3NUYA

Phosphoinositide-dependent kinase-1 (pdk1) with fragment17
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
286
structure length
276
Chain Sequence
QPRKKRPEDFKFGKILGEGSFSTVVLARELATSREYAIKILEKRHIIKENKVPYVTRERDVMSRLDHPFFVKLYFTFQDDEKLYFGLSYAKNGELLKYIRKIGSFDETCTRFYTAEIVSALEYLHGKGIIHRDLKPENILLNEDMHIQITDFGTAKVLSFVGTAQYVSPELLTEKSACKSSDLWALGCIIYQLVAGLPPFRAGNEYLIFQKIIKLEYDFPEKFFPKARDLVEKLLVLDATKRLGCEEMEGYGPLKAHPFFESVTWENLHQQTPPKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords PkB-like
publication title Aminoindazole PDK1 Inhibitors: A Case Study in Fragment-Based Drug Discovery.
pubmed doi rcsb
source organism Homo sapiens
total genus 88
structure length 276
sequence length 286
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2010-07-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3nuyA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3nuyA01
4EORA 4M15A 5HCZA 3O23A 2R3OA 5FRIA 3O2MA 1R39A 1BYGA 3RPSA 4JJRA 4IX6A 4IE9A 2GS7A 3BELA 3Q9XA 2ZJWA 5FDXA 1DAWA 3BWJA 4IX5A 4DAWA 4IAFA 3UIMA 4PV0A 3QUPA 5IQAA 1WBOA 2JDTA 3AG9A 3NDMA 4QYFA 4RFYA 4F9YA 2GTNA 2YM3A 2WMRA 3OEZA 3A7GA 4L6QA 1G8SA 2EXEA 2PZ5A 4IACA 4M69B 4I4FA 4UV0A 3V5WA 3DKCA 5EW8A 3OROA 1XR1A 5CALA 5BYZA 3BE2A 4NIFB 4V0GA 3S95A 4P5QA 1KSWA 3L8PA 5AM6A 3W2SA 2WEVA 4UX9A 3LFSA 4OAVB 4CD0A 4FV3A 1PMEA 4R1YA 2C0IA 3O7LD 3PPZA 4YTIA 1O6KA 5JGDA 4WBOA 2IW9A 3VHEA 3VS3A 3GGFA 4TXCA 3GU7A 5JFVA 2F57A 4GFMA 5E92A 3BGQA 4FTCA 4MHAA 1OL1A 2W0JA 3OD6X 4PTEA 4UB7A 5CTPA 5IH6A 4O83A 4G5JA 3M11A 2UW7A 4JRVA 4W4XA 4XBRA 4ZK5A 3WZUA 4FMQA 3CSVA 5IQEA 4PDPA 4PNIA 5HI2A 1FVVA 5HIEA 4D4VA 4K18A 1CMKE 4CZUA 3KXMA 5HX6A 4FTTA 1OIRA 4EHZA 4QMXA 3EIDA 2A27A 3FZSA 4ANBA 3D7ZA 5L8LA 5EM5A 4J8NA 4ZZMA 4FR4A 2XIKA 3ZC6A 3V5LA 3KVXA 4FKOA 5J9LA 3ET7A 2YDKA 3FDNA 3QKMA 4J7BA 4I5HA 5EYCA 1NVRA 3PTGA 1YDSE 3KCKA 4D1SA 5I3RA 3CE3A 4Q5EA 5I3OA 3U9CA 1GZOA 3LM5A 1FBNA 3LIJA 4FTMA 1OPLA 3UIBA 3CQWA 2QI8A 4FIGA 1P14A 4LFIA 2BR1A 3P9JA 2QKRA 4QP4A 1RDQE 3GI3A 2ZDTA 3FSKA 4G17A 5HG8A 3R1NA 4XP3A 5KMIA 5KNJA 1F5QA 1Q4LA 2RFDA 2NRUA 3E88A 2WTDA 1M7QA 3PA3A 4FKPA 4QMWA 4YC3A 4FC0A 3FKLA 4ASDA 2B9JA 3CTHA 1MQBA 2A4LA 2BHEA 4IWOA 4NCTA 3W10A 3W32A 4LGGA 3C0HA 4AOJA 5JZJA 2AYPA 5CSPA 5HG7A 3BYOA 4WNOA 4YC6A 3ZDIA 3N4VA 3GT8A 5HKMA 3FMEA 4B6LA 1YWNA 3R28A 3V5JA 3KREA 3KRJA 4ZJIA 2ZMCA 2V7AA 4K6ZA 3ZLWA 1Q8UA 1M7NA 1AD5A 2OH4A 2OI4X 2QO2A 4JIKA 4RG0A 5GHVA 3BLHA 5JRQA 5C1QB 4O27B 3F69A 2ITOA 3LJ2A 3PY1A 5C4LA 2P2HA 1XO2B 3IDCA 2H9VA 4JI9A 3Q3BA 4YURA 3F2AA 2H96A 3AGMA 3II5A 2CN5A 3VUIA 1ZYCA 4FTJA 3EMGA 3C4CA 5E91A 1CKIA 4R77A 2JIIA 3A8XA 2GFCA 3PE2A 4BZNA 4JDIA 5CU4A 4RSSA 3NPCA 5D1JA 4BDBA 4UXQA 4QOXA 3ERKA 5FBOA 4KBKA 3KXNA 4W4WA 1KWPA 5L2WA 4FI1A 4H3BA 4I6FA 4YZDA 5HQ0A 2QOOA 5M08A 2Y4PA 4RPVA 2CMWA 4WA9A 3C4ZA 4FOCA 1B39A 1JKSA 4FSNA 4C0TA 3N51A 4FKWA 3FZPA 4L44A 5GINE 4XS2A 2PYWA 3ZSHA 2GNFA 4HCUA 5HLNA 3IW6A 4QPAA 1HCLA 5DA3A 2OJFE 4A7CA 5BYLA 5HBJA 4FEVA 2J0LA 2CGUA 4E6DA 4RGJA 3R7EA 2UW5A 3FHRA 3PVGA 1RJBA 5DH3A 2VO0A 2ONLC 2YITA 4TNBA 4XUFA 3UO6A 4OT6A 3LQ3A 2YA9A 1OKWA 3EFLA 4EL9A 4QP8A 3HMOA 3UMWA 4F0FA 4MXZA 4M68A 2R0UA 3F2RA 4HVGA 3ZS5A 3EZVA 4IC8A 4A9SA 1CSNA 2XUUA 5FGKA 4EWQA 3QZGA 5CVGA 1WMKA 4QTCA 3RALA 4EK6A 2ZM3A 1H28A 4MAOA 2C69A 4ZTNA 3GXLA 4P7EA 3V04A 2OXYA 3B2WA 4K8AA 2W1HA 2J6MA 4BDJA 5GIOE 1A06A 4C2VA 5B7VA 1MRYA 3H0YA 2WQOA 5HE2A 2ITUA 5E8TA 4KIPA 2CCHA 2YIXA 5FXRA 5AUWA 4BIDA 4RC3A 3GB2A 4WRSA 5EW9A 3DZQA 1HCKA 1CM8A 3H9RA 4UEUA 3T3UA 3MH1A 1VR2A 2ITNA 2YZLA 2XZSA 3BEAA 1RE8A 4QNAA 4E1ZA 5ANIA 4BBEA 3W55A 4OTFA 1LEZA 5D12A 5FP5A 3OUKA 5HU9A 2V7OA 4F64A 5FP6A 2E9PA 4DYMA 3AT2A 4ZTSA 4F0IA 1WVWA 3TCPA 3ZUVA 5AR7A 2W06A 4F1MA 5KO1A 3SW7A 2WMUA 3QL8A 4ZTQA 4D2VA 3ZC5A 1YI6A 4NW6A 4AQCA 4DGLC 3S0OA 3R63A 1GY3A 3L9LA 3A60A 3UVPA 3HRFA 4OTGA 5ANOA 5AX3A 3O8UA 5KE0A 2XNGA 3OOGA 1IAHA 2OJJA 2ACXA 3FBVA 4HGEA 4FKIA 1J1BA 2F7EE 4FEQA 2VZ6A 4QP9A 4DHFA 5JH6A 3E87A 3IKAA 4Y5HA 3S00A 4L52A 1ZYDA 4L3LA 1UKHA 4TNDA 3W1FA 4D4SA 3WI6A 1UA2A 3COKA 5K0KA 3BHTA 4CTBA 3QU0A 4TYHB 3ZU7A 3FV8A 5CEKA 4FV8A 4GT4A 3EYHA 2Q0NA 1U46A 4G6OA 4EJ7A 5GZ9A 1H8FA 1XH6A 5EDPA 4WOVA 3HYHA 4FT7A 3PXZA 4EZ7A 4CZYB 3ALOA 2GQRA 3PUPA 5LVPA 3EKNA 1YI3A 4MTAA 3VUTA 2WU7A 3KXXA 3AQVA 4XV1A 2YDIA 3V8WA 5AP2A 2BZJA 4AG8A 3WYXA 3QZHA 4J1RA 4M69A 3UYTA 3PIYA 5HE0A 3HUBA 1IA8A 4IHPA 4P2KA 5E8UA 5HIBA 4W8DA 4ORKA 1ZOGA 4FBXA 3HV3A 4AN2A 3QYZA 5ETFA 2GQSA 2R7BA 4QMMA 2WQEA 5FTOA 1CDKA 2UVXA 3CD3A 4QRCA 4B0GA 1ZMWA 3DA6A 4N6YA 4ZSEA 5H8GA 3Q60A 4E4XA 4QQTA 4GKIA 4IXPA 4LRKA 3NCGA 3NW6A 3G9NA 3KCFA 2GDOA 3F9NA 5AV2A 4CMTA 3DLSA 5I9ZA 1YW2A 3R1QA 4YJPA 2JKMA 2IZTA 5H3QA 4WKQA 3OCSA 3AC5A 5FXSA 2OGVA 2VD5A 3CJFA 5J95A 4EKLA 2BMCA 1DAYA 2ZV8A 5AUZA 5ACBC 3U4UA 3IG7A 4OW8A 5DRDA 5HNGA 2WU6A 4I0RA 3PJ2A 5LMBA 5IDPA 1Y6AA 4H58A 5J79A 2C3IB 4KBAA 3MVLA 2PE0A 4I6HA 3BI6A 3DBEA 3AC2A 2ETMA 4D2PA 1H4LA 4K9YA 2HZIA 4XMOA 5E90A 4J95A 4IFCA 3R1YA 3EN7A 4DGNA 4E4NA 2WMTA 4NJ3A 1BKXA 3KF7A 2WMWA 4LUDA 5L6OA 2HW6A 2PVLA 2DS1A 2Q0BA 3P78A 4MD9E 2OIBA 2P0CA 5EHLA 1F0QA 3OBJA 1OIQA 3Q5IA 5BVWA 3W8LA 4UYAA 1Q8WA 3F5PA 1ZZLA 1IG1A 3RGFA 3SRVA 5K0XA 3D94A 3MWUA 2RG6A 2VTQA 3POOA 3HDNA 4L01A 3E5AA 4MBIA 4OT5A 4APPA 1ERKA 2R3FA 1FMKA 5A4EA 4RA5A 1Q24A 4YHTA 5J5TA 3SAYA 4AT4A 4DH8A 4BCKA 2WOUA 3QKKA 4AF3A 5HTBA 3KRWA 1REJA 5M09A 4R5YA 3RCDA 5F4NA 4G9CA 3EZRA 3FC2A 5HVJA 4D28A 2JD5A 3BWFA 4AZSA 5CEPA 4CT1A 3L9PA 4R7HA 3ZONA 4RVLA 4XV3A 5HU3A 2QNJA 3MW1A 5IU2A 3PJCA 5JQ5A 3VUDA 4H39A 3HA8A 4L68A 5FM3A 4QP6A 4KNBA 5L2QA 4H05A 4KSQA 5BUIA 3FHIA 3ZRLA 4AW1A 1OPKA 4HGSA 2X2LA 4V01A 3MBLA 2Y4IB 4XCUA 4QMSA 1M2PA 4EOKA 4KAOA 4UZDA 2IN6A 3TM0A 4EH3A 3NZ0A 4PMSA 2PE1A 3DB8A 4Z55A 5AV4A 1W83A 3NIZA 3U6HA 2WZJA 4JNWA 2VO3A 3V3VA 4BVUA 4XG8A 1ZYSA 3Q4TA 4IB1A 4L45A 3VHKA 2B55A 3M1SA 4KABA 3VF8A 4EQUA 2XBJA 3KULB 4X3FC 5M55A 1PXOA 3MTLA 3O96A 1FVRA 4PTGA 4XLIA 2VTMA 3UE4A 4YSJA 4RVMA 4J53A 2XNNA 2WTKB 2JLDA 5IQGA 3HA6A 4BDGA 4I0TA 2BFXA 3FPQA 1BI7A 3BYUA 4GRBA 3GC8A 4I0SA 4LQMA 4TZRA 3NYOA 1UWJA 1TVOA 3DJ7A 3ORIA 4AA4A 2Z8CA 4AU8A 2XJ1A 5JRSA 1YXVA 4JDKA 4DC2A 3FQHA 4C57A 2BALA 1OBGA 1YOJA 4M7IA 4W4YA 4EZ5A 4JBVA 4FL3A 4NFNA 4Z7HA 5LARA 1ZZ2A 3QAME 3R9OA 4DG0E 1P5EA 5HCYA 4G9RA 3DKOA 3VULA 3ROYA 3TNHA 4CV9A 3NLBA 5EW3A 3I0OA 4FV4A 3R9DA 5ANJA 3NUXA 3F3UA 2ETKA 2C6DA 5FM2A 5E4HA 3C4EA 4I22A 2Y6MA 2VWBA 2XNOA 1PXPA 1DI9A 2HZ4A 3HVCA 3VRYA 5L6PA 4UMPA 4ENXA 2QC6A 3KGAA 1WVYA 3WOWA 3PXKA 5CNOA 4CVAA 4JAJA 3EYGA 3PZEA 2HWOA 1I44A 3AT3A 5CNNA 3UBDA 3NAXA 3G2FA 3DS6A 4Y5QA 5HZNA 1XWSA 4I21A 4DTAA 3G6HA 4I5CA 4TYEA 3TEIA 4PPCA 1ZOEA 2C6MA 4B7TA 4BHNA 2CGWA 1J7LA 1OIUA 2RKUA 4KIOA 2Y0AA 4C38A 1H1WA 2ITZA 4JDHA 3W16A 5K5XA 5AP5A 3V5QA 2OF4A 3IOKA 3DKFA 5LMKA 5CQWA 3JY9A 5DE2A 3R7OA 1QPJA 4FTAA 4RRVA 3POZA 4YNEA 5EYMA 3BX5A 3DY7A 3KXGA 2XJ2A 1MRUA 2QOIA 4E6AA 1YOLA 3ZM9A 4BY9E 3DBDA 4HYIA 3QLFA 4ALVA 3QFVA 4GV1A 4G16A 4JXFA 4FIIA 3COMA 4G34A 3MFRA 5AV1A 5EDQA 5AP7A 4ANMA 2JC6A 3TN8A 4E3CA 3HMIA 2IJMA 3K3IA 4JT3A 3ZBFA 4MCVA 4DH5A 3F3TA 2W1GA 4H1JA 4U0IA 3MPTA 3D5VA 5L3AA 5IA5A 4O7ZA 4L43A 5BYYA 5JFSA 2G1TA 3NUAA 4MH7A 5DRBA 4FF8A 2R4BA 3R8VA 4IC7A 4PQNA 4ZSLA 4HVHA 1V0BA 3H10A 1G3NA 2JGZA 4BCMA 5BVNA 2GU8A 2XK8A 4PMMA 3R7VA 4IH8A 4U45A 3VBTA 2RFNA 1XBCA 4WNPA 3UIUA 3V5PA 4JBOA 2DQ7X 4EWHA 2CLXA 4K11A 2R3PA 4RIOA 4X6QC 2B9HA 3UOLA 1PF8A 2JBOA 3QQLA 4F70A 5CF5A 4OBPA 5M57A 2F2UA 3RBWA 3LFDA 3OVVA 1OBDA 3SXFA 3BU6A 4O7TA 3DT1A 3ZEPA 4I3ZA 3KQ7A 4C3PA 2GHMA 3PY3A 4ZSAA 5CEMA 2KTYA 2CN8A 3ALNA 3NAYA 3ZUTA 4IX4A 2X7GA 3DBQA 3MY0A 4FNYA 4FT3A 4MYGA 4GK3A 4PP9A 3ULIA 4A4LA 2OO8X 3BYSA 2ERKA 5HE3A 2XS0A 4O0XA 4WO5A 3U4WA 3VS7A 4X2FA 3TUDA 2CSNA 2YHVA 3UG1A 4DGMA 3T9IA 4BICA 4V04A 5L2SA 4Q5HA 2WTCA 3RAKA 2IWIA 2A19B 4S34A 3VUGA 4S2ZA 3R8ZA 5AJQA 3RAIA 4D55A 3NYXA 3ZBXA 4MX9A 2EU9A 4EJNA 2Y7JA 4L8MA 2W9ZB 3VWAA 3TACA 4ZSJA 5CEQA 2WTJA 5HX8A 2HY81 5DWRA 4XV9A 4DEEA 4HVIA 4LV8A 3H4JA 4DA5A 4OTRA 1IASA 3KL8A 2WIHA 5ETIA 1OUYA 4OTPA 1PXLA 5GJGA 2C1BA 4XG3A 4HVSA 1WBWA 2NPQA 3GNIB 3R22A 2G15A 2XA4A 2VTIA 2PSQA 5HLWA 4YBKA 4N70A 1J3HA 1U5RA 2I0VA 1J7UA 4NT4A 5I5ZA 3IW5A 5A4LA 2C1AA 1YXXA 5IEVA 4CG8A 1SZMA 4BI0A 1U59A 4GYIA 4YJTA 4YSMA 5KMKA 4IAZA 3NNVA 2B9FA 4FSWA 3EQIA 2W9FB 3FYKX 1MUOA 4I24A 5B2KA 1FOTA 3RPRA 4YPSA 3IW7A 2QOHA 1E1VA 3QRJA 2X7FA 4C4FA 4I4EA 3COIA 2QOBA 4HNFA 4ZSGA 3SD0A 3LVPA 2XB7A 3R8LA 3VBQA 4BL1A 4YTFA 2XK9A 2PVMA 2OBJA 3ORNA 4GFOA 2BROA 1ZMUA 4AGWA 4F6SA 1ZXEA 3A7IA 5HICA 3AXWA 5M53A 2YWPA 3I79A 3C51A 4GMYA 4M3QA 2YIRA 3GU4A 2BIYA 5IQCA 3FQSA 4FKGA 4MVFA 4BTJA 3D2IA 5D10A 2RGPA 5EFQA 5CI6A 1JAMA 3P7CA 5AP6A 2JDVA 4AZFA 4JX7A 3WF6A 4FTRA 3LCOA 2PHKA 2A2AA 3BBTB 3HV6A 4IM3A 5A4CA 3SGCA 5CU6A 3Q04A 3IO7A 4KKHA 2GPHA 3ZSIA 5KMOA 4YMJA 2IG7A 4UY9A 4E7WA 4GK4A 3SV0A 3A61A 4PL5A 4FKQA 4QMLA 2WMQA 4XOYA 2PZYA 1YXTA 2V5QA 3CPBA 4M67A 3R7UA 4FTKA 4A9RA 1ZY5A 1YDRE 4O7LA 5KMJA 3O71A 2XVDA 4FICA 4E26A 1NA7A 2CDZA 3QA0A 3O51A 4EK3A 1DI8A 2G9XA 4FNXA 2Y8OA 4DEIA 1W82A 4ZOGA 1OGUA 3K5VA 4YZCA 3LFAA 3FUPA 1SVEA 1JKLA 2OXDA 4L42A 4NCTC 4BDDA 5IMEA 3ZSGA 4G6LA 4Y72A 5AAFA 2PVKA 4WG3A 5K5NA 2XRWA 3U51A 3VAPA 3CGOA 2QD9A 3UC4A 1H25A 3MS9A 4II5A 4O2ZA 1G5SA 3RZBA 4U44A 1JLUE 1H00A 4HW7A 3UC3A 3VBXA 3KB7A 3SA0A 5HO7A 3A99A 4QP2A 3NS9A 1TQPA 2ITXA 5ICPA 4UXLA 2X4ZA 4TL0A 3Q9ZA 4IW0A 4CLJA 4YJQA 3FZRA 4YO4A 4FVRA 3GP0A 4ZS4A 4BN1A 5M4UA 4F7SA 2J5EA 1Q8TA 2QONA 3F5UA 4FYNA 3TKUA 5E8ZA 4ZTHA 3EJ1A 3ATTA 3JXWA 5A4TA 2X9FA 2ZAZA 3I7CA 4MQ1A 4A9YA 4O0RA 5BVDA 5I0BA 5L2IA 3DXPA 3PXRA 4BCPA 4RLLA 2FSOX 4PUZA 2Z7LA 2PZIA 3THBA 3OHTA 5DI1A 2WO6A 4CZTA 1BX6A 4BZDA 4EOSA 3OEFX 1P4OA 3MFSA 3AC3A 2W1CA 3HP5A 3UTOA 2OZOA 4AT5A 3Q9YA 3MFUA 5IQIA 4O22A 2HXQA 1QPDA 2V62A 5C03A 2YN8A 5E8VA 4AS0A 4YPDA 3DCVA 4CQGA 4IJPA 1VJYA 4BWXA 3U54A 2W7XA 2C5OA 4U79A 4U81A 4XP2A 3WIGA 2ZB0A 2JDOA 4CXAA 2C6KA 3FI8A 4AN3A 3FI4A 3Q4ZA 3GQLA 3FE3A 5CASA 3PVWA 2QVSE 3OFMA 2YCRA 4FTIA 3HV7A 3QD4A 2I0EA 3R2BA 2I1MA 2NO3A 3R7YA 4FNZA 4F6WA 3LOKA 2W4KA 3BE9A 1U54B 4JQEA 1S9IA 3DB6A 1BUHA 2IW6A 3LAUA 3OT8A 3RHKA 2W99B 3SLSA 1JPAA 4C3RA 1JVPP 2O0UA 5IKWA 4RMZA 4AGDA 5BMSA 5T68A 4FV0A 1YHWA 5EM6A 3R9HA 5KHWA 2VRXA 3NUYA 3OW3A 4NJDA 3E8EA 1XH9A 4FTLA 2QG7A 3R9RA 1X8BA 1ZY4A 4XG6A 2ZYBA 3VQHA 2PZPA 4BWPA 3DXQA 3TL8A 4FV5A 4RX7A 2OICA 3WILA 1YOMA 3EFKA 3F2NA 3BQRA 5JEBA 2PULA 4W4VA 4C4JA 3NIEA 4MD8E 4QP7A 4BIEA 4OTIA 2OG8A 3ZZEA 4R6VA 5EKOA 4XH6A 1OKZA 1XH7A 2JFLA 2G2IA 4QMTA 1IR3A 2GNLA 1ZYLA 4IVCA 4D1XA 2O65A 2YM6A 2J5FA 3FMDA 4RQVA 5AAEA 2WELA 4AGCA 5EQYA 4ZTMA 3TNQB 2HELA 4KRCA 1UVRA 5BMMA 3BV2A 5IUHA 4BYJA 2PUPA 2BTRA 4ITHA 4R5SA 2PVYA 4FK3A 3QC4A 3OWJA 4HGTA 4FG8A 4F9WA 3BHVA 3ZDUA 2XK6A 5CT0A 5LWNA 4CV8A 3HX4A 5C01A 1YVJA 4AAAA 3ZHPC 2R0IA 5DT0A 4ZJJA 4FKUA 5CSVA 1NY3A 2PY3A 2W05A 3EFWA 4G31A 3GCVA 2W1EA 4LOOA 2C3KA 1H08A 3OWPA 3R7IA 5J7BA 2QQ7A 3DGKA 2I0YA 1E1XA 3DQXA 3FZOA 4BTFA 3SVVA 4R3CA 3IDBA 4R7BA 4FZFB 4FKJA 5HOAA 3O7LB 2C6IA 1Q5KA 3PYYA 4PWNA 4RWKA 3KN5A 5HO8A 2VTJA 4FKSA 3ZO1A 4ANLA 3HAMA 4M66A 3L8SA 4BDCA 3ZMMA 4OTQA 4UMQA 1LP4A 4ARKA 4CNHA 4FZDB 2XNEA 3I5ZA 3ZLSA 4DF3A 3WZJA 2UZEA 2EVAA 4ZZOA 4G2FA 4DITA 3N9XA 3COHA 3SRVB 3UOKA 4TYJA 3LMGA 4D5HA 4PP7A 4TKSA 3OZ6A 3EQHA 4NUSA 2Q83A 5AAGA 3IECA 3UG2A 2BRHA 2UW9A 3QC9A 3HEGA 2O64A 3WZKA 2GS6A 2BFYA 1URWA 2J51A 4G5PA 4BDEA 4JL9A 4DFYA 3ETAA 4IB5A 2QOLA 5CAQA 4XG4A 4G3CA 2W1ZA 5AMNA 3ACJA 5HESA 4ASEA 4GEOA 1H0WA 2XNBA 5EYDA 2PUIA 3R71A 1LR4A 4ZP5A 5DR2A 4N0SA 5ACKA 3TXOA 4D9TA 4C8BA 3DPKA 5JQ8A 1SNUA 3KF4A 3E7OA 1CKJA 3B8QA 4IIRA 2HIWA 4X2KA 4A4XA 3H9OA 4S33A 4X2GA 5KBRA 4GYGA 2VTLA 2C6LA 3GCPA 5CYIA 3NNWA 4O7VA 4GVAA 2OIQA 4LRJA 1XH4A 5AM7A 2WAJA 2B1PA 1Y57A 2OU7A 4RWIA 3VS2A 4AXAA 3OC1A 4AX8A 2BHHA 4DTBA 5C8KA 3TUBA 3WBLA 2BDWA 5K3YA 3LE6A 3OF0A 4ACCA 4OBQA 2DWBA 4IFGA 4TT7A 4O0WA 1S9JA 4FIHA 4PMTA 4TPTA 3RINA 1PHKA 2F7XE 2HCKA 4J71A 4NKAA 5F95A 5D41A 5CANA 1L8TA 5HTCA 3MH2A 2UW4A 4MF0A 3LCSA 4I20A 3AGLA 4IVBA 4RBLA 4MK0A 3PRIA 2CHLA 4QYYA 2GCDA 3DAJA 4RIYB 3CS9A 3C9WA 5ETCA 4O0TA 3EH9A 4O2PA 2JBPA 3KXHA 4ZLZA 3M2WA 2BAKA 2XNPA 2WQBA 3CY2A 3R8UA 2F2CB 4LMNA 3N4UA 1M2QA 3IW4A 5T3QA 3QLGA 2ZMDA 3JYAA 3R8MA 3OUNB 3AC4A 5AP3A 3LLTA 3QUDA 4KKEA 2OKRA 3R2YA 1Y8GA 2QO7A 3HL7A 3O50A 4IZ5A 4XNEA 2UZNA 2X1NA 2X6EA 1KV2A 4FL1A 4IMYA 4QTAA 4RFMA 3W33A 3ZO3A 3NGAA 3U6IA 1XJDA 2YM5A 4USDA 1OZ1A 4O86A 1STCE 3NW5A 1Q3DA 2DUVA 3HKOA 4KS7A 1IRKA 4JG7A 4TY1A 4JDJA 2PUUA 2YM4A 3D5WA 3RAHA 3UIXA 3QWKA 3B2TA 3QD2B 5HNBA 5DT4A 4EONA 4O82A 3QQGA 2J0JA 3F3ZA 5K9IA 3DU8A 3RK5A 2I7QA 4U40A 4ONAA 3U6JA 2B7AA 3C0GA 4BCFA 2GFSA 3LXPA 3GC7A 4J96A 2B53A 3DBFA 3WARA 2IVUA 2OF2A 2RIOA 2RL5A 3A2CA 3QTWA 2FVDA 1GIHA 2BDJA 4F65A 3CTJA 5HORA 3JVRA 3W2QA 2OZAB 5DBXA 2XKEA 3FZ1A 4XBUA 1URCA 5F1ZA 2VWUA 5FTGA 4W9XA 4R3PA 5DR6A 3FMMA 5E1SA 5EYKA 2J7TA 2XK7A 3I0QA 3CTQA 5G6VA 3ZO4A 4UWBA 4AOTA 1U54A 4IJ9A 3RI1A 3RAWA 5M44A 4JQ8A 3MY5A 3G51A 2CPKE 4FGBA 4D2RA 3OW4A 4DLJA 3UPZA 5I4NA 5IQDA 1B38A 3VC4A 2QLUA 2CKEA 2Z60A 3BIZA 5FEQA 4NU1A 1UNHA 3TZMA 2W1IA 4L3JA 4AW2A 2VTRA 3BHUA 2B4SB 2VGOA 3Q52A 3LQ8A 3RHXA 3LFEA 3FI3A 1H1PA 3QHWA 3ZLXA 4IM0A 3LFNA 3VNTA 4IWQA 2XBAA 4B4LA 4NTTA 3FY0A 4YP8A 3ZLYA 3QRKA 3QTIA 2QKWB 3Q6WA 3T8OA 3TG1A 2XYUA 4E5BA 4ITJA 3T9TA 1KV1A 2R64A 3FPMA 3MI9A 4NYEA 5CS6A 1OVEA 3FLYA 3QALE 3P7AA 4XV2A 4C35A 4HVDA 1KE5A 2ITQA 3WF8A 2FSLX 4F99A 2FSMX 3TIZA 4E5WA 3PP0A 3I6UA 2XM8A 4GUEA 2HK5A 4WBBB 4G3FA 2ZOQA 3TDWA 3F7ZA 1GZKA 3EWHA 4EOMA 1Q3WA 3IPHA 5LMKC 3DOGA 4JX3A 1PXJA 5TE0A 3G5DA 1OI9A 4NH1A 3OS3A 4Z16A 1VEBA 5HCXA 4QNYA 3LZBA 4JS8A 4KIKB 4ZJVA 4BRXA 4IVDA 4F1OA 3R02A 5HHWA 4F08A 3AOXA 4ZY4A 1WBVA 2C6OA 2E9OA 4RX9A 2OLCA 5GZ8A 4O0YA 3TKIA 4O84A 2I40A 1J1CA 3EN5A 4F6UA 4C58A 2QR7A 2GMXA 3DAEA 2XK3A 1YKRA 4IADA 4QMYA 5TOZA 3R0TA 3A7JA 3LXKA 3ZRMA 1VZOA 4K33A 5AV0A 2VX1A 3E3BX 5EOBA 2R3IA 4D58A 4DN5A 4BFMA 2H6DA 3ANRA 3FZTA 4YJVA 5GIPE 4GU9A 5I9VA 3FAAA 4UALA 4QO9A 4FX3A 3FLZA 4FIFA 4AFEA 5ANEA 1EH4A 3JVSA 2R3RA 1L3RE 2EB3A 2QOFA 2WQNA 4IAAA 1NT2A 3MGYA 2PMIA 3PJ3A 4LL0A 2XEZA 4QT1A 1GNGA 2XP2A 3OT3A 4KINA 3DDPA 3QUEA 4IB0A 4I41A 1PKGA 3VUHA 4RVKA 4ID7A 1PJKA 3CXWA 4ZY6A 3RPYA 5H9BA 2F9GA 4J52A 4ERKA 4MKCA 4CFNA 2VWWA 2YCSA 1NVQA 5CSHA 1BL6A 1OL7A 2CGXA 4A4OA 2J4ZA 4I94A 2CNQA 4H1MA 2C3JA 4O96A 4Y95A 4WRGA 5BUJA 5BVFA 4F9BA 3KKVA 2GNHA 4RX5A 1XBAA 4L67A 4I5PA 4NW5A 4EOQA 4AE9A 3D7TB 3R00A 4YR8A 4I1ZA 1B6CB 4QTBA 3G6GA 1H27A 3BYVA 1JNKA 3Q32A 1KE7A 2UZOA 2XMYA 4I93A 4A9UA 1V0OA 4EK8A 3S2PA 5EKNA 4CTCA 5CF8A 5KKRB 5M07A 3F5XA 2VTPA 4RZVA 4FZ6A 1UV5A 3ORZA 4XG9A 4WNMA 3GOKA 3PLAE 1Q97A 5JT2A 2YIWA 3FMJA 3D5UA 5AIKA 4BC6A 4JLCA 1UWHA 4D2SA 5IF1A 2HOGA 3RK9A 5DNRA 3GOPA 3Q2JA 3R8PA 2UZDA 5HEZA 4U5JA 4MNFA 4U41A 4BCNA 3TT0A 2WKMA 2WTVA 1FQ1B 4FOBA 4LUEA 3UPXA 2PUNA 1YXUA 4RVTA 3E93A 4FNWA 4C36A 3BYMA 5J7HA 4P4CA 4RJ4A 4RIYA 5JN2A 3PSCA 2X8IA 4ZLOA 4M14A 5FWKK 2HYYA 5AA8A 1JBPE 5FBNC 3MJ2A 2BAJA 1FINA 4I6QA 2PVJA 3ZFMA 4LM5A 2X7OA 4FV7A 4J98A 4JOAA 3VIDA 3VJOA 1FGKA 5AR2A 3MPAA 2ZM1A 3BRBA 5B2MA 3QGYA 4ASZA 1OECA 5EI6A 4BBMA 2F49A 4QYEA 4KBCA 3QQKA 2ERZE 3IDPA 2YJSA 1QPCA 3CLYA 3EOCA 2PPQA 3FL5A 2YDJA 5AV3A 4AFJA 1PYXA 5BVEA 4JAIA 3QQHA 1UNLA 2JIVA 3TNIA 3CP9A 1ZARA 4MWIA 5IQBA 3FXXA 4X6RA 1HOWA 3VVHA 2Y4IC 1AGWA 1XH5A 5A9UA 2I0HA 3HGKA 3ZFXA 4DH1A 2RF9A 2WGJA 3ZO2A 3EFJA 3U8WA 2WMVA 3QX2A 4AWIA 4DT8A 1GIJA 5E8SA 3Q4UA 3FJQE 4R1VA 2C6TA 2W96B 5IA4A 2QHMA 4FV6A 5KKRC 2R3GA 5EM7A 4G3GA 3DDQA 5EI8A 3QD0A 4BDIA 3SOAA 3EKKA 2OH0E 3EB0A 2UW8A 4O1OA 3TNWA 4E6CA 2EB2A 4TWCA 2P3GX 2W1DA 5DPVA 4HNIA 4O7RA 4I92A 2BKZA 2WTKC 2IVVA 3BHYA 4QMZA 2Z02A 5LMAA 4L7FA 4QMUA 4UWCA 5CZHA 4QQJA 4ZS0A 3PIZA 2BKKA 4KIQA 4CMUA 2BRBA 4LL5A 4FSTA 2OZAA 2VV9A 2YACA 5KMMA 2GNGA 1GAGA 4IAYA 3UODA 3ZUUA 4BBFA 4BCJA 4D1ZA 4FT9A 5E9EA 4ANOA 1Z57A 3D83A 2X0GA 3FC1X 4GJ3A 2J0MB 4U97A 5CSWA 5CLPA 4ZTLA 4PNKA 4FEUA 4CKJA 5HNIX 4O6EA 4KKGA 2V0DA 3OXZA 3P79A 3BLRA 3VBWA 3PXFA 3R1SA 5FEEA 2WMAA 1PXNA 1OITA 4OTHA 1OKYA 5CU2A 2QOQA 2XIZA 3DFAA 3OWKA 1YQJA 4WNKA 1OL2A 2UVYA 5CI7A 1UU3A 2WTIA 3V51A 1OL6A 2B52A 5C27A 2RG5A 5IEXA 5CSXA 1PXIA 3HZTA 4TN6A 4C4IA 2HWPA 4CQEA 3KVWA 3ROCA 3QX4A 2QCSA 3QQUA 4K77A 5LVLA 2GNJA 3A62A 3F3VA 5L8KA 2X4FA 4PPAA 1H07A 3GCUA 4FG7A 2JKOA 5KCVA 5AUUA 3LJ0A 3QCQA 4FSRA 4EZ3A 2VWIA 4PPBA 3UJGA 5IQFA 3RCJA 2R2PA 1QPEA 1LUFA 4QTDA 4UN0C 3TV6A 3GU5A 4TWPA 4YHJA 4FV9A 4CLIA 2OFUA 2VTHA 1A9UA 3L9NA 2QHNA 2B9IA 4KIKA 4ENYA 3BBWA 4CKIA 2AC3A 2CNUA 4ACDA 4FIEA 2X81A 3GENA 4JQ7A 5EH0A 4L46A 3NSZA 4BGGA 3EL7A 3F66A 3UNZA 1UNGA 1W84A 1Q62A 4FEWA 3C5UA 5J9ZA 4A07A 1QMZA 3P1AA 1Q61A 5BVKA 1SM2A 4MXOA 3SC1A 1WBNA 3EQBA 4U8ZA 4ZEGA 5HVYA 5LJJA 1P2AA 4ZLYA 3AD4A 3OCTA 4YC8A 4B9DA 4DFXE 3ANQA 4KB8A 4DFLA 3PIXA 2R5TA 3KFAA 4EHEA 3N4TA 3R7GA 4U80A 3E63A 5GJFA 1H01A 4TRLA 3RJCA 1YI4A 4UZHA 3FYJX 4RA4A 3DKGA 2OIDA 3ODZX 3PG3A 2YIYA 4U3YA 2UUEA 1GZNA 1OM1A 4QP3A 4U42A 3R01A 1JSVA 5A14A 3LXNA 4C59A 4O0SA 3DZOA 1IA9A 3PZHA 4UYNA 2QOCA 1BMKA 3CC6A 3LCKA 3IGOA 3Q2MA 4BDFA 3MVJA 5M4CA 4F9CA 3ENHA 5CVHA 2NP8A 3E3PA 3NUPA 4GT5A 3BEGA 4C34A 4FV1A 3NYVA 4NL0A 4FODA 3KRRA 4ACMA 4O1PA 2AUHA 3P08A 3AC8A 1ZOHA 3H9FA 3JPVA 4IZYA 4WT6A 5CWZA 4FUYA 3GCSA 3PPKA 1SNXA 3UZPA 2WXVA 3D7TA 1V1KA 2BZHB 2Z7QA 3GVUA 2C0OA 4TWNA 3WF9A 3MDYA 3R30A 3ZOSA 4DBNA 4ZZNA 2QLQA 2VN9A 2UW0A 2PVNA 5DEYA 5IDNA 2OK1A 3WF5A 3KK8A 2YEXA 3OXIA 4LRMA 3ZEWA 4AZTA 4F7LA 3MB7A 3OG7A 1GIIA 4N6ZA 3QHRA 5H2UA 5A4QA 4D9UA 2VX0A 2H8HA 3H30A 2WEIA 3OXTA 2QG5A 3H0ZA 2JITA 2VTAA 2YFXA 3K3JA 2UZVA 3FI2A 4YZMA 1V0PA 4EQCA 3UVQA 1W8CA 1Z9XA 3MFTA 1U5QA 1BLXA 2VWYA 5DG5A 3QZIA 5CF6A 5HTIA 5JMSA 3FL4A 3QD3A 2XNMA 1YWVA 4D4RA 4ALWA 4JVGA 1H1SA 5CY3A 5A46A 3NWWA 4YJSA 4CCUA 3ORKA 4O7SA 5E8WA 1T46A 3UYSA 3F5GA 3UOHA 1ND4A 1XHAA 3VJNA 5IH5A 4M97A 3HUCA 2E9UA 4YLLA 5ANGA 2ESMA 2JEDA 4G3EA 3SQQA 1O9UA 2BRGA 3EQPA 4YTCA 4MEDA 4I23A 2PVRA 2X2KA 4MXXA 1BI8A 3C0IA 4ZTRA 3VS0A 3OOMA 2P55A 4EHVA 4XRLA 3A7HA 4RJ8A 3PA4A 2X9EA 3FQEA 2E9VA 4GKHA 3AD6A 4R3RA 5JFWA 3NW7A 2BILB 4GUBA 4NM7A 1PW2A 3ZTXA 3E64A 3M42A 1Y6BA 1OIYA 5AWMA 2R3HA 5DFPA 3FMHA 3G90X 3PWDA 3TI1A 3TWJA 3KN6A 4BKZA 3W18A 4FSQA 2C30A 4DFNA 1K3AA 2FB8A 2HY0A 2VTNA 3CKWA 3PPJA 4ZXTA 3EN9A 4UMUA 5AR8A 3SKCA 3OWLA 2XIRA 4RQKA 3CQUA 3NEWA 4QD6A 2PU8A 3QTUA 3CGFA 5A54A 4FSZA 3ZRKA 4C33A 3BGPA 4UMTA 3EN4A 4WD5A 3H3CA 1JWHA 4X3JA 3FSFA 3GQIA 5EDRA 4EH9A 3W2PA 3U55A 4MBJA 2PZRA 4M0ZA 4YO6A 3IS5A 2C4GA 4IDVA 4GFGA 4BI1A 3FXZA 1Q8YA 2UVZA 3LMHA 3NNUA 4Q9SA 2YABA 3TJCA 4FK6A 3D14A 3PSBA 3EHAA 1KOBA 3EL8A 4RLKA 5LXMA 3Q9WA 3ULZA 4DE4A 3HRBA 3E8DA 1UU9A 5J1WA 2W4OA 5IUIA 4NKSA 3REPA 5GJDA 2FH9A 5EOLA 2IW8A 2UZLA 4USFA 1PKDA 4OTWA 4CFMA 3W2CA 4U43A 2W1FA 2PK9A 2VO7A 3A4OX 4LMUA 4OTDA 3AMYA 4YJOA 3VW6A 1OB3A 3PVBA 3DK3A 4QMVA 4TTHB 4YNOA 1R0EA 1ZWSA 3AD5A 3PXQA 3HMNA 4IQ6A 4DH3A 3MPMA 2XCHA 3UVRA 4ZY5A 4NZWB 5BX0A 4PY1A 5FDPA 2XKDA 4WG4A 2IPXA 1CTPE 1WBSA 3I60A 2CKOA 4EH4A 3G15A 4IANA 3NR9A 2C47A 4F7NA 3FMNA 4DLIA 2PE2A 1P4FA 3CKXA 5E8YA 5IQHA 3KRXA 3MSSA 4Z9LA 4IAIA 3NYNA 4FKTA 2WB8A 2QU5A 1O6LA 2VO6A 4BI2A 3VUKA 4YUQA 5CAOA 3O8TA 2R3KA 1W7HA 4Y83A 4JG8A 1IEPA 4I6BA 5DYJA 3MY1A 5JFXA 3UQFA 3BU5A 3QQFA 4GJ2A 3OCGA 2EUFB 4WSYA 3WYYA 1WZYA 3QCYA 1ZLTA 3BPRA 3K54A 3D0EA 3F6XA 1I09A 1FVTA 5D7AA 3UOJA 2ZDUA 2CKPA 2Z7SA 4HCVA 2J0IA 2YLEA 3CQEA 3E62A 4XG2A 2IZSA 3FWQA 3G9LX 3OBGA 5DOSA 2XKFA 3BQCA 5J8IA 4XHKB 4DTKA 3ORPA 4C02A 1RW8A 3EQFA 4ITIA 3NRMA 3CJGA 3ELJA 3DTWA 4YZBA 1UKIA 3RMFA 4AZEA 3L9MA 3JR1A 4E5AX 4DGGA 4DFUA 4LOQA 3ODYX 5M56A 3DJ6A 2BDFA 2ITYA 4C61A 3ORTA 4MF1A 3CEKA 4N4SA 3SX9A 1H1QA 1QCFA 3LXLA 4IVAA 5HBEA 3RVGA 4R78A 4CT2A 4EOIA 4ZAUA 5FLFA 3DJ5A 1MQ4A 4FKLA 4EKKA 4HOKA 5LVNA 3OY1A 4KWPA 4CGAA 3ITZA 4EK5A 4AW5A 4EOOA 4PDYA 2REIA 2X8DA 2X39A 1YDTE 2YZAA 2WMSA 3QA8A 4NWMA 4U9AA 2GQGA 5AX9A 4AP7A 2O63A 2VX3A 2PVFA 3DNEA 3EQDA 3MA6A 2FO0A 3G0FA 3KA0A 4KD1A 5BNJA 3P4KA 3RM7A 5IEYA 5JGAA 3JS2A 1JSTA 3C1XA 4FTNA 4M0YA 4F63A 1WFCA 5EK7A 3C13A 3ORLA 4Y46A 5D9HA 4G3DA 3OCBA 4FL2A 4FYOA 4GW8A 5DIAA 3C4FA 5CU3A 1REKA 3VRZA 3G33A 4YTHA 5AADA 1YXSA 3PLSA 5H8EA 2Y9QA 1J91A 1PMUA 5H8BA 5IA1A 3SOCA 1G8AA 3R9NA 1OUKA 3MH3A 5C8MA 4ANQA 2WMBA 2QURA 2WMXA 5E1EA 5CX9A 2OFVA 3QYWA 4J97A 1WBTA 1SVGA 2FSTX 2G01A 4B99A 3DTCA 5IUGA 3ID6C 4NK9A 3RZFA 4D0WA 3MIYA 1W98A 3V8SA 2O5KA 3FLSA 3I81A 1ATPE 2GTMA 4X21A 3E8CA 4WSQA 4BTKA 4W8EA 3ZXZA 4AW0A 3D9VA 1K9AA 4RIWA 4DG3E 4EK4A 4U7ZA 4Q2AA 2UZUE 2BTSA 1H1RA 1JSUA 2NNWB 4OUCA 4MXCA 3TJDA 3D15A 3O17A 3P7BA 3GUBA 2UW3A 4BKJA 3ACKA 4KS8A 5CAPA 3V8TA 3KMWA 5A6NA 2OXXA 3BLQA 1Q41A 3MVHA 2ITVA 3Q5ZA 4QTEA 5CXZA 2VNYA 3V5TA 4X2JA 3W2RA 4E73A 4JR3A 4E6QA 3MVMA 1FGIA 4MNEB 4C62A 2V22A 5F20A 4EH2A 3JY0A 2SRCA 4RC2A 4BDAA 3EN6A 2GS2A 2JDRA 3TV7A 1U4DA 5LVOA 2ZV9A 4BCIA 3I1AA 2OJGA 2RFEA 3UQGA 3NMUF 3R73A 4U6RA 5JGBA 4L00A 3DBCA 1M52A 4S30A 1RQQA 1PY5A 3QTQA 4DEHA 3QRUA 4H3QA 4MD7E 2DYLA 4L9IA 5GZAA 1WBPA 3A7FA 4TYIA 5EG3A 4E20A 2R9SA 4IBMA 2JDSA 1JKTA 2HENA 4UWYA 3MB6A 3ZZWA 1AQ1A 2IO6A 2ITWA 4H3PA 5E7RA 4E4LA 3VQUA 3LFBA 3GFEA 4BF2A 4EC8A 4ZMEA 3QXOA 4LV5A 4QQ5A 2LAVA 2R3JA 5DR9A 4EOLA 2E2BA 1UU8A 2BRMA 4FUXA 4FZ7A 1XKKA 5G1XA 4XG7A 5J9YA 4J99A 4HGLA 5DVRA 4BDHA 5L2TA 3O0GA 2B0QA 2UZWE 3SXSA 2XK4A 4HYSA 4FIJA 5AUTA 3UNKA 4W9WA 3QXPA 5E8XA 4GK2A 3IK3A 4RFZA 2VNWA 3LKMA 3VBYA 2WFYA 3OY3A 3PFQA 2PVHA 5B0XA 3IONA 4AGUA 5EQPA 4X2NA 1PRYA 2WPAA 3I7BA 4HYHA 3G0EA 4FKRA 3K2LA 2JKQA 4RJ5A 3QWJA 5KBQA 4EBVA 3TTJA 1BL7A 2FA2A 2XCKA 4ACHA 5KHXA 3D4QA 3MTFA 2X8EA 3R04A 4HYUA 3TIYA 5FEDA 2VU3A 3R21A 3VN9A 4O7NA 1GZ8A 5GNKA 5C9CA 3ZFYA 1YHVA 5AP1A 3GEQA 4EYMA 4OR5A 3DK6A 2PMLX 4NEUA 3GU6A 5CAUA 2BCJA 4HPTE 1CKPA 1T45A 4C2WA 2P33A 1KUTA 2HZNA 3CR0A 1OMWA 4FT0A 4IM2A 2ZVAA 3OTUA 4R8QA 4ANNA 2UZTA 4YGAA 2XIXA 3ZCLA 3L1SA 4YJUA 5AIRA 4DH7A 3VF9A 2E9NA 4OAUC 5KMLA 1GOLA 1J7IA 2Y6OA 4APCA 2R3LA 2X2MA 4QMNA 4QMPA 2VWVA 4TW9A 1Y8YA 4MWHA 4FG9A 4K1BA 4C7TA 5EI2A 1W0XC 4O38A 3DNDA 2EXCX 5DMZA 4DFBA 4DG2E 2IZUA 3WZDA 5BUEA 4XJ0A 3T3VA 5BVOA 4H36A 4CKRA 4NIFA 3AC1A 2XH5A 3LW0A 4GVJA 4XEYA 1WVXA 2YISA 4PRJA 1E9HA 4BGQA 3HMMA 3QCSA 5C26A 5LVMA 3FLQA 4JRNA 4AA5A 5LCJA 4EHGA 3S1HA 2YWVA 2WHBA 5AEPA 4IX3A 4FT5A 2JAVA 2RFSA 3FMKA 3IGGA 4O7WA 4CYIA 4CMOA 2A1AB 3K5UA 3Q53A 2GSFA 4HCTA 2A0CX 4BKYA 1LEWA 2CLQA 4CFXA 4RC4A 4BYIA 3NUSA 4CRSA 3UQCA 3UZTA 5HG5A 5K4IA 2XRUA 3FKNA 4YHFA 3SW4A 3VO3A 4O81A 4IWDA 1KOAA 2VTTA 1VYZA 1R0PA 1YWRA 4O91A 3KRLA 4E93A 4I5MA 4EEVA 4F9AA 3HAVA 2NRYA 3C4XA 5LQFA 4AE6A 3GC9A 5BQ0A 4D2WA 5KUPA 4CG9A 3QQJA 4IB3A 3VS6A 1ZYJA 4BGHA 4MXAA 4X3FB 3QRTA 3C7QA 4IAKA 1MP8A 4BHZA 2XJ0A 5FUTA 5HBHA 3TZ7A 1Q99A 1XH8A 2J0KA 5EM8A 5TO8A 4TWOA 3OP5A 3RPVA 5CT7A 2C5YA 2Z7RA 3SHEA 1UU7A 4EQMA 2YCQA 2YAAA 2F7ZE 2V55A 2R3MA 2UV2A 3TZ8A 1NW1A 3OTVA 5BPYA 2WNTA 4P90A 5AUYA 5I9UA 3MA3A 3VS5A 3PP1A 3QRIA 2YM7A 5CEIA 2WD1A 1M2RA 2PTKA 4QYHA 3MIAA 3RNIA 3SXRA 2FGIA 5CZIA 3LMIA 3CD8A 1ZAOA 4KSPA 5LWMA 2ONLA 4LYNA 5CXHA 4ZIMA 4M8TA 3PJ1A 5IPJA 3KMMA 3NUUA 3AMBA 1DM2A 2ITTA 5DLSA 5AR4A 3V6SA 4RIXB 2R3NA 5AR5A 4DCAA 3UNJA 2H34A 3IOPA 2LGCA 2XIYA 1WCCA 2YM8A 3CCNA 4FVQA 2OWBA 4OBOA 3R83A 2BUJA 3U87A 4EH8A 1ZRZA 3WE8A 4F09A 3AT4A 3ZH8A 3TTIA 5IG1A 2F4JA 4YJNA 4AT3A 4KRDA 2WOTA 4JIAA 4DEAA 5LOHA 5LCKA 3RKBA 3Q96A 2YLFA 3E8NA 2AC5A 4HPUE 3KU2A 3PA5A 4XX9A 2J50A 4RJ6A 4CRLA 2BVAA 2CNVA 2C5XA 2PMOX 4DINA 5HG9A 2QO9A 4FTQA 1R78A 3FLNC 4O0VA 4C4GA 5JSMA 1VYWA 2W4JA 4DCEA 4JBQA 5T6KA 1KE9A 3CIKA 5B2LA 4U3ZA 4MNEA 4J8MA 5DHJA 3DK7A 3UP7A 4CFWA 2W5BA 3MJ1A 3PY0A 4P5ZA 4MQ2A 1YHSA 4GIHA 2HAKA 2WIPA 3WF7A 4DEGA 4Y8DA 4NM5A 4ZMFA 4RWJA 3ZYAA 3QBNA 3UMXA 4Q9ZA 2O3PA 4GT3A 1GJOA 1SVHA 3KEXA 5JKGA 3LCDA 3PSDA 4ANSA 4EH6A 5IA2A 3UO5A 1M17A 3ORMA 4GSBA 3IQ7A 4GCJA 4K2RA 4RWLA 3Q6UA 4EYJA 4CFUA 5ITAA 3L8XA 4DGOA 1PXMA 4RT7A 3C5IA 4XOZA 3NCZA 5FQDC 2ZV2A 4A06A 3NVMB 3DAKA 5M4FA 2VUWA 2R7IA 4AA0A 2C5NA 4EH7A 3HNGA 3I6WA 3P0MA 4TYGA 4FGRA 2HXLA 3EQRA 4IZ7A 4C37A 1OL5A 4YLJA 3QKLA 2J90A 4N57A 5TR6A 3TDVA 2VGPA 3L8VA 4V05A 3D2KA 3LM0A 5CVFA 4BCQA 4D2TA 2X6DA 3FEGA 2HW7A 3ZM4A 4DBXA 4Y73A 3MV5A 2QOKA 4RX8A 1NXKA 2O8YA 2W5AA 5M51A 3JUHA 4IWPA 5I9XA 4XRJA 4CYJA 1APME 4YJRA 3S3IA 1SMHA 3S4QA 2G2HA 4XLVA 5CENA 3GFWA 4PDOA 2YAKA 2WQMA 3RTPA 1JOWB 5EHYA 3FLWA 3HDMA 4FVPA 4B8LA 2O2UA 4EOPA 4CCBA 4O21A 4X7QA 1WAKA 2P2IA 4GL9A 1H0VA 3P5KA 2ZV7A 4UMRA 5IH4A 2Z2WA 3GU8A 4LGDA 2EWAA 1XBBA 3RPOA 4AN9A 4Z7GA 4BWKA 1NVSA 3RP9A 4AOIA 1M14A 4GG7A 4IEBA 3BU3A 2CCIA 5F94A 4CFFA 5A3XA 3NVKI 4BTMA 2I6LA 5FD2A 3CY3A 3UO4A 4JBPA 4BCGA 4YZNA 3QZFA 4E4MA 1TQIA 4IDTA 2YCFA 3WIKA 2KULA 5HE1A 1YRPA 2UW6A 1PMNA 4TYHA 1KE6A 3FY2A 4LGHA 4DEBA 1Y91A 3KXZA 5AP4A 2P4IA 4V0GB 2VAGA 2VWXA 3NNXA 5KZ0A 4CSVA 4MBLA 1H26A 4HZRA 3KMUA 3BKBA 4FE2A 4C3FA 3TZ9A 4FEXA 5F9EA 4NTSA 4PDSA 4XP0A 2J2IB 3U9NA 5J1VA 3PRFA 2FYSA 3FKOA 3MYGA 3PWYA 4EBWA 5KX8A 3QF9A 1PXKA 3P23A 5M06A 3TUCA 4QPMA 2YIQA 1K2PA 2BZKB 4BIBA 2OSCA 4KUJA 3B8RA 3MH0A 4A9TA 2VWZA 5IZFA 4RJ7A 3LLAA 2IZRA 5K4JA 3QTSA 2R3QA 2UZBA 3ATSA 4FSMA 4BR3A 4OLIA 5ETAA 5J87A 3F82A 4FV2A 4AZWA 3BGZA 3RK7A 2RSVA 5EQEA 1SYKA 5HD7A 4KA3A 3HMPA 1TQMA 5KZIA 1FPUA 5ANKA 3E92A 4FSYA 3WZEA 3UZRA 4PTCA 4RJ3A 3F61A 2J9MA 3HV4A 5JZNA 4DEDA 3VW8A 4AZVA 5JK3A 3UGCA 3HP2A 2JKKA 4L7SA 3HV5A 3TNPC 3MN3A 3SDJA 4FA2A 3KK9A 5HVKA 1OPJA 4IZAA 5DT3A 4M84A 5IMXA 3QCXA 3RWQA 4D5KA 5CAVA 3QTXA 4X3FA 2XYNA 3WE4A 4L53A 3KC3A 3ZXTA 4NM0A 2OW3A 5D7VA 5FG8A 3VUMA 3HLLA 4BCOA 3C50A 3LFFA 4B8MA 3LPBA 3HECA 3VS1A 4MXYA 4AUAA 4WHZA 3BZ3A 3EQCA 5IA3A 4C4EA 4EI4A 3TKHA 3ENMA 3DQWA 3V01A 4D4YA 4EH5A 5DN3A 4G1WA 4S32A 5CQUA 2C5VA 4LI5A 3BHHA 2G2FA 2OJIA 4LOPA 3UP2A 3LFQA 5AFVA 5TKDA 1H24A 3PE1A 3DV3A 4GIIA 4GU6A 5L6WL 4EUTA 3PXYA 5HGIA 4RIWB 2ITPA 3HRCA 4QMOA 5HD4A 3F3WA 3NX8A 2CGVA 2YJRA 2FUMA 3LHJA 4FSUA 4FZAB 4RIXA 2ETRA 2XEYA 4PL4A 4YBJA 2GNIA 3Q4CA 3PDTA 2W17A 4GG5A 4WUAA 3UDBA 2WTWA 4CFVA 3A8WA 4YLKA 2C68A 2YERA 3QTZA 4ACGA 5AUVA 3DXNA 2JFMA 2QODA 2CKQA 4AACA 4X0MA 4F7JA 4K0YA 4ERWA 4USEA 3SG9A 4PF4A 3DLZA 3ORXA 4JG6A 4BDKA 5D11A 2PWLA 2BPMA 3BV3A 4BCHA 4EOJA 5IA0A 5DGZA 3FMLA 5I9WA 4O6LA 4WUNA 5L8JA 4QPSA 4UBAA 3SG8A 1LPUA 2XF0A 4GS6A 4QP1A 4PL3A 4NFMA 4YU2A 4QYGA 4CEGA 4M12A 5ANDA 1PYEA 3KULA 3P86A 4EUUA 5I9YA 3D5XA 3C4WA 5KMNA 2VTOA 3O8PA 4F1TA 2BIKB 3LQ5A 4Z3VA 3A4PA 5HO6A 1DS5A 1JKKA 3VS4A 5CF4A 3AMAA 2BZIB 1OKVA 2W5HA 2XKCA 4GH2A 1QL6A 3KY2A 3BCEA 4EC9A 1IAJA 3I4BA 4WG5A 2JIUA 5AP0A 1O6YA 1KE8A 3GCQA 5TF9A 1PMVA 4QQCA 5M4IA 3GBZA 2GHGA 2C6EA 3LCTA 3NUNA 4M13A 4FTOA 4YZ9A 3RNYA 1TKIA 4ALUA 4D0XA 5TT7A 2IVSA 3E7VA 4OGRA 5DEWA 2BAQA 4WIHA 3DFCB 5C8NA 5AUXA 2XM9A 4C4HA 3GC0A 4RZWA 3PVUA 4JR7A 4ASXA 4BB4A 4R7IA 1JQHA 1XQZA 2IVTA 5CU0A 4DT9A 3EQGA 2B54A 4NSTA 4O7YA 2BRNA 5FTQA 3PG1A 4HZSA 4S31A 5EHOA 5L4QA 2EXMA 2QR8A 3QTRA 2ZB1A 4FTUA 4LG4A 3TV4A 2ZM4A 3OMVA 2OJ9A 3RWPA 2C0TA 3FXWA 5FXQA 3IW8A 4O0UA 3V6RA 4Y85A 3R6XA 4BZOA 4F4PA 5CEOA 1F3MC 2C3LA 5A6OA 3MESA 2PMNX 5HIDA 4G6NA 3RM6A 3LFCA 2QU6A 4E8AA 2GHLA 3CPCA 3W2OA 3LJ1A 2CJMA 4HJOA 1Z5MA 3F88A 2PL0A 5AR3A 1FMOE 4QMQA 3I5NA 1MRVA 1Q8ZA 2HZ0A 3CBLA 4PX6A 1R3CA 3W8QA 2VTSA 5C4KA 5AA9A 4FKVA 1R1WA 4DFZE 3PJ8A 4PMPA 5HLPA 4F0GA 4NM3A 3VBVA 4L3PA 5IISA 4XYFA 5J5SA 3F7WA 1A48A 1ZMVA 3QGWA 2JAMA
chains in the Genus database with same CATH superfamily
4EORA 4M15A 5HCZA 3O23A 2R3OA 5FRIA 3O2MA 1R39A 1BYGA 3RPSA 4JJRA 4IX6A 4IE9A 2GS7A 3BELA 3Q9XA 2ZJWA 5FDXA 1DAWA 3BWJA 4IX5A 4DAWA 4IAFA 3UIMA 4PV0A 3QUPA 5IQAA 1WBOA 2JDTA 3AG9A 3NDMA 4QYFA 4RFYA 4F9YA 2GTNA 2YM3A 2WMRA 3OEZA 3A7GA 4L6QA 1G8SA 2EXEA 2PZ5A 4IACA 4M69B 4I4FA 4UV0A 3V5WA 3DKCA 5EW8A 3OROA 1XR1A 5CALA 5BYZA 3BE2A 4NIFB 4V0GA 3S95A 4P5QA 1KSWA 3L8PA 5AM6A 3W2SA 2WEVA 4UX9A 3LFSA 4OAVB 4CD0A 4FV3A 1PMEA 4R1YA 2C0IA 3O7LD 3PPZA 4YTIA 1O6KA 5JGDA 4WBOA 2IW9A 3VHEA 3VS3A 3GGFA 4TXCA 3GU7A 5JFVA 2F57A 4GFMA 5E92A 3BGQA 4FTCA 4MHAA 1OL1A 2W0JA 3OD6X 4PTEA 4UB7A 5CTPA 5IH6A 4O83A 4G5JA 3M11A 2UW7A 4JRVA 4W4XA 4XBRA 4ZK5A 3WZUA 4FMQA 3CSVA 5IQEA 4PDPA 4PNIA 5HI2A 1FVVA 5HIEA 4D4VA 4K18A 1CMKE 4CZUA 3KXMA 5HX6A 4FTTA 1OIRA 4EHZA 4QMXA 3EIDA 2A27A 3FZSA 4ANBA 3D7ZA 5L8LA 5EM5A 4J8NA 4ZZMA 4FR4A 2XIKA 3ZC6A 3V5LA 3KVXA 4FKOA 5J9LA 3ET7A 2YDKA 3FDNA 3QKMA 4J7BA 4O4EA 4I5HA 5EYCA 1NVRA 3PTGA 1YDSE 3KCKA 4D1SA 5I3RA 3CE3A 4Q5EA 5I3OA 3U9CA 1GZOA 3LM5A 1FBNA 3LIJA 4FTMA 1OPLA 3UIBA 3CQWA 2QI8A 4FIGA 1P14A 4LFIA 2BR1A 4LDTA 3P9JA 2QKRA 4QP4A 1RDQE 3GI3A 2ZDTA 3FSKA 4G17A 5HG8A 3R1NA 4XP3A 5KMIA 5KNJA 1F5QA 3PFYA 1Q4LA 2RFDA 2NRUA 3E88A 2WTDA 1M7QA 3PA3A 4FKPA 4QMWA 4YC3A 4FC0A 3FKLA 4ASDA 2B9JA 3CTHA 1MQBA 2A4LA 2BHEA 4IWOA 4NCTA 3W10A 3W32A 4LGGA 3C0HA 4AOJA 5JZJA 2AYPA 5CSPA 5HG7A 3BYOA 4WNOA 4YC6A 3ZDIA 3N4VA 3GT8A 5HKMA 3FMEA 4B6LA 1YWNA 3R28A 3V5JA 2X0QA 3KREA 3KRJA 4ZJIA 2ZMCA 2V7AA 4K6ZA 3ZLWA 1Q8UA 1M7NA 1AD5A 2OH4A 2OI4X 2QO2A 4JIKA 4RG0A 5GHVA 3BLHA 5JRQA 5C1QB 4O27B 3F69A 2ITOA 3LJ2A 3PY1A 5C4LA 2P2HA 1XO2B 3IDCA 2H9VA 4JI9A 3Q3BA 4YURA 3F2AA 2H96A 3AGMA 3II5A 2CN5A 3VUIA 1ZYCA 4FTJA 3EMGA 3C4CA 5E91A 1CKIA 4R77A 2JIIA 3A8XA 2GFCA 3PE2A 4BZNA 4JDIA 5CU4A 4RSSA 3NPCA 5D1JA 4BDBA 4UXQA 4QOXA 3ERKA 5FBOA 4KBKA 3KXNA 4W4WA 1KWPA 5L2WA 4FI1A 4H3BA 4I6FA 4YZDA 5HQ0A 2QOOA 5M08A 2Y4PA 4RPVA 2CMWA 4WA9A 3C4ZA 4FOCA 1B39A 1JKSA 4FSNA 4C0TA 3N51A 2XARA 4FKWA 3FZPA 4LV7A 4L44A 5GINE 4XS2A 2PYWA 3ZSHA 2GNFA 4HCUA 5HLNA 3IW6A 4QPAA 1HCLA 5DA3A 2OJFE 4A7CA 5BYLA 5HBJA 4FEVA 2J0LA 2CGUA 4E6DA 4RGJA 3R7EA 2UW5A 3FHRA 3PVGA 1RJBA 5DH3A 2VO0A 2ONLC 2YITA 4TNBA 4XUFA 3UO6A 4OT6A 3LQ3A 2YA9A 1OKWA 3EFLA 4EL9A 4QP8A 3HMOA 3UMWA 4F0FA 4MXZA 4M68A 2R0UA 3F2RA 4HVGA 3ZS5A 3EZVA 4IC8A 4A9SA 1CSNA 2XUUA 5FGKA 4EWQA 3QZGA 5CVGA 1WMKA 4QTCA 3RALA 4EK6A 2ZM3A 1H28A 4MAOA 2C69A 4ZTNA 3GXLA 4P7EA 3V04A 2OXYA 3B2WA 4K8AA 2W1HA 2J6MA 4BDJA 5GIOE 1A06A 4C2VA 5B7VA 1MRYA 3H0YA 2WQOA 5HE2A 2ITUA 5E8TA 4KIPA 2XALA 2CCHA 2YIXA 5FXRA 5AUWA 4BIDA 4RC3A 3GB2A 4WRSA 5EW9A 3DZQA 1HCKA 1CM8A 3H9RA 4UEUA 3T3UA 3MH1A 1VR2A 2ITNA 2YZLA 2XZSA 3BEAA 1RE8A 4QNAA 4E1ZA 5ANIA 4BBEA 5BV3A 3W55A 4OTFA 1LEZA 5D12A 5FP5A 3OUKA 5HU9A 2V7OA 4F64A 5FP6A 2E9PA 4DYMA 3AT2A 4ZTSA 4F0IA 1WVWA 3TCPA 3ZUVA 5AR7A 2W06A 4F1MA 5KO1A 3SW7A 2WMUA 3QL8A 4ZTQA 4D2VA 3ZC5A 1YI6A 4NW6A 4AQCA 4DGLC 3S0OA 3R63A 1GY3A 3L9LA 3A60A 3UVPA 3HRFA 4OTGA 5ANOA 5AX3A 3O8UA 5KE0A 2XNGA 3OOGA 1IAHA 2OJJA 2ACXA 3FBVA 4HGEA 4FKIA 1J1BA 2F7EE 4FEQA 2VZ6A 4QP9A 4DHFA 5JH6A 3E87A 3IKAA 4Y5HA 3S00A 4L52A 1ZYDA 4L3LA 1VLRA 1UKHA 4TNDA 3W1FA 4D4SA 3WI6A 1UA2A 3COKA 5K0KA 3BHTA 4CTBA 3QU0A 4TYHB 3ZU7A 3FV8A 5CEKA 4FV8A 4GT4A 3EYHA 2Q0NA 1U46A 4G6OA 4EJ7A 5GZ9A 1H8FA 1XH6A 5EDPA 4WOVA 3HYHA 4FT7A 3PXZA 4EZ7A 4CZYB 3ALOA 2GQRA 3PUPA 5LVPA 3EKNA 1YI3A 4MTAA 3VUTA 2WU7A 3KXXA 3AQVA 4XV1A 2YDIA 3V8WA 5AP2A 2BZJA 4AG8A 3WYXA 3QZHA 4J1RA 4M69A 3UYTA 3PIYA 5HE0A 3HUBA 1IA8A 4IHPA 4P2KA 5E8UA 5HIBA 4DDIA 4W8DA 4ORKA 1ZOGA 4FBXA 3HV3A 4AN2A 3QYZA 5ETFA 2GQSA 2R7BA 4QMMA 2WQEA 5FTOA 1CDKA 2UVXA 3CD3A 4QRCA 4B0GA 1ZMWA 3DA6A 4N6YA 4ZSEA 5H8GA 3Q60A 4E4XA 4QQTA 4GKIA 4IXPA 4LRKA 3NCGA 3NW6A 3G9NA 3KCFA 2GDOA 3F9NA 5AV2A 4CMTA 3DLSA 5I9ZA 1YW2A 3R1QA 4YJPA 2JKMA 2IZTA 5H3QA 4WKQA 3OCSA 3AC5A 5FXSA 2OGVA 2VD5A 3CJFA 5J95A 4EKLA 2BMCA 1DAYA 2ZV8A 5AUZA 5ACBC 3U4UA 3IG7A 4OW8A 5DRDA 5HNGA 2WU6A 4I0RA 4BJJB 3PJ2A 5LMBA 5IDPA 1Y6AA 4H58A 5J79A 2C3IB 4KBAA 3MVLA 2PE0A 4I6HA 3BI6A 3DBEA 3AC2A 2ETMA 4D2PA 1H4LA 4K9YA 2HZIA 4XMOA 5E90A 4J95A 4IFCA 3R1YA 3EN7A 4DGNA 4E4NA 2WMTA 4NJ3A 1BKXA 3KF7A 2WMWA 4LUDA 5L6OA 2HW6A 2PVLA 2DS1A 2Q0BA 3P78A 4MD9E 2OIBA 2P0CA 5EHLA 1F0QA 3OBJA 1OIQA 3Q5IA 5BVWA 3W8LA 4UYAA 1Q8WA 3F5PA 1ZZLA 1IG1A 3RGFA 3SRVA 5K0XA 3D94A 3MWUA 2RG6A 2VTQA 3POOA 3HDNA 4L01A 3E5AA 4MBIA 4OT5A 4APPA 1ERKA 2R3FA 2X0OA 1FMKA 5A4EA 4RA5A 1Q24A 4YHTA 5J5TA 3SAYA 4AT4A 4DH8A 4BCKA 2WOUA 3QKKA 4AF3A 5HTBA 3KRWA 1REJA 5M09A 4R5YA 3RCDA 5F4NA 4G9CA 3EZRA 3FC2A 5HVJA 4D28A 2JD5A 3BWFA 4AZSA 5CEPA 4CT1A 3L9PA 4R7HA 3ZONA 4RVLA 4XV3A 5HU3A 2QNJA 3MW1A 5IU2A 3PJCA 5JQ5A 3VUDA 4H39A 3HA8A 4L68A 5FM3A 4QP6A 4KNBA 5L2QA 4H05A 4KSQA 5BUIA 3FHIA 3ZRLA 4AW1A 1OPKA 4HGSA 2X2LA 4V01A 3MBLA 2Y4IB 4XCUA 4QMSA 1M2PA 4EOKA 4KAOA 4UZDA 2IN6A 3TM0A 4EH3A 3NZ0A 4PMSA 2PE1A 3DB8A 4Z55A 5AV4A 1W83A 3NIZA 3U6HA 2WZJA 4JNWA 2VO3A 3V3VA 4BVUA 4XG8A 1ZYSA 3Q4TA 4IB1A 4L45A 3VHKA 2B55A 3M1SA 4KABA 3VF8A 4EQUA 2XBJA 3KULB 4X3FC 5M55A 1PXOA 3MTLA 3O96A 1FVRA 4PTGA 4XLIA 2VTMA 3UE4A 4YSJA 4RVMA 4J53A 2XNNA 2WTKB 2JLDA 5IQGA 3HA6A 4BDGA 4I0TA 2BFXA 3FPQA 1BI7A 3BYUA 4GRBA 3GC8A 4I0SA 4LQMA 4TZRA 3NYOA 1UWJA 1TVOA 3DJ7A 3ORIA 4AA4A 2Z8CA 4AU8A 2XJ1A 5JRSA 1YXVA 4JDKA 4DC2A 3FQHA 4C57A 2BALA 1OBGA 1YOJA 4M7IA 4W4YA 4EZ5A 4JBVA 4FL3A 4NFNA 4Z7HA 5LARA 1ZZ2A 3QAME 3R9OA 4DG0E 1P5EA 5HCYA 4G9RA 3DKOA 3VULA 3ROYA 3TNHA 4CV9A 3NLBA 5EW3A 3I0OA 4FV4A 3R9DA 4QEBA 5ANJA 3NUXA 3F3UA 2ETKA 2C6DA 5FM2A 5E4HA 3C4EA 1ST0A 4I22A 2Y6MA 2VWBA 2XNOA 1PXPA 1DI9A 2HZ4A 3HVCA 3VRYA 5L6PA 4QDEA 4UMPA 4ENXA 2QC6A 3KGAA 1WVYA 3WOWA 3PXKA 5CNOA 4CVAA 4JAJA 3EYGA 3PZEA 2HWOA 1I44A 3AT3A 5CNNA 3UBDA 3NAXA 3G2FA 3DS6A 4Y5QA 5HZNA 1XWSA 4I21A 4DTAA 3G6HA 3NFFB 4I5CA 4TYEA 3TEIA 4PPCA 1ZOEA 2C6MA 4B7TA 4BHNA 2CGWA 1J7LA 1OIUA 2RKUA 4KIOA 2Y0AA 4C38A 1H1WA 2ITZA 4JDHA 3W16A 5K5XA 5AP5A 3V5QA 2OF4A 3IOKA 3DKFA 3BL9A 5LMKA 5CQWA 3JY9A 5DE2A 3R7OA 1QPJA 4FTAA 4RRVA 3POZA 4YNEA 5EYMA 3BX5A 3DY7A 3KXGA 2XJ2A 1MRUA 2QOIA 4E6AA 1YOLA 3ZM9A 4BY9E 3DBDA 4HYIA 3QLFA 4ALVA 3QFVA 4GV1A 4G16A 4JXFA 4FIIA 3COMA 4G34A 3MFRA 5AV1A 5EDQA 5AP7A 4ANMA 2JC6A 3TN8A 4E3CA 3HMIA 2IJMA 3K3IA 4JT3A 3ZBFA 4MCVA 4DH5A 3F3TA 2W1GA 4H1JA 4U0IA 3MPTA 3D5VA 5L3AA 5IA5A 4O7ZA 4L43A 5BYYA 5JFSA 2G1TA 3NUAA 4MH7A 4DHIB 5DRBA 4FF8A 2R4BA 3R8VA 4IC7A 4PQNA 4ZSLA 4HVHA 1V0BA 3H10A 1G3NA 2JGZA 4BCMA 5BVNA 2GU8A 2XK8A 4PMMA 3R7VA 4IH8A 4U45A 3VBTA 2RFNA 1XBCA 4WNPA 3UIUA 3V5PA 4JBOA 2DQ7X 4EWHA 2CLXA 4K11A 2R3PA 4RIOA 4X6QC 2B9HA 3UOLA 1PF8A 2JBOA 3QQLA 4F70A 5CF5A 4OBPA 5M57A 2F2UA 3RBWA 3LFDA 3OVVA 1OBDA 3SXFA 3BU6A 4QDVA 4O7TA 3DT1A 3ZEPA 4I3ZA 3KQ7A 4C3PA 2GHMA 3PY3A 4ZSAA 5CEMA 2KTYA 2CN8A 3ALNA 3NAYA 3ZUTA 4IX4A 2X7GA 3DBQA 3MY0A 4FNYA 4FT3A 4MYGA 4GK3A 4PP9A 3ULIA 4A4LA 2OO8X 3BYSA 2ERKA 5HE3A 2XS0A 4O0XA 4WO5A 3U4WA 3VS7A 4X2FA 3TUDA 2CSNA 2YHVA 3UG1A 4DGMA 3T9IA 4BICA 4V04A 5L2SA 4Q5HA 2WTCA 3RAKA 2IWIA 2A19B 4S34A 3VUGA 4S2ZA 3R8ZA 5AJQA 3RAIA 4D55A 3NYXA 3ZBXA 4MX9A 2EU9A 4EJNA 2Y7JA 4L8MA 2W9ZB 3VWAA 3TACA 4ZSJA 5CEQA 2WTJA 5HX8A 2HY81 5DWRA 4JMQA 4XV9A 4DEEA 4HVIA 4LV8A 3H4JA 4DA5A 4OTRA 1IASA 3KL8A 2WIHA 5ETIA 1OUYA 4OTPA 1PXLA 5GJGA 2C1BA 4XG3A 4HVSA 1WBWA 2NPQA 3GNIB 3R22A 2G15A 2XA4A 2VTIA 2PSQA 5HLWA 4YBKA 4N70A 1J3HA 1U5RA 2I0VA 1J7UA 4NT4A 5I5ZA 3IW5A 5A4LA 2C1AA 1YXXA 5IEVA 4CG8A 1SZMA 4BI0A 1U59A 4GYIA 4YJTA 4YSMA 5KMKA 4IAZA 3NNVA 2B9FA 4FSWA 3EQIA 2W9FB 3FYKX 1MUOA 4I24A 5B2KA 1FOTA 3RPRA 4YPSA 3IW7A 2QOHA 1E1VA 3QRJA 2X7FA 4C4FA 4I4EA 3COIA 2QOBA 4HNFA 4ZSGA 3SD0A 3LVPA 2XB7A 3R8LA 3VBQA 4BL1A 4YTFA 2XK9A 2PVMA 2OBJA 3ORNA 4GFOA 2BROA 1ZMUA 4AGWA 4F6SA 1ZXEA 3A7IA 5HICA 3AXWA 5M53A 2YWPA 3I79A 3C51A 4GMYA 4M3QA 2YIRA 3GU4A 2BIYA 5IQCA 3FQSA 4FKGA 4MVFA 4BTJA 3D2IA 5D10A 2RGPA 5EFQA 5CI6A 1JAMA 3P7CA 4FRFA 5AP6A 2JDVA 4AZFA 4JX7A 3WF6A 4FTRA 3LCOA 2PHKA 2A2AA 3BBTB 3HV6A 4IM3A 5A4CA 3SGCA 5CU6A 3Q04A 3IO7A 4KKHA 2GPHA 3ZSIA 5KMOA 4YMJA 2IG7A 4UY9A 4E7WA 4GK4A 3SV0A 3A61A 4PL5A 4FKQA 4QMLA 2WMQA 4XOYA 2PZYA 1YXTA 2V5QA 3CPBA 4M67A 3R7UA 4FTKA 4A9RA 1ZY5A 1YDRE 4O7LA 5KMJA 3O71A 2XVDA 4FICA 4E26A 1NA7A 2CDZA 3QA0A 3O51A 4EK3A 1DI8A 2G9XA 4FNXA 2Y8OA 4DEIA 1W82A 4ZOGA 1OGUA 3K5VA 4YZCA 3LFAA 3FUPA 1SVEA 1JKLA 2OXDA 4L42A 4NCTC 4BDDA 5IMEA 3ZSGA 4G6LA 4Y72A 5AAFA 2PVKA 4WG3A 5K5NA 2XRWA 3U51A 3VAPA 3CGOA 2QD9A 3UC4A 1H25A 3MS9A 4II5A 4O2ZA 1G5SA 3RZBA 4U44A 1JLUE 1H00A 4HW7A 3UC3A 3VBXA 3KB7A 3SA0A 5HO7A 3A99A 4QP2A 2NYAA 3NS9A 1TQPA 2ITXA 5ICPA 4UXLA 2X4ZA 4TL0A 3Q9ZA 4IW0A 4CLJA 4YJQA 3FZRA 4YO4A 4FVRA 3GP0A 4ZS4A 4BN1A 5M4UA 4F7SA 2J5EA 1Q8TA 2QONA 3F5UA 4FYNA 3TKUA 5E8ZA 4ZTHA 3EJ1A 3ATTA 3JXWA 5A4TA 2X9FA 2ZAZA 3I7CA 4MQ1A 4A9YA 4O0RA 5BVDA 5I0BA 5L2IA 3DXPA 3PXRA 4BCPA 4RLLA 2FSOX 4PUZA 2Z7LA 2PZIA 3THBA 3OHTA 5DI1A 2WO6A 4CZTA 1BX6A 4BZDA 4EOSA 3OEFX 1P4OA 3MFSA 3AC3A 2W1CA 3HP5A 3UTOA 2OZOA 4AT5A 3Q9YA 3MFUA 5IQIA 4O22A 2HXQA 1QPDA 2V62A 5C03A 2YN8A 5E8VA 4AS0A 4YPDA 3DCVA 4CQGA 4IJPA 1VJYA 4BWXA 3U54A 2W7XA 2C5OA 4U79A 4U81A 4XP2A 3WIGA 2ZB0A 2JDOA 4CXAA 2C6KA 3FI8A 4AN3A 3FI4A 3Q4ZA 3GQLA 3FE3A 5CASA 3PVWA 2QVSE 3OFMA 2YCRA 4FTIA 3HV7A 3QD4A 2I0EA 3R2BA 2I1MA 2NO3A 3R7YA 4FNZA 4F6WA 3LOKA 2W4KA 3BE9A 1U54B 4JQEA 4DHZA 1S9IA 3DB6A 1BUHA 2IW6A 3LAUA 3OT8A 3RHKA 2W99B 3SLSA 1JPAA 4C3RA 1JVPP 2O0UA 5IKWA 4RMZA 4AGDA 5BMSA 5T68A 4FV0A 1YHWA 5EM6A 3R9HA 5KHWA 2VRXA 3NUYA 3OW3A 4NJDA 3E8EA 1XH9A 4FTLA 2QG7A 3R9RA 1X8BA 1ZY4A 4XG6A 2ZYBA 3VQHA 2PZPA 4BWPA 3DXQA 3TL8A 2IF8A 4FV5A 4RX7A 2OICA 3WILA 1YOMA 3EFKA 3F2NA 3BQRA 5JEBA 2PULA 4W4VA 4C4JA 3NIEA 4MD8E 4QP7A 4BIEA 4OTIA 2OG8A 3ZZEA 4R6VA 5EKOA 4XH6A 1OKZA 1XH7A 2JFLA 2G2IA 4QMTA 1IR3A 2GNLA 1ZYLA 4IVCA 4D1XA 2O65A 2YM6A 2J5FA 3FMDA 4RQVA 5AAEA 2WELA 4AGCA 5EQYA 4ZTMA 3TNQB 2HELA 4KRCA 1UVRA 5BMMA 3BV2A 5IUHA 4BYJA 2PUPA 2BTRA 4ITHA 4R5SA 2PVYA 3AKLA 4FK3A 3QC4A 3OWJA 4HGTA 4FG8A 4F9WA 3BHVA 3ZDUA 2XK6A 5CT0A 5LWNA 4CV8A 3HX4A 5C01A 1YVJA 4AAAA 3ZHPC 2R0IA 5DT0A 4ZJJA 4FKUA 5CSVA 1NY3A 2PY3A 2W05A 3EFWA 4G31A 3GCVA 2W1EA 4LOOA 2C3KA 1H08A 3OWPA 3R7IA 5J7BA 2QQ7A 3DGKA 2I0YA 1E1XA 3DQXA 3FZOA 4BTFA 3SVVA 4R3CA 3IDBA 4R7BA 4FZFB 4FKJA 5HOAA 3O7LB 2C6IA 1Q5KA 3PYYA 4PWNA 4RWKA 3KN5A 5HO8A 2VTJA 4FKSA 3ZO1A 4ANLA 3HAMA 4M66A 3L8SA 4BDCA 3ZMMA 4OTQA 4UMQA 1LP4A 4ARKA 4CNHA 4FZDB 2XNEA 3I5ZA 3ZLSA 4DF3A 3WZJA 2UZEA 2EVAA 4ZZOA 4G2FA 3W0QA 4DITA 3N9XA 3COHA 3SRVB 3UOKA 4TYJA 4O4CA 3LMGA 4D5HA 4PP7A 4TKSA 3OZ6A 3EQHA 4NUSA 2Q83A 5AAGA 3IECA 3UG2A 2BRHA 2UW9A 3QC9A 3HEGA 2O64A 3WZKA 2GS6A 2BFYA 1URWA 2J51A 4G5PA 4BDEA 4JL9A 3TYKA 4DFYA 3ETAA 4IB5A 2QOLA 5CAQA 4XG4A 4G3CA 2W1ZA 5AMNA 3ACJA 5HESA 4ASEA 4GEOA 1H0WA 2XNBA 5EYDA 2PUIA 3R71A 1LR4A 4ZP5A 5DR2A 4N0SA 5ACKA 3TXOA 4D9TA 3BLAA 4C8BA 3DPKA 5JQ8A 1SNUA 3KF4A 3E7OA 1CKJA 3B8QA 4IIRA 2HIWA 4X2KA 4A4XA 3H9OA 4S33A 4X2GA 5KBRA 4GYGA 2VTLA 2C6LA 3GCPA 5CYIA 3NNWA 4O7VA 4GVAA 2OIQA 4LRJA 1XH4A 5AM7A 2WAJA 2B1PA 1Y57A 2OU7A 4RWIA 3VS2A 4AXAA 3OC1A 4AX8A 2BHHA 4DTBA 5C8KA 3TUBA 3WBLA 2BDWA 5K3YA 3LE6A 3OF0A 4ACCA 4OBQA 2DWBA 4IFGA 4TT7A 4O0WA 1S9JA 4FIHA 4PMTA 4TPTA 3RINA 1PHKA 2F7XE 2HCKA 4J71A 4NKAA 5F95A 5D41A 5CANA 1L8TA 5HTCA 3MH2A 2UW4A 4MF0A 3LCSA 4I20A 3AGLA 4IVBA 4RBLA 4MK0A 3PRIA 2CHLA 4QYYA 2GCDA 3DAJA 4RIYB 3CS9A 3C9WA 5ETCA 4O0TA 3EH9A 4O2PA 2JBPA 3KXHA 4ZLZA 3M2WA 2BAKA 2XNPA 2WQBA 3CY2A 3R8UA 2F2CB 4LMNA 3N4UA 1M2QA 3IW4A 5T3QA 3QLGA 2ZMDA 3JYAA 3R8MA 3OUNB 3AC4A 5AP3A 3LLTA 3QUDA 4KKEA 2OKRA 3R2YA 1Y8GA 2QO7A 3HL7A 3O50A 4IZ5A 4XNEA 2UZNA 2X1NA 2X6EA 1KV2A 4FL1A 4IMYA 4QTAA 4RFMA 3W33A 3ZO3A 3NGAA 3U6IA 1XJDA 2YM5A 4USDA 1OZ1A 4O86A 1STCE 3NW5A 1Q3DA 2DUVA 3HKOA 4KS7A 1IRKA 4JG7A 4TY1A 4JDJA 2PUUA 2YM4A 4AXDA 3D5WA 3RAHA 3UIXA 3QWKA 3B2TA 3QD2B 5HNBA 5DT4A 4EONA 4O82A 3QQGA 2J0JA 3F3ZA 5K9IA 3DU8A 3RK5A 2I7QA 4U40A 4ONAA 3U6JA 2B7AA 3C0GA 4BCFA 2GFSA 3LXPA 3GC7A 4J96A 2B53A 3DBFA 3WARA 2IVUA 2OF2A 2RIOA 2RL5A 3A2CA 3QTWA 2FVDA 1GIHA 2BDJA 4F65A 3CTJA 5HORA 3JVRA 3W2QA 2OZAB 5DBXA 2XKEA 3FZ1A 4XBUA 1URCA 5F1ZA 2VWUA 5FTGA 4W9XA 4R3PA 5DR6A 3FMMA 5E1SA 5EYKA 2J7TA 2XK7A 3I0QA 3CTQA 5G6VA 3ZO4A 4UWBA 4AOTA 1U54A 4IJ9A 3RI1A 3RAWA 5M44A 4JQ8A 3MY5A 3G51A 2CPKE 4FGBA 4D2RA 3OW4A 4DLJA 3UPZA 5I4NA 5IQDA 1B38A 3VC4A 2QLUA 2CKEA 2Z60A 3BIZA 5FEQA 4NU1A 1UNHA 3TZMA 2W1IA 4L3JA 4AW2A 2VTRA 3BHUA 2B4SB 2VGOA 3Q52A 3LQ8A 3RHXA 3LFEA 3FI3A 1H1PA 3QHWA 3ZLXA 2XANA 4IM0A 3LFNA 3VNTA 4IWQA 2XBAA 4B4LA 4NTTA 3FY0A 4YP8A 3ZLYA 3QRKA 3QTIA 2QKWB 3Q6WA 3T8OA 3TG1A 2XYUA 4E5BA 4ITJA 3T9TA 1KV1A 2R64A 3FPMA 3MI9A 4NYEA 5CS6A 1OVEA 3FLYA 3QALE 3P7AA 4XV2A 4C35A 4HVDA 1KE5A 2ITQA 3WF8A 2FSLX 4F99A 2FSMX 3TIZA 4E5WA 3PP0A 3I6UA 2XM8A 4GUEA 2HK5A 4WBBB 4G3FA 2ZOQA 3TDWA 3F7ZA 1GZKA 3EWHA 4EOMA 1Q3WA 3IPHA 5LMKC 3DOGA 4JX3A 1PXJA 5TE0A 3G5DA 1OI9A 4NH1A 3OS3A 4Z16A 1VEBA 5HCXA 1W2FA 4QNYA 3LZBA 4JS8A 4KIKB 4ZJVA 4BRXA 4IVDA 4F1OA 3R02A 5HHWA 4F08A 3AOXA 4ZY4A 1WBVA 2C6OA 2E9OA 4RX9A 2OLCA 5GZ8A 4O0YA 3TKIA 4O84A 2I40A 1J1CA 3EN5A 4F6UA 4C58A 2QR7A 2GMXA 3DAEA 2XK3A 1YKRA 4IADA 4QMYA 5TOZA 3UDZA 3R0TA 3A7JA 3LXKA 3ZRMA 1VZOA 4K33A 5AV0A 2VX1A 3E3BX 5EOBA 2R3IA 4D58A 4DN5A 4BFMA 2H6DA 3ANRA 3FZTA 4YJVA 5GIPE 4GU9A 5I9VA 3FAAA 4UALA 4QO9A 4FX3A 3FLZA 4FIFA 4AFEA 5ANEA 1EH4A 3JVSA 2R3RA 1L3RE 2EB3A 2QOFA 2WQNA 4IAAA 1NT2A 3MGYA 2PMIA 3PJ3A 3W0RA 4LL0A 2XEZA 4QT1A 1GNGA 2XP2A 3OT3A 4KINA 3DDPA 3QUEA 4IB0A 4I41A 1PKGA 3VUHA 4RVKA 4ID7A 1PJKA 3CXWA 4ZY6A 3RPYA 5H9BA 2F9GA 4J52A 4ERKA 4MKCA 4CFNA 2VWWA 2YCSA 1NVQA 5CSHA 1BL6A 1OL7A 2CGXA 4A4OA 2J4ZA 4I94A 2CNQA 4H1MA 2C3JA 4O96A 4Y95A 4WRGA 5BUJA 5BVFA 4F9BA 3KKVA 2GNHA