4DFNA

Crystal structure of spleen tyrosine kinase complexed with an adamantylpyrazine inhibitor
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
274
structure length
269
Chain Sequence
VYLDRKLLTLEDKELGSGNFGTVKKGYYQMKKVVKTVAVKILKPALKDELLAEANVMQQLDNPYIVRMIGICEAESWMLVMEMAELGPLNKYLQQNRHVKDKNIIELVHQVSMGMKYLEESNFVHRDLAARNVLLVTQHYAKISDFGLSKALRADENYYKAQTHGKWPVKWYAPECINYYKFSSKSDVWSFGVLMWEAFSYGQKPYRGMKGSEVTAMLEKGERMGCPAGCPREMYDLMNLCWTYDVENRPGFAAVELRLRNYYYDVVNE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Pyrazine-based Syk kinase inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
molecule keywords Tyrosine-protein kinase SYK
total genus 83
structure length 269
sequence length 274
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2012-01-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4dfnA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4dfnA01
3W16A 4FSQA 3DS6A 2XNBA 3KRRA 3POZA 3DBEA 2OK1A 3RALA 3M11A 4IX5A 2Y4IB 4N4SA 4NCTA 3SDJA 3ZZWA 2WXVA 5K0XA 3C4EA 2XNPA 4M8TA 4MKCA 2OJIA 2HXQA 3KXXA 4YJRA 2I1MA 2VTAA 5L2QA 3HV6A 2EVAA 1J7IA 1PXKA 4CCBA 1B6CB 3OY1A 3TUBA 4A7CA 4N57A 3QX4A 2CNVA 2W1EA 1ZY4A 4JLCA 2V7AA 5AUWA 5BVWA 3VBYA 3PXFA 3HV4A 3VJOA 2OICA 4FT7A 5HBJA 4KIKB 1PXPA 2YN8A 3PVWA 4GT5A 3ZSHA 2HZ4A 4G3CA 5L2TA 3DB6A 5D11A 3A7GA 2HWOA 1GIIA 2YLFA 1JKSA 3QBNA 3DNEA 4ZJVA 3FLQA 4RIWA 4II5A 2OJGA 4ZP5A 4TKSA 1SM2A 4K18A 4X2GA 4RVTA 1PJKA 1YOMA 4M69A 3TUDA 2W99B 2F7ZE 3CQWA 4CNHA 2GMXA 4RWLA 3BHUA 2VTSA 4OBQA 2PMIA 4X2NA 4XLVA 5FTOA 3HZTA 5EFQA 3EQDA 4EQUA 2X1NA 2OI4X 4AT4A 3R7YA 5BUIA 4GS6A 1KE9A 4ZLOA 4A06A 2GNHA 3CCNA 1STCE 1M52A 3UTOA 4BR3A 3DBDA 3AG9A 3QD0A 4R3PA 3ULZA 1YXUA 3O0GA 4JDJA 3Q96A 1VYWA 3GFEA 2R2PA 5IZFA 5J1WA 2XKDA 4RJ8A 5C4KA 2XS0A 3O7LD 3ORXA 1UNHA 4FV2A 5B7VA 5L6OA 3FI8A 2O8YA 2R3OA 4ZZNA 1CSNA 5JFSA 1PW2A 2PWLA 3B8RA 4FTJA 3ZU7A 5CF5A 2BAKA 4BDFA 2PZ5A 3H30A 3OVVA 3QA0A 2OO8X 3ACKA 3CTHA 3O8PA 4MD7E 4BFMA 4QT1A 4DEBA 3EB0A 1XH8A 4QP8A 4U6RA 4C8BA 3D9VA 1IAHA 3I4BA 3A4PA 3AC2A 3GCUA 3TN8A 2I7QA 2W1ZA 3AC3A 5HBEA 3UC4A 1VR2A 3L9LA 3V5WA 3I81A 4D1XA 1YHVA 4MAOA 3V8TA 2XK9A 1F3MC 4XH6A 4F1TA 2BUJA 4ACCA 1MQ4A 3D2KA 4QMTA 4QD6A 2VZ6A 3U6IA 4HGEA 5AR3A 3PJ3A 2QKRA 3P79A 3ENMA 2QO7A 2R3IA 4Q9SA 4XRLA 5ANKA 2UZVA 2UZEA 3N9XA 2ITXA 4MYGA 3ZEPA 4UMRA 4HW7A 1IG1A 5CT0A 1P4OA 5HNIX 3QZGA 2W1FA 3VBXA 5E8ZA 1DM2A 4C2WA 1JAMA 2LGCA 2R3FA 2UW6A 4JBQA 4IZ5A 3ROYA 4BKJA 2GCDA 4U79A 3Q4TA 4Z16A 5GIOE 4FZDB 3U4WA 3A7FA 4FSTA 4FKRA 4QMWA 1CKJA 5AV2A 2YJRA 3BV3A 4FTQA 2GFCA 4J95A 4RPVA 4QYYA 3ZRMA 2BILB 1H07A 3LCDA 3NR9A 1NY3A 2C0OA 3HA8A 4MH7A 4H1JA 5I4NA 4NIFA 1Q5KA 4AP7A 2CLXA 5F1ZA 5A14A 1LPUA 3G0FA 1PHKA 3FYJX 4QP9A 5HIBA 2G01A 4IWPA 5IEYA 5CU3A 3RVGA 3KKVA 3SHEA 5H9BA 2OBJA 3QTQA 1LUFA 2R0UA 3KF4A 4MCVA 4BI0A 3GBZA 3K5VA 5E8VA 4EHEA 3FBVA 2VWYA 1WBTA 3CPBA 3VVHA 3ZLYA 4A4LA 1SVEA 3EFWA 1OZ1A 3KRLA 4D9UA 2R3HA 1UVRA 3TTIA 4QQCA 4LYNA 4I3ZA 1JSTA 2WMXA 4AAAA 4DTBA 2OGVA 4RIYA 4PDOA 2J2IB 5HE1A 5DG5A 2WHBA 4XG6A 4G3EA 5DGZA 5TO8A 2VUWA 3FI2A 4WA9A 3C9WA 4C35A 3HYHA 4IFGA 4BWXA 1ZMUA 3FQSA 3IW5A 4MXZA 4F0IA 3NVMB 1KE8A 4NTSA 5HQ0A 4C3RA 4GV1A 1ZXEA 2Q0NA 1O6YA 3QTRA 3R7EA 5TKDA 2P2IA 3GC7A 3FMLA 3LJ0A 4CMTA 2VWXA 4O7NA 3DCVA 4TYGA 3R04A 5HCYA 4X0MA 4FT3A 3CJGA 2OF2A 4RX5A 5HG8A 3VS5A 3RTPA 2OU7A 1M7NA 4YBKA 5JSMA 2W0JA 3Q6WA 2DWBA 3QL8A 1R0EA 1YOLA 4AA5A 4FT0A 2JIUA 3LFQA 1PXNA 3R7VA 4NJDA 3QUPA 3ENHA 1OBDA 3PTGA 4ZY6A 4GKIA 1UWHA 4ZSJA 3GCQA 2R3JA 2WMUA 5KBRA 4UYAA 4IX4A 3SXFA 2HENA 2E9NA 4BIEA 1KUTA 3UZRA 4OBPA 4AGDA 1YXVA 5CF8A 2WMRA 4Y73A 2IZSA 1NXKA 3FMMA 3I0QA 4IVCA 2I40A 4A07A 4DT9A 1PRYA 2NRUA 5LCKA 3ANRA 3QRJA 3LFDA 2HK5A 2WTWA 5M56A 2YISA 2G1TA 2W05A 4FE2A 3LAUA 1H0VA 5CEKA 4QMXA 4S33A 4IZAA 2YCQA 2RFEA 2UZLA 2J5EA 5AJQA 3GUBA 4QTAA 4AG8A 5GIPE 4L52A 4F7SA 3S95A 3KF7A 4KD1A 4K1BA 2QOHA 4RC4A 2PVJA 1H1PA 4NU1A 3R9OA 5L2WA 1FQ1B 2XCHA 5D7VA 2F7XE 3DDQA 4LGDA 5EM8A 3EFLA 1ZZ2A 3RCJA 4G9RA 4DT8A 4UEUA 4BCMA 1CKPA 3NWWA 2F49A 2C3IB 2H9VA 5CF6A 3HAMA 1OKWA 4YO6A 3QGYA 4UBAA 3U6HA 4E5AX 2VWWA 3I1AA 3IW8A 4QYFA 4FTRA 2VRXA 3FAAA 1XKKA 3T9TA 3OTUA 4GW8A 5F9EA 5KO1A 3DK7A 1IA9A 1JKLA 4W4VA 3SXSA 2CGVA 1IAJA 5IQDA 5T3QA 4ZSLA 5C8NA 4FICA 1XBBA 4JG7A 5CZIA 4BCKA 4DFNA 5GZAA 5IU2A 4CFWA 3C5IA 4IB5A 3EIDA 3RK5A 4EWQA 4NFNA 3SW4A 4BZDA 1XWSA 2VTPA 5HCZA 3LFBA 3C5UA 3OHTA 3OW3A 2YM3A 2QVSE 3Q53A 4AE6A 4FC0A 3MY5A 2OJFE 4FTOA 3C4ZA 2H34A 5E91A 5DOSA 4ZTQA 4UMPA 4W8EA 1TKIA 2Y4PA 4UXQA 5DRBA 3PXRA 2PUUA 4FIIA 3P78A 4KWPA 2BRBA 3WF8A 5J7HA 3FY2A 4FKWA 3NNWA 2R4BA 4IH8A 4KS8A 3FI3A 4MHAA 3IG7A 3TNHA 4A9TA 3NUSA 4AZFA 3MVLA 5AADA 2XZSA 5K5NA 3PP0A 2UZDA 3FV8A 4KB8A 3TACA 4ERKA 2UW0A 4JAJA 5FM2A 3KULA 3M2WA 4I94A 2YACA 1Q4LA 4BC6A 5IQBA 3EN7A 4I22A 3RM6A 1JKTA 3T9IA 3S0OA 3ALNA 3LMGA 1Y8GA 4RRVA 2W1GA 4DEHA 1PXLA 4ZK5A 2C5YA 3PY0A 4GYIA 4JDKA 4KAOA 4TYJA 4ANLA 2UZTA 5HIDA 5C1QB 4U5JA 2ACXA 4GEOA 4J8NA 2VV9A 3E3PA 4AOIA 3VAPA 2WKMA 2DUVA 2IO6A 3MBLA 4M3QA 2X81A 1Z5MA 2W9FB 5K3YA 5TF9A 4CRLA 4P5QA 4FG9A 3BLHA 3I60A 2YIQA 4FL1A 3VHKA 4EONA 3SD0A 4DEEA 4NUSA 4CFFA 4V01A 1Q62A 3VN9A 4BCPA 5L2IA 4BDAA 4ONAA 2QNJA 4R3RA 2CHLA 3LFCA 4C0TA 4F9YA 3JR1A 5AUUA 2PL0A 1NVSA 4G3GA 4I6HA 4R7HA 4MBIA 2J5FA 4PV0A 5B0XA 5LCJA 4H1MA 4FZAB 1ZYDA 4O2ZA 3AT2A 2CNUA 3F5XA 4IAKA 4NEUA 4ACMA 5JK3A 2BKKA 4IM0A 4C4IA 4WKQA 3MS9A 4BVUA 5JFVA 3QKMA 2R64A 5HCXA 3L1SA 4E20A 3DU8A 4FV6A 3QD2B 2ZV9A 4FNYA 1OKVA 3GC0A 4JVGA 4KIQA 2H8HA 4IE9A 4AW1A 2W06A 4Y5QA 2J7TA 5AP0A 5L4QA 4RJ5A 4M14A 4QPSA 1IASA 3RPRA 3UODA 2PUNA 1LEWA 2IW6A 2X4FA 3B2WA 3PE2A 3V01A 5IDPA 2Z2WA 3VW8A 2E9VA 5M4UA 3BX5A 5KCVA 1GIHA 2GPHA 3O50A 4FT9A 5E7RA 4F9AA 5HVYA 4D2RA 4AFJA 2ERZE 2V22A 5DR6A 1Z57A 3PFQA 4BY9E 3W1FA 2UZBA 1W7HA 2JKMA 1OB3A 2X8DA 3E87A 3P1AA 4MD9E 3ZHPC 5IQHA 5EYMA 3MWUA 3VUHA 5IMEA 2WMWA 5DR2A 3WF5A 4KRDA 3WYYA 4D4YA 4O1PA 2J0KA 5CSWA 3CS9A 3QU0A 2YJSA 4UWCA 3HEGA 3ANQA 5EQEA 3P5KA 4UALA 3VF8A 2UUEA 4CD0A 4BBFA 5LMBA 2CN8A 3HAVA 2PZRA 4OTHA 2A27A 2VGPA 5C8KA 2R3KA 2B4SB 2R3PA 3TUCA 3ROCA 4DFUA 4GU9A 2BDWA 4FYOA 5GJDA 5IUIA 4RWKA 3OXIA 1URCA 3HNGA 3PP1A 4J71A 1OPKA 1NW1A 4BZOA 4L01A 3ATTA 3ZOSA 5EW3A 1J1CA 3KB7A 2UVZA 2W4KA 3ORZA 2C6TA 3UJGA 3DBCA 5HZNA 4APCA 3UZPA 1FVTA 3BLRA 3UO4A 4GFGA 4L44A 5EDPA 5BPYA 4U41A 3GU6A 5CLPA 1Q8ZA 5LMKC 4QP3A 5HG7A 4Q9ZA 3A7HA 2XH5A 5HLPA 3F5UA 2C3LA 4GFOA 4TRLA 4QMSA 1GZNA 4FKPA 4IANA 4TYHA 2OXXA 2J9MA 5E8XA 2ZJWA 2CCHA 4WRSA 5L6PA 5GJGA 3DQWA 4FKGA 3UO6A 4CKRA 4ANBA 2X2LA 5BUEA 1KE6A 5BYZA 4G5PA 4FTNA 3TDVA 1ZLTA 2E9PA 5AV3A 2BR1A 4F0FA 1U5RA 3VULA 4IHPA 2BTSA 2PMOX 1QPDA 2R3QA 3G0EA 5DEYA 2J6MA 2XKEA 4PL3A 2R7BA 2XIYA 4O0UA 4KINA 1P5EA 2QLQA 3NUYA 1YHWA 3QZIA 2Z8CA 3K3JA 4L3LA 2J0MB 4O0SA 3AD6A 3ZO1A 3QQUA 2PVMA 2YDIA 3FLNC 4QTDA 2YZLA 5D9HA 3CBLA 2FGIA 2VTQA 2NRYA 5BQ0A 3IDPA 3ZSIA 3FPMA 3NUAA 4ASDA 3KU2A 1YXXA 2C6LA 3EQPA 3FZ1A 1W0XC 4TNDA 3K3IA 5G6VA 5DPVA 5JGBA 4D1ZA 2F2UA 4C2VA 4LV8A 4BCFA 4C33A 2YABA 4FUXA 2ITNA 1U59A 3R9DA 1Y6BA 4HGTA 5A4TA 5LQFA 2VWVA 4AN3A 1Q41A 3QLGA 5HESA 5BNJA 4F7NA 1ZOHA 4LL0A 2HW6A 2QONA 3MH1A 5DFPA 1PXIA 4O1OA 1H24A 4PMPA 3RAIA 2XJ1A 3Q5IA 2GNGA 3BE9A 1FINA 2X7OA 4L9IA 4DE4A 3SLSA 3FKOA 5EI8A 4QPAA 4NW5A 3ZS5A 3FXZA 2YEXA 4EJ7A 5M55A 3NZ0A 4Y46A 3MIYA 3K54A 2JFMA 3UMXA 3W2OA 4D9TA 4P7EA 1S9JA 2X8IA 4IJ9A 3SRVB 3S2PA 3VJNA 1WBPA 4EEVA 4MEDA 4RLLA 1A9UA 3PSCA 3FL5A 4GRBA 3ZRKA 4TZRA 4X6QC 4L53A 4IZYA 4YHFA 3VUMA 3PJCA 4IM3A 5IH5A 5EDRA 2WQNA 2C0IA 5IH6A 5KMIA 3C4WA 3R2YA 3BE2A 4A9RA 3REPA 3EQRA 3A2CA 3H9RA 3G33A 3HUBA 3POOA 1WBWA 4YJTA 4CT2A 2P0CA 2KTYA 1GZ8A 4IQ6A 3TIZA 3D5UA 4X2FA 2R3RA 4F09A 1YDRE 3SQQA 2ZV8A 4ORKA 3A8XA 4AW5A 4JIKA 2BZJA 3GU5A 3UVQA 4W4WA 3VF9A 1BKXA 4EOLA 2PVLA 3HL7A 4AXAA 2G15A 3CJFA 4GT3A 2GS7A 2UW5A 3GCSA 4YJUA 3F3WA 3I5NA 3ODZX 3UOKA 4W4YA 3TNIA 4LOQA 4YPDA 3NS9A 4NT4A 5C03A 2JEDA 4Y95A 3RI1A 4BDJA 5ANIA 3V8WA 3OROA 5FDPA 4YLKA 4FKSA 1WBOA 4MTAA 4E8AA 4QRCA 4R7BA 3PIZA 4WNKA 2XKCA 4PDPA 4XP2A 4D0XA 2YM8A 2WQOA 2XCKA 1WVWA 2G2FA 3D5XA 3U87A 3UYTA 4CTCA 3BYOA 4PY1A 4EK6A 4U80A 3QC9A 5M57A 2CGWA 3RAKA 4WBBB 4EBVA 5I3OA 1H08A 2C5VA 2QHNA 3NW5A 3MI9A 4X3JA 4UV0A 1RQQA 3DTCA 5KMLA 3CY3A 3H0ZA 1MRVA 5DI1A 1PF8A 4YZMA 3R28A 3TV4A 5J9ZA 2QR8A 1YXTA 3W2RA 3ZO4A 4EL9A 2GNIA 5EI6A 4PX6A 2X4ZA 4H58A 1OUYA 3K5UA 4LM5A 3UIBA 4ZY4A 4EC8A 2BPMA 1SMHA 4YR8A 3MESA 4CZUA 4I23A 3EQFA 3ZDIA 2C6KA 3TJDA 3WF6A 4YSJA 1F5QA 2WMQA 3MPMA 4EYMA 2R3GA 1YWVA 3LQ5A 4L6QA 5HU3A 3DB8A 3ID6C 2YM6A 4EH6A 2YDJA 3RPSA 5JFWA 3E8EA 4E5BA 1P4FA 2OJJA 3OD6X 1OECA 4N6ZA 2PMLX 3QTWA 4IAIA 1SYKA 4UMUA 3FLWA 4AW0A 3P23A 3MPTA 1BL6A 3O8UA 5JGDA 2C1BA 3JY9A 1FVRA 4B8MA 3RKBA 1DAWA 1ERKA 3NNUA 4FSUA 2VWUA 2WTCA 2WGJA 1U5QA 1ZYCA 2QODA 4E1ZA 4FOBA 4EHZA 2XUUA 3FMKA 3HDMA 3PZEA 4YTHA 1XBAA 5EKNA 4UYNA 3U9CA 4YZDA 5HD4A 4OBOA 3NUPA 4AGUA 2EB3A 4S32A 4QMYA 5CX9A 5C4LA 3PVBA 3A99A 2B52A 3GOKA 3R63A 4NCTC 3WIGA 2Y6OA 4BIBA 4GU6A 5IDNA 2UZWE 1BUHA 2BALA 2QO2A 3A8WA 2NO3A 3FZPA 4YJVA 5AMNA 5TOZA 4EOPA 4HVIA 5HO7A 2XIXA 4MNFA 2QD9A 4QTBA 3Q2JA 3CP9A 2W96B 3BHVA 2VX0A 3ZLXA 2VD5A 3ZO3A 5AAGA 1S9IA 2PULA 1Q3WA 1JSUA 4GIHA 3LW0A 4J8MA 4AA4A 3BCEA 1JWHA 3SOCA 4E6CA 4FV3A 4DCAA 3LFEA 1QPJA 3KC3A 4L7FA 4DF3A 3NUNA 4M67A 2OH4A 3LLAA 3R7UA 4KUJA 5EOBA 3F5GA 3R8VA 3UIXA 4J96A 3FZOA 4C34A 4E6AA 2XEYA 1Q24A 3UO5A 2BROA 4V04A 5FWKK 3IPHA 2CGUA 4MQ2A 5E8TA 2XK8A 1Q99A 2KULA 2QOCA 3TL8A 4F70A 4C58A 4EOMA 5EKOA 5ANJA 3DNDA 1PMEA 5A4EA 3VHEA 4HZRA 2PZIA 4PUZA 4R8QA 4FSZA 2WQBA 4FMQA 5AUYA 3ZXTA 3PXQA 4W4XA 4QMUA 3KQ7A 3PPKA 5HLNA 2VO0A 4BWKA 4F64A 1REKA 3EQBA 2WMAA 4OAUC 4JRNA 4FEUA 4CG9A 2CNQA 4DTAA 4ANNA 4YTFA 3GC8A 4FEXA 2C5XA 3R1SA 1AQ1A 4BDKA 2IZUA 3CKXA 3UVPA 2B0QA 1H1WA 4JBOA 2JFLA 4FK3A 2AUHA 2QU5A 3FMNA 3HRBA 5CI7A 5I9ZA 5IEXA 1YOJA 2W4OA 3UIMA 3TJCA 2FUMA 3CGOA 3OZ6A 4IBMA 2JBOA 3DQXA 4F7JA 3FJQE 2C4GA 4CZYB 3FHIA 4WBOA 4JXFA 4M66A 4YNEA 1ZAOA 4HZSA 2RSVA 3LIJA 5IQAA 4AU8A 1OL7A 4RX9A 3KK9A 3I7BA 2CKQA 2JITA 4XP3A 4XS2A 1CMKE 3R7GA 5M08A 1H26A 5AP3A 5LOHA 5EHLA 3RHXA 4QMLA 4WSYA 4BDDA 4IACA 4IJPA 4EWHA 2ZYBA 3QXPA 4JT3A 1U46A 5I9UA 5ANDA 3V6RA 5K5XA 3UPXA 3C4XA 4L7SA 1UU8A 3VW6A 4A9UA 3E64A 1KOAA 4Y83A 4L68A 4XOZA 3ULIA 4E4LA 3H9OA 3HP2A 3ZH8A 3EKNA 3VS7A 5CXZA 4D55A 1VJYA 2QKWB 3O8TA 3QGWA 4O84A 4FSYA 4PWNA 3BHYA 5AP1A 1XH9A 3QQKA 4OTDA 4K11A 4CFXA 2PSQA 4TW9A 4OTPA 2UZOA 2BKZA 3DY7A 4QNYA 5HI2A 4FX3A 2Z02A 3ZXZA 2GNJA 4FKJA 3MTLA 3QQJA 3PRIA 4DEGA 1YDTE 2E2BA 3R02A 3KRXA 3KL8A 4CTBA 5AP2A 4ENXA 4I4FA 3PY3A 1M2RA 3FWQA 2WQMA 3ODYX 5CALA 5ANOA 2GQSA 2XNMA 3FZRA 3FMJA 4U9AA 5DHJA 4EUTA 1BYGA 5EHOA 5KX8A 3MN3A 3VS1A 2WMSA 3UBDA 1M14A 4FIEA 3H9FA 2XNGA 5HU9A 5IEVA 3F3VA 2OSCA 3F88A 3QQLA 5CEPA 5EW8A 3UGCA 1YDSE 4D0WA 3BU6A 5KKRC 3RGFA 4ZJIA 5J9YA 2QO9A 3IDBA 2UZNA 5HO6A 3NMUF 4ZY5A 3FZTA 2XIKA 3ZCLA 2XJ0A 3Q9ZA 4XRJA 1L8TA 3NYOA 5EQPA 3C0GA 4PL5A 3I7CA 3L9MA 5CQWA 4AE9A 4EK8A 3SG8A 4BIDA 1SVGA 5AR8A 4L46A 2ETMA 4I0TA 4DFLA 3E8NA 3LCTA 3Q9XA 2QOIA 5HD7A 3DPKA 3MJ1A 1UNGA 1YI4A 3GGFA 4QNAA 1ZRZA 3DBQA 4HYSA 4QP2A 4TNBA 5M44A 2BHEA 4AWIA 5BVDA 4GCJA 1ZOEA 1G3NA 4HNIA 4M0YA 4RLKA 4NWMA 4JI9A 4CCUA 3SC1A 4GJ2A 4O0XA 3N4VA 4R1YA 3OWKA 4EOIA 3COIA 4YUQA 4K6ZA 2O2UA 4I0SA 3V5PA 2XYUA 2XNOA 3FXXA 4LOOA 4BYJA 2B9JA 3ZSGA 2B9FA 4C3PA 3ZLWA 5AV1A 5LVOA 3QYWA 2XIRA 4QYHA 2PY3A 5BVKA 3IS5A 3QWJA 4OUCA 3MVMA 3UOHA 4AQCA 3H0YA 2OH0E 1E1VA 2IPXA 3A4OX 2XM8A 3EL8A 2W4JA 1Y57A 3IGOA 2F2CB 2NPQA 4O27B 5E8YA 2OG8A 3LCSA 2F4JA 2CGXA 4H36A 1ZY5A 5FEDA 4PTEA 5FP5A 5CU0A 5EOLA 4FTUA 2XBJA 4YNOA 4FG8A 5IF1A 4ITJA 4QMPA 2XK7A 3CQUA 1H28A 4DEIA 1PMNA 2H6DA 3RPOA 3ET7A 5JRSA 2WAJA 4EUUA 4D4VA 3KMUA 4IAAA 2YM4A 2EU9A 2YFXA 5HGIA 4TL0A 5KMOA 3N51A 4KBCA 5IA2A 4EORA 4L3PA 4JIAA 4H05A 4UN0C 2QG7A 5I9XA 1SVHA 4AOJA 3UNKA 3G2FA 4WUAA 4IC8A 5F94A 4FKUA 4QYGA 4L42A 2HIWA 5CT7A 5K9IA 4XUFA 3Q9WA 2WOUA 5EW9A 2PVHA 3EJ1A 5AIRA 1J7LA 1W82A 3CIKA 4LFIA 4BF2A 1B38A 3JY0A 2CKEA 1Y8YA 2RL5A 2VTTA 3TTJA 3IW6A 4UB7A 4PRJA 3VS6A 3ZLSA 4EBWA 5LARA 4B99A 3MPAA 4FKQA 4JS8A 5HORA 4JR3A 4KIOA 2AC5A 4D5KA 4RWIA 3C7QA 5J5TA 2OJ9A 5CZHA 2QURA 5FBNC 4RC2A 4TN6A 2ITTA 4CRSA 4E7WA 2J4ZA 3F2NA 2EXEA 1R78A 2OIBA 3GFWA 1JPAA 1URWA 5AR4A 3WI6A 3IKAA 3OUNB 4E4XA 4ACGA 3COKA 4WSQA 1QCFA 2WQEA 5CF4A 5CVFA 5AM7A 3UOJA 4JNWA 2W5AA 1PXJA 5DEWA 1YKRA 4OT5A 3BELA 2X7FA 5DYJA 5IMXA 4AUAA 4B7TA 5AA9A 2WTVA 2ZVAA 3WYXA 2XK4A 5BUJA 4LG4A 4X3FC 1JVPP 4Z3VA 2V5QA 3GI3A 3JS2A 3MY0A 2UW3A 3ZRLA 3GU8A 3WE8A 2V62A 4QQJA 2JDRA 3VS4A 1PMVA 3MV5A 3A62A 2C6EA 3ORPA 5LVPA 2VWBA 4FZ7A 3DJ6A 3EYHA 3G15A 3H10A 4GFMA 4KKHA 4RFZA 4CZTA 5IH4A 3LMIA 5ETIA 5FTGA 3QZFA 2CDZA 3OCSA 3JPVA 4G1WA 4M68A 5EDQA 5T6KA 4PDSA 2Y0AA 4E4MA 4RX8A 4GH2A 1PYXA 3G9LX 5GNKA 3RZBA 2CLQA 4I41A 4OW8A 2DYLA 3PA3A 4FTLA 5HO8A 2YCFA 4BHZA 2LAVA 4RQKA 5L2SA 5HE2A 4L43A 5I9YA 4DCEA 2JDSA 3KRJA 3R9RA 2F9GA 1Q8TA 5IA3A 3OP5A 3Q04A 3MH3A 3D7TB 4K9YA 3FKNA 4PTCA 5C27A 3WZEA 1ZYJA 1VYZA 4CGAA 4DEDA 1FMKA 3S1HA 3UQGA 1H01A 3LCOA 3LJ1A 4AFEA 3R71A 4RSSA 2PE1A 2PK9A 3BLQA 4BDGA 2XK3A 2VTRA 4P2KA 4O0RA 2QOBA 5HVJA 2FO0A 4AF3A 3WZKA 3F82A 2PHKA 3GC9A 2VTJA 4H3QA 5HNGA 4IWOA 4IVAA 3TDWA 5L6WL 4NZWB 2JC6A 5M4CA 4UXLA 3Q52A 2VAGA 4ZMEA 2ERKA 3FQHA 5BYYA 1H8FA 2XEZA 2ZV2A 2F57A 5ACBC 5IG1A 5IA1A 4AZVA 3VBVA 3MYGA 1G5SA 5JZNA 3FMHA 3L8SA 3ZZEA 4BCQA 3QHWA 4O6LA 2C69A 3Q32A 4RQVA 4O91A 4ARKA 4C59A 1BL7A 3CQEA 5IPJA 3FZSA 5DE2A 4EH7A 1KE7A 4ZTNA 3LOKA 3E8DA 4K33A 4AS0A 5AAFA 4FIHA 5D12A 2WEIA 3W55A 5AR7A 3COHA 3CD8A 4Q5HA 3UYSA 2VGOA 4CFNA 1Q97A 3MH0A 2YIWA 2RIOA 4GVJA 4IC7A 3PIXA 5BVFA 3ZDUA 2QOOA 2X0GA 2BRHA 4ACDA 4DH3A 1WBVA 1B39A 4ITIA 2EXCX 2BRMA 1T46A 3OT3A 4IAFA 2O65A 5AUVA 5GJFA 4QQTA 3UP2A 4YHJA 2CKPA 2E9UA 4MBLA 4FV7A 2QOLA 5M06A 4RFYA 4HGLA 2ETKA 1ZOGA 3BU5A 4AOTA 4WNMA 4CXAA 4FNWA 3OCBA 4QMZA 5BVNA 3G6HA 3RNIA 5LXMA 3CEKA 3OCTA 3FSKA 3W2SA 3EN4A 2GNFA 2QR7A 4AZEA 2W9ZB 2IZTA 3R0TA 3UMWA 4NM7A 1Q8WA 2BDJA 1UU7A 3ZM9A 4ZZOA 1OITA 4IWQA 4M0ZA 4O82A 3NUXA 4HYHA 4LQMA 1J7UA 4M12A 1HOWA 3R1NA 4OT6A 2XRWA 3MA3A 5E8UA 4TWOA 3MFUA 3DAJA 1XH4A 4BGQA 2GHMA 4F65A 4FNXA 1OUKA 4Y72A 5J87A 1WBNA 1X8BA 2C6DA 2GTNA 3FDNA 4JJRA 5TE0A 4TT7A 3R9NA 1JLUE 3UE4A 3HX4A 1ZMWA 2B9IA 3NW6A 1PKDA 3OY3A 3Q2MA 1P14A 3CLYA 3ORKA 3DJ5A 3E92A 3Q4ZA 4DGMA 4HYUA 3R22A 1ZYSA 5AP6A 3OOMA 4MXOA 5KMJA 4AZTA 3CE3A 5H2UA 4CEGA 3ORNA 5ETCA 3QLFA 1U54A 3E7VA 3RNYA 2JAMA 3KN6A 4R77A 4YMJA 3KMWA 4MVFA 1GY3A 4G5JA 2UVYA 4ZJJA 4HOKA 4RIXB 5CASA 5EH0A 2OWBA 4BCNA 3I79A 3HVCA 2X9EA 3TZ7A 4S31A 3D83A 3L8VA 3GEQA 3E3BX 5KZIA 4U3YA 4BDBA 2QC6A 3HKOA 3D15A 4FIFA 3DAKA 2QI8A 4C4JA 3BWJA 1MP8A 1UNLA 4IDVA 4AX8A 1CTPE 5FUTA 4DINA 2ITVA 3A60A 3NYVA 2YITA 3ERKA 1UU3A 5AIKA 3EN6A 1AGWA 1OM1A 5FTQA 5H8BA 3U8WA 4BCGA 1NA7A 5CEOA 4EOSA 1M2PA 3NIZA 3QXOA 5ETFA 3U6JA 2Q0BA 4X21A 2XNEA 4LI5A 2X7GA 3HV3A 2IVSA 4JX3A 4O7ZA 3KA0A 4R3CA 4YTIA 3KCFA 2EB2A 4YJOA 4F4PA 3QTSA 4USDA 3HRFA 5EQYA 4IXPA 3QWKA 3HMMA 3PXZA 5FDXA 1SNUA 3AC5A 4S2ZA 5EHYA 5LWMA 5IQEA 1VZOA 3RZFA 1QPEA 4K77A 4OLIA 4WOVA 5C01A 1L3RE 4HVSA 4FOCA 4DN5A 1KWPA 2C3JA 4GJ3A 2IW8A 4R5SA 2RG5A 2EWAA 2YM5A 2UW9A 3IGGA 5K4IA 4PMSA 5IQCA 4RA5A 4PNIA 3OTVA 5M4IA 4WD5A 4TWPA 5DBXA 5H8GA 4G16A 1J91A 2VTHA 1JKKA 3VRZA 3E8CA 2A2AA 4QP4A 3ZUTA 2CKOA 2XJ2A 2RG6A 4I92A 3QQFA 3FXWA 4YP8A 5J8IA 3F5PA 3PJ8A 4BCIA 4ZTRA 5E92A 4BRXA 3PG1A 3ORLA 2Z7SA 2JKOA 1WAKA 2OIDA 4U8ZA 5FEEA 4EHGA 3C13A 4B8LA 4ZSEA 1Q8YA 4J1RA 3FLZA 4IB3A 2WNTA 4LL5A 1DS5A 4IDTA 3F61A 3TZ9A 3H3CA 4R78A 3DV3A 2ZV7A 5HKMA 4X2KA 2ITWA 3R8LA 1R1WA 1U4DA 4WO5A 2Q83A 1IRKA 4UX9A 3NUUA 2QLUA 4J53A 2PZYA 4O7SA 4FTAA 1JBPE 2B9HA 1XH7A 4FV9A 5LVLA 4Q2AA 3VQHA 3OEFX 3EN5A 5C8MA 3MSSA 3D7ZA 4XV2A 4BB4A 2HZ0A 4EZ7A 4MD8E 4UMTA 2B54A 2GFSA 4ZMFA 2JIIA 2VO3A 3BZ3A 4DBNA 4C02A 2BAJA 1GIJA 5LJJA 3BEGA 4Y8DA 4FKLA 4EK4A 3VNTA 4WG4A 3C1XA 2C3KA 3JXWA 2WIHA 2YERA 3VO3A 3EL7A 4HCVA 4RMZA 4HPTE 3KXZA 3DKFA 4I4EA 5G1XA 2ITZA 3EFKA 4M13A 1BI7A 3LFNA 3RK9A 1OKZA 3DFCB 3AQVA 4XBUA 3RP9A 3LXPA 3TCPA 3VUGA 3JUHA 3R6XA 4BHNA 4C4GA 3W2CA 3L8PA 5AP5A 2QQ7A 3E93A 3MGYA 2RKUA 4B4LA 4O0TA 4C61A 4F9WA 5AUTA 4X3FA 1FOTA 4MF1A 3NRMA 4CQGA 3BGPA 3QKKA 4U97A 2CMWA 3A61A 5AR2A 4E3CA 1FBNA 3UC3A 4G3FA 3TI1A 2BCJA 4RWJA 2FH9A 3S00A 5CNNA 3ETAA 2XM9A 5CVGA 2C30A 4YU2A 5LVNA 3N4UA 2A19B 2X2MA 5CU6A 3LFSA 4NYEA 4D58A 4FNZA 2FSOX 2XNNA 1XJDA 2QG5A 2VTNA 3AC4A 4ASXA 4V0GA 4QP7A 4F9BA 4O7RA 1FVVA 5AX9A 3W2PA 4JR7A 2FYSA 4C38A 2REIA 4UWYA 4OGRA 5EYKA 3TEIA 5JQ5A 3F6XA 2OLCA 2XVDA 3SG9A 3R73A 4I5HA 5KHWA 4DITA 2YCRA 4M84A 3CSVA 2QHMA 2ONLA 1G8AA 1GJOA 3SXRA 3EQGA 3ALOA 4JDIA 2DS1A 4JQ7A 4LUDA 2DQ7X 3CTJA 1OI9A 4NJ3A 1Y91A 4X7QA 4RA4A 3EZRA 3NX8A 3QD3A 5H8EA 1OVEA 3FQEA 5CAUA 4OTQA 2HCKA 4S30A 3EN9A 4ZZMA 4KBAA 2JKQA 3QD4A 4G6LA 2YCSA 3EOCA 4BTMA 3PG3A 4CFMA 3C4CA 3F66A 4C4FA 4YJNA 1ZWSA 3NYNA 4FT5A 5ANEA 1CM8A 4LRMA 4P5ZA 1GNGA 4I20A 3B8QA 4AA0A 3V6SA 1Q8UA 2HOGA 3LFAA 2WTIA 4ZOGA 3PJ1A 3RM7A 4ACHA 2VU3A 4C3FA 3I6UA 3VQUA 4ZSAA 2VO7A 4W9WA 3PWYA 4IB1A 4E5WA 5HX6A 1A06A 2FA2A 3II5A 4BCJA 5D7AA 2BFYA 1XH5A 4QPMA 2P2HA 5AV0A 4EK3A 4JBPA 4ZSGA 3DT1A 3EKKA 4C7TA 3F7ZA 5KUPA 4FZ6A 3PE1A 1KE5A 3O7LB 5HICA 5JFXA 4DBXA 4DG3E 3BEAA 4DYMA 5JQ8A 1IR3A 1UWJA 4GUBA 5EI2A 4DGLC 3UPZA 3OBJA 4EH2A 5AUXA 2R5TA 5I5ZA 4YTCA 2AC3A 3AC1A 4P4CA 1O9UA 3U51A 3F2RA 4DH5A 3MY1A 2YIXA 2V7OA 3BV2A 3C51A 4F99A 3H4JA 3KXNA 3FE3A 4WRGA 4E4NA 3BYVA 3Q5ZA 1IEPA 2ZOQA 3AMAA 2A4LA 4C62A 1UKHA 2BRGA 2GDOA 3RAWA 1EH4A 4YURA 2BZIB 1YXSA 3C50A 4F63A 3AOXA 4L3JA 3IOPA 4YLLA 4RBLA 3CY2A 4TYEA 5ICPA 1YHSA 5KMMA 5DA3A 2Y9QA 5CTPA 4BKZA 1K9AA 3L9PA 4G3DA 1JSVA 1TQMA 2WELA 2Y6MA 1OIRA 3D5WA 3G5DA 4XX9A 5A3XA 4BZNA 4PPAA 1KV2A 4AN2A 1OPLA 4RIOA 1KOBA 2RFNA 4DG2E 4EH8A 2XIZA 3KXHA 5FBOA 3ZFXA 5AV4A 2QCSA 4J98A 1FPUA 4C57A 4GK2A 2IG7A 2JDVA 3BGQA 1NVQA 5KMKA 2GSFA 2OW3A 4XV3A 5AUZA 3KXMA 3G51A 3LXNA 2BVAA 3HMOA 3TM0A 5HBHA 4MBJA 3G90X 5FXSA 5EM5A 1T45A 2UZUE 3BRBA 5AX3A 2FSMX 3AXWA 3IECA 2WTKB 2G9XA 3NEWA 4FI1A 1TQIA 2O64A 2X39A 4F7LA 2YIRA 3HECA 5LMKA 5FG8A 1XHAA 4GVAA 3RAHA 5A46A 3MTFA 2J50A 4BL1A 4IEBA 3NNVA 1WCCA 3D7TA 4IW0A 5A54A 3BIZA 5DIAA 4APPA 4EYJA 3UNZA 3NYXA 4NTTA 5JH6A 4BI1A 3AGMA 1PYEA 5M51A 4YJSA 3IW4A 2IVTA 3PUPA 2Y8OA 3RJCA 5L3AA 3P9JA 4MXXA 3ORMA 4O86A 3COMA 2C6OA 5HG9A 3UZTA 4B6LA 4I0RA 1GZKA 2W1IA 4ASZA 3OMVA 1H1SA 3QCSA 3FLYA 4AT3A 4FBXA 5D10A 5B2MA 3SX9A 3TNQB 3BHTA 4D5HA 4FV0A 4EOKA 5GHVA 5M09A 4LGHA 3QRTA 4S34A 1OBGA 3AT3A 2P55A 4NFMA 5LWNA 4RG0A 5J9LA 4K2RA 1V0PA 3PJ2A 4I6FA 4DH1A 4FKTA 4F6WA 3KEXA 4AT5A 4CLJA 3VRYA 4ZTMA 2G2HA 5BVEA 3PLSA 4WG5A 5M4FA 2GQRA 2BRNA 2XKFA 3P7BA 3HP5A 4E26A 2WMBA 2HY0A 3VUDA 3ORIA 5HVKA 3E88A 2XBAA 5DH3A 3KULB 3PA5A 4M7IA 5J5SA 4ZAUA 3PPZA 1TQPA 4GKHA 4U81A 2R0IA 3QQGA 3QX2A 4R5YA 1YVJA 5CAOA 4IWDA 2BIKB 4TXCA 4ZXTA 3ZTXA 4AGWA 3UQCA 1CDKA 1GZOA 3M42A 4I1ZA 5JRQA 4PP9A 4ALWA 3AMYA 1XR1A 5C26A 2PVNA 4DGNA 2RFDA 4BGHA 1RE8A 2PMNX 4AW2A 3KFAA 5J95A 4BDEA 1RW8A 2QU6A 5IA4A 3VIDA 3PXKA 3WBLA 4IZ7A 1BX6A 4QP6A 4MWIA 1R39A 1PY5A 3DOGA 4I6BA 4RIWB 3QTXA 5FGKA 4A4OA 3PSDA 2XYNA 4ITHA 4V0GB 4FL2A 4U44A 3Q3BA 2XMYA 3FMDA 4KIKA 4OTGA 4O96A 3QRUA 3W10A 5KE0A 3Q4CA 1XBCA 1CKIA 4BTJA 2PVFA 4FGBA 3VBTA 1OIUA 3RWQA 1PXOA 4ANSA 1OL1A 1E1XA 4D4SA 1UA2A 4I6QA 4EOOA 1ZARA 3P86A 5CI6A 1IA8A 3SRVA 2WB8A 3OFMA 4FSNA 4AZWA 4PNKA 3TV7A 1H1RA 3CTQA 3DZQA 4TYIA 4O7TA 3AMBA 3D14A 4JX7A 2YA9A 3NGAA 5AP4A 4QMQA 3WF9A 2R3NA 5E8WA 2W1CA 3NNXA 3TKUA 4FKVA 2WTJA 3GB2A 4FIGA 2WTDA 4YO4A 5JN2A 4GUEA 5FXRA 4H39A 3UP7A 4DGOA 3BGZA 1K3AA 3A7IA 3BYMA 4PTGA 3HA6A 3DZOA 5BMSA 4BDCA 4IAYA 2GQGA 2WO6A 3OWJA 3V51A 3CPCA 3R7IA 1ZZLA 3AD4A 3AD5A 2CCIA 1HCLA 4O6EA 5CWZA 4ZS0A 3QC4A 4XMOA 4KS7A 5L8KA 2PVYA 4J99A 3R1QA 4FA2A 2I0YA 2ITOA 3F3ZA 1V0BA 3DFAA 3G6GA 4BTKA 3LLTA 3GP0A 4F9CA 4PQNA 3LPBA 1NVRA 3G9NA 3LXKA 5IQIA 4CG8A 3DXPA 2VN9A 2PUIA 3O51A 3R01A 3WZDA 3ZONA 3DGKA 4ZTLA 3NAYA 1RJBA 4Y5HA 1JOWB 5FEQA 3OWLA 3T3UA 3HDNA 4U7ZA 3WZJA 3QTZA 3WIKA 3GU7A 4JG8A 4CFUA 1QPCA 2OFUA 1GOLA 3KXGA 2OIQA 4FKOA 4Z55A 3MA6A 2J90A 5CANA 4CYJA 2VO6A 3F9NA 3ZO2A 1YI6A 2OXDA 3GVUA 4XJ0A 3HGKA 4U0IA 4BGGA 3JYAA 3K2LA 2UVXA 2VWIA 1UKIA 2C0TA 2YM7A 2BIYA 3V5QA 4YSMA 2VX3A 1OIYA 2X6DA 3WILA 3P08A 4M97A 3FUPA 3V5LA 3L8XA 5GZ8A 4RIYB 4FSWA 3DXQA 4OTFA 5IUGA 2WD1A 3GQLA 1V1KA 3TZ8A 4EOJA 3D2IA 4XG4A 4O0WA 3EQCA 2J0IA 2R3MA 4IM2A 4F6UA 2GNLA 4U42A 4EKKA 5FRIA 2R3LA 4RJ6A 5CS6A 4JDHA 1GAGA 4KRCA 1W98A 2I6LA 1R0PA 4LMNA 4BCOA 4TTHB 3NDMA 2CN5A 4J97A 4BDHA 5B2LA 4F6SA 2VTOA 4FTIA 3C0HA 5BMMA 5E9EA 3R2BA 5ETAA 4FV5A 4I5MA 4WNPA 2J51A 3GU4A 4DA5A 2FVDA 4XEYA 4B0GA 3MIAA 3LHJA 3VBWA 4LRJA 3ZFYA 5HX8A 5EM7A 4GYGA 4KBKA 3FSFA 1J3HA 3FKLA 5IQGA 4FTTA 4PPBA 4FEQA 4GG5A 4EC9A 4YC8A 3U4UA 5HOAA 5J79A 3EHAA 4Z9LA 5CENA 4D2VA 3AC8A 5E8SA 2EXMA 5CAVA 1YWNA 3LQ3A 1YWRA 3FYKX 4NKAA 4BTFA 4ZEGA 4WIHA 3CC6A 4USEA 2JKKA 3GCPA 3QTUA 5CXHA 3QKLA 1QMZA 3NIEA 3AT4A 3W18A 1M2QA 4RJ3A 3SOAA 3NLBA 3I6WA 3JVRA 4ALVA 4BDIA 4CYIA 3ACJA 5TT7A 3S4QA 2C5OA 4IADA 5KBQA 2OFVA 4R6VA 3BI6A 4MXYA 3V04A 3N4TA 2Y4IC 3LKMA 2R9SA 2I0VA 3BBWA 4FTKA 4DG0E 2XF0A 5CEQA 3PVUA 4CT1A 5HEZA 3VBQA 5I3RA 3HRCA 3UIUA 5L8LA 2YHVA 2YIYA 2HZIA 3UOLA 3LFFA 4UZHA 2ZMCA 2B1PA 2VNWA 5JMSA 3PDTA 3UG2A 3QQHA 2Z60A 5DVRA 3QALE 4A9YA 4Q5EA 2B7AA 4I5PA 5FM3A 4FODA 3TWJA 4AACA 5A6NA 5BVOA 3TKHA 3ZBFA 4YZBA 4C36A 4PDYA 4O38A 4QTCA 3DLZA 2IJMA 2JIVA 3MH2A 4JAIA 4BCHA 5FLFA 3QCQA 2Z7QA 5AA8A 1UV5A 2BAQA 3QCXA 3R9HA 4FKIA 3SV0A 4DLIA 4DH7A 3MFTA 5JZJA 3C4FA 4IX3A 2A1AB 5ANGA 2RGPA 3BWFA 3E62A 4E6QA 4ZLYA 1H00A 4WT6A 5HTCA 3BBTB 4DFXE 3OOGA 4TPTA 2G2IA 5IA5A 3RCDA 4CMUA 5KKRB 4ZS4A 3MVHA 3CKWA 1LP4A 4ZTSA 5CNOA 4D2TA 1ZMVA 3I5ZA 5CAQA 2C1AA 2WOTA 5HE3A 3RWPA 3D0EA 3TXOA 3NPCA 2WU7A 2ZB0A 4MXCA 2PE0A 2JD5A 2HWPA 4XNEA 4K8AA 1G8SA 4KKGA 4OTIA 4H3PA 2P4IA 3NW7A 4MNEA 4BI2A 3DTWA 2GS2A 4NKSA 2CJMA 3RMFA 1MUOA 2HW7A 5D41A 2ZB1A 3SA0A 2ESMA 5E90A 4J52A 3IOKA 5DMZA 4EOQA 3PA4A 3VWAA 3R8ZA 2PUPA 4MWHA 1NT2A 3VS2A 4XG8A 3FC1X 3UNJA 4RFMA 2JDOA 1DAYA 4ANQA 3VUKA 3TIYA 1W84A 3QTIA 2XP2A 3OF0A 1H4LA 2YAAA 4GG7A 4WG3A 1WZYA 3FHRA 1ND4A 5F4NA 4O0YA 3R30A 4NL0A 2O5KA 2HAKA 2UW8A 3MJ2A 3MFSA 3PY1A 3QUDA 4FUYA 2WMTA 4NW6A 3SVVA 2GU8A 4KSPA 3HUCA 2E9OA 2XB7A 5HTBA 4FVPA 2VTLA 3ZC6A 3QFVA 2O3PA 3ZBXA 3CR0A 4E73A 4KABA 4D4RA 4NSTA 3OT8A 4YGAA 3TNWA 3T8OA 4EQCA 2ETRA 2VTIA 3LQ8A 2VTMA 3DKGA 4FZFB 4DFZE 4DAWA 4YJQA 1LEZA 4IVBA 5E1EA 5FQDC 2RFSA 3EH9A 2W1DA 4QP1A 1REJA 5J7BA 2XK6A 4K0YA 2I0HA 2CPKE 4I24A 5BYLA 4X3FB 5DNRA 4D2PA 4GIIA 4V05A 4X6RA 5LMAA 2C47A 4A9SA 2X6EA 2F7EE 3ELJA 4HCTA 5AM6A 5I0BA 3MB7A 3S3IA 1M17A 1V0OA 4HYIA 2ITPA 4XYFA 4TWCA 4CV8A 1WMKA 5F95A 4MNEB 4EH9A 3LJ2A 5A6OA 5CSHA 3D5VA 3WARA 3P7AA 5CSXA 3KMMA 3PLAE 2PPQA 5F20A 3RPVA 1H0WA 4CVAA 5JKGA 5E4HA 2QOKA 2ITYA 2B55A 3BYSA 3VUTA 4QMMA 3Q6UA 1OIQA 5J1VA 4D28A 4RGJA 3O71A 4UZDA 4DGGA 2WZJA 1WVXA 3LZBA 3ORTA 4N70A 5EYDA 2VX1A 2ZM3A 3LE6A 4ZLZA 5A4QA 1Z9XA 5FD2A 2YZAA 4G31A 4QO9A 3IO7A 5AWMA 5C9CA 3IDCA 4KIPA 1DI9A 3KK8A 3FLSA 4MK0A 4YBJA 2WFYA 3DLSA 1ZYLA 4U40A 4WNOA 4JQEA 3QHRA 5ACKA 3BU3A 4CV9A 1FMOE 3UDBA 4B9DA 4EQMA 4JBVA 3V8SA 4QOXA 3SGCA 5CU2A 5EK7A 5IA0A 3EQIA 3FMEA 4W9XA 5CU4A 2NNWB 4YZ9A 3IW7A 2X8EA 4RVKA 2GHLA 4NM5A 1TVOA 4IB0A 4YZCA 3O2MA 5HHWA 3D94A 3QUEA 4CMOA 2ZM4A 4HVGA 2PYWA 1WFCA 2P33A 2P3GX 1WBSA 3OCGA 4RC3A 2JAVA 4P90A 3EQHA 4FSMA 3EYGA 3QF9A 3GOPA 4RJ4A 4GMYA 2IVUA 4G6NA 2OZAB 2UV2A 5L8JA 2WU6A 3WOWA 3OW4A 4LMUA 3QCYA 4YHTA 2R7IA 4BYIA 3T3VA 4R1VA 3TZMA 4W8DA 3P7CA 3NVKI 3Q9YA 2ITUA 3F69A 1RDQE 4OTWA 5HTIA 3BKBA 4QMVA 2Z7RA 1F0QA 1E9HA 4XP0A 2PZPA 1I09A 3LXLA 3QAME 5CY3A 4DLJA 5CSPA 3U55A 4DTKA 1K2PA 3PYYA 4RZVA 2XA4A 3JVSA 1P2AA 3EWHA 5EM6A 5HE0A 5DRDA 3DK3A 2BHHA 4DEAA 1XO2B 3R1YA 4CKJA 1I44A 2JDTA 3AGLA 3DJ7A 3LVPA 3ZMMA 4L8MA 5DN3A 3KVXA 4FV1A 4WHZA 3OBGA 1BMKA 3FI4A 1OMWA 4U3ZA 4FR4A 4L67A 5A4CA 3E7OA 2JBPA 3CD3A 2Y7JA 5AAEA 4CLIA 1YI3A 4GL9A 3ZFMA 5T68A 1J1BA 2O63A 4G34A 4AZSA 4AN9A 4ANMA 4XG7A 3NCGA 1FGIA 4MF0A 4XG3A 3R7OA 4L45A 5K4JA 3PWDA 4X2JA 2IW9A 3QZHA 4XHKB 2ZDTA 4O22A 4TYHB 3KN5A 2W7XA 4NM0A 4TY1A 1JNKA 3VS3A 4DC2A 5BX0A 4FTMA 3NAXA 3L9NA 3R00A 4D2SA 2IN6A 3R8UA 5D1JA 4FL3A 4JOAA 4UMQA 5AFVA 5M07A 5DT0A 4RVLA 2ZAZA 1AD5A 4NM3A 5EG3A 4BN1A 4CSVA 4O81A 4EZ5A 3FL4A 3CGFA 5FXQA 4GSBA 4EI4A 3DDPA 4LUEA 3BQCA 4ANOA 1M7QA 3R21A 3W32A 3FEGA 4D2WA 3OS3A 4ERWA 3OEZA 1R3CA 2X2KA 3MVJA 4HGSA 4N0SA 1U54B 1UU9A 1W8CA 5JGAA 3LM0A 2B53A 2PTKA 1APME 1YW2A 3DXNA 4EH3A 4CKIA 3VS0A 5IKWA 3UG1A 3ATSA 4QTEA 5H3QA 3QRKA 5IQFA 1PMUA 3CXWA 5IISA 1QL6A 2RF9A 3F3UA 4H3BA 3FPQA 3ZEWA 4XLIA 4BICA 5LVMA 3WF7A 3I0OA 4J7BA 3QA8A 4O21A 3HLLA 3KCKA 2PE2A 4HNFA 1XH6A 1H25A 1PXMA 3OUKA 4GK4A 3O23A 4Z7GA 5EYCA 3F3TA 3PSBA 4FSRA 5KZ0A 3DK6A 2CSNA 2WIPA 4NH1A 1Q61A 4FIJA 4KA3A 5DT3A 2HYYA 3E5AA 4HVHA 3HMIA 5M53A 3W8QA 1ATPE 5TR6A 1BLXA 5DWRA 2PVKA 2W5BA 4GK3A 2GS6A 4JG6A 4MX9A 4PMTA 4ZTHA 3W2QA 5KNJA 3ZUVA 2VWZA 3PZHA 3TKIA 1Y6AA 3GENA 4PPCA 4YC3A 2OKRA 4IIRA 1PKGA 2BZKB 3W8LA 5DLSA 2UW4A 2ITQA 3MB6A 3WZUA 4XCUA 3GQIA 1FGKA 3ITZA 3PXYA 2OZAA 2C6IA 2FSLX 5CVHA 3WE4A 4FV4A 4Y85A 4HCUA 3RK7A 3BQRA 4QMNA 3C0IA 4USFA 4F0GA 4OTRA 2BDFA 4LGGA 2JGZA 3Q4UA 4MQ1A 4QYEA 5AP7A 5IUHA 3THBA 3HV7A 3OXTA 4EZ3A 4PF4A 2HELA 2QOQA 4G6OA 3ZC5A 4AGCA 4YC6A 4BWPA 3KY2A 4NK9A 5CSVA 3R83A 4O83A 3DKCA 4MXAA 4OR5A 4I21A 4M69B 3QRIA 4FEVA 4O7LA 5E1SA 1Q3DA 4FEWA 1SNXA 5HIEA 3PVGA 3FY0A 1A48A 1WVYA 3EMGA 4IX6A 2HY81 4DFYA 4EK5A 5HNBA 3RINA 2O0UA 3KGAA 4ASEA 2BMCA 4FYNA 3F7WA 4QMOA 5JT2A 1O6KA 4FGRA 2YLEA 2V55A 5GZ9A 4ALUA 3HV5A 4JRVA 2SRCA 3BYUA 4XV9A 3SKCA 5I9VA 3P4KA 3M1SA 4O7YA 1BI8A 1XQZA 2WEVA 3E63A 2NP8A 4KNBA 3RHKA 5HLWA 4IFCA 2ZDUA 4BBEA 2BTRA 5A4LA 2UW7A 4RVMA 3R8MA 4LOPA 4EKLA 3MW1A 5DR9A 1MRUA 4KSQA 4CQEA 5FP6A 3Q60A 3PRFA 3PIYA 1OKYA 3P0MA 3RPYA 3KREA 4O7VA 4WUNA 4JQ8A 3ZYAA 4DH8A 1YRPA 3EFJA 4YJPA 3TNPC 1HCKA 2X9FA 3GCVA 2OZOA 4C37A 4O2PA 1W83A 4CFVA 3BPRA 3KRWA 3OG7A 4N6YA 4G9CA 4Z7HA 2GHGA 3O96A 3HMNA 5CQUA 2BZHB 1SZMA 2FSTX 4D1SA 4E6DA 4ENYA 2W1HA 2WPAA 3QYZA 4NIFB 4G2FA 1DI8A 3MFRA 3D4QA 3VC4A 3GT8A 3TG1A 2Z7LA 4FVRA 4XOYA 2XRUA 5B2KA 5CEIA 3B2TA 4UWBA 3NSZA 3IK3A 5CYIA 4U43A 4FG7A 4R7IA 4PMMA 2C6MA 2IVVA 3W33A 4IVDA 3LMHA 2W17A 3DA6A 4RT7A 3FC2A 5CEMA 4EJNA 4ZIMA 2ONLC 3IONA 4BKYA 4GT4A 3OC1A 3OXZA 4XG2A 2HZNA 4QQ5A 4OAVB 4RX7A 5AEPA 1OL2A 2OF4A 5DT4A 4A4XA 4DFBA 2YDKA 4O0VA 5ITAA 1H27A 1OL6A 3IQ7A 3UVRA 1MRYA 4M15A 4ID7A 3UQFA 5GINE 1LR4A 2OXYA 3LCKA 3ZUUA 4LRKA 3DBFA 2ZM1A 3NCZA 2HXLA 2WTKC 4LV5A 4C4EA 2IWIA 2J0JA 2A0CX 3PPJA 2PVRA 4EH4A 1KSWA 1H1QA 4RJ7A 1OL5A 2AYPA 4IAZA 5CAPA 2ZMDA 3EZVA 3ZM4A 5JEBA 4UY9A 4YPSA 3SAYA 4IMYA 3RBWA 3GNIB 3HMPA 2H96A 2PU8A 2WMVA 3VUIA 4KKEA 2QOFA 4BBMA 4PP7A 1MQBA 2JLDA 2YAKA 2VNYA 4RIXA 2YWPA 2BFXA 3V5JA 1VEBA 4FF8A 5KHXA 3U54A 4HJOA 3KVWA 3F2AA 3GXLA 3LM5A 4U45A 4XBRA 4HPUE 4YZNA 3MDYA 3OWPA 4I5CA 3V3VA 3BHHA 4C4HA 2GTMA 2C5NA 5I9WA 3O17A 2YWVA 1YQJA 4I93A 4FK6A 4XG9A 3SW7A 4EH5A 4F1MA 2V0DA 4O7WA 4E93A 3A7JA 4G17A 3DAEA 4FTCA 5A9UA 1O6LA 5AR5A 4RZWA 4JL9A 2I0EA 4XV1A 3DKOA 3R8PA 2W5HA 3TV6A 4F1OA 1KV1A 3U9NA 4FVQA 3TT0A 4F08A 2EUFB 4L00A 1JQHA 4PL4A 5HG5A 5K0KA 4DHFA 4FV8A 4YLJA 4TWNA 4EHVA 2IZRA 4HVDA 3V5TA 1OGUA 1OPJA 2J0LA 2FB8A 5KMNA 2C68A
chains in the Genus database with same CATH superfamily
3W16A 4FSQA 3DS6A 2XNBA 3KRRA 3POZA 3DBEA 2OK1A 3RALA 3M11A 4IX5A 2Y4IB 4N4SA 4NCTA 3SDJA 3ZZWA 2WXVA 4LDTA 5K0XA 3C4EA 2XNPA 4M8TA 4MKCA 2OJIA 2HXQA 3KXXA 4YJRA 2I1MA 2VTAA 5L2QA 3HV6A 2EVAA 1J7IA 1PXKA 4CCBA 1B6CB 3OY1A 3TUBA 4A7CA 4N57A 3QX4A 2CNVA 2W1EA 1ZY4A 4JLCA 2V7AA 5AUWA 5BVWA 3VBYA 3PXFA 3HV4A 3VJOA 2OICA 4FT7A 5HBJA 4KIKB 1PXPA 2YN8A 3PVWA 4GT5A 3ZSHA 2HZ4A 4G3CA 5L2TA 3DB6A 5D11A 3A7GA 2HWOA 4AAYA 1GIIA 2YLFA 1JKSA 3QBNA 3DNEA 4ZJVA 3FLQA 4RIWA 4II5A 2OJGA 4ZP5A 4TKSA 1XMMA 1SM2A 4K18A 4X2GA 4RVTA 1PJKA 1YOMA 4M69A 3TUDA 2W99B 2F7ZE 3CQWA 4CNHA 2GMXA 4RWLA 3BHUA 4O4FA 2VTSA 4OBQA 2PMIA 4X2NA 4XLVA 5FTOA 3HZTA 5EFQA 3EQDA 4EQUA 2X1NA 2OI4X 4AT4A 3R7YA 5BUIA 4GS6A 1KE9A 4ZLOA 4A06A 2GNHA 3CCNA 1STCE 1M52A 3UTOA 4BR3A 3DBDA 3AG9A 3QD0A 4R3PA 3ULZA 1YXUA 3O0GA 4JDJA 3Q96A 1VYWA 3GFEA 2R2PA 5IZFA 5J1WA 3UDTA 2XKDA 4RJ8A 5C4KA 2XS0A 3O7LD 3ORXA 1UNHA 4FV2A 5B7VA 5L6OA 3FI8A 4JMQA 2O8YA 2R3OA 4ZZNA 1CSNA 5JFSA 1PW2A 2PWLA 3B8RA 4FTJA 3ZU7A 5CF5A 2BAKA 1TZDA 4BDFA 2PZ5A 3H30A 3OVVA 3QA0A 2OO8X 3ACKA 3CTHA 3O8PA 4MD7E 4BFMA 4QT1A 4DEBA 3EB0A 1XH8A 4QP8A 4U6RA 4C8BA 3D9VA 3W0PA 1IAHA 3I4BA 3A4PA 3AC2A 3GCUA 3TN8A 2I7QA 2W1ZA 3AC3A 5HBEA 3UC4A 4MUQA 1VR2A 3L9LA 3V5WA 3I81A 4D1XA 1YHVA 4MAOA 3V8TA 2XK9A 1F3MC 4XH6A 4F1TA 2BUJA 4ACCA 1MQ4A 3D2KA 4QMTA 4QD6A 2VZ6A 3U6IA 4HGEA 5AR3A 3PJ3A 2QKRA 3P79A 3ENMA 2QO7A 2R3IA 4Q9SA 4XRLA 5ANKA 2UZVA 2UZEA 3N9XA 2ITXA 4MYGA 3ZEPA 4UMRA 4HW7A 1IG1A 5CT0A 1P4OA 5HNIX 3QZGA 2W1FA 3VBXA 5E8ZA 1DM2A 4C2WA 1JAMA 2LGCA 2R3FA 2UW6A 4JBQA 4IZ5A 3ROYA 4BKJA 2GCDA 4U79A 3Q4TA 4Z16A 5GIOE 4FZDB 3U4WA 3A7FA 4FSTA 4FKRA 4QMWA 1CKJA 5AV2A 2YJRA 3BV3A 4FTQA 2GFCA 4J95A 4RPVA 4QYYA 3ZRMA 2BILB 1H07A 3LCDA 3NR9A 1NY3A 2C0OA 3HA8A 4MH7A 4H1JA 5I4NA 4NIFA 1Q5KA 4AP7A 1W2DA 2CLXA 5F1ZA 5A14A 1LPUA 3G0FA 1PHKA 3FYJX 4QP9A 5HIBA 2G01A 4IWPA 5IEYA 5CU3A 3RVGA 3KKVA 3SHEA 5H9BA 2OBJA 3O5AA 3QTQA 1LUFA 2R0UA 3KF4A 4MCVA 4BI0A 3GBZA 3K5VA 5E8VA 4EHEA 3FBVA 2VWYA 1WBTA 3CPBA 3VVHA 3ZLYA 4A4LA 1SVEA 3EFWA 1OZ1A 3KRLA 4D9UA 2R3HA 1UVRA 3TTIA 4QQCA 4LYNA 4I3ZA 1JSTA 2WMXA 4AAAA 4DTBA 2OGVA 4RIYA 4PDOA 2J2IB 5HE1A 5DG5A 2WHBA 4XG6A 4G3EA 5DGZA 5TO8A 2VUWA 3FI2A 4WA9A 3C9WA 4C35A 3HYHA 4IFGA 4BWXA 1ZMUA 3FQSA 3IW5A 4MXZA 4F0IA 3NVMB 1KE8A 4NTSA 5HQ0A 4C3RA 4GV1A 1ZXEA 2Q0NA 1O6YA 3QTRA 3R7EA 5TKDA 2P2IA 3GC7A 3FMLA 3LJ0A 4CMTA 2VWXA 4O7NA 3DCVA 4TYGA 3R04A 5HCYA 4X0MA 4FT3A 3CJGA 2OF2A 4RX5A 5HG8A 3VS5A 3RTPA 2OU7A 1M7NA 4YBKA 5JSMA 2W0JA 3Q6WA 2DWBA 3QL8A 1R0EA 1YOLA 4AA5A 4FT0A 2JIUA 3LFQA 2AEGA 1PXNA 3R7VA 4NJDA 3QUPA 3ENHA 1OBDA 3PTGA 4ZY6A 4GKIA 1UWHA 4ZSJA 3GCQA 2R3JA 2WMUA 5KBRA 4UYAA 4IX4A 3SXFA 2HENA 2E9NA 4BIEA 1KUTA 3UZRA 4OBPA 4AGDA 1YXVA 5CF8A 2WMRA 4Y73A 2IZSA 1NXKA 3FMMA 3I0QA 4IVCA 2I40A 4A07A 4DT9A 1PRYA 2NRUA 5LCKA 3ANRA 3QRJA 3LFDA 2HK5A 2WTWA 5M56A 2YISA 2G1TA 2W05A 4FE2A 3LAUA 1H0VA 5CEKA 4QMXA 4S33A 4IZAA 2YCQA 2RFEA 2UZLA 2J5EA 5AJQA 3GUBA 4QTAA 4AG8A 5GIPE 4L52A 4F7SA 3S95A 3KF7A 4KD1A 4K1BA 2QOHA 4RC4A 2PVJA 1H1PA 4NU1A 3R9OA 5L2WA 1FQ1B 2XCHA 5D7VA 2F7XE 3DDQA 4LGDA 5EM8A 3EFLA 1ZZ2A 3RCJA 4G9RA 4DT8A 4UEUA 4BCMA 1CKPA 3NWWA 2F49A 2C3IB 2H9VA 5CF6A 3HAMA 1OKWA 4YO6A 3QGYA 4UBAA 3U6HA 4E5AX 2VWWA 3I1AA 3IW8A 4AXCA 4QYFA 4FTRA 2VRXA 3FAAA 1XKKA 3T9TA 3OTUA 4GW8A 5F9EA 5KO1A 3DK7A 1IA9A 1JKLA 4W4VA 3SXSA 2CGVA 1IAJA 5IQDA 5T3QA 4ZSLA 5C8NA 4FICA 1XBBA 4JG7A 5CZIA 4BCKA 4DFNA 5GZAA 5IU2A 4CFWA 3C5IA 4IB5A 3EIDA 3RK5A 4EWQA 4NFNA 3SW4A 4BZDA 1XWSA 2VTPA 5HCZA 3LFBA 3C5UA 3OHTA 3OW3A 2YM3A 2QVSE 3Q53A 4AE6A 4FC0A 3MY5A 2OJFE 4FTOA 3C4ZA 2H34A 5E91A 5DOSA 4ZTQA 3KIOC 4UMPA 4W8EA 1TKIA 2Y4PA 4UXQA 5DRBA 3PXRA 2PUUA 4FIIA 3P78A 4KWPA 2BRBA 3WF8A 5J7HA 3FY2A 4FKWA 3NNWA 2R4BA 4IH8A 4KS8A 3FI3A 4MHAA 3IG7A 3TNHA 4A9TA 3NUSA 4AZFA 3MVLA 5AADA 2XZSA 5K5NA 3PP0A 2UZDA 3FV8A 4KB8A 3TACA 4ERKA 2UW0A 4JAJA 5FM2A 3KULA 3M2WA 4I94A 2YACA 1Q4LA 4BC6A 5IQBA 3EN7A 4I22A 3RM6A 1JKTA 3T9IA 3S0OA 3ALNA 3LMGA 1Y8GA 4RRVA 2W1GA 4DEHA 1PXLA 4ZK5A 2C5YA 3PY0A 4GYIA 4JDKA 4KAOA 4TYJA 4ANLA 2UZTA 5HIDA 5C1QB 4U5JA 2ACXA 4GEOA 4J8NA 2VV9A 3E3PA 4AOIA 3VAPA 2WKMA 2DUVA 2IO6A 3MBLA 4M3QA 2X81A 1Z5MA 2W9FB 5K3YA 5TF9A 4CRLA 4P5QA 4FG9A 3BLHA 3I60A 2YIQA 4FL1A 3VHKA 4EONA 3SD0A 4DEEA 4NUSA 4CFFA 4V01A 1Q62A 3VN9A 4BCPA 5L2IA 4BDAA 4ONAA 2QNJA 4R3RA 2CHLA 3LFCA 4C0TA 4F9YA 3JR1A 5AUUA 2PL0A 1NVSA 4G3GA 4I6HA 4R7HA 4MBIA 2J5FA 4PV0A 5B0XA 5LCJA 4H1MA 4FZAB 1ZYDA 4O2ZA 3AT2A 2CNUA 3F5XA 4IAKA 4NEUA 4ACMA 5JK3A 2BKKA 4IM0A 4C4IA 4WKQA 3MS9A 4BVUA 5JFVA 3QKMA 2R64A 5HCXA 3L1SA 4E20A 3DU8A 4FV6A 3QD2B 2ZV9A 4FNYA 1OKVA 3GC0A 4JVGA 4KIQA 2H8HA 4IE9A 4AW1A 2W06A 4Y5QA 2J7TA 5AP0A 5L4QA 4RJ5A 4M14A 4QPSA 1IASA 3RPRA 3UODA 2PUNA 1LEWA 2IW6A 1ST4A 2X4FA 3B2WA 3PE2A 3V01A 5IDPA 2Z2WA 3VW8A 2E9VA 5M4UA 3BX5A 5KCVA 1GIHA 2GPHA 3O50A 4FT9A 5E7RA 4F9AA 5HVYA 4D2RA 4AFJA 2ERZE 2V22A 5DR6A 1Z57A 3PFQA 4BY9E 3W1FA 2UZBA 1W7HA 2JKMA 1OB3A 2X8DA 3E87A 3P1AA 4MD9E 3ZHPC 5IQHA 5EYMA 3MWUA 3VUHA 5IMEA 2WMWA 5DR2A 3WF5A 4KRDA 3WYYA 4D4YA 4O1PA 2J0KA 5CSWA 3CS9A 3QU0A 2YJSA 4UWCA 3HEGA 3ANQA 3PUFC 3P5KA 4UALA 3VF8A 2UUEA 4CD0A 4BBFA 5LMBA 5EQEA 2CN8A 3HAVA 2PZRA 4OTHA 2A27A 2VGPA 5C8KA 2R3KA 2B4SB 2R3PA 3TUCA 3ROCA 4I6LA 4DFUA 4GU9A 2BDWA 4FYOA 5GJDA 5IUIA 4RWKA 3OXIA 1URCA 3HNGA 3PP1A 4J71A 1OPKA 1NW1A 4BZOA 4L01A 3ATTA 3ZOSA 5EW3A 1J1CA 3KB7A 2UVZA 2W4KA 3ORZA 2C6TA 3UJGA 3DBCA 5HZNA 4APCA 3UZPA 1FVTA 3BLRA 3UO4A 4GFGA 4L44A 5EDPA 5BPYA 4U41A 3GU6A 5CLPA 1Q8ZA 5LMKC 4QP3A 5HG7A 4Q9ZA 3A7HA 2XH5A 5HLPA 3F5UA 2C3LA 4GFOA 4TRLA 4QMSA 1GZNA 4FKPA 4IANA 4TYHA 2OXXA 2J9MA 5E8XA 2ZJWA 2CCHA 4WRSA 5L6PA 5GJGA 3DQWA 4FKGA 3UO6A 4CKRA 4ANBA 2X2LA 5BUEA 2XARA 1KE6A 5BYZA 4G5PA 4FTNA 3TDVA 1ZLTA 2E9PA 5AV3A 2BR1A 4F0FA 1U5RA 3VULA 4IHPA 2BTSA 2PMOX 1QPDA 2R3QA 3G0EA 5DEYA 2J6MA 2XKEA 4PL3A 2R7BA 4YZNA 2XIYA 4O0UA 4KINA 1P5EA 2QLQA 3NUYA 1YHWA 3QZIA 2Z8CA 3K3JA 4L3LA 2J0MB 4O0SA 3AD6A 4DHIB 3ZO1A 3QQUA 2PVMA 2YDIA 3FLNC 4QTDA 2YZLA 5D9HA 3CBLA 2FGIA 2VTQA 2NRYA 5BQ0A 3IDPA 3ZSIA 3FPMA 3NUAA 4ASDA 3KU2A 1YXXA 2C6LA 3EQPA 3FZ1A 1W0XC 4TNDA 3K3IA 5G6VA 5DPVA 5JGBA 4D1ZA 2F2UA 4C2VA 4LV8A 4BCFA 4C33A 2YABA 4FUXA 2ITNA 1U59A 3R9DA 1Y6BA 4HGTA 5A4TA 5LQFA 2VWVA 4AN3A 1Q41A 3QLGA 5HESA 5BNJA 4F7NA 1ZOHA 4LL0A 2HW6A 2QONA 3MH1A 5DFPA 1PXIA 4O1OA 1H24A 4PMPA 3RAIA 2XJ1A 3Q5IA 2GNGA 3BE9A 1FINA 2X7OA 4L9IA 4DE4A 3SLSA 3FKOA 5EI8A 4QPAA 4NW5A 3ZS5A 3FXZA 2YEXA 4EJ7A 5M55A 3NZ0A 4Y46A 3MIYA 3K54A 2JFMA 3UMXA 3W2OA 4D9TA 4P7EA 1S9JA 2X8IA 4IJ9A 3SRVB 3S2PA 3VJNA 1WBPA 4EEVA 4MEDA 4RLLA 1A9UA 3PSCA 3FL5A 4GRBA 3ZRKA 4TZRA 4X6QC 4L53A 4IZYA 4YHFA 3VUMA 3PJCA 4IM3A 5IH5A 5EDRA 2WQNA 2C0IA 5IH6A 5KMIA 3C4WA 3R2YA 3BE2A 4A9RA 3REPA 3EQRA 3A2CA 3H9RA 3G33A 3HUBA 3POOA 1WBWA 4YJTA 4CT2A 4DDIA 2P0CA 2KTYA 1GZ8A 4IQ6A 3TIZA 3D5UA 4X2FA 2R3RA 4F09A 1YDRE 3SQQA 2ZV8A 4ORKA 3A8XA 4AW5A 4JIKA 2BZJA 3GU5A 3UVQA 4W4WA 3VF9A 1BKXA 4EOLA 2PVLA 3HL7A 4AXAA 2G15A 3CJFA 4GT3A 2GS7A 2UW5A 3GCSA 4YJUA 3F3WA 3I5NA 3ODZX 3UOKA 4W4YA 3TNIA 4LOQA 4YPDA 3NS9A 4NT4A 5C03A 2JEDA 4Y95A 3RI1A 4BDJA 5ANIA 3V8WA 3OROA 5FDPA 4YLKA 4FKSA 1WBOA 4MTAA 4E8AA 4QRCA 4R7BA 3PIZA 3AKLA 4WNKA 2XKCA 4PDPA 4XP2A 4D0XA 2YM8A 2WQOA 2XCKA 1WVWA 2G2FA 3D5XA 3U87A 3UYTA 4CTCA 3BYOA 4PY1A 4EK6A 4U80A 3QC9A 5M57A 2CGWA 3RAKA 4WBBB 4EBVA 5I3OA 1H08A 2C5VA 2QHNA 3NW5A 3MI9A 4X3JA 4UV0A 1RQQA 3DTCA 5KMLA 3CY3A 3H0ZA 1MRVA 5DI1A 4FJVA 1PF8A 4YZMA 3R28A 3TV4A 5J9ZA 2QR8A 1YXTA 3W2RA 3ZO4A 4EL9A 2GNIA 5EI6A 4PX6A 2X4ZA 4H58A 1OUYA 3K5UA 4LM5A 3UIBA 4ZY4A 4EC8A 2BPMA 1SMHA 4YR8A 3MESA 4CZUA 4I23A 3EQFA 3ZDIA 2C6KA 3TJDA 3WF6A 4YSJA 1F5QA 2WMQA 3MPMA 4EYMA 2R3GA 1YWVA 3LQ5A 4L6QA 5HU3A 3DB8A 3ID6C 2YM6A 4EH6A 2YDJA 3RPSA 5JFWA 3E8EA 4E5BA 3VONA 1P4FA 2OJJA 3OD6X 1OECA 4N6ZA 2PMLX 3QTWA 4IAIA 1SYKA 4UMUA 3FLWA 4AW0A 3P23A 3MPTA 1BL6A 3O8UA 5JGDA 2C1BA 3JY9A 1FVRA 4B8MA 3RKBA 1DAWA 1ERKA 3NNUA 4FSUA 2VWUA 2WTCA 2WGJA 1U5QA 1ZYCA 2QODA 4E1ZA 4FOBA 4EHZA 2XUUA 3FMKA 3HDMA 3PZEA 4YTHA 1XBAA 5EKNA 4UYNA 3U9CA 4YZDA 5HD4A 4OBOA 3NUPA 4AGUA 2EB3A 4S32A 4QMYA 5CX9A 5BV3A 3PVBA 5C4LA 3A99A 2B52A 3GOKA 3R63A 4NCTC 3WIGA 2Y6OA 4BIBA 4GU6A 5IDNA 2UZWE 1BUHA 2BALA 2QO2A 3A8WA 2NO3A 3FZPA 4YJVA 5AMNA 5TOZA 4EOPA 4HVIA 5HO7A 2XIXA 4MNFA 2QD9A 4QTBA 3Q2JA 3CP9A 2W96B 3BHVA 2VX0A 3ZLXA 2VD5A 3ZO3A 5AAGA 1S9IA 2PULA 1Q3WA 1JSUA 4GIHA 3LW0A 4J8MA 4AA4A 3BCEA 1JWHA 3SOCA 4E6CA 4FV3A 4DCAA 3LFEA 1QPJA 3KC3A 4L7FA 4DF3A 3NUNA 4M67A 2OH4A 3LLAA 3R7UA 4KUJA 5EOBA 3F5GA 3R8VA 3UIXA 4J96A 3FZOA 4C34A 4E6AA 2XEYA 1Q24A 3UO5A 2BROA 4V04A 5FWKK 3IPHA 2CGUA 4MQ2A 5E8TA 2XK8A 1Q99A 2KULA 2QOCA 3TL8A 4F70A 4F78A 4C58A 4EOMA 5EKOA 5ANJA 3DNDA 1PMEA 5A4EA 3VHEA 4HZRA 2PZIA 4PUZA 4R8QA 1TFFA 4FSZA 2WQBA 4FMQA 5AUYA 3ZXTA 3PXQA 4W4XA 4QMUA 3KQ7A 3PPKA 5HLNA 2VO0A 4BWKA 4F64A 1REKA 3EQBA 2WMAA 4OAUC 4JRNA 4FEUA 4CG9A 2CNQA 4DTAA 4ANNA 4YTFA 3GC8A 4FEXA 2C5XA 3R1SA 1AQ1A 4BDKA 2IZUA 3CKXA 3UVPA 2B0QA 1H1WA 4JBOA 2JFLA 4FK3A 2AUHA 2QU5A 3FMNA 3HRBA 5CI7A 5I9ZA 5IEXA 1YOJA 2W4OA 3UIMA 3TJCA 2FUMA 3CGOA 3OZ6A 4IBMA 2JBOA 3DQXA 4F7JA 3FJQE 2C4GA 4CZYB 3FHIA 4WBOA 4JXFA 4M66A 2NYAA 4YNEA 1ZAOA 4HZSA 2RSVA 3LIJA 5IQAA 4AU8A 1OL7A 4RX9A 3KK9A 3I7BA 2CKQA 2JITA 4XP3A 4XS2A 1CMKE 3R7GA 5M08A 1H26A 5AP3A 5LOHA 5EHLA 3RHXA 4QMLA 4WSYA 4BDDA 4IACA 4IJPA 4EWHA 2ZYBA 3QXPA 4JT3A 1U46A 5I9UA 5ANDA 3V6RA 5K5XA 3UPXA 3C4XA 4L7SA 1UU8A 3VW6A 4A9UA 3E64A 1KOAA 4Y83A 4L68A 4XOZA 3ULIA 4E4LA 3H9OA 3HP2A 3ZH8A 1G8KA 3EKNA 3VS7A 5CXZA 4D55A 1VJYA 2QKWB 3O8TA 3QGWA 3PFYA 4FSYA 4PWNA 4O84A 3BHYA 5AP1A 1XH9A 3QQKA 4OTDA 4K11A 4CFXA 2PSQA 4TW9A 4OTPA 2UZOA 2BKZA 3DY7A 4QNYA 5HI2A 4FX3A 2Z02A 3ZXZA 2GNJA 4FKJA 3MTLA 3QQJA 3PRIA 4DEGA 1YDTE 2E2BA 3R02A 3KRXA 3KL8A 4CTBA 5AP2A 4ENXA 4I4FA 3PY3A 1M2RA 3FWQA 2WQMA 3ODYX 5CALA 5ANOA 2GQSA 2XNMA 3FZRA 3FMJA 4U9AA 5DHJA 4EUTA 1BYGA 5EHOA 5KX8A 3MN3A 3VS1A 2WMSA 3UBDA 1M14A 4FIEA 3H9FA 2XNGA 5HU9A 5IEVA 3F3VA 2OSCA 3F88A 3QQLA 5CEPA 5EW8A 3UGCA 1YDSE 4D0WA 3BU6A 5KKRC 3RGFA 4ZJIA 5J9YA 2QO9A 3IDBA 2UZNA 5HO6A 3NMUF 4ZY5A 3FZTA 2XAMA 2XIKA 3ZCLA 2XJ0A 3Q9ZA 4XRJA 1L8TA 3NYOA 5EQPA 3C0GA 4PL5A 3I7CA 3L9MA 5CQWA 4AE9A 4EK8A 3SG8A 4BIDA 1SVGA 5AR8A 4L46A 2ETMA 4I0TA 4DFLA 3E8NA 3LCTA 3Q9XA 2QOIA 5HD7A 3DPKA 3MJ1A 1UNGA 1YI4A 3GGFA 4QNAA 1ZRZA 3DBQA 4HYSA 4QP2A 4TNBA 5M44A 2BHEA 4AWIA 5BVDA 4GCJA 1ZOEA 1G3NA 4HNIA 4M0YA 4RLKA 4NWMA 4JI9A 4CCUA 3SC1A 4GJ2A 4O0XA 3N4VA 4R1YA 3OWKA 4EOIA 3COIA 4YUQA 4K6ZA 2O2UA 4I0SA 3V5PA 2XYUA 2XNOA 3FXXA 4LOOA 4BYJA 2B9JA 3ZSGA 2B9FA 4C3PA 3ZLWA 5AV1A 5LVOA 3QYWA 2XIRA 4QYHA 2PY3A 5BVKA 3IS5A 3QWJA 4OUCA 3MVMA 3UOHA 4AQCA 3H0YA 2OH0E 1E1VA 2IPXA 3A4OX 2XM8A 3EL8A 2W4JA 1Y57A 3IGOA 2F2CB 2NPQA 4O27B 5E8YA 2OG8A 3LCSA 2F4JA 2CGXA 4H36A 1ZY5A 5FEDA 4PTEA 5FP5A 5CU0A 5EOLA 4FTUA 2XBJA 4YNOA 4FG8A 5IF1A 4ITJA 4QMPA 2XK7A 3CQUA 1H28A 4DEIA 1PMNA 2H6DA 3RPOA 3ET7A 5JRSA 2WAJA 4EUUA 4D4VA 3KMUA 4IAAA 2YM4A 2EU9A 2YFXA 4O4EA 5HGIA 4TL0A 5KMOA 4LV7A 3N51A 4KBCA 5IA2A 4EORA 4L3PA 4JIAA 4H05A 4UN0C 2QG7A 5I9XA 1SVHA 4AOJA 3UNKA 3G2FA 4WUAA 4IC8A 5F94A 4FKUA 4QYGA 4L42A 2HIWA 5CT7A 3W0OA 5K9IA 4XUFA 3Q9WA 2WOUA 5EW9A 2PVHA 3EJ1A 5AIRA 1J7LA 1W82A 3CIKA 4LFIA 4BF2A 1ST0A 1B38A 3JY0A 2CKEA 1Y8YA 2RL5A 2VTTA 3TTJA 3IW6A 4UB7A 4PRJA 3VS6A 3ZLSA 4EBWA 5LARA 4B99A 3MPAA 4FKQA 4JS8A 5HORA 4JR3A 4KIOA 2AC5A 4D5KA 4RWIA 3C7QA 5J5TA 2OJ9A 5CZHA 2QURA 5FBNC 4RC2A 4TN6A 2ITTA 4CRSA 4E7WA 2J4ZA 3F2NA 2EXEA 1R78A 2OIBA 3GFWA 1JPAA 1URWA 5AR4A 3WI6A 3IKAA 3OUNB 4E4XA 4ACGA 3COKA 4WSQA 1QCFA 2WQEA 5CF4A 5CVFA 5AM7A 3UOJA 4JNWA 2W5AA 1PXJA 5DEWA 1YKRA 4OT5A 3BELA 2X7FA 5DYJA 5IMXA 4AUAA 4B7TA 5AA9A 2WTVA 2ZVAA 3WYXA 2XK4A 5BUJA 4LG4A 4X3FC 1JVPP 4Z3VA 2V5QA 3GI3A 3JS2A 3MY0A 2UW3A 3ZRLA 3GU8A 3WE8A 2V62A 4QQJA 2JDRA 3VS4A 1PMVA 3MV5A 3A62A 2C6EA 3ORPA 5LVPA 2VWBA 4FZ7A 3DJ6A 3EYHA 3G15A 3H10A 4DDGA 4GFMA 4KKHA 4RFZA 4CZTA 5IH4A 3LMIA 5ETIA 5FTGA 3QZFA 2CDZA 3OCSA 3JPVA 4G1WA 4M68A 5EDQA 5T6KA 4PDSA 2Y0AA 4E4MA 4RX8A 4GH2A 1PYXA 1W2FA 3G9LX 5GNKA 3RZBA 2CLQA 4I41A 4OW8A 2DYLA 3PA3A 4FTLA 5HO8A 2YCFA 4BHZA 2LAVA 4RQKA 5L2SA 5HE2A 4L43A 5I9YA 4DCEA 2JDSA 3KRJA 3R9RA 2F9GA 1Q8TA 5IA3A 3OP5A 3Q04A 3MH3A 3D7TB 4K9YA 3FKNA 4PTCA 5C27A 3WZEA 1ZYJA 1VYZA 4CGAA 4DEDA 1FMKA 3S1HA 3UQGA 1H01A 3LCOA 3LJ1A 4AFEA 2XANA 3R71A 4RSSA 2IEWA 2PE1A 2PK9A 3BLQA 4BDGA 2XK3A 2VTRA 4P2KA 4O0RA 2QOBA 5HVJA 2FO0A 4AF3A 3WZKA 3F82A 2PHKA 3GC9A 2VTJA 4H3QA 5HNGA 4IWOA 4IVAA 3TDWA 5L6WL 4NZWB 2JC6A 5M4CA 4UXLA 3Q52A 2VAGA 4ZMEA 2ERKA 3FQHA 5BYYA 1H8FA 2XEZA 2ZV2A 2F57A 5ACBC 5IG1A 5IA1A 4AZVA 3VBVA 3MYGA 1OGYA 1G5SA 5JZNA 3FMHA 3L8SA 3ZZEA 4BCQA 3QHWA 4O6LA 2C69A 3Q32A 4RQVA 4O91A 4ARKA 4C59A 1BL7A 3CQEA 5IPJA 3FZSA 5DE2A 4EH7A 1KE7A 4ZTNA 3LOKA 3E8DA 4K33A 4AS0A 3UDSA 5AAFA 4FIHA 5D12A 2WEIA 3W55A 5AR7A 3COHA 3CD8A 4Q5HA 3UYSA 2VGOA 4CFNA 1Q97A 3MH0A 2YIWA 2RIOA 4GVJA 4IC7A 3PIXA 5BVFA 3ZDUA 2QOOA 2X0GA 2BRHA 4ACDA 4DH3A 1WBVA 1B39A 4ITIA 2EXCX 2BRMA 1T46A 3OT3A 4IAFA 2O65A 5AUVA 5GJFA 4QQTA 3UP2A 4YHJA 2CKPA 2E9UA 4MBLA 4FV7A 2QOLA 5M06A 4RFYA 4HGLA 2ETKA 1ZOGA 3BU5A 4AOTA 4WNMA 4CXAA 4FNWA 3OCBA 4QMZA 5BVNA 3G6HA 3RNIA 5LXMA 3CEKA 3OCTA 3FSKA 3W2SA 3EN4A 2GNFA 2QR7A 4AZEA 1XMLA 2W9ZB 2IZTA 3R0TA 3UMWA 4NM7A 1Q8WA 2BDJA 1UU7A 3ZM9A 4ZZOA 1OITA 4IWQA 4M0ZA 4O82A 3NUXA 4HYHA 4LQMA 1J7UA 4M12A 1HOWA 3R1NA 4OT6A 2XRWA 3MA3A 5E8UA 4TWOA 3MFUA 3DAJA 1XH4A 4BGQA 2GHMA 4F65A 4FNXA 1OUKA 4Y72A 5J87A 1WBNA 1X8BA 2C6DA 2GTNA 3FDNA 4JJRA 5TE0A 4TT7A 3R9NA 1JLUE 3UE4A 3HX4A 1ZMWA 2B9IA 3NW6A 1PKDA 3OY3A 3Q2MA 1P14A 3CLYA 3ORKA 3DJ5A 3E92A 3Q4ZA 4DGMA 4HYUA 3R22A 1ZYSA 5AP6A 3OOMA 4MXOA 5KMJA 4AZTA 3CE3A 5H2UA 4CEGA 3ORNA 5ETCA 3QLFA 1U54A 3E7VA 3RNYA 2JAMA 3KN6A <