3NUYA

Phosphoinositide-dependent kinase-1 (pdk1) with fragment17
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
286
structure length
276
Chain Sequence
QPRKKRPEDFKFGKILGEGSFSTVVLARELATSREYAIKILEKRHIIKENKVPYVTRERDVMSRLDHPFFVKLYFTFQDDEKLYFGLSYAKNGELLKYIRKIGSFDETCTRFYTAEIVSALEYLHGKGIIHRDLKPENILLNEDMHIQITDFGTAKVLSFVGTAQYVSPELLTEKSACKSSDLWALGCIIYQLVAGLPPFRAGNEYLIFQKIIKLEYDFPEKFFPKARDLVEKLLVLDATKRLGCEEMEGYGPLKAHPFFESVTWENLHQQTPPKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Aminoindazole PDK1 Inhibitors: A Case Study in Fragment-Based Drug Discovery.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords PkB-like
total genus 88
structure length 276
sequence length 286
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2010-07-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3nuyA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3nuyA01
4RC3A 4RBLA 2O0UA 4FT9A 4CKRA 5E8XA 5EM5A 2R3QA 3FBVA 4I0TA 1JKLA 5EKOA 4R7IA 4X2NA 4ITIA 1YOMA 2I0YA 4TYJA 4C4IA 3DTCA 4BCJA 2ZMCA 3D83A 3MH1A 5EQEA 1VR2A 1KE7A 4D2VA 1URWA 1GOLA 4V0GB 4AGUA 5FXQA 1XH7A 4FTRA 4PDSA 3ZDIA 3LQ5A 2BUJA 5GJFA 5H8EA 4Z16A 1YDTE 4UEUA 4I1ZA 1PMNA 5IH4A 4Y8DA 2YZAA 3R9OA 5EM6A 4M69B 5HE3A 2PZPA 5B2LA 3TDVA 5JKGA 3FZRA 2BR1A 4FC0A 2C68A 4U79A 3H30A 1WCCA 2VN9A 3COHA 1J3HA 1SNXA 3N9XA 3R2BA 4PWNA 5HGIA 3BLHA 4KIPA 3ZLXA 1PXIA 1ERKA 4OTWA 4MF0A 3LCOA 3V8TA 4GIIA 5AAGA 4FR4A 2W05A 3BWJA 4BVUA 2WGJA 4FI1A 1U54B 4BTFA 5K3YA 2RG5A 4YPSA 4E4MA 3EL7A 4IX5A 5J8IA 1OITA 5DPVA 1UU7A 3QGWA 4FX3A 4YBJA 3DQXA 3R7EA 3NNWA 1T46A 4PMMA 4RIOA 4H58A 5LVLA 3WZDA 4LRMA 4E93A 1LEZA 2YITA 3KU2A 5EHOA 4U42A 5KHXA 3M42A 4K2RA 2HW6A 1GZKA 4R6VA 3GT8A 4TNBA 3LPBA 2XF0A 5CSXA 1IAJA 3PE1A 1YXSA 4C3PA 3NS9A 3ANRA 3HMNA 3LE6A 1XH8A 2E9VA 4O0XA 4QNAA 4UB7A 5EI6A 4USFA 4F4PA 5KBRA 2W1CA 4FV9A 5ANOA 3E92A 5ANGA 2C69A 3SVVA 2UZWE 2IVTA 4YLKA 1XHAA 2EXMA 4LOPA 1SVGA 3D14A 3TV6A 3LHJA 4ZTMA 3NMUF 3BLRA 3HMMA 4L6QA 3ORTA 4JG8A 4QP6A 2PPQA 4K9YA 3HV3A 3DNDA 2YWPA 4GV1A 3R1NA 3BBTB 4LRJA 4X2FA 4BKJA 4ZIMA 5E9EA 1O6YA 4G31A 3N4UA 2XKCA 2PY3A 3O2MA 4W9XA 5T6KA 4HCVA 3KK8A 5HQ0A 2UW5A 3QC9A 3PZHA 3VIDA 3GU5A 2EWAA 3DDQA 4FV8A 5BYZA 2ITXA 2XNMA 2J5FA 4QPSA 1MQBA 2XH5A 4F65A 3C13A 4QMTA 4CG9A 5CSPA 2BFXA 2W4OA 4QMVA 3UYTA 3LKMA 1MP8A 4ITHA 4JDHA 3ZS5A 2HXQA 1J7LA 3L9LA 4F7LA 3ROYA 3SRVA 2XCKA 4IE9A 3DBQA 4GFGA 3MH0A 4M3QA 2BDFA 3Q4ZA 2X9FA 4UWCA 3HGKA 3KMMA 4JS8A 5FWKK 4F6SA 4EQMA 2O8YA 5HNIX 3L9NA 3LJ2A 3ORMA 2OXXA 5AADA 4TYHA 4F63A 2YAAA 4MD7E 4FEVA 4EOQA 3EQFA 4OTQA 4ZTLA 4O2PA 2FSTX 3KULB 4BBMA 4AF3A 3PP0A 3HV7A 2PVYA 4FTTA 3WE4A 3DK3A 1OB3A 3DQWA 3ZXZA 4QOXA 3Q60A 2GQGA 5HNBA 1ZYDA 5HTBA 4CMOA 4H3BA 2I0HA 1GAGA 3AGMA 4FTUA 4QRCA 1VZOA 2YM8A 5IQIA 5IA2A 2YDKA 3FI3A 4KRCA 5HG8A 2OGVA 3CLYA 3IECA 3ZCLA 4EORA 5FLFA 3FWQA 2CJMA 3IPHA 1K2PA 1QPCA 4S33A 4AGWA 3MTLA 4Q9SA 4N57A 2Z8CA 3AG9A 4BDCA 2J4ZA 1YI3A 3PG3A 4NM0A 5AUYA 3E3BX 4FSYA 4I94A 4CFMA 4BDJA 4RX8A 3HRCA 3ZMMA 2B7AA 4XV1A 3F7ZA 4X2GA 2BTSA 5BVEA 2QONA 4MCVA 5AP6A 2Q0BA 4QYYA 3MFRA 4F6WA 2WMVA 3EQRA 4TNDA 4O38A 3DZOA 2UVYA 1BMKA 5L2QA 2PK9A 2QOHA 3V3VA 1A48A 3DT1A 3NW6A 5E90A 1H00A 4HJOA 2I7QA 4FEUA 1OGUA 1XBCA 5A6NA 4NIFB 4H3PA 4O7RA 4MXCA 4X3FB 5M56A 5E1SA 5J9YA 4BGGA 3TUBA 3FMKA 3NUPA 3ORLA 3C4EA 2PMNX 3I0QA 4L8MA 3CTQA 3DAEA 3VBXA 4EYJA 1RE8A 1ZMVA 3OWLA 4IACA 2VTJA 1YWVA 2ZOQA 4EHGA 4UN0C 5M53A 3QZFA 3UVRA 3ATSA 2BIYA 1QPDA 3ZDUA 2ZM4A 3FKOA 2Y9QA 2JDRA 4FIIA 5HE2A 3W55A 4DT8A 4XG7A 3MH2A 4PTGA 4RSSA 4FUXA 3EQCA 4IWPA 4XRJA 1Q8YA 3QUEA 3QAME 1H8FA 3RAHA 4B7TA 4DN5A 5A14A 2DUVA 4D55A 3PZEA 4FVRA 3Q2MA 2JIUA 2EXEA 2OIDA 4FKJA 3LFBA 4NUSA 4JG7A 4F7SA 3OROA 3MYGA 5LOHA 1ZWSA 3UO6A 3MVHA 3VUTA 4O7LA 1K9AA 2A1AB 3QD2B 2W99B 1OM1A 1ZZLA 4BF2A 4E73A 3ORXA 3I6UA 2RFNA 4UYAA 3TNHA 3UVQA 2HWPA 5DG5A 4I23A 4AE9A 4AT5A 3C5UA 5AAEA 5CQUA 3MIYA 5HEZA 4F1TA 4RVMA 4D4VA 5EDQA 1Q61A 2JDSA 3HA6A 2UZEA 3BYMA 4RQVA 3V8WA 2OIQA 3ZFXA 4KBCA 5CNNA 3OOMA 2HW7A 3PSCA 4IAZA 5IUIA 3D94A 3R8VA 4C02A 2IZUA 3QTQA 4F0FA 1VYZA 4J1RA 2YISA 3ULIA 4X7QA 4E4LA 2BRMA 3EHAA 4CT1A 4BCGA 1PMEA 4CFWA 4R7HA 2CPKE 3UVPA 3VWAA 4EOKA 1PXNA 3R63A 5HLWA 3HECA 4M97A 5CVGA 5C4LA 3I81A 3II5A 1HCKA 3HRBA 3OHTA 4QMWA 3TXOA 1WFCA 2P55A 2VTLA 3KKVA 1F5QA 1ZYJA 2A4LA 2A0CX 4FSRA 4HZRA 4DC2A 4F9BA 3AT2A 4I5PA 3E64A 4NZWB 3QLGA 5FEQA 3R1QA 4ZY5A 2CNUA 4RGJA 3O8TA 3UNZA 5EG3A 4I5CA 3VHKA 5HHWA 3ZLSA 3HMPA 2RKUA 4PF4A 1M14A 2BDJA 3NYNA 5FDPA 3JS2A 2Y4PA 3LXNA 4KABA 4J97A 3RGFA 4P7EA 4DF3A 4N6YA 5B7VA 4PL4A 3CE3A 1L3RE 3QD4A 4ZS0A 3TTJA 4WD5A 3E87A 1B39A 2ZV2A 3P79A 5HBHA 3SXFA 4O7VA 4GK3A 2WAJA 4JIKA 4F09A 5CVHA 5FDXA 4IM2A 3GFEA 4O7ZA 3RZBA 1JAMA 1U5QA 2R3OA 2QODA 4NK9A 4ARKA 3JY0A 4Z7GA 3LXLA 3KEXA 4WO5A 4RIXB 1RDQE 2WD1A 5AUXA 4MX9A 3S95A 2V7AA 3E8DA 2YM3A 1FOTA 4O6LA 4BKYA 1SM2A 4QP4A 3R8MA 4F9CA 3F61A 5EDPA 5AP2A 2J90A 4Y83A 1B38A 4G17A 2FSOX 5D7AA 2OJJA 5IA0A 2PMIA 5IUHA 3UJGA 2R3NA 4KS7A 4U43A 3JVRA 4DYMA 1FVRA 1RJBA 2R3MA 4AT4A 4G3DA 5JFVA 5BUIA 2ERKA 4BC6A 2AC5A 3EB0A 4M67A 2F2UA 2VWYA 5K5NA 2VO7A 4BGQA 2ZV7A 5E8UA 4FTKA 1UNHA 3IW5A 1WVYA 2V7OA 4NM3A 4YHFA 2F4JA 5TR6A 3IW8A 4D4SA 4EOLA 5H2UA 2OJGA 4IB5A 1KSWA 3KQ7A 1OKWA 3P7CA 4ENYA 4FVPA 2X8IA 3QZIA 2OI4X 5AP5A 3LFNA 5EI2A 3FMDA 5IDNA 4F7JA 2PULA 4C4GA 4IAFA 3ZHPC 1PHKA 4GG5A 1KV2A 4DEEA 1WBTA 4V0GA 3DAKA 4IDVA 2WTWA 3TNWA 4O82A 4EOOA 4PL5A 2XKEA 4FV1A 4MXXA 1XKKA 3LLTA 3RVGA 4C62A 3CIKA 5I5ZA 3ETAA 4FTQA 3FLNC 4FKVA 4EH2A 4RA5A 2R3HA 5HU9A 4XJ0A 5J95A 4BCPA 1F0QA 2XBJA 3KK9A 2KTYA 4BCKA 5GZAA 3N4TA 2UW3A 3A8WA 5FEDA 3QXOA 3PLSA 4KKEA 5E8SA 3UTOA 4APCA 4S31A 2XNEA 3EN6A 4PTEA 2W06A 4L45A 2OJFE 2B9JA 2UZNA 3FSKA 4I5MA 2LAVA 3ZBXA 4L7FA 1H01A 4JDJA 3CY2A 3PXYA 4B99A 3LQ8A 5AIRA 4M12A 3DJ5A 4RVKA 3D5UA 2PVKA 4A7CA 2CN5A 3R30A 4BDHA 4AWIA 4AFEA 3MW1A 4IM3A 4A9RA 4AW5A 5M4CA 2YN8A 4DGGA 4WIHA 4P90A 5BQ0A 4Y46A 3MTFA 3AC8A 2PU8A 2WQEA 3TKHA 3W8QA 3DBCA 2J2IB 4CCBA 2X7OA 3VS3A 1ND4A 4XNEA 4D1ZA 3Q9XA 3HDMA 3R01A 3K54A 4IAIA 4OTHA 5HG5A 1YHWA 2OICA 3G0EA 3MY5A 2KULA 4HOKA 5FD2A 2XJ0A 2BIKB 3E8EA 3W2QA 1EH4A 5K0XA 3RP9A 5CX9A 2YLFA 4WNOA 2C5VA 4MNEB 1LUFA 1XH5A 2OG8A 3BE2A 3FC2A 3OXZA 3ZEPA 3BU5A 3RZFA 1ZY4A 5LVNA 4GFOA 2GFCA 2F7XE 3R0TA 4QD6A 5CI7A 3VS4A 1WBSA 4EQCA 2R3JA 1WBOA 2UZVA 3G51A 4FZAB 5AUVA 4AOTA 3G2FA 3OZ6A 2PE2A 3PRFA 3UNKA 5HIDA 3PA3A 2CGUA 3UO4A 2JKMA 2EXCX 4YGAA 3RI1A 2UZBA 5K5XA 3RNIA 2E9PA 4J98A 3UQGA 4QYFA 3SQQA 3FY2A 1W7HA 4C35A 4RT7A 1V0PA 2R3LA 3FE3A 5KUPA 1RW8A 4CCUA 3ET7A 5ANJA 3VAPA 2W1GA 3DXQA 2ONLC 2CCHA 1OUYA 4FSUA 4A07A 1O6KA 2BAJA 5CAUA 2YIXA 2RL5A 2F7EE 2W4JA 2JC6A 3DJ6A 5HZNA 4ZSGA 4FKLA 4N4SA 4ZP5A 3RPVA 4BKZA 1VYWA 3L9PA 3CKWA 2J0JA 4IZ5A 4EC8A 2R64A 4S34A 2VO3A 4C3RA 2CKQA 4YR8A 2YCSA 4NSTA 3VBTA 5JMSA 3DKOA 1ZXEA 2WQOA 2PVJA 4IJ9A 5JEBA 3OCSA 3MVJA 2J50A 5L2SA 4OT6A 3WILA 4I6BA 4YPDA 3RWPA 4YNOA 5JT2A 3MJ1A 3R83A 4YZCA 4AS0A 4P5QA 4AW1A 4H1MA 1OZ1A 3UMXA 3UZPA 3DK6A 3P86A 4TYGA 4JL9A 5ANKA 5M57A 5IA4A 5GIOE 4M8TA 1JLUE 4JX7A 3UG1A 3F3VA 4C38A 3I6WA 5KMIA 1OKZA 1U46A 5AV4A 3AMAA 3OWKA 2VZ6A 3VO3A 4FUYA 5BUJA 4DE4A 4HPTE 5BMMA 2JIVA 5HVKA 1FGKA 2O2UA 5AP7A 2QO2A 4H36A 3EFKA 3IONA 3GC9A 2X2KA 3EH9A 4LQMA 4AZVA 4QQ5A 5M09A 4MEDA 3S00A 4FV6A 2OU7A 4JJRA 3R8PA 2UZOA 3V5WA 2X0GA 3M11A 1VJYA 1W0XC 3PDTA 2PZRA 4PTCA 2C1BA 4UV0A 5AP4A 2H34A 4FT3A 5CT0A 2YM4A 3MH3A 2OF4A 3O23A 4RVTA 1OI9A 4G34A 1M17A 2BALA 4TRLA 2QOQA 2C0IA 4P4CA 5HCXA 3S0OA 3FMLA 4MVFA 5BVWA 3KXXA 3MPMA 3QZHA 2G2HA 4IJPA 4YC6A 4JBPA 2Z60A 3FKNA 3TUDA 2X8DA 2JLDA 2OZOA 4F9YA 2R3IA 2B0QA 2BKKA 3QTSA 4KINA 4D28A 4ZLYA 4O1PA 1H1SA 3QTWA 4FNZA 3R8ZA 2ZV8A 3KF4A 3FKLA 4EK4A 4DCAA 4JAJA 3UQCA 3CJGA 5LARA 4DH3A 4ZTSA 3FHIA 4O0VA 3QRKA 4F08A 3OF0A 4YHJA 4CV8A 4Q5HA 5L8JA 5HBJA 5IA3A 2ITWA 1OIUA 3VUGA 4NM5A 4BRXA 4DEBA 4QO9A 4PMTA 5IQAA 2WXVA 3KN5A 2C3IB 4XS2A 2QVSE 4RIYB 4ACGA 4BTKA 1MUOA 4ZOGA 5LCKA 2HXLA 4DGNA 5BX0A 2XM9A 3F5XA 5JFWA 2F57A 3AC4A 4G6OA 1UA2A 4HGSA 3L8XA 4GCJA 3A62A 5ETCA 2YA9A 2H9VA 4CMUA 3H9OA 4GIHA 2Z2WA 1OECA 1O6LA 2I1MA 2JBPA 4Q2AA 4UMRA 2E9NA 4B4LA 4RVLA 2XRUA 4RJ3A 1U4DA 4FTMA 1YQJA 1H0VA 3QQGA 4OTGA 4QTBA 3NUAA 2VTPA 1OVEA 3I5NA 3LMGA 3GI3A 2DS1A 3HKOA 4FBXA 1H28A 4I3ZA 2HAKA 4KRDA 3TIYA 1NY3A 4WBOA 3MESA 5CEPA 3Q9ZA 3LFQA 2RFSA 1ZLTA 4TTHB 5J5SA 4F1MA 4TT7A 4R3RA 1M2QA 2QO9A 4RFYA 5IISA 2JFMA 3BYSA 3Q4UA 2ZM1A 2JFLA 4N70A 4OTFA 5T68A 2VTTA 3KGAA 3R7UA 3ZO1A 2QKWB 4NFMA 4QT1A 3Q32A 3AD5A 3QTZA 4FSQA 2JDVA 3FZ1A 4R7BA 4ZLZA 4TW9A 4AAAA 1P2AA 3RPRA 4M7IA 3MDYA 4DT9A 2OW3A 4O7WA 2C5OA 4CQEA 3R8UA 2ITNA 3VC4A 4LRKA 4EEVA 4NKAA 4PL3A 1R0PA 3SLSA 3VRZA 3DKFA 2R5TA 2PYWA 2FUMA 3QA0A 3G5DA 3HRFA 3OFMA 2IWIA 2JAMA 3D5XA 4R1VA 3E3PA 4GU9A 4XLVA 3RCJA 3DKGA 4FTNA 4JVGA 2CNVA 4JI9A 4NTSA 2ZMDA 3ITZA 3PJ3A 4U3YA 3KRRA 3QRJA 2REIA 3TNPC 4Z3VA 2BZIB 2FVDA 3LM5A 2YCQA 4KBAA 4MWIA 4BTJA 4YJQA 3TNQB 3GP0A 3NPCA 4XX9A 4BDGA 5HIEA 4M15A 3KULA 3O51A 3OUNB 1YDSE 3HDNA 4DTAA 4Z9LA 2PUUA 2XYNA 3N4VA 4O22A 3PJ1A 4O21A 5FRIA 2QG5A 4FEQA 4YZ9A 3P9JA 4ZSAA 3VBWA 3VW8A 2UVZA 2UZUE 4UMTA 4EK6A 4LV5A 5TT7A 5JN2A 3U4UA 3U54A 1R3CA 3DV3A 3DS6A 3F69A 1OIQA 4FSZA 2IZSA 4L3LA 3DCVA 5EW8A 3HYHA 1OL1A 4L52A 3QALE 4CKJA 1XBAA 2EVAA 2YM6A 3FHRA 3NAXA 4FG9A 2GFSA 3GU8A 4YJNA 3UNJA 1W98A 2I0VA 3OWJA 2ITOA 1Z9XA 2XK8A 5AM6A 3G6GA 4C0TA 5TE0A 4I6FA 3ODYX 4PY1A 3FL5A 4U9AA 3D7ZA 1UU3A 3RKBA 2C3JA 4I24A 4CFUA 2XNNA 2HZ0A 1KV1A 3WF7A 1SMHA 4TPTA 2C6KA 5BVFA 4EI4A 4YJOA 4D5HA 4YLJA 2WTIA 4USEA 2O64A 5L6WL 3CCNA 2PUIA 4AW2A 4I21A 3CXWA 3LZBA 3QKKA 4XLIA 4YBKA 5D7VA 4ZEGA 3IW7A 4OT5A 5CNOA 4O0WA 3AC2A 4WSQA 2JDTA 1AQ1A 3AC5A 5GNKA 4TWOA 4AT3A 4BTMA 3I7BA 2QOIA 2IW9A 3R02A 2CDZA 2PZIA 4DAWA 4F64A 3C4ZA 4RIYA 4TZRA 4QP9A 3IGOA 4PPBA 5CLPA 5A4TA 4FG8A 1CTPE 5KNJA 4XRLA 4O84A 4PP7A 2G1TA 3ZRKA 4IFCA 3Q5ZA 3VN9A 2C5YA 3UC3A 2ESMA 3EQHA 4JR7A 3Q2JA 4CFFA 3KF7A 3ZSIA 2ITTA 2JDOA 3FXXA 4AP7A 5CZHA 4GUBA 4Y5QA 4E1ZA 2XKFA 3HL7A 4C36A 1YDRE 3LOKA 1ZYCA 1S9JA 3PPZA 3LM0A 4FMQA 4L7SA 5CEMA 4ZS4A 5G1XA 2VWBA 4EH7A 3HLLA 3MY1A 2P33A 1CMKE 2J6MA 4MKCA 3TZ8A 4FA2A 1JPAA 2R3RA 3NRMA 3VQUA 1PYXA 3LJ0A 4YC8A 4YHTA 4DGLC 3V5PA 3UGCA 4ZJVA 2FGIA 4R8QA 3SHEA 2F7ZE 2R3FA 4NIFA 1YOJA 2C6IA 1Q8TA 4FTCA 4LGHA 3NEWA 5HKMA 4NT4A 3UP2A 3UPXA 2XVDA 3CC6A 4GT5A 5L6PA 5CANA 2F9GA 3MVLA 2IJMA 1FINA 4HYUA 3UOKA 4QMMA 3VS7A 3C1XA 4IB0A 3BV3A 1PMVA 3OEZA 4HW7A 1BI7A 2PUPA 3O8PA 5IQEA 1E1VA 4KSQA 2B4SB 3DGKA 4YTIA 5L2TA 4C37A 4U8ZA 3L1SA 3DJ7A 3HMIA 3OS3A 4ZTNA 2VU3A 4AUAA 3V5JA 4KSPA 3I1AA 3TZ7A 3ZSGA 4KKGA 4DGMA 3BWFA 4FL3A 5LMKC 4GVJA 3BIZA 1R78A 2W9ZB 3ZUTA 3R6XA 4M0ZA 3ZO3A 4EH4A 3UOJA 2IW8A 4FG7A 3AOXA 2J9MA 3QC4A 3IGGA 4Y72A 1XQZA 2XM8A 5F1ZA 5IU2A 4IWDA 1ZOEA 3BLQA 3REPA 4I92A 2I0EA 3FMMA 1NVRA 1DI9A 4RMZA 4TYIA 4U5JA 4EK5A 5IMXA 2UW6A 2ETKA 2X2MA 4GKHA 3RPOA 4PNKA 4LG4A 3QTRA 3I4BA 4KS8A 1O9UA 2XNGA 4IZYA 2RFEA 2X2LA 2GDOA 2XK7A 1IG1A 3QKMA 4LGDA 4MH7A 4ZZMA 5GINE 4UY9A 4KBKA 3ZFMA 3EN9A 1M2PA 3AMBA 4FK6A 5E8WA 3OMVA 3FMHA 1YI6A 2WMAA 1B6CB 4IFGA 2YAKA 5DYJA 3FPMA 1PXOA 2C6EA 3FLQA 2UW9A 2OKRA 3TV7A 1PYEA 4AZWA 5CAOA 4YZMA 4AGDA 3R28A 4ANLA 5I0BA 2JKOA 2XIYA 2WIHA 2W1IA 1OMWA 3UOHA 3HV5A 5AUUA 5C27A 4F9AA 3R7IA 3EYHA 4FGBA 3NDMA 3SOAA 3BELA 2GNFA 2IZRA 3JUHA 5IEXA 3LFSA 5FP5A 3AXWA 3V51A 3TI1A 3VUIA 3PJ8A 2P3GX 5CSHA 4X3JA 3W33A 2YIRA 1ZZ2A 5ICPA 1YHSA 3AD4A 3NUUA 2J0MB 2QU5A 4O1OA 4UWBA 4K77A 1W8CA 4PV0A 1JVPP 3LMHA 4G3GA 2C5XA 5BPYA 3WZUA 4UMUA 2CKOA 3ZM9A 1SZMA 1TQMA 2EU9A 2NRUA 4N6ZA 4JBOA 3EZRA 3KA0A 1H1RA 3OXTA 4UZHA 3QU0A 5F20A 5CQWA 3TACA 3VS6A 4S2ZA 4CTCA 5LWNA 1GJOA 4C61A 4LFIA 2WMTA 1BYGA 4R3PA 3AC3A 2WTCA 4EJ7A 4I41A 1OIRA 3F2AA 2VGOA 5F4NA 4R3CA 5D11A 4DFLA 4EJNA 4EUTA 4F99A 3NVKI 4WOVA 2H96A 4I93A 3UIUA 2ITZA 5HX8A 3BV2A 4B0GA 1WBVA 4FZ7A 4MXOA 5A4LA 3LFCA 3OEFX 4AOJA 3V5LA 2XS0A 1PY5A 5I9VA 2BMCA 1OIYA 2XNBA 3MI9A 4MNFA 4BBFA 2HY81 2UW0A 4JRNA 4ZJIA 5DWRA 4ZJJA 3DPKA 4LL5A 1GIJA 2ZAZA 3HX4A 4HGEA 3VS0A 2GHLA 2YM5A 4ASDA 1PW2A 4KIOA 4D1XA 3D9VA 3NUNA 1KE8A 3G33A 4LUEA 1QCFA 2YIYA 4XOYA 2HK5A 3S2PA 3F9NA 4U40A 2JITA 4AW0A 4YTFA 3UZRA 5E91A 3FXWA 4EK3A 2GS7A 5FBOA 4Y73A 3G9LX 5IKWA 1OPKA 5A9UA 1I09A 4XUFA 5BYYA 1JKTA 1DI8A 3O17A 5AV3A 3UPZA 3ZUUA 3R9RA 2VWXA 4KIKB 3I60A 4I4EA 4KUJA 4W8DA 5HBEA 2UW8A 2WO6A 1HCLA 3IO7A 5DGZA 4XG8A 4DH7A 2E9OA 2C3KA 4S32A 4ZLOA 1QPEA 4WG4A 1W83A 3LFDA 3NLBA 1ZMWA 2XYUA 3QQUA 4Z55A 5K0KA 2Y8OA 5J79A 3T8OA 2VV9A 3VUKA 4CVAA 2QI8A 2R7IA 3CPCA 1FBNA 4YTHA 1OL2A 3JVSA 3CJFA 3VS5A 3L8SA 4PDPA 4C57A 4FNWA 4AZFA 3R1SA 3PSBA 3B8QA 5DE2A 4V04A 5FUTA 2QCSA 2QOKA 4F0IA 2VAGA 3V5TA 4YLLA 3UZTA 3R7GA 4BWKA 4HVDA 5HG7A 4TY1A 3S1HA 4FNYA 4F6UA 2WMUA 3GCQA 3BYOA 1Q3WA 3P7BA 3NIZA 4C2VA 4D2SA 4X2JA 4X6RA 4UXQA 1WVXA 3G90X 4EBWA 1YXVA 2W1EA 4G6NA 4E4NA 4J8NA 5FP6A 4EWQA 1YKRA 4BDDA 4JQ7A 1YWNA 3UQFA 1S9IA 2BRBA 5HCZA 3TKUA 2BRGA 4WG3A 4BCHA 3HA8A 4UX9A 1FPUA 2R0UA 4ZXTA 4WRSA 2R2PA 1GZ8A 2ITYA 4JBQA 4MBIA 4RA4A 4ZSLA 3QCYA 4NKSA 3OC1A 4GRBA 4U0IA 4I20A 3CD8A 3TDWA 4GG7A 2XK4A 2Y0AA 3P08A 3PSDA 1U59A 1ZAOA 1JSUA 4JRVA 3VBYA 5HLNA 1IRKA 2E2BA 3CQUA 2WQBA 1M2RA 5CEIA 3ULZA 3ZOSA 1YRPA 1J7IA 5FTGA 3C4FA 5AR2A 1PXLA 3UG2A 3GOKA 3VW6A 3AT3A 1H0WA 4M14A 4W4YA 3UDBA 2WNTA 3GVUA 4IVCA 3FMNA 4DHFA 5KBQA 2OSCA 4HGLA 3LCKA 1P5EA 2HZIA 4XV9A 2WOTA 3NYXA 4U97A 3DLSA 1M7QA 4LOQA 1BI8A 4XG9A 2PWLA 3ZRLA 3KN6A 3W16A 2GNHA 1PXPA 5ANDA 4MNEA 3BQCA 3EN4A 2FB8A 4ASZA 5AX9A 2BRHA 4GT3A 4JX3A 3I7CA 4OAVB 4YZNA 3RNYA 4XMOA 4O83A 2QLUA 5CYIA 4ONAA 4HNIA 4XG3A 3SOCA 1CM8A 5AIKA 4UXLA 5C1QB 2V55A 2FSMX 3HMOA 2WFYA 1XH9A 4X21A 5CI6A 3BX5A 4DINA 3DFCB 4FIFA 4O0YA 3G0FA 3NYOA 4DFUA 4D9TA 4LM5A 3B8RA 3W18A 4FKUA 4C59A 3DLZA 4O6EA 1Y57A 2ZB0A 2UW7A 5BMSA 3QFVA 1P4OA 2YIWA 3BGQA 3TTIA 1NA7A 1BKXA 2Y6OA 4KD1A 4CTBA 3ZYAA 1BLXA 2YJRA 3FZPA 4XP2A 4RWIA 4IC7A 1P14A 5IZFA 1H1QA 3UMWA 4P5ZA 3EYGA 2YCRA 4O96A 3VBVA 3QQFA 4DITA 3TM0A 4NH1A 2NPQA 3CEKA 4CKIA 4PMPA 3TNIA 3PY3A 4TN6A 4GK4A 2QURA 5A4QA 2ZYBA 3R04A 5DNRA 4ZMEA 5DR9A 3ENHA 3PXRA 4I6HA 4YC3A 5EYDA 1Q62A 4FZFB 1KOAA 4QP1A 3ENMA 5HO6A 4FICA 3W8LA 5ACKA 2CKPA 5GJGA 4O27B 4ZY4A 4CGAA 4CMTA 3C4XA 2GSFA 3ORKA 4WHZA 5C8MA 4JR3A 4D2PA 4KIKA 4BZDA 4BCOA 5ANEA 4EH8A 3NCGA 3ALNA 4L01A 1WAKA 5C26A 5CF5A 5I9ZA 4YJSA 2VWWA 3FYJX 2UV2A 2QHNA 4RG0A 5KMKA 4CZTA 3BCEA 3VNTA 2XNPA 4GEOA 4K11A 4E6AA 1CSNA 4FTAA 1R0EA 4N0SA 3WOWA 3NUSA 4CNHA 5HI2A 5DT3A 3MPAA 3R71A 4FT0A 4RQKA 5M07A 5AAFA 2WU6A 4ALWA 5JZJA 3GNIB 4NJDA 1DAYA 4ZTHA 3VJOA 5A46A 3KC3A 3O8UA 2UVXA 4ANMA 4QYHA 3RAIA 5ANIA 5DRDA 3C7QA 2V0DA 3V8SA 4XCUA 3RAWA 4DTBA 5ETIA 3V01A 3MPTA 3FI8A 2NRYA 3ATTA 4DGOA 5BVOA 3PG1A 5C01A 4O7YA 3VQHA 2X81A 3T9IA 3L8PA 3THBA 5DT4A 3NGAA 4BYIA 1H27A 3RHKA 3HP5A 2XMYA 2J0KA 3H4JA 4IANA 3C0IA 4PPCA 5DHJA 2AYPA 3CGOA 3EKKA 4O91A 2BHEA 3F82A 2VTAA 4QYEA 4AA4A 2J0LA 4NYEA 3A7IA 3MA3A 3A4PA 5KMLA 5L6OA 4GK2A 4AQCA 1YXXA 4FV3A 3BYVA 4APPA 2HZ4A 2XJ2A 3U8WA 5ETFA 4O7TA 2FA2A 5IMEA 4L44A 4G5PA 1Y91A 4AZEA 3C51A 4D4RA 5KMMA 2XK9A 3ORIA 3LXKA 3MA6A 3RK7A 1GY3A 5TO8A 2H8HA 2WMBA 3K5VA 5CWZA 4G3CA 1YI4A 2H6DA 3NNUA 3ACKA 1CKPA 2XKDA 4QMQA 4U6RA 3PWDA 4QTCA 2XRWA 3W2PA 3HZTA 1SYKA 3LFAA 2Q83A 4ANBA 1ZRZA 4MQ1A 4S30A 2Y4IC 3CD3A 4XYFA 5HE0A 4E8AA 2ITPA 1F3MC 4QQTA 1FMKA 3WZEA 3LVPA 3GC7A 3WYYA 4EHVA 4FIEA 4W4VA 3O71A 4OW8A 5B0XA 4AACA 2CGWA 3KB7A 3BQRA 4O0SA 5J7HA 2QO7A 5JSMA 5CTPA 1Z5MA 5CT7A 5HVYA 5T3QA 4BIEA 1DAWA 5L2WA 4PRJA 2BROA 5AV0A 3Q6WA 2VTIA 2ZJWA 5FTOA 4B8LA 4E26A 4G9RA 4O7NA 4QNYA 2FSLX 4EHZA 2V5QA 5CU3A 3AQVA 4W4XA 3PA5A 4EOMA 4MXZA 3U9CA 4MYGA 4W8EA 3VF9A 4HYSA 3GU6A 5JQ5A 4BWXA 2GNGA 4BDBA 4GT4A 4OGRA 4UBAA 3OVVA 4XP0A 3U4WA 5DI1A 3WF5A 4LI5A 4NFNA 2GU8A 3ORNA 3Q5IA 2GNIA 3QTIA 4PUZA 4DBNA 4J8MA 1CKJA 4YNEA 1SNUA 2IO6A 2P2IA 2Z7QA 3S3IA 1Z57A 5M44A 3PVBA 3BHTA 4GL9A 4BDEA 2BZKB 1IEPA 3BHHA 3SW4A 4D0XA 3Q96A 5FG8A 4A4LA 1M7NA 3FQHA 2B1PA 3QTXA 4DTKA 2GS6A 3ZUVA 5HESA 2ETRA 4FTIA 3KMUA 3ZBFA 5J9LA 2QQ7A 1OUKA 1PXJA 2WZJA 3JR1A 2IVUA 3AC1A 4ZK5A 1M52A 4P2KA 3RM7A 4ASXA 3HV4A 5TOZA 3GEQA 4DG2E 4O0UA 1GNGA 4DCEA 3BE9A 4HVGA 2BCJA 4JQEA 1JKSA 5A6OA 1XWSA 3MWUA 3CR0A 1REKA 4FT7A 1KE6A 3DXPA 2C6LA 2WIPA 3ALOA 3SGCA 3E8NA 4J7BA 3CBLA 3QL8A 3WE8A 4F0GA 3OCTA 4EOSA 1A9UA 2IVSA 2GNLA 1LP4A 1XH4A 3R00A 5JQ8A 4FEXA 4IMYA 3GGFA 2JAVA 3EQDA 3EQGA 4HZSA 4LMNA 4EHEA 5AJQA 1JQHA 5CY3A 2WTKC 2YZLA 3CTHA 2J0IA 3FC1X 4M84A 4KNBA 5CSWA 3ZZEA 5LQFA 1ZOHA 2W1HA 3HUCA 5GIPE 3DOGA 3PPKA 3ZLYA 5DA3A 3QQHA 2G15A 3F5GA 5BVKA 4QMUA 4HPUE 2WMSA 4BFMA 4LV8A 4UZDA 5EQPA 2R7BA 3LIJA 5CVFA 3KMWA 3ODZX 4I0SA 5EW9A 2VGPA 2WHBA 3CQEA 4CLJA 2BILB 2OF2A 1REJA 1J1CA 5CASA 1H4LA 3DB6A 5DIAA 5A3XA 4ANOA 5K4JA 4PDYA 3QCQA 4YO6A 5TKDA 3FEGA 3NVMB 2XBAA 3ZH8A 4M0YA 3F88A 4OTDA 3OT3A 5KZ0A 1WBNA 1K3AA 1YXUA 3E93A 1PXKA 3LCDA 1UNLA 5CZIA 2GQRA 3U6JA 3HAVA 1NT2A 1ATPE 1PMUA 5EYMA 4ZAUA 3QQJA 1T45A 2XIXA 4GFMA 1DS5A 1PKGA 3DFAA 5AP0A 4WNKA 1QMZA 4DH1A 3T3UA 4IX6A 5J87A 5C03A 1RQQA 1YWRA 4QMNA 4FL1A 4BBEA 3BU3A 3IQ7A 4R5YA 4ZY6A 2WKMA 5LMBA 5AFVA 3TL8A 3VHEA 5LMAA 4AU8A 3DBDA 3KXGA 2OH4A 2IZTA 4BDAA 1BL7A 1AD5A 3TN8A 3ZM4A 4XP3A 1JNKA 3VUHA 3QWKA 3UO5A 3GC8A 3ZSHA 2R3KA 3M2WA 2OH0E 2BPMA 3NW7A 3NW5A 3ORZA 2VWZA 3I0OA 4FKIA 5CU6A 3KREA 4JLCA 2I40A 4RJ6A 3PRIA 3NYVA 4LUDA 3CKXA 3NAYA 4ORKA 2EB3A 3GFWA 5AP1A 2WMQA 2WMRA 4DH8A 5HCYA 4O0TA 3LMIA 5M06A 4GYIA 3OBGA 2HOGA 3JXWA 3BZ3A 3H9RA 3PY0A 4MQ2A 3Q9WA 4E7WA 4J53A 4GKIA 4V05A 4C7TA 3A7JA 4IH8A 3D2IA 2RFDA 5CU2A 4EKKA 3WBLA 4JAIA 3DKCA 3TWJA 4XG6A 5JH6A 2C1AA 5EM7A 4I22A 5JGBA 1YVJA 3LQ3A 4GW8A 2B9FA 4AX8A 5TF9A 5E4HA 3O7LD 3PVWA 5AA8A 4DFNA 1MRVA 2B9HA 5AUWA 2OJ9A 3O0GA 4JXFA 3FJQE 1W82A 3BRBA 4I4FA 4J71A 3ELJA 4BGHA 3IW6A 4O7SA 4YJTA 2GPHA 4IAYA 4J96A 5H3QA 2YLEA 2QOBA 5H9BA 3RCDA 4FV2A 4RPVA 2X8EA 3PA4A 1OBGA 1G5SA 3QUDA 2XUUA 3GOPA 3S4QA 4V01A 3EFWA 2GHGA 2VWVA 4OTPA 2RSVA 2ZM3A 3TZMA 5EQYA 4FYOA 1BUHA 1YXTA 4ERWA 3KRXA 2XIKA 2VTSA 2CN8A 4Y85A 1U54A 3WF8A 5CAPA 3FY0A 3QX2A 3P4KA 4YURA 4FIGA 2B52A 3E88A 4YP8A 2RG6A 4EWHA 4KA3A 2G9XA 3UE4A 3EIDA 2PZYA 1OKYA 3FMEA 4RJ5A 1Q3DA 4QTDA 4ZTRA 3ZRMA 4J99A 5M51A 5EI8A 2C0TA 4C4EA 5A4EA 5BUEA 4II5A 2HELA 3RPYA 1I44A 2PMOX 3MBLA 2F49A 4PDOA 4QPMA 4ANQA 3OY1A 4EQUA 2JKKA 3IDCA 4QMLA 5L8KA 2VNYA 2R3GA 2VTRA 2Z7SA 3DTWA 3KRJA 4CYJA 3EZVA 3E7VA 4E5WA 5HU3A 3SW7A 1OBDA 4Y5HA 4O2ZA 3FL4A 4EH3A 3EJ1A 2QD9A 5HO8A 4QQCA 4AA5A 2OZAA 4BI1A 3F2NA 3BU6A 5IH5A 5JK3A 3U55A 3TUCA 5E8TA 4QMOA 1J91A 1E9HA 2VD5A 3HP2A 1WMKA 4BHZA 1XJDA 2PSQA 3FI2A 3OBJA 3LFEA 4LMUA 1AGWA 1QPJA 3M1SA 3E7OA 4U7ZA 1SVHA 5J7BA 3QCSA 3QX4A 3F5UA 5KZIA 5DN3A 4IAKA 4Y95A 4BI0A 4CYIA 3KRWA 3MFUA 3G9NA 4QP7A 3H9FA 4MAOA 5G6VA 2CMWA 4FVQA 5LWMA 3A60A 2C6OA 3JPVA 5GJDA 3RTPA 4F1OA 5GZ9A 3SX9A 4BCNA 5HO7A 1Q97A 2A19B 4FTOA 4XH6A 4NW5A 5D41A 4A06A 4BIBA 5KKRB 1KUTA 2OK1A 4ANNA 3W2CA 3BHUA 4K1BA 5DMZA 5L3AA 5CU4A 5LXMA 2XB7A 5F95A 5F9EA 3MIAA 3F3TA 5K9IA 4HCTA 1PJKA 3U9NA 3IDPA 3R73A 4MK0A 4ACCA 4D0WA 4KAOA 1R1WA 3L8VA 2R4BA 3JYAA 1KE9A 3DK7A 5I9UA 5JFSA 3C5IA 4BB4A 1TKIA 4BCQA 1OKVA 2ZVAA 5IUGA 2YDJA 4CLIA 4DEGA 4IZ7A 4E20A 4WNMA 3MB6A 5CXHA 3W2RA 3FPQA 2W1ZA 3Q52A 4GS6A 4G1WA 4CZYB 4EL9A 3PWYA 3T9TA 1L8TA 4DFZE 4TYEA 2QKRA 4TL0A 1PRYA 2W1DA 5KHWA 5AUZA 3EMGA 3TZ9A 4UYNA 2XK6A 3QHWA 5E92A 5IPJA 5EK7A 4J95A 3R9DA 4HVSA 5L8LA 3DNEA 1UU8A 1LPUA 4AG8A 2PMLX 3PXZA 5AMNA 2WEIA 5D9HA 5E8YA 2ZV9A 3PIXA 4X2KA 5ITAA 4YJRA 4CZUA 3PP1A 4E6CA 2QOLA 2IG7A 4L9IA 4UMPA 1V0OA 4XOZA 4F9WA 3LLAA 5IQCA 3BGPA 3SG8A 3C4WA 4FV4A 5C4KA 4E5BA 3MGYA 2NO3A 4GJ3A 4HVIA 1HOWA 1NVQA 4FTJA 3BEAA 4HYIA 2XP2A 3OWPA 5DFPA 4ASEA 4FKWA 3R9NA 3SAYA 4ZZNA 4FOBA 4CRLA 3OTVA 3PXQA 2W4KA 2YHVA 4QTAA 3UP7A 5AUTA 4QP2A 2BTRA 5HX6A 1P4FA 4FKGA 2DQ7X 3O96A 4YZBA 4ZSEA 4EOPA 2WQNA 5B2KA 4YTCA 2BVAA 3FSFA 3PJCA 4FF8A 2C6DA 2I6LA 5HNGA 5M4UA 4WNPA 4FYNA 5EM8A 4L46A 1JKKA 3U6IA 2VX3A 3FQSA 3COMA 4RIWB 5KX8A 3N51A 2G2FA 4IWQA 1KE5A 2PVNA 4WSYA 4XBRA 4YJPA 3HEGA 3EWHA 2VNWA 3KXNA 2J51A 4U41A 3RK5A 2WOUA 2VTHA 3SKCA 2OXYA 1TQPA 3POOA 4QTEA 3FLWA 3Q4TA 4G16A 4KKHA 3KVXA 1ZYSA 1J1BA 4RZWA 3SXRA 5AR5A 5I9YA 2B53A 4W9WA 4IBMA 4BL1A 2GCDA 3GCSA 2PVRA 4CFVA 3CSVA 4L3JA 4NEUA 2X6DA 2CGVA 3GENA 2A27A 3GCPA 4O0RA 2JKQA 2XIZA 3NUXA 4QMPA 4BN1A 2Z7LA 4RIWA 3ZC5A 2WTKB 4I6QA 4M68A 2JD5A 2CKEA 4PQNA 3Q6UA 4BDIA 3OP5A 3OW3A 3ZFYA 3SDJA 3WYXA 3D5VA 4XV3A 4TWPA 4XBUA 4YMJA 2CLQA 5DLSA 4WT6A 5ETAA 3R7YA 2B54A 5HIBA 1H26A 4DEIA 3V5QA 2FYSA 2WTDA 2QOOA 4FV5A 3ZXTA 1H24A 3COIA 2EUFB 3DA6A 4GSBA 2BHHA 4OBPA 5KMOA 4WG5A 3TJDA 2PTKA 3UOLA 2CGXA 2QNJA 3Q3BA 5JFXA 1OPJA 4FODA 2SRCA 5AR3A 3AT4A 4C58A 4H39A 3C50A 4MBLA 5EDRA 4B8MA 3HUBA 5HOAA 2V62A 2Z7RA 1UWJA 3UIBA 3D0EA 4AGCA 3GB2A 3ZLWA 4D4YA 3VRYA 4IC8A 5H8BA 2JBOA 4IVBA 3GU4A 1BL6A 4KWPA 3NX8A 3V6SA 2GS2A 2LGCA 4FKTA 5EYKA 3LCSA 1Q41A 2XA4A 1UNGA 3LCTA 5EOLA 4CXAA 4ZMFA 1TQIA 4K0YA 4RZVA 3A7GA 1H08A 4TWCA 5IEYA 5CEKA 2HCKA 2R9SA 4IIRA 2UZLA 3RBWA 5AM7A 3PY1A 5J9ZA 4HCUA 1TVOA 4A9SA 4CV9A 2HWOA 2BAKA 3FZOA 3ID6C 4EONA 2X1NA 4GH2A 4F7NA 4OBOA 5I9XA 3OG7A 1JWHA 3L9MA 4A9YA 2VX1A 3E8CA 4FSMA 5DH3A 3GCVA 4CFXA 3VS2A 3C0GA 3QBNA 5I4NA 2G01A 4BWPA 2QR8A 2R3PA 4CRSA 3K3JA 4QQJA 4CG8A 4NTTA 3MFTA 3P1AA 1WZYA 1MRYA 4X3FA 3VBQA 4GYGA 4R78A 4WBBB 2AUHA 3Q04A 3UIXA 4EOIA 4QMYA 2C0OA 3EN5A 4UMQA 4ANSA 5HTIA 5KMNA 5BYLA 1VEBA 3QYWA 4EC9A 1GIIA 2UZTA 4QYGA 2HYYA 4ALUA 4DLJA 3MS9A 4EH6A 4D58A 2BZJA 4X3FC 2NNWB 4JDKA 3D2KA 3C4CA 4DEDA 1YOLA 3CPBA 4RJ8A 4DFXE 5CU0A 5BVNA 2O5KA 5HD4A 3MJ2A 4LOOA 3U87A 1H1PA 1H07A 4E5AX 4Z7HA 5CEOA 2GMXA 4OAUC 2Z02A 3RPSA 2VO6A 3EQIA 3R8LA 3P7AA 3TCPA 4IB1A 4CSVA 4JDIA 5E7RA 5IDPA 3JY9A 3GU7A 1FVTA 4C3FA 5J1WA 4YU2A 5JGAA 1LEWA 5CAVA 4DEHA 4RFZA 4DBXA 4EKLA 2CHLA 3QRTA 4RFMA 3BBWA 3QRUA 3WZJA 5DEWA 5AA9A 3ZU7A 1DM2A 3OUKA 2PVMA 5LVMA 2O3PA 4NW6A 4C4JA 2R0IA 5J1VA 3AD6A 1GZOA 3TKIA 3KFAA 2PE0A 4JBVA 4NWMA 2PVFA 4WUNA 3BHVA 4L3PA 1Y6BA 3QQKA 1Y8YA 2VTMA 2F2CB 3LFFA 4RIXA 5EHLA 5L2IA 1OL7A 2ZDTA 3COKA 1X8BA 2BAQA 3A4OX 3OOGA 1G3NA 4BZNA 3DB8A 3MFSA 4RX9A 3SA0A 2XK3A 4EZ5A 5M08A 3PFQA 5A54A 1V1KA 4MXYA 2W9FB 5CENA 2DYLA 4RWKA 5HICA 5FXRA 5E8VA 2O65A 3MY0A 2GHMA 3TEIA 2X4FA 2WELA 4ID7A 3BPRA 5CXZA 4UWYA 4H05A 4K8AA 2BDWA 3OT8A 2UUEA 2CLXA 5IA1A 4MHAA 3FMJA 2OIBA 3VS1A 4L42A 3NCZA 4RC2A 4QMXA 3KVWA 1Y8GA 5JRQA 2OFUA 3DAJA 3OY3A 4QP3A 3DU8A 3QKLA 4U45A 3T3VA 2NP8A 2PE1A 3PVGA 3QLFA 2PVLA 4G9CA 2VUWA 1ZYLA 3LJ1A 4FE2A 1BX6A 3F7WA 3QF9A 4OBQA 1UU9A 2CSNA 5FTQA 1MQ4A 3EQBA 3OXIA 3R7VA 2C3LA 4KB8A 4L53A 4BICA 5JZNA 4E6DA 4YSJA 4DFBA 3E63A 4DEAA 3W2OA 4XV2A 3D15A 4U3ZA 4OTRA 3V04A 5GHVA 5CF6A 2XZSA 4TYHB 3FI4A 5KKRC 4FSTA 3FYKX 4BIDA 2VWUA 4RLKA 3NNVA 4BY9E 2WTJA 2ITQA 4IZAA 5IQHA 4OUCA 3FDNA 3RINA 3W1FA 4AOIA 2XIRA 1E1XA 1JSTA 1PKDA 2ERZE 1STCE 2HENA 5K4IA 3LW0A 3HAMA 4D1SA 4BYJA 5AV1A 4PPAA 1PXMA 3G15A 4RC4A 3QCXA 4U44A 4M66A 3K3IA 4Q5EA 1LR4A 1KOBA 3ZO4A 2X6EA 4FKRA 4JNWA 4U80A 1J7UA 4GUEA 5DBXA 2PHKA 3CY3A 3ZONA 3EKNA 4Q9ZA 4FV7A 4NCTC 3VF8A 3EOCA 3VUDA 5C8NA 3ZO2A 4BI2A 4C8BA 5LCJA 4PMSA 1IA9A 3FQEA 4BR3A 2CCIA 3K5UA 4WUAA 2GTMA 5IQDA 2PVHA 2J5EA 2VTNA 3D7TA 4MD9E 4YO4A 4ENXA 4FZDB 1UV5A 4X6QC 4AA0A 3GC0A 2YACA 2W1FA 4LGGA 4FV0A 4C4FA 5M4IA 3B2WA 3QA8A 5IG1A 2IVVA 2WPAA 3NSZA 3QHRA 1XH6A 4OTIA 3SXSA 2ZB1A 4DLIA 3O7LB 3FLZA 5EW3A 4FSWA 5EOBA 3TJCA 2X7FA 2VRXA 1H25A 4NM7A 1JSVA 1Q4LA 3AMYA 3E62A 3MVMA 3A61A 5HVJA 2OXDA 5EKNA 1ZARA 5CF8A 1XR1A 4FEWA 4BCFA 1OL5A 4G3FA 3HVCA 4FIJA 4FKSA 4MF1A 4HYHA 2HIWA 1MRUA 3BYUA 4PP9A 2OO8X 3OD6X 4M13A 3RM6A 5I9WA 3DBFA 4IDTA 4RJ4A 5DOSA 4TKSA 4XG4A 3QQLA 3QZGA 4AFJA 4IQ6A 3SC1A 4MWHA 4BDFA 3ACJA 2QG7A 2OBJA 1Q8UA 1YHVA 1WBPA 3IK3A 4NU1A 5D1JA 5E8ZA 4C4HA 5CF4A 2ZDUA 3F66A 3NNXA 3LXPA 2W5AA 3WI6A 2DWBA 2X39A 1QL6A 2W0JA 3R22A 4NJ3A 2J7TA 2YWVA 4OR5A 4YJUA 3RWQA 4CQGA 3CQWA 5CS6A 5D10A 3MN3A 2QHMA 3MSSA 4RWJA 5AR8A 4X0MA 4D2WA 2OLCA 5IQGA 4MD8E 1UVRA 3IW4A 2P0CA 4IM0A 3MB7A 2VWIA 4G5JA 3W32A 2WB8A 4RJ7A 5AV2A 2OJIA 3OW4A 4R5SA 3I79A 4D2TA 4IW0A 5HE1A 2BKZA 1FGIA 2ONLA 3U51A 2O63A 4WKQA 5DRBA 1V0BA 2UW4A 3BHYA 2YIQA 2Y4IB 4L68A 2HY0A 4R77A 1WBWA 5AP3A 4G3EA 4AXAA 4I5HA 5FQDC 4DG0E 3PYYA 1NW1A 4IVAA 5KCVA 3WIGA 4PNIA 5LVPA 3GCUA 4FGRA 4BHNA 2XJ1A 2P2HA 4TXCA 2C47A 5M4FA 2JGZA 3D5WA 3EQPA 3FUPA 5FXSA 3PXFA 4BDKA 5C9CA 2XEZA 2YEXA 3B2TA 4EH9A 4E3CA 2YCFA 3FAAA 5BNJA 4GJ2A 2W5BA 3SRVB 4DG3E 2JEDA 2GQSA 3QGYA 4QMZA 5HORA 4FL2A 4ITJA 3C9WA 3IOPA 4FNXA 1IR3A 1G8AA 5HTCA 3FXZA 3QUPA 4KIQA 5JRSA 4IAAA 4AE6A 4HGTA 3TIZA 4NL0A 3D7TB 3H3CA 3A7FA 3GXLA 4YJVA 4BCMA 3SD0A 4YUQA 2YDIA 5KMJA 4USDA 2VX0A 4JOAA 2E9UA 3WIKA 3IDBA 4L43A 3K2LA 5L4QA 3H0ZA 3QWJA 1URCA 3DDPA 3NZ0A 4UALA 5A4CA 4I0RA 5FM2A 4IWOA 4A9UA 5IQFA 1A06A 5B2MA 5M55A 5DR6A 2WU7A 3V6RA 4WRGA 4AZTA 5CSVA 3A7HA 2W5HA 3BEGA 4DA5A 2YABA 4D2RA 1NXKA 4YSMA 5AWMA 2C5NA 2W96B 3P5KA 4EOJA 2ACXA 5CAQA 3PXKA 5KO1A 3ROCA 4BZOA 2W17A 4EYMA 2C6MA 3KXMA 4FT5A 1U5RA 3ZEWA 5FEEA 1PF8A 2VTOA 3PUPA 4GMYA 4EZ3A 4JG6A 3D4QA 3UC4A 3UODA 3F5PA 1FMOE 3I5ZA 3WARA 3U6HA 5AR7A 4HNFA 3NUYA 2GTNA 2X4ZA 4MTAA 1UWHA 2PL0A 2B55A 4IADA 4CFNA 5DR2A 3H0YA 4R1YA 4TWNA 4B9DA 4ZZOA 2B9IA 3Q9YA 3CGFA 2VTQA 3GBZA 4FIHA 4K18A 3PIYA 5AX3A 1H1WA 4W4WA 3CTJA 4RX5A 4G2FA 3A99A 4PX6A 3ERKA 3ZTXA 3P23A 1UKIA 4IXPA 2QC6A 5DVRA 3BGZA 1NVSA 5CEQA 3Q4CA 1SVEA 1XO2B 1UKHA 3RAKA 5EYCA 4IEBA 4QPAA 2JIIA 4CT2A 4ZTQA 4CD0A 4RLLA 4G6LA 3DBEA 2IW6A 1R39A 2QR7A 5IA5A 2OZAB 2WMWA 2WMXA 2ITVA 2WQMA 2YJSA 3QRIA 3QYZA 5E1EA 4RRVA 2A2AA 5FBNC 5IQBA 4M69A 4EZ7A 2Y6MA 3AGLA 3BKBA 3EL8A 5GZ8A 1Q24A 1Q99A 4WA9A 3TT0A 4EK8A 3R7OA 1W84A 5HG9A 4AN3A 4D5KA 4A4OA 4H1JA 4O86A 1Q8WA 4BCIA 2Q0NA 3KRLA 1ZY5A 1YW2A 3DXNA 3ZZWA 4A4XA 1GZNA 4DH5A 4ACMA 2CNQA 4FKOA 5FM3A 1CKIA 4FKPA 3P78A 3PPJA 2QOCA 2BRNA 4ALVA 3QD3A 3TG1A 4D9UA 5J5TA 2GNJA 3SG9A 4C34A 5LVOA 3H10A 4OLIA 1Q8ZA 3IKAA 5ACBC 4AN9A 3NR9A 3ZC6A 5LJJA 1KWPA 3GQLA 3LAUA 2XNOA 3F2RA 2OWBA 4FZ6A 3EFJA 3VULA 2IN6A 2C6TA 1IAHA 3Q53A 3R9HA 3SV0A 4FSNA 5F94A 2YM7A 3CS9A 1FVVA 2QLQA 2RIOA 2P4IA 2WTVA 2YERA 3FLSA 4A9TA 4FOCA 3W2SA 5CALA 1OPLA 5I3RA 2XCHA 1ZOGA 4JIAA 3RALA 3KCKA 2XEYA 3W10A 4AZSA 4LL0A 2W7XA 3KL8A 4GU6A 1FQ1B 3MV5A 3RHXA 1GIHA 4IX3A 5JGDA 4RX7A 2X9EA 3TV4A 3NWWA 3OCGA 1XBBA 4E4XA 4JT3A 5EHYA 5KE0A 3EFLA 2PZ5A 3KCFA 4IHPA 2QU6A 3KY2A 4QP8A 2IPXA 5H8GA 3HNGA 5D12A 5AR4A 4C33A 1ZMUA 3R2YA 2FH9A 2BFYA 3FLYA 2Y7JA 5HLPA 2EB2A 4L00A 3F3WA 4JQ8A 3G6HA 3FZTA 3PVUA 4L67A 4MXAA 4U81A 3EN7A 5C8KA 2PUNA 1Y6AA 3IS5A 4IVDA 1JOWB 1IA8A 2AC3A 4LYNA 3ANQA 3E5AA 4XEYA 4CEGA 4FKQA 3OCBA 3F3UA 5DT0A 3GUBA 4AN2A 3QXPA 2RF9A 2G2IA 3RJCA 3F3ZA 3WZKA 5I3OA 3C0HA 4FTLA 4E6QA 4IX4A 5DEYA 2FO0A 3IG7A 4FK3A 4C2WA 2C4GA 2QOFA 3KXZA 1G8SA 4MBJA 1JBPE 3VJNA 4ERKA 1OL6A 4ACDA 2X7GA 4F70A 3NIEA 3DZQA 3WF6A 5FGKA 3UYSA 2HZNA 5BVDA 3PIZA 3CP9A 4NCTA 3BI6A 4QMSA 4EBVA 4DFYA 1CDKA 4GVAA 5EH0A 4ACHA 2VO0A 3UBDA 4K33A 4XG2A 2WEVA 1IASA 3PE2A 3UIMA 5EFQA 2UZDA 1APME 2ITUA 3VVHA 3A8XA 3R1YA 2V22A 3RMFA 5IF1A 4EUUA 3PLAE 4IB3A 4B6LA 3KXHA 4J52A 3FZSA 1Q5KA 4HVHA 4YZDA 3HV6A 4RWLA 2YFXA 3R21A 3WF9A 5HD7A 4EH5A 3A2CA 3PTGA 3QTUA 3OTUA 4XHKB 4ZSJA 2OFVA 3VUMA 2BZHB 3PJ2A 5IH6A 3POZA 3P0MA 5AEPA 3QD0A 5IEVA 2ETMA 3IOKA 4H3QA 2C30A 3FV8A 3DY7A 2RGPA 3GQIA 3ORPA 4K6ZA 3O50A 5LMKA 4O81A 3RK9A 1WVWA 3F6XA
chains in the Genus database with same CATH superfamily
4RC3A 4RBLA 2O0UA 4FT9A 4CKRA 5E8XA 5EM5A 2R3QA 3FBVA 4I0TA 1JKLA 5EKOA 4R7IA 4X2NA 4ITIA 1YOMA 2I0YA 4TYJA 4C4IA 3DTCA 4BCJA 2ZMCA 3D83A 3MH1A 5EQEA 1VR2A 1KE7A 4D2VA 1URWA 1GOLA 4V0GB 4AGUA 5FXQA 1XH7A 4FTRA 4PDSA 3ZDIA 3LQ5A 2BUJA 5GJFA 5H8EA 4Z16A 1YDTE 4UEUA 4I1ZA 1PMNA 5IH4A 4Y8DA 2YZAA 3R9OA 5EM6A 4M69B 5HE3A 2PZPA 5B2LA 3TDVA 5JKGA 3FZRA 2BR1A 4FC0A 2C68A 4U79A 3H30A 1WCCA 2VN9A 3COHA 1J3HA 1SNXA 3N9XA 3R2BA 4PWNA 5HGIA 3BLHA 4KIPA 3ZLXA 1PXIA 1ERKA 4OTWA 4MF0A 3LCOA 3V8TA 4GIIA 5AAGA 4FR4A 2W05A 3BWJA 4BVUA 2WGJA 4FI1A 1U54B 4BTFA 5K3YA 2RG5A 4YPSA 4E4MA 3EL7A 4IX5A 5J8IA 1OITA 5DPVA 1UU7A 3QGWA 4FX3A 4YBJA 3DQXA 3R7EA 3NNWA 1T46A 4PMMA 4RIOA 4H58A 5LVLA 3WZDA 4LRMA 4E93A 1LEZA 2YITA 3KU2A 5EHOA 4U42A 5KHXA 3M42A 4K2RA 2HW6A 1GZKA 4R6VA 3GT8A 4TNBA 3LPBA 2XF0A 5CSXA 1IAJA 3PE1A 1YXSA 4C3PA 3NS9A 3ANRA 3HMNA 3LE6A 1XH8A 2E9VA 4O0XA 4QNAA 4UB7A 5EI6A 4USFA 4F4PA 5KBRA 2W1CA 4FV9A 5ANOA 3E92A 5ANGA 2C69A 3SVVA 2UZWE 2IVTA 4YLKA 1XHAA 2EXMA 4LOPA 1SVGA 3D14A 3TV6A 3LHJA 4ZTMA 4O4DA 3NMUF 3BLRA 3HMMA 4L6QA 3ORTA 4JG8A 4QP6A 2PPQA 4K9YA 3HV3A 3DNDA 2YWPA 4GV1A 3R1NA 3BBTB 4LRJA 4X2FA 4BKJA 4ZIMA 5E9EA 1O6YA 4G31A 3N4UA 2XKCA 2PY3A 3O2MA 4W9XA 5T6KA 4HCVA 3KK8A 5HQ0A 2UW5A 3QC9A 3PZHA 3VIDA 3GU5A 2EWAA 3DDQA 4FV8A 5BYZA 2ITXA 2XNMA 2J5FA 4QPSA 1MQBA 2XH5A 4F65A 3C13A 4QMTA 4CG9A 5CSPA 2BFXA 2W4OA 4QMVA 3UYTA 3LKMA 1MP8A 4ITHA 4JDHA 3ZS5A 2HXQA 1J7LA 3L9LA 4F7LA 3ROYA 3SRVA 2XCKA 4IE9A 3DBQA 4GFGA 3MH0A 4M3QA 2BDFA 3Q4ZA 2X9FA 4UWCA 3HGKA 3KMMA 4JS8A 5FWKK 4F6SA 4EQMA 2O8YA 5HNIX 2XARA 3L9NA 3LJ2A 3ORMA 2OXXA 5AADA 4TYHA 4F63A 2YAAA 4MD7E 4FEVA 4EOQA 3EQFA 4OTQA 4ZTLA 4O2PA 2FSTX 3KULB 4BBMA 4AF3A 3PP0A 3HV7A 2PVYA 4FTTA 3WE4A 3DK3A 1OB3A 3DQWA 3ZXZA 4QOXA 3Q60A 2GQGA 5HNBA 1ZYDA 5HTBA 4CMOA 4H3BA 2I0HA 1GAGA 3AGMA 4FTUA 4QRCA 1VZOA 2YM8A 5IQIA 5IA2A 2YDKA 3FI3A 4KRCA 5HG8A 2OGVA 3CLYA 3IECA 3ZCLA 4EORA 5FLFA 3FWQA 2CJMA 3IPHA 1K2PA 1QPCA 4S33A 4AGWA 3MTLA 4Q9SA 4N57A 2Z8CA 3AG9A 4BDCA 2J4ZA 1YI3A 3PG3A 4NM0A 5AUYA 3E3BX 4FSYA 4I94A 4CFMA 4BDJA 4RX8A 3HRCA 3ZMMA 2B7AA 4XV1A 3F7ZA 4X2GA 2BTSA 5BVEA 2QONA 4MCVA 5AP6A 2Q0BA 4QYYA 3MFRA 4F6WA 2WMVA 3EQRA 4TNDA 4O38A 3DZOA 2UVYA 1BMKA 5L2QA 2PK9A 2QOHA 3V3VA 1A48A 3DT1A 3NW6A 5E90A 1H00A 4HJOA 2I7QA 4FEUA 1OGUA 1XBCA 5A6NA 4NIFB 4H3PA 4O7RA 4MXCA 4X3FB 5M56A 5E1SA 5J9YA 4BGGA 3TUBA 3FMKA 3NUPA 3ORLA 3C4EA 2PMNX 3I0QA 4L8MA 3CTQA 3DAEA 3VBXA 4EYJA 1RE8A 1ZMVA 3OWLA 4IACA 2VTJA 1YWVA 2ZOQA 4EHGA 4UN0C 5M53A 3QZFA 3UVRA 3ATSA 2BIYA 1QPDA 3ZDUA 2ZM4A 3FKOA 2Y9QA 2JDRA 4FIIA 5HE2A 3W55A 4DT8A 4XG7A 3MH2A 4PTGA 4RSSA 4FUXA 3EQCA 4IWPA 4XRJA 1Q8YA 3QUEA 3QAME 1H8FA 3RAHA 4B7TA 4DN5A 5A14A 2DUVA 4D55A 3PZEA 4FVRA 3Q2MA 2JIUA 2EXEA 2OIDA 4FKJA 3LFBA 4NUSA 4JG7A 4F7SA 3OROA 3MYGA 5LOHA 1ZWSA 3UO6A 3MVHA 3VUTA 4O7LA 1K9AA 2A1AB 3QD2B 2W99B 1OM1A 1ZZLA 4BF2A 4E73A 3ORXA 3I6UA 2RFNA 4UYAA 3TNHA 3UVQA 2HWPA 5DG5A 4I23A 4AE9A 4AT5A 3C5UA 5AAEA 5CQUA 3MIYA 5HEZA 4F1TA 4RVMA 4D4VA 5EDQA 1Q61A 2JDSA 3HA6A 2UZEA 3BYMA 4RQVA 3V8WA 2OIQA 3ZFXA 4KBCA 5CNNA 3OOMA 2HW7A 3PSCA 4IAZA 5IUIA 3D94A 3R8VA 4C02A 2IZUA 3QTQA 4F0FA 1VYZA 4J1RA 2YISA 3ULIA 4X7QA 4E4LA 2BRMA 3EHAA 4CT1A 4BCGA 1PMEA 4CFWA 4R7HA 2CPKE 3UVPA 3VWAA 4EOKA 1PXNA 3R63A 5HLWA 3HECA 4M97A 5CVGA 5C4LA 3I81A 3II5A 1HCKA 3HRBA 3OHTA 4QMWA 3TXOA 1WFCA 2P55A 2VTLA 3KKVA 1F5QA 1ZYJA 2A4LA 2A0CX 4FSRA 4HZRA 4DC2A 4F9BA 3AT2A 4I5PA 3E64A 4NZWB 3QLGA 5FEQA 3R1QA 4ZY5A 2CNUA 4RGJA 3O8TA 3UNZA 5EG3A 4I5CA 3VHKA 5HHWA 3ZLSA 3HMPA 2RKUA 4PF4A 1M14A 2BDJA 3NYNA 5FDPA 3JS2A 2Y4PA 3LXNA 4KABA 4J97A 3RGFA 4P7EA 4DF3A 4N6YA 5B7VA 4PL4A 3CE3A 1L3RE 3QD4A 4ZS0A 3TTJA 4WD5A 3E87A 1B39A 2ZV2A 3P79A 5HBHA 3SXFA 4O7VA 4LDTA 4GK3A 2WAJA 4JIKA 4F09A 5CVHA 5FDXA 4IM2A 3GFEA 4O7ZA 3RZBA 1JAMA 1U5QA 2R3OA 2QODA 4NK9A 4ARKA 3JY0A 4Z7GA 3LXLA 3W0RA 3KEXA 4WO5A 4RIXB 1RDQE 2WD1A 5AUXA 4MX9A 3S95A 2V7AA 3E8DA 2YM3A 1FOTA 4O6LA 4BKYA 1SM2A 4QP4A 3R8MA 4F9CA 3F61A 5EDPA 5AP2A 2J90A 4Y83A 1B38A 4G17A 2FSOX 5D7AA 2OJJA 5IA0A 4AAYA 2PMIA 5IUHA 3UJGA 2R3NA 4KS7A 4U43A 3JVRA 4DYMA 1FVRA 1RJBA 2R3MA 4AT4A 4G3DA 5JFVA 5BUIA 2ERKA 4BC6A 2AC5A 3EB0A 4M67A 2F2UA 2VWYA 5K5NA 2VO7A 4BGQA 2ZV7A 5E8UA 4FTKA 1UNHA 3IW5A 1WVYA 2V7OA 4NM3A 4YHFA 2F4JA 5TR6A 3IW8A 4D4SA 4EOLA 5H2UA 2OJGA 4IB5A 1KSWA 3KQ7A 1OKWA 3P7CA 4ENYA 4FVPA 2X8IA 3QZIA 2OI4X 5AP5A 3LFNA 5EI2A 3FMDA 5IDNA 4F7JA 2PULA 4C4GA 4IAFA 3ZHPC 1PHKA 4GG5A 1KV2A 4DEEA 1WBTA 4V0GA 3DAKA 4IDVA 2WTWA 3TNWA 4O82A 4EOOA 4PL5A 2XKEA 4FV1A 4MXXA 1XKKA 3LLTA 3RVGA 4C62A 3CIKA 5I5ZA 3ETAA 1TFFA 4FTQA 3FLNC 4FKVA 4EH2A 4RA5A 2R3HA 5HU9A 4XJ0A 5J95A 4BCPA 1F0QA 2XBJA 3KK9A 2KTYA 4BCKA 5GZAA 3N4TA 2UW3A 3A8WA 5FEDA 3QXOA 3PLSA 4KKEA 5E8SA 3UTOA 4APCA 4S31A 2XNEA 3EN6A 4PTEA 2W06A 4L45A 2OJFE 2B9JA 2UZNA 3FSKA 4I5MA 2LAVA 3ZBXA 4L7FA 1H01A 4JDJA 3CY2A 3PXYA 4B99A 3LQ8A 5AIRA 4M12A 3DJ5A 4RVKA 3D5UA 2PVKA 4A7CA 2CN5A 3R30A 4BDHA 4AWIA 4AFEA 3MW1A 4IM3A 4A9RA 4AW5A 5M4CA 2YN8A 4DGGA 4WIHA 4P90A 5BQ0A 4Y46A 3MTFA 3AC8A 2PU8A 2WQEA 3TKHA 3W8QA 3DBCA 2J2IB 4CCBA 2X7OA 3VS3A 1ND4A 4XNEA 4D1ZA 3Q9XA 3HDMA 3R01A 3K54A 4IAIA 4OTHA 5HG5A 1YHWA 2OICA 3G0EA 3MY5A 2KULA 4HOKA 5FD2A 2XJ0A 2BIKB 3E8EA 3W2QA 1EH4A 5K0XA 3RP9A 5CX9A 2YLFA 4WNOA 2C5VA 4MNEB 1LUFA 1XH5A 2OG8A 3BE2A 3FC2A 3OXZA 3ZEPA 3BU5A 3RZFA 1ZY4A 5LVNA 4GFOA 2GFCA 2F7XE 3R0TA 4QD6A 5CI7A 3VS4A 1WBSA 4EQCA 3UDSA 2R3JA 1WBOA 2UZVA 3G51A 4FZAB 5AUVA 4AOTA 3G2FA 3OZ6A 2PE2A 3PRFA 3UNKA 5HIDA 3PA3A 2CGUA 3UO4A 2JKMA 2EXCX 4YGAA 3RI1A 2UZBA 5K5XA 3RNIA 2E9PA 4J98A 3UQGA 4QYFA 3SQQA 3FY2A 1W7HA 4C35A 4RT7A 1V0PA 2R3LA 3FE3A 5KUPA 1RW8A 4CCUA 3ET7A 5ANJA 3VAPA 2W1GA 3DXQA 2ONLC 2CCHA 1OUYA 4FSUA 4A07A 1O6KA 2BAJA 5CAUA 2YIXA 2RL5A 2F7EE 2W4JA 2JC6A 3DJ6A 5HZNA 4ZSGA 4FKLA 4N4SA 4ZP5A 3RPVA 4BKZA 1VYWA 3L9PA 3CKWA 2J0JA 4IZ5A 4EC8A 2R64A 4S34A 2VO3A 4C3RA 2CKQA 4YR8A 2YCSA 4NSTA 3VBTA 5JMSA 3DKOA 1ZXEA 2WQOA 2PVJA 4IJ9A 5JEBA 3OCSA 3MVJA 2J50A 5L2SA 4OT6A 3WILA 4I6BA 4YPDA 3RWPA 4YNOA 5JT2A 3MJ1A 3R83A 4YZCA 4AS0A 4P5QA 4AW1A 4H1MA 1OZ1A 3UMXA 3UZPA 3DK6A 3P86A 4TYGA 4JL9A 5ANKA 5M57A 5IA4A 5GIOE 4M8TA 1JLUE 4JX7A 3UG1A 3F3VA 4C38A 3I6WA 5KMIA 1OKZA 1U46A 5AV4A 3AMAA 4I6LA 3OWKA 2VZ6A 3VO3A 4FUYA 5BUJA 4DE4A 4HPTE 5BMMA 2JIVA 5HVKA 1FGKA 2O2UA 5AP7A 4AQKA 2QO2A 4H36A 3EFKA 3IONA 3GC9A 2X2KA 3EH9A 4LQMA 4AZVA 4QQ5A 5M09A 4MEDA 3S00A 4FV6A 2OU7A 4JJRA 3R8PA 2UZOA 3V5WA 2X0GA 3M11A 1VJYA 1W0XC 3PDTA 2PZRA 4PTCA 2C1BA 4UV0A 5AP4A 2H34A 4FT3A 3P5JC 5CT0A 2YM4A 3MH3A 2OF4A 3O23A 4RVTA 1OI9A 4G34A 1M17A 2BALA 4TRLA 2QOQA 2C0IA 4P4CA 5HCXA 3S0OA 3FMLA 4MVFA 5BVWA 3KXXA 3MPMA 3QZHA 2G2HA 4IJPA 4YC6A 4JBPA 2Z60A 3FKNA 3TUDA 2X8DA 2JLDA 2OZOA 4F9YA 2R3IA 2B0QA 2BKKA 3QTSA 4KINA 4D28A 4ZLYA 4O1PA 1H1SA 3QTWA 4FNZA 3R8ZA 2ZV8A 3KF4A 3FKLA 4EK4A 4DCAA 4JAJA 3UQCA 3CJGA 5LARA 4DH3A 4F78A 4ZTSA 3FHIA 4O0VA 3QRKA 4F08A 3OF0A 4YHJA 4CV8A 4Q5HA 5L8JA 5HBJA 5IA3A 2ITWA 4FRFA 1OIUA 3VUGA 4NM5A 4BRXA 4DEBA 4QO9A 4PMTA 5IQAA 2WXVA 3KN5A 2C3IB 4XS2A 2QVSE 4RIYB 4ACGA 4BTKA 1MUOA 4ZOGA 5LCKA 2HXLA 4DGNA 5BX0A 2XM9A 3F5XA 5JFWA 2F57A 3AC4A 4G6OA 1UA2A 4HGSA 3L8XA 4GCJA 3A62A 5ETCA 2YA9A 2H9VA 4CMUA 3H9OA 4GIHA 2Z2WA 1OECA 1O6LA 2I1MA 2JBPA 4Q2AA 4UMRA 2E9NA 4B4LA 4RVLA 2XRUA 4RJ3A 1U4DA 4FTMA 1YQJA 1H0VA 3QQGA 4OTGA 4QTBA 3NUAA 2VTPA 1OVEA 3I5NA 3LMGA 3GI3A 2DS1A 3HKOA 4FBXA 1H28A 4I3ZA 2HAKA 4KRDA 3TIYA 1NY3A 4WBOA 3MESA 5CEPA 3Q9ZA 3LFQA 2RFSA 1ZLTA 4TTHB 5J5SA 4F1MA 4TT7A 4R3RA 1M2QA 2QO9A 4RFYA 5IISA 2JFMA 3BYSA 3Q4UA 2ZM1A 2JFLA 4N70A 4OTFA 5T68A 2VTTA 3KGAA 3R7UA 3ZO1A 2QKWB 4NFMA 4QT1A 3Q32A 3AD5A 3QTZA 4FSQA 2JDVA 3FZ1A 4R7BA 4ZLZA 4TW9A 4AAAA 1P2AA 3RPRA 4M7IA 3MDYA 4DT9A 2OW3A 4O7WA 2C5OA 4CQEA 3W0PA 3R8UA 2ITNA 3VC4A 4LRKA 4EEVA 4NKAA 4PL3A 1R0PA 3SLSA 3VRZA 3DKFA 2R5TA 2PYWA 2FUMA 3QA0A 3G5DA 3HRFA 3OFMA 2IWIA 2JAMA 3D5XA 4R1VA 3E3PA 4GU9A 4XLVA 3RCJA 3DKGA 4FTNA 4JVGA 2CNVA 4JI9A 4NTSA 2ZMDA 3ITZA 3PJ3A 4U3YA 3KRRA 3QRJA 2REIA 3TNPC 4Z3VA 2BZIB 2FVDA 3LM5A 2YCQA 4KBAA 4MWIA 4BTJA 4YJQA 3TNQB 3GP0A 3NPCA 4XX9A 4BDGA 5HIEA 4M15A 3KULA 3O51A 3OUNB 1YDSE 3HDNA 4DTAA 4Z9LA 2PUUA 2XYNA 3N4VA 4O22A 3PJ1A 4O21A 5FRIA 2QG5A 4FEQA 4YZ9A 3P9JA 4ZSAA 3VBWA 3VW8A 2UVZA 2UZUE 4UMTA 4EK6A 4LV5A 5TT7A 5JN2A 3U4UA 3U54A 1R3CA 3DV3A 3TYKA 3DS6A 3F69A 1OIQA 4FSZA 2IZSA 4L3LA 3DCVA 5EW8A 3HYHA 1OL1A 4L52A 3QALE 4CKJA 1XBAA 2EVAA 2YM6A 3FHRA 3NAXA 4FG9A 2GFSA 3GU8A 4YJNA 3UNJA 1W98A 2I0VA 3OWJA 2ITOA 1Z9XA 2XK8A 5AM6A 3G6GA 4C0TA 5TE0A 4I6FA 3ODYX 4PY1A 3FL5A 4U9AA 3D7ZA 1UU3A 3RKBA 2C3JA 4I24A 4CFUA 2XNNA 2HZ0A 1KV1A 3WF7A 1SMHA 4TPTA 2C6KA 5BVFA 4EI4A 4YJOA 4D5HA 4YLJA 2WTIA 4USEA 2O64A 5L6WL 3CCNA 4QEBA 2PUIA 4AW2A 4I21A 3CXWA 3LZBA 3QKKA 4XLIA 4YBKA 5D7VA 4ZEGA 3IW7A 4OT5A 5CNOA 4O0WA 3AC2A 4WSQA 2JDTA 3W0MA 1AQ1A 3AC5A 5GNKA 4TWOA 4AT3A 4BTMA 3I7BA 2QOIA 2IW9A 3R02A 2CDZA 2PZIA 4DAWA 4F64A 3C4ZA 4RIYA 4TZRA 4QP9A 3IGOA 4PPBA 5CLPA 5A4TA 4FG8A 1CTPE 5KNJA 4XRLA 4O84A 4PP7A 2G1TA 3ZRKA 4IFCA 3Q5ZA 3VN9A 3TMOA 2C5YA 3UC3A 2ESMA 3EQHA 4JR7A 3Q2JA 4CFFA 3KF7A 3ZSIA 2ITTA 4DHJA 2JDOA 3FXXA 4AP7A 5CZHA 4GUBA 4Y5QA 4E1ZA 2XKFA 3HL7A 4C36A 1YDRE 3LOKA 1ZYCA 1S9JA 3PPZA 3LM0A 4FMQA 4L7SA 5CEMA 4ZS4A 5G1XA 2VWBA 4EH7A 3HLLA 3MY1A 2P33A 1CMKE 2J6MA 4MKCA 3TZ8A 4FA2A 1JPAA 2R3RA 3NRMA 3VQUA 1PYXA 3LJ0A 4YC8A 4YHTA 4DGLC 3V5PA 4MUQA 3UGCA 4ZJVA 2AEGA 2FGIA 4R8QA 3SHEA 2F7ZE 2R3FA 4NIFA 1YOJA 2C6IA 1Q8TA 4FTCA 4LGHA 3NEWA 5HKMA 4NT4A 3UP2A 3UPXA 2XVDA 3CC6A 4GT5A 5L6PA 5CANA 2F9GA 3MVLA 2IJMA 1FINA 4HYUA 3UOKA 4QMMA 3VS7A 3PUFC 3C1XA 4IB0A 3BV3A 1PMVA 3OEZA 4HW7A 1BI7A 2PUPA 3O8PA 5IQEA 1E1VA 4KSQA 2B4SB 3DGKA 4YTIA 3O5AA 5L2TA 4C37A 4U8ZA 3L1SA 3DJ7A 3HMIA 3OS3A 4ZTNA 2VU3A 4AUAA 3V5JA 4KSPA 3I1AA 3TZ7A 3ZSGA 4KKGA 4DGMA 3BWFA 4FL3A 5LMKC 4GVJA 3BIZA 1R78A 2W9ZB 3ZUTA 3R6XA 4M0ZA 3ZO3A 4EH4A 3UOJA 2IW8A 4FG7A 3AOXA 2J9MA 3QC4A 3IGGA 4Y72A 1XQZA 2XM8A 5F1ZA 5IU2A 4IWDA 3UDTA 1ZOEA 3BLQA 3REPA 4I92A 2I0EA 3FMMA 1NVRA 1DI9A 4RMZA 4TYIA 4U5JA 4EK5A 5IMXA 2UW6A 2ETKA 2X2MA 4GKHA 3RPOA 4PNKA 4LG4A 3QTRA 3I4BA 4KS8A 1O9UA 2XNGA 4IZYA 2RFEA 2X2LA 2GDOA 2XK7A 1IG1A 3QKMA 4LGDA 4MH7A 4ZZMA 4QDEA 5GINE 4UY9A 4KBKA 3ZFMA 3EN9A 1M2PA 3AMBA 4FK6A 5E8WA 3OMVA 3FMHA 1YI6A 2WMAA 1B6CB 4IFGA 2YAKA 5DYJA 3FPMA 1PXOA 2C6EA 3FLQA 2UW9A 2OKRA 2XANA 3TV7A 1PYEA 4AZWA 5CAOA 4YZMA 4AGDA 3R28A 4ANLA 5I0BA 2JKOA 2XIYA 1TZDA 2WIHA 2NYAA 2W1IA 1OMWA 3UOHA 3HV5A 5AUUA 5C27A 4F9AA 3R7IA 3EYHA 4FGBA 3NDMA 3SOAA 3BELA 2GNFA 2IZRA 4QDVA 3JUHA 5IEXA 3LFSA 5FP5A 3AXWA 3V51A 3TI1A 3VUIA 3PJ8A 2P3GX 5CSHA 4X3JA 3W33A 2YIRA 1ZZ2A 5ICPA 1YHSA 3AD4A 3NUUA 2J0MB 2QU5A 4O1OA 4UWBA 4K77A 1W8CA 4PV0A 1JVPP 3LMHA 4G3GA 2C5XA 5BPYA 3WZUA 4UMUA 2CKOA 3ZM9A 1SZMA 1TQMA 4DHZA 2EU9A 2NRUA 4N6ZA 4JBOA 3EZRA 3KA0A 1H1RA 3OXTA 4UZHA 3QU0A 5F20A 5CQWA 3TACA 3VS6A 4S2ZA 4CTCA 5LWNA 1GJOA 4C61A 4LFIA 2WMTA 1BYGA 4R3PA 3AC3A 2WTCA 4EJ7A 3W0NA 4I41A 1OIRA 3F2AA 2VGOA 5F4NA 4R3CA 5D11A 4DFLA 4EJNA 4EUTA 4F99A 3NVKI 4WOVA 2H96A 4I93A 3UIUA 2ITZA 5HX8A 3BV2A 4B0GA 1WBVA 4FZ7A 4MXOA 5A4LA 3LFCA 3OEFX 4AOJA 3V5LA 2XS0A 1PY5A 5I9VA 2BMCA 1OIYA 2XNBA 3MI9A 4MNFA 4BBFA 2HY81 2UW0A 4JRNA 4ZJIA 5DWRA 4ZJJA 3DPKA 4LL5A 1GIJA 2ZAZA 3HX4A 4HGEA 3VS0A 2GHLA 2YM5A 4ASDA 4O4EA 1PW2A 4KIOA 4D1XA 3D9VA 3NUNA 1KE8A 3G33A 4LUEA 1QCFA 2YIYA 4XOYA 2HK5A 3S2PA 3F9NA 4U40A 2JITA 4AW0A 4YTFA 3UZRA 5E91A 3FXWA 4EK3A 2GS7A 5FBOA 4Y73A 3G9LX 5IKWA 1OPKA 5A9UA 1I09A 4XUFA 5BYYA 1JKTA 1DI8A 3O17A 5AV3A 3UPZA 3ZUUA 3R9RA 2VWXA 4KIKB 3I60A 4I4EA 4KUJA 4W8DA 5HBEA 2UW8A 2WO6A 1HCLA 3IO7A 5DGZA 4XG8A 4DH7A 2E9OA 2C3KA 4S32A 4ZLOA 1QPEA 4WG4A 1W83A 3LFDA 3NLBA 1ZMWA 2XYUA 3QQUA 4Z55A 5K0KA 2Y8OA 5J79A 3T8OA 2VV9A 3VUKA 4CVAA 1OGYA 2QI8A 2R7IA 3CPCA 1FBNA 4YTHA 1OL2A 3JVSA 3CJFA 3VS5A 3L8SA 4PDPA 4C57A 1VLRA 3ML1A 4FNWA 1G8JA 4AZFA 3R1SA 3PSBA 3B8QA 5DE2A 4V04A 5FUTA 2QCSA 2QOKA 4F0IA 2VAGA 3V5TA 4YLLA 3UZTA 3R7GA 4BWKA 4HVDA 5HG7A 4TY1A 3S1HA 4FNYA 4F6UA 2WMUA 3GCQA 3BYOA 1Q3WA 3P7BA 3NIZA 4C2VA 4D2SA 4X2JA 4X6RA 4UXQA 1WVXA 3G90X 3NFGB 4EBWA 1YXVA 2W1EA 4G6NA 4E4NA 4J8NA 2AQXA 5FP6A 4EWQA 1YKRA 4BDDA 4JQ7A 1W2DA 1YWNA 3UQFA 1S9IA 2BRBA 5HCZA 3TKUA 2BRGA 4WG3A 4BCHA 3HA8A 4UX9A 1FPUA 2R0UA 4ZXTA 4WRSA 2R2PA 1GZ8A 2ITYA 4JBQA 4MBIA 4RA4A 4ZSLA 3QCYA 4NKSA 3OC1A 4GRBA 4U0IA 4I20A 3CD8A 3TDWA 4GG7A 2XK4A 2Y0AA 3P08A 3PSDA 1U59A 1ZAOA 1JSUA 4JRVA 3VBYA 5HLNA 1IRKA 2E2BA 3CQUA 2WQBA 1M2RA 5CEIA 3ULZA 3ZOSA 1YRPA 1J7IA 5FTGA 3C4FA 5AR2A 1PXLA 3UG2A 3GOKA 3VW6A 3AT3A 1H0WA 4M14A 4W4YA 3UDBA 2WNTA 3GVUA 4IVCA 3FMNA 4DHFA 5KBQA 2OSCA 4HGLA 3LCKA 1P5EA 2HZIA 4XV9A 2WOTA 3NYXA 4U97A 3DLSA 1M7QA 4LOQA 1BI8A 4XG9A 2PWLA 3ZRLA 3KN6A 3W16A 2GNHA 1PXPA 5ANDA 4MNEA 3BQCA 3EN4A 2FB8A 4ASZA 5AX9A 2BRHA 4GT3A 4JX3A 4LV7A 3I7CA 4OAVB 4YZNA 3RNYA 4XMOA 4O83A 2QLUA 5CYIA 4ONAA 4HNIA 4XG3A 3SOCA 1CM8A 5AIKA 4UXLA 5C1QB 2V55A 2FSMX 3HMOA 2WFYA 1XH9A 4X21A 5CI6A 3BX5A 4DINA 3DFCB 4FIFA 4O0YA 3G0FA 3NYOA 4DFUA 4D9TA 4LM5A 3B8RA 3W18A 4FKUA 4C59A 3DLZA 4O6EA 1Y57A 2ZB0A 2UW7A 5BMSA 3QFVA 1P4OA 2YIWA 3BGQA 3TTIA 1NA7A 1BKXA 2Y6OA 4KD1A 4CTBA 3ZYAA 1BLXA 2YJRA 3FZPA 4XP2A 4RWIA 4IC7A 1P14A 5IZFA 1H1QA 3UMWA 4P5ZA 3EYGA 2YCRA 4O96A 3VBVA 3QQFA 4DITA 3TM0A 4NH1A 2NPQA 3CEKA 4CKIA 4PMPA 3TNIA 3PY3A 4TN6A 4GK4A 2QURA 5A4QA 2ZYBA 3R04A 5DNRA 4ZMEA 5DR9A 3ENHA 3PXRA 3BLAA 4I6HA 4YC3A 5EYDA 1Q62A 4FZFB 1KOAA 4QP1A 3ENMA 5HO6A 4FICA 3W8LA 5ACKA 2CKPA 5GJGA 4O27B 4ZY4A 4CGAA 4CMTA 3C4XA 2GSFA 3ORKA 4WHZA 5C8MA 4JR3A 4D2PA 4KIKA 4BZDA 4BCOA 5ANEA 4EH8A 3NCGA 3ALNA 4L01A 1WAKA 5C26A 5CF5A 5I9ZA 4YJSA 2VWWA 3FYJX 2UV2A 2QHNA 4RG0A 5KMKA 4CZTA 3BCEA 3VNTA 2XNPA