4QT1A

Jak3 kinase domain in complex with 1-[(3s)-1-isobutylsulfonyl-3-piperidyl]-3-(5h-pyrrolo[2,3-b]pyrazin-2-yl)urea
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
289
structure length
277
Chain Sequence
PTIFEERHLKYISQLGKGNFGSVELCRYDPLGDNTGALVAVKQLQHSGPDQQRDFQREIQILKALHSDFIVKYRGVSYLRLVMEYLPSGCLRDFLQRHRARLDASRLLLYSSQICKGMEYLGSRRCVHRDLAARNILVESEAHVKIADFGLAKLLPLDKDYYVVREPGQSPIFWYAPESLSDNIFSRQSDVWSFGVVLYELFTYCDKSCSPSAEFLRMMPALSRLLELLEEGQRLPAPPACPAEVHELMKLCWAPSPQDRPSFSALGPQLDMLWSGS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Tyrosine-protein kinase JAK3
publication title Scaffold hopping towards potent and selective JAK3 inhibitors: discovery of novel C-5 substituted pyrrolopyrazines
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 87
structure length 277
sequence length 289
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2014-07-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4qt1A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4qt1A01
3T9TA 5EM7A 5CNOA 3CD3A 3ORZA 2J6MA 4J99A 2F57A 5IH5A 2WAJA 3QUPA 3G0EA 3VHKA 2QHMA 3ORLA 5AR5A 3BHUA 1GAGA 5E8ZA 4ALVA 5CEOA 4CYJA 4O0YA 2Y4IC 2IZSA 3JUHA 2P33A 3GXLA 3O0GA 4OBOA 2XUUA 2JDRA 4ZLOA 3WF7A 3EWHA 5IH6A 5AFVA 1PXIA 4LRKA 3THBA 2WKMA 3SVVA 4U7ZA 5D12A 4P90A 1WBOA 2QOOA 5HVYA 5KX8A 3FBVA 4GS6A 4M14A 4OUCA 3R00A 5IQDA 3VUMA 3UIMA 5CEKA 2UV2A 3EN7A 4RX9A 3HRBA 3NGAA 1IAHA 3OWJA 3TKUA 3VS5A 1OL6A 4QP6A 3NAYA 3BE9A 4MXYA 2OIQA 2UZBA 4WIHA 5FTGA 1KWPA 3P79A 4LOOA 1Y6BA 2FVDA 4I3ZA 4M97A 4RX8A 3UP2A 2X8DA 4C3PA 4FK6A 2W1IA 4YURA 2YIRA 3DJ6A 1ZZ2A 3DV3A 4XRLA 3HRCA 4EQMA 5DG5A 4FIEA 4IXPA 3UG2A 4DH7A 1YOLA 3U55A 3ZO3A 4OTRA 4BYIA 1H26A 2OFUA 4O21A 1JBPE 5IQIA 3NUAA 3C4XA 2YABA 3DOGA 4Q5HA 2R7BA 2BZHB 3BBWA 3F5GA 2WZJA 3HLLA 3KMUA 5HG8A 3UGCA 4H1JA 4F1OA 4FTJA 3EOCA 3GENA 2VN9A 3QTWA 5LMAA 4TNBA 3PZHA 3OXZA 4CQGA 4DEDA 1YHSA 3DT1A 2WMWA 4JL9A 3SOCA 4R5SA 4CT1A 5CAOA 3Q6WA 4MBJA 5GIOE 1O6YA 3ZM4A 5DR2A 3RAWA 4IWOA 1CMKE 3PFQA 3QQFA 3WE8A 1GIIA 3KGAA 4EK4A 2PL0A 3Q3BA 4PMMA 4HZSA 3JXWA 4GG7A 1H0VA 3MH3A 4FTKA 3SV0A 2UW3A 4FTNA 4HOKA 4PNIA 5HCZA 4XV1A 4C62A 3CTQA 2CPKE 2UW5A 4FT0A 4FTCA 4MXOA 4WG4A 4PDYA 2BDJA 2GMXA 2O63A 4RA5A 4QMPA 5F4NA 2HY81 4IDVA 4JNWA 3WF9A 3A7FA 4NM0A 5E7RA 5CEMA 5KMNA 3FLZA 5IQAA 4DCEA 4O7YA 1K3AA 4ZP5A 4FT9A 1IA8A 4CV8A 4MNEA 2I0VA 4GU9A 2WEVA 4GUEA 3U6HA 2W4KA 5KHXA 5M06A 2W06A 4U0IA 3ZLXA 3V5TA 4ZLYA 3FI3A 4NU1A 2VAGA 5AUYA 3MTFA 3LFCA 3QTRA 3FXXA 4OBPA 4Y5QA 3DNEA 4FKQA 2W5BA 1H1PA 4EOPA 4AE9A 4OBQA 2Z7SA 2QU5A 4RIYA 4FSYA 3KXMA 3TNHA 4Y46A 3BGQA 2QODA 3CQEA 3U54A 5FG8A 4D1SA 4RA4A 5FTQA 3FC2A 5L6WL 2RG6A 3FYJX 5EQEA 2XIZA 3DNDA 3EJ1A 3MPMA 3SD0A 5AV4A 2B1PA 4I5PA 5JT2A 3PJ3A 4GIHA 4ANMA 5J5TA 2ACXA 4XRJA 4U40A 4RJ6A 5J9ZA 2PVLA 4O6EA 2VTAA 2QO9A 4MXXA 3PSDA 3QUDA 2XK7A 5L2WA 4IW0A 4BI2A 4JDJA 3OCTA 3QA0A 4R78A 5IA1A 4ZJJA 4EYJA 5ANDA 2B55A 3E87A 4MBLA 4QTCA 4FTAA 4AUAA 3FMMA 4ID7A 3ACKA 3UNKA 3D5VA 4QPAA 2GTMA 3QC4A 2WQOA 3KCFA 1GY3A 4RFYA 5IG1A 1OL7A 3H10A 4HCVA 4IE9A 3QYZA 4J97A 4QYFA 3PVWA 3V3VA 5L4QA 5L2QA 3R7OA 3R8UA 3KA0A 5AIKA 3R8MA 4WOVA 3D9VA 2QR7A 3UMWA 2F4JA 4IWQA 4QQTA 1F5QA 5DR9A 1YHVA 3TN8A 4CFUA 1GOLA 4RQKA 3FMNA 2BAKA 3NAXA 1XR1A 3R7UA 1GNGA 3VS0A 1VJYA 2G9XA 3R04A 2ZB0A 4RJ4A 3ZRKA 1ZXEA 3DK6A 4R7HA 3PXQA 3SRVB 4NSTA 2C6TA 4IAIA 5A9UA 5CLPA 3M1SA 3U87A 3GGFA 3G90X 1JSVA 2VX1A 5AR4A 3UP7A 4FI1A 3FI4A 3AMAA 3OT3A 2QI8A 4L3LA 5D41A 3W8QA 4FVRA 3LFAA 3PJ8A 2FSLX 5JRSA 3BHHA 2UZEA 4CV9A 4K18A 4R5YA 1URCA 3SKCA 4AZTA 4QMVA 1OPKA 1P4FA 4AZSA 3KCKA 3E88A 4TRLA 5IF1A 2HAKA 2JDTA 2XK3A 2F7XE 3GC9A 1ZYSA 5L8JA 4RX5A 4MCVA 3COKA 5AR2A 4S34A 4C38A 3VUHA 1PW2A 4PMTA 4X2NA 4I4FA 2J51A 3GCSA 1GZNA 2A27A 3Q4CA 1FMKA 3COIA 4I5MA 4F0GA 4PX6A 3ZFMA 5I9XA 5J87A 3ROCA 4YZCA 4D4YA 4WG3A 1P2AA 2YDJA 4C7TA 1BI7A 3Q4ZA 2OXYA 5HU3A 1GZKA 4O82A 4IB1A 2VNWA 3OCSA 2ZB1A 2LGCA 3PLSA 4YHFA 3HEGA 4TZRA 4C4GA 2CKQA 4O2ZA 3F3TA 3KU2A 3TJCA 4YU2A 3IW5A 2JBOA 3W33A 3QCQA 4FL3A 5AR8A 3HAVA 2W1EA 2W4JA 2Y8OA 3I0QA 3I1AA 5HVJA 3MJ1A 4PPCA 4MTAA 2YZAA 4EOOA 3NVMB 3FZSA 4G9CA 1YXUA 3COMA 5CEQA 1PXOA 4NCTC 3ORTA 4DEAA 3G2FA 2GQSA 2O65A 5D10A 5EYDA 4D0WA 1NY3A 2R3HA 3NUYA 3I6UA 4KKHA 3QTSA 3UIXA 3V5JA 4F65A 4FR4A 2O5KA 3UOHA 2WFYA 4FNXA 4CCBA 3C5IA 2PZRA 1ATPE 4AGCA 4BFMA 1T46A 4DTKA 4BCOA 2RGPA 2BZIB 2CMWA 4QO9A 4K1BA 2J7TA 2YM5A 4O2PA 1ZYLA 3CPCA 3G15A 4ZZMA 3ZUTA 4ASXA 3FPMA 4BGGA 4M15A 4BCPA 5EK7A 3ZBXA 2F49A 3F5PA 3R2BA 4F64A 2W0JA 2PWLA 2OXDA 1R78A 3VUGA 2ZYBA 3D2KA 4HYUA 2VTRA 2EXCX 2YIXA 4R3CA 5AUWA 1VYWA 3RTPA 3UMXA 3GVUA 4YZ9A 3HX4A 5CNNA 3BZ3A 4O7WA 3BLQA 4UWCA 2PVRA 5AP2A 3C4FA 3NUXA 3RKBA 2W1ZA 5BMMA 4AACA 1Q99A 2VTQA 4OTIA 4W9WA 4B8LA 3VJOA 4EZ7A 5IPJA 3E62A 1XH9A 3O2MA 4PQNA 1OB3A 2B9FA 3QQJA 4OT6A 1LUFA 1PF8A 4XEYA 4ZAUA 2WMSA 1JPAA 2B4SB 3DJ5A 1R0PA 2WIHA 5M55A 3TXOA 3PXKA 4W4VA 4O1PA 2EU9A 5A4LA 4ZOGA 3E3BX 2ZMDA 4GEOA 4JDIA 1FVTA 3PIYA 4L44A 2A4LA 2UZWE 5T6KA 4C34A 2J0IA 1GZ8A 4CMOA 5GIPE 3S4QA 3HV7A 3P7AA 3RPRA 3UVRA 4MH7A 4X3FC 4NJ3A 4ZY5A 3FSFA 4ZTQA 2JGZA 5HTCA 3EMGA 3QD4A 4AFEA 5CYIA 1G3NA 5BX0A 4D0XA 3MJ2A 5F95A 2OF4A 3PWYA 2Y7JA 3PLAE 1IASA 3OP5A 4FKOA 4XMOA 3BYUA 3VW6A 5LARA 4UYAA 3D15A 4CZTA 2C68A 2J0KA 2R7IA 4FIGA 3Q53A 1YXSA 2QCSA 4U8ZA 4C4EA 4D1XA 1Z5MA 3VAPA 5KE0A 2R3OA 5L2TA 3GNIB 4IWDA 3F2RA 5IUIA 4O0UA 3NCZA 1XHAA 2X0GA 4FC0A 4FV3A 4M7IA 4WNMA 4FVPA 3AG9A 3PPJA 2GNJA 4BY9E 3ZZWA 4BDDA 3QXPA 3PA3A 2BHEA 4O0TA 1H1RA 4M84A 2XEYA 4I6FA 4AFJA 4EKLA 4IJ9A 4BTKA 3SW7A 4TYIA 4O0WA 1ZMWA 2WOTA 4P2KA 4CKRA 1STCE 2EUFB 2YCSA 3GEQA 4Q5EA 4E73A 3FQSA 4AA5A 4I20A 3HGKA 3E7OA 2BAQA 4C37A 3RAIA 2NP8A 3D5UA 4GT5A 3UPXA 3LCSA 5EYCA 4J52A 4JIAA 4FV7A 2OSCA 3R8PA 2YLEA 1PXLA 5AM7A 1W82A 1LEWA 4BCNA 1Q24A 4DEEA 3FMDA 4E3CA 2VTJA 3Q9WA 2ZM4A 3MH0A 5EI2A 3NVKI 5TR6A 2ZV8A 4L9IA 1JKLA 2PK9A 4TWCA 2C6OA 4MK0A 2PZ5A 3NR9A 4JIKA 4ITIA 4O0VA 3JPVA 2YCFA 4I22A 2EXEA 4FV1A 4HPTE 2C6EA 3V5LA 3SX9A 4F6UA 5JEBA 1AQ1A 3GOPA 3VS1A 2R3RA 2YM8A 5CVHA 2QC6A 4O6LA 3A8XA 4AOTA 2WTIA 5AP3A 4XUFA 2P0CA 4IX5A 2HK5A 5L2IA 4RMZA 3DS6A 4YTIA 2QG7A 5IQBA 4KS7A 4NFNA 2QONA 1H07A 4ZJIA 2FA2A 2R3IA 2XK8A 3MS9A 2ZV7A 3P1AA 4U79A 4N6YA 3LKMA 4NIFB 3QTZA 4M0ZA 4M69A 3M2WA 4FL2A 5EDPA 1PXKA 4I24A 4E5BA 3EQBA 5J8IA 3ZBFA 5BUEA 4EK3A 4PTEA 2VTOA 3RM6A 2XIRA 4TTHB 4UALA 4CNHA 3Q2JA 1YQJA 2VTIA 3FHIA 3LCTA 5FTOA 3NDMA 4CRSA 4E7WA 4UXLA 2NO3A 4XG8A 3II5A 4HPUE 4HYHA 2GSFA 2ZVAA 3EFKA 2C1AA 5HCYA 4E6DA 3IKAA 4GMYA 4EQUA 3O8TA 1ZMUA 3SAYA 5EKOA 4OTQA 3VBXA 2AC5A 2Y4IB 3WBLA 4RT7A 3WZKA 4I41A 3NIZA 4JJRA 5KMKA 1REJA 2OF2A 3FZOA 5IA4A 2F7EE 2FYSA 4OT5A 3CEKA 5C8NA 3EFWA 2UW0A 3G9LX 3F3ZA 4FNYA 5ETCA 3NNXA 3IW6A 3L8PA 4MVFA 4DG2E 3FKOA 5FWKK 3ZFYA 4L46A 3U6IA 3RWQA 1H1WA 3DBQA 3EFLA 3IO7A 1A48A 3R7VA 4S33A 2R3QA 3FLWA 3NYOA 4ERKA 4ZMFA 1CKIA 3MVHA 3F5UA 3NS9A 1QPDA 4AOJA 2WO6A 2B9HA 3WOWA 2QNJA 3FPQA 5ETFA 4ASZA 4AW2A 3TIZA 3BYSA 1OIUA 3UBDA 4BHZA 4H36A 5JN2A 2R3MA 3AC4A 2Z7QA 3G6HA 3IW7A 3OG7A 4IC8A 4CTCA 4LMUA 3CD8A 3KXGA 3NZ0A 1REKA 5AX3A 4KD1A 5EKNA 2J0LA 5HD7A 1YDRE 3D2IA 4AG8A 3N51A 3HMOA 3AXWA 4ZTRA 5HEZA 3IG7A 3QA8A 4I0SA 4HVDA 4IX4A 4PTGA 3HUCA 1WBTA 4GU6A 3MI9A 4DEIA 4GW8A 3RGFA 1OI9A 4C61A 1BLXA 3GU6A 4PL4A 4WRSA 3NLBA 2YJRA 4ANQA 2PMIA 2UZVA 3DTWA 3OFMA 4D5HA 4EEVA 1XH8A 4X2GA 2XBAA 4MXZA 4U5JA 1WBPA 2E9NA 4ALWA 4AN2A 4BVUA 4S31A 5ANIA 2DS1A 4O91A 4C33A 4ZXTA 5G1XA 4GYIA 4OTGA 3FMJA 2VTSA 1TQMA 3CS9A 4IAFA 5C8KA 1OMWA 3DKOA 2W1DA 2YAKA 4KIKA 2IZRA 1ZLTA 3QLFA 5GJGA 3GCVA 4DAWA 3KN6A 4EORA 4I6QA 4UMPA 3RHKA 2X9FA 3O96A 3EFJA 1WBVA 3UQCA 2XK9A 3BV2A 1UKIA 1H28A 3MTLA 4BGQA 3TZ9A 4YO6A 2VWZA 1ZAOA 4XP2A 3E5AA 4ZSJA 5FM2A 2R64A 3R9NA 4BYJA 4JG8A 3KRJA 5I9YA 1FGIA 4IC7A 3BYMA 4GG5A 5I3OA 1IRKA 1H01A 1H25A 5DE2A 3W55A 3R8LA 3ZLYA 4TWPA 2X7FA 5AV0A 4D9TA 3MVJA 3GOKA 3PYYA 3LXKA 5DPVA 4TYEA 2RSVA 4RZVA 4TKSA 1IR3A 4UZHA 3M42A 3C9WA 5DWRA 4C59A 4KS8A 3RCDA 4MX9A 3SHEA 3ID6C 1WVXA 2UZLA 2ZAZA 3DK3A 4N0SA 3UZPA 3F82A 4KSQA 5KZIA 4QYGA 4E4LA 3AOXA 3PY1A 3I7CA 4CLJA 3ODZX 3IONA 3R6XA 2Z2WA 4B8MA 3U4WA 2J0MB 3AGLA 4FICA 5CF8A 4NH1A 5EI6A 1YKRA 5DT0A 3SA0A 3LE6A 2B54A 3NUNA 3PJCA 4FZ6A 4MNFA 5B2KA 4EK5A 1OBDA 5AUTA 4G5JA 4MD8E 4FEUA 4FTOA 3VC4A 4QMZA 4ZTNA 1FBNA 4RWLA 3MVLA 4EH5A 3UNJA 2CGUA 4L7SA 1XH4A 2JDOA 3K3JA 3TV6A 3MFTA 3PPZA 4L3JA 3VS4A 3W18A 3ZO2A 5J1VA 2P3GX 4FEXA 3A8WA 1MRUA 1B6CB 5LWNA 4BRXA 3RP9A 3S00A 2BALA 4BDIA 5C1QB 4H39A 5ICPA 3COHA 1BX6A 2BRMA 3A7JA 2IVUA 1U5QA 5IEXA 3O7LD 1MRVA 5DYJA 4PRJA 5CI6A 3QTIA 4AGUA 3LCDA 4AA0A 5A3XA 1WBSA 5HOAA 3SOAA 5I9WA 5JH6A 2W1GA 3ODYX 4ZSGA 5CZHA 2A2AA 1QPEA 2UW4A 2R2PA 4O7NA 4F1TA 1XWSA 1UNHA 2X7OA 2O3PA 4TWOA 5FM3A 4PY1A 1ERKA 3O8PA 4DTAA 4UN0C 2JAMA 3E92A 4EWHA 1YXTA 5HX6A 1PHKA 2XBJA 5ITAA 1XQZA 4HYSA 4JAIA 3GQLA 3VBQA 5DNRA 4IX6A 2ZV9A 3A4PA 3QXOA 3DAKA 4EOSA 2P55A 5DEYA 4BBFA 3HMPA 5B0XA 4UMRA 2PVHA 2WMRA 4UBAA 5TE0A 4RJ3A 4FSWA 5HG7A 2PU8A 1ZYJA 3C4ZA 1WVWA 3FE3A 4GVAA 4IFGA 4ITHA 5DGZA 3S2PA 3ZZEA 4TNDA 4A07A 2FO0A 3EZVA 4G31A 3F2NA 5J9LA 2YISA 4FKIA 3RPVA 4Q9ZA 4QP4A 3PE2A 2JD5A 4A9UA 5IZFA 4E6AA 2ITWA 3VRZA 4BI1A 1TKIA 4WA9A 4LRMA 1H00A 1L3RE 2YERA 2JKMA 2Z8CA 5IA0A 5LVMA 3R1NA 2IVTA 3JYAA 3DXQA 4BWXA 4CFVA 4EHEA 5CVGA 4BCHA 3E8EA 4YJQA 3DLZA 4RIXB 1PKGA 4NZWB 4QMOA 3CJGA 4BKJA 3TUCA 2A1AB 3O50A 2I0YA 4RVLA 4F9CA 4V01A 3F66A 1SYKA 3AT3A 4RIWB 2FUMA 5E4HA 5KMIA 3CTHA 1YI4A 4IVBA 5AX9A 4BCQA 5M53A 3LOKA 2J90A 4G3DA 2F2UA 5K5XA 3PA5A 4DLIA 4ZY6A 2JDVA 2QOKA 1H1SA 2JDSA 2VRXA 3AC2A 5HIDA 4M66A 4J71A 4FYNA 5D1JA 3WZEA 4C3RA 4TWNA 1M2RA 1P4OA 3FKLA 3IOKA 5E8UA 5HX8A 3L9NA 3UO4A 4EOQA 1OPJA 3MDYA 4FF8A 4BIBA 4CFFA 3TEIA 3DZOA 3FDNA 1NVSA 4QMYA 3VWAA 3K54A 5AP1A 3ORMA 5LQFA 4EJ7A 1MP8A 3PG1A 4KNBA 4EC8A 4JRNA 3MFRA 5AEPA 4HVHA 1FOTA 4IVDA 3G9NA 1Q5KA 2YCRA 1ZARA 3LFFA 3WZUA 4C4IA 4FOCA 4ZSLA 4FMQA 4HNFA 3N4VA 4WHZA 3QZFA 1BUHA 4D9UA 4JG7A 2GHLA 1KOBA 1WCCA 1XKKA 4AX8A 4XNEA 3POOA 5HVKA 3KK8A 4KWPA 2C0OA 4L3PA 4D55A 1IAJA 5F9EA 4HVSA 3RK9A 2CSNA 4AZWA 3LW0A 2OJFE 5CXHA 3ZDIA 4O7RA 5CU0A 5T68A 3SC1A 3DBFA 5LWMA 4FZDB 4FKGA 3CQWA 4KABA 4NJDA 3AC3A 4X7QA 3EQCA 1OKWA 5CSWA 2XNMA 4Z7HA 5EHOA 5A6NA 1E1XA 3V5PA 1S9JA 2Y4PA 4MBIA 5HE1A 4E26A 4YGAA 4MQ1A 2GTNA 5CAQA 3NMUF 3BI6A 3PSBA 4G5PA 3IGOA 4X3FB 4CVAA 4ZSAA 4OTDA 3KXHA 3Q60A 5K3YA 3PY0A 4QP9A 4NM3A 3BQRA 4RWKA 4B0GA 4OAUC 3BELA 5M08A 5KZ0A 3GI3A 5I5ZA 5FRIA 2ITQA 1CKJA 2W1CA 5CT7A 3D5XA 3LJ0A 3ETAA 1YOMA 3FUPA 4OTPA 5E8SA 4FKWA 2IN6A 2WU7A 4YO4A 5M09A 3D14A 4TN6A 3RI1A 2WIPA 1PXMA 5IA5A 3R21A 3R9HA 4ERWA 3QTXA 1V1KA 2V55A 2VV9A 4L53A 4FGBA 4ZK5A 4RIOA 4A7CA 5FQDC 3RCJA 5CF6A 3RK5A 4FSTA 4QYYA 4YLKA 3DQXA 4YHTA 4AW0A 3AT2A 1Q8YA 1QPJA 3V8TA 3HV4A 1YRPA 4X0MA 3UQGA 4LL5A 3IQ7A 4PNKA 2HYYA 4Y8DA 1H27A 1KE5A 3KN5A 3PIZA 1E1VA 2HIWA 2XIYA 3DZQA 1F0QA 4EK8A 3FMEA 5HI2A 4AN3A 3QRUA 3OXIA 4QPMA 3VQUA 1NXKA 5LMKA 4BR3A 4Q2AA 3ATSA 3D7TB 4ZIMA 5AV1A 4BDAA 3QQUA 3R30A 3HAMA 5BVEA 2B7AA 2UZOA 1O6LA 1DAWA 4NW5A 5M57A 1W7HA 4IZYA 2ZDUA 3Q04A 3QX4A 3ZSGA 3REPA 4IZAA 1YDTE 5CQUA 4F99A 1Q8WA 5AV2A 3GU7A 2YA9A 2YFXA 4W4YA 4AA4A 3QU0A 4Z16A 3UOJA 3L9MA 3TDVA 2WMAA 3ZFXA 4HYIA 3WE4A 2C47A 4XV3A 3NCGA 2UZTA 4P7EA 3DFAA 3AD4A 4BICA 4A06A 4DBXA 4ACHA 4PPBA 5LCKA 2BAJA 2QOCA 3FI2A 3PP0A 2HXLA 4NTSA 4U41A 2KULA 2BDWA 1GJOA 1RDQE 3DGKA 4GFOA 4BC6A 1WZYA 4WNPA 4DBNA 2R5TA 4XBUA 3F69A 5DLSA 2IW8A 2OBJA 3QD0A 4A4LA 2X39A 3H30A 3LVPA 5HNGA 3UTOA 4DH8A 4ZLZA 3QLGA 1V0PA 3LJ1A 4U42A 4V0GA 1T45A 3OCBA 4FT3A 3ZRLA 2FH9A 4F4PA 5H8GA 4GK4A 3IOPA 3LFQA 4TYHB 3OWLA 3HECA 4BI0A 4RJ5A 5IQCA 3LCKA 2QHNA 2PHKA 4Z55A 3PXRA 5E1SA 1NVQA 3BHVA 4HNIA 5K4IA 4H05A 3LFBA 4XV9A 4UYNA 3MPAA 2CLQA 1FGKA 4EKKA 4EOMA 3QHRA 4H3BA 4BCIA 4MXCA 2WTVA 4J53A 4JBVA 3WYXA 4HCUA 5AIRA 5IQEA 5ETAA 5BVFA 5EDQA 5L2SA 3HKOA 4C57A 3MB7A 4C2VA 4FZFB 3EYGA 4ITJA 5CASA 4DEHA 5AAFA 3OBGA 2RG5A 3KC3A 1OUKA 4FSRA 4GRBA 4JLCA 4FA2A 4IANA 1EH4A 3ERKA 3MY1A 5AUXA 4K9YA 3DKCA 3R02A 4LUDA 5ANEA 4D4VA 5DH3A 3F61A 4MHAA 2W05A 4YJRA 1MQBA 1WBWA 2WTCA 3IECA 3SG9A 1KE8A 5BVOA 1UNGA 3NUPA 5M4IA 3HZTA 4NM7A 3O51A 3OCGA 4ASDA 5HQ0A 3U9CA 4IVCA 4BCMA 1Y6AA 4DEBA 2I7QA 2R3GA 2XK4A 2YWVA 4BL1A 4Z3VA 5A54A 3ANQA 1YDSE 2C3IB 3SQQA 5I9UA 4GT4A 2O2UA 4LI5A 4E4MA 2W96B 1XH6A 1WBNA 3R73A 1SNXA 3GP0A 4FTUA 5TO8A 4I6BA 4QP2A 1ZYDA 3TUDA 2PMNX 5IDPA 3UQFA 2ZV2A 3DCVA 3V01A 3ZONA 4LG4A 4RFMA 4BZDA 1Q8TA 4CZYB 3R9RA 5KMOA 3H9RA 3S3IA 2OI4X 3IW4A 5FEEA 2W9ZB 2IJMA 4HGLA 5TF9A 4RWJA 1KE9A 4J7BA 5HE3A 4G34A 5DA3A 3VUKA 1J1CA 2R3FA 4NW6A 2RKUA 4WT6A 5HTIA 4MF0A 5AR3A 4BBEA 3JR1A 3LQ5A 2I6LA 2GU8A 3LMGA 4QMWA 1CDKA 4YTHA 1PMUA 4G9RA 5A46A 4HCTA 2NRYA 3UJGA 3KMWA 3NNUA 3DB6A 2ONLA 3EL8A 3QF9A 1W0XC 4EH8A 1ZYCA 4I4EA 3SXFA 5CZIA 2OIBA 5JSMA 2Z02A 3OZ6A 2XNOA 3R9DA 4KKGA 5CS6A 2J4ZA 4E5AX 1SZMA 2H96A 1O6KA 5F1ZA 3QWKA 4AT5A 3VQHA 4WUAA 3I5ZA 5AAEA 1JNKA 3FZTA 5JRQA 4XV2A 3VS7A 2CN5A 3KXZA 4W9XA 3G33A 5AADA 3G51A 4FV0A 4YMJA 1B39A 3A61A 1ZOEA 1G8AA 1W8CA 2C5NA 2GNLA 3JVRA 5EI8A 3TIYA 4J1RA 4YLJA 5C03A 4FNWA 5CSPA 1Q4LA 3SXSA 4C4HA 3QCXA 4F1MA 5LVLA 1FVRA 2GHGA 2XM9A 5AUUA 5KBQA 5AUZA 4F7NA 3CXWA 5IDNA 5H2UA 4F7SA 4C2WA 4DT9A 1CM8A 5CF5A 2BZJA 3FJQE 1Y91A 3L8SA 5GZ9A 4O81A 4EOLA 3HV6A 5KO1A 2UW6A 4FSMA 4JAJA 3OF0A 3PVUA 4MD7E 4F9BA 2CHLA 5ETIA 1PMVA 3E3PA 4AF3A 1Q8UA 3H9FA 4RBLA 4JR3A 4R3RA 3V04A 3DKGA 4F70A 4FIHA 4L01A 1A9UA 4ZZOA 2VX3A 3DLSA 4BTFA 4UY9A 1UKHA 2QOLA 2J9MA 3F3UA 5HBJA 2YM4A 1P14A 2QLQA 2V7OA 4LGGA 4FG7A 4KRCA 4L68A 2XKDA 4M13A 5CQWA 2OWBA 3R01A 3R8VA 3PIXA 4FODA 3WZDA 2GQGA 4GK2A 1LP4A 4X6RA 5D11A 3U6JA 3E64A 4A4XA 2XKEA 3QAME 1H0WA 4YUQA 3C0IA 2HZ0A 3QRKA 4F09A 4USEA 2IVVA 3W2SA 1OL1A 3QKLA 3ZC5A 4C35A 1UU9A 5IA3A 5JQ8A 2BRNA 1RW8A 5LCJA 3UPZA 4ORKA 4DEGA 3BX5A 3KMMA 4PWNA 3C4EA 2G01A 3FSKA 3I79A 4QQ5A 5DRDA 3R8ZA 1GZOA 1PXNA 2X4ZA 4RC4A 2OJIA 3MGYA 2C30A 3KF4A 4O0SA 4I5HA 4O84A 3B8QA 2CNVA 4CRLA 4XG9A 1XBCA 5HGIA 2P2HA 4DLJA 3OROA 1FPUA 3CJFA 4YJPA 4V04A 3WF6A 4HW7A 5C4LA 3ZH8A 4GT3A 4D2SA 5BUJA 2GHMA 2QOQA 4YZNA 3O17A 5AJQA 2JEDA 3H0ZA 4XOZA 1J3HA 3GC8A 5AP5A 5FDXA 4W8DA 3D83A 3KFAA 3VBWA 1YI6A 4B6LA 2WB8A 3C0HA 4IAYA 2OXXA 1V0BA 2X2LA 4GCJA 3B2TA 3G6GA 5FXRA 2HZNA 4O7LA 4RGJA 2IPXA 3R7GA 2IZUA 3KULA 3QRTA 2CJMA 3R1QA 4I21A 3CKXA 5FBOA 3RINA 5CSVA 4ZZNA 3FQHA 5M4CA 5K9IA 3ZRMA 4CKIA 3QQHA 3P7BA 2W4OA 3EHAA 3RNYA 4RJ7A 2VWWA 5BMSA 3QGYA 1R0EA 2EB2A 1F3MC 4H1MA 3I4BA 4F7LA 3VULA 4CFWA 3Q9YA 3CCNA 3MWUA 3DQWA 4YJTA 1M2PA 4CCUA 3R1YA 2BMCA 4WO5A 2VUWA 4EC9A 4DFBA 4YTFA 4BKZA 3LCOA 3BRBA 4AE6A 1OIYA 4FV6A 2ITPA 5K0XA 2QLUA 2QKWB 2WHBA 3DXNA 1XJDA 4AAAA 5KHWA 2VU3A 2WMVA 5HO7A 4C8BA 2VWBA 1B38A 4FV2A 1VEBA 3BYOA 1MQ4A 4M67A 2EVAA 5C26A 3C0GA 4ACDA 5A4CA 2BKZA 3TUBA 4XCUA 2XRUA 3DFCB 5LJJA 2CKOA 4NUSA 2PYWA 4G6LA 3DAJA 3G5DA 3OEFX 4FV4A 3ZSIA 4IFCA 5HBEA 5HESA 3SDJA 3R7EA 4PDPA 3DBEA 2PVJA 3AMBA 3DPKA 3H4JA 3ULZA 1H4LA 4MEDA 4F9AA 4OLIA 5HNIX 2DWBA 2HXQA 4CFNA 4YPDA 3FI8A 2H34A 2G2FA 3PY3A 2HWOA 3PE1A 4QD6A 4U9AA 3TV4A 5C4KA 4L7FA 4DITA 3N4TA 4FL1A 2XCHA 4DA5A 1WAKA 4JXFA 1MUOA 2BR1A 3OY1A 4R6VA 5EH0A 1Y57A 1YHWA 2YEXA 5E8VA 4CT2A 4MNEB 1R1WA 4YJNA 2G1TA 2JC6A 3ENMA 3SW4A 3ZLWA 2RFSA 5BNJA 3NW5A 2ITVA 1KV2A 3R0TA 3ZC6A 3FC1X 3WIGA 3W16A 4JBPA 4BDEA 4B4LA 2G15A 3NW6A 5DN3A 4X2KA 2XCKA 5L8KA 4O22A 4RLLA 3WF8A 3CGFA 3QX2A 3U4UA 5CAUA 2F9GA 4USFA 4RC2A 3QQGA 2B0QA 2I0EA 3V5QA 3FY2A 2VWYA 4K0YA 4RIYB 5BVWA 3RWPA 4LL0A 4QTBA 2W99B 3UC4A 4IZ7A 3LXPA 3KF7A 4QMLA 1L8TA 4EH6A 2BFXA 2BIYA 5FLFA 1JKTA 4L6QA 5GJFA 2UZDA 3NYXA 1ZY5A 4LM5A 3BU5A 4D1ZA 1OL2A 4F9YA 3F3WA 4D2TA 4NT4A 3R83A 4WNOA 3VF9A 3GCPA 4G6OA 3GCUA 3JVSA 2E2BA 4P5ZA 1PKDA 5J7HA 3MFUA 5H8EA 2HWPA 4FKTA 4EOIA 3NSZA 5E8YA 4AQCA 3UC3A 5J5SA 4JI9A 1WFCA 3KXNA 4QQJA 3V8WA 4KB8A 4E4NA 2G2IA 4FUXA 2XJ1A 4BKYA 2R0UA 2XP2A 4QTDA 3UDBA 5JKGA 4PF4A 2XIKA 3OBJA 4L42A 2GFSA 1TQPA 2HENA 1RE8A 4DCAA 4RG0A 5AWMA 2ETMA 5HKMA 3UO6A 4QMSA 2BTRA 3POZA 5IEYA 3BBTB 4BBMA 4FE2A 3HVCA 3ZEWA 3UZTA 4JBQA 2ZMCA 5FGKA 3CP9A 5M4UA 3HDNA 4YTCA 2C0TA 2QO7A 3VUDA 2BRGA 4U6RA 4WBBB 5IQFA 2QG5A 3OWPA 3OW3A 5ANGA 3DDPA 2JBPA 4L67A 3TI1A 3VJNA 3MYGA 4O7VA 3PDTA 2UZUE 4O38A 4YC3A 3UIBA 2PSQA 3TACA 4G3EA 3R9OA 5CU6A 3ET7A 5CWZA 4CD0A 3O7LB 4FTQA 3CR0A 1PJKA 5B7VA 4UWBA 1YXVA 4CSVA 2C3JA 3T8OA 3LLTA 1G8SA 3MBLA 2DQ7X 2Y6OA 4LV8A 5AP4A 2X9EA 4XJ0A 4IB3A 2OICA 3GUBA 3QC9A 3KXXA 1PYEA 5D7VA 5GZAA 4O7ZA 4PMSA 5DR6A 4JS8A 4O86A 4GK3A 3PPKA 1Q61A 3VBTA 3IPHA 3FLYA 2VO7A 4MWIA 3QGWA 4FVQA 1Q41A 1CSNA 5CSXA 4BCKA 2C5XA 3BEAA 1DS5A 4YNOA 4BDBA 4FIIA 2C5YA 2UW9A 4KIPA 3BLRA 2LAVA 2VTMA 3SRVA 1BMKA 3M11A 4YBJA 3EN9A 4JQ7A 2RL5A 2XKCA 4DFYA 3MPTA 3JS2A 4ZS4A 1UA2A 4DYMA 4YJUA 5HIBA 3HNGA 5ANJA 3WYYA 4ONAA 5DT4A 4G2FA 4NKAA 1XBBA 4WBOA 3VBVA 3KQ7A 5M51A 4FSZA 2QKRA 5A4EA 3T3VA 3EQDA 5CXZA 3TNIA 3FKNA 4FOBA 5L8LA 2ESMA 2FSOX 4MYGA 2ITNA 4I93A 3OEZA 4CXAA 3KRXA 2Q0NA 2QOFA 1PRYA 2BVAA 2WMBA 1W83A 4I0TA 3LQ3A 3K3IA 3TCPA 1KOAA 1TQIA 1Q62A 3UIUA 2WQNA 3VN9A 3LQ8A 3ZSHA 3KVXA 4FV9A 1I44A 2OK1A 3I60A 1J7IA 4N70A 4PP9A 4XG2A 5HLWA 4PTCA 4FK3A 5JGAA 4DE4A 4NKSA 2VTTA 1JSTA 2ZM1A 3U51A 1UU8A 4JG6A 4IAZA 5AM6A 4BHNA 3F6XA 4EUTA 5HLPA 5FP6A 3RPYA 5LVNA 3PRIA 3O71A 4U45A 4EK6A 4DG0E 3NRMA 4DH3A 4DTBA 4EH7A 3HMIA 5H8BA 3OOGA 3A4OX 3SXRA 4BB4A 5DBXA 5KMMA 1A06A 4I23A 1OKYA 2XRWA 4ANSA 2XZSA 1KV1A 3F3VA 5EDRA 3S95A 4RJ8A 1OUYA 2XEZA 3H0YA 5EW8A 4X6QC 3BEGA 4FNZA 1U5RA 2A19B 3QRIA 4FTMA 2XB7A 2XIXA 3L1SA 3EIDA 4U97A 5HBHA 2GS7A 2ITTA 3TTJA 5B2MA 1JOWB 3PA4A 3QCYA 3TNWA 4EI4A 1X8BA 3FZRA 1JVPP 1LR4A 1BI8A 3C13A 4RX7A 5CX9A 3H9OA 1FINA 2C3KA 2EXMA 4G3CA 4I94A 4JT3A 5CEIA 4B7TA 5LVPA 3PUPA 3HL7A 1UVRA 5BYYA 3QZHA 3BYVA 3FXWA 2IWIA 4A9TA 4I0RA 4E8AA 4GYGA 5JFWA 2X1NA 1OPLA 4S30A 1TVOA 4HVGA 2HCKA 1DI8A 3P5KA 4W4XA 4WSQA 3UYTA 2AC3A 3C1XA 5M4FA 1W98A 3KRWA 4DGGA 3R7YA 4OAVB 4QNAA 2BIKB 2CNUA 4FKPA 5LVOA 3D4QA 3HV3A 5DFPA 5FEDA 3ZTXA 3WIKA 2VGPA 3S0OA 4IZ5A 3PVGA 2GQRA 2C4GA 2RFNA 4NK9A 2WTJA 4J98A 4R7BA 1OITA 4TT7A 4O1OA 4GV1A 3RALA 3FZPA 4NM5A 3Q5IA 2BRHA 2WQBA 2OJJA 2FGIA 4UB7A 3QZGA 3F7ZA 3TZMA 4ACMA 5BYZA 5KBRA 1IA9A 3ZOSA 3R2YA 5KNJA 4DFUA 3D94A 2R3JA 2NRUA 3EZRA 3ALOA 2BROA 2PZYA 3D7ZA 4XG3A 3BWFA 4ZY4A 5IA2A 1SNUA 3JY0A 1H8FA 2PE1A 3E7VA 4CTBA 2WOUA 3HRFA 2PE0A 2WTDA 3DU8A 2X4FA 3ELJA 4GVJA 4HJOA 3VS3A 1IG1A 5LMKC 4ZSEA 4YHJA 2BRBA 4FTRA 3AD6A 4RWIA 4JX3A 3ZUUA 3HV5A 2UW8A 4DGNA 3OUNB 4ZTMA 4FKLA 5L6PA 4BCJA 5IISA 4UX9A 4K33A 2XA4A 2WEIA 2JIVA 5EW3A 4PL5A 3LIJA 3HMMA 4W4WA 2YDKA 2J0JA 5EYKA 3MB6A 4E93A 2C6MA 3HP5A 5BPYA 3AC1A 3L9PA 3W2OA 2GS6A 2OZOA 4KKEA 3U8WA 5CF4A 2B9IA 4FX3A 4OR5A 4CFMA 4ZJVA 1ZZLA 3A7GA 2WQEA 4KAOA 3VBYA 3BQCA 3AMYA 5JZJA 4J95A 4AP7A 3KEXA 2OFVA 2Y9QA 5E8XA 2E9OA 3MA3A 4QNYA 2JIUA 3ORPA 3R1SA 3QTUA 4M69B 3VRYA 1UU3A 3FLSA 3O8UA 4IIRA 3RAKA 3ROYA 5FD2A 4FT7A 2W1FA 4BCFA 1K2PA 3HA8A 5AUVA 5F94A 4NFMA 4QP7A 3OC1A 3PJ1A 3GC7A 5E90A 4IHPA 4FEVA 3FLNC 3MH2A 4AGWA 4F6WA 1RJBA 2PUNA 4DFNA 5A14A 2R3NA 3MA6A 2G2HA 5C27A 4ACGA 4HVIA 3NWWA 1QPCA 1NT2A 1KE6A 3FLQA 4YSMA 4YJSA 4XP0A 5G6VA 4BDJA 3QD2B 2HOGA 4CLIA 4R1YA 3VUIA 2JFLA 3VF8A 2UUEA 3HYHA 4BDCA 4DGOA 5B2LA 3EQRA 3Q32A 3QQLA 1FVVA 3QHWA 4UXQA 5M07A 2DUVA 2XK6A 3KB7A 3VNTA 5HTBA 4ENYA 4XOYA 5JQ5A 4JDHA 3OS3A 4YZMA 3RM7A 1APME 4AOIA 2XYUA 3DA6A 2GDOA 3BGZA 5DT3A 4RLKA 3FWQA 1JWHA 5K5NA 3DBDA 3QKMA 4BF2A 4A4OA 4MD9E 4NIFA 4XYFA 4BDFA 2H6DA 3MVMA 3MIAA 5J1WA 4GUBA 2CCIA 1SVHA 1G5SA 2GNIA 2YACA 3FXZA 5KKRC 4C4FA 2OH4A 3GU5A 4QYHA 3FAAA 5DRBA 3D5WA 3AT4A 4FIJA 2O64A 2V0DA 2VTPA 3EQPA 3T3UA 1UV5A 1VR2A 5CEPA 3NW7A 2YWPA 4XHKB 5EHLA 5TKDA 2YJSA 4UEUA 3RZBA 2XS0A 4DT8A 3KRRA 3ORIA 3RJCA 5ACKA 4WSYA 4BZNA 4EHGA 3ZLSA 1J7UA 4DG3E 3CGOA 3EL7A 2H8HA 3AD5A 3PXYA 4Y83A 2ERKA 3ZO1A 3SG8A 5E9EA 2Y6MA 2J2IB 4XLVA 1ZOGA 2BKKA 4DGLC 3R63A 3TWJA 2CCHA 5EG3A 3NIEA 3OTUA 3V6SA 1KUTA 3C4WA 3DJ7A 5GINE 4ANLA 3SGCA 2XM8A 5CSHA 5DMZA 2JIIA 4FKVA 4LGDA 2JKOA 3WI6A 4M12A 2Z7RA 2QOIA 3V51A 1V0OA 3TNQB 4K8AA 1M7QA 2WGJA 3GT8A 4QPSA 4QP1A 5CVFA 5EYMA 3LHJA 1Z57A 1LPUA 4KIKB 4D2RA 1W84A 4UZDA 4EHZA 5J79A 5DVRA 4HGTA 1JSUA 1SVGA 5CTPA 2ZM3A 5EQPA 2X2KA 5CAPA 2FB8A 2VO0A 2YM7A 4U3YA 5ANKA 5FUTA 5C01A 2GPHA 2VWXA 3OTVA 4QTAA 5EOLA 2ONLC 3LAUA 5FXQA 2YM3A 3ZHPC 2GS2A 2DYLA 4TL0A 4N4SA 4ZEGA 5L6OA 4OGRA 2OKRA 3MY5A 5AMNA 4LOPA 4USDA 1Y8YA 4L45A 3QZIA 5CT0A 5IUHA 2YAAA 2B52A 2PUPA 3PXFA 5M44A 2VO3A 5HE2A 3ZDUA 4M68A 5DOSA 1PXPA 4JR7A 5HO6A 3TNPC 3RBWA 1YVJA 4IAAA 4XP3A 4XG6A 2ITOA 4MAOA 4QMNA 3ZS5A 4QRCA 3DAEA 4D2WA 4PP7A 4OTFA 2V22A 5D7AA 3I0OA 4DFXE 4RFZA 3AGMA 3OY3A 4CZUA 2B9JA 3A62A 4Y95A 2OG8A 3R7IA 2YIQA 1JKSA 4U43A 4E6QA 3FMKA 2YZLA 4GSBA 3IS5A 4YR8A 2PVNA 3QUEA 2ZOQA 4ZTSA 1JKKA 3HUBA 1M17A 1PXJA 3QL8A 4NEUA 2C6LA 2BCJA 4R1VA 1OBGA 4EYMA 2ITZA 4X21A 5J9YA 2BFYA 2PY3A 3GC0A 5EM5A 5HCXA 3RPOA 2W17A 4DF3A 2WTKC 4RPVA 2X8IA 1U59A 5EM6A 4L00A 3LFNA 2C3LA 4QMXA 2VTLA 4FKRA 2A0CX 2WTWA 4XH6A 3CSVA 2JFMA 4BWPA 3CPBA 1BKXA 1WVYA 1YXXA 4IH8A 2XKFA 2YDIA 4Y73A 5HG5A 4BDHA 4E6CA 5CENA 4HGSA 4G3FA 4YJOA 2GNGA 2PUUA 3GBZA 2OZAA 4ANBA 3WARA 5D9HA 3MFSA 4BTMA 4C36A 2OO8X 3CY3A 3FL5A 4TY1A 2Y0AA 3A7HA 3CBLA 4BDGA 1SM2A 4LRJA 2W1HA 4I92A 2B53A 2OGVA 3ORNA 3FMHA 4MQ2A 3TKIA 4IX3A 1ZY4A 3W2CA 3TTIA 4J8NA 2EWAA 4YLLA 4NWMA 4FTLA 4X2FA 3MV5A 3LXLA 4ZTHA 2BUJA 2R3KA 3NEWA 4CYIA 1M52A 3QYWA 1RQQA 1UU7A 3MH1A 4I6HA 4G3GA 2V5QA 3R22A 3UVQA 3DKFA 4G17A 3TDWA 3BIZA 4KSPA 2REIA 3RHXA 5I3RA 4FTIA 3C5UA 4EBWA 3RNIA 2W9FB 4L43A 3B8RA 3UO5A 4OTHA 2O8YA 3QRJA 1GIJA 4U44A 2GNHA 3PZEA 2XJ2A 3Q4UA 3PVBA 4JQ8A 3O23A 2OU7A 4P4CA 2VWVA 3Q9ZA 4EJNA 4O96A 2QU6A 4FKJA 1NA7A 2CGWA 4EH4A 4FTTA 3EN6A 4O7TA 3TM0A 2XNNA 4XS2A 5IUGA 3LFSA 2P4IA 1CKPA 3DB8A 4FT5A 4E4XA 4ANNA 1H24A 3EH9A 4YC6A 5I0BA 4OW8A 5AV3A 3UNZA 4RVTA 4F08A 1QMZA 2WXVA 5GJDA 4FKSA 4PUZA 3ZO4A 1ND4A 4LV5A 3BPRA 3QWJA 1U54A 2XMYA 4F0FA 4PPAA 3A99A 2XNPA 3E8CA 3F5XA 2PMOX 4LUEA 2QOBA 3ZEPA 5IMXA 4Y72A 3BGPA 3DY7A 1AGWA 3ZMMA 3Q9XA 2C0IA 2X8EA 3AQVA 4H3QA 5HO8A 3W2QA 4IADA 3N9XA 5DEWA 3ZXTA 1S9IA 1GIHA 2GNFA 2ITUA 3E8NA 3EB0A 4FSUA 4TXCA 4C02A 3LFEA 4EH2A 2OJ9A 4O83A 5M56A 4ZTLA 2CGXA 2PE2A 5JGDA 5I4NA 4KA3A 3TL8A 4XBRA 3VUTA 1AD5A 2IZTA 3E63A 2ZDTA 4N57A 3LMHA 2HW6A 3KL8A 3NNWA 5FP5A 3F9NA 5CAVA 3ORKA 3A2CA 2JKKA 3GFWA 4ANOA 1XBAA 3B2WA 4APCA 4A9RA 2JLDA 3FQEA 3GFEA 5E92A 2VZ6A 4AGDA 4E1ZA 4GJ3A 1KSWA 1OM1A 4IM0A 4MXAA 1OGUA 4MF1A 3W2PA 4EOKA 5JZNA 3KRLA 3T9IA 2WMTA 3HA6A 5E91A 5BVNA 2OH0E 4AXAA 3EQGA 4BTJA 4EL9A 5F20A 5K4JA 2PVKA 4RIXA 4GKIA 2PZPA 4IACA 2X7GA 2ETRA 4AZVA 3CKWA 4ENXA 4XG4A 1VYZA 4YZDA 4EQCA 5AA9A 3OOMA 3P0MA 1VZOA 2R3LA 4F63A 2WMXA 4BZOA 2ITYA 3Q96A 1PMNA 1Q3DA 4RIWA 1J7LA 4ZMEA 1J91A 3VIDA 4FGRA 4AZFA 4QP8A 4RSSA 3L9LA 1Z9XA 3A7IA 1Y8GA 3LJ2A 2O0UA 3OD6X 2J5FA 3PG3A 3BHTA 4NCTA 3BWJA 1Q97A 4S32A 2RF9A 3W1FA 3BLHA 3PXZA 3LMIA 4ALUA 5HLNA 2C69A 3ZUVA 2AUHA 1E9HA 1URWA 2XNBA 2QD9A 2YCQA 2CNQA 3P86A 5AP7A 5TT7A 2PUIA 2OIDA 3WZJA 3BCEA 2VWIA 3IDPA 2WU6A 1FMOE 4F9WA 3NYVA 4YNEA 4UV0A 4D4SA 1QCFA 2WMQA 3Q4TA 3G0FA 4FYOA 4GL9A 4KIQA 1SMHA 3CE3A 1BL6A 2J5EA 3HP2A 3EQIA 3P23A 4N6ZA 5JFSA 5BYLA 4CFXA 1UWHA 4IWPA 4XX9A 4WD5A 5FDPA 3DXPA 2HELA 3V8SA 4QOXA 4DFZE 3PJ2A 5KUPA 1U4DA 3ZM9A 4PL3A 2XNGA 3Q2MA 2VNYA 4H58A 5DI1A 5TOZA 4CG9A 3PRFA 4LQMA 3CQUA 4AW5A 5HNBA 5J7BA 4ASEA 2KTYA 1JQHA 1U46A 2YIYA 5DHJA 5A6OA 4GKHA 3BU3A 3HDMA 4PV0A 2XVDA 3UE4A 3FV8A 4EH9A 2PTKA 2JAVA 4S2ZA 4IB0A 1YOJA 5CI7A 3I5NA 2Q83A 3LM0A 4AW1A 4A9SA 5JGBA 4NL0A 4Q9SA 1IEPA 3DBCA 2NPQA 1OKVA 4FZAB 4P5QA 3MY0A 5C8MA 3QALE 3RAHA 2XYNA 1JAMA 4BDKA 3L8VA 5IQHA 2XNEA 3F88A 4I5CA 2RFDA 2ZJWA 1FQ1B 5I9ZA 4RC3A 3MESA 3PTGA 2FSMX 3OT8A 3ENHA 4M8TA 4AZEA 3EYHA 2F2CB 4X3FA 2UVZA 2VD5A 3KK9A 4MKCA 5EQYA 2UW7A 4APPA 1LEZA 3D0EA 4HZRA 2PVFA 5HZNA 5EHYA 4JBOA 3GB2A 3K2LA 3NUUA 2YHVA 4BIEA 2IW9A 4NYEA 1BYGA 1XH5A 1DAYA 3QCSA 3VVHA 2YLFA 3IK3A 2C1BA 4O7SA 3E8DA 4AU8A 4D28A 3PWDA 4IB5A 4ACCA 3I6WA 4G1WA 4FKUA 3F7WA 2BTSA 3OW4A 1MRYA 4D2PA 5I9VA 2E9PA 4QMTA 3FHRA 4V05A 2HW7A 4J8MA 4EOJA 3OMVA 4LMNA 4QMMA 2HZ4A 4TYGA 4EH3A 2I1MA 4EZ5A 4DHFA 3P4KA 2XH5A 4B99A 5E8WA 2ITXA 5CU2A 5EW9A 3UG1A 4FV8A 4I1ZA 3KVWA 4K77A 5CALA 3IGGA 2UVYA 3MW1A 4C3FA 1YWRA 4DINA 4X3JA 5LOHA 3UVPA 2E9UA 3VW8A 2XF0A 3GU4A 3RPSA 4YC8A 3LLAA 4C58A 2X6EA 2YIWA 3U9NA 3R71A 4M0YA 4F0IA 4V0GB 3RK7A 4CQEA 3W32A 3D7TA 5JK3A 3N4UA 4GFMA 5A4QA 2QR8A 3KY2A 3K5VA 3NPCA 4TW9A 3VHEA 1DI9A 3DTCA 3R28A 4G6NA 3AC8A 4JOAA 1YI3A 4LGHA 3EN5A 4YPSA 3TJDA 3OVVA 2CKEA 4RVKA 4KUJA 4WUNA 4QP3A 1M2QA 4Z9LA 3VO3A 4CKJA 4DH5A 3CTJA 3NUSA 3LFDA 3C7QA 4K6ZA 3PP1A 5BVDA 2W5HA 2IG7A 1KE7A 2FSTX 4QMUA 2AYPA 3TKHA 4F7JA 3ULIA 5EM8A 2H9VA 2QOHA 4K11A 4EWQA 1ZWSA 3V5WA 3ATTA 1JLUE 3Q5ZA 4FG8A 3EKNA 4E20A 1HCLA 2RFEA 4AT4A 3WF5A 4EONA 2X2MA 4AS0A 3MN3A 2BILB 1Q3WA 3K5UA 5IKWA 3WILA 2ERZE 4YJVA 3ZYAA 4QMQA 3NYNA 4WNKA 4O0RA 5FBNC 2GFCA 4IDTA 3OXTA 2J50A 4KIOA 3LPBA 4DN5A 2QVSE 4IJPA 1M7NA 3TG1A 4CMTA 4D4RA 3C50A 1O9UA 4U80A 5KKRB 4RQVA 4FIFA 5LMBA 1P5EA 3FY0A 2OLCA 1NW1A 1OL5A 4EHVA 5HG9A 4IVAA 5HD4A 4BN1A 4TYHA 4WG5A 4U81A 4DGMA 2R3PA 3W10A 4RRVA 5JFXA 2ETKA 5AR7A 3ACJA 1OZ1A 2BHHA 2WMUA 3EQHA 3GQIA 3TT0A 2PMLX 4UWYA 2Z60A 2VTHA 3W8LA 5AP6A 2R0IA 5FEQA 4XLIA 4HGEA 4JDKA 5ACBC 1UNLA 4KINA 3NNVA 4PDOA 2NNWB 3RMFA 4C4JA 2BZKB 3EQFA 4TPTA 3TZ7A 2UVXA 2R9SA 3PSCA 5GZ8A 3I7BA 2PZIA 3IW8A 3LXNA 4BGHA 4RZWA 4Y5HA 3QD3A 4QYEA 5LXMA 5AA8A 2OW3A 3OHTA 4A9YA 3QTQA 4KBKA 5JFVA 2QURA 5GNKA 5HHWA 2OZAB 1OIQA 4UMQA 3KREA 3CLYA 3OUKA 4CMUA 3QQKA 2EB3A 3W2RA 3Q6UA 3C51A 1J1BA 3UOLA 4DC2A 3P78A 4D5KA 2VWUA 5J95A 2W5AA 5T3QA 4RVMA 2CLXA 3SLSA 3IDCA 4PDSA 1YW2A 2IO6A 3I81A 5HU9A 5FXSA 2PPQA 2Z7LA 1K9AA 2X81A 4B9DA 1HCKA 4R7IA 2BPMA 1HOWA 5E1EA 3RVGA 3A60A 5L3AA 3CC6A 3ZU7A 5BQ0A 2CDZA 3KKVA 3MIYA 4O0XA 3FYKX 3ALNA 2GCDA 2VO6A 5H9BA 4ZS0A 2YN8A 2V62A 3EN4A 4ARKA 4R8QA 3GCQA 1OVEA 4EZ3A 2I40A 5KMLA 2CKPA 1ZMVA 1CTPE 4UMUA 3FEGA 2VGOA 2WD1A 1H1QA 4IAKA 2C5OA 4DFLA 4EUUA 3P9JA 1SVEA 4TYJA 2X6DA 3GU8A 2C6KA 4R77A 5ANOA 2XJ0A 3FZ1A 5HE0A 3BKBA 4GH2A 4AWIA 4QTEA 5IU2A 5BVKA 3ITZA 2PVMA 4KBCA 4GJ2A 3QBNA 3FL4A 4LOQA 4QQCA 4XG7A 4FUYA 2P2IA 3ZXZA 3RZFA 3TV7A 5GHVA 4AT3A 1U54B 4O27B 1BL7A 2RIOA 4Y85A 1M14A 3BU6A 3VS6A 2VTNA 2E9VA 2VX0A 5A4TA 4CEGA 5KMJA 1PMEA 3UODA 2WTKB 3H3CA 4IBMA 4L52A 4LFIA 5EFQA 4WRGA 4YZBA 4F6SA 4FEWA 3VS2A 1NVRA 2C6IA 4LYNA 1I09A 1ZOHA 5CU4A 5CY3A 3AC5A 2WQMA 5DIAA 3F2AA 1WMKA 4JVGA 5HICA 4GFGA 5BUIA 5IH4A 5AAGA 1OKZA 4FV5A 1OECA 2QO2A 2V7AA 3CY2A 1PYXA 1H08A 2PVYA 1XH7A 4II5A 4L8MA 1Q8ZA 3DDQA 2WELA 3P08A 1UWJA 4X2JA 4H3PA 3ORXA 5K0KA 2I0HA 5IMEA 3HMNA 4KRDA 2R4BA 3NX8A 4D58A 3Q52A 3DK7A 4IM3A 4GIIA 4BCGA 3IDBA 2C5VA 1OIRA 4QT1A 2CN8A 5HIEA 4IEBA 2IVSA 2OJGA 2BDFA 3CIKA 3QFVA 2C6DA 2CGVA 5KCVA 1R3CA 4U3ZA 5H3QA 4EBVA 2Q0BA 4PMPA 3QKKA 3LZBA 4FSQA 4K2RA 4BIDA 2QQ7A 4FSNA 3EKKA 4FZ7A 5CU3A 3UZRA 4YP8A 4M3QA 5C9CA 4FBXA 5HORA 3P7CA 3OWKA 3FMLA 2PULA 3ZCLA 3TZ8A 1R39A 4CGAA 3L8XA 3UYSA 2IW6A 3E93A 1QL6A 2HZIA 1PY5A 4E5WA 4OTWA 2WNTA 5AP0A 3LM5A 3BV3A 4C0TA 4KBAA 4UMTA 4YSJA 4MWHA 4DH1A 4Z7GA 1ZRZA 5IQGA 4D2VA 1DM2A 2W7XA 4IMYA 4YBKA 3S1HA 3KULB 1XO2B 3ANRA 4FEQA 5IEVA 3V6RA 2F7ZE 4IQ6A 3BHYA 2JKQA 3BE2A 5JMSA 2JITA 4G16A 2SRCA 2YM6A 2HY0A 4JQEA 4WKQA 4JRVA 4BWKA 5CANA 1YWVA 4CG8A 3UOKA 3MSSA 4IM2A 4FG9A 3C4CA 4AN9A 4R3PA 5E8TA 2WPAA 2YITA 3JY9A 4JX7A 4W8EA 2UZNA 4NTTA 1YWNA 5EOBA 4J96A
chains in the Genus database with same CATH superfamily
3T9TA 5EM7A 5CNOA 3CD3A 3ORZA 2J6MA 4J99A 2F57A 5IH5A 2WAJA 3QUPA 3G0EA 3VHKA 2QHMA 3ORLA 5AR5A 3BHUA 1GAGA 5E8ZA 4ALVA 5CEOA 4CYJA 4O0YA 2Y4IC 2IZSA 3JUHA 2P33A 3GXLA 3O0GA 4OBOA 2XUUA 2JDRA 1G8JA 4ZLOA 3WF7A 3EWHA 5IH6A 5AFVA 1PXIA 4LRKA 3THBA 2WKMA 3SVVA 4U7ZA 5D12A 4P90A 1WBOA 2QOOA 5HVYA 5KX8A 3FBVA 4GS6A 4M14A 4OUCA 3R00A 5IQDA 3VUMA 3UIMA 5CEKA 2AQXA 2UV2A 3EN7A 4RX9A 3HRBA 3NGAA 1IAHA 3OWJA 3TKUA 3VS5A 1OL6A 4QP6A 3NAYA 3BE9A 4MXYA 4BJJB 2OIQA 2UZBA 4WIHA 5FTGA 1KWPA 3P79A 4LOOA 1Y6BA 2FVDA 4I3ZA 4M97A 4RX8A 3UP2A 2X8DA 4C3PA 4FK6A 2W1IA 4YURA 2YIRA 3DJ6A 1ZZ2A 3DV3A 4XRLA 3HRCA 4EQMA 5DG5A 4FIEA 4IXPA 3UG2A 4DH7A 1YOLA 3U55A 3ZO3A 4OTRA 4BYIA 1H26A 2OFUA 4O21A 1JBPE 5IQIA 3NUAA 3C4XA 2YABA 3DOGA 4Q5HA 2R7BA 2BZHB 3BBWA 3F5GA 2WZJA 3HLLA 3KMUA 5HG8A 3UGCA 4H1JA 4F1OA 4FTJA 3EOCA 3GENA 2VN9A 3QTWA 5LMAA 4TNBA 3PZHA 3OXZA 4CQGA 4DEDA 1YHSA 3DT1A 2WMWA 4JL9A 3SOCA 4R5SA 4CT1A 5CAOA 3Q6WA 4MBJA 5GIOE 1O6YA 3ZM4A 5DR2A 3RAWA 4IWOA 1CMKE 3PFQA 3QQFA 3WE8A 1GIIA 3KGAA 4EK4A 2PL0A 3Q3BA 4PMMA 4HZSA 3JXWA 4GG7A 1H0VA 3MH3A 4FTKA 3SV0A 2UW3A 4FTNA 4HOKA 4PNIA 5HCZA 4XV1A 4C62A 3CTQA 2CPKE 2UW5A 4FT0A 4FTCA 4MXOA 4WG4A 4PDYA 2BDJA 2GMXA 2O63A 4RA5A 4QMPA 5F4NA 2HY81 4IDVA 4JNWA 3WF9A 3A7FA 4NM0A 5E7RA 5CEMA 5KMNA 3FLZA 5IQAA 4DCEA 4O7YA 1K3AA 4ZP5A 4FT9A 1IA8A 4CV8A 4MNEA 2I0VA 4GU9A 4AXFA 2WEVA 4GUEA 3U6HA 2W4KA 5KHXA 5M06A 2W06A 4U0IA 3ZLXA 3V5TA 4ZLYA 3FI3A 4NU1A 2VAGA 5AUYA 3MTFA 3LFCA 3QTRA 3FXXA 4OBPA 4Y5QA 3DNEA 4FKQA 2W5BA 1H1PA 4EOPA 4AE9A 4OBQA 2Z7SA 2QU5A 4RIYA 4FSYA 3KXMA 3TNHA 4Y46A 3BGQA 2QODA 3CQEA 3U54A 5FG8A 4D1SA 4RA4A 5FTQA 3FC2A 5L6WL 2RG6A 3FYJX 5EQEA 2XIZA 3DNDA 3EJ1A 3MPMA 3SD0A 5AV4A 2B1PA 4I5PA 5JT2A 3PJ3A 4GIHA 4ANMA 5J5TA 2ACXA 4XRJA 4U40A 4RJ6A 5J9ZA 2PVLA 4O6EA 2VTAA 4QEBA 2QO9A 4MXXA 3PSDA 3QUDA 2XK7A 5L2WA 4IW0A 4BI2A 4JDJA 3OCTA 3QA0A 4R78A 5IA1A 4ZJJA 4EYJA 5ANDA 2B55A 3E87A 4MBLA 4QTCA 4FTAA 4AUAA 3FMMA 4ID7A 3ACKA 3UNKA 3D5VA 4QPAA 2GTMA 3QC4A 2WQOA 3KCFA 1GY3A 4RFYA 5IG1A 1OL7A 3H10A 4HCVA 4IE9A 3QYZA 4J97A 4QYFA 3PVWA 3V3VA 5L4QA 5L2QA 3R7OA 3R8UA 3KA0A 5AIKA 3R8MA 4WOVA 3D9VA 2QR7A 3UMWA 2F4JA 4IWQA 4QQTA 1F5QA 5DR9A 1YHVA 3TN8A 4CFUA 1GOLA 4RQKA 3FMNA 2BAKA 3NAXA 1XR1A 3R7UA 1GNGA 3VS0A 1VJYA 2G9XA 3R04A 2ZB0A 4RJ4A 3ZRKA 1ZXEA 3DK6A 4R7HA 3PXQA 3SRVB 4NSTA 2C6TA 4IAIA 5A9UA 5CLPA 3M1SA 3U87A 3GGFA 3G90X 1JSVA 2VX1A 5AR4A 3UP7A 4FI1A 3FI4A 3AMAA 3OT3A 2QI8A 4L3LA 5D41A 3W8QA 4FVRA 3LFAA 3PJ8A 2FSLX 5JRSA 3BHHA 2UZEA 4CV9A 4K18A 4R5YA 1URCA 3SKCA 4AZTA 4QMVA 1OPKA 1P4FA 4AZSA 3KCKA 3E88A 4TRLA 5IF1A 2HAKA 2JDTA 2XK3A 2F7XE 3GC9A 1ZYSA 5L8JA 4RX5A 4MCVA 3COKA 5AR2A 4S34A 4C38A 3VUHA 1PW2A 4PMTA 4X2NA 3AKLA 4I4FA 2J51A 3GCSA 1GZNA 2A27A 3Q4CA 1FMKA 3COIA 4I5MA 4F0GA 4PX6A 3ZFMA 5I9XA 5J87A 3ROCA 4YZCA 4D4YA 4WG3A 1P2AA 2YDJA 4C7TA 1BI7A 3Q4ZA 2OXYA 5HU3A 1GZKA 1TFFA 4IB1A 4O82A 2VNWA 3OCSA 2ZB1A 2LGCA 3PLSA 4YHFA 3HEGA 4TZRA 4C4GA 2CKQA 4O2ZA 3F3TA 3KU2A 3TJCA 4YU2A 3IW5A 2JBOA 3W33A 3QCQA 4FL3A 5AR8A 3HAVA 2W1EA 2W4JA 2Y8OA 3I0QA 3I1AA 5HVJA 3MJ1A 4PPCA 4MTAA 2YZAA 4EOOA 3NVMB 3FZSA 4G9CA 1YXUA 3COMA 5CEQA 1PXOA 4NCTC 3ORTA 4DEAA 3G2FA 2GQSA 2O65A 5D10A 5EYDA 4D0WA 1NY3A 2R3HA 3NUYA 3I6UA 4KKHA 3QTSA 3UIXA 3V5JA 4F65A 4FR4A 2O5KA 3UOHA 2WFYA 4FNXA 4CCBA 3C5IA 2PZRA 1ATPE 4AGCA 4BFMA 1T46A 4DTKA 4BCOA 4AXDA 2RGPA 2BZIB 2CMWA 4QO9A 4K1BA 2J7TA 2YM5A 3TYKA 4O2PA 1ZYLA 3CPCA 3G15A 4ZZMA 3ZUTA 4ASXA 3FPMA 4BGGA 4M15A 4DDIA 4BCPA 5EK7A 3ZBXA 2F49A 3F5PA 3R2BA 4F64A 2W0JA 2PWLA 2OXDA 1R78A 3VUGA 2ZYBA 3D2KA 4HYUA 2VTRA 2EXCX 2YIXA 4R3CA 5AUWA 1VYWA 3RTPA 3UMXA 3GVUA 4YZ9A 3HX4A 5CNNA 3BZ3A 4O7WA 3BLQA 4UWCA 2PVRA 5AP2A 3C4FA 3NUXA 3RKBA 2W1ZA 5BMMA 4AACA 1Q99A 2VTQA 4OTIA 4W9WA 4B8LA 3VJOA 4EZ7A 5IPJA 3E62A 1XH9A 3O2MA 4PQNA 1OB3A 2B9FA 3QQJA 4O4FA 4OT6A 1LUFA 1PF8A 4XEYA 4ZAUA 2WMSA 1JPAA 2B4SB 3DJ5A 1R0PA 2WIHA 5M55A 3TXOA 3PXKA 4W4VA 4O1PA 2EU9A 5A4LA 4ZOGA 3E3BX 2ZMDA 4GEOA 4JDIA 1FVTA 3PIYA 4L44A 2A4LA 2UZWE 5T6KA 4C34A 2J0IA 1GZ8A 4CMOA 5GIPE 3S4QA 3HV7A 3P7AA 3RPRA 3UVRA 4MH7A 4X3FC 4NJ3A 4ZY5A 3FSFA 4ZTQA 2JGZA 5HTCA 3EMGA 3QD4A 4AFEA 5CYIA 1G3NA 5BX0A 4D0XA 3MJ2A 5F95A 2OF4A 3PWYA 2Y7JA 3PLAE 1IASA 3OP5A 4FKOA 4XMOA 3BYUA 3VW6A 3W0SA 4MUQA 5LARA 4UYAA 3D15A 4CZTA 2C68A 2J0KA 2R7IA 4FIGA 3Q53A 1YXSA 2QCSA 4U8ZA 4C4EA 4D1XA 1Z5MA 3VAPA 5KE0A 2R3OA 5L2TA 3GNIB 4IWDA 3F2RA 5IUIA 4O0UA 3NCZA 1XHAA 2X0GA 4FC0A 4FV3A 4M7IA 4WNMA 4FVPA 3AG9A 3PPJA 2GNJA 4AAYA 3ZZWA 4BDDA 4BY9E 3QXPA 3PA3A 2BHEA 4O0TA 1H1RA 4M84A 2XEYA 4I6FA 4AFJA 4EKLA 4IJ9A 4BTKA 3SW7A 4TYIA 4O0WA 1ZMWA 2WOTA 4P2KA 4CKRA 1STCE 2EUFB 2YCSA 3GEQA 4Q5EA 4E73A 3FQSA 4AA5A 4I20A 3HGKA 3E7OA 2BAQA 4C37A 3RAIA 2NP8A 3D5UA 4GT5A 3UPXA 3LCSA 5EYCA 4J52A 4JIAA 4FV7A 2OSCA 3R8PA 2YLEA 1PXLA 5AM7A 1W82A 1LEWA 4BCNA 1Q24A 4DEEA 3FMDA 4E3CA 2VTJA 3Q9WA 2ZM4A 3MH0A 5EI2A 3NVKI 5TR6A 2ZV8A 4L9IA 1JKLA 2PK9A 4TWCA 2C6OA 4MK0A 2PZ5A 3NR9A 4JIKA 4ITIA 4O0VA 3JPVA 2YCFA 4I22A 2EXEA 4FV1A 4HPTE 2C6EA 3V5LA 3SX9A 4F6UA 5JEBA 1AQ1A 3GOPA 3VS1A 3BL9A 2R3RA 2YM8A 5CVHA 2QC6A 3AKKA 4O6LA 3A8XA 4AOTA 2WTIA 5AP3A 4XUFA 2P0CA 4IX5A 2HK5A 5L2IA 4RMZA 3DS6A 4YTIA 2QG7A 5IQBA 4KS7A 4NFNA 2QONA 1H07A 4ZJIA 2FA2A 2R3IA 2XK8A 3MS9A 2ZV7A 3P1AA 4U79A 4N6YA 3LKMA 4NIFB 3QTZA 4M0ZA 4M69A 3M2WA 4FL2A 5EDPA 1PXKA 4I24A 4E5BA 3EQBA 5J8IA 3ZBFA 5BUEA 4EK3A 4PTEA 2VTOA 3RM6A 1ST0A 2XIRA 4TTHB 4UALA 4CNHA 3Q2JA 1YQJA 2VTIA 3FHIA 3LCTA 5FTOA 3NDMA 4CRSA 4E7WA 4UXLA 2NO3A 4XG8A 3II5A 4HPUE 4HYHA 2GSFA 2ZVAA 3EFKA 2C1AA 5HCYA 4E6DA 3IKAA 4GMYA 4EQUA 3O8TA 1ZMUA 3SAYA 5EKOA 4OTQA 3VBXA 2AC5A 2Y4IB 3WBLA 4RT7A 3WZKA 4I41A 3NIZA 4JJRA 5KMKA 1REJA 2OF2A 3FZOA 5IA4A 2F7EE 2FYSA 4OT5A 3CEKA 5C8NA 3EFWA 2UW0A 3G9LX 3F3ZA 4FNYA 5ETCA 3NNXA 3IW6A 3L8PA 4MVFA 4DG2E 3FKOA 5FWKK 3AKJA 3ZFYA 4L46A 3U6IA 3RWQA 1H1WA 3DBQA 3EFLA 3IO7A 1A48A 3R7VA 4S33A 2R3QA 3FLWA 3NYOA 4ERKA 4ZMFA 1CKIA 3MVHA 3F5UA 3NS9A 1QPDA 4AOJA 2WO6A 2B9HA 3WOWA 2QNJA 3FPQA 5ETFA 4ASZA 4AW2A 3TIZA 3BYSA 1OIUA 3UBDA 4BHZA 4H36A 5JN2A 2R3MA 3AC4A 2Z7QA 3G6HA 3IW7A 3OG7A 4IC8A 4CTCA 4LMUA 3CD8A 3KXGA 3NZ0A 1REKA 5AX3A 4KD1A 5EKNA 2J0LA 5HD7A 1YDRE 3D2IA 4AG8A 3N51A 3HMOA 3AXWA 4ZTRA 5HEZA 3IG7A 3QA8A 4I0SA 4HVDA 4IX4A 4PTGA 3HUCA 1WBTA 4GU6A 3MI9A 4DEIA 4GW8A 3RGFA 1OI9A 4C61A 1BLXA 3GU6A 4PL4A 4WRSA 3NLBA 2YJRA 4ANQA 2PMIA 2UZVA 3DTWA 3OFMA 4D5HA 4EEVA 1XH8A 4X2GA 2XBAA 4MXZA 4U5JA 1WBPA 2E9NA 4ALWA 4AN2A 4BVUA 4S31A 5ANIA 2DS1A 4O91A 4C33A 4ZXTA 5G1XA 4GYIA 4OTGA 3FMJA 2VTSA 1TQMA 3CS9A 4IAFA 5C8KA 1OMWA 3DKOA 2W1DA 2YAKA 4KIKA 2IZRA 1ZLTA 3QLFA 5GJGA 3GCVA 4DAWA 3KN6A 4EORA 4I6QA 4UMPA 3RHKA 2X9FA 3O96A 3EFJA 1WBVA 3UQCA 2XK9A 3BV2A 1UKIA 1H28A 3MTLA 4BGQA 3TZ9A 4YO6A 2VWZA 1ZAOA 4XP2A 3E5AA 4ZSJA 5FM2A 2R64A 3R9NA 4BYJA 4JG8A 3KRJA 5I9YA 1FGIA 4IC7A 3BYMA 4GG5A 5I3OA 1IRKA 1H01A 1H25A 5DE2A 3W55A 3R8LA 3ZLYA 4TWPA 2X7FA 5AV0A 4D9TA 3MVJA 3GOKA 3PYYA 3LXKA 5DPVA 4TYEA 2RSVA 4RZVA 4TKSA 1IR3A 4UZHA 3M42A 3C9WA 5DWRA 4C59A 4KS8A 3RCDA 4MX9A 3SHEA 3ID6C 1WVXA 2UZLA 2ZAZA 3DK3A 4N0SA 3UZPA 3F82A 4KSQA 5KZIA 4QYGA 4E4LA 3AOXA 3PY1A 3I7CA 4CLJA 3ODZX 3IONA 3R6XA 2Z2WA 4B8MA 3U4WA 2J0MB 3AGLA 4FICA 5CF8A 4NH1A 5EI6A 1YKRA 5DT0A 3SA0A 3LE6A 2B54A 3NUNA 3PJCA 4FZ6A 4MNFA 5B2KA 4EK5A 1OBDA 5AUTA 4G5JA 4MD8E 4FEUA 4FTOA 3VC4A 4QMZA 4ZTNA 1FBNA 4RWLA 3MVLA 4EH5A 3UNJA 2CGUA 4L7SA 1XH4A 2JDOA 3K3JA 3TV6A 3MFTA 3PPZA 4L3JA 3VS4A 3W18A 3ZO2A 5J1VA 2P3GX 4FEXA 3A8WA 1MRUA 1B6CB 5LWNA 4BRXA 3RP9A 3S00A 2BALA 4BDIA 5C1QB 4H39A 5ICPA 3COHA 1BX6A 1G8KA 2BRMA 3A7JA 2IVUA 4JMQA 1U5QA 5IEXA 3O7LD 1MRVA 5DYJA 4PRJA 5CI6A 3QTIA 4AGUA 3LCDA 4AA0A 5A3XA 1WBSA 5HOAA 3SOAA 5I9WA 5JH6A 2W1GA 3ODYX 4ZSGA 5CZHA 2A2AA 1QPEA 2UW4A 2R2PA 4O7NA 4F1TA 1XWSA 1UNHA 2X7OA 2O3PA 4TWOA 5FM3A 4PY1A 1ERKA 3O8PA 4DTAA 4UN0C 2JAMA 3E92A 4EWHA 1YXTA 5HX6A 1PHKA 2XBJA 5ITAA 1XQZA 4HYSA 4JAIA 3GQLA 3VBQA 5DNRA 4IX6A 2ZV9A 3A4PA 3QXOA 3DAKA 4EOSA 2P55A 5DEYA 4BBFA 3HMPA 5B0XA 4UMRA 2PVHA 2WMRA 4UBAA 5TE0A 4RJ3A 4FSWA 5HG7A 2PU8A 1ZYJA 3C4ZA 1WVWA 3FE3A 4GVAA 4IFGA 4ITHA 5DGZA 3S2PA 3ZZEA 4TNDA 4A07A 2FO0A 3EZVA 4G31A 3F2NA 5J9LA 2YISA 4FKIA 3RPVA 4Q9ZA 4QP4A 3PE2A 2JD5A 4A9UA 5IZFA 4E6AA 2ITWA 3VRZA 4BI1A 1TKIA 4WA9A 3TMOA 4LRMA 1H00A 1L3RE 4AXCA 2YERA 2JKMA 2Z8CA 5IA0A 5LVMA 3R1NA 2IVTA 3JYAA 3DXQA 4BWXA 4CFVA 4EHEA 5CVGA 4BCHA 3E8EA 4YJQA 3DLZA 4RIXB 1PKGA 4NZWB 4QMOA 3CJGA 4BKJA 3TUCA 2A1AB 3O50A 2I0YA 4RVLA 2XARA 4F9CA 4V01A 3F66A 1SYKA 3AT3A 4RIWB 2FUMA 5E4HA 5KMIA 3CTHA 1YI4A 4IVBA 5AX9A 4BCQA 5M53A 3LOKA 2J90A 4G3DA 2F2UA 5K5XA 3PA5A 4DLIA 2XALA 4ZY6A 2JDVA 2QOKA 1H1SA 2JDSA 2VRXA 3AC2A 5HIDA 4M66A 4J71A 4FYNA 5D1JA 3WZEA 4C3RA 4TWNA 1M2RA 1P4OA 3FKLA 3IOKA 5E8UA 5HX8A 3L9NA 3UO4A 4EOQA 1OPJA 3MDYA 4FF8A 4BIBA 4CFFA 3TEIA 3UDSA 3DZOA 3FDNA 1NVSA 4QMYA 3VWAA 3K54A 5AP1A 3ORMA 5LQFA 4EJ7A 1MP8A 3PG1A 4KNBA 4EC8A 4JRNA 3MFRA 5AEPA 4HVHA 1FOTA 4IVDA 3G9NA 1Q5KA 2YCRA 1ZARA 3LFFA 3WZUA 4C4IA 4FOCA 4ZSLA 4FMQA 4HNFA 3N4VA 4WHZA 3QZFA 1BUHA 4D9UA 4JG7A 2GHLA 1KOBA 1WCCA 1XKKA 4AX8A 4XNEA 3POOA 5HVKA 3KK8A 4KWPA 2C0OA 4L3PA 4D55A 1IAJA 5F9EA 4HVSA 3RK9A 2CSNA 4AZWA 3LW0A 2OJFE 5CXHA 3ZDIA 4O7RA 5CU0A 1W2FA 5T68A 3SC1A 3DBFA 5LWMA 4FZDB 4FKGA 3CQWA 4KABA 4NJDA 3AC3A 4X7QA 3EQCA 1OKWA 5CSWA 2XNMA 4Z7HA 5EHOA 5A6NA 1E1XA 3V5PA 1S9JA 2Y4PA 4MBIA 5HE1A 4E26A 4YGAA 4MQ1A 2GTNA 5CAQA 3NMUF 3BI6A 3PSBA 4G5PA 3IGOA 4X3FB 4CVAA 4ZSAA 4OTDA 3KXHA 3Q60A 5K3YA 3PY0A 4QP9A 4NM3A 3BQRA 4RWKA 4B0GA 4OAUC 3BELA 5M08A 5KZ0A 3GI3A 5I5ZA 5FRIA 2ITQA 1CKJA 2A98A 2W1CA 5CT7A 4DHZA 3D5XA 3LJ0A 3ETAA 1YOMA 3FUPA 4OTPA 5E8SA 4FKWA 2IN6A 2WU7A 4YO4A 5M09A 3D14A 4TN6A 3RI1A 2WIPA 1PXMA 5IA5A 3R21A 3R9HA 4ERWA 3QTXA 1V1KA 2V55A 2VV9A 4L53A 4FGBA 4ZK5A 4RIOA 4A7CA 5FQDC 3RCJA 5CF6A 3RK5A 4FSTA 4QYYA 4YLKA 3DQXA 4YHTA 4AW0A 3AT2A 1Q8YA 1QPJA 3V8TA 3HV4A 1YRPA 4X0MA 3UQGA 4LL5A 3IQ7A 4PNKA 2HYYA 4Y8DA 1H27A 1KE5A 3KN5A 3PIZA 1E1VA 2HIWA 2XIYA 3DZQA 1F0QA 4EK8A 3FMEA 5HI2A 4AN3A 3QRUA 3OXIA 4O4BB 4QPMA 3VQUA 1NXKA 5LMKA 4BR3A 4Q2AA 3ATSA 3D7TB 4ZIMA 5AV1A 4BDAA 3QQUA 3R30A 3HAMA 5BVEA 2B7AA 2UZOA 1O6LA 1DAWA 4NW5A 5M57A 1W7HA 4IZYA 2ZDUA 3Q04A 3QX4A 3ZSGA 3REPA 4O4DA 4IZAA 1YDTE 5CQUA 4F99A 1Q8WA 5AV2A 3GU7A 2YA9A 2YFXA 4W4YA 4AA4A 3QU0A 4Z16A 3UOJA 3L9MA 3TDVA 2WMAA 3ZFXA 4HYIA 3WE4A 2C47A 4XV3A 3NCGA 2UZTA 4P7EA 3DFAA 3AD4A 4BICA 4A06A 4DBXA 4ACHA 4PPBA 5LCKA 2BAJA 2QOCA 3FI2A 3PP0A 2HXLA 4NTSA 4U41A 2KULA 2BDWA 1GJOA 1RDQE 3DGKA 4GFOA 4BC6A 1WZYA 4WNPA 4DBNA 2R5TA 4XBUA 3F69A 4LDTA 5DLSA 2IW8A 2OBJA 3QD0A 4A4LA 2X39A 3H30A 3LVPA 5HNGA 3UTOA 4DH8A 3BL7A 4ZLZA 3QLGA 1V0PA 3LJ1A 4U42A 4V0GA 1T45A 3OCBA 4FT3A 3ZRLA 2FH9A 4F4PA 5H8GA 4GK4A 3IOPA 3LFQA 4TYHB 3VONA 2IEWA 3OWLA 3HECA 4BI0A 4RJ5A 5IQCA 3LCKA 2QHNA 2PHKA 4Z55A 3PXRA 5E1SA 1NVQA 3BHVA 4HNIA 5K4IA 4H05A 3LFBA 4XV9A 4UYNA 3MPAA 2CLQA 1FGKA 4EKKA 4EOMA 3QHRA 4H3BA 4BCIA 4MXCA 2WTVA 4J53A 4JBVA 3WYXA 4HCUA 5AIRA 5IQEA 5ETAA 5BVFA 5EDQA 5L2SA 3HKOA 4C57A 3MB7A 4C2VA 4FZFB 3EYGA 4ITJA 5CASA 4DEHA 5AAFA 3OBGA 2RG5A 3KC3A 1OUKA 4FSRA 4GRBA 4JLCA 4FA2A 4IANA 1EH4A 3ERKA 3MY1A 5AUXA 3PFYA 4K9YA 3DKCA 3R02A 4LUDA 5ANEA 4D4VA 5DH3A 3F61A 4MHAA 2W05A 4YJRA 1MQBA 1WBWA 2WTCA 3IECA 3SG9A 1KE8A 5BVOA 1UNGA 3NUPA 5M4IA 3HZTA 4NM7A 3O51A 3OCGA 4ASDA 5HQ0A 3U9CA 4IVCA 4BCMA 1Y6AA 4DEBA 2I7QA 2R3GA 2XK4A 2YWVA 4BL1A 4Z3VA 5A54A 3ANQA 1YDSE 2C3IB 3SQQA 5I9UA 4GT4A 2O2UA 4LI5A 4E4MA 2W96B 1XH6A 1WBNA 3R73A 1SNXA 3GP0A 4FTUA 5TO8A 4I6BA 4QP2A 1ZYDA 3TUDA 2PMNX 5IDPA 3UQFA 2ZV2A 3DCVA 3V01A 3ZONA 4LG4A 4RFMA 4BZDA 1XMLA 1Q8TA 3W0RA 4CZYB 3R9RA 5KMOA 3H9RA 3S3IA 2OI4X 3IW4A 5FEEA 2W9ZB 2IJMA 4HGLA 5TF9A 4RWJA 1KE9A 4J7BA 5HE3A 4G34A 5DA3A 3VUKA 1J1CA 2R3FA 4NW6A 2RKUA 4WT6A 5HTIA 4MF0A 5AR3A 4BBEA 3JR1A 3LQ5A 2I6LA 2GU8A 3LMGA 4QMWA 1CDKA 4YTHA 1PMUA 4G9RA 5A46A 4HCTA 2NRYA 3UJGA 3KMWA 3NNUA 3DB6A 2ONLA 3EL8A 3QF9A 1W0XC 4EH8A 5BV3A 1ZYCA 4I4EA 3SXFA 5CZIA 2OIBA 5JSMA 2Z02A 3OZ6A 2XNOA 3R9DA 4KKGA 5CS6A 2J4ZA 4E5AX 1SZMA 2H96A 1O6KA 5F1ZA 3QWKA 4AT5A 3VQHA 4WUAA 3I5ZA 5AAEA 1JNKA 3FZTA 5JRQA 4XV2A 3VS7A 2CN5A 3KXZA 4W9XA 3G33A 5AADA 3G51A 4FV0A 4YMJA 1B39A 3A61A 1ZOEA 1G8AA 1W8CA 2C5NA 2GNLA 3JVRA 5EI8A 3TIYA 4J1RA 4YLJA 5C03A 4FNWA 5CSPA 1Q4LA 3SXSA 4C4HA 3QCXA 4F1MA 5LVLA 1FVRA 2GHGA 2XM9A 5AUUA 5KBQA 5AUZA 4F7NA 3CXWA 5IDNA 5H2UA 4F7SA 4C2WA 4DT9A 1CM8A 5CF5A 2BZJA 3FJQE 1Y91A 3L8SA 5GZ9A 4O81A 4EOLA 3HV6A 5KO1A 2UW6A 4FSMA 4JAJA 3OF0A 3PVUA 4MD7E 4F9BA 2CHLA 5ETIA 1PMVA 3E3PA 4AF3A 1Q8UA 3H9FA 4RBLA 4JR3A 4R3RA 3V04A 3DKGA 4F70A 4FIHA 4L01A 1A9UA 4ZZOA 2VX3A 3DLSA 4O4EA 4UY9A 4BTFA 1UKHA 2QOLA 2J9MA 3F3UA 5HBJA 2YM4A 1P14A 2QLQA 2V7OA 4LGGA 4FG7A 4KRCA 4L68A 2XKDA 4M13A 5CQWA 2OWBA 3R01A 3R8VA 3PIXA 4FODA 3WZDA 2GQGA 4GK2A 1LP4A 4X6RA 5D11A 3U6JA 3E64A 4A4XA 2XKEA 3QAME 1H0WA 4YUQA 3C0IA 2HZ0A 3QRKA 4F09A 4USEA 2IVVA 3W2SA 1OL1A 3QKLA 3ZC5A 4C35A 1UU9A 5IA3A 5JQ8A 2BRNA 1RW8A 5LCJA 3UPZA 4ORKA 4DEGA 3BX5A 3KMMA 4PWNA 3C4EA 2G01A 3FSKA 3I79A 4QQ5A 5DRDA 3R8ZA 1GZOA 1PXNA 2X4ZA 4RC4A 2OJIA 3MGYA 2C30A 3KF4A 4O0SA 4I5HA 4O84A 3B8QA 2CNVA 4CRLA 4XG9A 1XBCA 5HGIA 2P2HA 4DLJA 3OROA 1FPUA 3CJFA 4YJPA 4V04A 3WF6A 4HW7A 5C4LA 3ZH8A 4GT3A 4D2SA 5BUJA 2GHMA 2QOQA 4YZNA 3O17A 5AJQA 2JEDA 3H0ZA 4XOZA 1J3HA 3GC8A 5AP5A 5FDXA 4DHJA 4W8DA 3D83A 3KFAA 3VBWA 1YI6A 4B6LA 2ZFYA 2WB8A 3C0HA 4IAYA 2OXXA 1V0BA 2X2LA 4GCJA 3B2TA 3G6GA 5FXRA 2HZNA 4O7LA 4RGJA 2IPXA 3R7GA 2IZUA 3KULA 3QRTA 2CJMA 3R1QA 4I21A 3CKXA 5FBOA 3RINA 5CSVA 4ZZNA 3FQHA 5M4CA 5K9IA 3ZRMA 4CKIA 3QQHA 3P7BA 2W4OA 3EHAA 3RNYA 4RJ7A 2VWWA 5BMSA 3QGYA 1R0EA 2EB2A 1F3MC 4H1MA 3I4BA 4F7LA 3VULA 4CFWA 3Q9YA 3CCNA 3MWUA 3DQWA 4YJTA 1M2PA 4CCUA 3R1YA 2BMCA 4WO5A 2VUWA 4EC9A 4DFBA 4YTFA