4FVPA

Crystal structure of the jak2 pseudokinase domain (apo form)
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
274
structure length
274
Chain Sequence
VFHKIRNEDLIFNESLGQGTFTKIFKGVRREVGDYGQLHETEVLLKVLDKAHRNYSESFFEAASMMSKLSHKHLVLNYGVCVCGDENILVQEFVKFGSLDTYLKKNKNCINILWKLEVAKQLAAAMHFLEENTLIHGNVCAKNILLIREEDRKTGNPPFIKLSDPGISITVLPKDILQERIPWVPPECIENPKNLNLATDKWSFGTTLWEICSGGDKPLSALDSQRKLQFYEDRHQLPAPKAAELANLINNCMDYEPDHRPSFRAIIRDLNSLF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords Tyrosine-protein kinase JAK2
publication title Crystal structures of the JAK2 pseudokinase domain and the pathogenic mutant V617F.
pubmed doi rcsb
source organism Homo sapiens
total genus 86
structure length 274
sequence length 274
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2012-06-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4fvpA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4fvpA01
4XG9A 2YFXA 4AZTA 5BMSA 4LRJA 4UZDA 2BAQA 4L43A 3VC4A 1YXSA 2JKQA 4NM5A 4Q5HA 4GUEA 5EQEA 2UZLA 3R0TA 2QOKA 1JKKA 1KUTA 3BHVA 1XBCA 3FMMA 3NZ0A 3RAWA 3LLAA 1PXOA 3W16A 2LAVA 3FMLA 2OH0E 3BWFA 4EK8A 1NW1A 4IDVA 4QMNA 1LR4A 4PL3A 2NNWB 3EFLA 1OUYA 4AW2A 4HPTE 2JGZA 3IW4A 5TKDA 3R8VA 4R3CA 3VO3A 1JWHA 3AT2A 1BMKA 1MP8A 4TKSA 4BIBA 4XP0A 4CT2A 3QTUA 1EH4A 5D7VA 3DU8A 3NEWA 4E4MA 4IWPA 3GU4A 5M44A 1OM1A 3GFWA 5JMSA 3RK5A 4E4LA 2HWPA 2R3LA 1OVEA 4WD5A 3QZIA 2EXMA 5AAGA 3PLSA 2PPQA 3Q60A 3UVQA 3THBA 1YWNA 2UZBA 5M57A 4QO9A 4AZSA 1WBVA 4IX4A 1H26A 4N6YA 4B9DA 4DEEA 1MRVA 2RF9A 3BBWA 3PJ2A 3GUBA 2J0MB 1CDKA 4KKGA 4ERWA 3EQHA 3LLTA 5D7AA 2C6DA 3VWAA 4UYAA 4DFUA 5IQCA 1CSNA 4AOJA 4C3FA 2IN6A 4J8MA 2PMOX 3F5XA 3AG9A 2Y9QA 4XRLA 4FV5A 4FE2A 4D1SA 4IVCA 4QTCA 3ZOSA 4ALVA 3QRJA 4BDCA 2YAAA 5KX8A 1J91A 1G3NA 2QG7A 5D9HA 5CU3A 3LJ1A 2V7AA 3P7BA 4G3DA 3PSCA 4EQCA 3FWQA 4FSMA 4LGHA 2XYNA 3FPMA 3ZH8A 1G8SA 5EDPA 3BV2A 2VO0A 3RPOA 1OIQA 4EC9A 5IDPA 4EBWA 4PQNA 5HO6A 4AT5A 4ACHA 4U44A 1OL6A 4L42A 3CTQA 4PMSA 2I0HA 4YNOA 5IA2A 3DK3A 4RIWB 5AJQA 4XHKB 5JFXA 5ITAA 4EQMA 3R04A 1M52A 3CLYA 4BB4A 1IRKA 2XBAA 3D2IA 1WCCA 4MX9A 4WIHA 5CT7A 3E8EA 4GV1A 3UJGA 4C7TA 4UXQA 2B53A 3QD2B 5CAOA 3DNDA 3KGAA 4O7WA 3RJCA 2OFUA 2AYPA 2W1DA 3DGKA 3HP2A 4G5JA 2A4LA 3ZFMA 2C3KA 1GIHA 4DGLC 4USFA 5HG5A 3RNYA 2CGUA 3HNGA 4RFZA 4YZ9A 5K0KA 4CKRA 2BIYA 4NH1A 4CYJA 3O2MA 3PJ3A 2PE1A 3KRWA 4FVPA 4W4WA 2ERKA 3R6XA 4IACA 1BL7A 4Y46A 1WZYA 4C59A 4EOOA 2J5EA 4TT7A 5EOLA 4HGEA 3PY0A 2ZM1A 3CTJA 4P4CA 3RAKA 3T9IA 3ZM4A 5JFWA 1YWVA 5CI6A 5K4IA 4GIIA 4O0WA 3ZFXA 4FIJA 3K2LA 2IW8A 4BZNA 4CFUA 3NW7A 1MUOA 4DEDA 3MH0A 3OEFX 5FDPA 4O21A 4RIWA 3IS5A 5HTIA 4DGMA 3VF8A 3A7JA 4AFEA 2E9PA 1Q41A 2PVJA 4NUSA 4FEQA 3NW6A 4M69B 4MNEA 3AMYA 2X7GA 4MXYA 4D4VA 4GG7A 4GKIA 4EOIA 3MDYA 2YZAA 3GU7A 3LE6A 2R3KA 4D2TA 2R3GA 4QPAA 2XBJA 4QMZA 4FSRA 4FTIA 4KB8A 1YXTA 3OT3A 3R1YA 3KRJA 3SKCA 3VS2A 1WBNA 4ZLOA 4LRKA 1WFCA 4MCVA 4TYGA 5E8ZA 3F3TA 4C4HA 2ZV2A 4L44A 3RPYA 4EZ3A 4TY1A 4BDIA 4YP8A 3ORMA 2IJMA 3MVJA 3ORZA 5CZIA 5DG5A 2V7OA 3PA5A 4RQKA 3Q04A 4L00A 3PP1A 4NIFA 4J71A 4ZOGA 2WMRA 1OL5A 2RFNA 4GH2A 3AOXA 2JKKA 4X2NA 5C03A 5I0BA 2R4BA 1OPKA 1CKPA 1YI4A 3M11A 4ZSLA 4LFIA 2ZMCA 1RDQE 4ZY6A 4O7TA 3OWPA 3PZHA 2CNQA 4ZTRA 3HKOA 4U80A 2GQRA 4HVDA 4YU2A 3A7FA 3GOPA 4JDKA 4EHEA 3UZTA 4FV1A 4M69A 4QYYA 3HMNA 2FA2A 5BVNA 4AF3A 2PWLA 1YXXA 3OHTA 2YM7A 4I3ZA 4YZMA 4X6QC 2W4OA 4E26A 3PJ8A 1WMKA 5GIOE 1W8CA 4IQ6A 2WELA 2FO0A 4G1WA 4PPAA 3RAHA 4ANQA 4MNFA 3S3IA 3ZDIA 4FICA 2PTKA 4C3PA 3NW5A 4G34A 5DR9A 4CT1A 4HNIA 2HWOA 3R02A 2O63A 4GU6A 3N9XA 4GFGA 4RJ8A 3UMXA 4BCNA 2XK3A 1PMUA 5C4LA 1W0XC 1PKDA 3OF0A 2B7AA 5AP5A 3UOJA 3OY3A 5AR5A 3EJ1A 4MWIA 3ZUTA 4CZTA 4GFOA 4IH8A 4S31A 1PW2A 4L6QA 4JS8A 3RINA 3QXPA 4JJRA 5GJGA 1OBGA 4IJ9A 1BLXA 3MW1A 2X4FA 2XNGA 3COHA 4MD8E 2W5AA 4U5JA 5GNKA 4D0WA 3C13A 3KREA 3FZSA 3MFUA 3P1AA 4XRJA 4D2VA 4UMRA 5AUTA 5CEKA 2WMTA 1UA2A 3KEXA 4RQVA 3TDVA 3FZTA 4U45A 3V5LA 4AGCA 1PMEA 3E64A 4FNWA 4YJRA 5EDQA 4C2WA 4GK3A 4CKJA 5E8YA 3F66A 3VUDA 4AGWA 4BRXA 4R1VA 4JQ7A 3U9NA 5J8IA 4K18A 3O7LD 2ZMDA 3UPZA 4BF2A 5HO8A 4EOLA 4OW8A 3ZONA 2JBPA 3FYJX 5LWNA 3SXSA 3RPVA 1TKIA 4KD1A 5T68A 5E4HA 1J7LA 4WRGA 1Q8WA 3GU8A 3F7WA 4IFGA 4DTBA 2UVYA 4MYGA 4U40A 4HPUE 3UODA 4CD0A 5IA4A 2WQOA 4AU8A 3A8WA 3ZXZA 4L3JA 5CZHA 1F0QA 3R7EA 2XIKA 4QTDA 5J9YA 3ZHPC 3I79A 3IPHA 4WSQA 4AA0A 3HL7A 5EYMA 5DYJA 3EL7A 3BWJA 5IH4A 2ZM3A 5EYCA 4EK4A 3QZGA 2YN8A 4F08A 4V05A 3R8UA 4FSZA 5A6OA 2B9IA 3D83A 1CM8A 4RT7A 1P2AA 4QMLA 2OIDA 1R0PA 4BI2A 1PY5A 3QHRA 3AC1A 2O64A 5LVLA 4O81A 3TDWA 4CEGA 4YJPA 4CTBA 5CAVA 3BELA 2UUEA 4F7SA 4WNPA 4D4YA 2VZ6A 4JIAA 4AT3A 5FQDC 3OOGA 4F0FA 4HVGA 1VYZA 3DKCA 5A4EA 2J50A 4MH7A 4AGUA 4B0GA 4JNWA 1JAMA 3V01A 2NRUA 5L2WA 2CGVA 3O8UA 5DMZA 1ZXEA 4G2FA 4I6QA 5BQ0A 4FTTA 2VTQA 3OCBA 2ZB1A 3RAIA 4EH3A 5TO8A 1R1WA 3UOLA 5J9ZA 1WBWA 3KQ7A 1P14A 4H1JA 5ACBC 1GZOA 2BVAA 4FK6A 4F65A 5M4IA 3ZTXA 3D5XA 3QD0A 1OL2A 3WYYA 1M17A 1IASA 1PXPA 1XBAA 3QQJA 5C26A 5D12A 3TV4A 3DLZA 3KXXA 3RTPA 2E9OA 5DT0A 3MS9A 2QOIA 2VTRA 3MH1A 4RPVA 2CSNA 2VTMA 3B8RA 3OOMA 4ITJA 5BPYA 3WI6A 4EH9A 3SDJA 5AA8A 3QTQA 3REPA 1NA7A 3IGOA 4QMPA 2ZV9A 3LFEA 4FOCA 2J90A 4YTIA 4AG8A 3F2AA 4DBXA 3FHRA 5FXQA 2ETMA 5AIRA 5B2LA 3H4JA 2W9FB 4RX8A 3G9LX 3WILA 3LMGA 4I22A 4MBLA 4Z3VA 5AUVA 4FTCA 4KSQA 5KMLA 1LP4A 3AC2A 4GUBA 1DAYA 1YXUA 5JQ8A 2V55A 4FZDB 3L9PA 3BU5A 3PRIA 4DTAA 1FOTA 1GY3A 3DJ6A 2HZ4A 2HIWA 2YCSA 1W7HA 2VWUA 3BGPA 2BZIB 3KC3A 4S33A 3DBCA 2SRCA 4KIKB 4AW1A 4LOPA 1FMOE 2ONLC 4D0XA 4EZ7A 2P55A 2R3OA 4EKKA 4ANLA 1JKTA 2OWBA 2Q0BA 3GCPA 2FGIA 4PF4A 2IZSA 4PV0A 1ATPE 2B9FA 4W8EA 4OBQA 2WTDA 4BCIA 5CXZA 5CYIA 4KBKA 4B8LA 4K6ZA 1OI9A 1FVTA 2YEXA 5J7BA 3FQEA 3VW8A 3UG2A 1JSVA 5J95A 3ZO1A 2BZHB 2XH5A 4B6LA 4CFFA 3LMIA 3HMPA 3I1AA 4QP3A 4NK9A 1RJBA 3QQUA 4HW7A 3ULIA 3ORPA 5H2UA 5JGAA 2VO3A 5CAPA 3UC4A 3JS2A 4C37A 5AR4A 4D55A 2PZIA 4XV9A 4EOJA 3MY0A 4OAVB 1VZOA 5GZ9A 3VS5A 3LCTA 3QCSA 2W5HA 2XJ0A 3KVXA 2YM3A 3NUUA 4KIKA 4MXAA 3W8LA 5IG1A 3R1NA 4FL3A 1V1KA 5HEZA 1XH6A 2WTCA 2QOHA 2YCQA 4GVJA 5HG9A 3SOCA 4O84A 3V04A 1AQ1A 4MAOA 3ANQA 5FXRA 5EM7A 3K3JA 3H0YA 3GCSA 3DDQA 3FI2A 5M4UA 3D15A 4TZRA 4XOZA 2XK9A 5HZNA 4DHFA 4E73A 2QODA 3EFWA 4RLLA 1M2QA 1Q61A 3FC1X 2YABA 3QTRA 3LOKA 4AE9A 4ANSA 3HV5A 2CGXA 4RJ3A 2WFYA 3VBTA 5A14A 5IA1A 2Q0NA 2VN9A 2CLXA 5EI2A 4F7JA 2G9XA 5C1QB 5JT2A 3MB6A 3R83A 4L46A 2OZOA 2PVLA 4H3QA 5CXHA 5HVKA 4U3YA 3DT1A 4YZDA 2JDRA 3MVHA 3AGLA 3TACA 2GNLA 5LWMA 4NKAA 3IDCA 1B39A 1JOWB 5HU9A 4DF3A 2XVDA 4DEGA 1TQIA 4U8ZA 5BVFA 4IX3A 2UV2A 5EW8A 4JRNA 2OJJA 5CS6A 3QQLA 5E90A 4RFYA 5HHWA 5KE0A 3CIKA 4AOIA 4G9RA 4JBVA 4MVFA 4FV4A 4I24A 5A4CA 1RE8A 4FX3A 4RLKA 3WF5A 3CS9A 5HG8A 1OGUA 3OT8A 3R22A 4F6SA 1ZZLA 3AC4A 3ET7A 2R7BA 3UO6A 3TM0A 5G1XA 4DLIA 5HE3A 4O27B 4JG7A 2C69A 3ZSIA 4HGLA 3W1FA 3ID6C 4RGJA 3MA3A 4J97A 3R63A 4IAZA 4Y72A 3QTWA 5JZJA 1AD5A 5FEQA 1OPLA 4GSBA 3UMWA 4BTKA 4U79A 5AR8A 4EH2A 2PL0A 4QMQA 4FEUA 3FAAA 4J1RA 4M0YA 5HLWA 2R0IA 4ID7A 2OH4A 4M68A 4JI9A 3T3VA 4BDBA 4Z16A 3P7AA 3OW3A 3WIKA 4FKLA 1ZLTA 3LQ8A 2HZIA 3NYVA 3MN3A 4U9AA 4V01A 3LVPA 5CSVA 2VUWA 3PWDA 4JBQA 5HNGA 2XF0A 3IW6A 2UZUE 2BR1A 3QGYA 2HZNA 5C8NA 3TTIA 4D2RA 4I21A 3F7ZA 4MD9E 2CJMA 3VUGA 5LVPA 2Q83A 4EK5A 2H34A 2VX1A 2UW4A 3EL8A 3ZBXA 4WA9A 5K9IA 4R5YA 3S0OA 3PJ1A 1WAKA 4DH8A 3VBWA 3PIYA 3DK6A 2WB8A 3AMAA 4RIXB 3OTVA 3D4QA 5CY3A 3K54A 4DITA 4WOVA 1OL1A 5E8VA 4M0ZA 4RC4A 4G9CA 5G6VA 1TQPA 4AW5A 3WARA 1Y8GA 3VN9A 1BUHA 3R7UA 5AA9A 2Y7JA 3EMGA 4QOXA 5AV2A 4F1MA 4O7ZA 4M8TA 5HBHA 3QU0A 4Y85A 2X8DA 2J6MA 3LHJA 3NCZA 3DQWA 4O6LA 5CSHA 5FBOA 5HX6A 4O1PA 2ITVA 4Q5EA 5L2IA 1W84A 3GC8A 3H9RA 3MV5A 4QP7A 4CGAA 1GIJA 4HVSA 5CSXA 5EHOA 3DOGA 1YW2A 1UNLA 4FMQA 4CNHA 4KUJA 3CQEA 5JEBA 2W96B 1Z9XA 2Y6MA 2XMYA 2YCRA 2I0VA 4X2KA 5DVRA 3OUKA 2X8EA 2XNOA 3P9JA 4RZWA 3R9HA 1Q3WA 4Z7GA 5CAUA 2YM5A 3LAUA 4X6RA 3C9WA 3VUKA 3BQRA 4ZZNA 4M12A 4E1ZA 3FLWA 3QUEA 3TNQB 2R5TA 3E63A 3C4WA 4E6QA 3VS0A 4CCUA 3FQHA 4I6BA 1JKLA 5FWKK 5IQGA 4KNBA 3UQFA 3MFTA 2YWPA 4YC6A 2J0KA 4TNDA 3UIMA 3CSVA 3HMMA 3PY3A 4QP6A 4IC7A 2XIXA 2X4ZA 4I5MA 4JX3A 3Q9YA 3IG7A 3UYTA 3ZBFA 4LOOA 4O7SA 4FV6A 1REJA 4WSYA 5LJJA 2R3IA 2G1TA 2JIVA 4IC8A 4DTKA 2CNVA 1U46A 4FKVA 4OT5A 5IISA 4U97A 5HU3A 3C0IA 3O8TA 4F7NA 3VRZA 2V62A 1ZZ2A 1SVGA 2WMUA 3KFAA 3HYHA 2IVVA 5C8MA 1Q5KA 4O0YA 3VBQA 3NCGA 4CG9A 3P5KA 3D14A 4LOQA 2W4JA 3QZFA 2QO7A 3PZEA 5JK3A 2OBJA 1UNGA 3DDPA 3UO5A 3OWJA 4YTCA 4USEA 1V0BA 3RWQA 3NS9A 5KMOA 4CFVA 2YCFA 4BTMA 3F5UA 5IEVA 3LCOA 2BFXA 2X81A 3BI6A 4O7YA 3V5WA 4YJVA 2VWYA 5F1ZA 1P5EA 4B8MA 4ANOA 5E8TA 4BHZA 2OIBA 5BUEA 5JRQA 1OB3A 3TNWA 4G3FA 3ITZA 3Q2MA 3D7ZA 4FVQA 1YDSE 4XYFA 1M7NA 3BU6A 3DAKA 3LJ2A 2XZSA 2ITOA 2QOBA 4H58A 4EORA 2CKPA 5E1EA 1Y8YA 4BHNA 2W06A 3DPKA 2FYSA 4J98A 2YM4A 4WBOA 4FVRA 2R3JA 4JG6A 4UMPA 2BDWA 2F7XE 4JT3A 2W0JA 4R7IA 3ACJA 3CTHA 3MJ1A 4G16A 3LM0A 2XKDA 5E8WA 1B38A 3FC2A 4DA5A 3HUBA 4MK0A 4Q2AA 4OTRA 4U7ZA 4HYHA 4ACGA 3UIUA 4W9WA 2GNIA 2PE2A 1PXIA 4GT5A 5CENA 3ZLXA 4D2PA 2OF4A 1J3HA 4R7HA 2IVUA 3WZEA 4H39A 4QP4A 4FI1A 4CMUA 1Q99A 3DFCB 1PXNA 2VV9A 3OXIA 4AGDA 4LQMA 4UYNA 3W2SA 5KHWA 4BY9E 2WAJA 4IB3A 4XV3A 3TT0A 2PHKA 5ANGA 4NM7A 4XJ0A 4D28A 4DC2A 1IAJA 2R9SA 4D2SA 2OW3A 4KIQA 4DFXE 1FVVA 3G0FA 1WBTA 4NEUA 2GMXA 3I4BA 1I09A 3B2WA 4XLIA 3VS6A 3SXFA 4JAIA 4DBNA 1URCA 3ZRKA 3BYMA 3LXNA 4D9UA 4EJNA 4GG5A 5FDXA 3Q3BA 4FSYA 3FSKA 4ZP5A 5ANIA 3U6JA 5IA0A 2ETKA 2BDJA 1PYXA 4I6FA 3C4FA 3VBYA 1LPUA 3SHEA 1VJYA 4QYHA 4DG2E 3G6GA 3DY7A 4M7IA 1E1XA 5KKRC 4RIYB 3Q4UA 2VTNA 3O8PA 3Q5ZA 4XP2A 3UBDA 3SLSA 4CQGA 5HBEA 4CG8A 3Q5IA 3PE1A 1IR3A 2O2UA 3N4VA 2VGOA 4TL0A 5EKNA 1ZMUA 3RI1A 4BCMA 4RC2A 5KNJA 4CRSA 1ZYJA 4QPMA 3KMUA 3L9LA 4I20A 3FZOA 5ANOA 4PNKA 5L2SA 2I6LA 2WOUA 4AOTA 2E9UA 2VU3A 4ZY5A 3QQFA 5DOSA 3QX2A 1JPAA 4LM5A 5T3QA 5IMEA 4PMPA 4D4SA 3EZVA 4F9AA 4X3JA 4BGGA 2ITYA 3RGFA 4CKIA 4O7RA 4ZK5A 4E4XA 3R7VA 2JC6A 4BCQA 2VTOA 3F69A 5AR2A 4DG3E 3QALE 1Y91A 3RZFA 5CQUA 2GPHA 1Q8ZA 4GT4A 4IAYA 5M55A 4ZAUA 4CFWA 1H4LA 3RMFA 1SVHA 1B6CB 4AN9A 4AZVA 5GJDA 3PXRA 5I9VA 2WTIA 5IA3A 5C9CA 4BBMA 4EOKA 4JBOA 3QD3A 5DR2A 3BHUA 4FV9A 4U42A 4DGGA 5M06A 1GZ8A 5L8LA 4FZFB 4F6UA 3KKVA 3FXXA 3QWJA 5DA3A 4JDIA 4F9WA 4D1XA 3FE3A 3P86A 5I9YA 1UU8A 1PMVA 3HV7A 2XNEA 3FZPA 5IU2A 4QMTA 2UZDA 4ITIA 3RCDA 4NWMA 4FEVA 2R2PA 4XLVA 2ETRA 4BDFA 5AMNA 4ZSGA 3V8TA 3GCUA 2C4GA 2I40A 3KRXA 2C5OA 2C6OA 4IHPA 2FH9A 5AP0A 3V3VA 3MA6A 1K3AA 3ZO3A 2KULA 4C61A 2PULA 1IAHA 2WGJA 3HDMA 4PX6A 4I94A 4EL9A 2B4SB 4YLJA 2OJGA 5CVFA 4GL9A 4C0TA 4OTWA 2PU8A 4X3FB 3UC3A 4ZY4A 3JY0A 2J9MA 2P4IA 2PZYA 4TTHB 4FG7A 2X2KA 4IB0A 3SQQA 3JVSA 4ZZMA 3LFSA 4Q9SA 1WBSA 3W18A 2G2HA 2XK6A 3UP7A 2UW9A 4AQCA 4WNOA 5HD7A 5I3OA 1A9UA 5DBXA 4R7BA 2B54A 3C4EA 4ZLZA 3GVUA 4FTAA 2PZPA 4XMOA 3UDBA 4G5PA 4E20A 4IIRA 3U9CA 3VULA 3ZZWA 3GU6A 5M51A 3CP9A 4XH6A 5K5NA 4FKIA 1GJOA 2R64A 3FDNA 3LXLA 3GQLA 3I5ZA 1YKRA 4O0SA 4I93A 3TJDA 3BU3A 5TF9A 3ZXTA 2WTJA 3BLQA 5H8EA 3EYHA 1XQZA 5HI2A 5I3RA 3EQIA 4PPBA 3U4WA 3NIZA 4BI0A 2GFSA 4QP9A 5EKOA 3QF9A 3W2QA 5M56A 2XNNA 4RRVA 4RZVA 3T9TA 3A4OX 3H30A 3C5UA 4M97A 2H8HA 1H8FA 3GXLA 3PPZA 2W17A 3R71A 4MBIA 3CKXA 3EH9A 4FZ6A 4APPA 4GS6A 2HENA 5DPVA 5LVOA 4O82A 5J7HA 2YWVA 3HRBA 4S34A 3F5GA 2CKOA 3ENMA 2BTSA 2X1NA 4L52A 3ZFYA 2R3QA 5FTQA 2OI4X 2ITNA 4R3PA 3G5DA 4OBPA 1SYKA 3AGMA 3DV3A 4FTLA 1ZMWA 3L9NA 3KXNA 1YQJA 4HCUA 4UMQA 3U51A 4UMUA 2JFMA 1Z57A 2BILB 2QLUA 2QQ7A 3QCXA 3DKFA 4N0SA 4E7WA 3I60A 1M2RA 2XNPA 5HTBA 3O23A 4OAUC 3MIAA 5AP2A 2B1PA 1KV1A 2B52A 2B9JA 2Y4IC 4ONAA 5ETAA 3RVGA 5CANA 3H9FA 5TR6A 2GHLA 3UVPA 4FG8A 2BUJA 3W55A 5KBRA 1S9IA 4L01A 4PDPA 1G5SA 4ZTHA 1J1BA 3DZOA 3GBZA 3ZZEA 4C3RA 4HZSA 2OGVA 1UU3A 1H01A 3IQ7A 2GS7A 2IW9A 4HCTA 4BKYA 1UKHA 5B2MA 4IBMA 2WMVA 1QPEA 1ZAOA 2YM8A 2WMSA 4L45A 1VEBA 4PP9A 5CU2A 3VIDA 4FSQA 4KS8A 1JSUA 4C38A 3LFDA 3QZHA 1HOWA 4IAIA 1ZYCA 2NP8A 3KXZA 5AV1A 3QWKA 3TIYA 2WEVA 4K0YA 4IVAA 4KABA 1OIUA 1YI3A 1XH9A 4BDEA 4IZYA 2JFLA 3RK7A 5EQPA 1DI8A 2WQNA 5FUTA 4TXCA 3O50A 2FSMX 5IKWA 2OIQA 3K5UA 4K9YA 4BKZA 2OU7A 4BCKA 3G51A 3W2RA 4D58A 3PUPA 5BUIA 3DKGA 4QPSA 4FIFA 4ZXTA 3R8LA 2ITXA 4FTNA 4O0XA 4QMUA 2C6MA 3HV3A 4Y95A 4C4GA 2BKZA 2IZRA 3E5AA 3CC6A 5DWRA 1J7IA 4BIEA 2O8YA 2RFEA 5L3AA 2R3NA 2QURA 3JPVA 4YC8A 3NWWA 5HVYA 4OTPA 3N4UA 2GHMA 3LJ0A 1AGWA 4ANBA 2ZJWA 4FSNA 3E88A 2C6LA 4M13A 2YERA 5AX3A 5GJFA 3EQPA 4F64A 4D1ZA 4EH8A 5HIDA 2WTKB 1ND4A 2GFCA 4YBKA 5F20A 2UW7A 4S30A 4FKOA 1ZRZA 4I92A 1H1QA 1YRPA 5AV0A 4BWKA 5CASA 4YSMA 5I9ZA 3HEGA 4RWJA 3R9DA 3RM7A 4BDJA 2PYWA 3E92A 4I0TA 3BKBA 4F9CA 5CEOA 4FT0A 4IADA 5AR7A 3QKMA 2QOLA 5A46A 3UVRA 3JUHA 1OPJA 4B4LA 4EK6A 1URWA 5KMNA 3LMHA 5KCVA 4O7LA 3DQXA 1BI8A 3DXPA 2BRNA 4P2KA 3ZUUA 2QOOA 2UW8A 2QG5A 3ZO4A 4UBAA 5CEPA 3DB6A 3KMWA 4FSTA 4ZSJA 4N57A 3P0MA 5FG8A 4FEWA 4FYNA 3SGCA 4IVDA 5EFQA 2W1CA 2WXVA 3UIXA 2JIUA 5K0XA 3UNZA 3HMIA 1H1SA 4A9TA 4FSWA 3A99A 4AP7A 5AUZA 4K11A 5HIEA 3ZCLA 1QMZA 5E1SA 3JYAA 2YLFA 3PYYA 4M15A 5C8KA 3BX5A 2CPKE 2UW0A 3KF7A 3PVGA 4EH5A 3N4TA 4I0SA 4EKLA 5KHXA 3SG8A 2J7TA 4RX7A 4UN0C 3OROA 5HICA 4A9UA 2HZ0A 4TN6A 3V6RA 3FMJA 4QYGA 2CCHA 5K5XA 4JR3A 2XCHA 3ANRA 2GTMA 2VNWA 2WNTA 3OG7A 3EN5A 5A9UA 3LPBA 3ZEPA 2QONA 2PUNA 5FTGA 3ORTA 3S95A 1GZKA 4FIIA 5DR6A 4AZEA 2VWZA 5E8UA 3U87A 3I0OA 4PP7A 4KBCA 2BHHA 4I23A 3A2CA 3OEZA 1W83A 3D9VA 3I6UA 4A4XA 2Z02A 3BQCA 4FT9A 4ASZA 1XKKA 3MWUA 1OUKA 1MRYA 3OTUA 1KWPA 5ETIA 3FKNA 3RP9A 1T45A 2EB3A 3FI3A 2UW6A 4YTFA 2IVSA 3ZU7A 4RA4A 4Y83A 1Q24A 4E3CA 3NYNA 2IPXA 4X0MA 1H07A 4I5PA 3VUTA 3OZ6A 5ETFA 4O0VA 3QLGA 4E5BA 2ZB0A 4FTOA 4U41A 2C6EA 2FSTX 5CF8A 2J5FA 2C6KA 2AC3A 2BRGA 2W9ZB 3F3VA 2C68A 4GW8A 3C0GA 2GSFA 4C8BA 3PVUA 2IZTA 2WHBA 5AIKA 3IOPA 1O6YA 4II5A 5L8JA 4C62A 3B8QA 2EB2A 4I4FA 3OP5A 5FM3A 4YSJA 2PVKA 4AUAA 2XIRA 5CX9A 3TZMA 4WRSA 5AM6A 3TUCA 3RALA 2CCIA 3PXYA 4DT9A 4NCTA 5CU4A 3FPQA 3QKLA 3WZKA 1K9AA 2VWWA 2QKWB 2Z7LA 2NO3A 4FKJA 2VWVA 2WIPA 1CMKE 5LCJA 3CGOA 4NM3A 2PMIA 1PXJA 5CI7A 4BGHA 1WBPA 1H25A 1YHVA 3FZRA 5HCXA 3BEGA 4XG4A 1H1PA 4ACCA 5CF4A 4X2GA 2BPMA 3EFKA 4YJNA 3E3PA 3EQRA 3LIJA 3W2OA 1Q8TA 1YDTE 3AC8A 3CXWA 3PFQA 3TN8A 4YPSA 3MSSA 4IAFA 4RMZA 2W1HA 2QOFA 1OECA 4HZRA 3DTWA 4DE4A 3F61A 2J0JA 3G6HA 3QRUA 2UVZA 4F9BA 1OKWA 2R0UA 3ENHA 3DA6A 4GJ3A 1VYWA 2JDVA 2XNMA 3QL8A 2XKEA 5D1JA 4IM2A 2YDJA 3NSZA 5HD4A 4DGNA 3BE9A 4DEHA 3CPBA 2H6DA 1SM2A 3IO7A 3PY1A 3Q9ZA 3QFVA 3LCDA 4GMYA 4WBBB 3ROCA 4ACDA 4G6LA 4C4FA 4N6ZA 4EHGA 3WF7A 1WBOA 4TYIA 5I9WA 3NPCA 4A9YA 4ENXA 5E7RA 2VTIA 2WU7A 3MTFA 3DJ7A 4GU9A 3Q32A 4KRDA 4BCPA 3TZ9A 4QMWA 3E8DA 4R3RA 1NT2A 5L4QA 4MXOA 1JNKA 3C0HA 5IQBA 3KXGA 4O38A 4CFNA 4MQ2A 2C0IA 2IG7A 5DEWA 3D7TB 2VTSA 4QQCA 3BYVA 5IEXA 3Q6UA 3G0EA 1DS5A 3ATTA 4BCGA 3SG9A 5AP6A 1P4FA 2JLDA 3NIEA 1FPUA 4BDGA 3UNKA 5M53A 3KN6A 4JXFA 4Z9LA 2YIRA 2W05A 2ERZE 2IVTA 1ZOHA 3O0GA 2A1AB 2NPQA 4Z55A 3R01A 4FTMA 2VX3A 1NY3A 5KZ0A 3QA0A 3DCVA 4C2VA 2OXXA 3D5UA 3ODZX 3GI3A 4CV9A 5TT7A 4FK3A 1APME 2F7ZE 3C4CA 3ORIA 3WYXA 5HCZA 1PHKA 4BTJA 4G17A 4ASDA 5M4FA 2X0GA 5HKMA 2IO6A 2BRBA 3FSFA 4PRJA 4FA2A 3NUXA 4LV8A 3F3WA 2YJRA 3L1SA 1JKSA 1UV5A 4L53A 3TKIA 4KBAA 1PF8A 4L67A 1ZWSA 4Q9ZA 3NNXA 3FLZA 3HLLA 2C5YA 4U6RA 5J87A 3EQBA 5A54A 3W33A 5HTCA 1S9JA 4ITHA 4X2JA 3O17A 4RJ4A 4YZCA 2PUPA 3UQGA 4FL1A 4CZYB 4NW6A 2CN8A 3AT4A 4EH4A 4FL2A 2WKMA 4JBPA 3GENA 4PTCA 4B99A 3AXWA 3PTGA 4FYOA 3E3BX 4FTUA 3RPSA 4NZWB 4CRLA 3IECA 4ZMFA 5IQFA 1T46A 2RGPA 3NUSA 3SXRA 4TNBA 4IW0A 3PIZA 1Y6BA 3V5JA 3EQCA 3ORXA 3LFNA 5EH0A 4UX9A 3KA0A 4OTIA 4QTBA 2EXEA 1IG1A 1LUFA 4ANNA 4RVLA 4HVIA 5CSPA 5ANJA 4AN2A 2C1AA 4JOAA 4BICA 2ITPA 4WG3A 3P23A 1JVPP 1G8AA 5TOZA 4LUDA 2CLQA 2QKRA 2ITQA 3SX9A 4R77A 5H3QA 4FV2A 3ATSA 3ULZA 5HE0A 2ZOQA 5DFPA 1ZOEA 5ANEA 2HW7A 3IONA 4K8AA 2VRXA 3COIA 3G90X 4EHZA 4YMJA 3LFAA 2OO8X 4FIHA 3R9RA 5AAFA 3LFQA 4FUXA 4C34A 3B2TA 3HDNA 4AFJA 2EVAA 3H3CA 2VD5A 3ROYA 4M14A 4XS2A 2C6TA 2X6EA 3CY2A 3VAPA 3NVMB 4CLIA 1QPDA 3KRLA 4XG6A 4IWDA 4F4PA 5E9EA 2HK5A 4V0GB 2PZRA 3ALNA 1NVRA 4E8AA 3U4UA 2V0DA 5BVOA 3GC7A 3AT3A 3EQFA 3UG1A 4Z7HA 1TQMA 1XWSA 2PUUA 3R7GA 2CGWA 4BCHA 5LMAA 5BYYA 2OZAB 2P3GX 4EI4A 2GQGA 3K3IA 2XNBA 1U54B 2YM6A 4G31A 4AAAA 5AADA 4EHVA 2QI8A 4EH6A 3KY2A 2WQEA 3VQUA 2RIOA 4DH1A 2OJFE 2X2MA 4IWQA 4BYJA 5J5TA 1UWHA 4LRMA 4RIXA 3NMUF 4AA5A 2ITUA 1CKJA 1O6LA 3RHKA 5J1VA 2WPAA 5EYDA 3FXWA 4O6EA 2UZNA 4TYHB 2ZVAA 3PRFA 3NRMA 2FVDA 4KIPA 4QNYA 5AP3A 3ZC5A 1Q97A 2VWXA 5IUIA 2A0CX 3VW6A 4E6AA 1ZY4A 3R28A 2CN5A 5HNBA 4RIOA 5HGIA 3PXKA 3SV0A 3VHKA 3WOWA 2WD1A 2F49A 4H36A 4HYUA 2JAMA 4EOMA 4W8DA 4MHAA 4WO5A 3A61A 3QCQA 4RG0A 5FP6A 1F5QA 3ERKA 5IMXA 3ACKA 1KV2A 2BAJA 3FKOA 2I0YA 4V0GA 4OTFA 4CV8A 4ZLYA 4H05A 5ICPA 1IEPA 3GOKA 4TW9A 2VAGA 1GNGA 2G01A 3VHEA 2B9HA 2QD9A 5EW3A 1U54A 1UKIA 2EXCX 3BYUA 4ZJJA 3DTCA 2XK7A 3I6WA 3KCKA 4WKQA 3COMA 2JBOA 1FGIA 3A7HA 4BWPA 4NSTA 2ZYBA 4MKCA 4PTEA 2VTLA 3OY1A 3MI9A 3BGQA 4J95A 4QP8A 4RWIA 4WNMA 2BDFA 2PZ5A 2QVSE 3OCSA 3PIXA 2EWAA 3MJ2A 4JQ8A 4TYHA 5TE0A 4MQ1A 1Q3DA 5CNNA 4DLJA 4KA3A 4QRCA 5HIBA 5CT0A 3T8OA 1KE9A 1E1VA 2VWBA 3RK9A 4FT5A 3RHXA 4EYJA 4F1TA 3HA8A 3DBEA 3EYGA 4X2FA 3S00A 3GU5A 4BCOA 5LXMA 4FIEA 5FEDA 4F0GA 3R00A 1HCLA 2VNYA 5L8KA 2P2IA 4J53A 3A7IA 3LFCA 1STCE 4C4EA 2YA9A 5KMKA 4YZBA 3VUMA 3ZLWA 3BBTB 2BFYA 1A48A 3L8XA 3IOKA 2C0OA 3N51A 4CMTA 2W1GA 1GOLA 1UU9A 5E8SA 5L2TA 4RJ6A 3V8SA 2V5QA 3QRKA 3KF4A 1JBPE 3IW5A 4DFYA 5FRIA 3GT8A 2Z7SA 4I5CA 3U6HA 4G6OA 4FEXA 3EN4A 4PWNA 2JIIA 2UZEA 4ZJIA 3QUPA 3FMHA 4K1BA 1XH5A 3IKAA 3CR0A 5IH6A 3BHTA 2FSOX 3FMEA 5IQAA 1KE5A 2XUUA 3FY0A 3W2CA 4FOBA 4XCUA 3OXZA 2HY0A 2UZVA 4FKQA 4NKSA 3WZJA 1VR2A 2XRUA 4FNYA 3UNJA 3E93A 3FY2A 4W4VA 2OJIA 1OIYA 2F7EE 2RG6A 4TWCA 5I4NA 3OW4A 5DT3A 4F99A 4GRBA 3PPKA 4YHJA 3PJCA 3TG1A 3FUPA 4CVAA 4PDOA 4F6WA 3PE2A 4K33A 1ZYDA 2YITA 3D5VA 3FHIA 2OFVA 3K5VA 4JL9A 3R8MA 5DEYA 2W1FA 3UZPA 5M07A 2OICA 4HYSA 5EM8A 4IANA 4IAAA 5C01A 4CFMA 3SA0A 1BKXA 2B55A 3F9NA 3G2FA 3FBVA 1XH7A 3V5QA 4RWLA 4FTJA 3F2NA 5EYKA 1SNXA 4NCTC 3MTLA 2CKEA 3ORNA 4KAOA 4FKRA 2C5NA 4HGSA 2Y6OA 4O91A 3TNIA 4DFLA 5CEMA 5H8BA 3F3UA 2OXDA 1V0PA 1WVXA 3PVBA 3PVWA 4O86A 4DEBA 1KOBA 5A4QA 4XV2A 5AUXA 4BCJA 5JGBA 4MF0A 1KE8A 4EWQA 2BMCA 5BYLA 3PSDA 2ITZA 4NL0A 3U54A 2VTAA 3M2WA 4FIGA 4FT7A 1PYEA 1XH4A 3OBJA 4U0IA 5CF5A 2ESMA 4HJOA 4MWHA 4R5SA 5KBQA 3ALOA 4QNAA 2X6DA 2E2BA 2X7OA 4PNIA 3W32A 2F57A 1UVRA 4AX8A 3NUYA 3OBGA 3MH2A 3HAMA 2HCKA 2C47A 3NUNA 4DAWA 3EN7A 5D41A 4O7NA 3A8XA 1U5RA 3ELJA 3LW0A 4XNEA 4QMMA 4LG4A 4I4EA 4BDKA 3KMMA 1H27A 4FTRA 4UWBA 2BZJA 3E62A 3NYOA 4L7FA 5DT4A 2IZUA 3LCKA 3BEAA 4M84A 4EUUA 5HLNA 3NAYA 3QLFA 2ZV7A 4QQJA 2JAVA 3Q6WA 4RA5A 4C57A 1U59A 5ANDA 5GZAA 2XJ1A 3LFFA 5EI8A 3W2PA 3ZRMA 3TL8A 4RIYA 3TWJA 2CMWA 5HOAA 3PSBA 5IF1A 2ONLA 2XYUA 1L3RE 3E8NA 4OTQA 5AUWA 4ANMA 4WHZA 5HE1A 4FNZA 3JR1A 4ASXA 4IX5A 3LXKA 4UMTA 5FD2A 3TIZA 3C7QA 4PMTA 3MFRA 3UP2A 5AWMA 5LQFA 5CWZA 3ETAA 3SRVB 3LQ5A 3NAXA 3NDMA 2PVYA 2UW5A 1GAGA 3OMVA 2AC5A 4H3BA 3ZM9A 4RX9A 3TZ7A 4ZTNA 3PXZA 3PP0A 1YOJA 5LARA 5HO7A 4E93A 4LI5A 3NNWA 4O2PA 5AUUA 2QNJA 4JIKA 5CEQA 3MVLA 3LFBA 4OGRA 3O96A 4Y5QA 3V5TA 3CCNA 4R8QA 4XG7A 2PSQA 5I9UA 2C3JA 2YJSA 4E4NA 4TYJA 2BRHA 3MYGA 1PRYA 4W4YA 3WF6A 5F94A 4WNKA 1GIIA 1XHAA 2DQ7X 4L9IA 2GNGA 4F1OA 5KO1A 4YJQA 3QQGA 2VO6A 4YJTA 5A4LA 3WBLA 4LUEA 3H10A 3HGKA 5D11A 1NXKA 3VUIA 2XM9A 5JSMA 4NTSA 3NYXA 2XK4A 4JDHA 4ACMA 4IE9A 3GGFA 2GU8A 3TNHA 5CALA 4O0TA 1QPCA 5CQWA 3VRYA 2R3PA 5K3YA 3NX8A 3SRVA 4NJ3A 5J1WA 2WMQA 5JFVA 3NNVA 4LMUA 5FGKA 3E7OA 3R9NA 4DFNA 4P90A 2UZWE 3C4ZA 3SC1A 5IZFA 3T3UA 3RWPA 2QC6A 4DN5A 1UNHA 3MY1A 4O83A 4GKHA 5E92A 1BYGA 2BALA 3MPAA 5EOBA 5I9XA 3VS3A 4CSVA 4MNEB 5LMKA 4ERKA 3Q2JA 2ZDUA 4FV7A 3UZRA 2QR7A 2F2UA 2WU6A 1IA8A 4X3FA 1SMHA 5AV3A 4BR3A 2BZKB 3COKA 4G3GA 4O1OA 3U8WA 3TXOA 5M4CA 4XG2A 5HVJA 4FKPA 3R2BA 5EW9A 1J7UA 1SZMA 5CVHA 4BDAA 2HAKA 3DB8A 1PKGA 4QYFA 1Y6AA 4GIHA 3ZUVA 4YO4A 3JY9A 5GINE 2WIHA 4JR7A 4MXCA 3EB0A 2JITA 4NIFB 5DH3A 2OXYA 4FKWA 2XIYA 4XP3A 1ZY5A 4EOSA 2KTYA 4BTFA 1E9HA 5GZ8A 1JSTA 3FZ1A 4XUFA 1YWRA 4DCEA 1BI7A 1R39A 4YHFA 3R7YA 4IXPA 3KU2A 1X8BA 3ZDUA 4D5HA 3TUDA 2PVHA 2RKUA 1RW8A 4RJ7A 1U4DA 3WE8A 4DH3A 4KWPA 4A4LA 4L3LA 1XBBA 4QP1A 2O5KA 3PXFA 2ACXA 2RSVA 3D2KA 3AMBA 4YNEA 3UE4A 4ZMEA 2C5XA 3RNIA 4C36A 3LM5A 4IZ5A 3ZC6A 2BCJA 5E8XA 1H24A 3OCTA 3RBWA 3L8VA 1O6KA 3M1SA 3NNUA 2JDTA 1H28A 1OKZA 3AQVA 2VTPA 1XO2B 3H0ZA 4QMVA 2W4KA 4P5QA 2XIZA 5CU6A 3AC5A 3Q9XA 3PXQA 5B2KA 4F63A 1RQQA 3CPCA 2UVXA 3FLYA 4FV3A 3CQUA 3BZ3A 3VNTA 4LL5A 3PG3A 5IQIA 2RG5A 4CYIA 2B0QA 4N70A 3F2RA 1KE6A 3GEQA 4AZWA 4C58A 4KRCA 2EU9A 2C5VA 4GYIA 4IMYA 4U3ZA 3H9OA 3U6IA 1IA9A 3C5IA 2OF2A 4FSUA 4JRVA 4XBRA 3F88A 4DEIA 2WQBA 3DBDA 3QQKA 4AACA 4C02A 1REKA 1CTPE 3HP5A 4JVGA 1FINA 3Q52A 4E5AX 4D4RA 4DYMA 2NRYA 4JX7A 3ZLSA 2PK9A 3MPTA 3QYZA 4RWKA 4UALA 4EUTA 4RBLA 4PUZA 4L3PA 1Q62A 3HA6A 4FBXA 4GK2A 2XEZA 3FL4A 5BVWA 3WF8A 3CEKA 4ZTQA 4AE6A 4ZS4A 1QPJA 4XV1A 3DK7A 3Q4ZA 4BFMA 4XOYA 5AV4A 3QTXA 5H9BA 4EEVA 3V51A 4FKUA 2GNFA 4F7LA 2A19B 5HCYA 3HUCA 4CTCA 3C50A 3GFEA 4N4SA 5A3XA 4L8MA 3S4QA 1H0VA 3QYWA 3CQWA 2FB8A 5C27A 3QD4A 2DS1A 3LKMA 1FMKA 3OCGA 4TPTA 3WZDA 4DH5A 5BYZA 2HELA 2GNHA 3IW7A 4YJSA 4AT4A 4EOPA 3PDTA 4YTHA 3QAME 1YHWA 4C35A 4R6VA 2XB7A 3GP0A 3QUDA 3F82A 3OXTA 1OITA 2PY3A 1CKIA 4PDYA 3WE4A 4UEUA 3QHWA 3EHAA 4UZHA 3TTJA 3ZRLA 4QD6A 5J5SA 3BYSA 4FKTA 4QTEA 3NLBA 4FF8A 3EIDA 2XCKA 4AXAA 1R78A 3QKKA 1FQ1B 3AD6A 4ZTLA 5CEIA 3UGCA 4C4IA 4PMMA 3EOCA 3C1XA 2JKMA 3ZSHA 2YACA 4BI1A 4BN1A 3KK9A 2C1BA 3GC0A 1H00A 4PY1A 4YR8A 3BCEA 2Y8OA 2IWIA 2P0CA 4M3QA 2PUIA 4FTKA 4WG5A 3R1QA 2HXLA 2PVFA 4BCFA 3S1HA 4P7EA 4L68A 2H9VA 4QQ5A 2C3LA 4OTHA 4FZAB 1W98A 1SNUA 3V5PA 4F09A 3EWHA 1OZ1A 5AM7A 5DN3A 5IA5A 2J4ZA 4F70A 3NGAA 4H3PA 5DHJA 2Z8CA 3D0EA 5DNRA 3ZYAA 2XM8A 3ZMMA 1XH8A 2Y4PA 4YC3A 3KRRA 4FTQA 3ZLYA 2WO6A 4JAJA 2CDZA 4K77A 4RVKA 3W8QA 4AZFA 4BGQA 4FZ7A 2VTJA 2XA4A 1O9UA 2WMBA 3QRTA 5FLFA 2J0IA 2CHLA 2IW6A 2HOGA 4KINA 2ZV8A 3TV6A 2J2IB 2J51A 4HOKA 3BPRA 5AP7A 4UWCA 4O22A 3VBXA 5JH6A 5DLSA 2C30A 4BZOA 3VS1A 4APCA 4DT8A 4EZ5A 4XBUA 4W4XA 5HG7A 3I81A 2VO7A 3EKKA 5HX8A 5IUGA 1ZOGA 4OTGA 5HE2A 5JN2A 2BHEA 3F5PA 4GCJA 4OR5A 2QLQA 3IDBA 4W9XA 3FJQE 4CMOA 1BX6A 1QL6A 3FQSA 3VS7A 4IZAA 4XEYA 4YURA 5HNIX 2YISA 4M67A 4B7TA 1OKYA 5EDRA 3SD0A 5KUPA 2R3HA 1YXVA 2XKFA 3G9NA 2JEDA 3GQIA 3DXQA 1JLUE 4BWXA 3CBLA 3VQHA 5HORA 3DZQA 4FV8A 5BMMA 4P5ZA 4Y73A 4CCBA 2RFDA 3P08A 5KKRB 4J7BA 4YO6A 2R3RA 3PG1A 2OKRA 4NW5A 4U43A 4XG3A 2OLCA 3MIYA 3R8ZA 2BRMA 5F9EA 3BLHA 3QBNA 4PL4A 5T6KA 2YLEA 3WZUA 3VF9A 3KXMA 4C33A 3D5WA 3HZTA 1SVEA 3CGFA 3WIGA 4ZS0A 3KK8A 3MB7A 2PVRA 1PMNA 5KMMA 2G2IA 3P78A 5CF6A 4YJUA 1NVSA 4NTTA 3TV7A 2RL5A 4NJDA 4FG9A 2JDSA 1WVWA 5FTOA 2FUMA 4A4OA 4ORKA 1PXMA 3L9MA 4CXAA 1OIRA 3QX4A 3F6XA 3WF9A 2Z2WA 3FLQA 4EC8A 4IEBA 3R8PA 2YDKA 1YVJA 1KSWA 2PMNX 2E9VA 5FM2A 3BGZA 4J99A 3RPRA 3SW7A 3QRIA 1MQBA 3AC3A 1YHSA 4XX9A 4UXLA 1FBNA 3TKUA 5CAQA 5IQHA 1UWJA 3FV8A 3DXNA 3FMDA 5B0XA 3UIBA 5BNJA 4YGAA 4EH7A 3UYSA 4DH7A 4JQEA 3R2YA 3EQGA 3PA4A 1XJDA 2X9EA 4CZUA 4IB1A 4LYNA 4MF1A 2HXQA 4QMYA 4LGGA 4ZIMA 2XKCA 3HRFA 3PWYA 3VUHA 3E7VA 5L6OA 2ITWA 4MBJA 3NVKI 4BYIA 4JDJA 2JKOA 5DRBA 2YAKA 3QA8A 4FR4A 3FXZA 4YLKA 4IWOA 1PXKA 5KMIA 4Y5HA 4FGRA 3TJCA 1KE7A 5AFVA 1YDRE 4AWIA 3MFSA 5L6WL 4GFMA 5LVNA 5FXSA 5BVKA 1YOLA 2ZM4A 4FC0A 3BHYA 2QHNA 4WUAA 4UV0A 3BIZA 4QYEA 4AN3A 3BV3A 4PL5A 3I7BA 4YBJA 5CTPA 2BROA 3KN5A 3HAVA 2OJ9A 2QOCA 1QCFA 3R30A 4AW0A 3FI4A 4DEAA 1FGKA 1LEZA 4WG4A 3KULB 5JKGA 3POOA 4ZSAA 2WMAA 5DI1A 4YZNA 1PJKA 5EI6A 4LMNA 4YPDA 4E5WA 1H1WA 4H1MA 4IX6A 5K4JA 2R3FA 1J1CA 2H96A 4ASEA 2WTVA 3L8SA 4TWNA 1W82A 5CU0A 4UY9A 2C6IA 2I1MA 3HVCA 3DAEA 5HQ0A 5EM5A 3TI1A 4BBFA 1K2PA 2GTNA 3OC1A 3OFMA 3R7OA 4EBVA 1HCKA 1KOAA 1ZMVA 3ZS5A 3EN6A 4BDHA 5BX0A 4LL0A 4PDSA 3G15A 2P2HA 4GJ2A 2FSLX 4QP2A 4NYEA 1LEWA 3ORKA 3E87A 1Q4LA 4G3EA 2Z7QA 4NU1A 5LMKC 1R0EA 2V22A 3A7GA 4R1YA 1F3MC 3PPJA 3ZSGA 4X3FC 2I7QA 3D7TA 2QU5A 3MPMA 3TUBA 2WTWA 4L7SA 3CE3A 4YUQA 5IQEA 4F9YA 4HYIA 3LQ3A 3C51A 3HMOA 3SAYA 3SOAA 2VTHA 4EK3A 3QTZA 1DI9A 3I7CA 3OS3A 5AEPA 3KULA 4RVMA 4IFCA 4CLJA 4IAKA 4E6DA 3I0QA 4FNXA 3UPXA 2WMXA 1R3CA 2OK1A 2WMWA 2WQMA 3KL8A 3MBLA 3PA3A 3DBQA 2XK8A 4FGBA 4LV5A 3QC4A 3L8PA 4ZTSA 2QU6A 4OTDA 1ERKA 4OLIA 4EWHA 2YIWA 5LCKA 5IPJA 2YIYA 3C4XA 2XRWA 5EM6A 5F4NA 3AD5A 3CKWA 5FP5A 5HLPA 4I5HA 4KKEA 2G15A 3Q9WA 3DLSA 5AP4A 3VJNA 2O0UA 4O96A 3IK3A 2BAKA 4A7CA 4A9RA 4EYMA 3LXPA 4ZEGA 2ITTA 3FL5A 2GDOA 4BIDA 3SW4A 5AX9A 2F2CB 3KXHA 5AR3A 2Y4IB 3R7IA 3ORLA 4YJOA 4AS0A 4OBOA 2W1IA 3BE2A 4ZJVA 5EK7A 4PTGA 2CNUA 2QO2A 4EOQA 2W5BA 3DNEA 3OVVA 4E6CA 1V0OA 1Y57A 2O65A 4AA4A 5CSWA 4DINA 3NUAA 5EHYA 1ZYSA 2GS6A 4YLLA 2EUFB 4IDTA 3FEGA 2WEIA 2PVMA 4I1ZA 5EHLA 1M14A 4BBEA 3QXOA 5KZIA 2O3PA 1MRUA 4F0IA 2QOQA 2A27A 3E8CA 4EQUA 2QR8A 5BVDA 4O7VA 2UZTA 4I0RA 3AD4A 5IH5A 3OWLA 1PXLA 3II5A 4QTAA 3FMKA 3I5NA 4S2ZA 4BL1A 3NR9A 5JGDA 3LZBA 2WOTA 3DBFA 4IJPA 3QTIA 1L8TA 2LGCA 1ZARA 1GZNA 2JDOA 3HECA 4J8NA 2I0EA 3RZBA 4A9SA 4J96A 4QMOA 2GS2A 3D94A 3S2PA 4HVHA 2QHMA 2W7XA 3IW8A 4J52A 4GEOA 2ZAZA 4QQTA 2ZDTA 4FV0A 2C3IB 2X2LA 4WT6A 2G2FA 2W1ZA 4MD7E 3HRCA 3Q4TA 3OUNB 3FMNA 4U81A 3POZA 3G33A 3F3ZA 4NFMA 3GCQA 3QQHA 2VWIA 4NFNA 3UOHA 3UTOA 3MESA 3R73A 2VX0A 2WZJA 3QGWA 2UW3A 3TCPA 4OT6A 2A2AA 1H1RA 4RC3A 4R78A 2R3MA 3UQCA 3GCVA 4ZTMA 5C4KA 3FKLA 5CNOA 5H8GA 3GB2A 5LOHA 4BC6A 4LGDA 2GCDA 4HNFA 4UWYA 3A4PA 5L6PA 4O2ZA 2OZAA 5D10A 2F9GA 5IDNA 2JD5A 3DKOA 4DGOA 3HX4A 5JFSA 4TWOA 4ENYA 3RKBA 2VTTA 3VBVA 3V6SA 2PVNA 3BHHA 2YIXA 3CD8A 4RJ5A 5AAEA 5BUJA 4JG8A 3R1SA 3UO4A 3V8WA 4QT1A 2X7FA 2P33A 4KIOA 3EFJA 3A62A 4O0UA 5ANKA 3DFAA 3ZEWA 5HBJA 3JXWA 5IEYA 2BTRA 3Q4CA 2DUVA 5J79A 5KMJA 2Y0AA 5GIPE 4EONA 1BL6A 1OBDA 2HY81 3MH3A 3FYKX 3P7CA 4BKJA 3VVHA 3W10A 3QCYA 3IDPA 3CY3A 1P4OA 4FODA 4FT3A 4K2RA 4TRLA 5F95A 5HESA 1Q8UA 1Q8YA 3U55A 2YDIA 4ZZOA 3MY5A 4HCVA 5CVGA 5FBNC 3FI8A 3GC9A 4RVTA 1OL7A 2OSCA 2WTKC 4RX5A 2XJ2A 2XS0A 2RFSA 4D2WA 2W99B 1I44A 3KB7A 4RFMA 3HV4A 5A6NA 4FUYA 3OD6X 2PE0A 4TWPA 3Q53A 4KKHA 4MXXA 4ARKA 4TYEA 4CFXA 4MEDA 2GNJA 4X7QA 4BZDA 1Z5MA 1OKVA 1H0WA 2YIQA 4NT4A 3UOKA 3O71A 4ZSEA 2R7IA 2Z7RA 5AUYA 2X9FA 2XEYA 5LVMA 1DAWA 2QCSA 2C0TA 3VS4A 3VJOA 4EJ7A 4OUCA 3RCJA 1FVRA 3R21A 2HW6A 4IB5A 4M66A 3M42A 4G3CA 4JLCA 1M7QA 3BLRA 5IUHA 4GVAA 3Q96A 5E91A 3QTSA 5DE2A 4CQEA 3MGYA 4O0RA 5M08A 2XP2A 2OG8A 4KSPA 2X39A 4FKSA 4MXZA 3TNPC 3P79A 5ETCA 5IQDA 5J9LA 3TZ8A 4D5KA 3ODYX 2PMLX 1MQ4A 1H08A 4D9TA 5I5ZA 2YZLA 5M09A 3MVMA 2CKQA 3DAJA 1OMWA 4DFZE 4RSSA 3ZO2A 4ALUA 4QMSA 5CLPA 3EKNA 3JVRA 3KVWA 4IM3A 5DGZA 5DIAA 5GHVA 3R9OA 4A07A 3A60A 5EQYA 2DWBA 2VGPA 4A06A 3BYOA 4IM0A 4DG0E 5B7VA 1UU7A 3KCFA 4ALWA 5FEEA 3OWKA 1XR1A 2REIA 5JZNA 3TKHA 4DFBA 3DS6A 1A06A 4XG8A 4HGTA 5A4TA 4BVUA 4NM0A 3LCSA 4G6NA 3GNIB 4GK4A 4IVBA 5DRDA 2W1EA 4Y8DA 1JQHA 4V04A 3BRBA 3O7LB 2GQSA 5AP1A 3RM6A 4KS7A 1ZYLA 2BIKB 1M2PA 4GT3A 4S32A 1U5QA 2UZOA 1YI6A 2AUHA 4QMXA 2DYLA 4C4JA 2J0LA 5ACKA 4BDDA 2QO9A 5JQ5A 5LMBA 3CJGA 3FLSA 4FKGA 3DJ5A 4I6HA 3PLAE 2HYYA 2GHGA 3FLNC 2BKKA 4X21A 3P4KA 4USDA 4UB7A 2F4JA 4GYGA 3QC9A 3TEIA 1YOMA 3HV6A 4I41A 1NVQA 4YHTA 3CD3A 3EQDA 3EN9A 5BVEA 4DCAA 3EZRA 1DM2A 1TVOA 2Z60A 1WVYA 4PPCA 3SVVA 2E9NA 3NUPA 3IGGA 2X8IA 4WUNA 3O51A 4MTAA 5EG3A 4IZ7A 5L2QA 3CJFA 2YHVA 5JRSA
chains in the Genus database with same CATH superfamily
4XG9A 2YFXA 4AZTA 5BMSA 4LRJA 4UZDA 2BAQA 4L43A 3VC4A 1YXSA 2JKQA 4NM5A 4Q5HA 4GUEA 5EQEA 2UZLA 3R0TA 2QOKA 1JKKA 1KUTA 3KIOC 3BHVA 1XBCA 3FMMA 3NZ0A 3RAWA 3LLAA 1PXOA 3W16A 2LAVA 3FMLA 2OH0E 3BWFA 4EK8A 1NW1A 4IDVA 4QMNA 1LR4A 4PL3A 2NNWB 3EFLA 1OUYA 4AW2A 4HPTE 3PFYA 2JGZA 3IW4A 5TKDA 3R8VA 4R3CA 3VO3A 1JWHA 3AT2A 1BMKA 1MP8A 4TKSA 4BIBA 4XP0A 4CT2A 3QTUA 1EH4A 5D7VA 3DU8A 3NEWA 4E4MA 4IWPA 3GU4A 5M44A 1OM1A 3GFWA 5JMSA 3RK5A 4E4LA 2HWPA 2R3LA 1OVEA 4WD5A 3QZIA 2EXMA 5AAGA 3PLSA 2PPQA 3Q60A 3UVQA 3THBA 1YWNA 2UZBA 5M57A 4QO9A 4AZSA 1WBVA 4IX4A 1H26A 4N6YA 4B9DA 4DEEA 1MRVA 2RF9A 3BBWA 3PJ2A 3GUBA 2J0MB 1CDKA 4KKGA 4ERWA 3EQHA 3LLTA 5D7AA 2C6DA 3VWAA 4UYAA 4DFUA 5IQCA 1CSNA 4AOJA 4C3FA 2IN6A 4J8MA 2PMOX 3F5XA 3AG9A 2Y9QA 4XRLA 4FV5A 4FE2A 4D1SA 4IVCA 4QTCA 3ZOSA 4ALVA 3QRJA 4BDCA 2YAAA 5KX8A 1J91A 1G3NA 2QG7A 5D9HA 5CU3A 3LJ1A 2V7AA 3P7BA 4G3DA 2AQXA 3PSCA 4EQCA 3FWQA 4FSMA 4BJJA 4LGHA 2XYNA 3FPMA 3ZH8A 1G8SA 5EDPA 3BV2A 2VO0A 3RPOA 1OIQA 4EC9A 5IDPA 4EBWA 4PQNA 5HO6A 4AT5A 4ACHA 4U44A 1OL6A 4L42A 3CTQA 4PMSA 2I0HA 4YNOA 5IA2A 3DK3A 4RIWB 5AJQA 4XHKB 5JFXA 5ITAA 4EQMA 3R04A 1M52A 3CLYA 4BB4A 1IRKA 2XBAA 3D2IA 1WCCA 4MX9A 4WIHA 5CT7A 3E8EA 4GV1A 3UJGA 4C7TA 4UXQA 2B53A 3QD2B 5CAOA 3DNDA 3KGAA 4O7WA 3RJCA 2OFUA 2AYPA 2W1DA 3DGKA 3HP2A 4G5JA 2A4LA 3ZFMA 2C3KA 1GIHA 4DGLC 4USFA 5HG5A 2X0PA 3RNYA 2CGUA 3HNGA 4RFZA 4YZ9A 5K0KA 4CKRA 2BIYA 4NH1A 4CYJA 3O2MA 3PJ3A 2PE1A 3KRWA 4FVPA 4W4WA 2ERKA 3R6XA 4IACA 1BL7A 4Y46A 1WZYA 4C59A 3W0MA 4EOOA 2J5EA 4TT7A 5EOLA 4HGEA 3PY0A 2ZM1A 3CTJA 4P4CA 3RAKA 3T9IA 3ZM4A 5JFWA 1YWVA 5CI6A 5K4IA 4GIIA 4O0WA 3ZFXA 4FIJA 3K2LA 2IW8A 4BZNA 4CFUA 3NW7A 1MUOA 4DEDA 3MH0A 3OEFX 5FDPA 4O21A 4RIWA 3IS5A 5HTIA 4DGMA 3VF8A 3A7JA 4AFEA 2E9PA 1Q41A 2PVJA 4NUSA 4FEQA 3NW6A 4M69B 4MNEA 3AMYA 2X7GA 4MXYA 4D4VA 4GG7A 4GKIA 4EOIA 3MDYA 2YZAA 3GU7A 3LE6A 2R3KA 4D2TA 2R3GA 4QPAA 2XBJA 4QMZA 4FSRA 4FTIA 4KB8A 1YXTA 3OT3A 3R1YA 3KRJA 3SKCA 3VS2A 1WBNA 4ZLOA 4LRKA 1WFCA 4MCVA 4TYGA 5E8ZA 3F3TA 4C4HA 2ZV2A 4L44A 3RPYA 4EZ3A 4TY1A 4BDIA 4YP8A 3ORMA 2IJMA 3MVJA 3ORZA 5CZIA 5DG5A 2V7OA 3PA5A 4RQKA 3Q04A 4L00A 3PP1A 4NIFA 4J71A 4ZOGA 2WMRA 1OL5A 2RFNA 4GH2A 3AOXA 2JKKA 4X2NA 5C03A 5I0BA 2R4BA 1OPKA 1CKPA 1YI4A 3M11A 4ZSLA 4LFIA 2ZMCA 1RDQE 4ZY6A 4O7TA 3OWPA 3PZHA 4O4DA 4ZTRA 3HKOA 4U80A 2CNQA 4HVDA 4YU2A 2GQRA 3A7FA 3GOPA 4JDKA 4EHEA 3UZTA 4FV1A 4M69A 4QYYA 3HMNA 2FA2A 5BVNA 4AF3A 2PWLA 1YXXA 3OHTA 2YM7A 4I3ZA 4YZMA 4X6QC 2W4OA 4E26A 3PJ8A 1WMKA 5GIOE 1W8CA 4IQ6A 2WELA 2FO0A 4G1WA 4PPAA 3RAHA 4ANQA 4MNFA 3S3IA 3ZDIA 4FICA 2PTKA 4C3PA 3NW5A 4G34A 5DR9A 4CT1A 4HNIA 2HWOA 3R02A 2O63A 4GU6A 3N9XA 4GFGA 4RJ8A 3UMXA 4BCNA 2XK3A 1PMUA 5C4LA 1W0XC 1PKDA 3OF0A 2B7AA 5AP5A 3UOJA 3OY3A 5AR5A 3EJ1A 4MWIA 3ZUTA 4CZTA 4GFOA 4IH8A 4S31A 1PW2A 4L6QA 4JS8A 3RINA 3QXPA 4JJRA 5GJGA 1OBGA 4IJ9A 1BLXA 3MW1A 2X4FA 2XNGA 3COHA 4MD8E 2W5AA 4U5JA 5GNKA 4D0WA 3C13A 3KREA 3FZSA 3MFUA 3P1AA 4XRJA 4D2VA 4UMRA 5AUTA 5CEKA 2WMTA 1UA2A 3KEXA 4RQVA 3TDVA 3FZTA 4U45A 3V5LA 4AGCA 1PMEA 3E64A 4FNWA 4YJRA 5EDQA 4C2WA 4GK3A 4CKJA 5E8YA 3F66A 3VUDA 4AGWA 4BRXA 4R1VA 4JQ7A 3U9NA 5J8IA 4K18A 3O7LD 2ZMDA 3UPZA 4BF2A 5HO8A 4EOLA 4OW8A 3ZONA 2JBPA 3FYJX 5LWNA 3SXSA 3RPVA 1TKIA 4KD1A 5T68A 5E4HA 1J7LA 4WRGA 1Q8WA 3GU8A 3F7WA 4IFGA 4DTBA 2UVYA 4MYGA 4U40A 4HPUE 3UODA 4CD0A 5IA4A 2WQOA 4AU8A 3A8WA 3ZXZA 4L3JA 5CZHA 1F0QA 3R7EA 2XIKA 4O4BB 4QTDA 5J9YA 3ZHPC 3I79A 3IPHA 4WSQA 4AA0A 3HL7A 5EYMA 5DYJA 3EL7A 3BWJA 5IH4A 2ZM3A 5EYCA 4EK4A 3QZGA 2YN8A 4F08A 4V05A 3R8UA 4FSZA 5A6OA 2B9IA 3D83A 1CM8A 4RT7A 1P2AA 4QMLA 2OIDA 1R0PA 4BI2A 1PY5A 3QHRA 3AC1A 2O64A 5LVLA 4O81A 3TDWA 4CEGA 4YJPA 4CTBA 5CAVA 3BELA 2UUEA 4F7SA 4WNPA 4D4YA 2VZ6A 4JIAA 4AT3A 5FQDC 3OOGA 4F0FA 4HVGA 1VYZA 3DKCA 5A4EA 2J50A 4MH7A 4AGUA 4B0GA 4JNWA 1JAMA 3V01A 2NRUA 5L2WA 2CGVA 3O8UA 5DMZA 1ZXEA 4G2FA 4I6QA 5BQ0A 4FTTA 2VTQA 3OCBA 2ZB1A 3RAIA 4EH3A 5TO8A 1R1WA 3UOLA 5J9ZA 1WBWA 3KQ7A 1P14A 4H1JA 5ACBC 1GZOA 2BVAA 4FK6A 4F65A 5M4IA 3ZTXA 3D5XA 3QD0A 1OL2A 3WYYA 1M17A 1IASA 1PXPA 1XBAA 3QQJA 5C26A 5D12A 3TV4A 3DLZA 3KXXA 3RTPA 2E9OA 5DT0A 3MS9A 2QOIA 2VTRA 3MH1A 4RPVA 2CSNA 2VTMA 3B8RA 3OOMA 4ITJA 5BPYA 3WI6A 4EH9A 4JMQA 3SDJA 5AA8A 3QTQA 3REPA 1NA7A 3IGOA 4QMPA 2ZV9A 3LFEA 4FOCA 2J90A 4YTIA 4AG8A 3F2AA 4DBXA 3FHRA 5FXQA 2ETMA 5AIRA 5B2LA 3H4JA 2W9FB 4RX8A 3G9LX 3WILA 3LMGA 4I22A 4MBLA 4Z3VA 4O4CA 5AUVA 4FTCA 4KSQA 5KMLA 3W0RA 1LP4A 3AC2A 4GUBA 1DAYA 1YXUA 5JQ8A 2V55A 4FZDB 3L9PA 3BU5A 3PRIA 4DTAA 1FOTA 1GY3A 3DJ6A 2HZ4A 2HIWA 2YCSA 1W7HA 2VWUA 3BGPA 2BZIB 3KC3A 4S33A 2X0QA 2SRCA 3DBCA 4KIKB 4AW1A 4LOPA 1FMOE 2ONLC 4D0XA 4EZ7A 2P55A 2R3OA 4EKKA 4ANLA 1JKTA 2OWBA 2Q0BA 3GCPA 2FGIA 4PF4A 2IZSA 4PV0A 1ATPE 2B9FA 4W8EA 4OBQA 2WTDA 4BCIA 5CXZA 5CYIA 4KBKA 4B8LA 4K6ZA 1OI9A 1FVTA 2YEXA 5J7BA 3FQEA 3VW8A 3UG2A 1JSVA 5J95A 3ZO1A 2BZHB 2XH5A 4B6LA 4CFFA 3LMIA 3HMPA 3I1AA 4QP3A 4NK9A 1RJBA 3QQUA 4HW7A 3ULIA 3ORPA 5H2UA 5JGAA 2VO3A 5CAPA 3UC4A 3JS2A 4C37A 5AR4A 4D55A 2PZIA 4XV9A 4EOJA 3MY0A 4OAVB 1VZOA 5GZ9A 3VS5A 3LCTA 3QCSA 2W5HA 2XJ0A 3KVXA 2YM3A 3NUUA 4KIKA 4MXAA 3W8LA 5IG1A 3R1NA 4FL3A 1V1KA 5HEZA 1XH6A 2WTCA 2QOHA 2YCQA 4GVJA 5HG9A 3SOCA 4O84A 3V04A 1AQ1A 4MAOA 3ANQA 5FXRA 5EM7A 3K3JA 3H0YA 3GCSA 3DDQA 3FI2A 5M4UA 3D15A 4TZRA 4XOZA 2XK9A 5HZNA 4DHFA 4E73A 2QODA 3EFWA 4RLLA 1M2QA 1Q61A 3FC1X 2YABA 3QTRA 3LOKA 4AE9A 4ANSA 3HV5A 2CGXA 4RJ3A 2WFYA 3VBTA 5A14A 5IA1A 2Q0NA 2VN9A 2CLXA 5EI2A 4F7JA 2G9XA 5C1QB 5JT2A 3MB6A 3R83A 4L46A 2OZOA 2PVLA 4H3QA 5CXHA 5HVKA 4U3YA 3DT1A 4YZDA 2JDRA 1VLRA 3MVHA 3AGLA 3TACA 2GNLA 5LWMA 4NKAA 3IDCA 1B39A 1JOWB 4I6LA 5HU9A 4DF3A 2XVDA 4DEGA 1TQIA 4U8ZA 5BVFA 4IX3A 2UV2A 5EW8A 4JRNA 2OJJA 5CS6A 3QQLA 5E90A 4RFYA 5HHWA 5KE0A 3CIKA 4AOIA 4G9RA 4JBVA 3PUFC 4MVFA 4FV4A 4I24A 5A4CA 1RE8A 4FX3A 4RLKA 3WF5A 3CS9A 5HG8A 1OGUA 3OT8A 3R22A 4F6SA 1ZZLA 3AC4A 3ET7A 2R7BA 3UO6A 3TM0A 5G1XA 4DLIA 5HE3A 4O27B 4JG7A 2C69A 3ZSIA 4HGLA 3W1FA 3ID6C 4RGJA 3MA3A 4J97A 3R63A 4IAZA 4Y72A 3QTWA 5JZJA 1AD5A 5FEQA 1OPLA 4GSBA 3UMWA 4BTKA 4U79A 5AR8A 4EH2A 2PL0A 4QMQA 4FEUA 3FAAA 4J1RA 4M0YA 5HLWA 3W0NA 2R0IA 4ID7A 2OH4A 4M68A 4JI9A 3T3VA 4BDBA 4Z16A 3P7AA 3OW3A 3WIKA 4FKLA 1ZLTA 3LQ8A 2HZIA 3NYVA 3MN3A 4U9AA 4V01A 3LVPA 5CSVA 2VUWA 3PWDA 4JBQA 5HNGA 2XF0A 3IW6A 2UZUE 2BR1A 3QGYA 2HZNA 5C8NA 3TTIA 4D2RA 4I21A 3F7ZA 4MD9E 2CJMA 3VUGA 5LVPA 2Q83A 4EK5A 2H34A 2VX1A 2UW4A 3EL8A 3ZBXA 4WA9A 5K9IA 4R5YA 3S0OA 3PJ1A 1WAKA 4DH8A 3VBWA 3PIYA 3DK6A 2WB8A 3AMAA 4RIXB 3OTVA 3D4QA 5CY3A 3K54A 4DITA 4WOVA 1OL1A 5E8VA 4M0ZA 4RC4A 4G9CA 5G6VA 1TQPA 4AW5A 3WARA 4MUQA 1Y8GA 3VN9A 1BUHA 3R7UA 5AA9A 2Y7JA 3EMGA 4QOXA 5AV2A 4F1MA 4O7ZA 4M8TA 5HBHA 3QU0A 4Y85A 2X8DA 2J6MA 3LHJA 3NCZA 3DQWA 4O6LA 5CSHA 5FBOA 5HX6A 4O1PA 2ITVA 4Q5EA 5L2IA 1W84A 3GC8A 3H9RA 3MV5A 4QP7A 4CGAA 1GIJA 4HVSA 5CSXA 5EHOA 3DOGA 1YW2A 1UNLA 4FMQA 4CNHA 4KUJA 3CQEA 5JEBA 2W96B 1Z9XA 2Y6MA 2XMYA 2YCRA 2I0VA 4X2KA 5DVRA 3OUKA 2X8EA 2XNOA 3P9JA 4RZWA 3R9HA 1Q3WA 4Z7GA 5CAUA 2YM5A 3LAUA 4X6RA 3C9WA 3AKKA 3VUKA 3BQRA 4ZZNA 4M12A 4E1ZA 4AQKA 3FLWA 3QUEA 3TNQB 2R5TA 3E63A 3C4WA 4E6QA 3VS0A 4CCUA 3FQHA 4I6BA 1JKLA 5FWKK 5IQGA 4KNBA 3UQFA 3MFTA 2YWPA 4YC6A 2J0KA 4TNDA 3UIMA 3CSVA 3HMMA 3PY3A 4QP6A 3W0SA 4IC7A 2XIXA 2X4ZA 4I5MA 4JX3A 3Q9YA 3IG7A 3UYTA 3ZBFA 4LOOA 4O7SA 4FV6A 1REJA 4WSYA 5LJJA 3UDSA 2R3IA 2G1TA 2JIVA 4IC8A 4DTKA 2CNVA 1U46A 4FKVA 4OT5A 5IISA 4U97A 4DHZA 5HU3A 3C0IA 3O8TA 4DDGA 4F7NA 3VRZA 2V62A 1ZZ2A 1SVGA 2WMUA 3KFAA 3HYHA 2IVVA 5C8MA 1Q5KA 4O0YA 3VBQA 3NCGA 4CG9A 3P5KA 3D14A 4LOQA 2W4JA 3QZFA 2QO7A 3PZEA 5JK3A 2OBJA 1UNGA 3DDPA 3UO5A 3OWJA 4YTCA 4USEA 1V0BA 3RWQA 3NS9A 5KMOA 4CFVA 2YCFA 4BTMA 3F5UA 5IEVA 3LCOA 2BFXA 2X81A 3BI6A 4O7YA 3V5WA 4YJVA 2VWYA 5F1ZA 1P5EA 4B8MA 4ANOA 5E8TA 4BHZA 2OIBA 5BUEA 5JRQA 1OB3A 3TNWA 4G3FA 3ITZA 3Q2MA 3D7ZA 4FVQA 1YDSE 4XYFA 1M7NA 3BU6A 3DAKA 3LJ2A 2XZSA 2ITOA 2QOBA 4H58A 4EORA 2CKPA 5E1EA 4AXFA 1Y8YA 4BHNA 2W06A 3DPKA 2FYSA 4J98A 2YM4A 4WBOA 4FVRA 2R3JA 4JG6A 4UMPA 2BDWA 2F7XE 4JT3A 2W0JA 4R7IA 3ACJA 3CTHA 3MJ1A 4G16A 3LM0A 2XKDA 5E8WA 1B38A 3FC2A 4DA5A 3HUBA 4MK0A 4Q2AA 4OTRA 4U7ZA 1G8KA 4HYHA 4ACGA 3UIUA 4W9WA 2GNIA 2PE2A 1PXIA 4GT5A 5CENA 3ZLXA 4D2PA 2OF4A 1J3HA 4R7HA 2IVUA 3WZEA 4H39A 4QP4A 4FI1A 4CMUA 1Q99A 3DFCB 1PXNA 2VV9A 3OXIA 4AGDA 4LQMA 4UYNA 3W2SA 5KHWA 4BY9E 2WAJA 4IB3A 4XV3A 3TT0A 2PHKA 5ANGA 4NM7A 4XJ0A 4D28A 4DC2A 1IAJA 2R9SA 4D2SA 2OW3A 4KIQA 4DFXE 1FVVA 3G0FA 1WBTA 4NEUA 2GMXA 3I4BA 1I09A 3B2WA 4XLIA 3VS6A 3SXFA 4JAIA 4DBNA 1URCA 3ZRKA 3BYMA 3LXNA 4D9UA 4EJNA 4GG5A 5FDXA 3Q3BA 4FSYA 3FSKA 4ZP5A 5ANIA 3U6JA 5IA0A 2ETKA 2BDJA 1PYXA 4I6FA 3C4FA 3VBYA 1LPUA 3SHEA 1VJYA 4QYHA 4DG2E 3G6GA 3DY7A 4M7IA 1E1XA 5KKRC 4RIYB 3Q4UA 2VTNA 3O8PA 3Q5ZA 4XP2A 3UBDA 3SLSA 4CQGA 5HBEA 4CG8A 3Q5IA 3PE1A 1IR3A 2O2UA 3N4VA 2VGOA 4TL0A 5EKNA 1ZMUA 3RI1A 4BCMA 4RC2A 5KNJA 4CRSA 1ZYJA 4QPMA 3KMUA 3L9LA 4I20A 3FZOA 5ANOA 4PNKA 5L2SA 2I6LA 2WOUA 4AOTA 2E9UA 2VU3A 4ZY5A 3QQFA 5DOSA 3QX2A 1JPAA 4LM5A 5T3QA 5IMEA 4PMPA 4D4SA 3EZVA 4F9AA 4X3JA 4BGGA 2ITYA 3RGFA 4CKIA 4O7RA 4ZK5A 4E4XA 3R7VA 2JC6A 4BCQA 2VTOA 3F69A 5AR2A 4DG3E 3QALE 1Y91A 3RZFA 5CQUA 2GPHA 1Q8ZA 4GT4A 4IAYA 5M55A 4ZAUA 4CFWA 1H4LA 3RMFA 1SVHA 1B6CB 4AN9A 4AZVA 5GJDA 3PXRA 5I9VA 2WTIA 5IA3A 5C9CA 4BBMA 4EOKA 4JBOA 3QD3A 5DR2A 3BHUA 4FV9A 4U42A 4DGGA 3W0OA 1GZ8A 5M06A 5L8LA 4FZFB 4F6UA 3KKVA 3FXXA 3QWJA 5DA3A 4JDIA 4F9WA 4D1XA 3FE3A 3P86A 5I9YA 1UU8A 1PMVA 3HV7A 2XNEA 3FZPA 5IU2A 4QMTA 2UZDA 4ITIA 3RCDA 4NWMA 4FEVA 2R2PA 4XLVA 2ETRA 4BDFA 5AMNA 4ZSGA 3V8TA 3GCUA 2C4GA 2I40A 3KRXA 2C5OA 2C6OA 4IHPA 2FH9A 5AP0A 3V3VA 3MA6A 1K3AA 3ZO3A 2KULA 4C61A 2PULA 1IAHA 2WGJA 3HDMA 4PX6A 4I94A 4EL9A 2B4SB 4YLJA 2OJGA 5CVFA 4GL9A 4C0TA 4OTWA 2PU8A 3W0QA 4X3FB 3UC3A 4ZY4A 3JY0A 2J9MA 2P4IA 2PZYA 4TTHB 4FG7A 2X2KA 4IB0A 3SQQA 3JVSA 4ZZMA 3LFSA 4Q9SA 1WBSA 3W18A 2G2HA 2XK6A 3UP7A 2UW9A 4AQCA 4WNOA 5HD7A 5I3OA 1A9UA 5DBXA 4R7BA 2B54A 3C4EA 4ZLZA 3GVUA 4FTAA 2PZPA 4XMOA 3UDBA 4G5PA 4E20A 4IIRA 3U9CA 3VULA 3ZZWA 3GU6A 5M51A 3CP9A 4XH6A 5K5NA 4FKIA 1GJOA 2R64A 3FDNA 3LXLA 3GQLA 3I5ZA 1YKRA 4O0SA 4I93A 3TJDA 3BU3A 5TF9A 1W2DA 2WTJA 3BLQA 5H8EA 3EYHA 1XQZA 5HI2A 3ZXTA 5I3RA 3EQIA 4PPBA 3U4WA 3NIZA 4BI0A 2GFSA 4QP9A 5EKOA 3QF9A 3O5AA 3W2QA 5M56A 2XNNA 4RRVA 4RZVA 3T9TA 3A4OX 3H30A 3C5UA 4M97A 3NFFB 2H8HA 1H8FA 3GXLA 3PPZA 2W17A 3R71A 4MBIA 3CKXA 3EH9A 4FZ6A 4APPA 4GS6A 2HENA 5DPVA 5LVOA 4O82A 5J7HA 2YWVA 3HRBA 4S34A 3F5GA 2CKOA 3ENMA 2BTSA 2X1NA 4L52A 3ZFYA 2R3QA 5FTQA 2OI4X 2ITNA 4R3PA 3G5DA 4OBPA 1SYKA 3AGMA 3DV3A 4FTLA 1ZMWA 3L9NA 3KXNA 1YQJA 4HCUA 4UMQA 3U51A 4UMUA 2JFMA 1Z57A 2BILB 2QLUA 2QQ7A 3QCXA 3DKFA 4N0SA 4E7WA 3I60A 1M2RA 2XNPA 5HTBA 4DHJA 3O23A 4OAUC 3VONA 3MIAA 5AP2A 2B1PA 1KV1A 2B52A 2B9JA 2Y4IC 4ONAA 5ETAA 3RVGA 5CANA 3H9FA 5TR6A 2GHLA 3UVPA 4FG8A 2BUJA 3W55A 5KBRA 1S9IA 4L01A 4PDPA 1G5SA 4ZTHA 1J1BA 3DZOA 3GBZA 3ZZEA 4C3RA 4HZSA 2OGVA 1UU3A 1H01A 3IQ7A 2GS7A 2IW9A 4HCTA 4BKYA 1UKHA 5B2MA 4IBMA 2WMVA 1QPEA 1ZAOA 2YM8A 2WMSA 4L45A 1VEBA 4PP9A 5CU2A 3VIDA 4FSQA 4KS8A 1JSUA 4C38A 3LFDA 3QZHA 1HOWA 4IAIA 3W0PA 1ZYCA 2NP8A 3KXZA 5AV1A 3QWKA 3TIYA 2WEVA 4K0YA 4IVAA 4KABA 1OIUA 1YI3A 1XH9A 4BDEA 4IZYA 2JFLA 3RK7A 5EQPA 1DI8A 2WQNA 5FUTA 4TXCA 3O50A 2FSMX 5IKWA 2OIQA 3K5UA 4K9YA 4BKZA 2OU7A 4BCKA 3G51A 4QDVA 3W2RA 4D58A 3PUPA 5BUIA 3DKGA 4QPSA 4FIFA 4ZXTA 3R8LA 1ST0A 2ITXA 4FTNA 4O0XA 4QMUA 2C6MA 3HV3A 4Y95A 4C4GA 2BKZA 2IZRA 3E5AA 3CC6A 5DWRA 1J7IA 4BIEA 2O8YA 2RFEA 5L3AA 2R3NA 2QURA 3JPVA 4YC8A 3NWWA 5HVYA 4OTPA 3N4UA 2GHMA 3LJ0A 1AGWA 4ANBA 2ZJWA 4FSNA 3E88A 2C6LA 4M13A 2YERA 5AX3A 5GJFA 3EQPA 4F64A 4D1ZA 4EH8A 5HIDA 2WTKB 1ND4A 2GFCA 4YBKA 5F20A 2UW7A 4S30A 4FKOA 1ZRZA 4I92A 1H1QA 1YRPA 5AV0A 4BWKA 5CASA 4YSMA 5I9ZA 3HEGA 4RWJA 3R9DA 3RM7A 4BDJA 2PYWA 3E92A 4I0TA 3BKBA 4F9CA 5CEOA 4FT0A 4IADA 5AR7A 3QKMA 2QOLA 5A46A 3UVRA 3JUHA 1OPJA 4B4LA 4EK6A 1URWA 5KMNA 3LMHA 4F78A 5KCVA 4O7LA 3DQXA 1BI8A 3DXPA 2BRNA 4P2KA 3ZUUA 2QOOA 2UW8A 2QG5A 3ZO4A 4DHIB 4UBAA 5CEPA 3DB6A 3KMWA 4FSTA 4ZSJA 4N57A 3P0MA 5FG8A 4FEWA 4FYNA 3SGCA 4IVDA 5EFQA 2W1CA 2WXVA 3UIXA 2JIUA 5K0XA 3UNZA 3HMIA 1H1SA 4A9TA 4FSWA 3A99A 4AP7A 5AUZA 4K11A 5HIEA 3ZCLA 1QMZA 5E1SA 3JYAA 2YLFA 3PYYA 4M15A 5C8KA 3BX5A 2CPKE 2UW0A 3KF7A 3PVGA 4EH5A 3N4TA 4I0SA 4EKLA 5KHXA 3SG8A 2J7TA 4RX7A 4UN0C 3OROA 5HICA 4A9UA 2HZ0A 4TN6A 3V6RA 3FMJA 4QYGA 2CCHA 5K5XA 4JR3A 2XCHA 3ANRA 2GTMA 2VNWA 2WNTA 3OG7A 3EN5A 5A9UA 3LPBA 3ZEPA 2QONA 2PUNA 5FTGA 3ORTA 3S95A 1GZKA 4FIIA 5DR6A 4AZEA 2VWZA 5E8UA 3U87A 3I0OA 4PP7A 4KBCA 2BHHA 4I23A 3A2CA 3OEZA 1W83A 3D9VA 3I6UA 4A4XA 2Z02A 3BQCA 4FT9A 4ASZA 1XKKA 3MWUA 1OUKA 1MRYA 3OTUA 1KWPA 5ETIA 3FKNA 3RP9A 1T45A 2EB3A 3FI3A 2UW6A 4YTFA 2IVSA 3ZU7A 4RA4A 4Y83A 1TZDA 1Q24A 4E3CA 3NYNA 2IPXA 4X0MA 1H07A 4I5PA 3VUTA 3OZ6A 5ETFA 4O0VA 3QLGA 4E5BA 2ZB0A 4FTOA 4U41A 2C6EA 2FSTX 5CF8A 2J5FA 2C6KA 2AC3A 2BRGA 4LV7A 2W9ZB 3F3VA 2C68A 4GW8A 3C0GA 2GSFA 4C8BA 3PVUA 2IZTA 2WHBA 5AIKA 3IOPA 1O6YA 4II5A 5L8JA 4C62A 3B8QA 2EB2A 4I4FA 3OP5A 5FM3A 4YSJA 2PVKA 4AUAA 2XIRA 5CX9A 3TZMA 4WRSA 5AM6A 3TUCA 3RALA 2CCIA 3PXYA 4DT9A 4NCTA 5CU4A 3FPQA 3QKLA 3WZKA 1K9AA 2VWWA 1TFFA 2QKWB 2Z7LA 3BL9A 2NO3A 4FKJA 2VWVA 2WIPA 1CMKE 5LCJA 3CGOA 4NM3A 2PMIA 1PXJA 5CI7A 4BGHA 1WBPA 1H25A 1YHVA 3FZRA 5HCXA 3BEGA 4XG4A 1H1PA 4ACCA 5CF4A 4X2GA 2BPMA 3EFKA 4YJNA 3E3PA 3EQRA 3LIJA 3W2OA 1Q8TA 1YDTE 3AC8A 3CXWA 3PFQA 3TN8A 4YPSA 3MSSA 4IAFA 4RMZA 2W1HA 2QOFA 1OECA 4HZRA 3DTWA 4DE4A 3F61A 2J0JA 3G6HA 3QRUA 2UVZA 4F9BA 1OKWA 2R0UA 3ENHA 3DA6A 4GJ3A 1VYWA 2JDVA 2XNMA 3QL8A 2XKEA 5D1JA 4IM2A 2YDJA 3NSZA 5HD4A 4DGNA 3BE9A 4DEHA 3CPBA 2H6DA 1SM2A 3IO7A 3PY1A 3Q9ZA 3QFVA 3LCDA 4GMYA 4WBBB 3ROCA 4ACDA 4G6LA 4C4FA 4N6ZA 4EHGA