4QT1A

Jak3 kinase domain in complex with 1-[(3s)-1-isobutylsulfonyl-3-piperidyl]-3-(5h-pyrrolo[2,3-b]pyrazin-2-yl)urea
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
289
structure length
277
Chain Sequence
PTIFEERHLKYISQLGKGNFGSVELCRYDPLGDNTGALVAVKQLQHSGPDQQRDFQREIQILKALHSDFIVKYRGVSYLRLVMEYLPSGCLRDFLQRHRARLDASRLLLYSSQICKGMEYLGSRRCVHRDLAARNILVESEAHVKIADFGLAKLLPLDKDYYVVREPGQSPIFWYAPESLSDNIFSRQSDVWSFGVVLYELFTYCDKSCSPSAEFLRMMPALSRLLELLEEGQRLPAPPACPAEVHELMKLCWAPSPQDRPSFSALGPQLDMLWSGS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Tyrosine-protein kinase JAK3
publication title Scaffold hopping towards potent and selective JAK3 inhibitors: discovery of novel C-5 substituted pyrrolopyrazines
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 87
structure length 277
sequence length 289
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2014-07-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4qt1A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4qt1A01
1PKDA 2OIQA 3KXXA 4Q5HA 3ZZEA 5L2WA 3QL8A 4KKHA 1NY3A 3EMGA 4BWPA 4A4XA 3QBNA 1MP8A 1E9HA 2HZNA 2J2IB 2OH4A 4GMYA 3PDTA 3NMUF 1P4FA 3LKMA 5IQAA 3DQXA 2BRGA 4IX3A 4DBNA 4XRLA 2QR8A 1UKHA 4IZ5A 3QXPA 2ZMCA 3C9WA 4P90A 4QMLA 4Y85A 3F6XA 4GSBA 3W2QA 4CT1A 5HTCA 1GIIA 3OF0A 4NIFB 4IWPA 2Y6OA 2JDSA 2B1PA 2JIIA 3K3JA 3EFKA 4AZVA 3UE4A 2XA4A 3FV8A 5CZHA 4JRVA 3KGAA 4FGBA 4CQGA 4KUJA 2EXCX 2J50A 1YXUA 4J99A 4DG2E 4MKCA 4L53A 2F57A 3CY2A 3VJNA 4HGTA 4FSUA 4MWIA 5AP3A 4IX5A 3RAHA 1M17A 4EWQA 3DLZA 3U51A 4A4LA 2ZB0A 3BYMA 2CLQA 3CQEA 3QKMA 3ZSHA 3G6HA 5CALA 2YJRA 4JVGA 4P5QA 4N57A 2R3GA 3RINA 3S3IA 2EVAA 3LJ2A 2ETKA 3FMDA 4M97A 4BCOA 1PXOA 5C8NA 3TNQB 1MRVA 2W4OA 5ITAA 2XM8A 3LQ8A 2WEVA 3CJFA 3GP0A 3BYOA 3BYVA 4HCTA 4XOZA 4YC8A 1PW2A 2FA2A 4JDJA 4L6QA 4RVKA 4IAAA 2XKDA 3E88A 1H0VA 4EH8A 4F08A 4OBOA 5T6KA 4DTKA 2BRBA 2GNIA 2IN6A 4XG2A 2XNNA 5AP4A 2J90A 1FPUA 3FLSA 5IA2A 2FO0A 4BYJA 4HNIA 4I41A 2BDFA 4IC8A 4I92A 5DEYA 1UVRA 3WOWA 3OZ6A 3P7CA 4KIPA 2XIKA 1U54B 1OI9A 5HX8A 4BWXA 2Y8OA 4J98A 2YIRA 3E3BX 1YXTA 3U87A 4TWNA 3E3PA 4I5HA 4XP0A 4BFMA 3R1YA 4PPCA 5IA1A 4O7YA 5LXMA 5M51A 3AGLA 3OBJA 4F1TA 5HVYA 4EBWA 5TOZA 4KAOA 3U6IA 1WVYA 4HVHA 3V8SA 3F2NA 3F5UA 3KVXA 4RJ7A 1PXLA 4RLLA 4IDVA 5BUEA 5B2KA 1A48A 2VZ6A 1TKIA 3KRRA 3EWHA 4ZK5A 3F3UA 4AXAA 3OTUA 3QALE 2V55A 4E5BA 5KMMA 5AMNA 3SGCA 3SQQA 3AC3A 3G5DA 4B0GA 2W7XA 3B8RA 2VX3A 5HIEA 2OFUA 5I9VA 2BALA 4RIWB 3QC9A 4EH6A 4DFYA 2WB8A 3DDPA 4IVCA 1VR2A 2JGZA 3RPVA 2NO3A 2X4FA 4D4SA 4RX5A 2OKRA 3PLAE 3NZ0A 4AGDA 5I5ZA 3COKA 4FV1A 3R2BA 4LOOA 5HU3A 4JBPA 4UMTA 3HV3A 4R8QA 2BZIB 2QOOA 2QI8A 3TACA 3ORIA 4AWIA 3UODA 4BDDA 4QYFA 5BVEA 3QCYA 4F1OA 5AR4A 4G3FA 5FRIA 3QQKA 3TNHA 4Z7HA 4YTIA 2OJFE 2Z7QA 3TDVA 3GCUA 3U9CA 3ZDUA 4BCIA 2Q83A 2JKOA 3QGWA 4FV2A 4KBCA 4AE6A 4BIEA 1CTPE 4IEBA 5FGKA 4QTBA 1QPDA 3HV7A 1XWSA 3KRXA 3DA6A 3VS4A 2BIYA 4WSQA 4AOJA 5CEKA 5IMEA 5HLWA 2QU5A 4MQ1A 2C0OA 4KIOA 5E7RA 2XUUA 5KMIA 4FKSA 4RJ6A 4F7NA 4HOKA 2PMNX 4MX9A 3PVBA 4C61A 4WNKA 5HEZA 3V5PA 3HDNA 1FGIA 2OGVA 4LFIA 4BDFA 4EZ5A 2WQMA 2YISA 2JKMA 3MWUA 4FSMA 2BRHA 1R1WA 4DLIA 1T46A 1ZYJA 2VTLA 1OITA 2Z2WA 4FKWA 4U8ZA 3GCQA 2YWPA 4XMOA 4E4MA 3FY2A 2PTKA 3Q04A 4FK6A 3I6UA 4BDAA 4B9DA 4CFFA 1YOMA 2X7OA 2GNGA 2IPXA 1WBWA 4W4YA 3D14A 4IVDA 5D12A 3S2PA 3WZDA 1ZY5A 2FUMA 2QOQA 4J8NA 4PP9A 5ANKA 5BUJA 1STCE 3FC2A 4QMUA 3N9XA 5EM7A 1JPAA 1GIHA 1REKA 4NM0A 4FTUA 4F7JA 4PQNA 4FE2A 3VBTA 1OKYA 2XF0A 3EQFA 3O7LD 5FWKK 2PVHA 5J7BA 4FV8A 4FNYA 2WTDA 2ZV9A 5IQIA 2YZLA 1F5QA 4DG0E 3NNWA 4FKJA 3HGKA 5L2SA 1SYKA 1EH4A 1FOTA 2QOLA 5CT7A 4GU6A 2WTWA 2V0DA 3LIJA 2HELA 5B0XA 4UN0C 5CEMA 2X8EA 3OEFX 3ZTXA 1ZRZA 4ZTSA 3WZUA 5HNIX 4W8EA 5HBEA 4X21A 3KXGA 3R21A 3C0GA 2OI4X 4U6RA 3PY0A 4W4XA 4WUAA 5E90A 3PZHA 4TYEA 2BRMA 3MB7A 4ZSJA 5IMXA 3I4BA 4O0WA 3OWJA 4OTIA 3EN4A 5CXHA 5D9HA 4DFXE 1K9AA 1Q8UA 2BROA 2R3OA 2WELA 3UJGA 3QTXA 4NU1A 1P2AA 3Q9XA 1M2QA 2C5NA 4FUXA 4KSQA 2A27A 2FSTX 5HE0A 3AOXA 5FD2A 4E6AA 3U6HA 3LQ5A 3SXRA 3Q96A 5JGBA 1FVVA 2A19B 3AT2A 5IQFA 3HLLA 2FH9A 4JG8A 2O0UA 4YO6A 3IOKA 2VNYA 3PJ3A 4YHFA 3TTJA 2GNFA 1ERKA 2G01A 1NVQA 2XJ1A 3GOKA 3Q5IA 4PY1A 1MQBA 4TWPA 3L8SA 4F63A 4D2PA 1WVXA 5FBNC 3L9NA 3NEWA 4WG4A 5EM8A 3WF9A 3NLBA 4QP7A 1A9UA 4ENYA 3AG9A 3NS9A 5DT4A 5GJFA 5BVFA 1AQ1A 3R02A 4GT5A 4X3FB 3Q2JA 3MVMA 4OW8A 5L2IA 4RWJA 3TZMA 2GNLA 4IB5A 2WMUA 5HU9A 4KB8A 4XNEA 4C3FA 4RZVA 1WAKA 4USDA 2X9EA 2J51A 4CD0A 2DS1A 4A9SA 4FV5A 4EWHA 5C26A 4CTCA 1UU7A 4LUDA 4I23A 2Y7JA 4DLJA 3NYOA 5CX9A 3IOPA 4F64A 4ACHA 3WZEA 5D7VA 1OIQA 2HAKA 2GQGA 3BU5A 5BVWA 4FIGA 1RE8A 3VN9A 3BGPA 4ITIA 3EKKA 5J5SA 4FKQA 4QTAA 3CPBA 2F7XE 2PUPA 4AGWA 4GVAA 5LOHA 3F7WA 5JFVA 3PRIA 2IJMA 4FODA 4D5KA 2XEYA 1WFCA 3F66A 3TUBA 3TEIA 5IEXA 3H3CA 2HW7A 4KNBA 4YZNA 2CGWA 3A4OX 1Y8GA 5ANDA 5GZAA 2PVMA 3AMBA 4DEBA 2W5HA 3VQUA 3Q6UA 2W05A 4E4NA 2W1CA 2R3RA 4ZEGA 2B7AA 4II5A 4YGAA 4HVIA 4QMWA 4IADA 4QP1A 5K5XA 5KMNA 2C6OA 2YHVA 2J4ZA 3NSZA 2ERKA 3RNYA 1KOAA 3EQIA 4C3PA 4D2WA 4ZJVA 4M13A 3UOLA 4M8TA 2B9JA 3KREA 2RF9A 3PPZA 3HP2A 3LAUA 4QMQA 5L6PA 4JBVA 4NUSA 4IVBA 3HMMA 2VO6A 3CQWA 2UZWE 4JI9A 4QMZA 3S4QA 2C5XA 3LXNA 4G6OA 4IAKA 2H34A 3CR0A 3E93A 4BBMA 5L3AA 1GAGA 3G0FA 4NW6A 3PE2A 4FTLA 1PMEA 3FI4A 2QQ7A 4ZXTA 3BCEA 4O91A 3TNIA 3K3IA 2A1AB 4YJVA 4DH1A 1BI8A 5LVMA 3VC4A 4FKUA 4JIAA 4DGMA 1JNKA 4RC3A 5J79A 1IASA 1Y91A 3IPHA 4G3CA 3EN5A 4OTFA 3LFFA 2OXYA 3WBLA 1XBAA 3KMUA 3PVUA 5HI2A 4CYIA 4A9YA 5EK7A 2C3KA 3UP2A 4PP7A 2DYLA 4IAFA 3JVSA 4L45A 5FTGA 3BBTB 4I5CA 3ANQA 4C4JA 4E6CA 5C03A 2HCKA 3KCFA 3MVJA 4MNEA 4YC3A 4GFMA 5HCYA 4CMTA 4F9CA 2GTMA 4FG7A 3PXKA 2HXQA 2XKFA 4FTTA 2PZIA 3MYGA 3ZFYA 3SA0A 4U7ZA 5BYYA 4WNMA 4A4OA 2J9MA 4JL9A 5M56A 2P33A 5AP1A 4PMPA 3ZEWA 3TNWA 3W8QA 2YDIA 3FI8A 1PXJA 5LMBA 4GIHA 4HVSA 2BAKA 5H8EA 3SW7A 2O5KA 5AV0A 2QKRA 3ROCA 1HCLA 4I22A 2YN8A 2JITA 3DAJA 3I81A 3R04A 4QNYA 1H27A 4ZTNA 3V51A 4BGGA 3MIYA 4TYHB 4W8DA 3MH3A 3M42A 4XJ0A 4JG6A 3HZTA 4EKKA 2RIOA 4C33A 3HX4A 4GUEA 3KF4A 3HRCA 3HDMA 4S30A 5FEDA 3VO3A 2FSMX 3BYUA 5L8LA 2OZOA 5EQEA 3NUXA 4FOBA 4CNHA 4FNXA 1ZOHA 5HNGA 1MRUA 3AC8A 3ZXZA 4FV9A 5TE0A 3MY5A 3DJ7A 4O82A 1JKSA 2BKZA 3COIA 3ROYA 5CQUA 1J1BA 5DR6A 5DHJA 1IAHA 3QUDA 3IGOA 3VW8A 3OY1A 5I9UA 5BX0A 4LRMA 2XRWA 4BIDA 5BVOA 1PYEA 2GTNA 3DZQA 1XH6A 3OW4A 3UYTA 2HOGA 3W1FA 3DXNA 5M09A 3R9OA 4BWKA 5A4QA 2PL0A 4FT7A 2YJSA 4F1MA 3EJ1A 4F7SA 3NRMA 1I09A 5HICA 4LRKA 3VBXA 4IBMA 3DGKA 4J8MA 4PDOA 2CHLA 2UZOA 3PG3A 3C7QA 4K6ZA 3LFCA 4Z3VA 2J5FA 3FXZA 2C69A 2I0HA 3U55A 3ACKA 1H28A 3PXYA 2QR7A 4RGJA 4FT5A 3PIYA 3VRZA 2W5BA 2ACXA 1YXXA 2ITQA 4RG0A 4K2RA 2YA9A 5HO6A 2R3JA 3MFUA 3G90X 1ZYLA 2X0GA 5IU2A 4B4LA 3I7CA 4OTDA 4FSTA 4YJOA 4RC4A 2Y4IB 3A8XA 4EYMA 4DF3A 1ZMWA 3ZSIA 4YLKA 4E73A 1SVHA 3FJQE 3MFRA 3ZU7A 4EK5A 2BCJA 3CXWA 3ENMA 4N6ZA 5EOBA 1YI3A 3RAKA 3G0EA 4HZSA 4A9UA 3QLFA 3EFWA 2PVFA 5HE3A 2F4JA 3BHVA 4AW0A 3KRJA 4R6VA 3R9RA 3F61A 3HA6A 3MVHA 4IX6A 2WKMA 3MS9A 3QQJA 5FTQA 3VIDA 4WHZA 2BHEA 3A99A 1YOJA 4XG3A 4RZWA 3GEQA 1Q97A 4OTRA 4ZSLA 3ODZX 2QHNA 5AAEA 3WI6A 3VS6A 1J3HA 5KE0A 1BX6A 2GSFA 2GDOA 4QMPA 5CU3A 4F6UA 1PJKA 4R7HA 3ZMMA 5ETIA 4K1BA 3Q52A 5CSWA 4BRXA 5CAVA 2PYWA 3FQHA 1S9JA 3UC4A 4DH8A 3BLHA 4DGLC 3E87A 4EHVA 2Z60A 3ZM9A 2G9XA 4WT6A 4AW2A 1KUTA 1ZMVA 4IVAA 3OOMA 5HO7A 4TW9A 2XNGA 3HMOA 4WRGA 5J9YA 1JLUE 4KRCA 2ZV2A 3OCTA 4X2KA 4L7SA 4XBUA 4X0MA 4U79A 2UZUE 3NVMB 2B4SB 2PE1A 3QU0A 3HMIA 1H08A 3R7GA 3JUHA 3V5LA 4O7RA 3R6XA 4OBPA 4RA5A 3JPVA 2CGXA 4P7EA 3VS2A 4QP6A 3MDYA 3RZFA 3S00A 5B2MA 4UWCA 3KRWA 5DMZA 5KMKA 3MSSA 1H1QA 4GEOA 4DEAA 5BUIA 5IH5A 4TN6A 2BZKB 4Q2AA 4G5PA 4JAJA 4Y73A 5HCZA 5AA8A 2EB3A 4FTJA 5DT0A 4PPBA 2JBPA 4AOTA 2OFVA 5GZ8A 1G8AA 1U46A 3ZO4A 4ANMA 4D0XA 3EYHA 4YP8A 2GNHA 3TNPC 4ACMA 1OPKA 4W4WA 5CF4A 3RHKA 1GOLA 3DPKA 4YZBA 1OUYA 4D55A 3PXFA 3ZUTA 4O7WA 3HMPA 3RI1A 3UZTA 5G1XA 2YIQA 3FUPA 4BN1A 3ZO2A 3UQCA 4CSVA 1MQ4A 3R9DA 1OVEA 1NVRA 2XNPA 3I0OA 5EI2A 2VTRA 3ZH8A 3DAKA 2QD9A 3L8XA 2H8HA 2PZPA 2W99B 4CMUA 3TKIA 2J7TA 3CKWA 1SVGA 4DA5A 3NYXA 2X2KA 4HYIA 4ITJA 4TWOA 5EHLA 3W32A 4AW5A 4I0TA 4PF4A 5FM3A 4PMSA 2XIZA 2UV2A 2R3KA 3G51A 3L9PA 4IAZA 1XH5A 5DFPA 3O50A 4ZTLA 5A3XA 3HAMA 2JC6A 4BCFA 3GT8A 4OR5A 5EW9A 1UWHA 4EOKA 3D5XA 4G16A 5D1JA 4GKIA 3W10A 2WMTA 3IK3A 1CKIA 3DY7A 4FL1A 5ETCA 5AV3A 3VF9A 3ZFMA 3N4VA 2C1AA 3D0EA 3BKBA 5AP5A 4JDIA 4XEYA 2GQSA 4ENXA 2OZAB 3FKLA 5IDNA 4QMXA 4IM2A 4G34A 5BVNA 2WTKB 5BVDA 2ITTA 2W0JA 1OZ1A 3REPA 4PTCA 4UBAA 3NUNA 5HG8A 4ACDA 3T3VA 4JQEA 3D7TA 2VNWA 1OPLA 2B9IA 4NFMA 3PVWA 2F7ZE 4RJ4A 4RIYB 1LPUA 4HJOA 3BQCA 4LM5A 4O7NA 3DZOA 3EOCA 1JKTA 3H30A 4APPA 3BE9A 1Q24A 2J6MA 2YIXA 5FQDC 5GJDA 3ZC5A 3KL8A 1GJOA 3JYAA 3MJ1A 3PIZA 4USEA 3PTGA 1YDSE 2JKQA 2WOUA 4FTOA 4ZSGA 3NUAA 4BZNA 2BPMA 3R7EA 2B9HA 3VJOA 5FXSA 5AA9A 1WBOA 2JAVA 4ZLZA 5KHXA 3FWQA 2G2FA 2H6DA 3NYNA 5EFQA 1UU9A 3FE3A 4C38A 2JIUA 1PXKA 2VD5A 3KVWA 2R3LA 3UYSA 5F1ZA 4O7TA 2E9PA 2HWPA 2QC6A 3FZSA 4I24A 3A8WA 3Q4TA 3GU7A 3HV6A 4FTRA 3F3VA 5EKNA 3PFQA 3OBGA 4ANOA 4OTPA 2P55A 4JDKA 3GCVA 2BFXA 4ID7A 2CNVA 5I9ZA 4FV7A 4CMOA 1WBPA 4AA5A 3HECA 4I1ZA 4H39A 2X7FA 4RRVA 3BHYA 2OXDA 2VRXA 3NGAA 4N70A 4MNFA 3PPKA 3KU2A 4EZ3A 3D2IA 5L2TA 1SNUA 5EM5A 4JX7A 4IXPA 4NSTA 1PXMA 4FVPA 3FYJX 1Q41A 4HYSA 4KINA 2OF4A 4RIXB 5CS6A 1GNGA 1BLXA 2C0IA 3HEGA 3W2RA 4AOIA 4WD5A 5A4CA 2WTCA 5IPJA 5AP2A 4FZ6A 4IQ6A 4BICA 3LFAA 4D9UA 2Z02A 2AUHA 4AT5A 1BMKA 4QOXA 3QUPA 4R3PA 2GFCA 2IVTA 4WA9A 4D2RA 3FI2A 2XZSA 4D2SA 4GT4A 3O0GA 5HE1A 3JVRA 4TL0A 2OJIA 4QMMA 2KULA 2B9FA 3DKGA 1YI4A 4K0YA 4AG8A 5FEEA 2OLCA 2PY3A 2UZEA 5JFSA 3DNEA 5AAGA 1PHKA 5HD7A 3UNJA 2XK6A 2R2PA 5F94A 1TQMA 1Q5KA 3QD0A 4R3RA 3UBDA 2F7EE 4J95A 4D4YA 3OMVA 4EQMA 4GG5A 3FBVA 4FTQA 5M4IA 3MESA 2ERZE 3FZRA 5C8MA 4K33A 4QPAA 4ACCA 4DGGA 4FSWA 4IANA 3U9NA 4NWMA 2LGCA 3S1HA 4E3CA 3R71A 4BBFA 4FKLA 4E26A 2ESMA 1KE8A 5CU6A 3P78A 5FP5A 2EXEA 3A61A 4PV0A 4F6WA 4AE9A 3FPQA 4OAUC 2O3PA 4QP4A 4TT7A 1AD5A 2VWZA 2QG7A 2I0YA 4Y46A 5EQPA 3RM7A 3E7VA 4YBKA 5DNRA 2BZHB 5HTIA 2C5OA 2WZJA 4FIJA 4D1SA 3VULA 5GINE 2C6EA 4U5JA 4IX4A 5ANEA 4BCGA 3TV4A 3R8MA 3Q9WA 2FSOX 4EH3A 4D4VA 5KUPA 3LVPA 2VV9A 3ORTA 4L43A 1YXVA 4S2ZA 5EHYA 4JR7A 4L42A 2JIVA 4BHNA 4F70A 2CLXA 1J7IA 4C34A 1UNLA 4EH4A 1XR1A 3EQCA 4YMJA 3DKFA 2VTTA 2ITNA 1L3RE 5IISA 3GC9A 4J71A 3VVHA 3W33A 2ITUA 2W1IA 5KKRC 5LJJA 3Q53A 3ZO3A 3P7BA 3LM0A 4BKJA 5BYLA 3H0YA 3NAXA 1E1VA 4NJ3A 2C47A 3ZYAA 2Z7RA 3FSKA 3FLYA 3AC1A 1OIUA 2BMCA 3QC4A 3GBZA 1U54A 3OXIA 4PL5A 3IW7A 4DN5A 2RGPA 2Y6MA 4C2WA 2REIA 2YFXA 2ZDTA 3RALA 3KXZA 3TM0A 4M84A 4FTAA 3PWDA 5IKWA 3R8UA 4M7IA 4CLJA 3QAME 4AF3A 2X1NA 1VYZA 4AU8A 4ERWA 3KULA 4WSYA 2GS7A 4KIQA 3QHWA 3DS6A 2UZBA 3GQLA 4O7VA 3GC7A 1APME 1YVJA 2YCRA 4YZCA 4PL3A 3GNIB 3VUKA 5L4QA 3QQUA 1YWNA 5JH6A 5CNOA 4CZYB 3LFQA 4KBKA 4FVRA 4O38A 2B0QA 3VUIA 5L6OA 3RJCA 1IR3A 3E5AA 3SG9A 4YHJA 4L46A 5AR2A 2IVSA 3SLSA 3OC1A 5DEWA 3SRVA 5A6NA 5GHVA 4FZFB 3ZRMA 2YM5A 3A7IA 1H26A 3I60A 4E4XA 5IEVA 3I79A 3CLYA 3LFDA 1ZZLA 4O0SA 2AC5A 4IW0A 5L6WL 1VZOA 3ZOSA 3RNIA 3QWJA 2X2MA 5AM6A 1JWHA 1P5EA 3V5WA 2G1TA 3EH9A 4EOQA 3UTOA 3DAEA 1WVWA 4DCAA 4KD1A 4R7IA 2YCSA 3QTWA 4E8AA 4AQCA 2CKQA 3IQ7A 2VUWA 1KV2A 5EDRA 2JBOA 2YEXA 3TUCA 3CCNA 2J0MB 2VO3A 4U42A 4WNPA 5DRBA 3L1SA 4PNKA 3DCVA 3QRTA 3QTQA 5DT3A 4G3DA 2E9NA 1GY3A 4YJNA 1OPJA 4DFUA 3A60A 5E91A 3F2RA 3NDMA 3N4UA 5HQ0A 4PUZA 2XJ0A 3Q4CA 4IHPA 3NIEA 4J52A 4WBBB 4XV9A 5DE2A 4CKIA 3MI9A 1URWA 3UOJA 2BIKB 3EL7A 1REJA 2C3LA 2PMOX 1OL7A 1NA7A 4KIKA 2WMXA 3ACJA 4FTIA 3KN6A 3UO5A 1FVTA 4FL3A 1H0WA 3ZXTA 2W1HA 2WNTA 1ZYSA 3R8LA 4NM7A 3CS9A 2IZSA 5FBOA 2BTSA 2VTAA 4GL9A 4AGCA 3BGQA 4FV0A 2B52A 4IH8A 4MHAA 4WUNA 1P14A 4WNOA 3AD5A 2HZIA 2UVYA 3LOKA 3QFVA 3FKOA 4IB0A 4QRCA 5CEIA 3UPZA 4I6BA 5IA0A 3OY3A 3VUGA 3TJCA 4KBAA 4FZAB 2BZJA 1R0PA 5AIRA 4UYAA 4FT0A 5EI6A 2UVZA 3BEGA 2R7BA 3T9TA 1FMKA 1HCKA 1CMKE 5IH4A 4QP8A 3HRFA 3TT0A 4MXCA 2W9FB 5JEBA 1JKLA 1Q8TA 4AA0A 5LCKA 4PWNA 4EHZA 3CTHA 3FZTA 4J97A 4O0VA 4ZY4A 3OXZA 4N4SA 3QYWA 4FSRA 2R9SA 4MXZA 2HXLA 3CD8A 4JNWA 2PVJA 5F9EA 4D1XA 1XO2B 2V5QA 1Y8YA 3PP0A 4RQKA 4JS8A 4TYGA 4DTBA 1ZYDA 3B2WA 3LFEA 4L00A 5AM7A 2WMVA 3PXZA 3ZM4A 3ZSGA 4XH6A 3UO6A 3C4CA 2R7IA 4WG5A 2XJ2A 5D11A 2OXXA 4EBVA 2C4GA 5JFXA 1JBPE 3DJ6A 1LUFA 4FV6A 5DGZA 5HO8A 5TF9A 3VHKA 2CSNA 3FMHA 1IG1A 2NRYA 3MPTA 4I0SA 4AFEA 1ZMUA 3VW6A 2EWAA 4ASXA 1V0BA 2GNJA 3ZC6A 5IH6A 4O7LA 2RFDA 5CVFA 4O22A 5HNBA 1Q4LA 5HVJA 3VBQA 4TRLA 2GHMA 3QRUA 1CSNA 1SMHA 2VWIA 4YJSA 3FL5A 3DBFA 4K11A 3EQRA 4E6DA 4EK4A 5TR6A 1YHWA 5IF1A 1Q3DA 3L9MA 4AT4A 5A4LA 2ZB1A 3FEGA 4FG9A 2VX0A 5KBQA 2CNUA 3SX9A 4C0TA 4I3ZA 4QNAA 5FP6A 5LWNA 3E8NA 4ZTRA 5M08A 3FLQA 4EC8A 4EK6A 4K9YA 3BV2A 3ITZA 4IC7A 4PDPA 2Z8CA 5E1SA 4B8MA 2VTNA 5HCXA 2UW7A 2C68A 3KA0A 4KWPA 4GK3A 4NZWB 3R83A 3LXLA 3PJ1A 4FT9A 3QZFA 2JAMA 4EJ7A 5J7HA 2E9VA 3HVCA 5K3YA 5A4EA 3NIZA 3MN3A 4IFGA 2UZTA 2PVYA 4C36A 4HGLA 4Z16A 5CAQA 4DITA 5E8UA 3CE3A 3GU6A 2X6DA 3SVVA 4CFWA 4AAAA 4LOPA 4U45A 4O84A 4BR3A 4FEQA 5AV2A 4CYJA 4GFGA 4M67A 3C50A 3C1XA 2E9UA 3QRJA 3U6JA 4FA2A 4XP3A 3CGOA 4D4RA 1ZY4A 3O23A 3R1QA 5DR9A 3PJ2A 3WYYA 3IW6A 2YACA 4D28A 4LUEA 2IVVA 4BY9E 2VN9A 3O96A 4F0FA 4ONAA 2UVXA 3UNKA 3KXNA 2BILB 3EN6A 3F3ZA 4AZWA 1OIYA 3SAYA 4C4HA 3E92A 3F7ZA 3H9FA 3MH2A 4OTQA 4D0WA 5JKGA 5C4LA 2FYSA 1NW1A 5IEYA 3UVPA 1FBNA 2J0IA 2A2AA 5EYKA 5KBRA 1Z9XA 5HG7A 4FIEA 3FZ1A 2UW6A 2G15A 4FSQA 4YHTA 4WKQA 2O63A 2I0VA 5ANGA 3R7OA 1UU3A 4RC2A 4BTFA 3TI1A 3CTQA 2WIPA 3LM5A 4XV1A 3TZ8A 1JQHA 3IDBA 4R5SA 3UVQA 2I40A 4BDKA 4ALWA 1W84A 3ZFXA 3BWJA 2CKEA 4LMNA 5CVGA 5KZ0A 3V3VA 3PZEA 4QTDA 2A4LA 4GYIA 2BRNA 1KSWA 4IMYA 3QA0A 4Y95A 4C4IA 2VWWA 4U97A 4FSYA 4UYNA 3ZONA 4OT5A 2ZMDA 2GCDA 4X2FA 4UMRA 3FDNA 4S31A 3V04A 3W18A 2OBJA 3RKBA 1Q99A 4BIBA 3R01A 3AD6A 4FKRA 1G8SA 4C7TA 2XNBA 4M69A 4TY1A 2JKKA 5H3QA 1U59A 5HKMA 5CANA 2YM8A 3EL8A 4MD7E 5EYCA 2G2IA 1J1CA 3V8WA 3UQGA 4JLCA 4NTSA 1DAWA 4D5HA 2WIHA 2QO9A 3P1AA 1QPJA 2P2IA 2QU6A 3MPMA 3OWKA 3EHAA 3WE8A 2RKUA 1YQJA 2VTMA 2ITOA 2W1FA 4ZTQA 4IB1A 3ORZA 5LVOA 3EQDA 3K2LA 4I93A 3QF9A 4JBOA 4O6LA 1R78A 4QYYA 4DYMA 3Q4ZA 1QPEA 4O0UA 4TYIA 4UZHA 4X2GA 4AUAA 4E5WA 4I20A 4QMVA 3RMFA 4GH2A 3OCSA 4RX7A 1ZOEA 4RWIA 3TWJA 3G2FA 3OS3A 4A9TA 2YERA 4UMUA 3VAPA 3GUBA 4BZOA 1Q62A 3R63A 4U0IA 1ZYCA 4RBLA 3TKHA 1Q3WA 4AZTA 2YM4A 4HVGA 5CF5A 1MUOA 3G9LX 1OBGA 2PPQA 2XM9A 2R64A 3Q9YA 4Z9LA 2AC3A 2ITPA 4JJRA 2XBJA 2X2LA 4ZTMA 4ANNA 4AN2A 4V0GB 1K2PA 5DH3A 2BKKA 4U80A 2X4ZA 3QYZA 4I5MA 4BDJA 5D7AA 3F5GA 3C4XA 3CEKA 1OKWA 3TTIA 2XH5A 2VAGA 3DB8A 3OROA 4P2KA 3CKXA 1YKRA 5C27A 4ACGA 2PE2A 4GFOA 5CLPA 1G3NA 3SOCA 4IZYA 3ZHPC 4EK8A 1VJYA 4EOMA 2JD5A 4FBXA 2WQOA 2Q0BA 5GIOE 2PMIA 2VWVA 3Q60A 4ZOGA 2BR1A 4Q9ZA 4CEGA 3LCSA 1I44A 5GIPE 1RJBA 3FHRA 4LI5A 4NK9A 3HP5A 4B6LA 3ZS5A 3FYKX 1J91A 4G5JA 3BZ3A 4LG4A 3RCDA 4DFZE 2J0KA 3RBWA 3BQRA 4OUCA 3OW3A 3RAWA 4AFJA 4JT3A 3OD6X 4FTNA 3HNGA 4FV3A 1W98A 4XV2A 5A9UA 4MNEB 3HV5A 3OP5A 3RM6A 4AACA 2ITWA 2PK9A 3KRLA 4FIFA 4ZMFA 1T45A 5TO8A 4GG7A 1CM8A 5AR8A 1YI6A 1KE7A 1PMNA 2UW0A 2V22A 3MFTA 4MXAA 4EJNA 4RFYA 4RSSA 4E93A 2WTJA 4HGEA 5CTPA 3IW5A 5BMSA 5CF8A 3P5KA 4IE9A 2JFMA 3C0HA 2R3IA 4NFNA 2C5VA 4H3PA 3RPOA 2PU8A 4I6FA 2XNOA 2ITXA 4YO4A 2CKPA 5AV1A 3C0IA 4MXYA 3Q2MA 5IDPA 4YURA 4XG9A 3BHHA 3C13A 3PY3A 3HV4A 2BHHA 4S34A 2ONLA 4HCUA 5HGIA 5AEPA 3OOGA 4KS7A 3NUUA 5KMOA 4D1ZA 5LWMA 4QO9A 4GT3A 1Y6BA 4UY9A 4XG8A 3ULIA 2IZRA 3FKNA 2PZYA 3CBLA 4DG3E 5CXZA 3DK3A 4CRLA 4DHFA 3M11A 1Z57A 2FB8A 3BBWA 4O0RA 5IZFA 1XHAA 2RFSA 3FMKA 3C4ZA 3WILA 4BBEA 3BLRA 2VU3A 5D10A 4XS2A 4E1ZA 3GCPA 4MQ2A 1F0QA 4HVDA 4GKHA 2PUIA 2PUUA 3UC3A 4U43A 1JSUA 5B7VA 2HK5A 4BZDA 5AUUA 4OGRA 2OIBA 3UDBA 4HYHA 1M52A 3DDQA 3Q32A 1XH4A 1Y6AA 4F9BA 4ANLA 1ZARA 4BKZA 4XG7A 1O6KA 4MK0A 4TTHB 5CAOA 4KRDA 3ERKA 5J9ZA 4ITHA 4XYFA 3P9JA 3RTPA 4LGDA 1H4LA 5TKDA 4MYGA 3KQ7A 4IWDA 4ZS0A 4EOOA 1XH8A 5L8KA 4N0SA 3TZ9A 5I4NA 3CGFA 3LMGA 2HY0A 2QLQA 5AUTA 4BTMA 4FKOA 2R0UA 3BELA 3LJ0A 5JMSA 2CJMA 4E20A 2XCKA 5CY3A 3MVLA 5LVPA 4KA3A 4Y8DA 3UZPA 5ETFA 3EYGA 1JSVA 4ASDA 2WMRA 3KXHA 2RSVA 5JRSA 4XUFA 3S0OA 4J96A 2NPQA 4K18A 3G6GA 3WZKA 3RGFA 4R1YA 2VGOA 1TQPA 3D7ZA 4QYGA 3DQWA 4I21A 2BUJA 3QUEA 3GQIA 5G6VA 4BGHA 5EH0A 2UZLA 5ANIA 3P23A 4EEVA 3R00A 1PYXA 1WBVA 2J0JA 1Q8ZA 2JDOA 4AN9A 4BDEA 4QP2A 1KE9A 2ONLC 2E9OA 2XKEA 2I7QA 3SD0A 2YIWA 4QTCA 5FDXA 4PDSA 2YITA 3OEZA 4HPUE 3CSVA 4HZRA 3PSBA 5FEQA 3U4UA 4YUQA 3VNTA 4O7SA 3D5UA 4X3JA 5AP7A 2ZOQA 3MTFA 3A7GA 5LARA 3OHTA 4FEVA 3D4QA 3EFJA 4PNIA 5AJQA 4X2NA 4NTTA 3ZUVA 4IB3A 4L3LA 3BYSA 1BUHA 1DAYA 3O51A 4YPDA 3PG1A 3ALNA 4TNBA 4BI2A 4ANBA 1Q8YA 2WD1A 4D2VA 2KTYA 3P7AA 3QQGA 4ORKA 3TZ7A 5IQCA 2QVSE 3P79A 3DFCB 2XIXA 4X2JA 2F49A 4DE4A 3DLSA 5AAFA 2R5TA 3DT1A 4QQJA 4DT8A 3LJ1A 4S33A 3II5A 5J95A 1KV1A 4TPTA 5JN2A 3OCBA 2OZAA 3QXOA 4RX8A 4QT1A 4NH1A 3PE1A 3V5JA 4FUYA 2W1EA 3KKVA 3PLSA 3KK8A 4L3PA 3R8ZA 5CWZA 5FTOA 4CZUA 4DTAA 5DR2A 3BPRA 5GZ9A 2OK1A 5KZIA 3W55A 4CV8A 4G2FA 5BYZA 4WRSA 4DCEA 3BX5A 3OVVA 4Z55A 4ZAUA 5CAUA 3DNDA 4L8MA 4FYNA 4IACA 5AP6A 2PHKA 3D9VA 2XYUA 3BI6A 5AUVA 4EH2A 4NKAA 1OIRA 3UIUA 2I0EA 3CP9A 4MCVA 3R7IA 1LEZA 3P08A 4JG7A 4KKEA 5HIDA 4KSPA 4EORA 2VTJA 5EW3A 4M66A 1MRYA 2YLFA 2JFLA 3NWWA 5EHOA 4HPTE 2I1MA 2QOBA 3GC0A 3OTVA 4CFMA 5M4FA 4O0YA 3RK5A 3ZDIA 5AFVA 5D41A 5CYIA 5E8ZA 1DI8A 4XLIA 3OXTA 4FTKA 4EK3A 4U44A 2JEDA 3POZA 4YZDA 3C51A 4CFVA 5IA4A 3EQBA 3MA3A 3F82A 4GV1A 4NCTA 3U4WA 5FXQA 3MTLA 4GCJA 5M57A 3PVGA 2O2UA 3RWPA 2XRUA 3W8LA 3NNVA 4F9YA 4CRSA 4DGNA 4U3ZA 2W4KA 5AP0A 1S9IA 2XK8A 3UIMA 2W17A 5LMKA 3KEXA 3D5VA 3POOA 1BI7A 2YIYA 2W06A 2PULA 3MY0A 1ZXEA 4U81A 5JQ8A 1A06A 1KOBA 1UV5A 1H1PA 3R0TA 5FLFA 3ZLYA 4B99A 3NNXA 5CEPA 4R78A 5J9LA 2WU7A 4CFUA 4GYGA 2QO2A 2GPHA 4BCMA 3FZPA 1L8TA 2YZAA 3FQSA 5AIKA 4BI0A 4OT6A 4FICA 2YWVA 3V6SA 4H05A 4MF0A 1UNGA 3DKOA 4O0XA 2SRCA 4C35A 4DT9A 2VTHA 4KKGA 2DUVA 2IO6A 2ZM4A 5IUHA 5M06A 4RVTA 5F95A 4ALVA 3E8EA 4J53A 5BPYA 5LVLA 1WBTA 1WBSA 3DFAA 4FIIA 4BCJA 4BF2A 4EONA 4CKJA 5JT2A 4ZTHA 3PRFA 2W5AA 1YW2A 5FG8A 2XYNA 4X7QA 5IUIA 5DOSA 4AGUA 4E7WA 3LQ3A 1XBCA 3TN8A 3DB6A 1BL7A 4GIIA 4UMQA 1YXSA 4RX9A 4C02A 2PVLA 3LLTA 2F2CB 4TXCA 4YC6A 5I9WA 2CN8A 4A9RA 4O81A 4NYEA 3DBEA 3VUMA 1W82A 2LAVA 2GHLA 5T3QA 5EOLA 4XP2A 4O21A 3SHEA 4F99A 5K4JA 1H1SA 3C4FA 1UU8A 3EN7A 3PA4A 3QQFA 4BTJA 5HVKA 5JRQA 1XJDA 4IM3A 2OG8A 4BCKA 4UALA 2PWLA 3T8OA 1CKJA 5K9IA 5J87A 3PXRA 1PMVA 4NIFA 2QOCA 4U40A 1B39A 4R7BA 2WPAA 3TCPA 4QTEA 1M2RA 2XEZA 3ODYX 4NCTC 5H8BA 3DBDA 3ZO1A 4BCNA 4C3RA 2IW6A 4CQEA 4NKSA 1XH7A 4EH7A 2C0TA 4BB4A 5J8IA 3JR1A 4RJ8A 3BU3A 3PIXA 1LR4A 3WYXA 5LMKC 3RAIA 4EYJA 1HOWA 4NM3A 3I1AA 4ZSEA 3ATSA 2QHMA 4FKTA 2QURA 3R9HA 3GI3A 4YBJA 4F0IA 5KO1A 5JZJA 4QD6A 5AUYA 4WBOA 3HKOA 2PZRA 4QPSA 4GJ2A 1IA9A 2OJ9A 4AA4A 4QMOA 3ORKA 5AWMA 1FQ1B 4DEGA 5J1WA 3FSFA 4HYUA 2X9FA 3R30A 3QLGA 4QP9A 3ZRLA 4JIKA 4F09A 5HZNA 5BQ0A 2OO8X 3F9NA 4I5PA 4CCUA 3O8TA 3V01A 5FDPA 3ID6C 1YWRA 3D83A 5E92A 3DXPA 3COMA 4E6QA 5JFWA 2ZM3A 2WTIA 3KMMA 3A62A 4FZDB 5HOAA 4GVJA 3R8PA 5I9XA 5IQDA 3UPXA 4F7LA 2R3PA 2ITZA 3O7LB 4FNWA 3ZEPA 4E5AX 1PMUA 4EH5A 3CD3A 5ANOA 5HESA 3GFWA 3V5QA 2UW5A 4X6RA 4HCVA 4FOCA 4OBQA 1U4DA 3NX8A 1WZYA 1X8BA 3ZCLA 2X8DA 3NVKI 2XP2A 1JSTA 1OL5A 3QD3A 3LXKA 2EU9A 4K8AA 4RMZA 1JVPP 4BL1A 4MH7A 4I6QA 4ZLOA 3FI3A 4YTFA 3DK6A 3O17A 3NNUA 3VBWA 3TIZA 1OL2A 2VTOA 1YHSA 4QQCA 3ENHA 2AYPA 2OJJA 4ZSAA 2GHGA 2F2UA 4WIHA 3QQLA 3BEAA 4BVUA 1SVEA 1PXIA 3WF8A 4ERKA 5DG5A 3RK9A 3IS5A 4BDHA 2R3NA 3QTIA 4RVMA 3ZBFA 4UX9A 3KMWA 3PYYA 4D9TA 4YTHA 2ZM1A 3FC1X 5KMJA 4O83A 4RIWA 2WXVA 5IQHA 5HTBA 1IEPA 3TV6A 3H0ZA 3E63A 3GCSA 3QHRA 5M44A 5JZNA 3FHIA 4EOJA 2QOHA 3KC3A 3F5XA 3OT8A 4FK3A 1OECA 1H07A 3AMYA 4D2TA 3FL4A 4EQUA 2PMLX 3QTUA 2QOIA 3M2WA 4AN3A 2W1GA 4LOQA 4UWBA 1DI9A 3FXXA 3QZGA 2I6LA 3NW6A 4FC0A 4U9AA 4FSNA 3R22A 4V04A 3PUPA 4RFZA 1YRPA 4BDBA 3PY1A 2ZJWA 3WZJA 2H9VA 3KULB 3RWQA 5I3RA 4O86A 2IZUA 5C9CA 3VS7A 3ORMA 3R1SA 1CDKA 4OTHA 3O8PA 2X39A 3IDCA 3T9IA 3HYHA 2RG5A 4HW7A 5F20A 4ARKA 3L8VA 3MJ2A 1IA8A 2WGJA 2WFYA 4FL2A 4O6EA 2ZVAA 4FT3A 3EFLA 2X8IA 3Q5ZA 4MAOA 4C58A 3AC5A 3C5IA 4YJQA 2RFNA 4M0ZA 3OG7A 2YCFA 3DBCA 5E8WA 3T3UA 2QG5A 1Y57A 4IIRA 4NJDA 4XV3A 3UOKA 1IRKA 3DU8A 2UW3A 3VRYA 2JDVA 2X81A 1VYWA 3BHTA 4RIOA 5C01A 4TZRA 4OTGA 5CT0A 3RVGA 2VGPA 4BTKA 3GU4A 3PPJA 3SRVB 3PA5A 4ANQA 5KNJA 2WMQA 4FKIA 4ZJJA 4DGOA 4Z7GA 3IGGA 4FKGA 4EOIA 3LCTA 4DFLA 4B7TA 4EUUA 2PVNA 1OKVA 5JGDA 1YDTE 3ULZA 3B8QA 3QGYA 3F69A 5I0BA 2ITYA 4L3JA 3QCSA 4DAWA 4ZZNA 3SXFA 3PXQA 1J7UA 3OFMA 5A14A 3DKCA 4IAIA 5LMAA 4C4GA 2JLDA 3GB2A 4BHZA 4Y72A 5JGAA 1ND4A 1PF8A 4XX9A 5AADA 4FX3A 2BAQA 4U41A 4BCPA 4TKSA 5AUZA 3LHJA 4WOVA 2Q0NA 4TYJA 5E4HA 2DWBA 2WTVA 3FLNC 2PVRA 5HX6A 4DFBA 2ITVA 3PA3A 4M15A 4LYNA 4QMNA 2XS0A 3EKNA 3O71A 4EHEA 3BE2A 4FTCA 5M53A 2GS6A 2YDKA 4ZIMA 4ZZOA 2EB2A 5HHWA 2W1ZA 3F3WA 1FMOE 4CG9A 5B2LA 4LV5A 4FVQA 3MW1A 3WF7A 4DEIA 5KX8A 4KIKB 3RPRA 4BKYA 2FSLX 3AT4A 2C6KA 3Q3BA 4USFA 2IWIA 5CSHA 3ELJA 2VWUA 3UNZA 4QMYA 3IONA 5F4NA 4P5ZA 3R73A 4BDCA 4KS8A 1W0XC 3MFSA 4JOAA 3FMJA 3FY0A 4O27B 5CI6A 3W2PA 4AP7A 4MXOA 3BWFA 3VUHA 3TKUA 3GENA 1OL1A 3E8DA 4FEWA 1NVSA 3LCOA 3RHXA 3DXQA 3EZVA 4C4EA 1U5RA 2P2HA 2V7AA 3TG1A 3QWKA 4ZP5A 3ZLXA 4ASEA 5FXRA 5EQYA 2J0LA 4RJ5A 2GFSA 5CU0A 2XK4A 5HLPA 1O6YA 4F9AA 2O8YA 3R7VA 1P4OA 2R3HA 3FLWA 3LMHA 2RG6A 3E62A 2XK3A 3EB0A 3RPSA 3DTCA 2ETMA 4OTWA 2XK7A 1ZZ2A 3GU8A 4PL4A 4WO5A 3LE6A 3N51A 3H9OA 4AX8A 3ZUUA 4NL0A 4X3FA 3V5TA 4A07A 2CGVA 4RWKA 3VS1A 5CASA 2UW8A 1Q61A 5KHWA 3FMLA 2ZAZA 5HG5A 5AR3A 3G9NA 4YJRA 2VTSA 3AT3A 1YDRE 3D2KA 5K4IA 4WG3A 4XG4A 2HWOA 5GNKA 3P4KA 4IZAA 4QYEA 3VHEA 3NCZA 3C4WA 2C6DA 2X6EA 2YM6A 4XG6A 3SOAA 4BDGA 4CGAA 3QTZA 5GJGA 2RFEA 1GZOA 1OBDA 5HORA 2WAJA 3L9LA 3UQFA 2Y0AA 1B6CB 3MH1A 5HLNA 2O65A 1CKPA 1YOLA 3A2CA 3KB7A 4CZTA 2QO7A 3ZZWA 2BVAA 4N6YA 4YJPA 3QTRA 4IWOA 3GU5A 3M1SA 5DVRA 4JQ7A 4C8BA 3DTWA 4IM0A 4G1WA 1H00A 2P0CA 5E8YA 3RP9A 5CSXA 2PZ5A 3UG2A 1GZNA 4JDHA 2YLEA 1TVOA 4XCUA 4IWQA 4DEDA 1SZMA 4M14A 3SW4A 2R3FA 1H1RA 4G17A 4L7FA 4ZJIA 1H24A 4X6QC 1M14A 2HYYA 3UMXA 2OH0E 3FMNA 4B8LA 3TXOA 4BDIA 4MF1A 3SXSA 2E2BA 3GFEA 3S95A 4LMUA 3E7OA 1GIJA 4XRJA 2W96B 2YAKA 2QONA 1XKKA 1ZWSA 4IFCA 3UOHA 3MB6A 3WF6A 3UP7A 4L68A 5CSVA 4DC2A 3QX2A 5L2QA 5EDQA 5HE2A 3F2AA 3GGFA 3IKAA 4MWHA 4A06A 3MGYA 2XNMA 3AC2A 2C6TA 4QP3A 3F3TA 4HGSA 1RQQA 4YPSA 3IDPA 3G15A 4UXQA 4QQTA 2VWYA 4H1MA 2CN5A 2YM7A 4LQMA 3RZBA 3U8WA 1R3CA 5CU4A 1V0PA 2UW4A 4IDTA 2PVKA 4OAVB 3NR9A 4FMQA 4CVAA 3SKCA 4LL0A 2QKWB 1U5QA 3R1NA 2YM3A 4L52A 3AQVA 4MVFA 3VWAA 2WMWA 2PSQA 4IJ9A 3LFSA 3LPBA 4X3FC 4EL9A 4U3YA 3D5WA 4R1VA 5EDPA 3QCXA 3TV7A 5DYJA 3LXPA 1Q8WA 5H9BA 1BYGA 4F65A 2B54A 4CCBA 2C3JA 3MPAA 2OF2A 5DN3A 3PWYA 5BNJA 4DH5A 3QKLA 4DH3A 3KK9A 3B2TA 5E8SA 4AW1A 5CU2A 3IO7A 2GS2A 4DBXA 5IG1A 3I6WA 3UGCA 1RW8A 2Z7LA 5CSPA 3P0MA 4EOLA 4M68A 2R0IA 4YJUA 4I4FA 4BCQA 4S32A 5JQ5A 4FSZA 4G3EA 4GK4A 3LMIA 5AR5A 3AMAA 4NT4A 2CGUA 1FINA 3AD4A 4FEXA 5IQEA 3R2YA 2UUEA 3THBA 4EQCA 5LVNA 4O1OA 4FZ7A 3QA8A 2IW8A 5DI1A 4LV8A 3FZOA 1H01A 4G31A 3EQGA 4JQ8A 4YLJA 5DPVA 5C1QB 4PTEA 5A4TA 4Q5EA 2H96A 4V0GA 4MBIA 5AV4A 4GU9A 1KWPA 3ZLWA 4ZY5A 1FVRA 1GZ8A 3QX4A 2XIYA 3A7HA 2R3QA 4CFNA 2CDZA 3LLAA 4JX3A 5EM6A 1QPCA 2ETRA 4CFXA 2ZV7A 4UZDA 5AUXA 5M55A 3OUNB 3A7JA 2XVDA 1DM2A 3KN5A 3LZBA 4XBRA 1YHVA 4M0YA 3NW5A 3HRBA 4NW5A 4TYHA 3MV5A 3Q9ZA 4M69B 5EW8A 1KE5A 4FTMA 3TIYA 4G9RA 3KFAA 5M4UA 3R28A 4GK2A 4I4EA 1UA2A 4FR4A 5FUTA 4I0RA 5HD4A 4FYOA 4PDYA 3FMMA 3FXWA 1UNHA 3ORXA 3UO4A 3FLZA 4PMMA 4M12A 3W2SA 2XBAA 3ZBXA 2BTRA 4ZLYA 3A4PA 1GZKA 2PE0A 4J7BA 3CPCA 4L01A 3HA8A 4UB7A 4IAYA 5DLSA 3U54A 3PSDA 3IW8A 3K5VA 2IW9A 4EOSA 3GOPA 3QZHA 4ZS4A 5IQGA 3LFBA 2CCIA 4FI1A 4JXFA 4F4PA 2JDRA 1FGKA 5DRDA 4YZMA 1WMKA 5LQFA 3KF7A 3K54A 2OJGA 3JY9A 1W83A 3R7YA 3EIDA 4K77A 3AC4A 3FMEA 5ANJA 4J1RA 4V05A 2X7GA 1ATPE 1NXKA 2C30A 3CQUA 3F88A 3JXWA 3LW0A 3I0QA 4GUBA 1UWJA 5CNNA 5AUWA 5JSMA 5IQBA 2NRUA 3HUCA 4CLIA 4CV9A 3TDWA 5J5TA 1QMZA 4EOPA 2IVUA 3OCGA 3WE4A 2C6LA 3EQHA 2UZVA 4UMPA 3IG7A 2XK9A 4MTAA 2BAJA 4M3QA 5CVHA 1OL6A 1ZOGA 3QRKA 2QODA 2F9GA 3BRBA 3ZRKA 3W16A 1M2PA 4ZZMA 2QLUA 5CI7A 2DQ7X 5H8GA 1KE6A 5I9YA 3CIKA 3MH0A 1SM2A 2UW9A 4FG8A 4RWLA 3HMNA 3AXWA 5DBXA 3OUKA 4D58A 4FKVA 3VBYA 4YLLA 5CQWA 2G2HA 5LCJA 5BVKA 3NCGA 4ASZA 2IZTA 4EZ7A 3D15A 2XB7A 3F5PA 1PXPA 4L9IA 5E9EA 4FKPA 4UEUA 3MA6A 5IUGA 3C5UA 3E64A 2VO0A 4W4VA 4PTGA 1K3AA 3O8UA 4RVLA 4H1JA 4RPVA 3R7UA 2HZ4A 2Z7SA 4I6HA 2W4JA 4MEDA 5ICPA 4Y83A 5IA3A 3CJGA 3DJ5A 4H36A 2BDJA 3ETAA 4AZSA 2OSCA 4UV0A 2FGIA 1YWVA 3L8PA 3UIXA 2V7OA 2XIRA 3MIAA 1TQIA 4QPMA 2CCHA 4OLIA 4Y5HA 3UVRA 3H9RA 2A0CX 3MBLA 4APCA 5A6OA 5CF6A 4BCHA 3OT3A 2VX1A 2UZNA 3ALOA 3R8VA 4PRJA 5ACBC 5E1EA 3V8TA 5KMLA 5K0XA 1B38A 3DBQA 2PUNA 1OM1A 4TNDA 3ORLA 4YSMA 3VS3A 3JY0A 2XNEA 2R4BA 4MD9E 5AR7A 4I94A 3H4JA 1NT2A 5BMMA 3VS0A 4AS0A 4DH7A 2FVDA 4DEEA 3W2CA 3TUDA 5C8KA 4AZEA 3QTSA 3CTJA 2WEIA 3COHA 4EH9A 4UWYA 2YABA 3TL8A 3VUTA 1V1KA 2VTQA 2Y4IC 2Y9QA 1R0EA 1R39A 4GW8A 3QQHA 3R9NA 3RCJA 5C4KA 3A7FA 5E8TA 3C4EA 1UKIA 3OWLA 5DA3A 3SG8A 4UXLA 2HIWA 1SNXA 4YSJA 2W9ZB 3NAYA 5J1VA 1OB3A 4BC6A 2VWXA 3TJDA 2C1BA 3W2OA 4CKRA 4R3CA 4XOYA 5L8JA 3VQHA 4O7ZA 3NW7A 3BIZA 4FNZA 2OWBA 4GJ3A 5TT7A 1V0OA 1WBNA 4JBQA 4O2PA 4BYIA 4CT2A 3WIGA 3Q4UA 1G5SA 4YJTA 3KY2A 3NUYA 1O6LA 2GU8A 4R5YA 1WCCA 4L44A 3SC1A 4ALUA 4F9WA 4C57A 3QRIA 4ZY6A 1PXNA 5ETAA 5KCVA 4L67A 1JOWB 3BLQA 5EYMA 4QYHA 3BV3A 4DINA 4YTCA 5A46A 2Y4PA 4EUTA 4G9CA 3QZIA 1BL6A 3EZRA 3ET7A 5HG9A 2YAAA 3NPCA 1ZAOA 5E8XA 5H2UA 1IAJA 2QCSA 4XLVA 3RK7A 1O9UA 3LCKA 3Q6WA 4YNOA 3HL7A 4H58A 2WQBA 4EKLA 4W9WA 1QCFA 3NUSA 5EI8A 3VUDA 4EI4A 3HAVA 3V6RA 3GVUA 2ZDUA 4RIYA 5IA5A 2O64A 2QNJA 4XHKB 2HZ0A 1DS5A 2GMXA 4G3GA 4LGHA 3I7BA 1F3MC 2OICA 4IZ7A 2R3MA 2XMYA 4FIHA 4GRBA 3IW4A 3PP1A 2WMAA 3WIKA 4PX6A 5K5NA 3UMWA 4R77A 4ZMEA 3GC8A 4RJ3A 5T68A 1Z5MA 4O1PA 3AGMA 3UZRA 3SDJA 4RQVA 1W7HA 5I3OA 3H10A 3IECA 5EG3A 4C37A 3NUPA 3LFNA 3PJCA 1M7QA 1PKGA 3GXLA 2BDWA 4FF8A 4HNFA 4QMTA 4YZ9A 5AX3A 4YNEA 4W9XA 3D94A 1W8CA 2C5YA 1JKKA 4MBLA 4P4CA 3QKKA 4JAIA 1JAMA 4C4FA 4CTBA 4DEHA 2OW3A 2ZV8A 2EXMA 2WU6A 3CY3A 3VS5A 5DIAA 4H3QA 1URCA 3KCKA 4JRNA 2WMSA 3QD4A 4PPAA 4TWCA 5JK3A 3ZLSA 4AZFA 3RPYA 4LGGA 1OGUA 4E4LA 5A54A 2OIDA 1AGWA 2J5EA 3O2MA 2CKOA 3MY1A 2QOFA 3FAAA 4DFNA 1ZLTA 3ANRA 5HBHA 5M4CA 4CG8A 4FEUA 3FQEA 4GS6A 3QCQA 4RIXA 3CC6A 5CAPA 2QOKA 1E1XA 1XH9A 4JR3A 3WARA 3WF5A 2YDJA 2GQRA 4YU2A 3D7TB 4A7CA 1XQZA 2VTPA 2EUFB 5EYDA 4V01A 3P86A 2XCHA 3DV3A 3EN9A 5EKOA 3I5NA 4QMSA 4FV4A 4BI1A 4QQ5A 2OU7A 3DOGA 3PSCA 4BGQA 1LP4A 2WTKC 3KXMA 3PJ8A 2C6MA 4ANSA 2YCQA 1LEWA 3NYVA 2V62A 2JDTA 2WQEA 2HENA 4MBJA 1XBBA 5DWRA 4C62A 3FPMA 1M7NA 4NM5A 2NP8A 3JS2A 2WQNA 2NNWB 4RT7A 4F0GA 2WO6A 3G33A 1RDQE 4LL5A 4KABA 2P4IA 4RLKA 3UIBA 2VTIA 4Q9SA 5HIBA 2RL5A 3EQPA 1PRYA 2IG7A 4EHGA 5M07A 3BU6A 5AX9A 3BHUA 2CMWA 2WMBA 2C6IA 2VO7A 4H3BA 4G6LA 3ATTA 4MD8E 3K5UA 1H1WA 3HUBA 4CXAA 1J7LA 1H8FA 5K0KA 2C3IB 3E8CA 4LRJA 4Y5QA 5CENA 1OKZA 2ZYBA 4AT3A 4O2ZA 1PY5A 2UZDA 4O96A 2W1DA 4NEUA 3VBVA 5E8VA 3ORPA 1BKXA 5FM2A 2HW6A 3OWPA 2VWBA 5ACKA 2BFYA 3UG1A 5KKRB 2B55A 4RFMA 4EC9A 5CEOA 4FGRA 4MXXA 1OUKA 4F6SA 4IJPA 4RA4A 3BGZA 1VEBA 4C2VA 3DK7A 4G6NA 3LCDA 2WOTA 1QL6A 5CZIA 2B53A 3SV0A 3QD2B 2XKCA 3ORNA 1OMWA 3VF8A 5HBJA 4YR8A 4PMTA 2HY81 1H25A 2CPKE 3I5ZA 4C59A 5CEQA 2CNQA 3N4TA 2WHBA 4O0TA 2P3GX
chains in the Genus database with same CATH superfamily
1PKDA 2OIQA 3KXXA 4Q5HA 3ZZEA 5L2WA 3QL8A 4KKHA 1NY3A 3EMGA 4BWPA 4A4XA 3QBNA 1MP8A 1E9HA 2HZNA 2J2IB 2OH4A 4GMYA 3PDTA 3NMUF 1P4FA 3LKMA 5IQAA 3DQXA 2BRGA 4IX3A 4DBNA 4XRLA 2QR8A 1UKHA 4IZ5A 3QXPA 2ZMCA 3C9WA 4P90A 4QMLA 4Y85A 3F6XA 4GSBA 3W2QA 4CT1A 5HTCA 1GIIA 3OF0A 4NIFB 4IWPA 2Y6OA 2JDSA 2B1PA 2JIIA 3K3JA 3EFKA 4AZVA 3UE4A 2XA4A 3FV8A 5CZHA 4JRVA 3KGAA 4DHJA 4FGBA 4CQGA 4KUJA 2EXCX 2J50A 1YXUA 4J99A 4DG2E 4MKCA 4L53A 2F57A 3CY2A 3VJNA 4HGTA 4FSUA 4MWIA 5AP3A 4IX5A 3RAHA 1M17A 4EWQA 3DLZA 3U51A 4A4LA 2ZB0A 3AKJA 3BYMA 2CLQA 3CQEA 3QKMA 3ZSHA 3G6HA 5CALA 2YJRA 4JVGA 4P5QA 4N57A 2R3GA 3RINA 3S3IA 2EVAA 3LJ2A 2ETKA 3FMDA 4M97A 4BCOA 1PXOA 5C8NA 3TNQB 1MRVA 2W4OA 5ITAA 2XM8A 3LQ8A 2WEVA 3CJFA 3GP0A 3BYOA 3BYVA 4HCTA 4XOZA 4YC8A 1PW2A 2FA2A 4JDJA 4L6QA 4RVKA 4IAAA 2XKDA 3E88A 1H0VA 4EH8A 4F08A 4OBOA 5T6KA 4DTKA 2BRBA 2GNIA 2IN6A 4XG2A 2XNNA 5AP4A 2J90A 1FPUA 3FLSA 5IA2A 2FO0A 4BYJA 4HNIA 4I41A 2BDFA 4IC8A 4I92A 5DEYA 1UVRA 3WOWA 3OZ6A 3P7CA 4KIPA 2XIKA 1U54B 1OI9A 5HX8A 4BWXA 2Y8OA 4J98A 2YIRA 3E3BX 1YXTA 3U87A 4TWNA 3E3PA 4I5HA 4XP0A 4BFMA 3R1YA 4PPCA 5IA1A 4O7YA 5LXMA 5M51A 3AGLA 3OBJA 4F1TA 5HVYA 4EBWA 5TOZA 4KAOA 3U6IA 1WVYA 4HVHA 3V8SA 3F2NA 3F5UA 3KVXA 4RJ7A 1PXLA 4RLLA 4IDVA 5BUEA 5B2KA 1A48A 2VZ6A 1TKIA 3KRRA 3EWHA 4ZK5A 3F3UA 2NYAA 4AXAA 3OTUA 3QALE 2V55A 2XALA 4E5BA 5KMMA 5AMNA 3SGCA 3SQQA 3AC3A 3G5DA 4B0GA 2W7XA 3B8RA 2VX3A 5HIEA 2OFUA 5I9VA 2BALA 4RIWB 3QC9A 4EH6A 1XMMA 4DFYA 2WB8A 3DDPA 4IVCA 1VR2A 2JGZA 3RPVA 2NO3A 2X4FA 4D4SA 4RX5A 2OKRA 3PLAE 3NZ0A 4AGDA 5I5ZA 3COKA 4FV1A 3R2BA 4LOOA 5HU3A 4JBPA 4UMTA 3HV3A 4R8QA 2BZIB 2QOOA 2QI8A 3TACA 3ORIA 4AWIA 3UODA 4BDDA 4QYFA 5BVEA 3QCYA 4F1OA 5AR4A 4G3FA 5FRIA 3QQKA 3TNHA 4Z7HA 4YTIA 2OJFE 3ML1A 2Z7QA 4AAYA 3TDVA 3GCUA 3U9CA 3ZDUA 4BCIA 2Q83A 2JKOA 3QGWA 4FV2A 4KBCA 4AE6A 4BIEA 1CTPE 4IEBA 5FGKA 4QTBA 1QPDA 3HV7A 1XWSA 3KRXA 3DA6A 3VS4A 2BIYA 4WSQA 4AOJA 5CEKA 5IMEA 5HLWA 2QU5A 4MQ1A 2C0OA 4KIOA 5E7RA 2XUUA 5KMIA 4FKSA 4RJ6A 4F7NA 4HOKA 2PMNX 4MX9A 3PVBA 4C61A 4WNKA 5HEZA 3V5PA 3HDNA 1FGIA 2OGVA 4LFIA 4BDFA 4EZ5A 2WQMA 2YISA 2JKMA 3MWUA 4FSMA 2BRHA 1R1WA 4DLIA 1T46A 1ZYJA 2VTLA 1OITA 2Z2WA 4FKWA 4U8ZA 3GCQA 2YWPA 4XMOA 4E4MA 3FY2A 2PTKA 3Q04A 4FK6A 3I6UA 4BDAA 4B9DA 4CFFA 1YOMA 2X7OA 2GNGA 2IPXA 1WBWA 4W4YA 3D14A 4IVDA 5D12A 3S2PA 3WZDA 1ZY5A 2FUMA 2QOQA 4J8NA 4PP9A 5ANKA 5BUJA 1STCE 3FC2A 4QMUA 3N9XA 5EM7A 1JPAA 1GIHA 1REKA 4NM0A 4FTUA 4F7JA 4PQNA 4FE2A 3VBTA 1OKYA 2XF0A 3EQFA 3O7LD 5FWKK 2PVHA 5J7BA 4FV8A 4FNYA 2WTDA 2ZV9A 5IQIA 2YZLA 1F5QA 4DG0E 3NNWA 4FKJA 3HGKA 5L2SA 1SYKA 1EH4A 1FOTA 2QOLA 5CT7A 4GU6A 2WTWA 2V0DA 1VLRA 3LIJA 2HELA 5B0XA 4UN0C 5CEMA 2X8EA 3OEFX 3ZTXA 1ZRZA 4ZTSA 3WZUA 5HNIX 4W8EA 5HBEA 4X21A 3KXGA 3R21A 3C0GA 2OI4X 4U6RA 3PY0A 4W4XA 4WUAA 5E90A 3PZHA 4TYEA 2BRMA 3MB7A 4ZSJA 5IMXA 3I4BA 4O0WA 4F78A 3OWJA 4OTIA 3EN4A 5CXHA 5D9HA 4DFXE 1K9AA 1Q8UA 2BROA 2R3OA 2WELA 3UJGA 3QTXA 4NU1A 1P2AA 3Q9XA 1M2QA 2C5NA 4FUXA 4KSQA 2A27A 2FSTX 5HE0A 3AOXA 5FD2A 4E6AA 3U6HA 3LQ5A 3SXRA 3Q96A 5JGBA 1FVVA 2A19B 3AT2A 5IQFA 3HLLA 2FH9A 4JG8A 2O0UA 4YO6A 3IOKA 2VNYA 3PJ3A 4YHFA 3TTJA 2GNFA 1ERKA 2G01A 1NVQA 2XJ1A 3GOKA 3Q5IA 4PY1A 1MQBA 4TWPA 3L8SA 4F63A 4D2PA 1WVXA 5FBNC 2A98A 3L9NA 3NEWA 4WG4A 5EM8A 3WF9A 4O4DA 3NLBA 4QP7A 1A9UA 4ENYA 3AG9A 3NS9A 5DT4A 5GJFA 5BVFA 1AQ1A 3R02A 4GT5A 4X3FB 3Q2JA 3MVMA 4OW8A 5L2IA 4RWJA 3TZMA 2GNLA 4IB5A 2WMUA 5HU9A 4KB8A 4XNEA 4C3FA 4RZVA 3AKLA 1WAKA 4USDA 2X9EA 2J51A 4CD0A 2DS1A 4A9SA 4FV5A 4EWHA 5C26A 4CTCA 1UU7A 4LUDA 4I23A 2Y7JA 4DLJA 3NYOA 5CX9A 3IOPA 4F64A 4ACHA 3WZEA 5D7VA 1OIQA 2HAKA 2GQGA 3BU5A 5BVWA 4FIGA 1RE8A 3VN9A 3BGPA 4ITIA 3EKKA 5J5SA 4FKQA 3UDTA 4QTAA 3CPBA 2F7XE 2PUPA 4AGWA 4GVAA 5LOHA 3F7WA 5JFVA 3PRIA 2IJMA 4FODA 4D5KA 2XEYA 1WFCA 3F66A 3TUBA 3TEIA 5IEXA 3H3CA 2HW7A 4KNBA 4YZNA 2CGWA 3A4OX 1Y8GA 5ANDA 5GZAA 2PVMA 3AMBA 2AQXA 4DEBA 2W5HA 3VQUA 3Q6UA 2W05A 4E4NA 2W1CA 2R3RA 1G8JA 4ZEGA 2B7AA 4II5A 4YGAA 4HVIA 4QMWA 4IADA 4QP1A 5K5XA 5KMNA 2C6OA 2YHVA 2J4ZA 3NSZA 2ERKA 3RNYA 1KOAA 3EQIA 4C3PA 4D2WA 4ZJVA 4M13A 3UOLA 4M8TA 2B9JA 3KREA 2RF9A 3PPZA 3HP2A 3LAUA 4QMQA 5L6PA 4JBVA 4NUSA 4IVBA 3HMMA 2VO6A 4MUQA 3CQWA 2UZWE 4JI9A 4QMZA 3S4QA 2C5XA 3LXNA 4G6OA 4IAKA 2H34A 3CR0A 3E93A 4BBMA 5L3AA 1GAGA 3G0FA 4NW6A 3PE2A 4FTLA 1PMEA 3FI4A 2QQ7A 4ZXTA 3BCEA 4O91A 3TNIA 3K3IA 2A1AB 4YJVA 4DH1A 1BI8A 5LVMA 3VC4A 4FKUA 4JIAA 4DGMA 1JNKA 4RC3A 5J79A 1IASA 1Y91A 3IPHA 4G3CA 3EN5A 4OTFA 3LFFA 2OXYA 3WBLA 1XBAA 3KMUA 3PVUA 5HI2A 4CYIA 4A9YA 5EK7A 2C3KA 3UP2A 4PP7A 2DYLA 4IAFA 3JVSA 4L45A 5FTGA 3BBTB 4I5CA 3ANQA 4C4JA 4E6CA 5C03A 2HCKA 3KCFA 3MVJA 4MNEA 4YC3A 4GFMA 5HCYA 4CMTA 4F9CA 2GTMA 4FG7A 3PXKA 2HXQA 2XKFA 4FTTA 2PZIA 3MYGA 3ZFYA 3SA0A 4U7ZA 5BYYA 4WNMA 4A4OA 2J9MA 4JL9A 5M56A 2P33A 5AP1A 4PMPA 4DHZA 3ZEWA 3TNWA 3W8QA 2YDIA 3FI8A 1PXJA 5LMBA 4GIHA 4HVSA 2BAKA 5H8EA 3SW7A 2O5KA 5AV0A 2QKRA 3ROCA 1HCLA 4I22A 2YN8A 2JITA 3DAJA 3I81A 3R04A 4QNYA 1H27A 4ZTNA 3V51A 4BGGA 3MIYA 4TYHB 4W8DA 3MH3A 3M42A 4XJ0A 4JG6A 3HZTA 4EKKA 2RIOA 4C33A 3HX4A 4GUEA 3KF4A 3HRCA 3HDMA 4S30A 5FEDA 3VO3A 2FSMX 3BYUA 5L8LA 2OZOA 5EQEA 3NUXA 4FOBA 4CNHA 4FNXA 1ZOHA 5HNGA 1MRUA 3TYKA 3AC8A 3ZXZA 4FV9A 5TE0A 3MY5A 3DJ7A 3O5AA 4O82A 1JKSA 2BKZA 3COIA 3ROYA 5CQUA 1J1BA 5DR6A 5DHJA 1IAHA 3QUDA 3IGOA 3VW8A 3OY1A 5I9UA 5BX0A 4LRMA 2XRWA 4BIDA 5BVOA 1PYEA 2GTNA 3DZQA 1XH6A 3OW4A 3UYTA 2HOGA 3W1FA 3DXNA 5M09A 3R9OA 4BWKA 5A4QA 3AKKA 2PL0A 4FT7A 2YJSA 4F1MA 3EJ1A 4F7SA 3NRMA 1I09A 5HICA 4LRKA 3VBXA 4IBMA 3DGKA 4J8MA 4FRFA 4PDOA 2CHLA 2UZOA 3PG3A 3C7QA 4K6ZA 3LFCA 4Z3VA 2J5FA 3FXZA 2C69A 2I0HA 3U55A 3ACKA 1H28A 3PXYA 2QR7A 4RGJA 2X0QA 4FT5A 3PIYA 3VRZA 2W5BA 2ACXA 1YXXA 2ITQA 4RG0A 4K2RA 2YA9A 5HO6A 2R3JA 3MFUA 3G90X 1ZYLA 2X0GA 5IU2A 4B4LA 3I7CA 4OTDA 4FSTA 4YJOA 4RC4A 2Y4IB 3A8XA 4EYMA 4DF3A 1ZMWA 3ZSIA 4YLKA 4E73A 1SVHA 3FJQE 3MFRA 3ZU7A 4EK5A 2BCJA 3CXWA 3ENMA 4N6ZA 5EOBA 1YI3A 3RAKA 3G0EA 4HZSA 4A9UA 3QLFA 3EFWA 2PVFA 5HE3A 2F4JA 3BHVA 4AW0A 3KRJA 4R6VA 3R9RA 3F61A 3HA6A 3MVHA 4IX6A 2WKMA 3MS9A 3QQJA 5FTQA 3VIDA 4WHZA 2BHEA 3A99A 4FJVA 1YOJA 4XG3A 4RZWA 3GEQA 1Q97A 4OTRA 4ZSLA 3ODZX 2QHNA 5AAEA 3WI6A 3VS6A 1J3HA 5KE0A 1BX6A 2GSFA 2GDOA 4QMPA 5CU3A 4F6UA 1PJKA 4R7HA 3ZMMA 5ETIA 4K1BA 3Q52A 5CSWA 4BRXA 5CAVA 2PYWA 3FQHA 1S9JA 3UC4A 4DH8A 3BLHA 4DGLC 3E87A 4EHVA 2Z60A 3ZM9A 2G9XA 4WT6A 4AW2A 1KUTA 1ZMVA 4IVAA 3OOMA 5HO7A 4TW9A 2XNGA 3HMOA 4WRGA 5J9YA 1JLUE 4KRCA 2ZV2A 3OCTA 4X2KA 4L7SA 4XBUA 4X0MA 4U79A 2UZUE 3NVMB 2B4SB 2PE1A 3QU0A 3HMIA 1H08A 3R7GA 3JUHA 3V5LA 4O7RA 3R6XA 4OBPA 4RA5A 3JPVA 2CGXA 4P7EA 3VS2A 4QP6A 3MDYA 3RZFA 1ST4A 3S00A 5B2MA 4UWCA 3KRWA 5DMZA 5KMKA 3MSSA 1H1QA 4GEOA 4DEAA 5BUIA 5IH5A 4TN6A 2BZKB 4Q2AA 4G5PA 4JAJA 4Y73A 5HCZA 5AA8A 2EB3A 4FTJA 5DT0A 4PPBA 2JBPA 4AOTA 2OFVA 5GZ8A 1G8AA 1U46A 3ZO4A 4ANMA 4D0XA 3EYHA 4YP8A 2GNHA 3TNPC 4ACMA 1OPKA 4W4WA 5CF4A 3RHKA 1GOLA 3DPKA 4YZBA 1OUYA 4D55A 3PXFA 3ZUTA 4O7WA 3HMPA 3RI1A 3UZTA 5G1XA 2YIQA 3FUPA 4BN1A 3ZO2A 3UQCA 4CSVA 1MQ4A 3R9DA 1OVEA 1NVRA 2XNPA 3I0OA 5EI2A 2VTRA 3ZH8A 3DAKA 2QD9A 3L8XA 2H8HA 2PZPA 2W99B 4CMUA 3TKIA 2J7TA 3CKWA 1SVGA 4DA5A 3NYXA 2X2KA 4HYIA 4ITJA 4TWOA 5EHLA 3W32A 4AW5A 4I0TA 4PF4A 5FM3A 4PMSA 2XIZA 3VONA 2UV2A 2R3KA 3G51A 3L9PA 4IAZA 1XH5A 5DFPA 3O50A 4ZTLA 5A3XA 3HAMA 2JC6A 4BCFA 3GT8A 4OR5A 5EW9A 1UWHA 4EOKA 3D5XA 4G16A 5D1JA 4GKIA 3W10A 2WMTA 3IK3A 1CKIA 3DY7A 4FL1A 5ETCA 5AV3A 3VF9A 3ZFMA 3N4VA 2C1AA 3D0EA 3BKBA 5AP5A 4JDIA 4XEYA 2GQSA 4JMQA 4ENXA 2OZAB 3FKLA 5IDNA 4QMXA 3UDSA 4IM2A 4G34A 5BVNA 2WTKB 5BVDA 2ITTA 2W0JA 1OZ1A 3REPA 4PTCA 4UBAA 3NUNA 5HG8A 4ACDA 3T3VA 4JQEA 3D7TA 2VNWA 4QDEA 1OPLA 2B9IA 4NFMA 3PVWA 2F7ZE 4RJ4A 4RIYB 1LPUA 4HJOA 3W0QA 3BQCA 4LM5A 4O7NA 3DZOA 3EOCA 1JKTA 3H30A 4APPA 3BE9A 1Q24A 2J6MA 2YIXA 5FQDC 5GJDA 3ZC5A 3KL8A 1GJOA 3JYAA 3MJ1A 3PIZA 4USEA 3PTGA 1YDSE 2JKQA 2WOUA 4FTOA 4ZSGA 3NUAA 4BZNA 2BPMA 3R7EA 4BJJA 2B9HA 3VJOA 5FXSA 5AA9A 1WBOA 2JAVA 4ZLZA 5KHXA 3FWQA 2G2FA 2H6DA 3NYNA 5EFQA 1UU9A 3FE3A 4C38A 2JIUA 1PXKA 2VD5A 3KVWA 2R3LA 3UYSA 5F1ZA 4O7TA 2E9PA 2HWPA 2QC6A 3FZSA 4I24A 3A8WA 3Q4TA 3GU7A 3HV6A 4FTRA 3F3VA 5EKNA 3PFQA 3OBGA 4ANOA 4OTPA 2P55A 4JDKA 3GCVA 2BFXA 4ID7A 2CNVA 5I9ZA 4FV7A 4CMOA 1WBPA 4AA5A 3HECA 4I1ZA 4H39A 2X7FA 4RRVA 3BHYA 2OXDA 2VRXA 3NGAA 4N70A 4MNFA 3PPKA 3KU2A 4EZ3A 3D2IA 5L2TA 1SNUA 5EM5A 4JX7A 4IXPA 4NSTA 1PXMA 4FVPA 3FYJX 1Q41A 4HYSA 4KINA 2OF4A 4RIXB 5CS6A 1GNGA 1BLXA 2C0IA 3HEGA 3W2RA 4AOIA 4WD5A 5A4CA 2WTCA 5IPJA 5AP2A 4FZ6A 4IQ6A 4BICA 3LFAA 4D9UA 2Z02A 2AUHA 4AT5A 1BMKA 4QOXA 3QUPA 4R3PA 2GFCA 2IVTA 4WA9A 4D2RA 3FI2A 2XZSA 4D2SA 4GT4A 3O0GA 5HE1A 3JVRA 4TL0A 2OJIA 4QMMA 2KULA 2B9FA 3DKGA 1YI4A 4K0YA 4AG8A 5FEEA 2OLCA 2PY3A 2UZEA 5JFSA 3DNEA 5AAGA 1PHKA 5HD7A 3UNJA 2XK6A 2R2PA 5F94A 1TQMA 1Q5KA 3QD0A 4R3RA 3UBDA 2F7EE 4J95A 4D4YA 3OMVA 4EQMA 4GG5A 3FBVA 4FTQA 5M4IA 4AXCA 3MESA 2ERZE 3FZRA 5C8MA 4K33A 4QPAA 4ACCA 4DGGA 4FSWA 4IANA 3U9NA 4NWMA 2LGCA 3S1HA 4E3CA 3R71A 4BBFA 4FKLA 4E26A 2ESMA 1KE8A 5CU6A 3P78A 5FP5A 2EXEA 3A61A 4PV0A 4F6WA 4AE9A 3FPQA 4OAUC 2O3PA 4QP4A 4TT7A 1AD5A 2VWZA 2QG7A 2I0YA 4Y46A 5EQPA 3RM7A 3E7VA 4YBKA 5DNRA 2BZHB 5HTIA 2XAOA 2C5OA 2WZJA 4FIJA 4D1SA 3VULA 5GINE 2C6EA 4U5JA 4IX4A 5ANEA 4BCGA 3TV4A 4O4CA 3R8MA 3Q9WA 2FSOX 4EH3A 4D4VA 5KUPA 3LVPA 2VV9A 3ORTA 4L43A 1YXVA 4S2ZA 5EHYA 4JR7A 4L42A 2JIVA 4BHNA 4F70A 2CLXA 1J7IA 4C34A 1UNLA 4EH4A 1XR1A 3EQCA 4YMJA 3DKFA 2VTTA 2ITNA 1L3RE 5IISA 3GC9A 4J71A 3VVHA 3W33A 2ITUA 2W1IA 5KKRC 5LJJA 3Q53A 3ZO3A 3P7BA 3LM0A 4BKJA 5BYLA 3H0YA 3NAXA 1E1VA 4NJ3A 2C47A 3ZYAA 2Z7RA 3FSKA 3FLYA 3AC1A 1OIUA 2BMCA 3QC4A 3GBZA 1U54A 3OXIA 4PL5A 3IW7A 4DN5A 2RGPA 2Y6MA 4C2WA 2REIA 2YFXA 2ZDTA 3RALA 3KXZA 3TM0A 4M84A 4FTAA 3PWDA 5IKWA 3R8UA 4M7IA 4CLJA 3QAME 4AF3A 2X1NA 1VYZA 4AU8A 4ERWA 3KULA 4WSYA 2GS7A 4KIQA 3QHWA 3DS6A 2UZBA 2XANA 3GQLA 4O7VA 3GC7A 1APME 1YVJA 2YCRA 4YZCA 4PL3A 3GNIB 3VUKA 5L4QA 3QQUA 1YWNA 5JH6A 5CNOA 4CZYB 3LFQA 4KBKA 4FVRA 4O38A 2B0QA 3VUIA 5L6OA 3RJCA 1IR3A 3E5AA 3SG9A 4YHJA 4L46A 5AR2A 2IVSA 3SLSA 3OC1A 5DEWA 3SRVA 5A6NA 5GHVA 4FZFB 3ZRMA 2YM5A 3A7IA 1H26A 3I60A 4E4XA 5IEVA 3I79A 3CLYA 3LFDA 1ZZLA 4O0SA 2AC5A 4IW0A 5L6WL 1VZOA 3ZOSA 3RNIA 3QWJA 2X2MA 5AM6A 1JWHA 1P5EA 3V5WA 2G1TA 3EH9A 4EOQA 3UTOA 3DAEA 1WVWA 4DCAA 4KD1A 4R7IA 2YCSA 3QTWA 4E8AA 4AQCA 2CKQA 3IQ7A 2VUWA 1KV2A 5EDRA 2JBOA 2YEXA 3TUCA 3CCNA 2J0MB 2VO3A 4U42A 4WNPA 5DRBA 3L1SA 4PNKA 3DCVA 3QRTA 3QTQA 5DT3A 4G3DA 2E9NA 1GY3A 4YJNA 1OPJA 4DFUA 3A60A 5E91A 3F2RA 3NDMA 3N4UA 5HQ0A 4PUZA 2XJ0A 3Q4CA 4IHPA 3NIEA 4J52A 4WBBB 4XV9A 5DE2A 4CKIA 3MI9A 1URWA 3UOJA 2BIKB 3EL7A 1REJA 2C3LA 2PMOX 1OL7A 1NA7A 4AXDA 4KIKA 2WMXA 3ACJA 4FTIA 3KN6A 3UO5A 1FVTA 4FL3A 1H0WA 4O4EA 3ZXTA 2W1HA 1W2CA 1ZYSA 2WNTA 4NM7A 3CS9A 2IZSA 5FBOA 2BTSA 2VTAA 4GL9A 3R8LA 4AGCA 3BGQA 4FV0A 2B52A 4IH8A 4MHAA 4WUNA 1P14A 4WNOA 3AD5A 2HZIA 2UVYA 3LOKA 3QFVA 3FKOA 4IB0A 4QRCA 5CEIA 3UPZA 4I6BA 5IA0A 3OY3A 3VUGA 3TJCA 4KBAA 4FZAB 2BZJA 1R0PA 5AIRA 4UYAA 4FT0A 5EI6A 2UVZA 3BEGA 2R7BA 3T9TA 1FMKA 1HCKA 1CMKE 5IH4A 4QP8A 3HRFA 3TT0A 4MXCA 2W9FB 5JEBA 1JKLA 1Q8TA 4AA0A 5LCKA 4PWNA 4EHZA 5JSMA 3CTHA 3FZTA 4J97A 4O0VA 4ZY4A 3OXZA 4N4SA 3QYWA 4FSRA 2R9SA 4MXZA 2HXLA 3CD8A 4JNWA 2PVJA 5F9EA 4D1XA 1XO2B 2V5QA 1Y8YA 3PP0A 4RQKA 4JS8A 4TYGA 4DTBA 1ZYDA 3B2WA 3LFEA 4L00A 5AM7A 2WMVA 3PXZA 3ZM4A 3ZSGA 4XH6A 3UO6A 3C4CA 2R7IA 4WG5A 2XJ2A 5D11A 2OXXA 4EBVA 2C4GA 5JFXA 1JBPE 3DJ6A 1LUFA 4FV6A 5DGZA 5HO8A 5TF9A 3VHKA 2CSNA 3FMHA 1IG1A 2NRYA 3MPTA 4I0SA 4AFEA 1ZMUA 3VW6A 2EWAA 4ASXA 1V0BA 2GNJA 3ZC6A 5IH6A 4O7LA 2RFDA 5CVFA 4O22A 5HNBA 1Q4LA 5HVJA 3VBQA 1TFFA 4TRLA 2GHMA 3QRUA 1CSNA 1SMHA 2VWIA 4YJSA 3FL5A 3DBFA 4K11A 3EQRA 4E6DA 4EK4A 5TR6A 1YHWA 5IF1A 1Q3DA 3L9MA 4AT4A 5A4LA 2ZB1A 3FEGA 4FG9A 2VX0A 5KBQA 2CNUA 3SX9A 4C0TA 4I3ZA 4QNAA 5FP6A 5LWNA 3E8NA 2IEWA 4ZTRA 5M08A 3FLQA 4EC8A 4EK6A 4K9YA 3BV2A 3ITZA 4IC7A 4PDPA 2Z8CA 5E1SA 4B8MA 2VTNA 5HCXA 2UW7A 2C68A 3KA0A 4KWPA 4GK3A 4NZWB 3R83A 3LXLA 3PJ1A 4FT9A 3QZFA 2JAMA 4EJ7A 5J7HA 2E9VA 3HVCA 5K3YA 5A4EA 3NIZA 3MN3A 4IFGA 2UZTA 2PVYA 4C36A 4HGLA 4Z16A 5CAQA 4DITA 5E8UA 3CE3A 3GU6A 2X6DA 3SVVA 4CFWA 4AAAA 4LOPA 4U45A 4O84A 4BR3A 4FEQA 5AV2A 4CYJA 4GFGA 4M67A 3C50A 3C1XA 2E9UA 3QRJA 3U6JA 4FA2A 4XP3A 3CGOA 4D4RA 1ZY4A 3O23A 3R1QA 5DR9A 3PJ2A 3WYYA 3IW6A 2YACA 4D28A 4LUEA 2IVVA 4BY9E 2VN9A 3O96A 4F0FA 4ONAA 2UVXA 3UNKA 3KXNA 2BILB 3EN6A 3F3ZA 4AZWA 1OIYA 3SAYA 4C4HA 3E92A 3F7ZA 3H9FA 3MH2A 4OTQA 4D0WA 5JKGA 5C4LA 2FYSA 1NW1A 5IEYA 3UVPA 1FBNA 2J0IA 2A2AA 5EYKA 5KBRA 1Z9XA 5HG7A 4FIEA 3FZ1A 2UW6A 2G15A 4FSQA 4YHTA 4WKQA 2O63A 2I0VA 5ANGA 3R7OA 1UU3A 4RC2A 4BTFA 3TI1A 3CTQA 2WIPA 3LM5A 4XV1A 3TZ8A 1JQHA 3IDBA 4R5SA 3UVQA 2I40A 4BDKA 4ALWA 1W84A 3ZFXA 3BWJA 2CKEA 4LMNA 5CVGA 5KZ0A 3V3VA 3PZEA 4QTDA 2A4LA 4GYIA 2BRNA 1KSWA 4IMYA 3QA0A 4Y95A 4C4IA 2VWWA 4U97A 4FSYA 2IF8A 4UYNA 3ZONA 4OT5A 2ZMDA 2GCDA 4X2FA 4UMRA 3FDNA 4S31A 3V04A 3W18A 2OBJA 3RKBA 1Q99A 4BIBA 3R01A 3AD6A 4FKRA 1G8SA 4C7TA 2XNBA 4M69A 4TY1A 2JKKA 5H3QA 1U59A 5HKMA 5CANA 2YM8A 3W0RA 4AQKA 3EL8A 4MD7E 5EYCA 2G2IA 1J1CA 3V8WA 3UQGA 4JLCA 4NTSA 1DAWA 4D5HA 2WIHA 2QO9A 3P1AA 1QPJA 2P2IA 2QU6A 3MPMA 3OWKA 3EHAA 3WE8A 2RKUA 1YQJA 2VTMA 2ITOA 2W1FA 4ZTQA 4IB1A 3ORZA 5LVOA 3EQDA 3K2LA 4I93A 3QF9A 4JBOA 4O6LA 1R78A 4QYYA 4DYMA 3Q4ZA 1QPEA 4O0UA 4TYIA 4UZHA 4X2GA 4AUAA 4E5WA 4I20A 4QMVA 3RMFA 4GH2A 3OCSA 4RX7A 1ZOEA 4RWIA 3TWJA 3G2FA 3OS3A 4A9TA 2YERA 3BL9A 4UMUA 3VAPA 3GUBA 4BZOA 1Q62A 3R63A 4U0IA 1ZYCA 4RBLA 3TKHA 1Q3WA 4AZTA 2YM4A 4HVGA 5CF5A 3PFYA 1MUOA 3G9LX 1OBGA 2PPQA 2XM9A 2R64A 3Q9YA 4Z9LA 2AC3A 2ITPA 4JJRA 2XBJA 2X2LA 4ZTMA 4ANNA 4AN2A 4V0GB 1K2PA 5DH3A 2BKKA 4U80A 2X4ZA 3QYZA 4I5MA 4BDJA 5D7AA 3F5GA 3C4XA