2BR1A 5AAFA 3CQWA 4X2KA 2YERA 4AF3A 3PVWA 4EHZA 3FE3A 1NT2A 2QHNA 4K6ZA 4QMZA 4FEUA 5M4CA 5HNGA 3L9NA 1Q3WA 5D7VA 5EYDA 1U54B 3QAME 1UA2A 5AMNA 3WBLA 4E20A 1MP8A 4YO6A 4WUNA 4EUUA 3GGFA 3Q52A 3TEIA 5ITAA 3PYYA 4BZNA 1FPUA 4KKGA 3C51A 3ERKA 3G5DA 1DM2A 4IWQA 5HVKA 1FGIA 3OHTA 3SOCA 1ZMVA 5CF6A 4XHKB 2CKPA 2P4IA 2WU7A 3BV3A 4FTKA 4C3FA 5DA3A 2CNVA 3NIEA 4FVQA 3N4UA 1I44A 4ANOA 2JEDA 2XNOA 3PPJA 3UOLA 5FWKK 2VTPA 3QTZA 4HCVA 3ZSHA 2WTWA 4CZTA 3FWQA 4QP7A 2GCDA 4EOOA 3L8SA 3OUNB 5ANJA 3PJ3A 1FINA 3BPRA 3TT0A 4X3FC 3QD2B 4MXZA 3WF7A 4JR7A 3ID6C 5HVJA 2VGOA 3FZRA 4FTTA 2VTTA 3PPZA 4IB5A 4FV3A 3SKCA 4EKLA 3I81A 3RK9A 2RSVA 5LJJA 3OVVA 1P5EA 4FSQA 3Q4ZA 4P5QA 2BDFA 2Z7SA 5IA5A 3L9MA 3UVRA 3VF8A 3F69A 1OECA 2BHEA 3UBDA 3N4VA 4MEDA 4BDJA 1JSTA 1Q8YA 3FZTA 4TTHB 2YFXA 2B9JA 2GHMA 4TWOA 4BWXA 5L2TA 2CCIA 4MBLA 1O9UA 2HW7A 4MH7A 3HAMA 4U3ZA 2PVKA 4YBKA 3CIKA 3I6WA 4QTCA 1YXVA 4QMVA 3CXWA 3D14A 4RJ5A 4BI1A 4PPAA 5JFVA 3QZHA 5J5SA 2XNGA 4IX3A 4HNIA 5HCXA 3TTJA 3CY3A 4FTMA 4EONA 5C8KA 3MH0A 1H1WA 2CN5A 3S4QA 2E9PA 4KSPA 3EHAA 4ZTSA 4QPSA 2BVAA 5AUYA 2FUMA 5CYIA 4DITA 5IU2A 2QR7A 4P90A 3UIXA 4WNOA 3SV0A 3OBJA 3UP2A 4HVIA 5BMSA 1LEZA 4FUYA 5JRQA 2F9GA 2VX3A 3B2WA 4UBAA 1M2RA 3ORZA 4PWNA 2C5OA 1YHWA 1YHSA 3ZC6A 4PMMA 3ZSGA 4BL1A 3A4OX 3EN9A 2RFSA 5E90A 2W1ZA 3EKNA 4ZSGA 4I6QA 2XNBA 4RPVA 3RZBA 3D5UA 1ZOEA 2OO8X 4NK9A 4UYNA 5KHWA 3OCBA 5HQ0A 3ZUUA 2OKRA 4TZRA 2UVYA 3R71A 4CD0A 4NM5A 1ZZ2A 2B4SB 4GJ2A 2OZOA 3FZOA 4WSYA 2OIDA 3ACJA 4FIGA 1XH4A 4S30A 4IVAA 4F09A 2WOTA 1J7IA 2Z02A 3GU8A 2H8HA 4QP1A 1LEWA 3Q9ZA 3A7FA 4J96A 3NSZA 5FBOA 4FKOA 3PIZA 4BZDA 2ZV7A 5K0XA 4TRLA 2OSCA 2X2LA 5L2SA 4B7TA 3BLRA 3V8SA 4H3BA 4I4FA 1YDSE 3DZQA 2I0HA 3QXOA 4IW0A 1H26A 4QP4A 2Z2WA 1KV1A 1JSVA 2P55A 5E92A 4BWPA 4QYFA 3KF4A 4AG8A 4FG7A 5L2WA 5DNRA 2IPXA 3E3BX 3EL8A 3FLSA 2CKQA 2YWVA 3K54A 3R02A 4O6LA 5B2KA 3G33A 2C6EA 3D15A 4F1TA 1OIUA 4MCVA 4DH1A 4U43A 5BVDA 1U4DA 4TKSA 3A99A 4MHAA 3AD4A 3DJ6A 4EC9A 5AP4A 3HMOA 2ITZA 4PUZA 3NPCA 2WMVA 1ZWSA 4YC3A 2R3JA 5ACKA 1AGWA 3GCSA 4G6OA 3F9NA 5CLPA 4GH2A 4KINA 3GU5A 1XBAA 4O38A 4ZAUA 2UW8A 2OIQA 4W4YA 3F3WA 3ZO3A 2C3LA 4B8LA 1OUKA 2FGIA 2HZIA 3FBVA 3MY0A 5FTQA 1PMEA 4HVGA 5DBXA 5L4QA 5H8EA 4AU8A 3ORMA 4O6EA 4DTAA 2QNJA 4JQEA 2WAJA 3AGLA 3ORNA 3OD6X 4EOLA 5DIAA 4FIFA 2J9MA 4G17A 2IVUA 1ZYDA 4RIXA 5K5NA 4CKRA 2BCJA 3ZCLA 5JRSA 2XBJA 3HL7A 4Q2AA 2IZTA 4QYYA 1YQJA 4JG7A 2C6DA 4RIOA 4F6UA 3F2RA 2JC6A 3LAUA 4GU6A 3V5LA 2XP2A 3PXRA 1YW2A 3ZMMA 2UW5A 1H00A 2C1BA 4ENYA 3GCUA 1RE8A 5D7AA 5GINE 4MF0A 4CGAA 3ANQA 3DNDA 1Q8TA 4GCJA 3R8ZA 3FPMA 1IA8A 4LL0A 5EKOA 3ZLYA 3PVUA 4M69A 3WE4A 4ZJVA 3A7JA 5JK3A 2E2BA 2VZ6A 4RA5A 2VX0A 4PPCA 4CT2A 2GQRA 4AOIA 2HCKA 4IMYA 4H1MA 4OAVB 4FZDB 1RJBA 3PDTA 2UZTA 3FZSA 4IZYA 3VW6A 2J6MA 4IB3A 1SVGA 2Y7JA 4Y85A 3U51A 3LQ5A 3MV5A 4I3ZA 3FC1X 3LFNA 4IWPA 2YLFA 4RIXB 2H9VA 3DXQA 5DGZA 4OTHA 1NY3A 3C4XA 1BL6A 5JFXA 4CLJA 4X21A 3H10A 3MY1A 1OMWA 1VJYA 3V8WA 4DH8A 1QPDA 3RK7A 5AADA 4ZTNA 1GOLA 3QKKA 5HE0A 3W2QA 3ZEWA 3WF6A 2V62A 5CT7A 3V5TA 4YO4A 2YJRA 5DRBA 3AT3A 1Y57A 3A8XA 5HNBA 2RIOA 4ZY4A 4O7ZA 3NYXA 4LV8A 4ACMA 3FMDA 3UODA 3BQRA 4Y46A 2VNYA 3U6IA 4F0GA 4DH3A 5E8YA 4WG3A 4M69B 5EYCA 5KMKA 3AC3A 3V5PA 4R5YA 4CQGA 3IONA 5BYYA 5IQCA 3UZPA 4BGQA 2W17A 4O2PA 5JEBA 4FG8A 3QTWA 4BDEA 5LWNA 4RVTA 3VUTA 3KRLA 3OF0A 4KUJA 4PMSA 4FR4A 1YXSA 1EH4A 4MD9E 4EEVA 3LCTA 5M4UA 3P5KA 1IAJA 3TTIA 4BN1A 5DT3A 4MAOA 1OL5A 3CGOA 2C6KA 2JDTA 5HO8A 2BKKA 3U54A 3PG1A 3CJGA 1W7HA 3HA8A 4GUBA 4BB4A 3PA5A 4GW8A 4B4LA 3SGCA 3C4CA 2J0JA 4NJDA 3MN3A 3HAVA 2X6EA 1VEBA 3ZRKA 3UPZA 4JT3A 3ZM4A 5IQEA 5KMOA 3P0MA 1KSWA 3VRZA 3O50A 4LRKA 4UMQA 2C6OA 4BHZA 4DTBA 5J1WA 2WEIA 2PUNA 3CPCA 1Y8YA 1G3NA 2HY81 2W1HA 2JKKA 1KE7A 1SNUA 2C5NA 2CGUA 4GRBA 4YJNA 5HG5A 4C8BA 3NMUF 2CNQA 3GFEA 5CZIA 4JX7A 2EVAA 4X2GA 3OXZA 5ICPA 3TZMA 2ZAZA 2IZUA 3MVJA 3ZFXA 4PDOA 3E5AA 5HD7A 5I3OA 4GEOA 2PU8A 4ITJA 4YR8A 5A6NA 3VS7A 5I5ZA 1PXPA 3NLBA 4NTSA 1ZOGA 5IUIA 4O81A 4HYIA 3OG7A 4M66A 4HVDA 3R21A 2E9OA 3OCSA 2HZ4A 3OZ6A 4MYGA 3IOPA 4QP6A 3GU6A 2WGJA 4IZAA 2ITPA 3TZ8A 3NUYA 2GNIA 2V22A 4JNWA 4NCTC 3VBXA 4JXFA 4LUEA 5C26A 3PIYA 3FLNC 2ZV9A 2FSLX 2WXVA 3QZGA 3SOAA 4EWHA 5HTIA 4X6RA 4PP7A 5IZFA 4QMOA 2ONLA 4GG7A 5IDPA 4RA4A 4A9SA 5FGKA 3F5PA 2P0CA 4USFA 4DGMA 4GVJA 3GCQA 2PMLX 3O7LB 5EM7A 2IWIA 1L3RE 1PKGA 4LGDA 2IZRA 4JS8A 4NH1A 1ZYLA 5E8WA 4CV9A 4MVFA 4D2SA 5BQ0A 5I9XA 2IVTA 4CCBA 4R7BA 3D2KA 3RPOA 5I9UA 3WZJA 1JNKA 3R8PA 1PJKA 3E7VA 1P2AA 4QQCA 5LQFA 1UKIA 4CFFA 3S95A 4FF8A 5J7BA 4BCKA 1J3HA 4DFZE 4O7YA 3G2FA 2BZKB 2XKFA 4G3CA 2R9SA 4KA3A 4CV8A 4X7QA 3EQGA 3B8RA 2W9ZB 3NW6A 3EZVA 2A19B 1XH6A 2OICA 4XP0A 4J1RA 2XH5A 4R7HA 4U8ZA 1JLUE 3EFLA 3LHJA 2C6TA 2PK9A 2C5VA 4LOQA 1JAMA 3G51A 4RC4A 4HCTA 4DA5A 3QBNA 4EH9A 4ZMFA 4BCGA 1OL1A 3K2LA 4EKKA 5KO1A 5DR6A 1T45A 1UU8A 3SHEA 4A4OA 4FGRA 3ZBFA 2CJMA 4FYOA 4AZFA 3C1XA 3OROA 3VW8A 2PZYA 3R00A 1JSUA 2ZMCA 3NRMA 4YHJA 4S31A 3QCYA 1YWNA 2YIRA 1ZMUA 3FLYA 4QMTA 4DEEA 4DC2A 5F4NA 3CY2A 4NM3A 2UW3A 3EFWA 3DTWA 1DS5A 3PY3A 5FRIA 2OG8A 3DXNA 2BUJA 4IJ9A 5CSWA 1KUTA 1UV5A 3TV7A 4WRGA 3MFRA 4MNEA 4EORA 4L3JA 3ZYAA 4QQJA 2G2FA 2UW0A 3F3ZA 4FNYA 3KKVA 3G6GA 1DAWA 4HYUA 3IQ7A 4MTAA 5GJDA 3T8OA 4ZLYA 3AMBA 4JBQA 2C0OA 2DQ7X 3FSKA 4M68A 3ODYX 5A4EA 4MXCA 2W4JA 3BYVA 1H25A 4W8EA 4EJNA 3D5VA 4I94A 2VTNA 2PHKA 1H08A 1CKIA 3KULA 4XEYA 3TL8A 3TKUA 4UMPA 5BPYA 2ITWA 3OFMA 5IA2A 2ITYA 3CKWA 3THBA 2QD9A 4LV5A 1W84A 3M11A 5IDNA 4KIOA 3MB7A 3REPA 4BGHA 4GS6A 4JAJA 4ZY5A 1G8SA 2H34A 5AIRA 3NYNA 5AV2A 1TQMA 2VO3A 3MY5A 5FLFA 2F2CB 4I6BA 2QLQA 2XKDA 4M14A 5C03A 3EQDA 5L6PA 3BU3A 4QQTA 5D9HA 4ACDA 4ASEA 4G3FA 5K3YA 3QZIA 4WSQA 3IG7A 4BCOA 3R04A 2QOOA 5L3AA 5GIPE 4MNEB 1LP4A 3E87A 3TN8A 5K4IA 5CU6A 3I1AA 4FA2A 4JQ8A 4CT1A 3SX9A 2X1NA 4I1ZA 3GC0A 4D2WA 5CF8A 4EWQA 4DFBA 4XRLA 4YJOA 3VRYA 1Y6AA 3H0YA 5FEQA 3P9JA 2GHLA 4OLIA 4AXAA 3EOCA 3KULB 2WTKB 1OKWA 4NM0A 4FZ6A 4YGAA 3ATSA 4PV0A 5CANA 3DK7A 3ZC5A 2YAKA 4C0TA 1SNXA 2HIWA 2OIBA 4M8TA 4QMLA 4RX5A 3R9DA 2BZHB 1SYKA 3NGAA 2VWYA 4AS0A 1FVTA 5HE1A 5LARA 3QALE 3GFWA 3ZEPA 4AT4A 2ERKA 2A4LA 5LVOA 2YN8A 5AA8A 3FKNA 5KZIA 4C02A 3BYMA 2F49A 2PZ5A 3NR9A 5BVKA 2W05A 3C0HA 1OI9A 3DQWA 4FEXA 4I5MA 1S9IA 2PVRA 3O17A 4J71A 4ARKA 5GZ8A 3VHKA 1XH7A 5E1EA 3TNHA 3NDMA 1JPAA 3HNGA 5KKRC 2WMAA 5CQWA 4G1WA 4CTBA 2WMQA 3GCVA 4G2FA 4TNDA 2J2IB 3H30A 1YHVA 5K4JA 5IUHA 2F2UA 2O2UA 4XOZA 4C58A 4CZYB 1ZRZA 4BR3A 4F08A 2DUVA 4UB7A 3SXSA 2OJ9A 4FKPA 4BYIA 3IW6A 5DG5A 3GBZA 4O2ZA 4ZZOA 4E73A 2WOUA 4G3DA 5EYKA 2C1AA 4DFXE 3FEGA 4JIKA 3S0OA 1KWPA 4BC6A 3NNXA 4C4IA 1BI7A 2CLXA 3RJCA 4FSMA 4LGHA 1IA9A 1MUOA 2H96A 3MGYA 4ZTHA 1UU9A 1BX6A 1OBGA 5F9EA 3NVKI 2B1PA 4EHEA 3FSFA 2C5XA 4YC8A 3WILA 3PUPA 4U7ZA 5I9ZA 2Y4IB 2CKEA 3K5VA 3WIGA 2PE1A 5L8KA 3G6HA 3I6UA 1UNHA 1VR2A 2HELA 4OT5A 3R7UA 3A7IA 3V5WA 4D2RA 5CTPA 3R8LA 2QO9A 4HW7A 3G90X 5M44A 2W1DA 4RSSA 4AZVA 3H9RA 2JDOA 1YI6A 3OTUA 3HGKA 4G3GA 4ANBA 4EH2A 4FL1A 4G6LA 3LQ8A 4QPAA 3W2OA 4M67A 1GZKA 3OXIA 4MXYA 1W0XC 2OXDA 3TNQB 5HU9A 4GV1A 3SAYA 2BRNA 2PE0A 3CD3A 3IK3A 2RG5A 5ANEA 3DFCB 3RINA 1XH9A 5ANKA 1M7QA 3L9LA 2A2AA 3TUDA 5HO7A 4DYMA 4GVAA 3BU6A 3MB6A 1ZY5A 3NCGA 4FX3A 4IX5A 3VBQA 2WZJA 4GT4A 3VO3A 3BHHA 4D5KA 5L6OA 2W4KA 3FMJA 4XG2A 1P14A 5EW9A 4EH4A 4L67A 4PTEA 1L8TA 2ZB0A 4RMZA 3E3PA 2GTNA 4B8MA 2WQMA 3VWAA 4AE9A 5EW3A 4BIEA 3UC4A 5E1SA 4BTJA 2O8YA 4FKWA 4TYEA 4K33A 5IA4A 5CQUA 3R73A 2OH4A 3GP0A 2YDIA 3JXWA 3R7IA 4NZWB 3SW7A 4R3PA 3AC1A 2ITTA 3U8WA 3IW5A 4I92A 4HPUE 4EOJA 2G2IA 3GUBA 3U4UA 1V0PA 2ZMDA 4A7CA 5D10A 1Q8UA 1H8FA 3W32A 3TI1A 4EK4A 4D55A 4O7TA 2BRHA 3RVGA 5IA0A 4Y83A 3ULZA 3QF9A 3FQSA 1K3AA 3TUCA 2QQ7A 4NKSA 4J7BA 2O5KA 4P7EA 2PVMA 2HXQA 2WELA 4GT3A 2X8EA 1FQ1B 3R22A 3V8TA 1LUFA 3TV4A 5IQGA 2Q0BA 3HKOA 3P4KA 5IEVA 2I40A 4RC3A 4ANLA 1OM1A 2CGXA 3G0FA 5EOLA 1ZYJA 4JG8A 5AP1A 3RTPA 3I7CA 5DOSA 5CEIA 4KABA 4N6ZA 3KGAA 1CTPE 2ZJWA 5FTOA 1NW1A 4GUEA 1G8AA 4C4GA 3KMUA 3ZM9A 1Q62A 1ZXEA 2O63A 4GFGA 4G9RA 3KVWA 3R9HA 3TNPC 3Q96A 4DCAA 2Y0AA 4PL3A 4FSUA 4FTRA 1H4LA 4RWKA 2W0JA 3DKFA 1F5QA 4OTPA 4RWLA 4PL4A 2LAVA 4D5HA 4ACGA 2PTKA 3DCVA 4RFMA 5CU4A 5FXSA 4E93A 1FBNA 1Y91A 3BU5A 3NS9A 2ITUA 3W55A 5JZJA 3R9RA 4OTGA 3O51A 4EQMA 3E8EA 1GY3A 5FM3A 2WTVA 5FTGA 2C3JA 3SXFA 3TACA 3LXKA 4LGGA 4IX6A 1U46A 2YABA 4U81A 3FLZA 3QTUA 5DFPA 2CDZA 3D4QA 4RVLA 5H9BA 5JN2A 4C2VA 2PUPA 5LMKA 2YM8A 4U6RA 3OY3A 3ORTA 3P7BA 4WG4A 4ZY6A 3E64A 2GDOA 5JFWA 2VWZA 4Y5HA 3WZUA 3DBCA 3R30A 2ZV8A 5E8TA 4TY1A 5KBQA 1Q97A 5HOAA 4UMTA 3SG8A 4EYMA 3U87A 3LXNA 4C4JA 5H8BA 4ITIA 4JLCA 5E9EA 2UZUE 2IO6A 2ETKA 1F0QA 1PMNA 2JDSA 4UYAA 4YZMA 1JQHA 4X6QC 3EKKA 3R1SA 2B53A 4U0IA 5M4IA 2ZDTA 4XH6A 1ZAOA 5AAEA 5L8LA 2HENA 1R3CA 2R3KA 5BUEA 3VQUA 3ZONA 4MD8E 3TJDA 4F7LA 3F5XA 4IQ6A 3ATTA 3RP9A 1OB3A 5CSHA 2E9NA 1WBPA 3H0ZA 3PRFA 4ID7A 4IHPA 4G5PA 4JBPA 4RIWA 3LCSA 1H01A 4V01A 4WNPA 3NNUA 4JX3A 4LQMA 4KS8A 4MNFA 4FE2A 3BBTB 4U5JA 3MWUA 5TO8A 3W16A 4UZHA 4C59A 1HOWA 3HV4A 3OEZA 4JQ7A 1JVPP 4FL2A 3QYWA 2XIYA 2W5HA 2RFDA 2QKRA 5EFQA 3QTXA 1KOAA 2OU7A 3W2CA 1YXTA 4E6CA 2YA9A 3H9OA 4ZP5A 5DN3A 4F9WA 2ITVA 3V01A 3UMWA 4FTCA 4IM2A 4RJ3A 4IE9A 2CSNA 4L46A 1URWA 4PL5A 3UVQA 1H0VA 2GQGA 1M7NA 2HK5A 2WD1A 1M17A 2XJ2A 3PVBA 4FIJA 3R7YA 2W06A 1A9UA 4BF2A 1CDKA 4FKUA 4ZXTA 2VO6A 4ZTQA 2BZIB 3PE2A 5DPVA 4YJUA 3F3VA 2VRXA 5DE2A 3FKOA 3KN6A 1YI4A 3PSCA 4O0XA 4QT1A 2J7TA 5DLSA 3UDBA 4Z3VA 1SZMA 3QQFA 2YM5A 3BGZA 3QQKA 4LOPA 5E91A 3RCDA 4RLLA 5LVLA 5EHOA 3LPBA 1MRVA 4L8MA 4RIWB 2R3NA 2XK9A 2GS2A 1M2QA 4IACA 2GNJA 2WHBA 1XBBA 1XO2B 2BIKB 5HEZA 1STCE 4O7RA 3OWJA 3MESA 4JDHA 3SW4A 3G9LX 3OT8A 4XP3A 2QVSE 3VS5A 4O84A 3IOKA 3NUNA 1CM8A 2H6DA 2UZVA 3LMIA 4AW0A 4O83A 1OKVA 3CCNA 3DKOA 1KOBA 3EB0A 3QKMA 2WQEA 3QQJA 4O7NA 4FSZA 4AZTA 4NW5A 4BDBA 2BRBA 2QO2A 1T46A 3BHTA 4NIFA 5DVRA 3R8UA 4RVMA 4E6QA 3UNKA 3FPQA 3DBQA 4QMSA 4RX8A 4IM3A 3WYYA 3IGGA 4K0YA 4R77A 3PTGA 3G0EA 4NEUA 2DWBA 1PW2A 2G9XA 2OF2A 4E8AA 3BI6A 3QXPA 4KBAA 1OBDA 3S3IA 1APME 4FKSA 3HUCA 4LMUA 5C01A 4M97A 1KE8A 5KBRA 5T3QA 4L53A 4J97A 3CTJA 2GFCA 3P79A 3QGYA 5IMXA 4ALUA 5J95A 1OGUA 3A7GA 3DTCA 4B99A 4CYJA 4A06A 4USEA 1Q4LA 4PNIA 3V5QA 5AV4A 3POZA 3KY2A 2F7EE 4A9UA 1UNGA 5CXHA 5EW8A 3V3VA 3SG9A 3AD6A 5ANDA 4CKIA 5A54A 1ERKA 1H24A 2REIA 2YM7A 4XG4A 4KWPA 4ENXA 4P4CA 4FKGA 4QMXA 5L2QA 5KZ0A 4H58A 2XK8A 1IRKA 2ITQA 4BYJA 4H39A 2ZVAA 4QO9A 2JKMA 4C2WA 2E9VA 4U97A 5ETAA 2W99B 3HEGA 5EKNA 3OW4A 4CFMA 4NIFB 3BRBA 3AT2A 5D1JA 1VYWA 4KBKA 3EIDA 5CEOA 4LRMA 1PXNA 2CHLA 4LMNA 4I6FA 3VUMA 4AOTA 4XP2A 3ET7A 4LG4A 3RALA 3R9NA 5AX9A 4W4VA 2HOGA 3BHVA 4FV2A 4WNMA 5IG1A 3MIYA 4L00A 2AC5A 1UKHA 2NRYA 2QHMA 5DRDA 3C9WA 4M0ZA 4OBQA 3LMHA 3TM0A 3EWHA 1Q61A 5KNJA 2AUHA 3MTLA 5IA3A 3MVHA 4DEBA 2HYYA 4ZTLA 2NNWB 1BYGA 3BWFA 3RPRA 4F9CA 2AC3A 3D94A 4HGEA 3EL7A 4D2TA 3EQCA 3UQCA 5FEDA 3V51A 3D5WA 2RG6A 1BUHA 3MTFA 3QD0A 4KIPA 5EK7A 3VF9A 3E8DA 3UG2A 1O6LA 3DKCA 4NJ3A 3UE4A 4I41A 4FTLA 5TOZA 2WIPA 5HG8A 2PMNX 3OEFX 3Q4UA 3ZRMA 5AV1A 1OL7A 2BHHA 3DB6A 3IKAA 4FV1A 4EK5A 1PMVA 3O7LD 5TKDA 2XK3A 4ZS0A 3P7CA 1PF8A 3ENHA 4AT5A 2VTAA 2I0EA 3EQFA 3QC4A 3UVPA 3BWJA 4ACCA 2OFVA 4CLIA 1YOLA 2VTRA 5L2IA 2XEYA 4YJSA 4YZ9A 5C8NA 5HLWA 4IADA 3W18A 4F9BA 1VYZA 4UZDA 3HMMA 3PE1A 3KC3A 3PIXA 3QYZA 5CSXA 3JPVA 1RDQE 3R7EA 3UO4A 3ZUTA 3HRCA 1Q8WA 3ZXZA 4QP2A 2YJSA 1SM2A 4YP8A 3EYGA 4WG5A 3KRXA 3AT4A 3EQPA 3EQRA 3MFUA 3QA0A 4C36A 4C4FA 4AOJA 5CASA 4QRCA 3WZDA 3OY1A 3PLAE 5A14A 4U41A 3QRJA 5JSMA 4I0RA 4IAZA 4BGGA 2VGPA 4BDIA 4Y5QA 3DT1A 5DWRA 1Y6BA 4FG9A 3ENMA 4I5CA 4R1VA 2J5EA 4DH5A 4CXAA 4EH5A 3PXQA 2V7AA 4FV0A 2VTSA 3A7HA 3EFKA 2X8IA 4IAAA 4KS7A 4RWIA 4TNBA 3FXZA 3COIA 4YSJA 3VBVA 4D0WA 2PYWA 1UWJA 4CCUA 1PKDA 5H3QA 4BTMA 4DFUA 2UZDA 5AR4A 1KE5A 2WMBA 4AZEA 4IAFA 5JQ5A 3PFQA 2UZBA 1ATPE 1VZOA 5IEXA 2IN6A 5HI2A 3HV7A 4FEWA 3NWWA 3KREA 4ZZMA 4AQCA 4N6YA 4BIDA 4ZMEA 2QOCA 4MBJA 3D2IA 4PP9A 4XS2A 1REJA 3IS5A 4R7IA 4L7SA 3KXNA 3ETAA 4FKVA 4NU1A 4AT3A 4DG0E 2WMTA 4WT6A 2O3PA 3G15A 2UW9A 5HLPA 4BKJA 2WQOA 4ZTRA 3L9PA 2WNTA 3SA0A 5M57A 1XBCA 4BCIA 2QO7A 2WTJA 3PXYA 5FDXA 3C0IA 4XV1A 4HGTA 2R5TA 5DR2A 2QI8A 3UQGA 3KXHA 4ASDA 2HZ0A 1GIIA 1A06A 3BV2A 2XM8A 4QMPA 1WVYA 2R4BA 2ONLC 4BIBA 4QYGA 3BEGA 2I0YA 3EN4A 4FOCA 4IAYA 4DINA 4ALWA 2WPAA 1A48A 3E93A 4FV9A 4FZAB 1ZZLA 2IVSA 3PXKA 2BALA 3QWKA 4IDTA 5HG7A 4EC8A 2JIVA 2ERZE 4EK6A 4WKQA 2XNNA 5BVNA 3RAWA 2VTLA 4FEQA 4DFYA 4OBPA 3OC1A 3GVUA 3A2CA 4JR3A 4LL5A 3DZOA 3E88A 2GNFA 3FZ1A 5FXQA 1TQPA 2YCSA 3UTOA 3BGPA 4XG8A 3DBDA 4M15A 3FMKA 4TYHA 3RZFA 4E4XA 4EHGA 5ANGA 3R7VA 5CS6A 2JBPA 3D7ZA 3NCZA 3BQCA 3KK9A 3SXRA 2W5BA 4FKJA 4QYEA 3FHRA 5CNNA 2FH9A 3Q04A 2Q0NA 1QPCA 3NAXA 3RKBA 4MF1A 3MFTA 5ETCA 4JJRA 1MRYA 3TV6A 5HESA 4H1JA 5E7RA 3QRUA 4EJ7A 2Y6MA 2CLQA 2YITA 2C0TA 5JGBA 3I4BA 2W4OA 1E1XA 4CFNA 5EYMA 1QPJA 3IDCA 3FLWA 3ORLA 4FTJA 4XV3A 5CSPA 5EQEA 4F63A 4IC7A 2VTHA 2GS6A 4RX9A 4E5WA 5KMMA 3HLLA 5EHYA 4ZIMA 2PVHA 4XOYA 2UZNA 3ZZEA 2WB8A 5GZAA 4Q9ZA 2HXLA 3QZFA 4QNYA 1JKTA 1XH8A 2OJFE 3QD4A 4IFCA 4YLKA 5JT2A 3KRWA 4MX9A 4TYHB 2JAMA 3QWJA 4Y73A 3UC3A 4ASZA 1PHKA 2R3QA 4FSYA 5HD4A 5M09A 4H3QA 4RGJA 4JVGA 4KSQA 4IH8A 4EH3A 2O65A 3C5UA 2X7GA 2GU8A 3L8XA 3AMYA 3SQQA 4TYJA 2YM4A 3BYOA 3L8VA 5J7HA 3GC9A 3ODZX 4KRDA 4B0GA 2WTKC 5BUIA 2YDJA 2XEZA 4O0WA 4WRSA 5CSVA 1YRPA 2QOHA 3TZ7A 4J95A 4QP9A 4BCPA 4I5HA 4BVUA 3FI2A 2KTYA 5B7VA 1JKLA 3W1FA 3UZTA 3NUUA 3Q4TA 4NYEA 2YAAA 3LW0A 4HOKA 3LFEA 3V6SA 4IVCA 4D1ZA 5AEPA 5ETFA 3W2PA 2F4JA 2PZIA 3QGWA 3SD0A 4GK3A 3MA3A 4J8NA 4LUDA 4O82A 4DT8A 4M0YA 5BVWA 2QOQA 4DEHA 2ZV2A 3JY0A 5DEYA 5E8VA 5EQYA 3FV8A 3A8WA 1R78A 2JBOA 3HRFA 3QQLA 3OCTA 4Y8DA 2O0UA 1H0WA 4C35A 1JOWB 2J4ZA 4FTNA 4AN9A 3AC4A 1AQ1A 4YC6A 4H36A 3U55A 4CMOA 3C4ZA 3MH3A 3KN5A 3MH1A 3M42A 3NVMB 2UW4A 3P86A 5T6KA 2X6DA 3OW3A 3PA3A 2Z7RA 3ROCA 2FYSA 3FJQE 4IIRA 4KAOA 2VX1A 4I93A 2PVNA 4V04A 4OUCA 1G5SA 4S32A 5EM6A 3DS6A 3LXLA 5AUVA 4QMWA 5FG8A 2QOLA 3QCSA 3BCEA 5C4LA 3MH2A 4U79A 4WD5A 2G2HA 4QP3A 4QTDA 2QKWB 5J9YA 4DGGA 5TE0A 4O27B 4EK3A 1M14A 3F7WA 2UW7A 4EBVA 3P7AA 3N4TA 4J99A 1WVWA 4CTCA 3LXPA 4Y72A 4FNXA 2PPQA 2ZDUA 3QQUA 5E8UA 2IW9A 4YTCA 4F9YA 3KF7A 5HU3A 2Y4IC 4E3CA 4K1BA 4R3CA 5HTCA 1U5QA 1JKSA 4IB1A 3IECA 1Q3DA 5TT7A 3UMXA 4D9TA 1YVJA 3FDNA 2FO0A 1Z57A 4IEBA 4ACHA 3LM0A 4CEGA 4CZUA 3E8NA
chains in the Genus database with same CATH superfamily
2BPMA 5AM7A 3OWKA 3DAKA 3E92A 3U6HA 4Q5EA 4RLKA 1NVRA 3AKLA 4D9UA 3MI9A 4E26A 3QU0A 5HNIX 5DI1A 3HDMA 5FXRA 5CI7A 5ACBC 4AWIA 3I0QA 5C9CA 4F6SA 2R3IA 2VN9A 2CCHA 3KA0A 4FIIA 5FP6A 2JDRA 4IB0A 2YM6A 3RPYA 4F64A 4TYGA 3FMHA 1IAHA 3UP7A 1DAYA 2X9EA 4RFZA 5GHVA 2OI4X 4AX8A 2RL5A 4D4VA 3AC5A 4K9YA 4FK3A 5J87A 3VUDA 4CMUA 2UUEA 2B0QA 4UMUA 1WBOA 2WU6A 4O0VA 4RBLA 3UYTA 4DN5A 2R3LA 2YACA 4C3RA 4FC0A 2HW6A 5A4QA 2CGWA 2C0IA 5B2MA 5TF9A 5BUJA 1S9JA 5KE0A 4O7SA 4AACA 4F78A 3VULA 3RAHA 3W0QA 4FI1A 4NSTA 2KULA 3RGFA 2JFMA 4A4LA 4DG3E 4H3PA 3WI6A 3P08A 4OBOA 5BYZA 1XR1A 3TZ9A 4DCEA 2W1CA 2BRMA 5GNKA 4ZJJA 2YCFA 4A9TA 2XKCA 4JDJA 4Z7GA 3GQLA 5J8IA 3LFAA 3GU4A 5IMEA 2W1EA 2X39A 1TFFA 4L3LA 4D58A 1WBNA 2Y8OA 2J0LA 1HCLA 4CYIA 4ONAA 3VS2A 1WCCA 2ITNA 2P2IA 5J5TA 5CY3A 3ALNA 5J9ZA 5FUTA 4FNWA 2OH0E 4CG9A 4GFOA 3ZSIA 3Q2JA 3C4WA 3QLGA 1B38A 2UZOA 2XMYA 5DHJA 3CTQA 4EQCA 2PZRA 3LCOA 3MPMA 4IC8A 4U3YA 5HIBA 3BLAA 2C5YA 2OFUA 2R3RA 4Q9SA 4F7SA 2XM9A 4JDIA 2YCQA 3ZFYA 2JKOA 3NX8A 5C4KA 5F94A 5E8ZA 2CMWA 2ZOQA 3AD5A 4ZEGA 5CWZA 3RAIA 3CPBA 3ORIA 5EHLA 3ANRA 3BGQA 1RW8A 4DFLA 3PY1A 4DGOA 4FBXA 4EH6A 4BDCA 4WUAA 3CD8A 5IEYA 4U40A 4XNEA 3R7OA 1NVSA 4ORKA 3PFYA 2OXXA 3TIYA 3VAPA 4FT3A 3ZDIA 4BCNA 3R7GA 4LI5A 3S2PA 2EXEA 4AFJA 2F7XE 5ETIA 4YZDA 3AG9A 2V0DA 2R7BA 2YIQA 2ZM1A 5C27A 4EOMA 5FDPA 2EUFB 1XQZA 4GK2A 2I6LA 5LCKA 3LLAA 2RFNA 2IG7A 3LFFA 2IVVA 1KE6A 1OKZA 4DFNA 1UU3A 5JFSA 2FA2A 3O8TA 5CEKA 3FYKX 2XJ0A 3R9OA 1UWHA 2WMSA 3VUKA 4OW8A 3O8PA 4MWHA 4Y95A 5CXZA 4C38A 4GIHA 1ZY4A 2R3HA 4QDVA 4IZ5A 4XUFA 3RAKA 3S00A 3W0PA 3FLQA 2G1TA 3DFAA 5AM6A 2UVXA 3SC1A 5KMLA 4ALVA 4DBNA 1OIYA 2P3GX 5ANIA 5AR8A 3UNZA 5T68A 5HBHA 1OIRA 4TL0A 3CSVA 3MYGA 3ZH8A 5HCZA 1MRUA 5AR2A 4BCFA 5LMBA 3B8QA 4EYJA 3F88A 2YWPA 4P5ZA 3HUBA 4C4EA 4RJ7A 4DH7A 3HP2A 4JIAA 1PMUA 3C5IA 3LOKA 3E63A 4LOOA 1OIQA 4HZSA 1PXIA 1YXUA 4CNHA 5CAOA 3P23A 4BHNA 4O7WA 4XG9A 4MXXA 2C68A 4BCMA 3JVRA 3O0GA 3PY0A 4IWOA 4DGNA 4J53A 1F3MC 1JWHA 2ACXA 3BYUA 2FVDA 4I5PA 3MS9A 2PZPA 4M3QA 5IA1A 3I7BA 2XNPA 3ORXA 4EOPA 2YLEA 4R8QA 4TWCA 5E8XA 3W0NA 3KQ7A 3NIZA 3Q32A 3COKA 4S33A 4YMJA 2R3FA 4WHZA 2R3GA 2UW6A 1WZYA 1FGKA 2WTIA 4FV5A 5D12A 2OJIA 3RNIA 3VIDA 3Q6UA 3SRVA 1WBSA 4U45A 3CLYA 2C30A 3VJNA 1H07A 4O0RA 2YIYA 4YJQA 2X81A 5AR7A 2XVDA 2ETMA 3KMWA 4YTHA 5AV0A 2O64A 5D41A 5LMKC 3QA8A 1IEPA 2P2HA 4K11A 1I09A 1KE9A 2HWOA 3TJCA 5KMJA 5A4CA 4GIIA 3W8QA 1WAKA 3VS3A 5HE2A 5AUUA 4KD1A 3LJ0A 1QCFA 4K18A 2NO3A 2XIZA 4LM5A 4UWBA 4UY9A 3SLSA 3QC9A 5CENA 3IPHA 3DK6A 4R5SA 4KNBA 5HZNA 2OBJA 4E4MA 2XZSA 3ACKA 3BHUA 3PJ2A 3TNWA 4NKAA 3CTHA 2PWLA 3HMPA 2EXCX 3OOMA 3FMNA 4FSNA 3SRVB 3EQBA 4FK6A 2X0GA 2WTDA 4Q5HA 5EOBA 3ROYA 4B9DA 4I21A 4RVKA 4O7LA 3PZHA 4FSTA 4TPTA 2BDWA 4UN0C 2W5AA 3AKKA 5IH4A 3CQUA 1J1BA 3KVXA 4UXLA 2RKUA 4MKCA 4MD7E 5K5XA 4DEAA 2I1MA 5CVFA 4OTFA 3QRIA 3DA6A 4QTEA 4NM7A 1KV2A 2AYPA 4CFUA 5CVGA 3ZZWA 3EQIA 3W2RA 4BCQA 5A6OA 4AGWA 2VWXA 4LFIA 2BIYA 4N70A 4O0TA 3JS2A 4XLIA 1Z5MA 4RC2A 5LOHA 4XBRA 5DEWA 5FQDC 3UOHA 3FC2A 4FGBA 4G9CA 4II5A 4FV8A 3UO6A 1SVEA 3HMNA 4AZSA 3CBLA 3RHXA 3C50A 4I22A 4IWDA 4O1PA 4F99A 3QQHA 2X4FA 3W2SA 3NFFB 1PXKA 4F65A 2B9FA 4E1ZA 3RMFA 3WE8A 2B55A 5HCYA 4CRSA 4EK8A 3MJ1A 5JGDA 4JBVA 4J98A 1LPUA 1QPEA 1Q41A 2WQBA 4IAIA 5AV3A 5EM8A 1V0BA 3UGCA 4DAWA 3JVSA 5CX9A 4XX9A 3QUPA 2WEVA 2J0IA 2IW8A 4NW6A 4FKRA 4F6WA 2QOIA 3DKGA 5CT0A 5JMSA 1URCA 4DLJA 5AFVA 1OITA 2PL0A 1B39A 1W98A 2VAGA 5HLNA 4D0XA 5CAUA 2GMXA 4XYFA 5HIEA 3LFCA 1AD5A 4RIYA 1CSNA 4DHIB 3ITZA 2Z7LA 1W82A 3Q3BA 4L7FA 4OTRA 4PTCA 2PUUA 3FQEA 2JIUA 2VO7A 3P1AA 4G34A 2VWIA 3LFSA 3PA4A 3GC7A 5CZHA 3TXOA 3UJGA 4A07A 4AZWA 3ZLSA 1M52A 1M2PA 2J0KA 5KHXA 4X3JA 2B54A 3LIJA 4BBMA 1GZOA 4ZTMA 4I20A 3PXZA 3D9VA 2OLCA 4XRJA 4ZS4A 2JAVA 2BFXA 4FV4A 4YZBA 5BNJA 4QMYA 4EOIA 2XKEA 3HYHA 2ESMA 4M84A 1ND4A 4WBOA 2YZLA 2B9IA 1O6YA 4DEDA 4AXEA 2A0CX 3MFSA 1XH5A 5K9IA 5HO6A 5M55A 3TKIA 4TYIA 4H05A 3VN9A 5AX3A 1NXKA 2C69A 3Q9YA 1PXJA 3F6XA 4JI9A 3DXPA 4JG6A 4MWIA 5M08A 4K2RA 3HV5A 5LXMA 5JKGA 4PX6A 2CN8A 4RQKA 4FKIA 3LJ2A 3I0OA 1ST0A 3DNEA 5AP0A 4C4HA 4RIYB 5EI8A 2WO6A 1WFCA 4RG0A 3PSBA 3V6RA 3ELJA 4IX4A 3GEQA 3BBWA 3ORPA 3C13A 3DAJA 4GSBA 4L43A 5CNOA 5CEMA 2XNMA 3Q60A 4EQUA 2VTIA 2WKMA 3OBGA 4KKHA 4DHFA 3E62A 4AQKA 4PNKA 1UU7A 4R3RA 4DTKA 2ITXA 3UPXA 5IQBA 2JIIA 1BLXA 2QG7A 5HVYA 3D83A 1PXMA 4O22A 1JBPE 3OS3A 4F1MA 4F7NA 3CEKA 3NNVA 5JGAA 4FYNA 2BILB 2VV9A 3C4FA 1YI3A 3I5ZA 2YCRA 4OTQA 3AKJA 5IQAA 3O96A 4NFNA 4LYNA 4UALA 4YURA 3P78A 5AA9A 5JH6A 2ZM4A 4JRNA 3LCKA 4PDYA 3N51A 4Z16A 1IASA 2WMWA 4BI2A 2VTMA 2XIXA 4BDDA 5CU0A 2W1FA 4OGRA 3RHKA 3ZBXA 2F7ZE 1YDRE 3OUKA 4L52A 2G15A 4QTAA 1BI8A 4PQNA 4PTGA 4DE4A 4MQ1A 4AP7A 1OKYA 2JD5A 4QOXA 5FM2A 5IKWA 4AAAA 4E6AA 4EBWA 4BCJA 1G8KA 4WBBB 5A9UA 4X2NA 4EHVA 3CGFA 4O0SA 1Q8ZA 2OGVA 3DGKA 4I24A 5CAVA 1OPKA 4EZ3A 4N0SA 5HKMA 4F0IA 1GIJA 3GOPA 4L45A 2EU9A 2XK6A 4ANNA 3RM7A 3NUAA 4U80A 3FMMA 4L01A 1GNGA 4USDA 4O4BB 3M1SA 2PE2A 4HPTE 1CMKE 1V0OA 2XBAA 5DMZA 3FXXA 4C7TA 3RNYA 4X3FA 3UG1A 5M06A 4EOQA 3R1NA 2CKOA 3ZRLA 1GZ8A 4D2VA 4I4EA 5DR9A 2VWWA 3AC2A 3EMGA 3Q4CA 4W9WA 3WYXA 1OZ1A 3Q6WA 1XKKA 4G3EA 4TXCA 3WZEA 5IQIA 3DOGA 4O0UA 4IM0A 1GZNA 4S2ZA 4JOAA 3DK3A 4MBIA 5J79A 4XG7A 2OWBA 2WFYA 2BTRA 3DBFA 3O8UA 5DH3A 4BTKA 3A62A 4KB8A 4V05A 4QP8A 4GYGA 4AN3A 4C34A 3TCPA 4BDKA 3IW7A 3F2NA 2J50A 3KCFA 5AR3A 3T3VA 4XLVA 3DDQA 4BKZA 4OTDA 5M53A 2C47A 4YPSA 4RJ8A 5FP5A 1H1SA 4NTTA 3TNIA 4FSWA 4EUTA 3HZTA 4PPBA 4GFMA 3PLSA 4DEIA 4A9YA 4BBEA 2R0IA 3BE2A 4QYHA 2QU5A 2YZAA 4K77A 2X8DA 2XYUA 4X3FB 1YDTE 3LFBA 3K3JA 4TWNA 1LR4A 3FUPA 3MJ2A 3KEXA 3U4WA 3NW5A 4E6DA 4F0FA 4HZRA 3VUGA 3Q2MA 4IANA 1YOJA 3FL5A 3MW1A 3QLFA 3WARA 2UV2A 4O86A 2Z7QA 4BDHA 2HY0A 2R2PA 4X0MA 5LVNA 4W4WA 3AC8A 3TG1A 2BTSA 1XWSA 4AFEA 2PVYA 2HWPA 3COHA 4YTIA 5FD2A 4ZK5A 4E5BA 4C57A 2CPKE 1OUYA 3NUSA 1BMKA 2XYNA 4EOSA 2R0UA 3VS6A 4YJVA 2W1GA 4C62A 4YLLA 4RJ6A 5DT0A 1BKXA 4QDEA 3GI3A 3O23A 4BCHA 2JITA 4KIKA 2WMUA 2J0MB 3HDNA 4GMYA 5M07A 2Z8CA 3RM6A 2E9UA 3HA6A 2QOKA 5FBNC 3BHYA 4PDSA 2BKZA 3T9TA 3K5UA 1R39A 5IQFA 5C1QB 5F95A 3F5UA 4M12A 2WTCA 4BICA 2BRGA 1H1QA 4HJOA 3LFDA 4YHTA 3BELA 5D11A 5LCJA 3WZKA 1W8CA 2EB3A 3QUDA 4A9RA 4K8AA 5A46A 2XCHA 2XRUA 4IVDA 3COMA 2HZNA 5CVHA 4DLIA 4GYIA 2GNGA 4YJTA 5K0KA 3ULIA 5AUXA 5HORA 5AP6A 1CKPA 1U5RA 2X9FA 5HTBA 3A4PA 5GIOE 3CQEA 2WMRA 2RFEA 3HECA 4XV9A 4RZVA 4TWPA 4IXPA 2QODA 2VWUA 3A60A 3F61A 5L6WL 5I4NA 3F2AA 3FAAA 1J7UA 3R1YA 4WOVA 5A3XA 2ZYBA 4KIQA 5C8MA 4D4SA 4E4NA 2BZJA 4F9AA 4KIKB 5M56A 3BZ3A 4EZ7A 3N9XA 4FV7A 3U9NA 5LWMA 3M2WA 3KMMA 3MDYA 4BDAA 1WBWA 2F57A 3HV6A 3PPKA 4O0YA 3PUFC 1YWRA 1J7LA 1H1PA 2GS7A 2UZEA 2XIRA 4HGLA 4I23A 4O96A 4OTWA 1E1VA 2A27A 3VBTA 2GFSA 3LFQA 5CU3A 4RRVA 4AA4A 4ASXA 3BE9A 5HBJA 4FZ7A 1E9HA 2WQNA 3NW7A 4NT4A 5JQ8A 3U6JA 1ZOHA 3T3UA 4DGLC 2UVZA 4UWYA 4M13A 4YSMA 3EQHA 1MQBA 3GXLA 4FUXA 4I0SA 1OPLA 3R8VA 1PXOA 3R01A 3C4EA 1ZYSA 3EN6A 4PF4A 2UZLA 4ZSLA 4LDTA 3CP9A 3QHWA 1WVXA 3MSSA 4BWKA 2GNHA 4CKJA 2P33A 4U9AA 4UX9A 5EI6A 1GJOA 2CGVA 3VQHA 5J1VA 4C61A 4XG3A 4CG8A 2XK4A 5AUWA 5I9VA 4C33A 3QTSA 5GJGA 4FOBA 4NWMA 4CFVA 4FNZA 4GKIA 4FKLA 4AGUA 3F66A 2PSQA 2XUUA 2BAQA 4MXAA 4YPDA 3ZFMA 4HYHA 3KXXA 4O91A 4QQ5A 3HX4A 3KRRA 1ZYCA 4BJJA 5CEQA 1TKIA 3CJFA 4O7VA 3KXMA 4AGDA 3V04A 1QMZA 1FVRA 2X7OA 5EG3A 5B2LA 2XNEA 2JKQA 4FV6A 4IFGA 4F4PA 3ORKA 3AGMA 3PWYA 3ZLXA 4YZNA 3Q53A 5AAGA 1OGYA 2BROA 1OVEA 3BIZA 2LGCA 2X2KA 5KMNA 5CI6A 3VHEA 2V55A 3QCQA 3W8LA 3CE3A 2A1AB 3DPKA 1XJDA 4ZSJA 2OZAA 2W96B 3DY7A 4ZLZA 3F5GA 2YM3A 2FSOX 3QQGA 1U59A 3GOKA 5B0XA 4JDKA 4UEUA 3EH9A 3JY9A 2QR8A 4BY9E 2FSTX 2J5FA 3LE6A 3ZUVA 3VVHA 4PRJA 3W0RA 1FMOE 2EXMA 5HE3A 4D1SA 2RGPA 4F7JA 3H3CA 4OT6A 4C3PA 5I3RA 4BJJB 3UOKA 4GKHA 3LKMA 3RPVA 4JL9A 3PRIA 1R0EA 4ANQA 4I0TA 5IPJA 3KU2A 3UNJA 3BLHA 2YEXA 3DLSA 1PXLA 4G16A 3OP5A 3CC6A 3POOA 2C6MA 5H8GA 4FTQA 2Y9QA 5CU2A 5AP7A 4AW1A 4W8DA 4CFWA 4N57A 3O71A 4QMQA 3EZRA 4QMNA 2GSFA 4JRVA 3AMAA 3NYVA 3RI1A 2BAJA 5I9YA 1OPJA 3IW4A 3EN5A 5F20A 5J9LA 2QU6A 2PUIA 3LZBA 3KB7A 4AA0A 2OZAB 4BFMA 4FMQA 2CNUA 5BVOA 2PVFA 4AN2A 1ZLTA 2IJMA 2R3PA 2YISA 3DAEA 3DBEA 3E8CA 3PP1A 1IG1A 2X2MA 4WO5A 4X2JA 5HHWA 3RWQA 3RWPA 4A4XA 2XK7A 2ZM3A 4YBJA 2IZSA 2V7OA 5M51A 3GENA 3D0EA 1FMKA 3ZLWA 1BL7A 4CVAA 1CKJA 1HCKA 2BMCA 4Z9LA 2OJGA 3KFAA 5E8SA 5AUTA 3FI8A 3OCGA 2I0VA 3EN7A 3QTIA 4IZ7A 2BAKA 2R64A 4AXFA 4BZOA 3CKXA 3OMVA 4B6LA 5ANOA 3QD3A 4FIHA 4FKQA 4IBMA 4WNKA 3PVGA 4DG2E 4FVPA 2JDVA 3UYSA 3FI3A 3PXFA 3A61A 3OXTA 4HCUA 1Z9XA 3FXWA 4GL9A 4EH8A 2YIWA 3OOGA 1WBTA 2C4GA 5HG9A 4YJPA 3KRJA 3PSDA 4ZOGA 3II5A 5AP2A 4PY1A 4RWJA 4L44A 1RQQA 5BMMA 2C3KA 2R3MA 2GNLA 4NCTA 3W10A 4DT9A 3QKLA 1QL6A 3D7TA 4BKYA 3LLTA 4NFMA 3L8PA 2OJJA 3DJ7A 4CRLA 3HV3A 2C6LA 4KBCA 3ZO1A 2W7XA 5BVFA 3DU8A 1H27A 2Y6OA 1YXXA 4GU9A 4QTBA 3ZHPC 4FTOA 3VC4A 4FIEA 4F70A 3D5XA 4AUAA 5KCVA 3IDPA 3NUPA 5A4TA 5EM5A 5AUZA 4CMTA 3H9FA 5EH0A 2VTQA 2X0PA 4ZSEA 3ZOSA 3LCDA 3QX4A 3R63A 4XV2A 4CQEA 4FODA 4FT7A 4ERKA 3JUHA 1PRYA 4F1OA 3PWDA 3H4JA 1XHAA 4NL0A 2W1IA 3SDJA 3PP0A 1ZARA 3BLQA 5HGIA 3GC8A 4HYSA 4G5JA 4CSVA 4RX7A 2NP8A 3FMEA 4YLJA 5H2UA 3UQFA 2GTMA 4RT7A 2XF0A 4TW9A 3FKLA 3I79A 3VBWA 2C3IB 3HRBA 3Q5ZA 3DDPA 4AA5A 3GNIB 2QOFA 4R6VA 2RF9A 2Y4PA 3R28A 4QMUA 3GU7A 3ZDUA 1WMKA 1W83A 5HBEA 4EI4A 4FTAA 3D7TB 4ITHA 2WMXA 2XB7A 5AP3A 4EOKA 4BRXA 2UZWE 4OTIA 3TUBA 4KRCA 4MXOA 3RCJA 4ANMA 2PVJA 3T9IA 4YU2A 3R2YA 3LMGA 2DS1A 3NAYA 1WBVA 4QD6A 3ALOA 5IQHA 4ZJIA 5KUPA 2V5QA 3NUXA 2EWAA 3HP5A 3FQHA 3F7ZA 3QCXA 2GQSA 3PJCA 4DF3A 2Z60A 4U44A 3G9NA 5LMAA 3FY2A 3IW8A 4L6QA 2VWBA 2DYLA 3Q9XA 3WF5A 3DJ5A 4HVHA 2QOBA 2XAOA 2VUWA 2QG5A 4GJ3A 4RFYA 4I6HA 1IR3A 1P4FA 4W4XA 4O4FA 5EI2A 2GHGA 4R1YA 5AR5A 1FOTA 4YJRA 4HVSA 3QHRA 4AGCA 1REKA 3AQVA 2GPHA 3VJOA 4RJ4A 3QTRA 3TDVA 3GT8A 2QONA 2XRWA 3DV3A 3PJ1A 5G1XA 4APCA 4OAUC 4D4RA 4FTIA 4FVRA 2B9HA 4ZZNA 3QUEA 2ZB1A 1UNLA 2QURA 3WF9A 4ERWA 4DHJA 3CR0A 3R1QA 4YUQA 3LQ3A 4FZFB 3TWJA 4S34A 3QFVA 1PYEA 2FB8A 2X7FA 5EDRA 4UMRA 4MQ2A 5DYJA 5CAPA 5EDPA 3JYAA 4Z55A 3BEAA 1MQ4A 1Y8GA 4FT0A 1DI9A 5FEEA 4EZ5A 2Q83A 2ITOA 1TQIA 3KXZA 3FZPA 4YNOA 2NPQA 4QMMA 3IO7A 4ZLOA 5IISA 4YTFA 1YKRA 2JFLA 4KKEA 3R2BA 5L8JA 3UOJA 5BVEA 1GIHA 2PULA 4MK0A 2J90A 3DB8A 5IH5A 2SRCA 4J8MA 4YZCA 3RBWA 4L3PA 5LVPA 3EFJA 3FHIA 4EH7A 3LM5A 3KL8A 3ZO4A 4RQVA 1R1WA 2PMOX 4BI0A 4IVBA 2R7IA 3KCKA 4IAKA 5I9WA 4UWCA 4BTFA 3F82A 3PJ8A 4OR5A 1DI8A 3R83A 3MVLA 4QNAA 4WIHA 3U9CA 1OL2A 1UVRA 5CAQA 3C7QA 3R0TA 3IGOA 5DT4A 4E7WA 1PYXA 2JGZA 1K9AA 1R0PA 4XG6A 4DDGA 3R6XA 3OWPA 4HNFA 4DEGA 3L1SA 1V1KA 4PDPA 2XA4A 1K2PA 4XJ0A 3GQIA 3CS9A 4E4LA 2PMIA 5A4LA 3ZTXA 1Q24A 1NVQA 5HX6A 4N4SA 2VU3A 2VWVA 5EQPA 4FL3A 3GB2A 1J1CA 5IQDA 4UV0A 3QTQA 3KXGA 5EDQA 2XS0A 5AIKA 4APPA 3MA6A 2OK1A 2X4ZA 3Q5IA 1SVHA 3AXWA 3MBLA 1PY5A 3MPTA 1JKKA 2IEWA 3OTVA 4G31A 4GG5A 4JBOA 3ZS5A 2C6IA 2FSMX 3NZ0A 4IDVA 4LRJA 3RK5A 5BX0A 3ZU7A 3WF8A 3K3IA 4BDFA 4D28A 2PY3A 3BX5A 1NA7A 4AXCA 3QL8A 2IW6A 2B52A 4GT5A 1FVVA 4L42A 3ZXTA 3SVVA 1GAGA 1SMHA 4FICA 4V0GA 4AE6A 1YWVA 3NNWA 5CEPA 3UO5A 4X2FA 5LVMA 3FY0A 2VD5A 3VUIA 1ZMWA 4G6NA 4AW2A 4O21A 3I60A 4NUSA 1H28A 1Q5KA 4QPMA 3QX2A 3S1HA 3W33A 3UZRA 5G6VA 3UIBA 2NRUA 3EYHA 5JZNA 4D1XA 3VS0A 4Z7HA 5CF5A 3UIMA 5KKRB 2OF4A 3NEWA 2VNWA 3VS4A 5IH6A 2OW3A 2WIHA 3FYJX 2I7QA 4JAIA 3RPSA 5HX8A 3HVCA 5AWMA 3TKHA 4E5AX 3LJ1A 1B6CB 3VUHA 2BDJA 1YOMA 3OT3A 4M7IA 3IDBA 3VBYA 3NYOA 4P2KA 1TVOA 3FI4A 4HGSA 3GCPA 3MIAA 3DQXA 4WA9A 3WIKA 1H1RA 2G01A 5HIDA 4W9XA 2EB2A 4XBUA 4J52A 3FMLA 2B7AA 4BDGA 4C37A 2R3OA 5GZ9A 4AW5A 3FL4A 4FTUA 5CALA 2VTOA 4V0GB 4FT9A 3E7OA 1X8BA 3LVPA 3TIZA 3V5JA 2XIKA 3O2MA 3F3UA 3VS1A 1O6KA 4FKTA 2J51A 4L68A 5E4HA 5TR6A 2PVLA 3MVMA 4YHFA 3WOWA 2ETRA 4ANSA 3QRKA 5KX8A 3BYSA 3F3TA 2VTJA 3AOXA 1Q99A 2YHVA 3EJ1A 2QCSA 3KK8A 4L9IA 5M4FA 3TDWA 5HICA 1U54A 2XCKA 3OWLA 2QC6A 5AJQA 1P4OA 1OL6A 3MPAA 4U42A 3B2TA 3Q9WA 5F1ZA 3R8MA 3VNTA 5IF1A 2YDKA 4XCUA 4BBFA 2BFYA 3C0GA 1XMMA 5IUGA 3DLZA 4YNEA 3ZO2A 2HAKA 4PMTA 2JLDA 4O1OA 4CFXA 3BKBA 4D2PA 3JR1A 4EL9A 5KMIA 4TT7A 4GK4A 5BYLA 4TN6A 5GJFA 1J91A 2OXYA 4FSRA 4RZWA 2QLUA 4PMPA 5CF4A 2YIXA 4XMOA 5AP5A 4FT5A 5I0BA 4UXQA 4DBXA 3PZEA 3QRTA 4FEVA 2W9FB 3HMIA 3PG3A 2XJ1A 3I5NA 4D4YA 2VO0A 3UIUA 4ZSAA 4R78A 4IJPA 2BR1A 5AAFA 3CQWA 4X2KA 2YERA 4AF3A 3PVWA 4EHZA 2ZFYA 3FE3A 1NT2A 2QHNA 4K6ZA 4QMZA 4FEUA 5M4CA 5HNGA 3L9NA 1Q3WA 5D7VA 5EYDA 1U54B 3QAME 1UA2A 5AMNA 3WBLA 4E20A 1MP8A 4YO6A 4WUNA 4EUUA 3GGFA 3Q52A 3TEIA 5ITAA 3PYYA 4BZNA 1FPUA 4KKGA 3C51A 3ERKA 3G5DA 1DM2A 4IWQA 5HVKA 1FGIA 3OHTA 3SOCA 1ZMVA 5CF6A 4XHKB 2CKPA 2P4IA 2WU7A 3BV3A 4FTKA 4C3FA 5DA3A 2CNVA 3NIEA 4FVQA 3N4UA 1I44A 4ANOA 2JEDA 2XNOA 3PPJA 3UOLA 5FWKK 2VTPA 3QTZA 2NYAA 4HCVA 3ZSHA 2WTWA 4CZTA 3FWQA 4QP7A 2GCDA 4EOOA 3L8SA 3OUNB 5ANJA 3PJ3A 1FINA 3BPRA 3TT0A 4X3FC 3QD2B 4MXZA 3WF7A 4JR7A 3ID6C 5HVJA 2VGOA 3FZRA 4FTTA 2VTTA 3PPZA 4IB5A 4FV3A 3SKCA 4EKLA 3I81A 3RK9A 2RSVA 5LJJA 3OVVA 1P5EA 4FSQA 3Q4ZA 4P5QA 2BDFA 2Z7SA 5IA5A 3L9MA 3UVRA 3VF8A 3F69A 1OECA 2BHEA 3UBDA 2XAMA 3N4VA 4MEDA 4BDJA 1JSTA 1Q8YA 3FZTA 4TTHB 2YFXA 2B9JA 2GHMA 4TWOA 4BWXA 5L2TA 2CCIA 4MBLA 1O9UA 2HW7A 4MH7A 3HAMA 4U3ZA 2PVKA 4YBKA 3CIKA 3I6WA 4QTCA 1YXVA 4QMVA 3CXWA 3D14A 4RJ5A 4BI1A 4PPAA 5JFVA 3QZHA 5J5SA 2XNGA 4IX3A 4HNIA 5HCXA 3TTJA 3CY3A 4FTMA 4EONA 5C8KA 3MH0A 2AQXA 1H1WA 2CN5A 3S4QA 2E9PA 4KSPA 3EHAA 4ZTSA 4QPSA 2BVAA 5AUYA 2FUMA 5CYIA 4DITA 5IU2A 1W2CA 2QR7A 4P90A 4WNOA 3SV0A 3OBJA 3UIXA 3UP2A 4HVIA 5BMSA 2XALA 1LEZA 4FUYA 5JRQA 3O5AA 2F9GA 2VX3A 3B2WA 4UBAA 1M2RA 3ORZA 4PWNA 2C5OA 1YHWA 1YHSA 3ZC6A 4PMMA 3ZSGA 4BL1A 3A4OX 3EN9A 2RFSA 5E90A 2W1ZA 3EKNA 4ZSGA 4I6QA 2XNBA 4RPVA 3RZBA