3NUYA

Phosphoinositide-dependent kinase-1 (pdk1) with fragment17
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
286
structure length
276
Chain Sequence
QPRKKRPEDFKFGKILGEGSFSTVVLARELATSREYAIKILEKRHIIKENKVPYVTRERDVMSRLDHPFFVKLYFTFQDDEKLYFGLSYAKNGELLKYIRKIGSFDETCTRFYTAEIVSALEYLHGKGIIHRDLKPENILLNEDMHIQITDFGTAKVLSFVGTAQYVSPELLTEKSACKSSDLWALGCIIYQLVAGLPPFRAGNEYLIFQKIIKLEYDFPEKFFPKARDLVEKLLVLDATKRLGCEEMEGYGPLKAHPFFESVTWENLHQQTPPKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PkB-like
publication title Aminoindazole PDK1 Inhibitors: A Case Study in Fragment-Based Drug Discovery.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 88
structure length 276
sequence length 286
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2010-07-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3nuyA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3nuyA01
2I7QA 5AP3A 3H0YA 1Z9XA 4JAIA 3FMMA 3BZ3A 3KA0A 2WU7A 3KXZA 3WOWA 4F1MA 4V01A 3TT0A 5DEWA 4HVHA 2P4IA 2WMTA 2WQMA 4UALA 3UPZA 5AP0A 3COHA 4QPSA 1Q62A 3AC4A 4QQ5A 1CTPE 5IQDA 5AIKA 5CQUA 5FM3A 4OT6A 4C4FA 2QQ7A 1T45A 3BLHA 3QFVA 5M4IA 3HX4A 3W2QA 3Q4CA 3OC1A 4E6AA 2F7XE 3VUKA 4NL0A 3PG3A 2B9FA 1OB3A 2VWXA 4XG8A 1P2AA 2ERZE 2JBPA 1GZKA 2F4JA 1GIIA 4QTBA 5JH6A 4YMJA 3ZBXA 4AG8A 3NUAA 3AC1A 4JQ8A 5CSWA 4N6YA 3E8NA 2BZKB 3CKXA 3KRJA 3MIYA 1OL5A 3P23A 4CFUA 5CF8A 3DBCA 3HA8A 1PYXA 3TUBA 5AX9A 3ZM9A 3FEGA 3OXZA 4DFZE 4EH5A 4CQEA 3BEAA 1KE6A 4PUZA 2FSOX 2R3QA 3QRUA 1PJKA 1A06A 3PY0A 5EDQA 3BU6A 3FZ1A 5HESA 4D5KA 4QMTA 4UMQA 2WMRA 4JT3A 4FVRA 4LUEA 3G2FA 1JWHA 1WBSA 4BDBA 3CEKA 1SVGA 3VF8A 4F7JA 3A7FA 3TM0A 3ZEWA 3V8WA 2WKMA 3ZH8A 4OBQA 4WNKA 2BIYA 5HO7A 2R2PA 3R28A 2PSQA 4EQUA 5IUGA 3OBJA 4CYJA 4AZVA 1V0OA 3A99A 4D9UA 3E62A 4J8NA 4MQ1A 3B8QA 4PWNA 2PPQA 2B0QA 1OPJA 2EU9A 3EQRA 3FXWA 5GNKA 4JOAA 3CXWA 5L2IA 1R1WA 4RIXA 4IX4A 3RCDA 3VULA 3ETAA 2I0YA 2J5EA 4Y5QA 4EEVA 4L44A 5CQWA 1FVRA 4ALVA 5IDNA 5DR6A 3ROYA 4EUTA 3NRMA 2XM9A 1RJBA 5C01A 1H1SA 2R3HA 3RAWA 3F3ZA 5AR2A 4HVGA 5CYIA 4IIRA 4QQTA 3ACJA 1PXMA 2ZAZA 3MS9A 1YWNA 4FG7A 1RW8A 4RIYB 4FKWA 2XKDA 5L2WA 1H24A 3C4FA 3PPKA 4LOQA 4YJSA 5FP6A 3MH3A 4YJPA 3GB2A 2X4FA 3R8PA 5JZNA 3ZC5A 4C02A 1M7QA 3POZA 4QO9A 1UNGA 3R8ZA 3R04A 3CLYA 3LMIA 1V0BA 3EH9A 5FM2A 3FPQA 3W2CA 1JOWB 4FL3A 2IW8A 4U97A 5HU9A 5FTGA 3KKVA 2XKCA 2Z7QA 2E9PA 3BQRA 3PTGA 2OXYA 3R9DA 3U8WA 2C5YA 3PXKA 3SOCA 1OPKA 2HWPA 4I1ZA 2YJRA 3QQHA 4I6HA 3D9VA 4ZOGA 5AV4A 4K1BA 3RPVA 3LAUA 2YM4A 2ITVA 4KB8A 4ZTQA 4FOCA 3LW0A 1Q97A 3QD2B 4MTAA 3K5UA 4QP7A 3ACKA 3R9OA 4W8DA 5IH5A 3V5JA 5AP1A 4BZOA 2R7BA 5ANKA 4EI4A 1J1CA 4RPVA 4UYAA 3F2NA 5BUIA 2Z02A 4V0GB 3TEIA 4DBXA 3H9OA 1IEPA 4FTNA 3V5WA 4E6QA 3CQEA 4IAYA 2Y4PA 5ANIA 4OAVB 3K5VA 3RCJA 5EH0A 5M44A 3F7WA 3GT8A 4BDGA 3HAVA 2WEIA 2JEDA 4OTGA 5AWMA 4YP8A 4W4XA 3UYSA 3C4EA 1AGWA 4G3CA 1YXUA 2W06A 4FTRA 4IW0A 4BR3A 4NM5A 5C03A 3PJ1A 1CKJA 4GUBA 3SQQA 1BI8A 2BRNA 4KBAA 2BALA 3KFAA 3VUGA 3DB8A 4GT5A 4I6FA 2IZTA 3WE4A 2V7OA 3IS5A 5IMEA 1OM1A 3O7LB 3OW3A 3PRFA 4C7TA 4B6LA 5A6NA 4GSBA 1OL2A 1U59A 2JIUA 4YJNA 4DH7A 2GNIA 5ACKA 2VTNA 4E4NA 5EDRA 1NVQA 3UC3A 2VTIA 1XBAA 2ZM4A 3OEZA 4IWQA 4X3FC 1UV5A 3T9TA 3UQCA 2CGWA 5ETIA 2V55A 2VUWA 3E64A 4FSYA 4LGHA 4M8TA 1KSWA 2BZIB 4YHTA 3UJGA 4RIWA 3A7HA 2QU5A 2J0IA 5E8VA 2WELA 5E8XA 4A4LA 4G31A 4AWIA 4AGUA 5L6PA 3UOHA 3GEQA 3PXZA 2PMOX 5JGDA 2PE0A 2PMIA 3OTUA 5HQ0A 2PZYA 4BTMA 4ACDA 4FV5A 4F99A 4JI9A 4D4YA 1Q8YA 5H8GA 3WBLA 2WB8A 3PG1A 4IXPA 3HV6A 4DT9A 3OEFX 4GYGA 5CXZA 4W4VA 4JS8A 1ZYJA 3RHXA 4ZLZA 3FPMA 2PVNA 5EYKA 3QTWA 4ZS0A 3VUDA 3NUUA 3PXRA 4D2SA 4X2NA 3PA4A 3TV4A 3ZRKA 2OZAA 4E1ZA 4QMQA 4QTEA 4GK4A 4J52A 1X8BA 1M17A 1W83A 1YRPA 3NIZA 2X8EA 2J0LA 2ZB1A 1B38A 3A7IA 3PVGA 2VGPA 2IZRA 1YXXA 3Q04A 3TIYA 3FE3A 2CKOA 3M42A 3FDNA 1PW2A 3HV5A 3ET7A 4BDKA 2BCJA 3KRLA 1M2QA 4C61A 4FTAA 3VJNA 2C6LA 2BVAA 3WF7A 1IRKA 5D41A 5HVYA 4J7BA 4XUFA 1ATPE 4QMYA 2WZJA 1WBNA 3R01A 4RX8A 5HVKA 5ANEA 3VBYA 4E5WA 4OAUC 5I9VA 3LXPA 3WYXA 4LMUA 4LRJA 1FMKA 5J1VA 3V8TA 3D2KA 5DR2A 1LR4A 5AP7A 3MN3A 4G16A 4G6OA 4NW5A 4CMOA 5CAUA 3F2AA 3QHWA 4Z7HA 4MHAA 2YN8A 5A3XA 4MNEB 3W2SA 4Z3VA 5KMOA 3GBZA 3GCVA 1BL6A 4EBVA 2O63A 4J99A 4CFFA 4E6DA 4QYEA 5E91A 3QQLA 5JFSA 4O2PA 3PWDA 3F3UA 4D2PA 3SXRA 2NRYA 2B9IA 2IW9A 4N0SA 4CCUA 1H25A 2EXMA 5AA9A 4X2KA 5BVDA 2GPHA 4CD0A 4YC8A 4FIFA 2OK1A 4B99A 5EQPA 3OW4A 4H3QA 3ZBFA 1K9AA 1WVYA 4U7ZA 1ND4A 2VRXA 2CNVA 5AFVA 3U54A 4MD7E 4RBLA 3VBXA 4ZSEA 4CVAA 1DM2A 2V22A 2WOUA 3QTUA 2ZV2A 2WTJA 2XJ1A 3CGFA 4DLJA 3BHUA 2QC6A 4AT5A 4FV4A 4MBIA 4BVUA 2PVYA 1IAJA 3G51A 2B9JA 3GU5A 3OCSA 3OG7A 2QO7A 4OTDA 4AXAA 1MRUA 4O6LA 2WO6A 2YABA 4CV8A 2R3KA 4GVAA 4BZDA 3EFWA 1UWHA 5HNGA 4WUNA 4R1VA 3MH0A 2QNJA 2C5NA 4AW1A 4I5CA 4N4SA 5CTPA 3KB7A 3H9FA 3N4TA 5AUYA 5J8IA 2WMQA 2O64A 2X7FA 3BHVA 4KSQA 5AM6A 1UKIA 2WTKB 4ONAA 2WPAA 4M14A 3KK8A 1YHSA 3ZDIA 4XP0A 2E9VA 3GCPA 1M2PA 3C50A 3CE3A 2HZIA 2Z2WA 4DGOA 2XRUA 3E5AA 3NX8A 4I3ZA 5M51A 4CKJA 3WZEA 5I3RA 2GNHA 4O81A 5AIRA 3VHKA 1UKHA 2CCIA 3E93A 3S00A 4KNBA 2HIWA 2NP8A 3NCGA 2JLDA 3I1AA 2C0TA 4D9TA 4FEVA 3MFRA 4KIKB 1DAWA 3VQHA 3VS4A 3ZM4A 5CI7A 5FEDA 1NXKA 3VS6A 3NUYA 3MB7A 3P7BA 4JQ7A 4YGAA 4JBOA 1Y91A 4QRCA 3DT1A 3QALE 3ERKA 4O38A 4OUCA 4EZ5A 1OUKA 2J0MB 4I20A 1YDTE 4O0UA 4RIOA 2JAMA 2HENA 4JRNA 5JN2A 3SW7A 3UC4A 3Q5ZA 4G1WA 3Q53A 4MXXA 4ASXA 4BDCA 4RIXB 5GZ9A 2X8IA 4QYHA 5KMLA 1NW1A 2YM6A 5K4IA 4JVGA 5H8EA 2JD5A 2C69A 5I4NA 3TV6A 5HCZA 3UG2A 3N4VA 1OMWA 4J95A 3OCTA 2IN6A 3RAHA 4ERWA 4FV8A 3FV8A 4QMMA 5EDPA 5JMSA 1KV2A 4FKOA 4TT7A 3DOGA 4NJ3A 2ONLC 3F5PA 4LG4A 4MXYA 4DYMA 3DBFA 2WAJA 4S34A 2QR7A 3KGAA 5HD7A 2F7ZE 3NMUF 2QO9A 2OWBA 5M53A 4FGRA 4ALUA 3KL8A 5CSHA 4EBWA 2HZ4A 5JFXA 1QPEA 5DFPA 2CJMA 3CTJA 3QUPA 3PSBA 3DJ7A 4QNYA 4U43A 1RQQA 3MVJA 3RZFA 1YKRA 2R9SA 1OKZA 3D5XA 3OT3A 4FNZA 4YTHA 5IQBA 4GVJA 3NYXA 3UIUA 1GZ8A 3QXOA 2XP2A 4C35A 2ITOA 3AOXA 3FZSA 3QZIA 3OWPA 1PXIA 5CS6A 4DH8A 2R3PA 2X2KA 3LFDA 2WU6A 3CJGA 2XNPA 4M67A 4XP3A 3OTVA 4XLIA 3PLAE 3D4QA 2GFCA 1J7IA 4X2JA 5CU6A 5CAOA 3OMVA 4NH1A 2WMUA 4BHNA 4RQVA 5K9IA 3COMA 4PRJA 1OKWA 4MVFA 4FICA 3FMEA 3FLWA 3SXSA 4ITIA 3OFMA 3TJDA 2PUPA 4O0VA 5FTOA 2FA2A 1ZLTA 5IU2A 1QPCA 2R7IA 4R3PA 3A61A 2HCKA 1MP8A 2XIYA 1KWPA 4JNWA 4KS7A 3R7OA 3HUCA 4DH3A 4JRVA 2DUVA 4I0SA 4HCTA 4BTJA 3BYVA 5LMAA 2BDJA 2X9EA 4FKGA 4D0WA 5CEIA 4F7LA 4LL5A 4EHVA 2XJ2A 3DKOA 3H10A 3PJ2A 2HXQA 3U4UA 1JKKA 2AC3A 2XKEA 4CZUA 3KCKA 4ASZA 4CT2A 4IZYA 3ODYX 4R78A 4GKIA 4C4IA 3UQFA 4H39A 2YERA 5IA0A 2DYLA 5IG1A 4DG3E 4PP9A 4ZP5A 3DFAA 2VO3A 2XNEA 4GU9A 4P2KA 4ZSAA 4O84A 4R7HA 1P5EA 5KMKA 1Z57A 3TZ9A 2XIZA 2XNBA 3Q4TA 1BLXA 4YBKA 4CKIA 3GFWA 5HIEA 3MW1A 2YM7A 3I0OA 5ETFA 3WI6A 4FBXA 3WZKA 2RFSA 4GJ2A 4FKUA 4QMOA 3O8TA 3VBVA 1H08A 2JITA 2EB3A 2ZDUA 4XOZA 4L01A 4L6QA 1L3RE 3EJ1A 4GS6A 2YAKA 5EKOA 3HV3A 4WG5A 4PMPA 3O96A 2PL0A 5IEVA 5HLWA 5I9YA 4HYIA 1GNGA 3F9NA 2R3LA 3KK9A 5EQYA 4F6WA 3DKCA 4JG7A 3DPKA 4IDTA 5DWRA 3EZVA 4TTHB 4ZTRA 1SMHA 4I41A 4EH7A 4FTUA 4U0IA 4ANMA 5K4JA 4DFUA 4GRBA 4RG0A 2OXXA 5E8ZA 4NM3A 1IA9A 4XNEA 3C13A 3H30A 4E5AX 1W8CA 5L2TA 3D5WA 5CT7A 5ANGA 4R3CA 3HEGA 5IA1A 3HYHA 3AMYA 5J9ZA 3LM5A 5F4NA 2UW5A 3LMGA 3SC1A 1ZRZA 4UXQA 3EQHA 2DS1A 3U4WA 2C3LA 1J1BA 4XBUA 5AR8A 3I6WA 1Q4LA 3PLSA 5B2KA 4ANBA 2VX0A 3FZOA 5GZ8A 4P7EA 4DEAA 5HZNA 3ZMMA 3KN5A 4FV0A 2IWIA 1PXLA 1R3CA 4R8QA 4A06A 1UWJA 3R8MA 4AOIA 5BYLA 4YHFA 3DY7A 2VX1A 4XJ0A 4IAZA 2SRCA 4XG7A 5KKRB 1BUHA 4D28A 3R22A 3FQEA 5EM5A 4B4LA 4RZVA 2PHKA 3QX2A 3ZLYA 1R0EA 1BKXA 2HY81 4JX7A 5LOHA 5LVMA 4M0ZA 3UZPA 3NNXA 1I44A 1PKDA 5CNOA 4NJDA 2HOGA 4O2ZA 4E73A 4IAFA 4L46A 3ROCA 1XH9A 1QL6A 1ZYLA 2QOIA 4I21A 5KMIA 2CPKE 2VN9A 4MF1A 3HRBA 5HE0A 4BWPA 4WBBB 2YM3A 4WNMA 3CD8A 1YOJA 2CLXA 1HCLA 1A48A 4NIFA 5M4UA 1YDSE 1E1XA 3MA6A 3QQKA 5JEBA 1OUYA 4E93A 4O21A 2XNOA 2J9MA 4FKLA 4FUXA 3CKWA 4RIYA 3LCOA 2YZLA 4E26A 3ZLSA 4DGNA 2UW6A 5HNBA 4C4EA 3OP5A 4FL1A 2J0KA 2PULA 2UZUE 3QAME 4NCTA 1PHKA 1ZWSA 2WIHA 5DPVA 5J7BA 3O51A 3QLGA 2R0UA 3QTRA 4ASDA 3ZEPA 1TKIA 1G3NA 4RJ4A 3JUHA 2J2IB 2UZOA 3VUHA 4HJOA 5F95A 3I0QA 4AP7A 2G01A 2C1BA 2W4OA 3LFAA 3UG1A 4IZAA 3GC7A 3QRIA 3SX9A 4EH3A 5BMSA 1VYZA 4PQNA 5IDPA 4DGGA 3TZ7A 1OIYA 2R0IA 2VTRA 3FYKX 5FEEA 3OHTA 2ZM3A 4G5JA 5IEYA 4XHKB 4G6LA 3DDPA 4C4GA 4RC4A 3KRWA 4V0GA 5D1JA 2BPMA 2OGVA 3NW6A 4MNFA 4L68A 2YFXA 1P4OA 4EK4A 5L4QA 2GS7A 1BYGA 3NW5A 2OJIA 3NS9A 2PMNX 1IG1A 4U5JA 5IMXA 3ORKA 1H27A 4EYJA 1LEWA 2FSMX 2QOQA 3Q2MA 4JBPA 4Z9LA 3HV7A 3NAXA 3OWLA 1EH4A 2VGOA 4AACA 4C4HA 2O65A 2GMXA 4EORA 4FNXA 1NVRA 5BQ0A 5M4FA 4UB7A 3PUPA 4MXZA 4BB4A 4ZAUA 4EONA 4BCHA 3O0GA 3ZSGA 4DH5A 2C1AA 4DTKA 2Y6MA 5HCYA 5HE2A 3FY0A 4OBPA 1FVVA 4BCNA 2VTTA 3DNDA 4GYIA 4U45A 3ZYAA 3V5PA 3KMMA 1Q99A 4Z55A 4CRLA 4MCVA 3GNIB 2FSLX 4FNYA 2OG8A 1OIRA 3G33A 3F2RA 2WMBA 1JSTA 3GU8A 4FV1A 2VTPA 3R1NA 4G3EA 4C33A 4DEDA 3SV0A 4FR4A 2PWLA 5I3OA 5CI6A 5A54A 1WBTA 2UVYA 5AR7A 2AC5A 2FSTX 5HBEA 2PYWA 5ETAA 2GNFA 4K6ZA 3BQCA 2YDJA 2JIIA 3F5GA 5KZ0A 3SLSA 5M07A 4AE6A 5AADA 2C5XA 2F7EE 4C58A 1XH4A 3TKUA 5I5ZA 2VTSA 4D1ZA 5TR6A 3GUBA 4UWYA 4YJRA 4EUUA 2FUMA 4DCEA 2Y7JA 3JXWA 5ANJA 4PNKA 3I79A 4PDYA 3F3VA 1REJA 3ORNA 4IWOA 4YSJA 5AUUA 3FMJA 1DS5A 4YJQA 3MGYA 3VNTA 3P7CA 4UMUA 4DT8A 1Y8YA 2EVAA 4QQCA 2I6LA 3FMNA 4QQJA 5DH3A 3L8SA 1XBCA 3QL8A 4AX8A 2XKFA 3MY1A 3WILA 3HMMA 4CRSA 2O5KA 4CQGA 2QVSE 3MH1A 3OT8A 4FTTA 4IVDA 4JBQA 3IW4A 1O6LA 2VTLA 4O27B 3VRZA 4AGDA 5IISA 2OFVA 3S1HA 4RWJA 3K2LA 4IADA 3M11A 4BGHA 4RFZA 4X7QA 4FIEA 4IAKA 4IVAA 3FHRA 2UZNA 3V04A 4I94A 2PUUA 2JDSA 4FGBA 5EW8A 4MNEA 1G8SA 3TUDA 4BCKA 4D2RA 2UZEA 1GIHA 3QD3A 5F1ZA 5HCXA 3PIYA 5KE0A 5T6KA 3A4PA 2PZPA 5HKMA 4QP6A 4F64A 2ITUA 3HA6A 4DE4A 3GP0A 4FTCA 3ZS5A 4CV9A 4A7CA 3PZEA 4W9XA 3I7BA 4JDHA 5IZFA 1O9UA 2BAQA 2YDIA 3NW7A 5A6OA 3KREA 3S3IA 4Y8DA 4ACGA 4K8AA 2F49A 1Q3DA 1Q41A 4JQEA 3FMLA 3QU0A 3L9LA 3OF0A 4PNIA 4RT7A 4ZTMA 5LWNA 2OIBA 5L2SA 2YIQA 3EN4A 1BMKA 5LWMA 1ZZLA 1OL1A 1WFCA 3CPBA 3QUDA 3OY3A 4FZFB 5DLSA 5J5SA 4Y73A 1OL6A 4RJ5A 3MFSA 1YXSA 5HTCA 1Q8ZA 3O17A 3PPZA 4G6NA 3UTOA 1ZZ2A 4BCMA 4CG8A 4ZS4A 1J7UA 2W1IA 3PE1A 3SHEA 3EKNA 1WBVA 4OTRA 2WTVA 3T8OA 3UODA 2UZVA 3LMHA 2F9GA 5LVLA 4C36A 3ATSA 4FTQA 2JGZA 1OKVA 4BRXA 3R1YA 4O0SA 1J91A 3DK3A 2JC6A 4BDIA 3DZQA 3PVUA 4PY1A 3RPRA 2ITPA 5A9UA 2QI8A 2J6MA 4BC6A 5KX8A 4BI2A 4DEGA 4CMUA 2XCHA 3LQ8A 3EFLA 4ID7A 1K2PA 3JVRA 4LV8A 1VZOA 4KIKA 3GGFA 4TWPA 5GZAA 4RX5A 3OUNB 3G6GA 4TRLA 4AZSA 1SZMA 3I5ZA 2W1ZA 4QP3A 4OTFA 4QT1A 2KTYA 4XCUA 5E4HA 1BI7A 3LXKA 2OZOA 5CWZA 4BTKA 2CKPA 4U40A 3A4OX 1UNHA 4R7IA 3BHYA 4D4RA 2YA9A 3Q9WA 3I7CA 2AUHA 3BBWA 4EH9A 1PXNA 4G5PA 4TYEA 3E8EA 5D11A 2H8HA 4DEBA 3GXLA 4EH2A 4MQ2A 5GJFA 2QG7A 4NIFB 4EHZA 3QGYA 3NNVA 4C57A 4F08A 2JDTA 3C5IA 2RFDA 1H07A 3BYSA 2A2AA 2JKMA 3IDCA 4EZ7A 2OU7A 5LMBA 4TYGA 5DE2A 3K54A 2XF0A 4U3ZA 2NNWB 2X9FA 3R8LA 3CR0A 4HNFA 3BU3A 2VZ6A 3ZRLA 3GFEA 4BICA 5C27A 4A4XA 4IHPA 3QC4A 4MXCA 4WO5A 2I1MA 3C7QA 3ITZA 4XV3A 3D15A 2XIKA 4GKHA 5JFWA 4JJRA 1G8AA 4ZTSA 5FD2A 3OD6X 4M3QA 4MWHA 4G34A 4QOXA 1JBPE 2J7TA 2OI4X 5HLPA 3JS2A 4BF2A 4DEHA 2R3GA 4EL9A 3IW8A 2BRMA 4M12A 2W1DA 4LI5A 2QOOA 3D14A 5HEZA 3TKIA 4BI0A 4KINA 5C4KA 4NU1A 2X2LA 4XRJA 2PVHA 3SOAA 3RGFA 4U79A 3V5QA 3FXZA 2RG5A 3HMOA 4BDAA 5HORA 2OF4A 2XEZA 3MJ1A 3ZFYA 4CXAA 3DTWA 3V8SA 5FG8A 2JDOA 3HMPA 2P0CA 2BHEA 2B52A 4FSUA 5J95A 3V01A 3EN5A 3Q4ZA 5KMJA 5HE3A 4I22A 2PU8A 2CHLA 4OTHA 5C8NA 2PE1A 2VTQA 3PIZA 3UVRA 1Q8TA 2ITWA 3L1SA 3OOGA 5E8UA 4CZYB 5EKNA 2BRBA 4M13A 3UIMA 2C0IA 2C6IA 2ERKA 3B8RA 3K3JA 3KF4A 3O2MA 2BRGA 4PPBA 4GUEA 2V7AA 3O8PA 4RWLA 1GAGA 2WTWA 2YM5A 4J98A 3ZTXA 1M7NA 3TNQB 2Z8CA 4YO6A 4YPSA 1XWSA 3TZ8A 4LRKA 4O22A 4EJ7A 3NVKI 3ORTA 4EHGA 4HVIA 2BILB 4MK0A 3Q4UA 3VVHA 1P14A 4QMZA 4XBRA 4GL9A 4TKSA 3LCSA 3QZFA 4I93A 3ZUUA 1GZNA 2P33A 3W2RA 2J5FA 3DLSA 1U46A 3HECA 5FXRA 3DCVA 1QPDA 4WBOA 5C8MA 4F1OA 4LYNA 4U81A 5D7AA 3UNZA 3BGQA 2C3KA 1APME 2FH9A 3RNIA 3UOKA 4BBFA 4BGQA 2PZRA 4YC6A 3EMGA 4FZ7A 5BYYA 3EL8A 3E63A 3U9CA 5I0BA 2OJJA 2R3NA 1YWRA 4IZ7A 4QMSA 5CEPA 2H6DA 4OGRA 4RJ8A 1AQ1A 5GIPE 2W1EA 2XCKA 5CT0A 4MH7A 3HVCA 4C62A 2EUFB 4TW9A 1M2RA 4U44A 3OCBA 1NVSA 3SG9A 2W1FA 2G2HA 2I40A 2ITQA 4I4EA 2VU3A 2CNUA 4RGJA 3R7VA 4CSVA 2OO8X 5J9LA 3KXNA 3NZ0A 4FKPA 3QD4A 3EQBA 4B9DA 4CNHA 2C3IB 3TDWA 2R4BA 3BU5A 3O71A 2IZSA 3H0ZA 3QXPA 5C9CA 2VO0A 3RINA 4DG2E 3KVWA 4UYNA 1ZMUA 3ID6C 2JFLA 1XH5A 2R3IA 3TZMA 1IR3A 2HAKA 4H1MA 4BI1A 3AD6A 3LZBA 3KC3A 3R2YA 4MKCA 4QMXA 3R7YA 4DC2A 3BE9A 4M68A 1UVRA 2W17A 2Y4IC 4XS2A 2XYNA 4RJ3A 5E8YA 4R3RA 4ZXTA 2HW6A 5CENA 4FKJA 3LM0A 4C2VA 5HGIA 5AMNA 4PDPA 3LCTA 3A8XA 1H1RA 3RAKA 1O6YA 2J90A 4ZTHA 3RZBA 2WQOA 4PV0A 5CF4A 4EWHA 3QQGA 3R8VA 3W32A 5JZJA 1KOAA 5BVKA 2JAVA 2WHBA 5IH6A 4MX9A 1H8FA 4XRLA 2C3JA 1BL7A 3KULB 5EOBA 4M15A 3DTCA 5FTQA 3Q9XA 4PL5A 4TPTA 2VV9A 3KCFA 3BKBA 4QP2A 2GCDA 3I5NA 3MA3A 3OROA 4LGGA 4UMTA 3W10A 3PZHA 1ZOGA 1ZYSA 5EI6A 3ORLA 2CLQA 3GU4A 4ZK5A 4TNBA 4NSTA 2VWYA 2YIRA 4FKSA 4HCUA 2WMSA 4YPDA 5E90A 4DHFA 5TKDA 3NIEA 2ITTA 2UW7A 2C6MA 2CSNA 4FZ6A 3RALA 5KUPA 4LV5A 2QOHA 2A4LA 3RBWA 4BIDA 4KKGA 4RVTA 2W5BA 5ITAA 3R7EA 4ZJVA 5DVRA 2HW7A 3LJ2A 4FT9A 4CYIA 5KBRA 4QTAA 4R77A 3GU6A 2XH5A 4D0XA 4LL0A 4ZZMA 4F0IA 4IB1A 3RTPA 4GV1A 2W0JA 2BRHA 4K0YA 2R64A 2UZDA 3EQIA 4YZBA 2HYYA 4O7YA 5CASA 4D2VA 3HUBA 5A4CA 1F5QA 4DITA 1R78A 5BVFA 3QA0A 2QOBA 1SYKA 2ZB0A 3W8QA 2XIRA 1NA7A 4RVLA 4FT0A 3QTSA 4IB3A 4EOPA 4EOQA 3U55A 4KIQA 3A2CA 2BR1A 4FODA 4YJTA 4QD6A 3QRKA 4II5A 4R5YA 5CSXA 1NT2A 2PVLA 2QONA 3E3BX 2UVZA 3FUPA 5EI8A 3VBQA 1IA8A 3ALOA 3P1AA 3BX5A 4FK6A 4YSMA 3QCXA 3BWJA 3F6XA 3G90X 1ZY4A 5FBNC 3R63A 3V3VA 2ZMDA 3V6SA 2ITXA 2YIYA 3RHKA 2UW8A 2QOFA 3EYHA 4AT4A 4NW6A 4D5HA 4IDVA 2YISA 2BFYA 4MEDA 4GW8A 2EXEA 3VS0A 3UO5A 4IM0A 3NLBA 3TNWA 4F0GA 2PZ5A 4BY9E 3MY5A 3KVXA 4Y5HA 4BKZA 3KMUA 4Y46A 3Q32A 3D2IA 3NR9A 4G3FA 4GIIA 4AOTA 3L9PA 4HYUA 3ZC6A 2A1AB 3NYVA 2W1GA 4TNDA 3FJQE 3SVVA 4AQCA 4I92A 2V5QA 4O1PA 3MPMA 3FZRA 3CY3A 4RMZA 3AMAA 3FHIA 3TACA 3DU8A 5DRDA 4AZWA 1O6KA 4J96A 3QZHA 4FKTA 3ALNA 4MBJA 4FZDB 4NFNA 5HO6A 4BDDA 2YAAA 4KIPA 2YLEA 2XJ0A 4DFLA 3PY3A 4QP4A 1KE5A 4USFA 3G5DA 4EYMA 4QP9A 3HRCA 1Y8GA 2BFXA 3D5VA 3T3VA 4FKVA 4BZNA 3G6HA 2VO6A 1I09A 4KKEA 3VHEA 3AC8A 3TIZA 4TYHB 4D1SA 3CCNA 4WSYA 3W55A 4AW5A 2WQNA 4FE2A 3QCYA 1MQ4A 2GTMA 4GU6A 4NTSA 5EW3A 5A4QA 4O91A 3AXWA 3LFQA 4HVSA 1OGUA 3ANRA 4L3PA 4K18A 3CIKA 4W4YA 4X3JA 1W84A 3P7AA 5I9UA 5AP4A 4BBEA 4L3JA 4ZZOA 4O7LA 4LOPA 3IQ7A 4EOKA 2O0UA 3FMHA 5AX3A 4L43A 3RJCA 3EQCA 2O2UA 3SXFA 1XKKA 4RRVA 1U4DA 2IVUA 3EWHA 1JNKA 2YDKA 3I4BA 3DDQA 3UO4A 3VJOA 4C37A 2FYSA 2W96B 2X7GA 3FLZA 2QHNA 4RC2A 4XG6A 3R02A 3GQIA 3IKAA 4CT1A 4CG9A 3UVPA 1K3AA 3EYGA 3RMFA 5J87A 3N51A 5JSMA 3DKGA 5DA3A 3R71A 2OBJA 4CTCA 2BZHB 4JG6A 4U80A 1H1WA 4GH2A 5JFVA 3FI3A 1OKYA 5TF9A 5CAPA 3NYOA 3PWYA 1SNUA 4FIIA 3R7IA 4A9RA 3OUKA 4AZFA 4FIHA 2GHGA 3RNYA 5L6OA 2VWVA 4H05A 4NEUA 3DK7A 3WF9A 4YNEA 4S2ZA 4USDA 4DFBA 3W8LA 4JBVA 3AT2A 4WA9A 4EOLA 3U6JA 2QCSA 4I0RA 2XK7A 5JGBA 3G15A 2UW3A 3I6UA 2BTSA 3GOPA 4MAOA 5EI2A 1JKLA 1Q61A 3GQLA 4FIGA 2W7XA 5DI1A 5F20A 3UNKA 4J97A 3PVWA 4IM3A 2F2CB 2ZV9A 3O7LD 4WHZA 1YHWA 3NUXA 2WGJA 1FQ1B 4IX5A 2UV2A 3IW5A 3ZZEA 4AA0A 3GCUA 1E1VA 3IK3A 3ENHA 3HV4A 4Q9SA 1XQZA 1H0VA 2G15A 2XYUA 3MVLA 4C8BA 2IVSA 2CDZA 4Y83A 3WYYA 3U87A 5H3QA 3RI1A 4CLJA 3LFNA 1L8TA 2JBOA 1OZ1A 1Q8WA 1WBPA 4FSMA 4F70A 2C30A 5T68A 5E8SA 4PMTA 1R39A 3L8PA 2GFSA 3CTQA 4TWCA 4FTOA 4RFMA 4X3FB 3ZXZA 3T3UA 4QNAA 1UU8A 2C6TA 3MSSA 4D2WA 4EC9A 3FWQA 1LEZA 4RWKA 4O0XA 5CLPA 2W4KA 2WMAA 3TWJA 5LMKA 5EHYA 1E9HA 1DI8A 2ACXA 5HX6A 4FEQA 1ERKA 3F61A 4JX3A 4B0GA 3NEWA 3TTIA 4EJNA 4BYJA 5EQEA 4HZSA 5TT7A 4HYSA 4D4SA 4CFWA 4JLCA 3DA6A 2W9FB 4ARKA 4DCAA 2HY0A 4LM5A 2JFMA 2BAJA 3DBDA 3RK5A 4QPAA 2PE2A 3A60A 4IH8A 4WOVA 4EOSA 5C8KA 3RP9A 4BL1A 2RFNA 2ZJWA 3UIXA 3WE8A 5L8LA 2UW4A 4GK2A 5AUZA 2X2MA 2BMCA 4BCFA 3WZUA 5IUHA 3VAPA 3SG8A 2I0VA 4JDJA 4Y85A 4FSZA 4KBCA 4ANSA 4DINA 2BUJA 5J1WA 3NSZA 4APPA 5LCJA 2WFYA 4CEGA 4R7BA 3VUIA 4FIJA 4FV3A 4YNOA 5HG8A 4IWPA 3DXNA 5AP2A 5B0XA 4O0YA 2CGXA 3A7GA 4BHZA 2QOKA 4C3RA 3S0OA 4KBKA 2QKWB 4NK9A 4RA5A 1J3HA 1Y6AA 1AD5A 3PXQA 4I5MA 4C34A 2Z7RA 3ZFXA 3BGPA 4BGGA 4EK3A 5BVNA 2XEYA 4X0MA 4FNWA 3P78A 2B55A 4GG7A 3WIKA 3EOCA 5BVEA 1Q3WA 3LPBA 4EKLA 2VTAA 4S33A 1KE8A 3VS5A 5CZIA 3R1SA 5JKGA 3QA8A 3MY0A 3VS3A 4A9TA 2X7OA 4B7TA 4QMPA 2F2UA 3NUPA 4K33A 3UO6A 4BKYA 5HTBA 3D7TB 3E88A 3EQPA 1JPAA 5BUJA 4AF3A 3VS7A 2Q0NA 5HIBA 5D9HA 4XP2A 4WT6A 1G5SA 4QP8A 3MWUA 4F0FA 2Z60A 4IJPA 4RJ7A 2P2IA 3KMWA 4NM7A 3V51A 3IECA 2RG6A 3W18A 2VX3A 4BWXA 3QF9A 3E87A 1H1QA 4AN9A 5K5XA 3IONA 1RDQE 2CGVA 1MUOA 4WRSA 2ETRA 4FKIA 4J8MA 5ANDA 2IW6A 3LFEA 4CCBA 3P9JA 5L3AA 3BBTB 4F7NA 4O7TA 2XIXA 4O7NA 4NCTC 5AM7A 2QD9A 2ZV7A 3DAJA 2J51A 4PL3A 1PRYA 1YOLA 4H1JA 3BPRA 4TWNA 2DQ7X 3QBNA 4PPAA 3LIJA 1YVJA 3R0TA 3LE6A 3G0EA 1CM8A 2OKRA 3D7ZA 1DI9A 2JKKA 4RVKA 5E8WA 4HGEA 2PVMA 5HE1A 4GCJA 4FX3A 2C47A 3QTZA 4HGSA 5LVNA 3MYGA 2HZNA 1U5QA 3LCDA 3KN6A 4KAOA 4L42A 4LMNA 3ZDUA 5LXMA 4O83A 5EK7A 4HPUE 3W2OA 3LQ3A 4F4PA 1FINA 2BDFA 4DA5A 5AUTA 4DTAA 3TN8A 2YZAA 3NUSA 1OBGA 3RM6A 2VWZA 4S30A 3QWKA 1W82A 4EQCA 4ZLOA 2VAGA 1WBOA 5BVOA 4RC3A 1FOTA 5HU3A 4BCIA 5DN3A 3LFCA 4MBLA 2AYPA 1W0XC 3A8WA 5JK3A 5KO1A 3NWWA 5EW9A 3MFUA 3OCGA 3POOA 3QLFA 4W4WA 3EN7A 1QCFA 3DJ6A 1ZXEA 4YJOA 3IOKA 2REIA 3FLSA 3KXHA 3TNIA 2FB8A 3LCKA 2WMXA 3RK7A 4U9AA 3HL7A 3UZRA 5IQFA 3PP1A 4YZCA 5DYJA 4BDFA 3AD4A 4BYIA 3VF9A 2PMLX 3QYZA 3OY1A 4HOKA 4OTIA 2RKUA 4C4JA 5IEXA 5E1SA 1YHVA 3HGKA 1YI4A 3R7GA 1ZY5A 4AGCA 2NRUA 5CU2A 3EL7A 2WTDA 2H9VA 3QD0A 4PTEA 4Q2AA 5HG5A 1VYWA 4F65A 1U54B 4YJVA 3S4QA 4ALWA 2BTRA 2GNLA 4X6RA 3R1QA 4QMUA 1SVHA 2WMWA 5IQIA 4X6QC 5C4LA 1GJOA 1H1PA 4PTGA 2HK5A 4IFCA 5IA4A 1CMKE 3CC6A 4IMYA 4RJ6A 3W2PA 3GOKA 4FMQA 3ZONA 5K3YA 5DEYA 5KHWA 4O86A 3R00A 5B7VA 3Q6UA 1WMKA 3R8UA 1QMZA 2YCRA 5I9XA 3WF8A 4FG9A 1Z5MA 4ZTNA 3ZRMA 4EC8A 5AEPA 2XNGA 5ANOA 1H0WA 1TQIA 3BGZA 3RKBA 2VTMA 1WBWA 3PP0A 2RGPA 2GTNA 3DFCB 5M06A 4JAJA 4MWIA 5EYDA 3MVHA 3PY1A 4O82A 4XLVA 3CPCA 3IGOA 2CN5A 3AD5A 4GFGA 2C0OA 3AGLA 3VIDA 4BCPA 1ZYCA 3FLQA 5AAEA 3NDMA 1TQPA 3TNPC 5AUVA 1ZMWA 3BE2A 3ORXA 4L9IA 4G17A 3R7UA 3VW6A 3BHTA 4DFYA 4C2WA 3ZFMA 4U42A 5DT0A 2GSFA 5E92A 3BEGA 3TL8A 3K3IA 1KE7A 4G9RA 5K0KA 5FBOA 4FV9A 4BCJA 2PVJA 5DHJA 4YZMA 1VR2A 4RQKA 4UMRA 4K11A 2X6EA 3PJ3A 2YJSA 3C5UA 1V0PA 4K2RA 5CF6A 3DNEA 3N9XA 3ODZX 2IJMA 4KUJA 3NYNA 5IPJA 5M09A 2XBAA 2CNQA 1B6CB 1RE8A 3P86A 5BNJA 5D10A 4ZSJA 5L6WL 4IFGA 3FMKA 3JPVA 4YURA 4V05A 4E4MA 2G1TA 1FGKA 3Q3BA 4R5SA 3R21A 3V6RA 3KEXA 3KULA 1CDKA 2XZSA 1SM2A 4AA5A 4X2FA 3BWFA 2B54A 3DQXA 4KD1A 3RWPA 3COIA 4AFJA 5LVPA 3UP2A 5CSVA 4IC8A 3FBVA 3OBGA 3NVMB 4E7WA 3RPSA 3C1XA 4ITHA 3JY0A 3ZO3A 1F3MC 3IO7A 3BIZA 2CKEA 3DK6A 2FVDA 3SDJA 1Q24A 2QURA 4YZ9A 4BN1A 2RSVA 1UU9A 4I6QA 5KCVA 1OBDA 1PY5A 1H01A 3O8UA 1OPLA 5EOLA 4O7RA 5EYCA 5CVHA 4G3DA 1WAKA 2QO2A 4PL4A 3NNUA 5AR4A 2WTKC 4EOMA 4IACA 5CEMA 4J53A 1Q5KA 4AZTA 1ZOHA 3HRFA 4E4LA 3O23A 4Z7GA 3RVGA 5FDPA 2IG7A 2OH0E 3PE2A 3TDVA 3VW8A 1ZMVA 2J0JA 1JAMA 4L67A 1ZAOA 3Q9YA 4XV9A 3ZXTA 1UA2A 3FYJX 3EN6A 3ORIA 4NM0A 4NKSA 3WZDA 3UNJA 5M56A 3JYAA 3GI3A 1OITA 1V1KA 3U51A 3HZTA 2Z7SA 4DH1A 3EQFA 4U41A 4D2TA 5EYMA 2UZTA 3R6XA 4O7VA 4LRMA 5I9WA 4ZY4A 5HG7A 4BDJA 3P5KA 4GT4A 4FVPA 3WZJA 4DN5A 3DLZA 3MVMA 5CVGA 4BWKA 2UZBA 3R9RA 3I60A 4FV6A 3QCSA 3CBLA 3KRXA 3CD3A 3V5TA 3ORPA 2Y0AA 4RWIA 3KY2A 2R3RA 3DAKA 2GQSA 3H9RA 4H36A 4FTKA 1HCKA 2EXCX 2WNTA 5DG5A 4NFMA 2C5VA 4DGLC 4ENYA 5E1EA 2O8YA 2Y8OA 1JLUE 3MIAA 3S95A 3HMIA 4ENXA 3EN9A 4YLKA 4O7WA 1YOMA 4IANA 2C5OA 1R0PA 4M69B 4X21A 2OJFE 4XG2A 3UBDA 4ACCA 1VEBA 4A9YA 4PDOA 3QHRA 2GS2A 4DAWA 4RX9A 2C6EA 2XVDA 4UWCA 4ANQA 4ASEA 4D58A 4UV0A 4F9CA 4FEWA 4AUAA 5HNIX 1FVTA 3QX4A 1S9JA 3OXTA 4UN0C 1WVXA 5DMZA 3PDTA 4MD9E 1LUFA 5D12A 3O50A 1OI9A 5AV0A 1JQHA 2EWAA 3IDBA 2C68A 2JDVA 5AP5A 5IA3A 3FMDA 4QP1A 1M52A 3F66A 3LFFA 4PMMA 3BV2A 3FLNC 4QMLA 4JIAA 3EQDA 4UY9A 1PMVA 2H34A 4JDIA 4TYHA 5L8KA 3EB0A 4FTMA 3CQWA 5IA2A 4X2GA 5AUWA 2CMWA 5G1XA 4F63A 4ZY6A 4MXOA 4C0TA 3PJ8A 3H4JA 4XMOA 4NT4A 4C38A 1FBNA 1YW2A 1OIQA 1PXJA 4I24A 3Q5IA 2QLQA 1FMOE 4DF3A 4FSRA 5FP5A 2G2FA 2GHLA 2UUEA 5HI2A 4ZSLA 3ZOSA 4O0TA 4ORKA 3FZTA 4HGTA 3C51A 5AP6A 1PXKA 4UZHA 3EFJA 4RSSA 1Y57A 5A14A 2UZLA 2XB7A 2OIDA 3R2BA 4F09A 4CFVA 3IW6A 2OF2A 3OS3A 2E9NA 3BCEA 2XK6A 2A27A 4AAAA 2ETKA 4K9YA 3Q2JA 2XM8A 2X39A 3F5UA 1OIUA 3LLTA 3B2WA 5FQDC 3JR1A 2BHHA 5KMNA 4IB0A 3D94A 4I5PA 5LCKA 3W33A 3MJ2A 4ZLYA 3VQUA 4P5ZA 4YLLA 2YEXA 5IF1A 2B7AA 4B8LA 5KHXA 3UMXA 4I6BA 3UPXA 4EOJA 5CY3A 2PVFA 2PVRA 3GC9A 4RZWA 2ESMA 3UGCA 4YZNA 3HDNA 4NTTA 4G2FA 1UU3A 4PMSA 5HHWA 1DAYA 3MH2A 3BYMA 3C4CA 5JQ8A 1VJYA 3UMWA 1PXOA 2WXVA 3QTIA 2Y6OA 5H9BA 3PA5A 4FK3A 2B4SB 4IX3A 1NY3A 3ZLXA 2NPQA 4ZIMA 4WG4A 5E7RA 5CAQA 3U6HA 4FEUA 3QQUA 4AU8A 3HAMA 4FTIA 4YZDA 3VBWA 3C9WA 1GIJA 2WQEA 3VUMA 2FO0A 3LXLA 4JG8A 3SW4A 4EH4A 5JT2A 1YXVA 3NPCA 3QRTA 2IZUA 4FKRA 4FI1A 2Q83A 3R9HA 4BCQA 4GFOA 3SA0A 4WNOA 4Q9ZA 4YLJA 2OIQA 4XH6A 3UQGA 4IEBA 2WD1A 2P55A 4FV7A 4AA4A 2BIKB 2V0DA 2ZVAA 3IDPA 4N6ZA 3M2WA 3QTXA 4JR7A 4OTQA 4HGLA 4X3FA 5EM8A 1URCA 2BROA 4AE9A 4AN2A 5CF5A 5D7VA 4HVDA 5A4LA 3KRRA 4AS0A 5HIDA 1YI3A 3GC8A 3JY9A 4M84A 1YQJA 5HG9A 4V04A 1TQMA 2XK4A 5HX8A 1CSNA 3UVQA 4USEA 5IA5A 3MDYA 5IH4A 4O7SA 3L9MA 4E6CA 4O7ZA 4A07A 3ZUTA 2HXLA 5G6VA 4BTFA 2CGUA 3SRVA 2BKZA 4FT3A 3PXFA 4L7FA 4LOOA 4ZJJA 4LQMA 5GJGA 3HKOA 4S32A 3FI4A 3OZ6A 4IB5A 4MXAA 4E5BA 2Y9QA 5K5NA 1MRYA 4PP7A 1URWA 4ACHA 2R5TA 1XJDA 4QTDA 4UEUA 2IVVA 1OECA 2W5HA 4KABA 3WF6A 4CLIA 2WMVA 4F7SA 1Q8UA 4DFXE 4E4XA 4FVQA 3D5UA 3QKLA 4OW8A 3Q60A 3BELA 2HELA 3QKMA 1JSVA 3TCPA 5FWKK 3F82A 3PSCA 2GNGA 4XG4A 1JKTA 2IVTA 5CANA 3ZO4A 3KXGA 5HICA 1IAHA 4TYIA 1S9IA 3ZLWA 4XX9A 4LGDA 5CEQA 4HW7A 4YR8A 4A9SA 3IOPA 3AG9A 1LPUA 4EK8A 4DEEA 3H3CA 2YCQA 3T9IA 3II5A 4QTCA 3TNHA 5KKRC 2GDOA 4FL2A 4FTJA 3BV3A 5JRSA 2J50A 3E7OA 5H2UA 4EH6A 1PXPA 3CJFA 5AJQA 2VTOA 3KF7A 2OJ9A 3AMBA 4ITJA 4U6RA 4UX9A 3DXPA 3Q6WA 3NCZA 4NUSA 4TWOA 5GJDA 3ZZWA 4H3BA 4AN3A 2YIWA 3RPYA 3NGAA 5A46A 1TVOA 3C4ZA 4QYYA 1YDRE 3SAYA 3FLYA 3FKOA 4FT7A 4Z16A 3BYUA 3D7TA 4HNIA 4U3YA 4KSPA 1H26A 2RL5A 2WQBA 4AOJA 3EQGA 4IX6A 3HP2A 4O1OA 2QHMA 3LHJA 4W8EA 3QRJA 4YTFA 3ENMA 4GK3A 3A7JA 2X81A 3EIDA 3KQ7A 5T3QA 2LAVA 2JDRA 3MBLA 4WNPA 5EFQA 5GHVA 4F6UA 4ZJIA 5DT4A 2OLCA 2QKRA 4W9WA 2YIXA 1SNXA 1U5RA 1F0QA 2OH4A 2B53A 3C0HA 3VWAA 1ZYDA 4M97A 4YBJA 3PPJA 3LJ0A 2GQGA 2GHMA 3GCQA 5EHOA 4A4OA 3PJCA 3KXXA 4WSQA 2VD5A 2RF9A 4L45A 2R3OA 4P90A 2ITYA 4G3GA 3ZSHA 4IZ5A 2VTJA 5CALA 2W1CA 4EQMA 2CN8A 4QMVA 5H8BA 5LARA 3F88A 5FXQA 5EM7A 2OW3A 2PK9A 4IJ9A 3THBA 5BUEA 4KKHA 2OXDA 3OXIA 2BKKA 1PMUA 3HP5A 1XR1A 3GVUA 1HOWA 2I0EA 2ZMCA 3SGCA 2WTCA 3ZCLA 3ATTA 4I4FA 4DBNA 2QOLA 4P5QA 2E2BA 4XEYA 5CX9A 5DBXA 4TL0A 4FUYA 4LFIA 1SVEA 4Q5EA 3B2TA 4YC3A 4ANOA 3GENA 4RFYA 1JKSA 4UZDA 1J7LA 5GIOE 3DZOA 1W7HA 3OOMA 2KULA 4XYFA 5DRBA 2CCHA 2PTKA 4BFMA 3A62A 3C0IA 4IAIA 4CFNA 2YCFA 4MF0A 5I9ZA 4EZ3A 5TOZA 3FC1X 4IC7A 2B1PA 5EHLA 3BRBA 1UNLA 1YWVA 4E8AA 3RAIA 3GC0A 3NAYA 1W98A 1PYEA 2WEVA 3C0GA 1LP4A 1MRVA 2PUNA 3ZO1A 5IQEA 4OTPA 4DGMA 5C26A 5KZIA 5B2LA 3BI6A 2P3GX 4FG8A 4FSTA 2GNJA 5BMMA 2R3JA 5M55A 2IO6A 2YCSA 4QYFA 4Y72A 4F9WA 3PVBA 2G9XA 3BLRA 5CNNA 3ZO2A 3DXQA 1XBBA 2W9ZB 4PF4A 1GZOA 3DQWA 1Y6BA 4GMYA 4IVBA 3UOJA 5FUTA 5ACBC 4KWPA 3DBQA 3ORMA 3F69A 2ONLA 4IQ6A 4QPMA 3WIGA 2QG5A 3QQFA 4L52A 1U54A 3ULZA 3QYWA 4CKRA 3FI8A 5HOAA 3R73A 2BAKA 5LVOA 2RIOA 2X0GA 1KOBA 2UW9A 4FYNA 3C4XA 4FTLA 2YACA 5KBQA 4RX7A 2B9HA 3QQJA 4AGWA 2P2HA 2VNWA 3QTQA 3REPA 4MYGA 3WF5A 5CU0A 2PUIA 2ETMA 3AC5A 5BVWA 2W1HA 3UYTA 3RM7A 2XMYA 3R83A 4QYGA 4EH8A 1P4FA 4ANLA 5AV3A 5AR3A 2XS0A 3QKKA 4F9BA 4YU2A 2QLUA 4IE9A 2WTIA 4IVCA 2NO3A 2YWPA 3BHHA 4S31A 5TO8A 4DG0E 5BX0A 5CEOA 3PA3A 3AGMA 4EKKA 3ZU7A 4YUQA 4GG5A 5HTIA 2VWWA 2XA4A 5ETCA 4BKJA 5J5TA 4G9CA 3TJCA 3I81A 3VUTA 3DGKA 3FI2A 3LOKA 3COKA 1ZOEA 3UDBA 4CZTA 3LFBA 4PTCA 1XO2B 3BYOA 5KMMA 4FSQA 4O0WA 4WD5A 3FQHA 3ZSIA 3F3WA 4ZEGA 4Q5HA 4YTCA 1XHAA 5IQGA 3P08A 3TTJA 3UOLA 1REKA 3U6IA 2A19B 1CKPA 2C6KA 3VS2A 4KIOA 4DFNA 4FA2A 3E3PA 5JQ5A 4XV1A 1A9UA 4FC0A 4CFMA 2VTHA 3ANQA 3IG7A 4FF8A 4J1RA 2JKOA 1JVPP 4H58A 4RIWB 2EB2A 4UXLA 4QMNA 2WIPA 4KRDA 4TY1A 3QZGA 5LMKC 1PKGA 3FQSA 4XV2A 4YO4A 4ZSGA 1PMEA 5M08A 3QUEA 3AT4A 4P4CA 3LKMA 4ZZNA 2OFUA 4FV2A 4C59A 4D4VA 1T46A 4IM2A 5AV1A 3RK9A 3VO3A 3G0FA 4FKQA 2W4JA 4GEOA 2Z7LA 4ANNA 1GOLA 2E9OA 2HWOA 3U9NA 2PZIA 1YI6A 4GJ3A 3TG1A 3UP7A 1OVEA 4AZEA 4OBOA 5CU4A 3KXMA 2OZAB 3SRVB 1QPJA 2PY3A 4TYJA 2YLFA 4UBAA 2VWIA 2R3MA 3MTLA 5KNJA 5GINE 1IASA 3PXYA 4L8MA 2C4GA 2DWBA 2ZM1A 4FZAB 5AA8A 2OICA 5EM6A 3CY2A 3L9NA 2CKQA 5IUIA 3DB6A 3PSDA 3OWJA 1FGIA 1GY3A 4BBMA 4RLKA 4O96A 4XOYA 3ZHPC 2E9UA 2OSCA 3PIXA 4HZRA 4TZRA 3TKHA 3RPOA 1WVWA 4BIEA 2W5AA 3G9LX 1XH8A 5CZHA 3MFTA 4FYOA 4GFMA 1XH6A 4M0YA 5HO8A 5J9YA 2A0CX 3HNGA 1WCCA 3IW7A 3LXNA 3LQ5A 1JSUA 4E3CA 3E92A 3PYYA 2Y4IB 3DBEA 5CEKA 3FC2A 4RLLA 2W99B 2YHVA 2XBJA 4L7SA 4OR5A 5CU3A 3N4UA 2WOTA 3FZPA 4FEXA 4OLIA 4WKQA 4N70A 4ZMFA 1M14A 2BZJA 3LLAA 4EK5A 2UVXA 2YM8A 3JVSA 4CGAA 2I0HA 3DJ5A 2GS6A 1H00A 2ITNA 3GU7A 3DAEA 4BIBA 5M4CA 4TXCA 2XK8A 3MTFA 4I5HA 4JL9A 1CKIA 2W05A 2XRWA 3TXOA 3LFSA 4C3FA 5L8JA 2QR8A 3MB6A 4M69A 4CFXA 5F94A 1XH7A 2F57A 3L8XA 4DEIA 4YJUA 3ZUVA 1H4LA 2Q0BA 2HZ0A 3CS9A 2JKQA 1UU7A 1MQBA 4XG9A 4HCVA 3QGWA 2ZOQA 3UZTA 4QMWA 3FSFA 5IQAA 3IPHA 3F3TA 5DT3A 3TI1A 1KE9A 4FOBA 3HDMA 1FPUA 2O3PA 4IWDA 5DNRA 5AUXA 3P79A 5BYZA 4I23A 1STCE 2BDWA 4EOOA 4J71A 5FLFA 3FY2A 5L2QA 4O0RA 4NYEA 5AV2A 3DKFA 5J79A 2C6OA 2YITA 3E8CA 3PFQA 4AFEA 4UMPA 4L3LA 3OWKA 4Y95A 5FEQA 3VN9A 3E7VA 4JXFA 5DR9A 3EHAA 4BDEA 4EOIA 5A4TA 3M1SA 3V5LA 3D0EA 2RFEA 3HMNA 3SD0A 4WG3A 4CTBA 3R30A 3EZRA 5FGKA 1KV1A 4GT3A 4UWBA 5LJJA 1WZYA 4BCGA 2ITZA 2UZWE 4IAAA 4EWQA 3S2PA 4PDSA 5B2MA 1OL7A 3HLLA 2QOCA 5BPYA 5ICPA 3VS1A 2R3FA 3G9NA 2GU8A 4LUDA 5DIAA 3ULIA 4D55A 3MESA 2VWBA 3F5XA 2ZYBA 1H28A 4A9UA 3DV3A 1YXTA 2UW0A 4K77A 2ZDTA 3VBTA 4AW2A 4NZWB 3MV5A 3FXXA 4WRGA 5HBHA 4BDHA 2J4ZA 4DTBA 5HD4A 2XNNA 4TN6A 2X6DA 2XNMA 3DS6A 2JIVA 3SKCA 5J7HA 4OTWA 4XG3A 5E9EA 2QODA 3TUCA 3Q96A 3Q9ZA 4FT5A 3ORZA 3CTHA 2G2IA 3EKKA 3FSKA 4U8ZA 5CXHA 5IQHA 4MD8E 3BLQA 2QU6A 4R6VA 4YHJA 5IKWA 3FKLA 4KRCA 2YWVA 3D83A 4FSWA 3TV7A 3F7ZA 4M7IA 3P0MA 4DLIA 3FL4A 3AT3A 4PPCA 2IPXA 1KUTA 4M66A 3E8DA 2H96A 3LJ1A 2ZV8A 3QCQA 2VWUA 4C3PA 1BX6A 3WARA 1PF8A 5K0XA 3QC9A 4H3PA 3KU2A 5C1QB 4NKAA 5HVJA 1ZARA 3FKNA 4JIKA 3VRYA 3ELJA 4PX6A 4BCOA 4WIHA 3W16A 4IBMA 4GIHA 5E8TA 5FDXA 3IGGA 4JDKA 5HBJA 4FSNA 3CP9A 3L8VA 4ZY5A 2GQRA 5JGAA 3UIBA 2X8DA 3VC4A 4AW0A 3MPTA 3GCSA 5F9EA 4L53A 4ACMA 4F1TA 5AR5A 5FRIA 2V62A 5A4EA 5LQFA 4NWMA 4F9YA 1B39A 3MI9A 4F6SA 2XUUA 3UE4A 4L00A 5HLNA 4CMTA 4YTIA 2LGCA 4HPTE 3CQUA 4I0TA 2XK3A 4AT3A 3AC2A 4E20A 4JR3A 3EFKA 3NUNA 4RVMA 4HYHA 5EG3A 5JRQA 3Q52A 4EHEA 5CSPA 3C4WA 3MPAA 4B8MA 3CGOA 2X1NA 4ZTLA 4ERKA 5FXSA 4KS8A 4ZMEA 4O6EA 5TE0A 4R1YA 1PMNA 2VO7A 4RA4A 5M57A 5AAFA 3AQVA 2X4ZA 4KA3A 3RWQA 4EK6A 5CAVA 2PVKA 4APCA 2XK9A 5IQCA 5DOSA 2VNYA 3P4KA 4D1XA 5CVFA 4OT5A 4N57A 2OJGA 3CSVA 2C6DA 2FGIA 3OVVA 4F9AA 3W1FA 5DGZA 5AAGA 3FL5A 3FAAA 3AC3A 3PRIA 3QWJA 3NNWA 3R9NA 4WUAA 3LVPA
chains in the Genus database with same CATH superfamily
2I7QA 5AP3A 3H0YA 1Z9XA 4JAIA 3FMMA 3BZ3A 3KA0A 2WU7A 3KXZA 3WOWA 4F1MA 4V01A 3TT0A 3TYKA 5DEWA 4HVHA 2P4IA 2WMTA 2WQMA 4UALA 3UPZA 5AP0A 3COHA 4QPSA 1Q62A 3AC4A 4QQ5A 1CTPE 5IQDA 5AIKA 1TFFA 5CQUA 5FM3A 4OT6A 4C4FA 2QQ7A 1T45A 3BLHA 3QFVA 5M4IA 3HX4A 3W2QA 3Q4CA 3OC1A 4E6AA 2F7XE 3VUKA 4NL0A 3PG3A 2B9FA 1OB3A 2VWXA 4XG8A 1P2AA 2ERZE 2JBPA 1GZKA 2F4JA 1GIIA 4QTBA 5JH6A 4YMJA 3ZBXA 4AG8A 3NUAA 3AC1A 4JQ8A 5CSWA 4N6YA 3E8NA 2AQXA 2BZKB 3CKXA 3KRJA 1OL5A 3MIYA 3P23A 4CFUA 5CF8A 3DBCA 3HA8A 1PYXA 3TUBA 5AX9A 3ZM9A 1OGYA 3OXZA 3FEGA 4O4BB 4DFZE 4EH5A 4CQEA 3BEAA 1KE6A 4PUZA 2FSOX 2R3QA 3QRUA 1PJKA 1A06A 3PY0A 5EDQA 3BU6A 3FZ1A 5HESA 4D5KA 4QMTA 4UMQA 2WMRA 4JT3A 3BL7A 4FVRA 4LUEA 3G2FA 1JWHA 1WBSA 4BDBA 3CEKA 1SVGA 3VF8A 4F7JA 3A7FA 3TM0A 2ZFYA 3ZEWA 3V8WA 2WKMA 3ZH8A 4OBQA 4WNKA 2BIYA 5HO7A 2R2PA 3R28A 2PSQA 4EQUA 5IUGA 3OBJA 4CYJA 4AZVA 1V0OA 3A99A 4D9UA 3E62A 4J8NA 4MQ1A 3B8QA 4PWNA 1ST0A 2PPQA 2B0QA 1OPJA 2EU9A 3EQRA 3FXWA 5GNKA 4JOAA 3CXWA 5L2IA 1R1WA 4RIXA 4IX4A 3RCDA 3VULA 3ETAA 2I0YA 2J5EA 4Y5QA 4EEVA 4L44A 5CQWA 1FVRA 4ALVA 5IDNA 5DR6A 3ROYA 4EUTA 3NRMA 2XM9A 1RJBA 5C01A 1H1SA 2R3HA 3RAWA 3F3ZA 5AR2A 4HVGA 5CYIA 4IIRA 3W0OA 4QQTA 3ACJA 1PXMA 2ZAZA 3MS9A 1YWNA 4FG7A 1RW8A 4RIYB 4FKWA 2XKDA 5L2WA 1H24A 3C4FA 3PPKA 4LOQA 4YJSA 5FP6A 3MH3A 4YJPA 3GB2A 2X4FA 3R8PA 5JZNA 3ZC5A 4C02A 1M7QA 3POZA 4QO9A 1UNGA 3R8ZA 3R04A 3CLYA 3LMIA 1V0BA 3EH9A 5FM2A 3FPQA 3W2CA 1JOWB 4FL3A 2IW8A 4U97A 5HU9A 5FTGA 3KKVA 2XKCA 2Z7QA 2E9PA 3BQRA 3PTGA 2OXYA 3R9DA 3U8WA 2C5YA 3PXKA 3SOCA 1OPKA 2HWPA 4I1ZA 2YJRA 3QQHA 4I6HA 3D9VA 4ZOGA 3KIOC 5AV4A 4K1BA 3RPVA 3LAUA 2YM4A 2ITVA 4KB8A 4ZTQA 4FOCA 3LW0A 1Q97A 3QD2B 4MTAA 3K5UA 4QP7A 3ACKA 3R9OA 4W8DA 5IH5A 3V5JA 5AP1A 4BZOA 2R7BA 5ANKA 4EI4A 1J1CA 4RPVA 4UYAA 3F2NA 5BUIA 2Z02A 4V0GB 3TEIA 4DBXA 3H9OA 1IEPA 4FTNA 3V5WA 4E6QA 3CQEA 4IAYA 2Y4PA 5ANIA 4OAVB 3K5VA 3RCJA 5EH0A 5M44A 3F7WA 3GT8A 4BDGA 3HAVA 2WEIA 2JEDA 4OTGA 5AWMA 4YP8A 4W4XA 3UYSA 3C4EA 1AGWA 4G3CA 1YXUA 2W06A 4FTRA 4IW0A 4BR3A 4NM5A 5C03A 3PJ1A 1CKJA 4GUBA 3SQQA 1BI8A 2BRNA 4KBAA 2BALA 3KFAA 3VUGA 3DB8A 4GT5A 4I6FA 2IZTA 3WE4A 2V7OA 3IS5A 5IMEA 1OM1A 3O7LB 3OW3A 3PRFA 4C7TA 4B6LA 5A6NA 4GSBA 1OL2A 1U59A 2JIUA 4YJNA 4DH7A 2GNIA 5ACKA 2VTNA 4E4NA 5EDRA 1NVQA 3UC3A 2VTIA 1XBAA 2ZM4A 3OEZA 4IWQA 4X3FC 1UV5A 3T9TA 3UQCA 2CGWA 5ETIA 2V55A 2VUWA 3E64A 4FSYA 4LGHA 4M8TA 1KSWA 2BZIB 4YHTA 3UJGA 4RIWA 3A7HA 2QU5A 2J0IA 5E8VA 2WELA 5E8XA 4A4LA 4G31A 5BV3A 4AWIA 4AGUA 5L6PA 3UOHA 3GEQA 3PXZA 2PMOX 5JGDA 2PE0A 2PMIA 3OTUA 5HQ0A 2PZYA 4BTMA 4ACDA 4FV5A 4F99A 4JI9A 4D4YA 1Q8YA 5H8GA 1W2FA 3WBLA 2WB8A 3PG1A 4IXPA 3HV6A 4DT9A 3OEFX 4GYGA 5CXZA 4W4VA 4JS8A 1ZYJA 3RHXA 4ZLZA 3FPMA 2PVNA 5EYKA 3QTWA 4ZS0A 2IF8A 3VUDA 3NUUA 3PXRA 4D2SA 4X2NA 3PA4A 3TV4A 3ZRKA 2OZAA 4E1ZA 4QMQA 4QTEA 3BLAA 4GK4A 4J52A 1X8BA 1M17A 1W83A 1YRPA 3NIZA 2X8EA 2J0LA 2ZB1A 1B38A 3A7IA 3PVGA 2VGPA 2IZRA 1YXXA 3Q04A 3TIYA 3FE3A 2X0PA 2CKOA 3M42A 3FDNA 1PW2A 3HV5A 3ET7A 4BDKA 2BCJA 3KRLA 1M2QA 4C61A 4FTAA 1TZDA 2C6LA 2BVAA 3VJNA 3WF7A 1IRKA 5D41A 5HVYA 4AAYA 4J7BA 4XUFA 1ATPE 4QMYA 2WZJA 1WBNA 3R01A 4RX8A 5HVKA 5ANEA 3VBYA 4E5WA 4OAUC 5I9VA 3LXPA 3WYXA 4LMUA 4LRJA 2XARA 1FMKA 5J1VA 3V8TA 3D2KA 5DR2A 1LR4A 5AP7A 3MN3A 4G16A 4G6OA 4NW5A 4CMOA 5CAUA 3F2AA 3QHWA 4Z7HA 4MHAA 2YN8A 5A3XA 4MNEB 3W2SA 4Z3VA 5KMOA 3GBZA 3GCVA 1BL6A 4EBVA 2O63A 4J99A 4CFFA 4E6DA 4QYEA 5E91A 3QQLA 5JFSA 4O2PA 3PWDA 3F3UA 4D2PA 3SXRA 2NRYA 2B9IA 2IW9A 4N0SA 4CCUA 1H25A 2EXMA 5AA9A 4X2KA 5BVDA 2GPHA 4CD0A 4YC8A 4FIFA 2OK1A 4B99A 5EQPA 3OW4A 4H3QA 3ZBFA 1K9AA 1WVYA 4U7ZA 1ND4A 2VRXA 2CNVA 5AFVA 3U54A 4MD7E 4RBLA 3VBXA 4ZSEA 4CVAA 1DM2A 2V22A 2WOUA 3QTUA 2ZV2A 3AKLA 2WTJA 2XJ1A 3CGFA 4DLJA 3BHUA 2QC6A 4AT5A 4FV4A 4MBIA 4BVUA 2PVYA 1IAJA 3G51A 2B9JA 3GU5A 3OCSA 3OG7A 2QO7A 4OTDA 4AXAA 1MRUA 4O6LA 2WO6A 2YABA 4CV8A 2R3KA 4GVAA 4BZDA 3EFWA 1UWHA 5HNGA 4WUNA 4R1VA 3MH0A 2QNJA 2C5NA 4AW1A 4I5CA 4N4SA 5CTPA 3KB7A 3H9FA 3N4TA 5AUYA 5J8IA 2WMQA 2O64A 2X7FA 3BHVA 4KSQA 5AM6A 1UKIA 2WTKB 4ONAA 2WPAA 4M14A 3KK8A 1YHSA 3ZDIA 4XP0A 2E9VA 3GCPA 1M2PA 3C50A 3CE3A 2HZIA 2Z2WA 4DGOA 2XRUA 3E5AA 3NX8A 4I3ZA 5M51A 4CKJA 3WZEA 5I3RA 2GNHA 4O81A 5AIRA 3VHKA 1UKHA 2CCIA 3E93A 3S00A 4KNBA 2HIWA 2NP8A 3NCGA 2JLDA 3I1AA 2C0TA 4D9TA 4FEVA 3MFRA 4KIKB 1DAWA 3VQHA 3VS4A 3ZM4A 5CI7A 5FEDA 1NXKA 3VS6A 3NUYA 3MB7A 3P7BA 4JQ7A 4YGAA 4JBOA 1Y91A 4QRCA 3DT1A 3QALE 3ERKA 4O38A 4OUCA 4EZ5A 1OUKA 2J0MB 4I20A 1YDTE 4O0UA 4RIOA 2JAMA 2HENA 4JRNA 5JN2A 3SW7A 3UC4A 3Q5ZA 4G1WA 3Q53A 4MXXA 4ASXA 4BDCA 4RIXB 5GZ9A 2X8IA 4QYHA 5KMLA 1NW1A 2YM6A 5K4IA 4JVGA 5H8EA 2JD5A 2C69A 5I4NA 3TV6A 5HCZA 3UG2A 3N4VA 1OMWA 4J95A 3OCTA 2IN6A 3RAHA 4ERWA 4FV8A 3FV8A 4QMMA 5EDPA 5JMSA 1KV2A 4FKOA 4TT7A 3DOGA 4NJ3A 2ONLC 3F5PA 4LG4A 4MXYA 4DYMA 3DBFA 2WAJA 4S34A 2QR7A 3W0NA 3KGAA 5HD7A 2F7ZE 3NMUF 2QO9A 2OWBA 5M53A 4FGRA 4ALUA 3W0RA 3KL8A 5CSHA 4EBWA 2HZ4A 5JFXA 1QPEA 5DFPA 2CJMA 3CTJA 3QUPA 3PSBA 3DJ7A 4QNYA 4U43A 1RQQA 3MVJA 3RZFA 1YKRA 2R9SA 1OKZA 3D5XA 3OT3A 4FNZA 4YTHA 5IQBA 4GVJA 3NYXA 3UIUA 1GZ8A 3QXOA 2XP2A 4C35A 2ITOA 3AOXA 3NFGB 3FZSA 3QZIA 3OWPA 1PXIA 5CS6A 4DH8A 2R3PA 2X2KA 3LFDA 2WU6A 3CJGA 2XNPA 4M67A 4XP3A 3OTVA 4XLIA 3PLAE 3D4QA 2GFCA 1J7IA 4X2JA 5CU6A 2X0QA 5CAOA 3OMVA 4NH1A 2WMUA 4BHNA 4RQVA 5K9IA 3COMA 4PRJA 1OKWA 4MVFA 4FICA 3FMEA 3FLWA 3SXSA 4ITIA 3OFMA 3TJDA 2PUPA 4O0VA 5FTOA 2FA2A 1ZLTA 5IU2A 1QPCA 2R7IA 4R3PA 3A61A 2HCKA 1MP8A 2XIYA 1KWPA 4JNWA 4KS7A 3R7OA 3HUCA 4DH3A 4JRVA 2DUVA 4I0SA 4HCTA 4BTJA 3BYVA 5LMAA 2BDJA 2X9EA 4FKGA 4D0WA 5CEIA 4F7LA 4LL5A 4EHVA 2XJ2A 3DKOA 3H10A 3PJ2A 2HXQA 3U4UA 1JKKA 2AC3A 2XKEA 4CZUA 3KCKA 4ASZA 4CT2A 1G8KA 4IZYA 3ODYX 4R78A 4GKIA 4C4IA 3UQFA 4H39A 2YERA 5IA0A 2DYLA 5IG1A 4DG3E 4PP9A 4ZP5A 3DFAA 1VLRA 2VO3A 2XNEA 4GU9A 4P2KA 4ZSAA 4O84A 4R7HA 3UDTA 1P5EA 5KMKA 1Z57A 3TZ9A 2XIZA 2XNBA 3Q4TA 1BLXA 4YBKA 4CKIA 3GFWA 5HIEA 3MW1A 2YM7A 3I0OA 5ETFA 3WI6A 4FBXA 3WZKA 2RFSA 4GJ2A 4FKUA 4QMOA 3O8TA 3VBVA 1H08A 2JITA 2EB3A 2ZDUA 4XOZA 4L01A 4L6QA 1L3RE 3EJ1A 4GS6A 2YAKA 5EKOA 3HV3A 4WG5A 1W2DA 3O96A 4PMPA 2PL0A 5IEVA 5HLWA 5I9YA 4HYIA 1GNGA 3F9NA 2R3LA 3KK9A 5EQYA 4F6WA 3DKCA 4JG7A 3DPKA 4IDTA 5DWRA 3EZVA 4TTHB 4ZTRA 1SMHA 4I41A 4EH7A 4FTUA 4U0IA 4ANMA 5K4JA 4DFUA 4GRBA 4RG0A 2OXXA 5E8ZA 4NM3A 1IA9A 4XNEA 3C13A 3H30A 4E5AX 1W8CA 5L2TA 3D5WA 5CT7A 5ANGA 4R3CA 3HEGA 5IA1A 3HYHA 3AMYA 5J9ZA 3LM5A 5F4NA 2UW5A 3LMGA 3SC1A 4LV7A 1ZRZA 4UXQA 3EQHA 2DS1A 3U4WA 2C3LA 1J1BA 4XBUA 5AR8A 3I6WA 2AEGA 1Q4LA 3PLSA 5B2KA 4ANBA 2VX0A 3FZOA 5GZ8A 4P7EA 4DEAA 5HZNA 3ZMMA 3KN5A 4FV0A 2IWIA 1PXLA 1R3CA 4R8QA 4A06A 1UWJA 3R8MA 4AOIA 5BYLA 4YHFA 3DY7A 2VX1A 4XJ0A 4IAZA 2SRCA 4XG7A 5KKRB 1BUHA 4D28A 3R22A 3FQEA 5EM5A 4B4LA 4RZVA 2PHKA 3QX2A 3ZLYA 1R0EA 1BKXA 2HY81 4JX7A 5LOHA 5LVMA 4M0ZA 3UZPA 3NNXA 1I44A 1PKDA 5CNOA 4NJDA 2HOGA 4O2ZA 4E73A 4IAFA 4L46A 3ROCA 1XH9A 1QL6A 1ZYLA 2QOIA 4I21A 5KMIA 4AXCA 2CPKE 2VN9A 4MF1A 3HRBA 5HE0A 4BWPA 4WBBB 2YM3A 4WNMA 3CD8A 1YOJA 2CLXA 1HCLA 1A48A 4NIFA 5M4UA 1YDSE 1E1XA 3MA6A 3QQKA 5JEBA 1OUYA 4E93A 4O21A 2XNOA 2J9MA 4FKLA 4FUXA 3CKWA 4RIYA 3LCOA 2YZLA 4E26A 3ZLSA 4DGNA 2UW6A 5HNBA 4C4EA 3OP5A 4FL1A 2J0KA 2PULA 2UZUE 3QAME 4NCTA 1PHKA 1ZWSA 2WIHA 5DPVA 5J7BA 3O51A 3QLGA 2R0UA 3QTRA 4ASDA 3ZEPA 1TKIA 1G3NA 4RJ4A 3JUHA 2J2IB 2UZOA 3VUHA 4O4DA 4HJOA 5F95A 3I0QA 4AP7A 2G01A 2C1BA 2W4OA 3LFAA 3UG1A 4IZAA 3GC7A 3QRIA 3SX9A 4EH3A 5BMSA 1VYZA 4PQNA 5IDPA 4DGGA 3TZ7A 1OIYA 2R0IA 2VTRA 3FYKX 5FEEA 3OHTA 2ZM3A 4G5JA 5IEYA 4XHKB 4G6LA 3DDPA 4C4GA 4RC4A 3KRWA 4V0GA 1W2CA 5D1JA 2BPMA 2OGVA 3NW6A 4MNFA 4L68A 2YFXA 1P4OA 4EK4A 5L4QA 2GS7A 1BYGA 3NW5A 2OJIA 3NS9A 2PMNX 1IG1A 4U5JA 5IMXA 3ORKA 4MUQA 1H27A 4EYJA 1LEWA 2FSMX 2QOQA 3Q2MA 4JBPA 4Z9LA 3HV7A 3NAXA 3OWLA 1EH4A 2VGOA 4AACA 4C4HA 2O65A 2GMXA 4EORA 4FNXA 1NVRA 5BQ0A 5M4FA 4UB7A 3PUPA 4MXZA 4BB4A 4ZAUA 4EONA 4BCHA 3O0GA 3ZSGA 4DH5A 2C1AA 4DTKA 2Y6MA 5HCYA 5HE2A 3FY0A 4OBPA 1FVVA 4BCNA 2VTTA 3DNDA 4GYIA 4U45A 3ZYAA 3V5PA 3KMMA 1Q99A 4Z55A 4CRLA 4MCVA 3GNIB 2FSLX 4FNYA 2OG8A 1OIRA 3G33A 3F2RA 2WMBA 1JSTA 3GU8A 4FV1A 2VTPA 3R1NA 4G3EA 4C33A 4DEDA 3SV0A 4FR4A 2PWLA 5I3OA 5CI6A 5A54A 1WBTA 2UVYA 5AR7A 2AC5A 2FSTX 5HBEA 2PYWA 5ETAA 2GNFA 4K6ZA 3BQCA 2YDJA 2JIIA 3F5GA 5KZ0A 3SLSA 5M07A 4AE6A 5AADA 2C5XA 2F7EE 4C58A 1XH4A 3TKUA 5I5ZA 2VTSA 4D1ZA 5TR6A 3GUBA 4UWYA 4YJRA 4EUUA 2FUMA 4DCEA 2Y7JA 3JXWA 5ANJA 4PNKA 3I79A 4PDYA 3F3VA 1REJA 3ORNA 4IWOA 4YSJA 5AUUA 3FMJA 1DS5A 4YJQA 3MGYA 3VNTA 3P7CA 4UMUA 4DT8A 1Y8YA 2EVAA 4QQCA 2I6LA 3FMNA 4QQJA 5DH3A 3L8SA 1XBCA 3QL8A 4AX8A 2XKFA 3MY1A 3WILA 3HMMA 4CRSA 2O5KA 4CQGA 2QVSE 3MH1A 3OT8A 4FTTA 4IVDA 4JBQA 3IW4A 1O6LA 2VTLA 4O27B 3VRZA 4AGDA 5IISA 2OFVA 3S1HA 4RWJA 3K2LA 4IADA 3M11A 4BGHA 4RFZA 4X7QA 4FIEA 4IAKA 4IVAA 3FHRA 2UZNA 3V04A 4I94A 2PUUA 2JDSA 4FGBA 5EW8A 4MNEA 1G8SA 3TUDA 4BCKA 4D2RA 2UZEA 1GIHA 3QD3A 5F1ZA 5HCXA 3PIYA 5KE0A 5T6KA 3A4PA 2PZPA 5HKMA 4QP6A 4F64A 2ITUA 3HA6A 4DE4A 3GP0A 4FTCA 3ZS5A 4CV9A 4A7CA 3PZEA 4W9XA 3I7BA 4JDHA 5IZFA 1O9UA 2BAQA 2YDIA 3NW7A 5A6OA 3KREA 3S3IA 4Y8DA 4ACGA 4K8AA 2F49A 3NFFB 1Q3DA 1Q41A 4JQEA 3FMLA 3QU0A 3L9LA 3OF0A 4PNIA 4RT7A 4ZTMA 5LWNA 2OIBA 5L2SA 2YIQA 3EN4A 1BMKA 5LWMA 1ZZLA 1OL1A 1WFCA 3CPBA 3QUDA 3OY3A 4FZFB 5DLSA 5J5SA 4Y73A 1OL6A 4RJ5A 3MFSA 1YXSA 5HTCA 1Q8ZA 3O17A 3PPZA 4G6NA 3UTOA 1ZZ2A 4BCMA 4CG8A 4ZS4A 1J7UA 2W1IA 3PE1A 3SHEA 3EKNA 1WBVA 4OTRA 2WTVA 3T8OA 3UODA 2UZVA 3LMHA 2F9GA 5LVLA 4C36A 3ATSA 4FTQA 2JGZA 1OKVA 4BRXA 3R1YA 4O0SA 1J91A 3DK3A 2JC6A 4BDIA 3DZQA 3PVUA 4PY1A 3RPRA 2ITPA 5A9UA 2QI8A 2J6MA 4BC6A 5KX8A 4BI2A 4DEGA 4CMUA 2XCHA 3LQ8A 3EFLA 4ID7A 1K2PA 3JVRA 4LV8A 1VZOA 4KIKA 3GGFA 4TWPA 5GZAA 4RX5A 3OUNB 3G6GA 4TRLA 4AZSA 1SZMA 3I5ZA 2W1ZA 4QP3A 4OTFA 4QT1A 2KTYA 4XCUA 5E4HA 1BI7A 3LXKA 2OZOA 5CWZA 4BTKA 2CKPA 4U40A 3A4OX 1UNHA 4R7IA 3BHYA 4D4RA 2YA9A 3Q9WA 3I7CA 2AUHA 3BBWA 4EH9A 1PXNA 4G5PA 4TYEA 3E8EA 5D11A 2H8HA 4DEBA 3GXLA 4EH2A 4MQ2A 5GJFA 2QG7A 4NIFB 4EHZA 3QGYA 3NNVA 4C57A 4F08A 2JDTA 3C5IA 2RFDA 1H07A 3BYSA 2A2AA 2JKMA 3IDCA 4EZ7A 2OU7A 5LMBA 4TYGA 5DE2A 3K54A 2XF0A 4U3ZA 2NNWB 2X9FA 3R8LA 3CR0A 4HNFA 3BU3A 2VZ6A 3ZRLA 3GFEA 4BICA 5C27A 4A4XA 4IHPA 3QC4A 4MXCA 4WO5A 2I1MA 3C7QA 3ITZA 4XV3A 3D15A 2XIKA 4GKHA 5JFWA 4JJRA 1G8AA 4ZTSA 5FD2A 3OD6X 4M3QA 4MWHA 4G34A 4QOXA 1JBPE 2J7TA 2OI4X 5HLPA 3JS2A 4BF2A 4DEHA 3W0QA 2R3GA 4EL9A 3IW8A 2BRMA 4M12A 2W1DA 4LI5A 2QOOA 3D14A 5HEZA 3TKIA 4BI0A 4KINA 5C4KA 4NU1A 2X2LA 4XRJA 2PVHA 3SOAA 3RGFA 4U79A 3V5QA 3FXZA 2RG5A 3HMOA 4BDAA 5HORA 2OF4A 2XEZA 3MJ1A 3ZFYA 4CXAA 3DTWA 3V8SA 5FG8A 2JDOA 3HMPA 2P0CA 2BHEA 2B52A 4FSUA 5J95A 3V01A 3EN5A 3Q4ZA 5KMJA 2A98A 5HE3A 4I22A 2PU8A 2CHLA 4OTHA 5C8NA 2PE1A 2VTQA 3PIZA 3UVRA 1Q8TA 2ITWA 3L1SA 3OOGA 5E8UA 4CZYB 5EKNA 2BRBA 4M13A 3UIMA 2C0IA 2C6IA 2ERKA 3B8RA 3K3JA 3KF4A 3O2MA 2BRGA 4PPBA 4GUEA 2V7AA 3O8PA 4RWLA 1GAGA 2WTWA 2YM5A 4J98A 3ZTXA 1M7NA 3TNQB 2Z8CA 4YO6A 4YPSA 1XWSA 3TZ8A 4LRKA 4O22A 4EJ7A 3NVKI 3ORTA 4EHGA 4HVIA 2BILB 4MK0A 3Q4UA 3VVHA 1P14A 4QMZA 2IEWA 4XBRA 4GL9A 4TKSA 3LCSA 3QZFA 4I93A 3ZUUA 1GZNA 2P33A 3W2RA 2J5FA 3DLSA 1U46A 3HECA 5FXRA 3DCVA 1QPDA 4WBOA 5C8MA 4F1OA 4LYNA 4U81A 5D7AA 3UNZA 3BGQA 2C3KA 1APME 2FH9A 3RNIA 3UOKA 4BBFA 4BGQA 2PZRA 4YC6A 3EMGA 4FZ7A 5BYYA 3EL8A 3E63A 3U9CA 5I0BA 2OJJA 2R3NA 1YWRA 4IZ7A 4QMSA 5CEPA 2H6DA 2X0OA 4OGRA 4RJ8A 1AQ1A 5GIPE 2W1EA 2XCKA 5CT0A 4MH7A 3HVCA 4C62A 2EUFB 4DHIB 4TW9A 1M2RA 4U44A 3OCBA 1NVSA 3SG9A 2W1FA 2G2HA 2I40A 2ITQA 4I4EA 2VU3A 2CNUA 4RGJA 3R7VA 4CSVA 2OO8X 5J9LA 3KXNA 3NZ0A 4FKPA 3QD4A 3EQBA 4B9DA 4CNHA 2C3IB 3TDWA 2R4BA 3BU5A 3O71A 2IZSA 3H0ZA 3QXPA 5C9CA 2VO0A 3RINA 4DG2E 3KVWA 4UYNA 1ZMUA 3ID6C 2JFLA 1XH5A 2R3IA 3TZMA 1IR3A 2HAKA 4H1MA 4BI1A 3AD6A 3LZBA 3KC3A 3R2YA 4MKCA 4QMXA 3R7YA 4DC2A 3BE9A 4M68A 1UVRA 2W17A 2Y4IC 4XS2A 2XYNA 4RJ3A 5E8YA 4R3RA 4ZXTA 2HW6A 4O4CA 4FKJA 3LM0A 5CENA 4C2VA 5HGIA 5AMNA 4PDPA 3LCTA 3A8XA 1H1RA 3RAKA 1O6YA 2J90A 4ZTHA 3RZBA 2WQOA 4PV0A 5CF4A 4EWHA 3QQGA 3R8VA 3W32A 5JZJA 1KOAA 5BVKA 2JAVA 2WHBA 5IH6A 4MX9A 1H8FA 4XRLA 2C3JA 1BL7A 3KULB 5EOBA 4M15A 3DTCA 5FTQA 3Q9XA 4PL5A 4TPTA 2VV9A 3KCFA 3BKBA 4QP2A 2GCDA 3I5NA 3MA3A 3OROA 4LGGA 4UMTA 3W10A 3PZHA 1ZOGA 1ZYSA 5EI6A 3ORLA 2CLQA 3GU4A 4ZK5A 4TNBA 4NSTA 2VWYA 2YIRA 4FKSA 4HCUA 2WMSA 4YPDA 5E90A 4DHFA 5TKDA 3NIEA 2ITTA 2UW7A 2C6MA 2CSNA 4FZ6A 3RALA 5KUPA 4LV5A 4I6LA 2QOHA 2A4LA 3RBWA 4BIDA 4KKGA 4RVTA 2W5BA 5ITAA 3R7EA 4ZJVA 5DVRA 2HW7A 3LJ2A 4FT9A 4CYIA 5KBRA 4QTAA 4R77A 3GU6A 2XH5A 4D0XA 4LL0A 4ZZMA 4F0IA 4IB1A 3RTPA 4GV1A 2W0JA 2BRHA 4K0YA 2R64A 2UZDA 3EQIA 4YZBA 2HYYA 4O7YA 5CASA 4D2VA 3HUBA 5A4CA 1F5QA 4DITA 1R78A 5BVFA 3QA0A 2QOBA 1SYKA 2ZB0A 3W8QA 2XIRA 1NA7A 4RVLA 4FT0A 3QTSA 4IB3A 4EOPA 4EOQA 3U55A 4KIQA 3A2CA 2BR1A 4FODA 4YJTA 4QD6A 3QRKA 4II5A 4R5YA 5CSXA 1NT2A 2PVLA 2QONA 3E3BX 2UVZA 3FUPA 5EI8A 3VBQA 1IA8A 3ALOA 3P5JC 3P1AA 3BX5A 4FK6A 4YSMA 3QCXA 3BWJA 3F6XA 3G90X 1ZY4A 5FBNC 3R63A 3V3VA 2ZMDA 3V6SA 2ITXA 2YIYA 3RHKA 2UW8A 2QOFA 3EYHA 4AT4A 4NW6A 4D5HA 4IDVA 2YISA 2BFYA 4MEDA 4GW8A 1XMLA 2EXEA 3VS0A 3UO5A 4IM0A 3NLBA 3TNWA 4F0GA 2PZ5A 4BY9E 3MY5A 3KVXA 4Y5HA 4BKZA 3KMUA 4Y46A 3Q32A 3D2IA 3NR9A 4G3FA 4GIIA 4AOTA 3L9PA 4HYUA 3ZC6A 2A1AB 3NYVA 2W1GA 4TNDA 3FJQE 3SVVA 4AQCA 4I92A 2V5QA 4O1PA 3MPMA 3FZRA 3CY3A 4RMZA 3AMAA 3FHIA 3TACA 3DU8A 5DRDA 4AZWA 1O6KA 4J96A 3QZHA 4FKTA 3ALNA 4MBJA 4FZDB 4NFNA 5HO6A 4BDDA 2YAAA 4KIPA 2YLEA 2XJ0A 4DFLA 3PY3A 4QP4A 1KE5A 4USFA 3G5DA 4EYMA 4QP9A 3HRCA 1Y8GA 2BFXA 3D5VA 3T3VA 4FKVA 4BZNA 3G6HA 2VO6A 1I09A 4KKEA 3VHEA 3AC8A 3TIZA 4TYHB 4D1SA 3CCNA 4WSYA 3W55A 4AW5A 2WQNA 4FE2A 3QCYA 1MQ4A 2GTMA 4GU6A 4NTSA