3NUYA

Phosphoinositide-dependent kinase-1 (pdk1) with fragment17
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
286
structure length
276
Chain Sequence
QPRKKRPEDFKFGKILGEGSFSTVVLARELATSREYAIKILEKRHIIKENKVPYVTRERDVMSRLDHPFFVKLYFTFQDDEKLYFGLSYAKNGELLKYIRKIGSFDETCTRFYTAEIVSALEYLHGKGIIHRDLKPENILLNEDMHIQITDFGTAKVLSFVGTAQYVSPELLTEKSACKSSDLWALGCIIYQLVAGLPPFRAGNEYLIFQKIIKLEYDFPEKFFPKARDLVEKLLVLDATKRLGCEEMEGYGPLKAHPFFESVTWENLHQQTPPKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PkB-like
publication title Aminoindazole PDK1 Inhibitors: A Case Study in Fragment-Based Drug Discovery.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 88
structure length 276
sequence length 286
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2010-07-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3nuyA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3nuyA01
3TI1A 5HTBA 5DEYA 4BTFA 2UZNA 3NNWA 2VO3A 3JS2A 3O7LD 1KUTA 4OTQA 3BWJA 4YZMA 2WAJA 2XRWA 4BCIA 5IH4A 3F5GA 3NEWA 4ZTNA 3NCZA 2VRXA 4BTKA 3R04A 1M2RA 1XBBA 2PK9A 3NUUA 4JDHA 2CNVA 4FE2A 5FLFA 2QHNA 4RRVA 5AP5A 3DBCA 4J1RA 2J5FA 2XUUA 3PVUA 1UNGA 2PE2A 2WTDA 2W9ZB 4DYMA 3TUCA 2VWYA 5C27A 3FPMA 2CCHA 4FSQA 3ZO3A 4YTCA 1Q62A 2R3RA 5EI8A 3W16A 4EOJA 4YJUA 4D28A 1SVGA 5L6WL 3FYKX 1H27A 4K9YA 4O0YA 4RQKA 2W1FA 4IAZA 3K5UA 4GEOA 2E9OA 3DKCA 1XH6A 3PXQA 3GC8A 1FVRA 3QQHA 4IVCA 4NJDA 2NRYA 2XJ1A 5HG5A 3ROYA 2WQNA 4XRJA 4D4VA 4JRNA 2Y4IC 5I9UA 4E7WA 2XF0A 2AC5A 2B9IA 3F66A 4YZCA 3FMNA 2CN5A 4MWIA 3VF8A 4CYJA 4HYSA 4J71A 3I0QA 3I5NA 3LXKA 1KSWA 3QTUA 4I94A 4W8DA 4KINA 4BCJA 4BKZA 4EH2A 4LMNA 4EQCA 1XH8A 4NFNA 3R7OA 4GKIA 2Q0NA 3RNYA 4NL0A 3B2WA 4P7EA 5HU3A 3KCKA 4UV0A 1TVOA 2F4JA 3GCPA 3MFSA 5D41A 4HCUA 5HG8A 3R7EA 4J52A 1ZOEA 3H0ZA 3Q53A 4QTEA 2C1BA 4ZK5A 2YM5A 2RGPA 5HORA 5CSVA 1OM1A 4E4MA 3R1NA 4LV8A 4G31A 3GFWA 3HMPA 1EH4A 1U5QA 2WU6A 2QKWB 4EZ7A 1OPKA 3ENMA 5J87A 5AR8A 3VS3A 2YABA 2YDJA 4ACCA 5LMBA 3QRUA 1STCE 2ZAZA 3R8PA 5J9LA 4HYIA 4O0VA 4EORA 1H01A 4OGRA 4WT6A 2PZ5A 5ANIA 5C1QB 1Q97A 3ENHA 4CZTA 3IGOA 4WG4A 4X6RA 3N4TA 4P2KA 4F6WA 4IJ9A 5KE0A 2YEXA 3QZHA 4EH7A 3TDWA 3LHJA 1H4LA 3ZBXA 2X39A 4F1MA 1YWVA 2HWOA 2E9PA 2OICA 3Q5ZA 2R0IA 3PP1A 1BMKA 4L3PA 4GUEA 2ERZE 4UWCA 4O21A 2UZOA 2HAKA 3O8TA 3PVWA 3GQLA 4EQUA 2OK1A 3QLGA 2VO7A 3LMHA 5KUPA 4AS0A 3HL7A 3COKA 2YFXA 5AV4A 1PRYA 4E8AA 3P08A 3AC1A 3EQRA 5HNIX 4EUTA 4O27B 4NW6A 2PVHA 2LAVA 3OT3A 4BCPA 4WBOA 2V62A 2QLUA 3TWJA 5LVMA 2WEIA 3OCGA 5KHWA 3E93A 4KAOA 4FR4A 3V8WA 4CEGA 3MPTA 4QMNA 3Q52A 3QYWA 4NFMA 4ANSA 1B39A 4BIBA 5HE2A 4MBJA 4UWBA 3NRMA 4M97A 2UZDA 3GC9A 4IWOA 3MY1A 3VUGA 4RFMA 4DGMA 3GP0A 2HW7A 3IW7A 3ULZA 4IAYA 5CEMA 4IWQA 5KKRC 2ZDTA 3C51A 2O65A 3KULA 3R8VA 3ZRKA 4E3CA 4KIKB 3D5VA 3ZRMA 3I6UA 4BI2A 2ZMDA 5LWNA 3W2SA 2PZPA 4YLLA 4M13A 4YZ9A 4KRDA 2Z7LA 3R1YA 2IVUA 3ZM4A 1Q4LA 3VJOA 4DITA 4ANBA 1OIUA 1GIJA 3I5ZA 4M66A 5HLNA 3DNDA 3FC2A 3RK7A 2WELA 1PXJA 5JFVA 4USFA 4NH1A 2IVTA 4F9CA 3VVHA 3D7ZA 3ZLWA 1XJDA 1PF8A 3SXSA 4BCGA 4EBWA 3PP0A 5JQ8A 5M4IA 5AUXA 2ERKA 5CXZA 5BPYA 5M51A 4E26A 2VWVA 4DH5A 3B8RA 4CG9A 2B7AA 2YLFA 3ACJA 4FV2A 4E5AX 5AV3A 4BR3A 1H26A 5CEPA 2B54A 1M14A 4U8ZA 2WMBA 4RIOA 4E4XA 3IKAA 4QMWA 1M52A 1QMZA 3R1SA 4QMZA 4RJ8A 4FVQA 4RIYB 5BMSA 2JAVA 3Q2MA 4QYHA 5CU4A 5L8JA 3OOMA 4DLIA 1JOWB 1FMOE 5IQBA 2ITOA 3OXTA 4ZAUA 3MJ1A 3R9NA 2WTKB 4AA0A 2VTPA 5HVKA 3HV4A 4Y8DA 4ASEA 3KRWA 4AUAA 2R4BA 3UDBA 3CEKA 2G2IA 5CT7A 3C9WA 5CXHA 4E4NA 3SVVA 3SOAA 4LI5A 4QP6A 4RX7A 2OIBA 3O96A 4YGAA 3UODA 3KFAA 3KL8A 2O0UA 3LAUA 4NWMA 4OUCA 4EOQA 3VBQA 3W32A 4ZSEA 3I7CA 2UW9A 3OWKA 2QOHA 4QD6A 5BX0A 4DEEA 2BHHA 4FTKA 3ET7A 4QT1A 4FEVA 4KA3A 4YZBA 2VGPA 1WVWA 4W9XA 2OO8X 2XK8A 2YDKA 3A7FA 2YIYA 3MSSA 3I4BA 4Y46A 3UIBA 4YC8A 2GQSA 3HECA 2VAGA 3C5IA 3QKMA 4AQCA 5J1WA 2JFLA 4J8MA 5H8GA 3R7UA 1OBGA 3EFWA 3SW4A 3W2OA 4RJ6A 2ETRA 4I0TA 3ZFXA 2WOUA 3ORNA 1MRUA 3PRFA 4MQ1A 3U51A 4EC8A 3VUDA 5LVLA 4FBXA 3QL8A 4O22A 1K9AA 4D0WA 3OFMA 4PPBA 3ALOA 4GIHA 2PZRA 4CSVA 3PJ8A 4YTIA 4EHVA 3BLHA 4Y83A 2WMAA 3DQWA 1OL5A 4R5SA 3RWQA 5IMEA 3DXPA 2PVKA 3PWYA 4EHEA 3HYHA 2H6DA 4G3GA 3BWFA 2IJMA 5J95A 4FI1A 5L3AA 1OECA 4FTUA 2C5YA 2X4FA 3R83A 4K11A 3AC4A 2EWAA 5IU2A 2X2MA 2C1AA 1WBVA 2PMIA 3DBFA 3KF4A 2ESMA 4PMSA 4QP1A 4R5YA 4S34A 5F94A 3CP9A 3QX4A 3A99A 5C01A 1U54B 2WXVA 1W83A 5DHJA 2CLXA 4I6BA 3OC1A 1G3NA 3E8NA 1ZOHA 2GNIA 1M2PA 3VRYA 3MA6A 4AG8A 4U3ZA 5A4TA 4OW8A 1DI8A 4JDKA 3ZO1A 1FMKA 3VS0A 3ELJA 4HNFA 5HNGA 5M4FA 2ITUA 3DT1A 3OROA 3M1SA 4Z9LA 3KMMA 2HZ4A 3MB7A 5HHWA 3IQ7A 3V5WA 5HTCA 3Q6WA 3V8TA 4EOMA 2XK7A 3LQ3A 4AU8A 3Q4CA 5CSXA 3QQFA 4EYMA 3AT2A 4MD9E 4CRSA 3MGYA 4O6LA 1VZOA 4PF4A 2J0LA 3FI2A 5EYKA 3D2KA 4AZTA 4GK4A 1FQ1B 3NS9A 4K77A 2XBAA 3PG1A 3W10A 3FMJA 3TEIA 3BHHA 3IW4A 5KMIA 2E9VA 3ODZX 3PXRA 3F3TA 2PVRA 3VULA 3ZYAA 5DR2A 3CPCA 3GUBA 2RFEA 1YKRA 4QYEA 2V22A 3HAVA 3R21A 3TNPC 2R3GA 5EHOA 5A6NA 2J0MB 1J91A 2FB8A 4QPSA 2QQ7A 4IC7A 5M56A 3DXNA 3I81A 4A4LA 3BLQA 3O0GA 4X2KA 4PV0A 4EK3A 2IVSA 4W4VA 2OXXA 4FV9A 4PDYA 5CANA 5G1XA 4WG5A 4R7IA 5LJJA 2B9JA 3QCXA 3QGWA 4GH2A 4KIKA 4YLJA 5CS6A 5HLPA 3G51A 3UP2A 3VJNA 3WF7A 4KNBA 4BZOA 2YACA 5BVWA 1S9IA 3DZOA 4QTCA 1WBPA 4I5MA 5EKOA 4ZP5A 4ZS0A 5FBOA 3HMNA 5GZ8A 1XHAA 2J0KA 4AGDA 5FBNC 3HAMA 3LFBA 4N70A 4YMJA 2CNUA 4BCNA 1J3HA 4FKRA 3D14A 3AOXA 4IMYA 1PJKA 4HGLA 5D9HA 4BDFA 3PPJA 4IFGA 3TCPA 3LQ5A 1J1BA 4BI1A 4AFEA 3AT3A 3PPKA 2XIYA 3O71A 4BCKA 3ORZA 3IPHA 5EG3A 5F1ZA 4RFYA 2V55A 4U0IA 5CU6A 5FUTA 1WCCA 5FD2A 1G5SA 3NAXA 3IS5A 3A7IA 5HCYA 4O7LA 1Y57A 1CTPE 1YI4A 4KB8A 4CFWA 2V0DA 4AW5A 3R71A 2X2KA 3CR0A 3NUYA 5T6KA 3D5UA 3NGAA 2YISA 1Q41A 3PTGA 4RIYA 3FQSA 5GNKA 2W1IA 3TG1A 1Y6AA 2R3PA 5M53A 4E6AA 2EXEA 3UP7A 3EYGA 4X3JA 4AA4A 1KV1A 4JI9A 3DLSA 1U59A 3ZSHA 4R78A 1WBOA 1PHKA 2OFVA 4OBQA 1XO2B 4R8QA 5AUYA 4PNIA 2VTLA 3LCSA 1PKGA 4G1WA 3C4XA 4RC2A 3RCDA 4QP9A 4NTSA 2CMWA 3PXZA 1DM2A 4U44A 4O1OA 1R39A 3U8WA 3I1AA 4NK9A 5KMLA 4C37A 1APME 3G5DA 1YWNA 4ZSAA 4A4XA 2FO0A 4KD1A 3TKIA 4C4JA 4C4FA 5D10A 5AA9A 5CEKA 4CT1A 5IQHA 3ZOSA 3R30A 5EYMA 4EH3A 5LARA 4BZNA 3U9CA 4BTMA 3TKHA 2QG7A 3IW5A 3C13A 3VUTA 4RX8A 1E1XA 1B38A 2IZUA 2HWPA 3H9RA 3HGKA 3LJ0A 1JKKA 4YJRA 4KS7A 5HESA 3VUKA 3RALA 4K6ZA 1HOWA 2VN9A 2XMYA 4XV9A 1ZYLA 1B6CB 2VTIA 4FTNA 4JS8A 5AUUA 2BRNA 2BIKB 3RGFA 2ZV7A 4I24A 3CTHA 3DDQA 5TR6A 1HCKA 1OUKA 1OMWA 2X8IA 5E8SA 4D5HA 3CTJA 4WNKA 3GENA 3S4QA 5EQPA 3PJCA 2HCKA 4OBPA 3NNXA 3WIGA 2BZJA 3P79A 1PMUA 3Q2JA 3R9RA 3IDBA 4GUBA 3SRVB 4ENXA 5KNJA 2XM9A 4BCQA 5HO7A 1BI8A 1J7IA 4L9IA 1BL7A 4FKVA 3AGLA 1Q5KA 2ITTA 2OBJA 4LGHA 3R8UA 2J0JA 3KB7A 3RHXA 2VWUA 1U54A 4FIGA 4GJ2A 1O6KA 3G6GA 3FI4A 5G6VA 3QZIA 2IZSA 3MJ2A 4NM0A 3U6IA 4MKCA 3ZZEA 4QMOA 4IVDA 3UG2A 5BYLA 5CEQA 2W5BA 4OR5A 4M15A 3FC1X 4GVJA 2QOBA 3LFEA 2IW9A 4EQMA 3C4FA 4MD7E 3QCYA 5ANDA 4D2WA 5FEEA 5AFVA 1GAGA 2O5KA 4FNWA 4XG7A 4D1SA 1VEBA 4ZTSA 4F6SA 2P2HA 3FMKA 4FKTA 2X1NA 2WFYA 3QC4A 3SG9A 3LCTA 3R0TA 4GYIA 4N6ZA 4UZHA 4UMPA 3FQEA 4CQEA 3D7TA 4FSNA 5AR5A 3BBTB 4JT3A 4Q9ZA 5DPVA 4M69B 3L8PA 2JDVA 3SC1A 3V6SA 2QG5A 3DB6A 4R7HA 5E1EA 4WSYA 1OGUA 2XEZA 4AN9A 3PLSA 4IACA 2VO0A 4XP2A 1BI7A 1PXOA 2C3JA 2WTJA 4B99A 4Q2AA 3CLYA 2VWWA 3U6JA 4C4EA 5L2QA 2C5XA 2R3HA 4PWNA 3SXFA 4TL0A 4RIWB 3OHTA 4MH7A 3CTQA 2YN8A 3DKOA 3R2BA 4A9YA 4DN5A 4QMQA 4XV1A 2AC3A 5AP2A 1SM2A 5C4LA 4IQ6A 4FX3A 4DA5A 2HOGA 4GCJA 3F9NA 3A4OX 1XH4A 3BU6A 4JG7A 2CCIA 3V51A 4PMTA 4QQ5A 2ZOQA 3RPOA 3V5QA 4UX9A 2VWXA 2YITA 2OXDA 3OCTA 3QAME 4GT3A 4JLCA 5FXQA 4IM0A 3TXOA 4FSYA 4FA2A 3HP5A 1YDRE 3KN5A 4I6HA 4V05A 4G17A 2VZ6A 2VWBA 3HEGA 5CF4A 2PVJA 5E8VA 4D4YA 3NIZA 3OY3A 2Y8OA 3KA0A 4WUNA 2ZB0A 4FOBA 2C6MA 2JKQA 2X6EA 4BDEA 4W4XA 3OUKA 2XZSA 4I5CA 4L44A 3LLTA 1TQMA 3QGYA 4U41A 5AP0A 2J6MA 1PXNA 4RC4A 5IA3A 4OTDA 5CSWA 1U5RA 5DRBA 4ARKA 1BLXA 2YCFA 2C0IA 1NY3A 4AACA 3E64A 5DEWA 3NW5A 4PP9A 3EWHA 4XS2A 1ZYDA 2FVDA 5HX6A 4Y5QA 3OWJA 2QO9A 1H1RA 3OTVA 4GW8A 4DBNA 5D7AA 4AW1A 2YM4A 2Q83A 4A9RA 1UU9A 1OKZA 5HLWA 5KMNA 3GC0A 4ACDA 4BBMA 3R73A 2YWVA 4IZAA 3UOKA 2XA4A 5E8WA 4DLJA 5BMMA 1Y8YA 3OF0A 3QTXA 4TPTA 4C35A 3HA6A 4F70A 4CCUA 1KWPA 5FXSA 1YHVA 1ZOGA 3E88A 4NEUA 4PDSA 4U6RA 2I0EA 3AC8A 2AUHA 3T8OA 3EL7A 4WUAA 2B9HA 3PA4A 2PMOX 5HKMA 1DAWA 4LUDA 2WTCA 4Y73A 1A9UA 4BDIA 4FKWA 4DH7A 3HLLA 3RZFA 2RKUA 3F2NA 3WIKA 4AW0A 4D1ZA 5DYJA 2VNWA 4YUQA 4Q9SA 4BY9E 1IA8A 4JQEA 2VD5A 4LG4A 3RHKA 3JY9A 3LCOA 2DWBA 3ORLA 3DNEA 4RJ4A 4XLIA 1GY3A 2HYYA 3IDPA 5ANOA 4XEYA 4CRLA 3DZQA 3RAWA 5K4IA 5M07A 4DE4A 4LOOA 5HE0A 4DTAA 4IB1A 3ZONA 3E3PA 2G2HA 4F7JA 4ZTHA 3G90X 3L9NA 3KC3A 5AP6A 3UOHA 4HVDA 3ACKA 3WF8A 2IG7A 4BZDA 2GDOA 1WVXA 3F5UA 3WBLA 4CNHA 4DFUA 2HY0A 3RINA 4O7TA 1U46A 3KQ7A 5JH6A 1WBTA 3ORKA 3Q32A 2A4LA 2GS2A 5KZ0A 1W7HA 4BDGA 2VTAA 3FUPA 3HDNA 3SRVA 3DFAA 4R1YA 2OZAB 3OP5A 2WTKC 4W4YA 5TO8A 1CSNA 3EB0A 2HY81 3V01A 3R01A 3F6XA 3WF5A 5ACBC 1Q8ZA 1OVEA 3PPZA 1XWSA 3FY2A 4O6EA 3U6HA 4BB4A 5JZJA 4IWPA 5C9CA 5DIAA 1IAHA 1CMKE 2GQRA 4FEQA 5C03A 3MWUA 4DFBA 4WOVA 1OKVA 4AP7A 5J9YA 4FNXA 2XNBA 4ENYA 1URWA 2HXQA 3ZXZA 5LXMA 5TE0A 3F3ZA 3PDTA 4UN0C 1NA7A 4IDTA 5HO6A 4CZUA 4FKSA 2PYWA 4QP2A 4TNBA 4FTOA 5IEXA 3R8LA 2PVYA 4MNEB 1REJA 4OT6A 3KRJA 3AD4A 2B4SB 2FH9A 4WBBB 1MQBA 4FZAB 3HV7A 3PA5A 5CYIA 3W8QA 3QTRA 5GHVA 4FEUA 3CIKA 3U9NA 4YPDA 4B6LA 4UY9A 4JG8A 5EDQA 4FKPA 4M69A 3ROCA 4EOSA 5K5XA 4DT8A 4IIRA 4QMTA 5L2IA 3Q9ZA 3BV2A 3OBJA 2W1GA 3MH1A 5AM7A 1RDQE 4QP3A 2I0VA 4S32A 4MXOA 4JL9A 3LW0A 3B2TA 4YR8A 5IH5A 1T46A 4XG2A 5LMKA 4DBXA 4QTBA 2BRBA 3ORIA 4XX9A 3FSKA 1LUFA 3CJGA 4RIWA 3LJ2A 1W0XC 3HV3A 2YIWA 3T9TA 4D1XA 3MY0A 3ZHPC 4EH6A 3VO3A 3ATSA 1XH5A 4F7NA 3Q96A 1VJYA 4M0YA 3HRCA 4A7CA 1KOAA 3OTUA 5JGBA 4Q5HA 1QPCA 3D15A 4HVHA 5K4JA 3NZ0A 3KVWA 3I7BA 1XR1A 5CI6A 4F0GA 4HW7A 1JKTA 4GU9A 3AT4A 2BVAA 5F20A 1M7NA 5LVOA 4FVRA 4OTFA 4EOIA 4QNYA 3A7JA 4WA9A 5CSPA 3Q9YA 5HQ0A 4IM2A 5GIPE 2JIVA 3CS9A 5FM2A 5FDPA 3II5A 3QQLA 4PPAA 4TYIA 4PL5A 4QMXA 2Z60A 5A4LA 4L68A 4CFXA 2GHLA 3LXNA 4DT9A 2IVVA 3F3VA 4H1MA 4GIIA 4UB7A 3CQWA 1ZLTA 4GT4A 4WNOA 1UNHA 4RJ3A 4FT5A 3AD6A 3P7BA 4TTHB 4ITJA 4OAVB 2PVLA 2C69A 1OZ1A 3DBQA 3TTJA 2IW8A 4ERWA 4W4WA 5AA8A 5L4QA 3FJQE 3VN9A 5HBEA 2WOTA 1RJBA 3FBVA 1VYWA 3KXGA 4QMVA 4C59A 5IA2A 2BROA 2GNFA 5LMAA 2R3LA 1ND4A 1WZYA 5CNNA 4RJ5A 3P86A 5TOZA 2OJIA 5A54A 1OIQA 5ACKA 5CVGA 4EH4A 5CAVA 4ANMA 3FL5A 2X7GA 3RK9A 1WMKA 5CVHA 3HUBA 1Z9XA 5DT4A 1RQQA 3DAKA 2OXYA 3IG7A 4MXXA 3BU5A 3R22A 2HZ0A 4NCTA 3LCKA 4O0XA 5A3XA 2G15A 2J90A 3LXPA 5A46A 2Y7JA 4XJ0A 5I0BA 2P33A 4FV7A 3FXWA 3PJ2A 3SDJA 4QP8A 5AJQA 2IW6A 3HX4A 4BCMA 5CALA 4U7ZA 3DGKA 5BUJA 2OSCA 4KSPA 1QPDA 5L8LA 4G2FA 4R7BA 4YJSA 2XS0A 3E8DA 3FLWA 5AP3A 1TKIA 5EHLA 3DS6A 4I92A 2JKKA 3GU8A 4ONAA 3UE4A 4MVFA 4DGOA 3NNUA 4QYGA 2PVNA 4O0TA 4ZTRA 3AC2A 2A1AB 5AV1A 4EWQA 5BQ0A 5E8YA 4I93A 4LRKA 3UIMA 3KMUA 4I3ZA 2JITA 2OW3A 2B53A 3E8CA 3KGAA 3OCBA 4UEUA 2XYNA 5B2KA 2GNGA 3H9FA 4CQGA 4I20A 4YO4A 3LM0A 4FL1A 1R0PA 3PLAE 4KBAA 1ZMWA 2F49A 4RQVA 1YXTA 2QI8A 3UYSA 3DB8A 3POOA 5HBJA 4M14A 5EHYA 2OZAA 3N51A 4LV5A 3AXWA 2WMWA 3DDPA 2PTKA 4FTJA 2CDZA 2YDIA 3DBDA 3HMOA 3NMUF 1V0BA 2W06A 1OPJA 2CJMA 3EFLA 3MFTA 4EHGA 1R1WA 3DAJA 5ETFA 4FV0A 4X7QA 5AR3A 3MDYA 4F99A 3ORTA 2R9SA 3QD0A 2RFDA 3U87A 3HMIA 5CWZA 1UNLA 1Q61A 5JGDA 5DMZA 5K9IA 3D9VA 3R9HA 4IADA 4I0RA 1E9HA 2OH0E 3QKKA 4YPSA 1I09A 3MVLA 3PYYA 4B7TA 3EQHA 5I3RA 2NNWB 3PVBA 4O7RA 2ETKA 4MNEA 5TT7A 4ZEGA 3MS9A 4NU1A 3S00A 4PTCA 4C33A 2XCHA 3R2YA 2IN6A 3VUMA 4XP3A 4EUUA 2UVYA 1A06A 5HOAA 3LIJA 2OGVA 4O7ZA 2CKEA 2XBJA 3CQUA 1ZRZA 4AAAA 4I41A 3SX9A 5LCJA 1YI3A 2WIPA 3VBWA 4GSBA 3AC3A 4TT7A 1F0QA 4OTGA 4BDBA 2C6OA 3G6HA 3WE4A 4DEAA 5AIKA 3QALE 3RZBA 5J5TA 2JGZA 2B52A 3GI3A 5E1SA 2VWIA 4K33A 2IZTA 3NUPA 5IQIA 5IUGA 4AGWA 3DFCB 5DLSA 1VR2A 5A9UA 1UU7A 4EOKA 1A48A 3RI1A 1V1KA 2NPQA 4V01A 2XJ2A 3ZSIA 4D2TA 3D83A 1PXKA 3W1FA 3LFQA 1PMEA 1OB3A 3Q4ZA 4IDVA 4C7TA 4Q5EA 3WARA 5CEIA 2QC6A 5I9XA 1RW8A 3WF6A 3AGMA 4PL4A 3KU2A 3ORPA 4H36A 1Q3DA 3SHEA 2GFSA 3MTFA 5K0XA 4CMTA 3NUSA 4GT5A 1O9UA 5CQWA 4A9UA 2O3PA 2A27A 3F82A 4QTAA 2UUEA 3C4EA 4R3RA 3U4WA 4CMOA 5AUTA 3TT0A 5IQFA 2C47A 3QWKA 3SGCA 1XBAA 3UVPA 3DA6A 4U3YA 2CGWA 2RIOA 3OCSA 4JIKA 5D7VA 4XRLA 4FSRA 3SLSA 4EHZA 5HIEA 2XRUA 2GTNA 2CKPA 2XB7A 1T45A 4LYNA 4PX6A 4YSJA 3GOKA 5JK3A 3F2RA 3E87A 1NT2A 3R1QA 3Q9WA 3GCUA 2QR7A 3I6WA 5F95A 3HRFA 1PW2A 3SQQA 2R3IA 1L8TA 3A8WA 5LMKC 5CAQA 2IZRA 1ZYSA 2J2IB 3TUBA 3JUHA 3UNJA 5H8BA 2W0JA 4K1BA 4LQMA 1XH9A 3F7WA 5EQYA 1H1WA 1FVTA 1X8BA 4IX3A 4JQ7A 4EEVA 4H05A 2HENA 3DK7A 3NYOA 4M0ZA 4ZY5A 1ZZ2A 4FTIA 4L3JA 5FG8A 3DU8A 3UNZA 2O64A 5FTQA 3ZTXA 4A06A 1BUHA 2WKMA 2J5EA 2UZWE 1RE8A 4QOXA 4O7YA 5BVNA 2QLQA 4UMTA 4EK5A 5BUIA 4KIOA 4RWKA 1OIRA 3CJFA 5JZNA 4GFGA 4IZ7A 2W4JA 2C6EA 5GJDA 5CLPA 4EOPA 1DS5A 4IB5A 4ZSJA 4YTFA 4Z7HA 3G15A 4G6OA 4S2ZA 4PDPA 2YJRA 4ZJVA 5HE1A 3QA0A 1YDSE 2F9GA 4I5HA 2GS7A 4ORKA 3TM0A 5AUVA 4IEBA 1Y8GA 4IX4A 2QOFA 3TDVA 2KULA 5JT2A 3G2FA 4TWNA 2R7IA 1YHSA 3UVQA 3ATTA 4G34A 2OF4A 2XNGA 2UV2A 5DT3A 3D7TB 4KS8A 3QKLA 5C8NA 4RX9A 2WMSA 3MW1A 4X6QC 3TIZA 4F1TA 3HV6A 3KN6A 2CKOA 2PE1A 3QQUA 5D1JA 4C3FA 5AR2A 5IUIA 4CCBA 4E6DA 4AGUA 4H39A 4FNZA 3GOPA 4MQ2A 4GFOA 4FTCA 3LFFA 4JDIA 5TKDA 1JQHA 4PL3A 2C5OA 2V5QA 2BUJA 3JY0A 4CFVA 5HIDA 2CLQA 4O7NA 3VHKA 3R7VA 4WRSA 5AIRA 1ZAOA 4YHJA 3OW4A 3DJ5A 3MVHA 1YVJA 3QXOA 4R6VA 1WAKA 3C7QA 3VBXA 2PZYA 4PY1A 3PZEA 4ITHA 4LRMA 5FM3A 3UG1A 3DOGA 3R7IA 2F7EE 1K3AA 3EJ1A 3KXZA 3SOCA 2F2CB 2VTQA 3ZUUA 2W5AA 4C58A 4BGQA 3VBVA 3E8EA 4HCVA 3AG9A 3UPXA 1H00A 3BBWA 4XBUA 2G1TA 4QMUA 1SZMA 3BI6A 3QC9A 4FIIA 3LFAA 1U4DA 3HV5A 2BAKA 1M2QA 2YCQA 3D0EA 3EKNA 4I23A 2R3MA 4TY1A 2CPKE 4D55A 4FK3A 3C5UA 4BIEA 3QX2A 4FSMA 2CN8A 3AQVA 4U42A 1K2PA 2YERA 4C61A 4AZSA 5AP1A 2Z7RA 4IHPA 4FTTA 3JPVA 3V8SA 4XLVA 4FTRA 5B7VA 4AFJA 4DF3A 4DGGA 2EB3A 4X21A 2WIHA 4DG3E 5C26A 4O7WA 3O7LB 5I5ZA 1PY5A 3UOLA 3ZCLA 4CT2A 4YLKA 2QOKA 4CFNA 3M2WA 2UZBA 5DN3A 4O2ZA 2KTYA 4ZY6A 4HYHA 2Y0AA 2PSQA 2UW0A 4L7SA 4FIEA 4Y72A 3E92A 5GJFA 4GV1A 3RWPA 4ZLZA 4CKJA 3UNKA 4H3PA 4AZWA 1KE7A 3H9OA 2EXCX 5L2SA 1JAMA 1PXMA 4QTDA 1YW2A 2I40A 3F5XA 2OFUA 4ERKA 3PJ3A 4JIAA 5J8IA 3QCQA 5CT0A 4F0FA 2UVZA 4JX7A 3MVJA 5AM6A 4PPCA 4S33A 3UBDA 4JOAA 4ANOA 4J95A 4F9BA 3N4UA 4J8NA 4ZOGA 3WE8A 2C3KA 4E73A 4OTHA 4F0IA 3NUAA 5EDRA 3LVPA 4FV4A 5HCZA 4J96A 3CGOA 3QTZA 3FSFA 3QRKA 4C2VA 4KKEA 3W2CA 3O17A 3KK9A 2PHKA 4Y95A 4DINA 2ZM4A 2X9EA 4BDDA 4FUXA 4JBVA 4MXCA 4QQJA 1O6YA 5A4EA 5M08A 4F64A 5JFXA 5CU2A 3VW6A 4TW9A 3GCQA 4TYHB 2VU3A 4WSQA 3NYXA 3F3UA 4F7LA 4BHNA 3FWQA 4DEBA 1KOBA 3ZMMA 3NUNA 4G5JA 4I22A 4YTHA 3ZS5A 3O8UA 2QOOA 2P2IA 3VAPA 1MUOA 3K54A 2PU8A 5K5NA 4LGDA 4YHFA 2X4ZA 4FOCA 2QD9A 4Z7GA 2BMCA 2WMVA 3A60A 5C4KA 5EDPA 2W17A 4Z3VA 3JXWA 5I9WA 4ANQA 4EH5A 2CKQA 4EZ3A 3R9OA 3BELA 4GKHA 3QTQA 4RVLA 1DAYA 2CNQA 5KHXA 3F5PA 3GU4A 2BCJA 3IGGA 3R6XA 4PTEA 1OKYA 2ITQA 1H25A 2YA9A 4HGEA 3UPZA 2ONLA 3TJDA 3FKNA 4BWKA 1YXSA 3CD8A 3VW8A 2R64A 1YQJA 2DS1A 3CGFA 2ZM1A 4FIJA 4FKUA 3ZUVA 5DVRA 3P7CA 5EW3A 3QWJA 2YHVA 3ORXA 1ZY5A 2ZV8A 4AT5A 4C62A 4C34A 4IX6A 2PUIA 3UIUA 4E5WA 1UV5A 4MEDA 3ZH8A 2DYLA 1H28A 3O51A 4UXQA 4M12A 2BKKA 4JRVA 1JSTA 1UWHA 2F7ZE 3ID6C 5FEQA 1NW1A 5DT0A 1OL2A 3RM6A 5CQUA 2QU5A 3EQDA 2REIA 4DGNA 3PE2A 1JVPP 4MNFA 2BRMA 3BE9A 4LGGA 2ZJWA 2HXLA 2YM3A 5DRDA 5BVKA 5EW8A 4U5JA 3ZDIA 1Z57A 1NXKA 2WD1A 3LMGA 2Z8CA 3JYAA 4IW0A 5CY3A 5AAFA 3RMFA 3VNTA 4QO9A 4B9DA 2XKEA 3ZDUA 1WVYA 4GU6A 1DI9A 4B4LA 2RL5A 3LM5A 3MFRA 1XBCA 3WI6A 4MHAA 5IDPA 2OLCA 4DFXE 4YC6A 3W8LA 4AWIA 2G9XA 4WRGA 1L3RE 3PWDA 1UKIA 3FZRA 3EQIA 3FDNA 4FV6A 3RPSA 3FHRA 3SG8A 1I44A 3IK3A 4KWPA 4KIQA 1Q8UA 2XNOA 1Z5MA 4P90A 4V0GB 4CV9A 2YAAA 3QTSA 4G9RA 4L43A 5I9VA 1ZWSA 2B55A 2R3QA 3LCDA 3I0OA 3QQGA 2BTSA 2GPHA 3BHVA 1P4OA 3W33A 3E62A 3Q5IA 3KKVA 1CDKA 4PMMA 4S30A 2XJ0A 4L6QA 3VS6A 3LXLA 3R8MA 4AOIA 2OIQA 3EFKA 3GEQA 5M4UA 4HZSA 4NYEA 5J7HA 2YWPA 5BUEA 3Q04A 5JFWA 5IA4A 3P23A 5FGKA 2R2PA 2OJJA 3EL8A 2GFCA 3O8PA 3ZFYA 4BBFA 5L2TA 3JVSA 3SD0A 3OBGA 3GU7A 1MQ4A 3MVMA 4EOLA 4C0TA 3PXKA 3KRRA 3T9IA 2ACXA 1WBSA 5FTOA 4Z55A 2C3LA 2VV9A 3BQCA 4GMYA 4F1OA 1J1CA 3ANQA 4FUYA 4KUJA 4FGBA 4CFUA 3GFEA 3TV7A 2CGVA 3V3VA 2B9FA 2Y6MA 5KO1A 3KRLA 4IBMA 3NX8A 4FKIA 5EM5A 3RPYA 3VS2A 4TRLA 2I0HA 3LZBA 1H1PA 3Q9XA 4GS6A 2Q0BA 3FPQA 2QNJA 2P4IA 3IW8A 5AR4A 4F08A 2XK3A 3EZRA 2ZM3A 1WBNA 1TQIA 1YI6A 2X0GA 3NSZA 4PDOA 4ITIA 4RJ7A 3MH0A 3U4UA 3PJ1A 4L67A 5B2MA 2BTRA 3ZO2A 2WQEA 2GCDA 4KBCA 4RVKA 4CYIA 2C0TA 1FGKA 2C6LA 3QQKA 4BTJA 3L9LA 4IE9A 3DK3A 3S0OA 3WZKA 3C4WA 3DJ6A 4YURA 2PMLX 3NVMB 2VNYA 4IANA 5M06A 3UQCA 1MP8A 3NAYA 4ZSLA 3C1XA 3FLSA 5GJGA 3GXLA 4I0SA 3DTWA 3FMLA 4L8MA 4U97A 4YNEA 4BWXA 2C3IB 3BYOA 4DG0E 3B8QA 2XNPA 4HYUA 4FIHA 5I9ZA 2PY3A 3W18A 4FG7A 4WKQA 2BIYA 2OI4X 4RWLA 4DEDA 4C3PA 1J7LA 1ZMUA 4QMMA 4FEXA 2Z02A 2YM7A 2VGOA 5EOLA 3CXWA 4EWHA 3GC7A 1MRVA 2W1EA 2ZV9A 1S9JA 2VTTA 4MX9A 4TYHA 3PY1A 4XCUA 2OZOA 3GCVA 4NKSA 4ZJIA 4HOKA 3SA0A 3UTOA 1AQ1A 4NIFB 4FSZA 1E1VA 3UZTA 1IA9A 3BRBA 4FV3A 3VC4A 3Q4UA 5ETCA 3EZVA 2BDJA 4E6QA 4FKOA 5JEBA 4W8EA 3EH9A 4BKYA 4HJOA 2ITXA 3EKKA 3ZFMA 3QRTA 4CFMA 2RSVA 2XIXA 3ZZWA 4A9SA 4I4EA 4L3LA 3OXZA 2X2LA 4EH8A 5EW9A 1WBWA 4PNKA 2BZKB 3PXYA 2Y4PA 4RLLA 2JDTA 3DBEA 3WZEA 3DLZA 1XH7A 3CKWA 4C4IA 4N57A 4I21A 5DR9A 5HD4A 4XHKB 2BILB 2YM6A 3PXFA 2ZVAA 4MBIA 5IUHA 4BHZA 2X8EA 3PE1A 4RA4A 4I4FA 1CKIA 5L8KA 5J9ZA 4WO5A 3NWWA 1PKDA 4CZYB 3QRIA 2BPMA 2YAKA 3I79A 4EJNA 5LVPA 2UW8A 4DGLC 1SYKA 4G3CA 4O0WA 3P5KA 4ZTQA 4PRJA 2FUMA 3MTLA 3MESA 3DK6A 3VHEA 4YNOA 2BZIB 4BN1A 4TZRA 2X7OA 3UJGA 4AXAA 4O96A 4FT9A 3L1SA 1YOLA 4AF3A 3N4VA 3ETAA 2HK5A 4NTTA 2QOIA 3QTIA 2J4ZA 1QCFA 2HIWA 3R02A 4GL9A 1LPUA 5J7BA 4AW2A 1W82A 3AMBA 3BE2A 2HZIA 4F6UA 2E9UA 4P5QA 4YJQA 1GNGA 3S1HA 5ICPA 1ZY4A 4EONA 4NW5A 4PMPA 3OG7A 4FICA 4O82A 2WMTA 1GIHA 2ITPA 3BX5A 3PIYA 2R3KA 1JPAA 4V04A 5IQGA 3EQFA 4I1ZA 4IVBA 4X2NA 1YXUA 4XUFA 3TNQB 5CNOA 5B0XA 1XKKA 2QR8A 2QOQA 2YIRA 4II5A 4V0GA 3EHAA 5KZIA 4FF8A 2C6IA 2J51A 5DGZA 3WILA 1ZXEA 2Z7QA 5FQDC 4HVGA 4OAUC 4IZ5A 4FV1A 3P1AA 2ONLC 3EN4A 3COMA 3NLBA 2UZTA 2W1ZA 3PY0A 2EVAA 1XQZA 4MXZA 4EYJA 4U43A 4F9AA 2XK4A 4PTGA 4ZZNA 2QOLA 2XIKA 4DTBA 3EIDA 3LFCA 2XNMA 3EQGA 1JWHA 5IKWA 5CF8A 3D4QA 4DCEA 5L6PA 4M84A 3R9DA 1H1QA 2LGCA 2ZYBA 5AUWA 3BYVA 4FKQA 3AMAA 4IVAA 1R78A 4XYFA 3T3UA 4C02A 4GJ3A 4XP0A 5M44A 5M4CA 4ZJJA 4L46A 3UOJA 2R7BA 4KRCA 4D58A 1Y6BA 4G3FA 4IWDA 3TZ9A 3R8ZA 3IOPA 4M7IA 3IECA 3QUDA 4JNWA 4YBKA 4O84A 2XYUA 5HE3A 1V0OA 5K3YA 5D12A 1ERKA 2JDSA 2PUPA 2X7FA 2PVMA 4AT4A 3QHRA 1M17A 3QD2B 4TYGA 5EK7A 2O8YA 5E91A 5CENA 4J98A 4QQTA 2VTOA 2PL0A 1OPLA 3K5VA 4G3EA 4IFCA 3RP9A 2JKMA 2RF9A 4GRBA 3TKUA 3WZUA 4C36A 2C30A 5B2LA 4FNYA 3IW6A 5EYCA 3PUPA 4TYJA 4EOOA 3NNVA 5IMXA 4QP4A 2WU7A 2EUFB 2H8HA 4JBQA 2OJGA 1H1SA 5ANKA 4M68A 4E93A 5E8UA 4EZ5A 5HVYA 3UZRA 3N9XA 4EKLA 4IH8A 2CSNA 5EQEA 3OW3A 4CKRA 2XNNA 1YWRA 4BI0A 5AP4A 2P55A 5CF5A 1KE8A 3UC3A 3KXHA 2PZIA 5KCVA 3MH3A 1W8CA 3FYJX 5EM7A 3RNIA 3VQHA 2BDWA 2UW6A 1SNXA 5DWRA 2BRGA 2W1CA 4D4RA 3NYNA 3MIYA 4YU2A 3CY3A 3HNGA 4K8AA 4LOPA 4NKAA 5TF9A 5IF1A 4DFNA 5KMKA 4CXAA 4LL5A 3PSDA 2UW7A 4YJOA 4DCAA 4LOQA 5T3QA 5JFSA 3TNHA 4FKGA 2H96A 3UC4A 1PXPA 4A4OA 3W55A 2JDRA 2W1DA 4I6QA 1UKHA 4CGAA 4O0SA 2WTIA 1IASA 3HP2A 3K3IA 4L00A 5J1VA 2GHGA 4XG6A 5CZHA 4YP8A 2YLEA 3F61A 4NIFA 5HNBA 3SKCA 5J79A 3MA3A 4IXPA 2YCSA 2VTSA 1VYZA 3FI3A 3V5JA 3OWPA 4JBPA 4RGJA 2XKDA 3ORMA 4EH9A 2G01A 3DKFA 4N4SA 5CEOA 1O6LA 3C50A 3EMGA 4I5PA 2OH4A 3TJCA 3FZSA 3FHIA 3G0FA 5LCKA 3MYGA 4DTKA 4JAIA 3HMMA 2PPQA 4NUSA 5FTGA 3VBYA 5HI2A 4IAFA 3EQPA 4ZY4A 2OKRA 3BEGA 4MXYA 3RVGA 4X3FB 5ANEA 3BPRA 3QBNA 4L45A 4TWCA 4GVAA 3D94A 2BDFA 2Z2WA 3RTPA 3ZBFA 3GGFA 2AYPA 3RBWA 4QMLA 3GT8A 3FXXA 3CQEA 1UVRA 5ETIA 4GK2A 2X6DA 4TKSA 3RPRA 4IZYA 2Y9QA 1PMVA 2W9FB 2WEVA 1UU3A 1UWJA 4L53A 4D9TA 3F69A 2J50A 4JR7A 5K0KA 4RWIA 3TNWA 4Z16A 4PP7A 1IG1A 3EQBA 3BGPA 4E6CA 5IPJA 3K3JA 2PUUA 3PA3A 4OLIA 5E90A 3NW6A 4KSQA 4QPAA 4QMYA 4UXLA 3QXPA 5FWKK 4A9TA 2QOCA 1JKSA 4IC8A 4AZFA 2UW3A 2WMXA 2OJ9A 2WQOA 1W98A 4G3DA 2XNEA 3Q3BA 4FSUA 2JIIA 3LMIA 3U54A 3LFNA 2FYSA 2NRUA 3KK8A 4P5ZA 1LR4A 3LFSA 4I6FA 4KBKA 4ZLOA 3MFUA 2WB8A 4RZVA 2UW4A 3UIXA 4O38A 4BBEA 2F57A 5E7RA 4WIHA 5M55A 4ASXA 4D2RA 2JLDA 3OWLA 4RZWA 4ZMEA 3FLQA 4FC0A 5IA0A 1GZNA 1SVHA 5M09A 3QYZA 2FA2A 3GNIB 3PSCA 4JJRA 2IWIA 4FZFB 4KKHA 4DEHA 5CASA 2BR1A 2E2BA 4ZLYA 3MY5A 3OY1A 5BYZA 3QFVA 2ZDUA 4EL9A 2P0CA 2VO6A 2G2FA 4RFZA 4RIXB 5E92A 4XG3A 3T3VA 4CKIA 4EI4A 3QZFA 5LVNA 2XP2A 3FMHA 4UMQA 4B0GA 3QCSA 4DG2E 3EN7A 5L6OA 1UA2A 3SAYA 4EBVA 2BHEA 4DHFA 2BAQA 2NO3A 4FVPA 2HELA 4RSSA 1OITA 3P7AA 4H1JA 4ZTLA 1PXIA 1Q8TA 5AUZA 2CHLA 1H24A 3PSBA 5HIBA 3ZUTA 1REKA 4O2PA 2BKZA 5KBRA 4FL2A 5CU0A 3NIEA 1URCA 5EI6A 4FEWA 5E8TA 1IAJA 1OL7A 4HVSA 3R28A 2YZLA 2JD5A 2ZB1A 4IM3A 4EK4A 1ZYJA 3HKOA 4FV8A 4YZDA 1UU8A 4NM5A 2C6DA 3P9JA 3VS5A 3CPBA 3WYYA 2A19B 3S3IA 4R77A 3RK5A 4EKKA 4HVIA 3M42A 1P5EA 1H08A 5CX9A 1R0EA 4X2FA 3LPBA 5HD7A 2GQGA 1Q99A 1F5QA 2GNLA 4QQCA 3V6RA 1FBNA 3COIA 3FI8A 1GJOA 3L9PA 4RLKA 5HICA 4G6NA 4GG5A 2FGIA 2JIUA 5CU3A 4D2VA 4AE6A 3FLNC 3QD4A 5L2WA 3JR1A 1KE9A 5IZFA 4B8MA 4FIFA 4WHZA 1ZMVA 2VX3A 1CM8A 5BVDA 4A07A 4ZS4A 1KE6A 2WHBA 3MH2A 3KMWA 4DEGA 5JMSA 4HCTA 4LMUA 2WGJA 5IQEA 2W4KA 3G33A 2XEYA 5J5SA 3TIYA 4XBRA 5IQDA 2GHMA 3PY3A 5EYDA 1BYGA 3OT8A 1OUYA 5DOSA 3ALNA 4U81A 3P78A 3GU6A 4J53A 5H2UA 2JAMA 4Y5HA 3MB6A 3TL8A 3KREA 3ZLXA 4XOYA 3MPMA 3DV3A 5ETAA 2PVFA 3DJ7A 4QPMA 4C2WA 4KKGA 2DUVA 4DH1A 4F65A 4O1PA 5CZIA 3H4JA 5KBQA 2C5VA 3DAEA 5DG5A 5DNRA 2QONA 2XKCA 4XV2A 4Y85A 3L8XA 4PQNA 1YOMA 3A8XA 4BYJA 4UALA 3LQ8A 3IOKA 2PUNA 2OIDA 1YDTE 3F7ZA 3NW7A 3ZM9A 3LOKA 2ITVA 3RAKA 3U55A 2WNTA 4BDHA 3I60A 4CD0A 5JRSA 3RAIA 2W99B 2ITWA 3QTWA 2FSMX 4YSMA 4U40A 5ANJA 4QYYA 4UBAA 4ZXTA 2YZAA 4U80A 4XMOA 3FQHA 5EM6A 1IEPA 4AN2A 2YJSA 3KCFA 4BDAA 2HZNA 4UMRA 3MIAA 4FZDB 3NVKI 4O83A 1GOLA 3QUEA 3H30A 3BGZA 3AMYA 4MCVA 4EC9A 3C4CA 3KXMA 2GMXA 3V5TA 3SV0A 4RVMA 2R3FA 3WZDA 3ZLSA 3R7YA 2R0UA 4U9AA 1BX6A 2BFXA 2W1HA 3UO6A 4X3FA 4M3QA 5A4CA 2QO2A 2VX0A 3OXIA 4RVTA 1PYEA 2F7XE 3GQIA 4R1VA 3O2MA 3WF9A 4D2PA 4AT3A 3DY7A 4UWYA 5AMNA 4FSWA 5C8MA 4E1ZA 3FKLA 2WZJA 4AGCA 3E7VA 3PG3A 4FL3A 4TWPA 5FDXA 2B1PA 4G9CA 3RCJA 5GIOE 4XH6A 5H3QA 2C5NA 5JKGA 4JVGA 2ITNA 2YCRA 5AWMA 4NCTC 2Y4IB 3F88A 3RJCA 3UQGA 2UZLA 2C0OA 5JRQA 5FP6A 2XM8A 2C68A 2OU7A 3JVRA 3L8VA 4B8LA 1YRPA 5BVOA 1Q3WA 1FINA 4ALVA 4O86A 4MD8E 1GZ8A 3CD3A 4YO6A 5JN2A 3QUPA 4GYGA 3TZMA 4JR3A 3UO4A 3TNIA 4F09A 1QPJA 2V7OA 2UW5A 2BFYA 2R3NA 4C57A 3DQXA 4YJTA 5HBHA 5AADA 2ITZA 4FTLA 2J7TA 3H10A 2ZMCA 2RG6A 2BAJA 3GCSA 4OTWA 4R3CA 4RWJA 5JQ5A 5I3OA 2PE0A 3FV8A 1G8AA 1G8SA 3FLYA 3OEFX 4WG3A 2QO7A 2EXMA 3H0YA 4YJNA 5HG9A 4YBJA 2XH5A 3KF7A 1GZOA 1FOTA 1YXVA 2OJFE 3FKOA 4F9YA 5EI2A 5BNJA 5AP7A 4RIXA 2VTJA 4RMZA 4N0SA 2UVXA 1W84A 3BYSA 4MTAA 4ANNA 5DA3A 2RG5A 1WFCA 3VIDA 2I6LA 5IDNA 1OI9A 2VX1A 1AD5A 4RA5A 5CAOA 4FG9A 4AZEA 3A7GA 3P0MA 5DI1A 5FEDA 4YZNA 3BYMA 3FAAA 3VS4A 3Q60A 4MBLA 4F7SA 1MRYA 1PYXA 1KE5A 1P14A 1HCLA 3ITZA 2BALA 4BDKA 5T68A 2Y6OA 4BCFA 4DFZE 3FL4A 3BIZA 3Q6UA 3DCVA 4ALWA 3QZGA 3BHTA 4DFYA 5HU9A 4HPTE 4H3BA 4ACHA 1QPEA 3ERKA 1P2AA 3GU5A 3NDMA 5HCXA 2XVDA 4QMSA 5HG7A 3W2PA 5A14A 4LM5A 4C3RA 5A6OA 3L8SA 5HEZA 2I1MA 3E63A 2JKOA 4G5PA 3ANRA 4JG6A 5IA5A 4IB0A 3CCNA 4FKLA 5IISA 4RC3A 1Q8WA 3EYHA 3KRXA 3NPCA 2WTVA 4YC3A 1SNUA 2XIZA 1IR3A 2DQ7X 2F2UA 4G6LA 4HGSA 3W2RA 2ETMA 3E3BX 5KKRB 2VTMA 4XNEA 3G0EA 4FG8A 5EFQA 4FT7A 4D5KA 2QODA 4L42A 3G9NA 3O23A 4MXAA 5IH6A 2X81A 5LWMA 4BCHA 1OKWA 2RFNA 5ANGA 2E9NA 1YHWA 3NYVA 4TN6A 4BIDA 3R7GA 3ZEPA 4ZTMA 1PXLA 4USEA 3BKBA 5F4NA 4PUZA 3H3CA 2JBOA 4FZ6A 5CTPA 3TZ7A 4N6YA 5GZAA 2C6KA 4U79A 2GTMA 3ZRLA 2QVSE 4J99A 2V7AA 2BRHA 3OD6X 3C0IA 1ZARA 3GVUA 2R3JA 2QHMA 4NZWB 4IAAA 4X2GA 4CLIA 3CC6A 4ACMA 4E5BA 4IAIA 3RM7A 3CSVA 3AC5A 3M11A 2WMRA 4FKJA 4M8TA 2X8DA 3UO5A 3ZC6A 3MN3A 3L9MA 4D4SA 5IEYA 3VQUA 4MF0A 2A0CX 3VUHA 1M7QA 4JXFA 3O50A 1OL1A 4L01A 1JKLA 3BU3A 4NJ3A 4BICA 4BWPA 3ZO4A 3CKXA 3LKMA 5EOBA 2IPXA 2I0YA 2QURA 4ZZOA 5C8KA 5IG1A 1ZZLA 4BVUA 4HPUE 1NVRA 4TWOA 4EK8A 4NM7A 3HZTA 2VTNA 3MV5A 3LJ1A 4BGGA 4UYAA 2QKRA 5BVEA 3EQCA 2R3OA 3HA8A 3QU0A 4RBLA 3AD5A 3OOGA 5DE2A 4BFMA 5KMJA 3BQRA 4FODA 5H8EA 2X9FA 3A62A 5JGAA 3GB2A 3EOCA 2OF2A 4YJVA 4O7VA 3BEAA 3RKBA 4CG8A 4FTMA 3DXQA 4CMUA 3MI9A 4BRXA 5EM8A 4AA5A 4DH3A 4BCOA 3UZPA 4BL1A 5AEPA 4APPA 2PULA 4G16A 3F3WA 3KY2A 4CLJA 3EFJA 3FY0A 4OTRA 5JSMA 4CTBA 4FK6A 5AAGA 4HZRA 2C6TA 2WMQA 1P4FA 4XG8A 5AX3A 4E4LA 4L52A 2W05A 4LFIA 5M57A 3BGQA 3A7HA 4MK0A 2XKFA 3UVRA 1JSVA 4ALUA 5AX9A 4TXCA 4WNPA 4GFMA 4NSTA 3UGCA 4ZSGA 3WOWA 4ASZA 2ZV2A 4LL0A 3GBZA 4WNMA 3VRZA 3EN6A 2W96B 5F9EA 1F3MC 1KV2A 4FYOA 4BGHA 3KXNA 1Q8YA 4ZIMA 4D2SA 4OTIA 5I9YA 3FMDA 4HGTA 5EKNA 3UQFA 4QP7A 3MPAA 1CKJA 2XK9A 1SVEA 3FE3A 3D5WA 4XG9A 4UMUA 3BV3A 2CGXA 4FTQA 5AV0A 3SXRA 4IJPA 2JBPA 3KVXA 4W9WA 3IO7A 3C0GA 3REPA 3V5PA 1JBPE 3BLRA 4AOTA 5CAPA 4D9UA 3CE3A 4BKJA 5H9BA 4EK6A 5DFPA 3NCGA 3BYUA 2B0QA 2YIXA 3Q4TA 3NR9A 3S95A 4X2JA 4JX3A 5ITAA 2VTRA 4HNIA 3A61A 4RX5A 5CAUA 5IEVA 3QD3A 4J7BA 3KXXA 4WD5A 4M67A 1GIIA 4OT5A 3PVGA 3WZJA 3FZTA 3QF9A 4BDCA 4KABA 3THBA 1OL6A 4X3FC 5E8ZA 3WYXA 2JC6A 4AN3A 5CF6A 3VWAA 3PIZA 3NUXA 4LRJA 4YHTA 4J97A 4O7SA 3SW7A 2W7XA 3FZPA 3TTIA 4FGRA 5AR7A 4RPVA 3FLZA 4D0XA 2UZEA 5HVJA 4LUEA 2WQBA 3RPVA 3D2IA 4AE9A 4QRCA 3OZ6A 2FSOX 1OIYA 4FYNA 4ANLA 3FMMA 4AOJA 3BHUA 3PZHA 5FXRA 1V0PA 4P4CA 4OBOA 4ZZMA 2I7QA 2H34A 4TNDA 3G9LX 3R00A 1JNKA 1Q24A 4O0RA 2FSLX 1AGWA 4OTPA 4JQ8A 4C4GA 5FP5A 4BDJA 1YXXA 4FSTA 4RG0A 5HGIA 5GZ9A 3PIXA 3D5XA 1ZYCA 4IB3A 5AAEA 2YIQA 3ZXTA 4FZ7A 4QYFA 3QQJA 4H58A 1R3CA 3QHWA 2R5TA 4R3PA 5HX8A 4O91A 3BZ3A 3CY2A 3UYTA 1NVSA 3OMVA 4CV8A 4O81A 3POZA 3OEZA 4YJPA 3C0HA 3CBLA 3PFQA 3K2LA 4UYNA 4TYEA 3UMWA 1ATPE 2NP8A 2QU6A 3A2CA 3ULIA 2P3GX 4AZVA 5KMOA 4MWHA 4MAOA 3E5AA 5DH3A 4F9WA 1JLUE 2W5HA 2PMNX 2WPAA 4FV5A 2EB2A 5IA1A 2VTHA 4ID7A 5E4HA 4FTAA 5D11A 2GNHA 2C4GA 5KMMA 2PWLA 3QRJA 2O2UA 1BKXA 1H07A 3W2QA 3F2AA 4FT3A 2SRCA 3ZU7A 1H0WA 3TZ8A 2J9MA 5FRIA 5KX8A 4X0MA 4ZMFA 5A4QA 4MF1A 4UZDA 1Y91A 3OVVA 1PMNA 3QLFA 4FT0A 4DEIA 5BVFA 2XCKA 4K18A 2VUWA 4JAJA 2J0IA 2XIRA 4DAWA 4NT4A 4GK3A 3E7OA 3EN9A 2O63A 1OBDA 3PRIA 5HZNA 5DR6A 1TQPA 4U45A 2HW6A 2JDOA 3BHYA 3LFDA 5E9EA 4EJ7A 3COHA 3VS1A 4C8BA 1NVQA 5IQAA 2QCSA 3HUCA 5AV2A 5EH0A 2XK6A 1BL6A 1FGIA 1JSUA 1IRKA 1LP4A 4KIPA 4XV3A 5LOHA 4BYIA 2H9VA 3DKGA 3VBTA 5IQCA 5HO8A 2A2AA 3DPKA 4JBOA 3BCEA 3EN5A 1LEZA 3HRBA 3V5LA 3LLAA 2VWZA 2WQMA 3KEXA 4NM3A 4C38A 4F4PA 2WO6A 3VUIA 4K0YA 3VF9A 3TUDA 1J7UA 3ZC5A 5LQFA 3OUNB 5DBXA 1SMHA 2WMUA 5GINE 3HDMA 1LEWA 3KULB 4DC2A 2FSTX 2GU8A 2OG8A 3ODYX 1H8FA 2UZUE 2WTWA 3HVCA 4L7FA 4S31A 2RFSA 3FZOA 5CSHA 4C4HA 2GNJA 5CI7A 4ASDA 4E20A 3MBLA 4CVAA 3ZSGA 2W4OA 4ACGA 3LE6A 4CTCA 3C4ZA 5I4NA 3V04A 2JEDA 3TACA 3UMXA 2JFMA 2ITYA 4QMPA 4GG7A 3VS7A 4APCA 3TV6A 2OWBA 3S2PA 4H3QA 3P4KA 3FXZA 4BC6A 3TV4A 2Z7SA 3QA8A 3IDCA 3R63A 5CVFA 4AX8A 3A4PA 4RT7A 3DTCA 4IAKA 3TN8A 3ZLYA 5BYYA 5HTIA 4K2RA 4QNAA 4DH8A 1YOJA 1GZKA 4O0UA 1H0VA 3ZEWA 5E8XA 4XG4A 4BF2A 3RAHA 3FEGA 1CKPA 3FZ1A 4CFFA 2YM8A 4MYGA 2IO6A 4USDA 2EU9A 1FPUA 4F63A 3IONA 2GSFA 2GS6A 2CGUA 4JDJA 4DFLA 1QL6A 2BZHB 4FMQA 2UZVA 1FVVA 3FMEA 3OS3A 4XOZA 4IX5A
chains in the Genus database with same CATH superfamily
3TI1A 5HTBA 5DEYA 4BTFA 2UZNA 3NNWA 2VO3A 3JS2A 3O7LD 1KUTA 4OTQA 3BWJA 4YZMA 2WAJA 2XRWA 4BCIA 5IH4A 3F5GA 3NEWA 4ZTNA 3NCZA 2VRXA 4BTKA 3R04A 1M2RA 1XBBA 2PK9A 3NUUA 4JDHA 2CNVA 4FE2A 5FLFA 2QHNA 4RRVA 5AP5A 3DBCA 4J1RA 2J5FA 2XUUA 3PVUA 1UNGA 2PE2A 2WTDA 2W9ZB 4DYMA 3TUCA 2VWYA 5C27A 3FPMA 2CCHA 4FSQA 3ZO3A 4YTCA 1Q62A 2R3RA 5EI8A 3W16A 4EOJA 4YJUA 4D28A 1SVGA 5L6WL 3FYKX 1H27A 4K9YA 4O0YA 2IEWA 2W1FA 4IAZA 3K5UA 4RQKA 4GEOA 2E9OA 3DKCA 1XH6A 3PXQA 3GC8A 1FVRA 3QQHA 4IVCA 4NJDA 2NRYA 2XJ1A 5HG5A 3ROYA 2WQNA 4XRJA 4D4VA 4JRNA 3P5JC 2Y4IC 5I9UA 4E7WA 2XF0A 2AC5A 2B9IA 3F66A 4YZCA 3FMNA 2CN5A 4MWIA 3VF8A 4CYJA 4HYSA 4J71A 3I0QA 3I5NA 3LXKA 1KSWA 3QTUA 4I94A 4W8DA 4KINA 4BCJA 4BKZA 4EH2A 4LMNA 4EQCA 1XH8A 4NFNA 3R7OA 4GKIA 2Q0NA 3RNYA 4NL0A 3B2WA 4P7EA 5HU3A 3KCKA 4UV0A 1TVOA 2F4JA 3GCPA 3MFSA 5D41A 4HCUA 5HG8A 3R7EA 4J52A 1ZOEA 3H0ZA 3Q53A 4QTEA 2C1BA 4ZK5A 2YM5A 2RGPA 5HORA 5CSVA 1OM1A 4E4MA 3R1NA 4LV8A 4G31A 3GFWA 3HMPA 1EH4A 1U5QA 2WU6A 2QKWB 4EZ7A 4AAYA 1OPKA 3ENMA 5J87A 5AR8A 3VS3A 2YABA 2YDJA 4ACCA 5LMBA 3QRUA 1STCE 2ZAZA 3R8PA 5J9LA 3W0QA 4HYIA 4O0VA 4EORA 1H01A 4OGRA 4WT6A 2PZ5A 5ANIA 5C1QB 1Q97A 3ENHA 4CZTA 3IGOA 4WG4A 4X6RA 3N4TA 4P2KA 4F6WA 4IJ9A 5KE0A 2YEXA 3QZHA 4EH7A 3TDWA 3LHJA 1H4LA 3ZBXA 2X39A 4F1MA 1YWVA 2HWOA 2E9PA 2OICA 3Q5ZA 2R0IA 3PP1A 1BMKA 4L3PA 4GUEA 2ERZE 4UWCA 4O21A 2UZOA 2HAKA 3O8TA 3PVWA 3GQLA 4EQUA 2OK1A 3QLGA 2VO7A 3LMHA 5KUPA 4AS0A 3HL7A 3COKA 2YFXA 5AV4A 1PRYA 4E8AA 3P08A 3AC1A 3AKLA 3EQRA 5HNIX 4EUTA 4O27B 4NW6A 2PVHA 2LAVA 3OT3A 4BCPA 4WBOA 2V62A 2QLUA 3TWJA 5LVMA 2WEIA 3OCGA 5KHWA 3E93A 4KAOA 4FR4A 3V8WA 4CEGA 3MPTA 4QMNA 3Q52A 3QYWA 4NFMA 4ANSA 1B39A 4BIBA 5HE2A 4MBJA 4UWBA 3NRMA 4M97A 2UZDA 3GC9A 4IWOA 3MY1A 3VUGA 4RFMA 4DGMA 3GP0A 2HW7A 3IW7A 3ULZA 4IAYA 5CEMA 4IWQA 5KKRC 2ZDTA 3C51A 2O65A 3KULA 3R8VA 3ZRKA 4E3CA 4KIKB 3D5VA 3ZRMA 3I6UA 4BI2A 2X0QA 2ZMDA 5LWNA 3W2SA 2PZPA 4YLLA 4M13A 4YZ9A 4KRDA 2Z7LA 3R1YA 2IVUA 3ZM4A 1Q4LA 3VJOA 4DITA 4ANBA 1OIUA 1GIJA 3I5ZA 4M66A 5HLNA 3DNDA 3FC2A 3RK7A 2WELA 1PXJA 5JFVA 4USFA 4NH1A 2IVTA 4F9CA 3VVHA 3D7ZA 3ZLWA 1XJDA 1PF8A 3SXSA 4BCGA 4EBWA 3PP0A 5JQ8A 5M4IA 5AUXA 2ERKA 5CXZA 5BPYA 5M51A 4E26A 2VWVA 4DH5A 3B8RA 4CG9A 2B7AA 2YLFA 3ACJA 4FV2A 4E5AX 5AV3A 4BR3A 1H26A 5CEPA 2B54A 1M14A 4U8ZA 2WMBA 4RIOA 4E4XA 3IKAA 4QMWA 1M52A 1QMZA 3R1SA 4QMZA 4RJ8A 3W0NA 4FVQA 4RIYB 5BMSA 2JAVA 3Q2MA 4QYHA 5CU4A 5L8JA 3OOMA 4DLIA 1JOWB 1FMOE 5IQBA 2ITOA 3OXTA 4ZAUA 3MJ1A 3R9NA 2WTKB 4AA0A 2VTPA 5HVKA 3HV4A 4Y8DA 4ASEA 3KRWA 4AUAA 2R4BA 3UDBA 3CEKA 2G2IA 5CT7A 3C9WA 5CXHA 4E4NA 3SVVA 3SOAA 4LI5A 4QP6A 4RX7A 2OIBA 3O96A 4YGAA 3UODA 3KFAA 3KL8A 2O0UA 3LAUA 4NWMA 4OUCA 4EOQA 3VBQA 3W32A 4ZSEA 3I7CA 2UW9A 3OWKA 4AXCA 2QOHA 4QD6A 5BX0A 4DEEA 2BHHA 4FTKA 4MUQA 3ET7A 4QT1A 4FEVA 4KA3A 4YZBA 2VGPA 1WVWA 4W9XA 2OO8X 2XK8A 2YDKA 3A7FA 2YIYA 3MSSA 3I4BA 4Y46A 3UIBA 4YC8A 2GQSA 3HECA 2VAGA 3C5IA 3QKMA 4AQCA 5J1WA 2JFLA 4J8MA 5H8GA 3R7UA 1OBGA 3EFWA 3SW4A 3W2OA 4RJ6A 2ETRA 4I0TA 3ZFXA 2WOUA 3ORNA 1MRUA 3PRFA 4MQ1A 3U51A 4EC8A 3VUDA 3O5AA 5LVLA 4FBXA 3QL8A 4O22A 1K9AA 4D0WA 3OFMA 4PPBA 3ALOA 4GIHA 2PZRA 4CSVA 3PJ8A 4YTIA 4EHVA 3BLHA 4Y83A 2WMAA 3DQWA 1OL5A 4R5SA 3RWQA 5IMEA 3DXPA 2PVKA 3PWYA 4EHEA 3HYHA 2H6DA 4G3GA 3BWFA 2IJMA 5J95A 4FI1A 5L3AA 1OECA 4FTUA 2C5YA 2X4FA 3R83A 4K11A 4BJJB 3AC4A 2EWAA 5IU2A 2X2MA 2C1AA 1WBVA 2PMIA 3DBFA 3KF4A 2ESMA 4PMSA 4QP1A 4R5YA 4S34A 5F94A 3CP9A 3QX4A 3A99A 5C01A 1U54B 2WXVA 1W83A 5DHJA 2CLXA 4I6BA 3OC1A 1G3NA 3E8NA 1ZOHA 2GNIA 1M2PA 3VRYA 3MA6A 4AG8A 4U3ZA 5A4TA 4OW8A 1DI8A 4JDKA 3ZO1A 1FMKA 3VS0A 3ELJA 4HNFA 5HNGA 5M4FA 2ITUA 3DT1A 3OROA 3M1SA 4Z9LA 3KMMA 2HZ4A 3MB7A 5HHWA 3IQ7A 3V5WA 5HTCA 3Q6WA 3V8TA 4EOMA 2XK7A 3LQ3A 4AU8A 3Q4CA 5CSXA 3QQFA 4EYMA 3AT2A 4MD9E 4CRSA 3MGYA 4O6LA 1VZOA 4PF4A 2J0LA 3FI2A 5EYKA 3D2KA 4AZTA 4GK4A 1FQ1B 3NS9A 4K77A 2XBAA 3PG1A 3W10A 3FMJA 3TEIA 3BHHA 3IW4A 5KMIA 2E9VA 3ODZX 3PXRA 3F3TA 2PVRA 3VULA 3ZYAA 5DR2A 3CPCA 3GUBA 2RFEA 1YKRA 4QYEA 2V22A 3HAVA 3R21A 3TNPC 2R3GA 5EHOA 5A6NA 2J0MB 1J91A 2FB8A 4QPSA 2QQ7A 4IC7A 5M56A 3DXNA 3I81A 4A4LA 3BLQA 3O0GA 4X2KA 4PV0A 4EK3A 2IVSA 4W4VA 2OXXA 4FV9A 4PDYA 5CANA 5G1XA 4WG5A 4R7IA 5LJJA 2B9JA 3QCXA 3QGWA 4GH2A 4KIKA 4YLJA 5CS6A 5HLPA 3G51A 3UP2A 3VJNA 3WF7A 4KNBA 4BZOA 2YACA 5BVWA 1S9IA 3DZOA 4QTCA 1WBPA 4I5MA 5EKOA 4ZP5A 4ZS0A 5FBOA 3HMNA 5GZ8A 1XHAA 2J0KA 4AGDA 5FBNC 3HAMA 3LFBA 4N70A 4YMJA 2CNUA 4BCNA 1J3HA 4FKRA 3D14A 3AOXA 4IMYA 1PJKA 4HGLA 5D9HA 4BDFA 3PPJA 4IFGA 3TCPA 3LQ5A 1J1BA 4BI1A 4AFEA 3AT3A 3PPKA 4FJVA 2XIYA 3O71A 4BCKA 3ORZA 3IPHA 2IF8A 5EG3A 5F1ZA 4RFYA 2V55A 4U0IA 5CU6A 5FUTA 1WCCA 5FD2A 1G5SA 3NAXA 3IS5A 3A7IA 5HCYA 4JMQA 1Y57A 4O7LA 1CTPE 1YI4A 4KB8A 4CFWA 2V0DA 4AW5A 3R71A 2X2KA 3CR0A 3NUYA 5T6KA 3D5UA 3NGAA 2YISA 1Q41A 3PTGA 4RIYA 3FQSA 5GNKA 2W1IA 2AQXA 3TG1A 1Y6AA 3W0SA 2R3PA 5M53A 4E6AA 2EXEA 3UP7A 3EYGA 4X3JA 4AA4A 1KV1A 4JI9A 3DLSA 1U59A 3ZSHA 4R78A 1WBOA 1PHKA 2OFVA 4OBQA 1XO2B 4R8QA 5AUYA 4PNIA 2VTLA 3LCSA 1PKGA 4G1WA 3C4XA 4RC2A 3RCDA 4QP9A 4NTSA 2CMWA 3PXZA 1DM2A 4U44A 4O1OA 1R39A 3U8WA 3I1AA 4NK9A 5KMLA 4C37A 1APME 3G5DA 1YWNA 4ZSAA 4A4XA 2FO0A 4KD1A 3TKIA 4C4JA 4C4FA 5D10A 5AA9A 5CEKA 4CT1A 5IQHA 3ZOSA 3R30A 5EYMA 4EH3A 5LARA 4BZNA 3U9CA 4BTMA 3TKHA 2QG7A 3IW5A 3C13A 3VUTA 4RX8A 1E1XA 1B38A 2IZUA 2HWPA 3H9RA 3HGKA 3LJ0A 1JKKA 4YJRA 4KS7A 5HESA 3VUKA 3RALA 4K6ZA 1HOWA 2VN9A 2XMYA 4XV9A 1ZYLA 1B6CB 2VTIA 4FTNA 4JS8A 5AUUA 2BRNA 2BIKB 3RGFA 2ZV7A 4I24A 3CTHA 3DDQA 5TR6A 1HCKA 1OUKA 1OMWA 2X8IA 5E8SA 4D5HA 3CTJA 4WNKA 3GENA 3S4QA 5EQPA 3PJCA 2HCKA 4OBPA 3NNXA 3WIGA 2BZJA 3P79A 4BJJA 1PMUA 3Q2JA 3R9RA 3IDBA 4GUBA 1W2CA 3SRVB 4ENXA 5KNJA 2XM9A 4BCQA 5HO7A 1BI8A 1J7IA 4L9IA 1BL7A 4FKVA 3AGLA 1Q5KA 2ITTA 2OBJA 4LGHA 3R8UA 2J0JA 3KB7A 3RHXA 2VWUA 1U54A 4FIGA 4GJ2A 1O6KA 3G6GA 3FI4A 5G6VA 3QZIA 2IZSA 3MJ2A 4NM0A 3U6IA 4MKCA 3ZZEA 4QMOA 4IVDA 3UG2A 5BYLA 5CEQA 2W5BA 4OR5A 4M15A 3FC1X 4GVJA 2QOBA 3LFEA 2IW9A 4EQMA 3C4FA 4MD7E 3QCYA 5ANDA 4D2WA 5FEEA 5AFVA 1GAGA 2O5KA 4FNWA 4XG7A 4D1SA 1VEBA 4ZTSA 4F6SA 2P2HA 3FMKA 4FKTA 2X1NA 2WFYA 3QC4A 3SG9A 3LCTA 3R0TA 4GYIA 4N6ZA 4UZHA 4UMPA 3FQEA 2XAMA 4CQEA 3D7TA 4FSNA 5AR5A 3BBTB 4JT3A 4Q9ZA 5DPVA 4M69B 3L8PA 2JDVA 3SC1A 3V6SA 2QG5A 3DB6A 4R7HA 5E1EA 4WSYA 1OGUA 2XEZA 4AN9A 3PLSA 4IACA 2VO0A 4XP2A 1BI7A 1PXOA 2C3JA 2WTJA 4B99A 4Q2AA 3CLYA 2VWWA 3U6JA 4C4EA 5L2QA 2C5XA 2R3HA 4PWNA 3SXFA 4TL0A 4RIWB 3OHTA 4MH7A 3CTQA 2YN8A 3DKOA 3R2BA 4A9YA 4DN5A 4QMQA 4XV1A 2AC3A 5AP2A 1SM2A 5C4LA 4IQ6A 4FX3A 4DA5A 2HOGA 4GCJA 3F9NA 3A4OX 1XH4A 3BU6A 4JG7A 2CCIA 3V51A 4PMTA 4QQ5A 2ZOQA 3RPOA 3V5QA 4UX9A 2VWXA 2YITA 2OXDA 3OCTA 3QAME 4GT3A 4JLCA 5FXQA 4IM0A 3TXOA 4FSYA 4FA2A 3HP5A 1YDRE 3KN5A 4I6HA 4V05A 4G17A 2VZ6A 2VWBA 3HEGA 5CF4A 2PVJA 5E8VA 4D4YA 4DHZA 3NIZA 3OY3A 2Y8OA 3KA0A 4WUNA 2ZB0A 4FOBA 2C6MA 2JKQA 2X6EA 4BDEA 4W4XA 3OUKA 2XZSA 4I5CA 4L44A 3LLTA 1TQMA 3QGYA 4U41A 5AP0A 2J6MA 1PXNA 4RC4A 5IA3A 4OTDA 5CSWA 1U5RA 5DRBA 4ARKA 1BLXA 2YCFA 2C0IA 1NY3A 4AACA 2X0PA 3E64A 5DEWA 3NW5A 4PP9A 3EWHA 4XS2A 1ZYDA 2FVDA 5HX6A 4Y5QA 3OWJA 2QO9A 1H1RA 3OTVA 4GW8A 4DBNA 5D7AA 4AW1A 2YM4A 2Q83A 4A9RA 1UU9A 1OKZA 5HLWA 5KMNA 3GC0A 4ACDA 4BBMA 3R73A 2YWVA 4IZAA 3UOKA 2XA4A 5E8WA 4DLJA 5BMMA 1Y8YA 3OF0A 3QTXA 4TPTA 4C35A 3HA6A 4F70A 4CCUA 1KWPA 5FXSA 1YHVA 1ZOGA 3E88A 4NEUA 4PDSA 4U6RA 2I0EA 3AC8A 2AUHA 3T8OA 3EL7A 4WUAA 2B9HA 3PA4A 2PMOX 5HKMA 1DAWA 4LUDA 2WTCA 4Y73A 1A9UA 4BDIA 4FKWA 4DH7A 3HLLA 3RZFA 2RKUA 3F2NA 3WIKA 4AW0A 4D1ZA 5DYJA 2VNWA 4YUQA 4Q9SA 4BY9E 1IA8A 4AXEA 4JQEA 2VD5A 4DHIB 4LG4A 3RHKA 3JY9A 3LCOA 2DWBA 3ORLA 3DNEA 4RJ4A 4XLIA 1GY3A 2HYYA 3IDPA 5ANOA 4XEYA 4CRLA 3DZQA 3RAWA 5K4IA 5M07A 4DE4A 4LOOA 5HE0A 4DTAA 4IB1A 3ZONA 3E3PA 2G2HA 4F7JA 4ZTHA 3G90X 3L9NA 3KC3A 5AP6A 3UOHA 4HVDA 3ACKA 3WF8A 2IG7A 4BZDA 2GDOA 1WVXA 3F5UA 3WBLA 4CNHA 4DFUA 2HY0A 3RINA 4O7TA 1U46A 3KQ7A 5JH6A 1WBTA 3ORKA 3Q32A 2A4LA 2GS2A 5KZ0A 1W7HA 4BDGA 2VTAA 3FUPA 3HDNA 3SRVA 3DFAA 4R1YA 2OZAB 3OP5A 2WTKC 4W4YA 5TO8A 1CSNA 3EB0A 2HY81 3V01A 3R01A 3F6XA 3WF5A 5ACBC 1Q8ZA 1OVEA 3PPZA 1XWSA 3FY2A 4O6EA 3U6HA 4BB4A 5JZJA 4IWPA 5C9CA 5DIAA 1IAHA 1CMKE 2GQRA 4FEQA 5C03A 3MWUA 4DFBA 4WOVA 1OKVA 4AP7A 5J9YA 4FNXA 2XNBA 4ENYA 1URWA 2HXQA 3ZXZA 5LXMA 5TE0A 3F3ZA 3PDTA 4O4DA 1NA7A 4IDTA 5HO6A 4CZUA 4UN0C 4FKSA 2PYWA 4QP2A 4TNBA 4FTOA 5IEXA 3R8LA 2PVYA 4MNEB 1REJA 4OT6A 3KRJA 3AD4A 2B4SB 2FH9A 4WBBB 1MQBA 4FZAB 3HV7A 3PA5A 5CYIA 3W8QA 3QTRA 5GHVA 4FEUA 3CIKA 3U9NA 4YPDA 4B6LA 4UY9A 4JG8A 5EDQA 1ST0A 4FKPA 4M69A 3ROCA 4EOSA 5K5XA 4DT8A 4IIRA 4QMTA 5L2IA 3Q9ZA 3BV2A 3OBJA 2W1GA 3MH1A 5AM7A 1RDQE 1TZDA 4QP3A 2I0VA 4S32A 4MXOA 4JL9A 1VLRA 3LW0A 3B2TA 4YR8A 5IH5A 1T46A 4XG2A 5LMKA 4DBXA 4QTBA 2BRBA 3ORIA 4XX9A 3FSKA 1LUFA 3CJGA 4RIWA 3LJ2A 1W0XC 3HV3A 2YIWA 3T9TA 4D1XA 3MY0A 3ZHPC 4EH6A 3VO3A 3ATSA 1XH5A 4F7NA 3Q96A 1VJYA 4M0YA 3HRCA 4A7CA 1KOAA 3OTUA 5JGBA 4Q5HA 1QPCA 3D15A 4HVHA 5K4JA 3NZ0A 3KVWA 3I7BA 1XR1A 5CI6A 4F0GA 4HW7A 1JKTA 4GU9A 3AT4A 2BVAA 5F20A 1M7NA 5LVOA 4FVRA 4OTFA 4EOIA 4QNYA 1ST4A 3A7JA 4WA9A 5CSPA 3Q9YA 5HQ0A 4IM2A 5GIPE 2JIVA 3CS9A 5FM2A 5FDPA 3II5A 3QQLA 4PPAA 4TYIA 4PL5A 4QMXA 2Z60A 5A4LA 4L68A 4CFXA 2GHLA 3LXNA 4DT9A 2IVVA 3F3VA 4H1MA 4GIIA 4UB7A 3CQWA 1ZLTA 4GT4A 4WNOA 1UNHA 4RJ3A 4FT5A 3AD6A 3P7BA 4TTHB 4ITJA 4OAVB 2PVLA 2C69A 1OZ1A 3DBQA 3TTJA 2IW8A 4ERWA 4W4WA 5AA8A 5L4QA 3FJQE 3VN9A 5HBEA 2WOTA 1RJBA 3FBVA 1VYWA 3KXGA 4QMVA 4C59A 5IA2A 2BROA 2GNFA 5LMAA 2R3LA 1ND4A 1WZYA 4O4BB 4RJ5A 5CNNA 3P86A 5TOZA 2OJIA 5A54A 1OIQA 5ACKA 5CVGA 4EH4A 5CAVA 4ANMA 3FL5A 2X7GA 3RK9A 1WMKA 5CVHA 3HUBA 1Z9XA 5DT4A 1RQQA 3DAKA 2OXYA 3IG7A 4MXXA 3BU5A 3R22A 2HZ0A 4NCTA 3LCKA 4O0XA 5A3XA 2G15A 2J90A 3LXPA 5A46A 2Y7JA 4XJ0A 5I0BA 2P33A 4FV7A 3FXWA 3PJ2A 3SDJA 4QP8A 5AJQA 2IW6A 3HX4A 4BCMA 5CALA 4U7ZA 3DGKA 5BUJA 2OSCA 4KSPA 1QPDA 5L8LA 4G2FA 4R7BA 4YJSA 2XS0A 3E8DA 3FLWA 5AP3A 1TKIA 5EHLA 3NFGB 3DS6A 4I92A 2JKKA 3GU8A 4ONAA 3UE4A 4MVFA 4DGOA 3NNUA 4QYGA 2PVNA 4O0TA 4ZTRA 3AC2A 2A1AB 5AV1A 4EWQA 5BQ0A 5E8YA 4I93A 4LRKA 3UIMA 3KMUA 4I3ZA 2JITA 2OW3A 2B53A 3E8CA 3KGAA 3OCBA 4UEUA 2XYNA 5B2KA 2GNGA 3H9FA 4CQGA 4I20A 4YO4A 3LM0A 4FL1A 1R0PA 3PLAE 4KBAA 1ZMWA 2F49A 4RQVA 1YXTA 2QI8A 3UYSA 3DB8A 3POOA 5HBJA 4M14A 5EHYA 2OZAA 3N51A 4LV5A 3AXWA 2WMWA 3DDPA 2PTKA 4FTJA 2CDZA 2YDIA 3DBDA 3HMOA 3NMUF 1V0BA 2W06A 1OPJA 2CJMA 3EFLA 3MFTA 4EHGA 1R1WA 3DAJA 5ETFA 4FV0A 4X7QA 5AR3A 3MDYA 4F99A 3ORTA 2R9SA 3QD0A 2RFDA 3U87A 3HMIA 5CWZA 1UNLA 1Q61A 5JGDA 5DMZA 5K9IA 3D9VA 3R9HA 4IADA 4I0RA 1E9HA 2OH0E 3QKKA 4YPSA 1I09A 3MVLA 3PYYA 4B7TA 3EQHA 5I3RA 2NNWB 3PVBA 4O7RA 2ETKA 4MNEA 5TT7A 4ZEGA 3MS9A 4NU1A 3S00A 4PTCA 4C33A 2XCHA 3R2YA 2IN6A 3VUMA 4XP3A 4EUUA 2UVYA 1A06A 5HOAA 3LIJA 2OGVA 4O7ZA 2CKEA 2XBJA 3CQUA 1ZRZA 4AAAA 4I41A 3SX9A 4I6LA 5LCJA 1YI3A 2WIPA 3VBWA 4GSBA 3AC3A 4TT7A 1F0QA 4OTGA 4BDBA 2C6OA 3G6HA 3WE4A 4DEAA 5AIKA 3QALE 3RZBA 5J5TA 2JGZA 2B52A 3GI3A 5E1SA 2VWIA 4K33A 2IZTA 3NUPA 5IQIA 5IUGA 4AGWA 3DFCB 5DLSA 1VR2A 5A9UA 1UU7A 4EOKA 1A48A 3RI1A 1V1KA 2NPQA 4V01A 2XJ2A 3ZSIA 4D2TA 3D83A 1PXKA 3W1FA 3LFQA 1PMEA 1OB3A 3Q4ZA 4IDVA 4C7TA 4Q5EA 3WARA 5CEIA 2QC6A 5I9XA 1RW8A 3WF6A 3AGMA 4PL4A 3UDZA 3KU2A 3ORPA 4H36A 1Q3DA 3SHEA 2GFSA 3MTFA 5K0XA 4CMTA 3NUSA 4GT5A 1O9UA 5CQWA 4A9UA 2O3PA 2A27A 3F82A 4QTAA 2UUEA 3C4EA 4R3RA 3U4WA 4CMOA 5AUTA 3TT0A 5IQFA 2C47A 3QWKA 3SGCA 1XBAA 3UVPA 3DA6A 4U3YA 2CGWA 2RIOA 3OCSA 4JIKA 5D7VA 4XRLA 4FSRA 3SLSA 4EHZA 5HIEA 2XRUA 2GTNA 2CKPA 2XB7A 1T45A 4LYNA 4PX6A 4YSJA 3GOKA 5JK3A 3F2RA 3E87A 1NT2A 3R1QA 3Q9WA 3GCUA 2QR7A 3I6WA 5F95A 3HRFA 1PW2A 3SQQA 2R3IA 1L8TA 3A8WA 5LMKC 5CAQA 2IZRA 1ZYSA 2J2IB 3TUBA 3JUHA 3UNJA 5H8BA 5BV3A 2W0JA 4K1BA 4LQMA 1XH9A 3F7WA 5EQYA 1H1WA 1FVTA 1X8BA 4IX3A 4JQ7A 4EEVA 4H05A 2HENA 3DK7A 3NYOA 4M0ZA 4ZY5A 1ZZ2A 4FTIA 4L3JA 1XMMA 5FG8A 3DU8A 3UNZA 2O64A 5FTQA 3ZTXA 4A06A 3BL9A 1BUHA 2WKMA 2J5EA 2UZWE 1RE8A 4QOXA 2X0OA 2XANA 4O7YA 5BVNA 2QLQA 4UMTA 4EK5A 5BUIA 4F78A 4KIOA 4RWKA 1OIRA 3CJFA 5JZNA 4GFGA 4IZ7A 2W4JA 2C6EA 5GJDA 5CLPA 4EOPA 1DS5A 4IB5A 4ZSJA 4YTFA 4Z7HA 3G15A 4G6OA 4S2ZA 4PDPA 2YJRA 4ZJVA 5HE1A 3QA0A 1YDSE 2F9GA 4I5HA 2GS7A 4ORKA 3TM0A 5AUVA 4IEBA 1Y8GA 4IX4A 2QOFA 3TDVA 2KULA 5JT2A 3PFYA 3G2FA 4TWNA 2R7IA 1YHSA 3UVQA 3ATTA 4G34A 2OF4A 2XNGA 2UV2A 5DT3A 3D7TB 4KS8A 3QKLA 5C8NA 4RX9A 2WMSA 3MW1A 4X6QC 3TIZA 4F1TA 3HV6A 3KN6A 2CKOA 2PE1A 3QQUA 5D1JA 4C3FA 5AR2A 5IUIA 4CCBA 4E6DA 4AGUA 4H39A 4FNZA 3GOPA 4MQ2A 4GFOA 4FTCA 3LFFA 4JDIA 5TKDA 1JQHA 4PL3A 2C5OA 2V5QA 2BUJA 3JY0A 4CFVA 5HIDA 2CLQA 4O7NA 3VHKA 3R7VA 4WRSA 5AIRA 1ZAOA 4YHJA 3OW4A 3DJ5A 3MVHA 1YVJA 3QXOA 4R6VA 1WAKA 3C7QA 3VBXA 2PZYA 4PY1A 3PZEA 4ITHA 4LRMA 5FM3A 3UG1A 3DOGA 3R7IA 2F7EE 1K3AA 3EJ1A 3KXZA 3SOCA 2F2CB 2VTQA 3ZUUA 2W5AA 4C58A 4BGQA 3VBVA 3E8EA 4HCVA 3AG9A 3UPXA 1H00A 3BBWA 4XBUA 2G1TA 4QMUA 1SZMA 3BI6A 3QC9A 4FIIA 3LFAA 1U4DA 3HV5A 2BAKA 1M2QA 2YCQA 3D0EA 3EKNA 4I23A 2R3MA 4TY1A 2CPKE 4D55A 4FK3A 3C5UA 4BIEA 3QX2A 4FSMA 2CN8A 3AQVA 3KIOC 4U42A 1K2PA 2YERA 4C61A 4AZSA 5AP1A 2Z7RA 4IHPA 4FTTA 3JPVA 3V8SA 4XLVA 4FTRA 5B7VA 4AFJA 4DF3A 4DGGA 2EB3A 4X21A 2WIHA 4DG3E 5C26A 4O7WA 3O7LB 5I5ZA 1PY5A 3UOLA 3ZCLA 4CT2A 4YLKA 2QOKA 4CFNA 3M2WA 2UZBA 5DN3A 4O2ZA 2KTYA 4ZY6A 4HYHA 2Y0AA 2PSQA 2UW0A 4L7SA 4FIEA 4Y72A 3E92A 5GJFA 4GV1A 3RWPA 4ZLZA 4CKJA 3UNKA 4H3PA 4AZWA 1KE7A 3H9OA 2EXCX 5L2SA 1JAMA 1PXMA 4QTDA 1YW2A 2I40A 3F5XA 2OFUA 4ERKA 3PJ3A 4JIAA 5J8IA 3QCQA 5CT0A 4F0FA 2UVZA 4JX7A 3MVJA 5AM6A 4PPCA 4S33A 3UBDA 4JOAA 4ANOA 4J95A 4F9BA 3N4UA 4J8NA 4ZOGA 3WE8A 2C3KA 4E73A 4OTHA 4F0IA 3NUAA 5EDRA 3LVPA 4FV4A 5HCZA 4J96A 3CGOA 3QTZA 3FSFA 3QRKA 4C2VA