3NUYA

Phosphoinositide-dependent kinase-1 (pdk1) with fragment17
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
286
structure length
276
Chain Sequence
b'QPRKKRPEDFKFGKILGEGSFSTVVLARELATSREYAIKILEKRHIIKENKVPYVTRERDVMSRLDHPFFVKLYFTFQDDEKLYFGLSYAKNGELLKYIRKIGSFDETCTRFYTAEIVSALEYLHGKGIIHRDLKPENILLNEDMHIQITDFGTAKVLSFVGTAQYVSPELLTEKSACKSSDLWALGCIIYQLVAGLPPFRAGNEYLIFQKIIKLEYDFPEKFFPKARDLVEKLLVLDATKRLGCEEMEGYGPLKAHPFFESVTWENLHQQTPPKL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PkB-like
publication title Aminoindazole PDK1 Inhibitors: A Case Study in Fragment-Based Drug Discovery.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 88
structure length 276
sequence length 286
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2010-07-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3nuyA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3nuyA01
1H24A 1XJDA 2PUIA 3ZOSA 1K2PA 5I9ZA 4FG8A 3FLNC 2OF2A 4I0TA 3C1XA 2YM3A 2OBJA 4GK2A 3E5AA 4YZNA 3CTQA 2ZV8A 3C4XA 3HMMA 2VTNA 4FZFB 4EK3A 3QA8A 4ZJIA 5LVOA 5AP0A 3AC3A 1Q8YA 3TN8A 3FMKA 2QG5A 4O96A 3ZO3A 3QQJA 4RX9A 5EDRA 5T68A 2C47A 5JK3A 4ENYA 5CAQA 2ITNA 4HCUA 4AOJA 5F20A 3OHTA 4FZ6A 3JY9A 2XNEA 4X2JA 3PJCA 3UO4A 3DXNA 4ITHA 5IEYA 4AT3A 1PXNA 5T6KA 5FP6A 1Y57A 2QODA 2ZOQA 3GCUA 4FV6A 2QI8A 3C51A 3OXZA 4U41A 4D4SA 4ZTLA 4UN0C 3FY2A 1MQBA 3I79A 3U4WA 2YACA 3LFQA 4PP7A 5HORA 2Q0NA 4BDJA 3FLQA 1O6LA 4M0ZA 4CFVA 2G1TA 3FKNA 5C9CA 4JQ7A 3DNDA 3OT3A 3UIUA 2IN6A 1TQPA 4FZ7A 3TKIA 3C0IA 3BV3A 3QTWA 5DWRA 3CR0A 3IS5A 3T9TA 2PU8A 2A2AA 1CTPE 4OUCA 4ASEA 4O7NA 2ZB1A 3NW6A 2BTRA 4GIIA 5DRBA 4PL4A 4BCFA 5M06A 4UMQA 3TNQB 1Q97A 4GFMA 4RT7A 1CSNA 3GU7A 1OECA 3CEKA 2OKRA 4KIQA 4OBPA 2C4GA 5E90A 3FZOA 4PDYA 3ZRMA 4I5HA 4BCGA 3QUDA 4W4VA 3RAWA 4YHJA 4BCOA 2Y0AA 4EZ3A 4IVAA 2JIUA 4ZTMA 1NVRA 3DKFA 3W2SA 3BBTB 2Y6OA 5FEEA 5BVKA 2UZDA 3Q9YA 4FTKA 1L3RE 2GHMA 2C6KA 4FKRA 5DA3A 5H8BA 4U6RA 1H1RA 1M2PA 3OROA 4YR8A 4YMJA 1OPKA 2C6TA 4AACA 1IA9A 4J8NA 3D14A 3PY0A 5D1JA 4LOOA 4RQKA 2PVJA 3R04A 4MNEB 3CY2A 3ORIA 3IDBA 2AYPA 4F9AA 3E62A 3CGOA 5C01A 4C34A 2HZ4A 4RGJA 4G3DA 3ODYX 2VD5A 3QQGA 3MY1A 4IAYA 4DG0E 1A48A 2GU8A 3MSSA 3KK8A 3LCDA 3I5NA 4C33A 3A7FA 5IH5A 4A4LA 3KRLA 3QZHA 3HV3A 3PWDA 5DR2A 4FKUA 5HCZA 2BAQA 5KE0A 4GJ2A 3EOCA 3GOPA 3R8LA 2HW6A 1V0PA 2W1DA 3QWJA 5EHYA 5EG3A 5DE2A 4RIYA 4IB0A 2RFEA 5H8GA 2WAJA 3VBXA 1U54A 4KA3A 4LGHA 3ORPA 2HIWA 3JUHA 4RPVA 4WNOA 4Y5HA 3UQGA 4NW5A 3GC7A 1XBCA 1YXVA 4Y85A 1YKRA 3VBTA 3COIA 4IWOA 4RJ5A 5LQFA 2P2HA 3RK7A 4FKWA 5EDQA 3T9IA 1MRUA 1WBVA 3B2WA 3D0EA 3Q5IA 4GK3A 1U59A 4JBQA 2XIXA 5CX9A 4KB8A 2VWWA 1VYZA 4JG6A 3MBLA 3O96A 4M84A 5E91A 1P2AA 3JXWA 4XG8A 4X21A 1I44A 3BGZA 3PJ3A 3PFQA 2WHBA 4XG3A 3ZXZA 5IQEA 2NO3A 3ZUVA 3PZHA 4R78A 3LMGA 4QO9A 4ANSA 2GTNA 4C4EA 3CD3A 3NNXA 3QQLA 4BYJA 3KVWA 4O86A 3P7BA 4KBAA 4G3CA 3TEIA 3MESA 3UZTA 4M13A 2O2UA 2DYLA 3AMAA 3U87A 3RWQA 1YDRE 3U4UA 2BHEA 5AUZA 3QTUA 4I93A 3AGLA 5BMMA 2VV9A 1XBBA 2WTKC 3FI4A 3ZSIA 1IR3A 1UNLA 2HK5A 3OS3A 3EKKA 4DEAA 2C6EA 4FTMA 3VS3A 2VWYA 3D7ZA 4EOJA 4EZ7A 5HESA 4UWCA 5JGAA 4O7TA 2Z7SA 1DI9A 4AFJA 5HCYA 3W55A 5IMXA 4U40A 4F9BA 3C5IA 3EN6A 3MVLA 4QYYA 2VTJA 2GS6A 5LCKA 4JI9A 2ERKA 4IZYA 2QO2A 4USFA 3FQSA 5M4FA 4YHTA 3C13A 3BHYA 4QYHA 3TV7A 3UDBA 5JRQA 2WTDA 5KX8A 4M7IA 4O1OA 2P3GX 2W5HA 4QP9A 3V5QA 3D83A 3DT1A 4IANA 4IHPA 5EYMA 5JQ8A 1UU8A 5CI7A 1J3HA 1OL1A 2PUNA 3ORTA 1SM2A 2ZVAA 4AT5A 5AAGA 3MB7A 2FYSA 4FBXA 4TWNA 4U9AA 5AUUA 4BI2A 3DKCA 1R3CA 3G6HA 4XBRA 4BDIA 3UQFA 3LPBA 3CQEA 3HV7A 4TW9A 1J7UA 5E1SA 4EK6A 4NM7A 1WZYA 2P0CA 3SLSA 3NVMB 3SW4A 3BELA 2ONLC 3KXNA 4EOIA 2GCDA 2JKQA 4MNFA 3VQHA 3LXNA 3CC6A 5FXRA 3F3VA 3MI9A 5BUJA 2ONLA 5DT3A 2JITA 5FDPA 2YIRA 1CDKA 1XH6A 2P55A 4QP8A 4BDAA 5CY3A 3SD0A 4M0YA 4RIXA 4X2FA 1OM1A 4B4LA 3EJ1A 4NH1A 3COMA 3ANRA 2HYYA 5LXMA 5IEVA 2XK4A 2ZM3A 4RA5A 3VW6A 4DLIA 4R8QA 1IAHA 2XK9A 2ZAZA 3PXQA 2OG8A 2OK1A 3Q52A 4QMLA 3I60A 3VJNA 2XKDA 2WQOA 2JKMA 4KBCA 4PMSA 2YCFA 3OCTA 4RG0A 1JSVA 4DG2E 1PY5A 2PUUA 4YUQA 4FIEA 2OIBA 2ZV7A 1SYKA 3QQFA 3IK3A 5C03A 4MF1A 3KRJA 4R5YA 1ZY5A 2R3PA 4PTGA 3TV6A 4AGCA 4DHFA 2QU6A 1JVPP 3WF7A 3RKBA 4A4XA 4AA0A 2W99B 2VTTA 2BKKA 4NFNA 2UZWE 3RZFA 4FIHA 4LMUA 1KE5A 4AX8A 3NUAA 4ZTRA 2UVYA 4JXFA 4NYEA 4J97A 5A4TA 4S33A 1YOMA 2YZAA 5GZ8A 3TJCA 3CIKA 4TTHB 4E7WA 4DG3E 4IWPA 5D7VA 5HD4A 5AP3A 2I0HA 3ZM4A 3RNIA 4EBVA 4I4EA 1ZLTA 2B52A 4YBJA 4YJUA 4E6AA 4GSBA 2YIYA 3AC8A 4FSYA 2Z8CA 3R83A 3RGFA 4ZTSA 3SRVB 4EKKA 2I0EA 3HAVA 4YZCA 4AGWA 4OR5A 3C0GA 4ZMFA 2R3RA 2OZOA 4J99A 3GQIA 3ZSGA 2PZIA 4XV1A 3F6XA 4J71A 1SVGA 4P7EA 4EC9A 4NK9A 3RK9A 3KXZA 3SW7A 2VX0A 4JDJA 4HYUA 5AA8A 3R02A 4YTCA 3MVHA 3QFVA 1NW1A 4GVJA 3TT0A 5CAUA 4P4CA 3TL8A 3LAUA 4CYIA 4FTJA 2LAVA 3VJOA 2WIPA 3NSZA 5E92A 4CEGA 5CXHA 4EH2A 4EONA 2ETRA 2CMWA 4G9RA 2CKQA 3EN5A 4XP0A 1WBWA 3R1SA 1ZZ2A 4FVQA 3FMMA 4BHNA 4ZS0A 4Q2AA 4LOPA 3MY5A 3EYHA 5K9IA 3BZ3A 3OOGA 2F7ZE 5DT4A 5LMAA 3TKHA 1Q4LA 5J95A 3DLSA 4CT2A 3W2CA 1ZYJA 4ALWA 4HVGA 2PE1A 3OOMA 3QRUA 4FZAB 2QKWB 3QTIA 2BRMA 3CY3A 4YO6A 3NYNA 3FLWA 2W1EA 5EKNA 3RVGA 5TE0A 4DE4A 4YNEA 3RWPA 1CMKE 2Y4PA 2ZDUA 2C5YA 4G5JA 4O27B 3AD4A 3E64A 3E93A 3GGFA 3IGGA 3D7TB 3EH9A 1H08A 3O23A 4QYFA 4D58A 1WFCA 4BI0A 1VR2A 2XA4A 3EWHA 3MTLA 1ZWSA 3LE6A 4O7YA 3E3PA 2JDOA 4U3ZA 3K54A 4E4XA 4U7ZA 4IM3A 4QMPA 3EN9A 2C68A 4H39A 2QOOA 3U6HA 3MPTA 5EFQA 1Y8GA 3W16A 4FGRA 3QKMA 2ZM1A 3O8PA 4PF4A 3FI3A 5L2IA 3LCSA 3NAYA 4YC8A 2P33A 2XJ0A 3IGOA 2VTQA 4XG7A 5IDNA 3GFEA 4JX3A 3BX5A 4A9UA 5KMNA 1H1WA 3U6JA 4MBJA 3UMXA 2C5OA 5K4JA 5CEPA 3NIEA 4DTAA 1H8FA 1BKXA 2X8EA 2FA2A 3PG1A 1JKKA 2YLFA 2VGOA 2GFSA 2CLXA 3HGKA 3KL8A 1GZNA 1OVEA 2QD9A 3C4EA 1YXXA 3S95A 5GJDA 1J1BA 3VBVA 3GT8A 3TIZA 4LRJA 3ZEPA 3ZO4A 2W1CA 3FI8A 3KMWA 3H30A 3O0GA 3ROYA 3KFAA 5AR2A 3N4VA 1PXPA 2GNGA 3GU4A 2CCHA 3H4JA 3PRIA 3NYXA 3GUBA 3OWPA 3G0EA 1BMKA 1KE6A 3WE8A 5B2KA 2YM6A 1YW2A 4D2WA 4AUAA 2J5EA 4L3PA 2YAAA 2Z7LA 4QPSA 5CSVA 5GZAA 5A4EA 2VTRA 2W4JA 4D9TA 3NNWA 3QCQA 2R4BA 4HW7A 4WT6A 2BZHB 5HVJA 2ITWA 4KKGA 4I20A 3RZBA 2P4IA 1CM8A 2ESMA 3HVCA 3LFEA 4LQMA 3KC3A 3F5UA 2CCIA 1KV2A 1QL6A 2Q0BA 2R3LA 3BCEA 5FBOA 4J1RA 2X9FA 4JJRA 4PL5A 4N57A 4EUUA 4OAUC 4O6LA 4RMZA 3WZEA 4D28A 2H6DA 5JKGA 2A1AB 3S4QA 4IJ9A 2C0OA 3N4UA 4IX4A 5CASA 5GIOE 2CKEA 2OGVA 4BTKA 4C2WA 3PWYA 4L00A 3BYUA 4BTMA 3F9NA 2C6OA 4IH8A 5GJFA 5GNKA 4EOPA 3PUPA 4PWNA 2XCKA 2QOKA 3H0ZA 5BUEA 3R8UA 3KEXA 2F57A 4FKSA 5EI6A 4O7RA 3DK7A 4GEOA 2GTMA 1OPLA 4OBOA 3RTPA 2QKRA 4HGSA 3ZHPC 3FXZA 3QX2A 3CS9A 5AP5A 4FT0A 4IVBA 1WVXA 4JRNA 1NT2A 3HLLA 3E88A 2G2IA 1Q62A 4PV0A 1XH9A 2IVTA 3R6XA 3ZLYA 5FEQA 4L43A 1STCE 4XH6A 3ORZA 5C27A 3F2RA 4MHAA 4QQ5A 1JKSA 2XEZA 5L6OA 3QD3A 2X6DA 1BI8A 3GNIB 3KCFA 5FXQA 2PVHA 3MH1A 4C4FA 4AT4A 3QYZA 4DH7A 4NKSA 4JLCA 4AA4A 4AE9A 1G8AA 3GI3A 2BAKA 2J7TA 3FQHA 3MFUA 3MS9A 1BL6A 3MH3A 1P4OA 1WBNA 4J95A 4Q9SA 3HKOA 4FNWA 4AXAA 3UYSA 2GNJA 3FEGA 5EM5A 4P90A 4XRJA 4AA5A 1U5RA 5DPVA 4EC8A 5J7BA 3QC9A 3VHKA 5EQYA 4EHGA 2UV2A 3D5XA 3UC3A 4CV9A 4DCAA 5A54A 3F7WA 3NMUF 2YIQA 3A99A 2QC6A 5AP1A 5IA1A 2VTHA 2JC6A 4H05A 2WMWA 3TDWA 1F0QA 4NJ3A 4CGAA 3LXLA 4CFUA 4G31A 5AWMA 3QHWA 3O7LD 3M11A 3WZDA 4C3FA 5CEOA 1B39A 3KXHA 3R01A 4QP4A 3EMGA 3ODZX 3Q9XA 3VBYA 4AZFA 5CALA 3CPCA 4CNHA 4UALA 4R3RA 4JRVA 2B9IA 2VX3A 4OTIA 2WMUA 4YGAA 4F1MA 4F99A 4MD7E 4D1SA 3F69A 4ZSLA 4IVCA 1M52A 3VS0A 3C4CA 3VS4A 4L44A 5ANJA 4FKQA 4TNDA 4X2KA 4UMTA 4G2FA 4ZTQA 5IH6A 3QQUA 5CANA 2XK7A 4RLLA 1Q8ZA 3BIZA 4BIBA 5AP4A 5IA2A 3QD2B 2VTMA 3VO3A 1SMHA 5BVWA 5M53A 4UX9A 4JAIA 3AXWA 5AAEA 2BR1A 2R3KA 4Q9ZA 3SG8A 3EKNA 2RG6A 3BV2A 4DINA 3E63A 2WTKB 4G3FA 4MCVA 4HGEA 2J5FA 4R1YA 3ZDUA 3Q9WA 3Q04A 2AC5A 3HV6A 3R7VA 3W32A 5CXZA 2R2PA 4O0SA 2HY0A 4HJOA 4G6OA 3BYVA 4TRLA 4LRMA 4DH5A 4YJNA 5IH4A 3HMIA 1PMUA 3A2CA 3IW5A 4FK6A 3RAHA 2UW3A 2W4KA 1PJKA 3QKKA 4IAFA 4AS0A 5KZ0A 4FVPA 1GNGA 4XRLA 3NS9A 4CG9A 3LW0A 2VWVA 3UJGA 4U5JA 3PXZA 3ERKA 4I4FA 4UYAA 1LP4A 1UKIA 3AOXA 2HY81 5K0XA 4Z9LA 3VC4A 3PPZA 3C7QA 4FTQA 4CFFA 4Y83A 4QYEA 3OMVA 2YM5A 3UVRA 4FV1A 3REPA 2V7AA 4XHKB 4FTAA 3TCPA 4BZNA 3VUMA 3K3JA 5HVKA 3IECA 3ENMA 4DFBA 5IQIA 3R8ZA 4DH3A 3LIJA 2VX1A 4D55A 1YVJA 4BWKA 3K5VA 2BVAA 4RC3A 3UG2A 3ZO2A 2R0UA 4QMTA 4D0XA 4D0WA 4E6CA 4H3BA 3CTJA 3GC8A 4QPAA 4MBLA 2XEYA 3P9JA 3FPQA 5JMSA 3ZEWA 2VGPA 5AV3A 4AOTA 3BHTA 3I0QA 2QOLA 2W1ZA 3IPHA 4IZ5A 4RIXB 3F3WA 2B7AA 4DYMA 2WTWA 3VWAA 4QOXA 3ZTXA 5ACBC 2R3JA 2IWIA 2YFXA 4QMVA 2R3IA 2Z7QA 4I0RA 4LV5A 4GG7A 4IFCA 3LLAA 2HOGA 4FV7A 4PQNA 4IAAA 3CXWA 4F08A 4EQCA 4FSNA 3DA6A 5KMIA 4ZSAA 2BPMA 3E7OA 2WQNA 2Y8OA 2IVVA 4LMNA 4S32A 4BCJA 4BIEA 1GY3A 2CGWA 4YSMA 4XJ0A 4NWMA 1JKLA 2R3OA 4Y73A 3V01A 4YZDA 5FG8A 1Z9XA 3KQ7A 4ZJVA 3BU3A 3V5PA 4E6DA 2A27A 3QCYA 3JVRA 4KSPA 4WIHA 2I0VA 4RWJA 3W8LA 1KE7A 4Z55A 4GMYA 3PJ1A 3HL7A 4DBNA 3SVVA 3V5TA 3UNJA 2RG5A 3P0MA 3EL8A 1OB3A 5CAPA 1MP8A 5KMOA 3BGPA 4YPDA 4Y5QA 3L9NA 1XH4A 4GH2A 5BUIA 1YWNA 1Q8UA 2WMXA 2HW7A 3PLSA 4O82A 3R00A 4HYIA 1M17A 2B1PA 4JQ8A 3UNZA 1ZMUA 3BU5A 3RHXA 4BCNA 2C0IA 3R2BA 4RWKA 3A8XA 1J91A 2YCRA 2IW6A 4NCTA 4F6SA 4YJPA 3K3IA 2YCQA 3IOPA 4WUAA 2Z2WA 3F3UA 3SXSA 5AR4A 3NUUA 4GG5A 4FT3A 4YBKA 5BYZA 4ALVA 2PK9A 5FEDA 4D5KA 2WOTA 3OXTA 5D41A 1FGIA 2X81A 4OTWA 4UWYA 4QMQA 1K3AA 1FVVA 4N6YA 3QYWA 2DWBA 3GBZA 4IACA 3PVGA 4I6FA 5BPYA 5GINE 3UYTA 1OIYA 3EFLA 2HXLA 5IKWA 5ANOA 1WBPA 3U51A 4YTFA 1YOLA 4O38A 2W1FA 2X2MA 4L53A 4CKRA 4F9YA 2OXXA 3VUIA 2H9VA 4M67A 3OY3A 4JDKA 4OGRA 2VO7A 3QAME 3TNIA 2FSTX 3LFSA 4AF3A 3NUNA 2ITOA 3QZIA 3P5KA 4RFYA 3RMFA 1TQMA 4O2ZA 5KKRC 2OJFE 3DB6A 5H3QA 3DOGA 1IAJA 3ACKA 3VS7A 2OJJA 1J7IA 3EQFA 2FSMX 2JIIA 3LJ0A 2C5VA 5B7VA 5LVLA 4R6VA 4RBLA 4XBUA 2RF9A 2WGJA 3D5WA 4XOZA 4A9RA 4AWIA 4K2RA 4CTCA 4YJRA 2VO0A 2WMTA 4EJNA 4YJTA 2C3JA 4WKQA 2XJ2A 4OTRA 4F4PA 3I6UA 3PPKA 4ANBA 1XH8A 4I0SA 5M07A 5BVNA 4NTTA 4M15A 3DFCB 4JG8A 1ZOGA 4FYNA 5M44A 3HECA 3QRTA 4IC7A 2VN9A 2OJGA 2QNJA 3L8XA 4HYHA 4BDDA 3JYAA 3KKVA 2A19B 5A14A 4IB3A 4KIPA 2XBJA 2RGPA 3DBQA 3Q4CA 1SNUA 4HOKA 5B2LA 4RJ8A 1MQ4A 4J8MA 4GYGA 4ANQA 2BZIB 1KOBA 1Y91A 2CNVA 3V8TA 3A62A 4FTOA 2Y4IB 2V5QA 1PXMA 1PXJA 3NUSA 4ACCA 2XUUA 5I9XA 1BLXA 2ZM4A 5CTPA 2JLDA 3ZLXA 3EL7A 3G9NA 3Q96A 3UPXA 3F2AA 2OSCA 3QALE 4F7LA 3LXPA 4CVAA 3QTQA 2SRCA 4R77A 3R73A 3EFKA 4D2RA 4AP7A 3HMNA 4ZSJA 5L2SA 3GOKA 4BDKA 4AN3A 5HX8A 2GNIA 4W9XA 2HAKA 3QC4A 3TIYA 4JBPA 3R8MA 3ZUUA 3E92A 3E7VA 3TTIA 4F1TA 3GU5A 3OWLA 5JEBA 1W8CA 5BX0A 3DBDA 2XIZA 4JIKA 2IZSA 4I6BA 3AMBA 3VUDA 1XBAA 2GS7A 3QL8A 4KBKA 4IFGA 4JNWA 4FODA 4DFLA 4CKJA 1TVOA 2OU7A 2OH0E 3MDYA 3ZCLA 4FGBA 4NM3A 3RBWA 4YJOA 4W4YA 3ET7A 3Q9ZA 4KUJA 3R8VA 4BICA 2OFUA 3EHAA 3PJ8A 4RVKA 2BILB 3GCQA 4MTAA 4WO5A 3GCSA 3SXRA 3ORKA 3AG9A 4XLIA 3G51A 3RJCA 3R9OA 4WBBB 2YHVA 3UIXA 4QQTA 3UIMA 3Q60A 4F64A 1Z5MA 4C36A 3NUYA 3EQGA 3PLAE 3G90X 4ASDA 4E26A 4G3GA 2OFVA 5FDXA 3Q6WA 4FTNA 1G3NA 2WNTA 4GV1A 2J0MB 2E9OA 4IB5A 4HZRA 4MX9A 3R1YA 3FMJA 3EQBA 3O8UA 4BCHA 2ITPA 4AZTA 3MIAA 3QLGA 4YSJA 3P23A 5E8TA 2VTAA 1JBPE 3A61A 2Y6MA 3EQIA 2G2FA 4IAZA 4L3LA 5DOSA 2YWVA 4O2PA 5BQ0A 3B2TA 4XP3A 2YM4A 3CJGA 4XG2A 4F0FA 4I23A 3U9NA 1SVHA 5F94A 3KREA 3F3ZA 3MW1A 4RJ7A 4D4RA 4J53A 4X3JA 2ZB0A 2WXVA 3ULZA 4O0WA 4CZTA 5AUWA 5LJJA 3ZBXA 1ZXEA 5E8VA 3AD6A 1I09A 4WA9A 3D2KA 2R7BA 1OKVA 4EH5A 3WZUA 2XK8A 5K5NA 2XH5A 2C5XA 3KGAA 3UO6A 4PNIA 4G17A 5FXSA 1MUOA 5DT0A 4PTCA 3FHRA 1FMOE 3B8RA 2P2IA 4MXYA 4CCUA 2IZTA 4BWXA 2X4FA 1H0WA 3P7CA 5A6NA 5DYJA 2YCSA 1LPUA 4YZ9A 4YC3A 4GUEA 4JOAA 1YI4A 2WEVA 4YJSA 3R2YA 2RIOA 4W4WA 4B99A 4ZLZA 3G0FA 3VF8A 4RA4A 2C3IB 3UE4A 4I92A 4HVDA 2WTVA 1CKJA 2OXDA 4QNYA 4B0GA 3FQEA 2JDTA 3FUPA 3QQKA 2B0QA 3KB7A 1FQ1B 4MK0A 3VNTA 3DTWA 1JAMA 4R1VA 3O8TA 4O7LA 2H34A 2X1NA 4FT9A 4S31A 5TO8A 3VULA 3ZDIA 5J9LA 1CKPA 2YITA 2I1MA 2VO3A 5CLPA 2W5AA 2FH9A 3HV5A 1R39A 5CU6A 4J96A 3MA3A 1NY3A 4ITJA 4OLIA 4QP6A 2PTKA 3GXLA 4BCMA 1W7HA 4IXPA 3N9XA 3FSKA 1W82A 3QUPA 2HZNA 4Y95A 4GK4A 3PXYA 5CU3A 4C4GA 1SVEA 3G33A 2RFNA 5AP2A 3HRBA 1HCKA 4EH9A 4FKJA 3SOCA 3RPOA 4GUBA 5DBXA 5EQPA 2O3PA 4FX3A 3O7LB 4BZOA 5ETFA 2ZV9A 4TWPA 2OLCA 3KU2A 3PP1A 5DHJA 1OMWA 3HRCA 4BTFA 5AUVA 5HU3A 1UWJA 3ETAA 2C1BA 4FV3A 3FL5A 4AU8A 3QRJA 2IZUA 3I7BA 5CF5A 2C69A 2IW8A 3NR9A 5EW3A 2VNYA 2I40A 5EOBA 3DXQA 2H96A 3WARA 4B9DA 4AW0A 5C8NA 1UNHA 4GT3A 5CSXA 5HE2A 2RSVA 3Q3BA 5CVHA 1ZYDA 3U6IA 2EWAA 4HVIA 4C38A 2YWPA 5J1VA 5CI6A 5AJQA 4H1MA 3ZM9A 4U3YA 4I5CA 5FRIA 4C58A 3OEFX 2J0LA 2OF4A 3LJ2A 4BL1A 4CLIA 1RQQA 3A4PA 3GVUA 3AMYA 3ZXTA 5A4LA 2CNUA 3TNHA 2FSOX 3OD6X 5AM7A 3KA0A 3PYYA 2ITUA 2UUEA 1L8TA 2UVZA 3UG1A 1HCLA 4NSTA 5LMKC 3EN4A 4G16A 2ZV2A 3FZPA 1A9UA 4BFMA 2OIDA 2F7XE 5KCVA 4NW6A 2BRBA 1O6YA 3N51A 4OBQA 4IWQA 2IVSA 4E20A 5BNJA 5TF9A 4AOIA 5HQ0A 2UZEA 4XV9A 1Q61A 2PZRA 4YLKA 4QTAA 1KE9A 3TNWA 2R3GA 3KN6A 4F6WA 3EQDA 4D1XA 2Y7JA 2XK6A 4TYHA 1PKDA 4C2VA 2HWOA 2BRGA 4RC4A 3RCJA 3V8SA 3UZRA 4AN2A 2V62A 4LYNA 3EB0A 4QMZA 1H07A 4L7SA 4RWLA 2XVDA 4RVMA 2FUMA 1YHVA 4EOSA 3JVSA 4AZEA 3PXKA 4ZMEA 3R7YA 4FSMA 1JKTA 2EXEA 3VN9A 4UEUA 2UZUE 4FEVA 2OIQA 2EXMA 3DAJA 5CENA 3ZZWA 1Q24A 3LXKA 4K6ZA 4WNPA 2PHKA 3SAYA 4ANMA 4O22A 4DH8A 3PVWA 4N0SA 1M2QA 3MIYA 4JX7A 4ZTNA 4I3ZA 5HI2A 3R9DA 2WU6A 3CGFA 3FE3A 3LOKA 3D5UA 2JGZA 3IO7A 5CS6A 4M12A 5T3QA 2CGVA 4NEUA 4IW0A 5ANEA 2NNWB 2WTIA 3FLZA 3HA6A 5IA3A 3QU0A 4YJVA 3C4ZA 3QTRA 3SDJA 3ITZA 4FSZA 3DJ6A 1SNXA 5DMZA 5ANGA 2VTIA 4NU1A 5D11A 5L8KA 3JR1A 1PF8A 4H3QA 5I3OA 5LOHA 3TDVA 4BVUA 3F5GA 5LVMA 2UZTA 1PXLA 2UZVA 4QTDA 4V05A 4DGGA 3QTZA 4CFNA 3F88A 2X7OA 4CZUA 1OI9A 2WMAA 3QWKA 4UY9A 4XG6A 2WQEA 2JBOA 1NXKA 4A9YA 3DTCA 4YHFA 5BYYA 2C1AA 4EQMA 2G01A 2EU9A 2PVKA 4GCJA 2ITZA 4EJ7A 5HO7A 4EH3A 2R64A 1H01A 3QF9A 4ORKA 2VWXA 4NZWB 4UBAA 2HELA 4UMRA 1OIUA 2V22A 2BHHA 4GRBA 4I21A 4E8AA 5J5SA 4LGGA 5C1QB 3OZ6A 2DUVA 3EIDA 4PMTA 2IG7A 5H8EA 3V6SA 4X3FC 4FE2A 2RFDA 3NPCA 5LARA 1Q8TA 2JEDA 3NNVA 4HZSA 5DI1A 5CQWA 4F65A 2XBAA 5AR5A 3OCGA 3F2NA 4MVFA 1ND4A 4RC2A 4AW1A 3P86A 3IDCA 2XNGA 4J52A 4QMMA 4WBOA 4L3JA 4BHZA 4DFYA 5AUTA 4TKSA 1NVQA 4CYJA 4AW5A 2QQ7A 4HGTA 4MBIA 4FUYA 3AC4A 3VUTA 5FTOA 3H3CA 4XLVA 5KKRB 3UO5A 4YU2A 4TNBA 4CKIA 3NZ0A 1IA8A 4V04A 4UMPA 4L42A 3VS5A 1GIJA 2PMIA 2YISA 1W98A 2CKPA 2JD5A 3VUKA 4TYIA 3QX4A 5CT0A 1AGWA 3CKWA 4FKVA 5IA4A 3AT2A 3COHA 4XUFA 3R7EA 5DGZA 5L6WL 2UZOA 1O9UA 2KTYA 3T8OA 1UU7A 4QYGA 5CQUA 4QRCA 5CT7A 4EH4A 4IBMA 4DFUA 1XKKA 1B38A 2WFYA 3ZC6A 2QO9A 4XMOA 3IKAA 5BVOA 2WMSA 3VS1A 4CMOA 4LL5A 5EM8A 4QNAA 4PDSA 4BTJA 5CSWA 4HVHA 3NYVA 5IUIA 1FVTA 3I81A 3LJ1A 4FL2A 4MD8E 4QMXA 4OTDA 3R9RA 4Q5EA 3BLHA 2FO0A 3TWJA 2I7QA 2OWBA 5F95A 1OIRA 1ZARA 4WSQA 4AZSA 3PSCA 3RP9A 5L2WA 2IPXA 5DIAA 2GHGA 4GJ3A 4JT3A 5H2UA 5CEMA 4RX7A 3QQHA 2EB2A 3WILA 2UZNA 5C8KA 1OIQA 3ORLA 4GW8A 2R5TA 3FC2A 1GZ8A 1PXIA 2PPQA 5IQCA 3II5A 4O1PA 5AX9A 4EK8A 4EOMA 2C3KA 3L9PA 4QQCA 5HLWA 2HENA 5HTIA 3KF7A 3HAMA 4IADA 1RE8A 3DNEA 4IIRA 1F3MC 3LCKA 4RLKA 4G1WA 4ITIA 4BKJA 5CNOA 4IM2A 5M4UA 4C4JA 4U8ZA 5IQHA 3BLQA 3PSDA 4MKCA 2CDZA 4TY1A 3VBQA 3VQUA 3TUDA 4QMSA 4FEWA 2GSFA 3RK5A 2BROA 4K9YA 3WYXA 4FNYA 4QMWA 1OGUA 2OH4A 4FUXA 3MB6A 2PUPA 3V5LA 2YABA 3FJQE 4P2KA 3BI6A 1ZMWA 2EXCX 2I0YA 2PYWA 4A7CA 3NIZA 4FR4A 2C3LA 5DEWA 3WF9A 5JFWA 4FIIA 3DBCA 4APPA 3PIZA 1Q3WA 2PMNX 2XIKA 4FIGA 2YIXA 1WMKA 2V55A 2HZ0A 3FZ1A 4V0GB 2BDWA 2W1HA 5DLSA 4F7SA 2OJIA 2VTPA 5E8SA 4EUTA 4IX6A 5CU2A 4CFWA 5EYKA 4E6QA 3TG1A 4EOQA 1G8SA 5IEXA 4FA2A 3LM0A 3RNYA 4FG9A 4PNKA 4FNZA 4I22A 2HWPA 4FEXA 4RJ3A 2WMRA 2QOQA 4FV4A 4KABA 4QTBA 2ITYA 3GQLA 5CYIA 3WIGA 3DDPA 2WTCA 3V8WA 3DJ7A 5ICPA 5AFVA 2J51A 1WVYA 3KRWA 3L8VA 4KRDA 4A07A 3I6WA 5IDPA 4CD0A 4IWDA 5F1ZA 1X8BA 4QMOA 2C30A 3FWQA 2YA9A 1RJBA 3AC2A 5J5TA 2R0IA 3A7GA 4XS2A 4K1BA 4F9CA 3HZTA 5DN3A 4LUDA 2YAKA 3QCXA 4F7NA 3ELJA 1YRPA 4ERWA 5J7HA 3N4TA 2WQMA 5D12A 5DFPA 3LKMA 1KSWA 4G5PA 4F6UA 3LMHA 4L68A 5I0BA 3DKOA 3UQCA 2V7OA 5KHXA 1GOLA 4ZZOA 3OVVA 4L7FA 4DT8A 5AR7A 4WOVA 5EKOA 3S1HA 5IISA 4IM0A 4DFNA 4FTIA 2YERA 2ZDTA 2NP8A 5J87A 5DG5A 2ACXA 2QOIA 4O6EA 4OTGA 3VHEA 4WRGA 5HG8A 5JQ5A 5KUPA 2E9PA 3HUBA 5M08A 5FTGA 3U8WA 2F4JA 4D2TA 1XQZA 1LUFA 5HG5A 4GU6A 5TKDA 4UZDA 2ZMCA 5I9YA 3GENA 2B54A 2IJMA 4PTEA 4MEDA 4IVDA 4EYJA 4JIAA 4IMYA 1OUYA 4JDHA 5KO1A 4TYJA 1AD5A 2FVDA 4BC6A 3E3BX 4EH6A 1JOWB 5JFSA 4MWIA 2XNNA 4RVLA 1NA7A 4GKIA 2FB8A 2DS1A 3TACA 1GJOA 4BDBA 4RJ6A 4FKLA 2X0GA 2PL0A 2J9MA 4DFXE 4NM5A 1H00A 1ZYSA 2ZMDA 3LCOA 4I6QA 3OW3A 4KRCA 4BKZA 2XYNA 1GZKA 3BE2A 4FV5A 4WG4A 5K4IA 3PE2A 3WYYA 3Q6UA 1PMVA 4MXXA 3NEWA 4ONAA 4WUNA 1KWPA 4KIOA 4W4XA 3FSFA 4YZBA 5ETAA 3OBGA 4M69B 3NWWA 4DEGA 5AA9A 4KINA 3FBVA 3IQ7A 3QXPA 4ZY4A 5L8LA 2WMVA 3DFAA 3PG3A 5IU2A 1RW8A 1ZOEA 4I94A 3OW4A 1BUHA 5HIDA 5D7AA 4YP8A 4K11A 4LV8A 2ETMA 2NRYA 5HBEA 4JBVA 3RPSA 5AR3A 1UU9A 5A6OA 4II5A 5HBJA 4ZZMA 2JIVA 2VTSA 3VBWA 4DA5A 5IZFA 3WE4A 3I4BA 4O7SA 3LQ5A 3NVKI 2IW9A 1BI7A 3E8EA 3O50A 4NJDA 4TYGA 4I41A 4BDGA 2YZLA 4FZDB 2PWLA 3ALNA 3ORNA 4CSVA 4LL0A 4YO4A 4AGUA 2RFSA 3RPVA 4RJ4A 3MA6A 3FXWA 4DGOA 5JZNA 4C4HA 3F66A 3UBDA 3THBA 3F5XA 3UOJA 2IZRA 3R63A 4FVRA 4WNKA 3I1AA 3K5UA 4ZEGA 4ZY5A 4BYIA 4ACHA 4TXCA 5HVYA 4FV9A 5E1EA 4IAIA 1U5QA 4CMTA 3MYGA 4B6LA 2E9NA 4RIWB 3V04A 2C6MA 2UZLA 2QG7A 5AV4A 2WKMA 3B8QA 2JAVA 1OZ1A 2XB7A 5AM6A 2ITVA 4ARKA 4F63A 2HXQA 3JPVA 2QHMA 4BBFA 4FKPA 3LQ3A 4FSUA 4P5QA 4PDOA 5L8JA 1R0PA 3MVJA 2PMLX 4MF0A 4PRJA 4TPTA 1DS5A 3WZKA 4TL0A 1VJYA 2W5BA 2AC3A 2NRUA 1UVRA 4IB1A 5EHOA 1YDTE 2PZYA 3H0YA 1G5SA 3NW5A 4TYHB 4PMPA 4IZAA 1H1PA 4BDEA 1YOJA 5FGKA 3L1SA 2VAGA 4YJQA 4EK4A 5F9EA 4M97A 3W1FA 4C3RA 4YPSA 3ZBFA 3GP0A 1FBNA 5IA5A 4HPTE 3A60A 3ALOA 1IASA 3V5JA 4G34A 5ANIA 3UP2A 3NDMA 4O0RA 1V0BA 2XK3A 2VUWA 5IG1A 5JGDA 3MVMA 4QD6A 3UVQA 4HVSA 3G15A 2YDJA 2JFMA 1KV1A 4NM0A 5EHLA 5AIKA 3SOAA 3VAPA 3BWFA 3VUGA 4NKAA 4BI1A 4D4VA 1CKIA 1Z57A 3PE1A 3U55A 2WO6A 2R3MA 4JL9A 3RPRA 4U42A 1BL7A 2W17A 1DM2A 3M1SA 3OC1A 3R71A 4ZOGA 4C8BA 5M56A 3TTJA 5HE0A 4TWCA 4JBOA 2ETKA 4MQ1A 5K5XA 2OICA 1PMEA 4JQEA 5EOLA 2J2IB 3R30A 3QZGA 2GS2A 3WZJA 4PY1A 4H36A 3ZLSA 4GIHA 3FMHA 4PMMA 5L4QA 4NIFB 5CAVA 5EDPA 1YI6A 3HNGA 4KS7A 4DEIA 4I24A 4L52A 3FMEA 5CU4A 4FEQA 2W0JA 3I0OA 4EBWA 4FSRA 3FZRA 4LGDA 4O81A 1QCFA 1PXOA 3G9LX 2W9ZB 4U97A 5AIRA 4K33A 4D4YA 5CU0A 1A06A 3TZ7A 3PRFA 5A4QA 5KMMA 4CG8A 3R21A 3ENHA 4R3PA 1XWSA 4XX9A 2XJ1A 4F70A 5HZNA 3H10A 1H28A 1LEZA 3TZ8A 3JY0A 3C0HA 1WBSA 1BX6A 3ZH8A 5A3XA 2J6MA 3LM5A 3ACJA 2XCHA 3M42A 1V0OA 3SQQA 4OT6A 3IW8A 4PPCA 2ITTA 4X3FB 3GFWA 2XF0A 3LZBA 4RWIA 5DH3A 3W8QA 1O6KA 2C5NA 4FTCA 4L9IA 4F7JA 4X6QC 5F4NA 4W8DA 3SX9A 3EQCA 2F49A 2B53A 1APME 3VRYA 1ZMVA 4X6RA 3FKOA 2WZJA 3HMOA 3IG7A 4C57A 2HCKA 1ZOHA 1R78A 4EORA 1BYGA 2CGUA 4ZXTA 3VS2A 4L67A 4K0YA 4MAOA 2XKEA 2OZAB 2PVNA 4JR3A 3E8NA 1IEPA 2EVAA 2XP2A 3GU8A 4RSSA 4OTPA 3UOHA 3UC4A 4ZS4A 3CD8A 4ERKA 3LVPA 4QMYA 2PVFA 3LHJA 1QPCA 2QU5A 4X0MA 4BDHA 3CQWA 2R3FA 3EN7A 5C8MA 2WEIA 3OUNB 4Y8DA 4FL3A 2XS0A 4DGMA 3W2OA 4A06A 3EZRA 5IQGA 5EM7A 4LRKA 1T45A 3D15A 2B55A 4BGGA 4EH8A 3CKXA 2J90A 1GZOA 1IRKA 1ZYCA 3SA0A 1DAWA 4HCVA 4BBMA 4CZYB 1AQ1A 3HDNA 1FVRA 4C3PA 5A4CA 3RM7A 5AAFA 4R5SA 4CV8A 4QP2A 2W06A 5K0KA 5KMJA 1OKYA 4HNFA 5C4LA 5GZ9A 3V6RA 3T3UA 4EZ5A 3A7IA 5EI2A 2VTOA 4O91A 4QMNA 4TYEA 4V0GA 3Q4TA 4E4MA 1OKWA 5CVGA 2UW5A 3WF5A 4EH7A 1JNKA 2JBPA 1H1SA 3DBFA 4EOLA 5ITAA 1J1CA 1OL7A 5HHWA 4ALUA 1ZAOA 2PZ5A 3ZFXA 4ASZA 3OCSA 1OPJA 2ZYBA 2UVXA 5HTBA 3L8SA 4I6HA 2CPKE 1YHWA 4RFZA 3Q5ZA 3R7GA 4FKTA 4QTEA 3Q2JA 4ZSGA 2QLQA 3UPZA 4GVAA 4PUZA 5EH0A 4B8LA 3FZTA 3PTGA 5L3AA 3OY1A 4AZWA 4O0TA 4FKGA 2R3NA 3SHEA 4L46A 4PPAA 4W9WA 1H0VA 4WD5A 3ZONA 5I5ZA 4KS8A 4E4LA 2UW9A 4DCEA 3NNUA 4WHZA 2R9SA 4BDFA 3DK3A 3AC1A 5CF4A 5C4KA 2WU7A 4EHEA 3F82A 2J4ZA 4RQVA 3BE9A 3PVUA 1JWHA 4KSQA 2C6LA 3H9OA 3QHRA 1MRYA 3OTUA 4LI5A 1FPUA 3UOLA 3QA0A 3R22A 4FYOA 5IQDA 3ID6C 3BRBA 2B4SB 2A4LA 3A8WA 3FY0A 4BGQA 1ZYLA 5IQAA 4YLLA 1E1XA 4YNOA 3BYMA 3WF8A 2QONA 3LLTA 4X2NA 3OF0A 3KN5A 4M8TA 5AUYA 3WF6A 2W96B 2PZPA 5DR9A 5J8IA 3GU6A 3KMMA 2VTLA 1W83A 2O0UA 3UMWA 4PX6A 3U54A 4IJPA 2EUFB 5E7RA 5JN2A 1URWA 4K18A 2WMQA 4DC2A 1JSUA 2X7FA 3MH2A 3BHVA 2W1GA 5KZIA 3VRZA 2PY3A 4N6ZA 4QT1A 3FMDA 3UVPA 1M14A 5FBNC 5E8UA 4A9TA 5KMLA 3ZYAA 2WELA 4UB7A 2CNQA 3KMUA 3VIDA 1GIHA 4DEBA 1UV5A 4E5WA 4QTCA 4MXOA 4E73A 4O0XA 4WG5A 5HU9A 5ETIA 3ZLWA 5DVRA 4EEVA 3IOKA 3FC1X 4EHVA 4MWHA 1UU3A 5IUGA 2XIYA 4M68A 2XNMA 4GFOA 3E8DA 3P4KA 4EKLA 3MFRA 2W05A 1QPJA 2XKCA 3POOA 4KNBA 4FNXA 3DK6A 2OXYA 4YURA 5B2MA 2X2KA 3R1NA 1VEBA 1WVWA 5FTQA 3DQWA 3SG9A 4BR3A 3LFAA 3G5DA 3DKGA 4DAWA 4CRLA 2VRXA 4HCTA 3QCSA 4ZSEA 4B7TA 2X6EA 5E8WA 3FI2A 4IX5A 3I7CA 4U45A 4WG3A 1ERKA 3PA5A 4M69A 5LVNA 4IQ6A 3HRFA 2VWUA 4FL1A 4FKIA 3BYOA 4FV0A 3DBEA 3OTVA 5M57A 3IW4A 5IMEA 1Q99A 3RI1A 4F9WA 4E3CA 1E1VA 2BDJA 3MJ2A 4A4OA 5E4HA 1UKHA 2X4ZA 4G6NA 4MQ2A 4EYMA 2GPHA 1Y6AA 4EWHA 5IUHA 3UODA 3O2MA 4PP9A 5BMSA 1URCA 4GU9A 5HNGA 3OWKA 4BRXA 1OUKA 1R1WA 2B9HA 3MFSA 4J98A 4NFMA 2YIWA 4LG4A 4WNMA 5HE3A 4UWBA 3G2FA 5HICA 4UMUA 3BHUA 3S00A 4UV0A 4O0YA 1W0XC 4JR7A 4XCUA 1OBDA 1W84A 4GYIA 4FTLA 3FKLA 3OWJA 4H1JA 4X7QA 4ANLA 2XKFA 5JT2A 3BHHA 4HPUE 5FLFA 5L2QA 2UW0A 3KULB 3GEQA 2JDVA 3QZFA 4ZTHA 4AZVA 5M4IA 2GQRA 2IVUA 3ZRLA 5ANKA 2Z60A 5K3YA 2XNOA 2C6DA 3KVXA 3ZC5A 3EQPA 4IX3A 4FT5A 4FTUA 4RIWA 3AT3A 3EFJA 3FHIA 4UXQA 4D9UA 3TJDA 2UW8A 5HEZA 3QGYA 4S34A 5TR6A 4M14A 2YDKA 2CHLA 3P08A 4ANNA 1ZRZA 5GJGA 3D94A 3HYHA 3SC1A 3Q4ZA 3TV4A 3AD5A 1Q5KA 2QOCA 4DEDA 5LMKA 1TQIA 2V0DA 3K2LA 1FOTA 4Z16A 3NGAA 5HCXA 2QOHA 1M7NA 3ZZEA 4BZDA 3BGQA 3RM6A 2OI4X 5H9BA 5TOZA 3LMIA 1K9AA 4BCIA 3S0OA 4X2GA 3ANQA 4Z7GA 3C5UA 4IC8A 4QPMA 5EW9A 3KXMA 3BU6A 5FM3A 5I3RA 3BKBA 5E8YA 2Z02A 2XM8A 4GS6A 4CXAA 3QRKA 3EFWA 3KK9A 3MGYA 5M55A 4ANOA 4ZZNA 5IQFA 2E2BA 5IA0A 3WBLA 2XIRA 4QMUA 2X8IA 2WMBA 4O7VA 3PSBA 5L2TA 5CEIA 1PXKA 3NYOA 4FSWA 3PZEA 3R7UA 3EQHA 3T3VA 2F2UA 4KIKA 3R7IA 4RX5A 1J7LA 1YXUA 5CF6A 1H1QA 3TM0A 4I5MA 4ZJJA 3FMLA 3NCZA 2PSQA 5E9EA 2A0CX 4FT7A 2ERZE 5BYLA 2EB3A 2WIHA 4PL3A 2BRHA 4ZLOA 3Q32A 4AAAA 4AE6A 3TUBA 1R0EA 1REJA 1H25A 2UW7A 4OTFA 2QURA 3R8PA 3OFMA 3O17A 2VWIA 5C26A 4FMQA 3UNKA 1XHAA 2IO6A 3CCNA 3P1AA 5D10A 3ZS5A 4GT4A 5FUTA 4R7IA 2PVYA 4CRSA 1Y8YA 2VWZA 1E9HA 4BCKA 1KOAA 4MXCA 1YI3A 4MXZA 4NIFA 4Y46A 4CFXA 4L45A 1SZMA 4M66A 5CF8A 3NUXA 4BWPA 3GCVA 4NT4A 5AR8A 3CBLA 4ID7A 4DN5A 3FPMA 3HA8A 1EH4A 3HP2A 4NUSA 3C9WA 1REKA 5CEQA 5AADA 2ZJWA 5BVDA 4BBEA 5DEYA 2Y9QA 4KWPA 5HNIX 2QCSA 5FQDC 1WBOA 2GMXA 4RX8A 3TNPC 3ZRKA 3QGWA 4XV3A 1PW2A 5JFVA 5IF1A 2WQBA 3FXXA 4L8MA 2QLUA 4FV8A 5G6VA 3F3TA 2XZSA 1Y6BA 3ZO1A 4FSQA 3VVHA 3DCVA 2B9JA 2BALA 2XYUA 2Q83A 4E4NA 3C50A 2GFCA 3UZPA 4B8MA 4FOCA 5A46A 3R9HA 1GAGA 1DI8A 4X3FA 5IPJA 2CN8A 3DB8A 3MFTA 3Q2MA 3OT8A 4W8EA 4XV2A 4USDA 2PVMA 2QO7A 2DQ7X 4EOOA 3D4QA 3ZFMA 3PA4A 1QPEA 2YM7A 3SGCA 5JFXA 5HE1A 4XEYA 3VW8A 4FTTA 2QR7A 1RDQE 3ZMMA 3V3VA 4DT9A 2UW4A 2W9FB 4DFZE 5LWMA 2OZAA 5J1WA 5EK7A 1FGKA 2REIA 3AGMA 1NVSA 3PY3A 3DS6A 4O7ZA 3R9NA 3PIYA 3ROCA 4C61A 4O83A 4RFMA 3NW7A 2Y4IC 3V51A 3H9RA 2GNFA 3MY0A 4J7BA 3S2PA 4O7WA 3G6GA 3PXFA 2BRNA 2YN8A 3CLYA 3TXOA 4DEHA 4EHZA 1OL5A 4HGLA 3FAAA 4YC6A 3HDMA 2C0TA 2QR8A 2J50A 3HMPA 3NUPA 5HIEA 4GKHA 2F9GA 1TKIA 2GNLA 2E9UA 4L6QA 4HNIA 4U43A 4FIJA 2XMYA 5KMKA 4BF2A 5JZJA 4DBXA 3MJ1A 4FC0A 1PYXA 3TZ9A 3UIBA 3KXXA 2LGCA 3RAKA 4NL0A 2YEXA 4LUEA 1PYEA 2FSLX 3NAXA 2ITQA 2WOUA 3W2QA 4R3CA 5A9UA 2VU3A 3EQRA 3F5PA 1VYWA 3FYKX 5HLNA 2XRUA 3OG7A 3L9LA 4P5ZA 5G1XA 4RZVA 4TT7A 3IDPA 3HX4A 2BFXA 2CJMA 5HG9A 4U0IA 2BMCA 5HG7A 2XNBA 3PVBA 5JH6A 3D5VA 5CAOA 2HZIA 4MNEA 4Q5HA 3RHKA 1FMKA 4IAKA 3QTXA 4YLJA 4RIOA 3I5ZA 2BDFA 5GIPE 3O51A 3DXPA 5HBHA 1P5EA 3BQRA 4YTHA 5D9HA 4BY9E 3P7AA 3E8CA 1S9IA 4OT5A 2FGIA 1QMZA 4DITA 4DGLC 5AV1A 1S9JA 3RPYA 3DPKA 4E5BA 1OITA 3E87A 4APCA 4BN1A 3Q53A 1QPDA 2X9EA 3OXIA 2WPAA 1H26A 2JDSA 5E8XA 4JAJA 4AGDA 5I9WA 4IE9A 4GL9A 2PVRA 2XM9A 3LCTA 4HYSA 3WI6A 4FEUA 1OKZA 5BVEA 3U9CA 5AEPA 5FP5A 4ENXA 1F5QA 4IZ7A 1XR1A 3NLBA 3R0TA 3R1QA 4FF8A 2PULA 5KBQA 1XH5A 4MD9E 3COKA 4BKYA 3MN3A 1U4DA 3FLYA 4XG9A 5IQBA 3LFBA 4F1OA 3KXGA 2O63A 3RAIA 3GB2A 2RKUA 5HX6A 2CN5A 4UYNA 3KCKA 3TUCA 3PJ2A 2XRWA 5I9VA 1H4LA 2ITXA 5J79A 2J0IA 1FINA 4CQEA 1XO2B 4O0UA 3AQVA 4JG7A 2R7IA 1UA2A 2GNHA 3HP5A 3UGCA 5AP6A 1KUTA 3GCPA 3ATTA 3MH0A 4C35A 2C6IA 5TT7A 3F61A 4DTBA 2Z7RA 1H27A 4AW2A 5JSMA 3DZQA 4K8AA 3HV4A 2VWBA 4FV2A 2NPQA 3BYSA 3SXFA 3W2PA 4BCPA 1Q8WA 4Z3VA 3D2IA 3EYGA 3OCBA 4FIFA 1U46A 5ACKA 5FWKK 5CEKA 1M7QA 1P4FA 4CCBA 3BEAA 2GQGA 4L01A 4CQGA 5KHWA 5B0XA 5FM2A 4KD1A 4Y72A 5AX3A 3AT4A 2UZBA 2JDRA 4CMUA 2WTJA 3H9FA 5EI8A 3JS2A 4QP3A 1ATPE 5JRSA 4CLJA 5HIBA 3O71A 2BZJA 4RRVA 2CLQA 1KE8A 4JS8A 3CJFA 3F7ZA 3W33A 3OEZA 4E1ZA 5ANDA 5CWZA 1YWVA 1YWRA 3DAEA 4H58A 4RIYB 4D2PA 4F0GA 3CE3A 1U54B 3ORMA 3A7JA 3VUHA 4G3EA 3DGKA 3DLZA 5HO6A 2F2CB 3C4FA 1UWHA 4MYGA 4TZRA 4U79A 4XP2A 5L6PA 4FK3A 2O65A 3PXRA 4GT5A 5CVFA 3W2RA 4FSTA 4V01A 4U80A 3DJ5A 5EYDA 3WIKA 3LFCA 1T46A 4KAOA 4ZY6A 4C4IA 4RZWA 2VO6A 2W1IA 2X8DA 1UNGA 2BUJA 3FMNA 3D9VA 3L8PA 4QP7A 2BIYA 4XOYA 4RVTA 5CZIA 3A7HA 2F7EE 1VZOA 4TN6A 2KULA 5J9YA 2H8HA 3A4OX 2OW3A 3DV3A 5M09A 3CQUA 4FOBA 2XNPA 4YZMA 5HGIA 5HLPA 3ZFYA 4G9CA 3ZSHA 5AV0A 3QD4A 1Q41A 2YJRA 2RL5A 4C59A 3DU8A 4QP1A 3CPBA 3FYJX 2UW6A 3NRMA 4YTIA 5M4CA 3PPJA 4S30A 1P14A 5GHVA 4ACGA 1Q3DA 2OO8X 3P79A 5DRDA 4EWQA 3BQCA 3EZVA 3LFFA 4C02A 2YM8A 4BIDA 3SKCA 4KKEA 5LWNA 4QQJA 3L9MA 4ZK5A 4EQUA 3KRRA 3RCDA 4D1ZA 2AUHA 4C62A 3IW7A 3OP5A 4AG8A 3LFDA 3W18A 1WAKA 3KULA 5HKMA 3MV5A 4DGNA 3RINA 4E93A 2G9XA 2PE0A 4UZHA 4ZIMA 4ZLYA 2YDIA 5AV2A 3NX8A 1PMNA 3DY7A 1WCCA 3BWJA 1OBGA 2BCJA 2CGXA 3QTSA 3AC5A 3FZSA 1JQHA 5DR6A 3VS6A 4ASXA 3CSVA 2BFYA 3QRIA 2E9VA 2JKOA 2QOBA 2I6LA 3QXOA 5EM6A 5LVPA 4PDPA 4D2VA 3PP0A 5CZHA 2JFLA 4MXAA 1JLUE 4KKHA 3QD0A 5HTCA 5HNBA 3UP7A 4FI1A 3BEGA 4I1ZA 3GC0A 3IONA 3FV8A 3KY2A 5EQEA 5HOAA 3UOKA 3MTFA 1HOWA 3IW6A 5LMBA 4EL9A 4XYFA 3POZA 1GIIA 2J0KA 3SV0A 2O8YA 1JSTA 3OBJA 2X2LA 3UTOA 5DNRA 3PY1A 4N4SA 4NTSA 1V1KA 5I4NA 4D2SA 2BZKB 3VF9A 1ZY4A 5ETCA 5CNNA 5JGBA 2O64A 3FDNA 3TI1A 4ACMA 4BDCA 2B9FA 4O21A 3DDQA 5CSPA 3GC9A 3ULIA 2W4OA 4LM5A 2GDOA 4IDTA 3DZOA 4LOQA 4DLJA 2YLEA 4TWOA 3QKLA 4O0VA 1ZZLA 4OW8A 5CSHA 1XH7A 3MWUA 2CSNA 2BKZA 3CTHA 3LFNA 3SRVA 4A9SA 1OL6A 3KRXA 4IEBA 4CTBA 2W7XA 4DEEA 5KNJA 3HEGA 5FD2A 4OAVB 4JDIA 4C7TA 1MRVA 3FLSA 4XNEA 4EI4A 5M51A 4GFGA 4USEA 3V5WA 4FKOA 4R7BA 2QVSE 4AQCA 4DTKA 4H3PA 4M3QA 5AMNA 2PMOX 3PIXA 3QLFA 3W10A 1LEWA 2X39A 4OTHA 4EOKA 1YHSA 4XG4A 5AP7A 3MPMA 3P78A 5J9ZA 3KF4A 3BPRA 4D5HA 4R7HA 2WD1A 2BAJA 4E5AX 3R7OA 3ZU7A 4G6LA 3OUKA 3QUEA 5AUXA 4ACDA 4CFMA 2OJ9A 2R3HA 2G15A 4ZAUA 4AFEA 4AN9A 1YXTA 4I5PA 3C4WA 2PVLA 3NCGA 3WOWA 3FL4A 1PHKA 2G2HA 3HUCA 4WSYA 4KIKB 4LFIA 1PKGA 1YDSE 3QBNA 4C37A 5E8ZA 2YJSA 3MPAA 4BGHA 4EK5A 4DH1A 3ORXA 4OTQA 4NCTC 5LCJA 3DAKA 3PA3A 4JVGA 5HO8A 5KBRA 3CP9A 3TKUA 2BTSA 3S3IA 1PRYA 1YQJA 5EYCA 1M2RA 2JKKA 4S2ZA 4BB4A 4K77A 2X7GA 3BBWA 3BLRA 1IG1A 4MH7A 4BCQA 4Z7HA 3ATSA 3R28A 2PE2A 3RALA 2JAMA 4DF3A 2VNWA 4UXLA 5EW8A 4N70A 3M2WA 4FTRA 4PPBA 3LQ8A 4F09A 2QOFA 4FG7A 2QHNA 4U44A 4WRSA 4O84A 4IDVA 4CT1A 2CKOA 3D7TA 2J0JA 1YXSA 2WB8A 1DAYA 4U81A 3TZMA 2GHLA 1OL2A 2R3QA 4FICA 5I9UA 1WBTA 4C0TA 3ZUTA 5BVFA 4ZP5A 1JPAA 4F0IA 2BIKB 5HD7A 2VZ6A 3Q4UA 2O5KA 3PDTA 1B6CB 1LR4A 3DQXA 2GQSA
chains in the Genus database with same CATH superfamily
1H24A 1XJDA 2PUIA 3ZOSA 1K2PA 5I9ZA 4FG8A 3FLNC 2OF2A 4I0TA 3C1XA 2YM3A 2OBJA 4GK2A 3E5AA 4YZNA 3CTQA 2ZV8A 3C4XA 3HMMA 2VTNA 4FZFB 4EK3A 3QA8A 4ZJIA 5LVOA 3W0QA 5AP0A 3AC3A 1Q8YA 3TN8A 3FMKA 2QG5A 4O96A 3ZO3A 3QQJA 4RX9A 5EDRA 5T68A 2C47A 5JK3A 4ENYA 5CAQA 2ITNA 4HCUA 4AOJA 5F20A 3OHTA 4FZ6A 3JY9A 2XNEA 4X2JA 3PJCA 3UO4A 3DXNA 4ITHA 5IEYA 4AT3A 1PXNA 5T6KA 5FP6A 1Y57A 2QODA 2ZOQA 3GCUA 4FV6A 2QI8A 3C51A 3OXZA 4U41A 4D4SA 4ZTLA 4UN0C 3FY2A 1MQBA 3I79A 3U4WA 2YACA 3LFQA 4PP7A 5HORA 2Q0NA 4BDJA 3FLQA 1O6LA 4M0ZA 4CFVA 2G1TA 3FKNA 5C9CA 4JQ7A 3DNDA 3OT3A 3UIUA 2IN6A 1TQPA 4FZ7A 3TKIA 3C0IA 3BV3A 3QTWA 5DWRA 3CR0A 3IS5A 3T9TA 2PU8A 2A2AA 1CTPE 4OUCA 4ASEA 4O7NA 2ZB1A 3NW6A 2BTRA 4GIIA 5DRBA 4PL4A 4BCFA 5M06A 4UMQA 3TNQB 1Q97A 4GFMA 4RT7A 3W0OA 1CSNA 3GU7A 1OECA 3CEKA 2OKRA 4KIQA 4OBPA 2C4GA 5E90A 3FZOA 4PDYA 3ZRMA 4I5HA 4BCGA 3QUDA 4W4VA 3RAWA 4YHJA 4BCOA 2Y0AA 4EZ3A 4IVAA 2JIUA 4ZTMA 1NVRA 3DKFA 3W2SA 3BBTB 2Y6OA 5FEEA 5BVKA 2UZDA 3Q9YA 4FTKA 4O4FA 1L3RE 2GHMA 2C6KA 4FKRA 5DA3A 5H8BA 4U6RA 1H1RA 1M2PA 3OROA 2A98A 4YR8A 1OPKA 2C6TA 4AACA 4YMJA 1IA9A 4J8NA 3D14A 3PY0A 5D1JA 4LOOA 4RQKA 2PVJA 3R04A 4MNEB 3CY2A 3ORIA 3IDBA 2AYPA 4F9AA 3E62A 3CGOA 5C01A 4C34A 2HZ4A 4RGJA 4G3DA 3ODYX 2VD5A 3QQGA 3MY1A 4IAYA 4DG0E 1A48A 2GU8A 3MSSA 3KK8A 3LCDA 3I5NA 4C33A 3A7FA 5IH5A 4A4LA 3KRLA 3QZHA 3HV3A 3PWDA 5DR2A 4FKUA 5HCZA 2BAQA 5KE0A 4GJ2A 3EOCA 3GOPA 3R8LA 2HW6A 1V0PA 2W1DA 2XAMA 3QWJA 5EHYA 5EG3A 5DE2A 4RIYA 4IB0A 2RFEA 5H8GA 2WAJA 3VBXA 1U54A 4KA3A 4LGHA 3ORPA 2HIWA 3JUHA 4RPVA 4WNOA 4Y5HA 3UQGA 4NW5A 3GC7A 1XBCA 1YXVA 4Y85A 1YKRA 3VBTA 3COIA 4IWOA 4RJ5A 5LQFA 2P2HA 3RK7A 4FKWA 5EDQA 3T9IA 1MRUA 1WBVA 3B2WA 3D0EA 3Q5IA 4GK3A 1U59A 4JBQA 2XIXA 5CX9A 4KB8A 2VWWA 1VYZA 4JG6A 3MBLA 3O96A 4M84A 5E91A 1P2AA 3JXWA 4XG8A 4X21A 1I44A 3BGZA 3PJ3A 3PFQA 2WHBA 4XG3A 3ZXZA 5IQEA 2NO3A 3ZUVA 3PZHA 4R78A 3LMGA 4QO9A 4ANSA 2GTNA 4C4EA 3CD3A 3NNXA 3QQLA 4BYJA 3KVWA 4O86A 3P7BA 4KBAA 4G3CA 3TEIA 3MESA 3UZTA 4M13A 2O2UA 2DYLA 3AMAA 3U87A 3RWQA 1YDRE 3U4UA 2BHEA 5AUZA 3QTUA 4I93A 3AGLA 5BMMA 2VV9A 1XBBA 2WTKC 3FI4A 3ZSIA 1IR3A 1UNLA 2HK5A 3OS3A 3EKKA 4DEAA 2C6EA 4FTMA 3VS3A 2VWYA 3D7ZA 4EOJA 4EZ7A 5HESA 4UWCA 5JGAA 4O7TA 2Z7SA 1DI9A 4AFJA 5HCYA 3W55A 5IMXA 4U40A 4F9BA 3C5IA 3EN6A 3MVLA 4QYYA 2VTJA 2GS6A 5LCKA 4JI9A 2ERKA 4IZYA 2QO2A 4USFA 3FQSA 5M4FA 4YHTA 3C13A 3BHYA 4QYHA 3TV7A 3UDBA 5JRQA 2WTDA 5KX8A 4M7IA 4O1OA 2P3GX 2W5HA 4QP9A 3V5QA 3D83A 3DT1A 4IANA 4IHPA 5EYMA 5JQ8A 1UU8A 5CI7A 1J3HA 1OL1A 2PUNA 3ORTA 1SM2A 2ZVAA 4AT5A 5AAGA 3MB7A 2FYSA 4FBXA 4TWNA 4U9AA 5AUUA 4BI2A 3DKCA 1R3CA 3G6HA 4XBRA 4BDIA 3UQFA 3LPBA 3CQEA 3HV7A 4TW9A 1J7UA 5E1SA 4EK6A 4NM7A 1WZYA 2P0CA 3SLSA 3NVMB 3SW4A 3BELA 2ONLC 3KXNA 4EOIA 2GCDA 2JKQA 4MNFA 3VQHA 3LXNA 3CC6A 5FXRA 3F3VA 3MI9A 5BUJA 2ONLA 5DT3A 2JITA 5FDPA 2YIRA 1CDKA 1XH6A 2P55A 4QP8A 4BDAA 5CY3A 3SD0A 4M0YA 4RIXA 4X2FA 1OM1A 4B4LA 3EJ1A 4NH1A 3COMA 3ANRA 2HYYA 5LXMA 5IEVA 2XK4A 2ZM3A 4RA5A 3VW6A 4DLIA 4R8QA 1IAHA 2XK9A 2ZAZA 3PXQA 2OG8A 2OK1A 3Q52A 4QMLA 3I60A 3VJNA 2XKDA 2WQOA 2JKMA 4KBCA 4PMSA 2YCFA 3OCTA 4RG0A 1G8JA 1JSVA 4DG2E 1PY5A 2PUUA 4YUQA 4FIEA 2OIBA 2ZV7A 1SYKA 3QQFA 3IK3A 5C03A 4MF1A 3KRJA 4R5YA 1ZY5A 2R3PA 4PTGA 3TV6A 4AGCA 4DHFA 2QU6A 1JVPP 3WF7A 3RKBA 4A4XA 4AA0A 2W99B 2VTTA 2BKKA 4NFNA 2UZWE 3RZFA 4FIHA 4LMUA 1KE5A 4AX8A 3NUAA 4ZTRA 2UVYA 4JXFA 4NYEA 4J97A 5A4TA 4S33A 1YOMA 2YZAA 5GZ8A 3TJCA 3CIKA 4TTHB 4E7WA 4DG3E 4IWPA 5D7VA 5HD4A 5AP3A 2I0HA 3ZM4A 3RNIA 4EBVA 4I4EA 1ZLTA 2B52A 4YBJA 4YJUA 4E6AA 4GSBA 2YIYA 3AC8A 4FSYA 2Z8CA 3R83A 3RGFA 4ZTSA 3SRVB 4EKKA 2I0EA 3HAVA 4YZCA 4AGWA 4OR5A 3C0GA 4ZMFA 2R3RA 2OZOA 4J99A 3GQIA 3ZSGA 2PZIA 4XV1A 3F6XA 4J71A 1SVGA 4P7EA 4EC9A 4NK9A 3RK9A 3KXZA 3SW7A 2VX0A 4JDJA 4HYUA 5AA8A 3R02A 4YTCA 3BLAA 3MVHA 3QFVA 1NW1A 4GVJA 3TT0A 5CAUA 4P4CA 3TL8A 3LAUA 4CYIA 4FTJA 2LAVA 3VJOA 2WIPA 3NSZA 5E92A 4CEGA 5CXHA 4EH2A 4EONA 2ETRA 2CMWA 4G9RA 2CKQA 3EN5A 4XP0A 1WBWA 3R1SA 1ZZ2A 4FVQA 3FMMA 4BHNA 4ZS0A 1ST4A 4Q2AA 4LOPA 3MY5A 3EYHA 5K9IA 3BZ3A 3OOGA 2F7ZE 5DT4A 5LMAA 3TKHA 1Q4LA 5J95A 3DLSA 4CT2A 3W2CA 1ZYJA 4ALWA 4HVGA 2PE1A 3OOMA 3QRUA 4FZAB 2QKWB 3QTIA 2BRMA 3CY3A 4YO6A 3NYNA 3FLWA 2W1EA 5EKNA 3RVGA 5TE0A 4DE4A 4YNEA 3RWPA 1CMKE 2Y4PA 2ZDUA 2C5YA 4G5JA 4O27B 3AD4A 3E64A 3E93A 3GGFA 3IGGA 3D7TB 3EH9A 1H08A 3O23A 4QYFA 4D58A 1WFCA 4BI0A 1VR2A 2XA4A 3EWHA 3MTLA 1ZWSA 3LE6A 4O7YA 3E3PA 2JDOA 4U3ZA 3K54A 4E4XA 4U7ZA 4IM3A 4QMPA 3EN9A 2C68A 4H39A 2QOOA 3U6HA 3MPTA 5EFQA 1Y8GA 3W16A 4FGRA 3QKMA 2ZM1A 3O8PA 4PF4A 3FI3A 5L2IA 3LCSA 3NAYA 4YC8A 2P33A 2XJ0A 3IGOA 2VTQA 4XG7A 5IDNA 3GFEA 4JX3A 3BX5A 4A9UA 5KMNA 1H1WA 3U6JA 4MBJA 3UMXA 2C5OA 5K4JA 5CEPA 3NIEA 4DTAA 1H8FA 1BKXA 2X8EA 2FA2A 3PG1A 1JKKA 2YLFA 2VGOA 2GFSA 2CLXA 3HGKA 3KL8A 1GZNA 1OVEA 2QD9A 3C4EA 1YXXA 3S95A 5GJDA 1J1BA 3VBVA 3GT8A 3TIZA 4LRJA 3ZEPA 3ZO4A 2W1CA 3FI8A 3KMWA 3H30A 3O0GA 3ROYA 3KFAA 5AR2A 3N4VA 1PXPA 2GNGA 3GU4A 2CCHA 3H4JA 3PRIA 3NYXA 3GUBA 3OWPA 3G0EA 1BMKA 1KE6A 3WE8A 5B2KA 2YM6A 1YW2A 4D2WA 4AUAA 2J5EA 4L3PA 2YAAA 2Z7LA 4QPSA 5CSVA 5GZAA 5A4EA 2VTRA 2W4JA 4D9TA 3NNWA 3TMOA 3QCQA 2R4BA 4HW7A 4WT6A 2BZHB 5HVJA 2ITWA 4KKGA 1XMMA 4I20A 3RZBA 2P4IA 1CM8A 2ESMA 3HVCA 3LFEA 4LQMA 3KC3A 3F5UA 2CCIA 1KV2A 1QL6A 2Q0BA 2R3LA 3BCEA 5FBOA 4J1RA 2X9FA 4JJRA 4PL5A 4N57A 4EUUA 4OAUC 4O6LA 4RMZA 3WZEA 4D28A 2H6DA 5JKGA 2A1AB 3S4QA 4IJ9A 2C0OA 3N4UA 4IX4A 5CASA 5GIOE 2CKEA 2OGVA 4BTKA 4C2WA 3PWYA 4L00A 3BYUA 4BTMA 3F9NA 2C6OA 4IH8A 5GJFA 5GNKA 4EOPA 3PUPA 4PWNA 2XCKA 2QOKA 3H0ZA 5BUEA 3R8UA 3KEXA 2F57A 4FKSA 5EI6A 4O7RA 3DK7A 4GEOA 2GTMA 1OPLA 4OBOA 3RTPA 2QKRA 4HGSA 3ZHPC 3FXZA 3QX2A 3CS9A 5AP5A 4FT0A 4IVBA 1WVXA 4JRNA 1NT2A 3HLLA 4AXFA 4LDTA 3E88A 2G2IA 1Q62A 4PV0A 1XH9A 2IVTA 3R6XA 3ZLYA 5FEQA 4L43A 1STCE 4XH6A 3ORZA 5C27A 3F2RA 4MHAA 4QQ5A 1JKSA 2XEZA 5L6OA 3QD3A 2X6DA 1BI8A 3GNIB 3KCFA 5FXQA 2PVHA 3MH1A 4C4FA 4AT4A 3QYZA 4DH7A 4NKSA 4JLCA 4AA4A 4AE9A 1G8AA 3GI3A 2BAKA 2J7TA 3FQHA 3MFUA 3MS9A 1BL6A 3MH3A 1P4OA 1WBNA 4J95A 4Q9SA 3HKOA 4FNWA 4AXAA 3UYSA 2GNJA 3FEGA 5EM5A 4P90A 4XRJA 4AA5A 1U5RA 5DPVA 4EC8A 5J7BA 3QC9A 3VHKA 5EQYA 4EHGA 2UV2A 3D5XA 3UC3A 4CV9A 4DCAA 5A54A 3F7WA 3NMUF 2YIQA 3A99A 2QC6A 5AP1A 5IA1A 2VTHA 2JC6A 4H05A 2WMWA 3TDWA 1F0QA 4NJ3A 4CGAA 3LXLA 4CFUA 4G31A 5AWMA 3QHWA 3O7LD 3M11A 3WZDA 4C3FA 5CEOA 1B39A 3KXHA 3R01A 4QP4A 3EMGA 3ODZX 3Q9XA 3VBYA 4AZFA 5CALA 3CPCA 4CNHA 4UALA 4R3RA 4JRVA 2B9IA 2VX3A 4OTIA 2WMUA 4YGAA 4F1MA 4F99A 4MD7E 4D1SA 4AXCA 3F69A 4ZSLA 4IVCA 1M52A 3VS0A 3C4CA 3VS4A 4L44A 5ANJA 4FKQA 4TNDA 4X2KA 4UMTA 4G2FA 4ZTQA 5IH6A 3QQUA 5CANA 2XK7A 4RLLA 2XAOA 1Q8ZA 3BIZA 4BIBA 5AP4A 5IA2A 3QD2B 2VTMA 3VO3A 1SMHA 5BVWA 5M53A 4UX9A 4JAIA 3AXWA 5AAEA 2BR1A 2R3KA 1TFFA 4O4DA 4Q9ZA 3SG8A 3EKNA 2RG6A 3BV2A 4DINA 3E63A 2WTKB 4G3FA 4MCVA 4HGEA 2J5FA 4R1YA 3ZDUA 3Q9WA 3Q04A 2AC5A 3HV6A 3R7VA 3W32A 5CXZA 2R2PA 4O0SA 2HY0A 4HJOA 4G6OA 3BYVA 4TRLA 4LRMA 4DH5A 4YJNA 5IH4A 3HMIA 1PMUA 3A2CA 3IW5A 4FK6A 3RAHA 2UW3A 2W4KA 1PJKA 3QKKA 4IAFA 2IF8A 5KZ0A 4FVPA 1GNGA 4XRLA 3NS9A 4AS0A 4CG9A 3LW0A 2VWVA 3UJGA 4U5JA 3PXZA 3ERKA 4I4FA 4UYAA 1LP4A 1UKIA 3AOXA 2HY81 5K0XA 4Z9LA 3VC4A 3PPZA 3C7QA 4FTQA 4CFFA 4Y83A 4QYEA 3OMVA 2YM5A 3UVRA 4FV1A 3REPA 2V7AA 4XHKB 4FTAA 3TCPA 4BZNA 3VUMA 3K3JA 5HVKA 3IECA 3ENMA 4DFBA 5IQIA 3R8ZA 4DH3A 3LIJA 2VX1A 4D55A 1YVJA 4BWKA 3K5VA 2BVAA 4RC3A 3UG2A 3ZO2A 2R0UA 4QMTA 4D0XA 4D0WA 4E6CA 4H3BA 3CTJA 3GC8A 4QPAA 4MBLA 2XEYA 3P9JA 3FPQA 5JMSA 3ZEWA 2VGPA 5AV3A 4AOTA 3BHTA 3I0QA 2QOLA 2W1ZA 3IPHA 4IZ5A 4RIXB 3F3WA 2B7AA 4DYMA 2WTWA 3VWAA 4QOXA 3ZTXA 5ACBC 2R3JA 2IWIA 2YFXA 4QMVA 2R3IA 2Z7QA 4I0RA 4LV5A 4GG7A 4IFCA 3LLAA 2HOGA 4FV7A 4PQNA 4O4CA 4IAAA 3CXWA 4F08A 4EQCA 4FSNA 3DA6A 5KMIA 4ZSAA 2BPMA 3E7OA 2WQNA 2Y8OA 2IVVA 4LMNA 4S32A 4BCJA 4BIEA 1GY3A 2CGWA 4YSMA 4XJ0A 4NWMA 1JKLA 2R3OA 4Y73A 3V01A 4YZDA 5FG8A 1Z9XA 3KQ7A 4ZJVA 3BU3A 3V5PA 4E6DA 2A27A 3QCYA 3JVRA 4KSPA 4WIHA 2I0VA 4RWJA 3W8LA 1KE7A 4Z55A 4GMYA 3PJ1A 3HL7A 4DBNA 3SVVA 3V5TA 3UNJA 2RG5A 3P0MA 3EL8A 1OB3A 5CAPA 1MP8A 5KMOA 3BGPA 4YPDA 4Y5QA 3L9NA 1XH4A 2ZFYA 4GH2A 5BUIA 1YWNA 1Q8UA 2WMXA 2HW7A 3PLSA 4O82A 3R00A 4HYIA 1M17A 2B1PA 4JQ8A 3UNZA 1ZMUA 3BU5A 2XALA 3RHXA 4BCNA 2C0IA 3R2BA 4RWKA 3A8XA 1J91A 2YCRA 2IW6A 4NCTA 4F6SA 4YJPA 3K3IA 2YCQA 3IOPA 4WUAA 2Z2WA 3F3UA 3SXSA 5AR4A 3NUUA 4GG5A 4FT3A 4YBKA 1W2DA 5BYZA 4ALVA 2PK9A 5FEDA 4D5KA 2WOTA 3OXTA 5D41A 1FGIA 2X81A 4OTWA 4UWYA 4QMQA 1K3AA 1FVVA 4N6YA 3QYWA 2DWBA 3GBZA 4IACA 3PVGA 4I6FA 5BPYA 5GINE 3UYTA 1OIYA 3EFLA 2HXLA 5IKWA 5ANOA 1WBPA 3U51A 4YTFA 1YOLA 4O38A 2W1FA 2X2MA 4L53A 4CKRA 4F9YA 2OXXA 3VUIA 2H9VA 4M67A 3OY3A 4JDKA 4OGRA 3W0SA 2VO7A 3QAME 3TNIA 2FSTX 3LFSA 4AF3A 4DHIB 3NUNA 2ITOA 3QZIA 3P5KA 4RFYA 3RMFA 1TQMA 4O2ZA 2X0QA 2OJFE 5KKRC 3DB6A 5H3QA 3DOGA 1IAJA 3ACKA 3VS7A 2OJJA 1J7IA 3EQFA 4LV7A 2FSMX 2JIIA 3LJ0A 2C5VA 5B7VA 5LVLA 4R6VA 4RBLA 4XBUA 2RF9A 2WGJA 3D5WA 4XOZA 4A9RA 4AWIA 4K2RA 4CTCA 4YJRA 2VO0A 2WMTA 4EJNA 4YJTA 2C3JA 3W0RA 4WKQA 2XJ2A 4OTRA 4F4PA 3I6UA 3PPKA 4ANBA 1XH8A 4I0SA 5M07A 5BVNA 4NTTA 4M15A 3DFCB 4JG8A 1ZOGA 4FYNA 5M44A 3UDTA 3HECA 3QRTA 4IC7A 2VN9A 2OJGA 2QNJA 3L8XA 4HYHA 4BDDA 3JYAA 3KKVA 2A19B 5A14A 4IB3A 4KIPA 2XBJA 2RGPA 3DBQA 3Q4CA 1SNUA 4HOKA 5B2LA 4RJ8A 1MQ4A 4J8MA 4GYGA 4ANQA 2BZIB 1KOBA 1Y91A 2CNVA 3V8TA 3A62A 3P5JC 4FTOA 2Y4IB 2V5QA 1PXMA 1PXJA 3NUSA 4ACCA 2XUUA 5I9XA 1BLXA 2ZM4A 5CTPA 2JLDA 3ZLXA 3EL7A 3G9NA 3Q96A 3UPXA 3F2AA 2OSCA 3QALE 4F7LA 3LXPA 4CVAA 3QTQA 2SRCA 4R77A 3R73A 3EFKA 4D2RA 4AP7A 3HMNA 4ZSJA 5L2SA 3GOKA 4BDKA 4AN3A 5HX8A 2GNIA 4W9XA 2HAKA 3QC4A 3TIYA 4JBPA 3R8MA 3ZUUA 3E92A 3E7VA 3TTIA 4F1TA 3GU5A 3OWLA 5JEBA 1W8CA 5BX0A 3DBDA 2XIZA 4JIKA 2IZSA 4I6BA 3AMBA 3VUDA 1XBAA 2GS7A 3QL8A 4KBKA 4IFGA 4JNWA 4FODA 4DFLA 4CKJA 1TVOA 2OU7A 2OH0E 3MDYA 3ZCLA 4FGBA 4NM3A 3RBWA 4YJOA 4W4YA 3ET7A 3Q9ZA 4KUJA 3R8VA 4BICA 2OFUA 3EHAA 4BJJB 3PJ8A 4RVKA 2BILB 2AEGA 3GCQA 4MTAA 4WO5A 3GCSA 3SXRA 3ORKA 3AG9A 4XLIA 3G51A 3RJCA 3R9OA 4WBBB 2YHVA 3UIXA 4QQTA 3UIMA 3Q60A 4F64A 1Z5MA 4C36A 3NUYA 3EQGA 3PLAE 3G90X 4ASDA 4E26A 4G3GA 2OFVA 5FDXA 3Q6WA 4FTNA 1G3NA 1W2CA 2WNTA 4GV1A 3NFFB 2J0MB 2E9OA 4IB5A 4HZRA 4MX9A 3R1YA 3FMJA 3EQBA 3O8UA 4BCHA 2ITPA 4AZTA 3MIAA 3QLGA 4YSJA 3P23A 5E8TA 2VTAA 1JBPE 3A61A 2Y6MA 3EQIA 2G2FA 4IAZA 4L3LA 5DOSA 2YWVA 4O2PA 5BQ0A 3B2TA 4XP3A 2YM4A 3CJGA 4XG2A 4F0FA 4I23A 3U9NA 1SVHA 5F94A 3KREA 4AQKA 3F3ZA 3MW1A 4RJ7A 3W0NA 4D4RA 4J53A 4X3JA 2ZB0A 2WXVA 3ULZA 4O0WA 4CZTA 5AUWA 5LJJA 3ZBXA 1ZXEA 5E8VA 3AD6A 1I09A 4WA9A 3D2KA 2R7BA 1OKVA 4EH5A 3WZUA 2XK8A 5K5NA 2XH5A 2C5XA 3KGAA 3UO6A 4O4BB 4PNIA 4G17A 5FXSA 1MUOA 5DT0A 4PTCA 3FHRA 1FMOE 3B8RA 2P2IA 4MXYA 4CCUA 2IZTA 4BWXA 2X4FA 1H0WA 3P7CA 5A6NA 5DYJA 2YCSA 1LPUA 4YZ9A 4YC3A 4GUEA 4JOAA 1YI4A 2WEVA 4YJSA 3R2YA 2RIOA 4W4WA 4B99A 4ZLZA 3G0FA 3PFYA 3VF8A 4RA4A 2C3IB 3UE4A 4I92A 4HVDA 2WTVA 1CKJA 2OXDA 4QNYA 4B0GA 3FQEA 2JDTA 3FUPA 3QQKA 2B0QA 3KB7A 1FQ1B 4MK0A 3VNTA 3DTWA 1JAMA 4R1VA 3O8TA 4O7LA 2H34A 2X1NA 4FT9A 4S31A 5TO8A 3VULA 3ZDIA 5J9LA 1CKPA 2YITA 2I1MA 2VO3A 5CLPA 2W5AA 2FH9A 3HV5A 1R39A 5CU6A 4J96A 3MA3A 1NY3A 4ITJA 4OLIA 4QP6A 2PTKA 3GXLA 4BCMA 1W7HA 4IXPA 3N9XA 3FSKA 1W82A 3QUPA 2HZNA 4Y95A 4GK4A 3PXYA 5CU3A 4C4GA 1SVEA 3G33A 2RFNA 5AP2A 3HRBA 1HCKA 4EH9A 4FKJA 3SOCA 3RPOA 4GUBA 5DBXA 5EQPA 2O3PA 4FX3A 3O7LB 4BZOA 5ETFA 2ZV9A 4TWPA 2OLCA 3KU2A 3PP1A 5DHJA 1OMWA 3HRCA 4BTFA 5AUVA 5HU3A 1UWJA 3ETAA 2C1BA 4FV3A 3FL5A 4AU8A 3QRJA 4AXEA 2IZUA 3I7BA 5CF5A 2C69A 2IW8A 3NR9A 5EW3A 2VNYA 2I40A 5EOBA 3DXQA 2H96A 3WARA 4B9DA 4AW0A 5C8NA 1UNHA 4GT3A 5CSXA 5HE2A 2RSVA 3Q3BA 5CVHA 1ZYDA 3U6IA 2EWAA 4HVIA 4C38A 1ST0A 2YWPA 5J1VA 5CI6A 5AJQA 4H1MA 3ZM9A 4U3YA 4I5CA 3AKJA 5FRIA 4C58A 3OEFX 2J0LA 2OF4A 3LJ2A 4BL1A 4CLIA 1RQQA 3A4PA 3GVUA 3AMYA 3ZXTA 5A4LA 2CNUA 3TNHA 2FSOX 3OD6X 5AM7A 3KA0A 3PYYA 2ITUA 2UUEA 1L8TA 2UVZA 3UG1A 1HCLA 4NSTA 1OGYA 5LMKC 3EN4A 4G16A 2ZV2A 3FZPA 1A9UA 4BFMA 4JMQA 2OIDA 2F7XE 5KCVA 4NW6A 2BRBA 1O6YA 3N51A 4OBQA 4IWQA 2IVSA 4E20A 5BNJA 5TF9A 4AOIA 5HQ0A 2UZEA 4XV9A 1Q61A 2PZRA 4YLKA 4QTAA 1KE9A 3TNWA 2R3GA 3KN6A 4F6WA 3EQDA 4D1XA 2Y7JA 2XK6A 4TYHA 1PKDA 4C2VA 2HWOA 2BRGA 4RC4A 3RCJA 3V8SA 3UZRA 4AN2A 2V62A 4LYNA 3EB0A 4QMZA 1H07A 4L7SA 4RWLA 2XVDA 4RVMA 2FUMA 1YHVA 4EOSA 3JVSA 4AZEA 3PXKA 4ZMEA 3R7YA 4FSMA 1JKTA 2EXEA 3VN9A 4UEUA 2UZUE 4FEVA 2OIQA 2EXMA 3DAJA 5CENA 3ZZWA 1Q24A 3LXKA 4K6ZA 4WNPA 2PHKA 3SAYA 4ANMA 4O22A 4DH8A 3PVWA 4N0SA 1M2QA 3MIYA 4JX7A 4ZTNA 4I3ZA 5HI2A 3R9DA 4AAYA 2WU6A 3CGFA 3FE3A 3LOKA 3D5UA 2JGZA 3IO7A 5CS6A 4M12A 5T3QA 2CGVA 4NEUA 4IW0A 5ANEA 2NNWB 2WTIA 3FLZA 3HA6A 5IA3A 3QU0A 4YJVA 3C4ZA 3QTRA 3SDJA 3ITZA 4FSZA 3DJ6A 1SNXA 5DMZA 5ANGA 2VTIA 4NU1A 5D11A 5L8KA 3JR1A 1PF8A 4H3QA 5I3OA 5LOHA 3TDVA 4BVUA 3F5GA 5LVMA 2UZTA 1PXLA 2UZVA 4QTDA 4V05A 4DGGA 3QTZA 4CFNA 3F88A 2X7OA 4CZUA 1OI9A 2WMAA 3QWKA 4UY9A 4XG6A 2WQEA 2JBOA 1NXKA 4A9YA 3DTCA 4YHFA 5BYYA 2C1AA 4EQMA 2G01A 2EU9A 2PVKA 4GCJA 2ITZA 4EJ7A 5HO7A 4EH3A 2R64A 1H01A 3QF9A 4ORKA 2VWXA 4NZWB 4UBAA 2HELA 4UMRA 1OIUA 2V22A 2BHHA 4GRBA 4I21A 4E8AA 5J5SA 4LGGA 5C1QB 3OZ6A 2DUVA 3EIDA 4PMTA 2IG7A 5H8EA 3V6SA 4X3FC 4FE2A 2RFDA 3NPCA 5LARA 1Q8TA 2JEDA 3NNVA 4HZSA 5DI1A 5CQWA 4F65A 2XBAA 5AR5A 5BV3A 3OCGA 3F2NA 4MVFA 1ND4A 4RC2A 4AW1A 3P86A 3IDCA 2XNGA 4J52A 4QMMA 4WBOA 4L3JA 4BHZA 4DFYA 5AUTA 4TKSA 1NVQA 4CYJA 4AW5A 2QQ7A 4HGTA 4MBIA 4FUYA 3AC4A 3VUTA 5FTOA 3H3CA 4XLVA 5KKRB 3UO5A 4YU2A 4TNBA 4CKIA 4I6LA 3NZ0A 1IA8A 4V04A 4UMPA 4L42A 3VS5A 1GIJA 2PMIA 2YISA 1W98A 2CKPA 2JD5A 3VUKA 2XARA 4TYIA 3QX4A 5CT0A 1AGWA 3CKWA 4FKVA 5IA4A 3AT2A 3COHA 4XUFA 3R7EA 5DGZA 5L6WL 2UZOA 4AXDA 1O9UA