4DFNA

Crystal structure of spleen tyrosine kinase complexed with an adamantylpyrazine inhibitor
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
274
structure length
269
Chain Sequence
VYLDRKLLTLEDKELGSGNFGTVKKGYYQMKKVVKTVAVKILKPALKDELLAEANVMQQLDNPYIVRMIGICEAESWMLVMEMAELGPLNKYLQQNRHVKDKNIIELVHQVSMGMKYLEESNFVHRDLAARNVLLVTQHYAKISDFGLSKALRADENYYKAQTHGKWPVKWYAPECINYYKFSSKSDVWSFGVLMWEAFSYGQKPYRGMKGSEVTAMLEKGERMGCPAGCPREMYDLMNLCWTYDVENRPGFAAVELRLRNYYYDVVNE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Tyrosine-protein kinase SYK
publication title Pyrazine-based Syk kinase inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 83
structure length 269
sequence length 274
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2012-01-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4dfnA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4dfnA01
3NS9A 3QZFA 4UALA 4MXCA 4A9YA 3P7AA 2XA4A 4DCAA 2FO0A 1GZOA 2GQSA 2CLQA 5HCZA 5J9YA 3BYUA 3KCKA 3PJ8A 5T68A 3PSBA 3M11A 3BV2A 5IQAA 4PQNA 5FXQA 3HKOA 3PIXA 3OG7A 1VJYA 4BHZA 1E9HA 2WMVA 4DEAA 5HKMA 3NYVA 3W2CA 5AR7A 1RQQA 2A2AA 2BIYA 4YZMA 3U4WA 3CBLA 4O7VA 5AR5A 1ZY4A 4UYAA 5D12A 4QMPA 5B0XA 4O0XA 3G33A 4YJNA 3NUPA 4FKGA 1MRVA 1ZARA 4JAIA 4AXAA 3UJGA 3GEQA 5I9YA 1KE8A 4L7SA 2BDJA 2BZHB 3F2RA 1JVPP 4FL2A 1W98A 3E8EA 4CKJA 3Q3BA 5AP2A 5IMXA 1PKGA 4EBVA 3TTIA 1WBSA 5ETFA 4ORKA 3THBA 4PTGA 4P2KA 5C01A 3A7HA 4IB5A 5ANEA 4DFNA 4O7WA 1MRUA 4EH9A 2QU5A 5E1SA 3UYSA 4BCGA 4FEUA 4YJUA 5IKWA 5D1JA 3ANQA 1PXKA 4GIHA 1WBTA 3D2IA 4O86A 3ORPA 3M2WA 5JGBA 3PVGA 4HPTE 1CKIA 4X6RA 2QOFA 3O50A 4FGRA 3FMHA 5KHWA 5ANIA 4TXCA 2I1MA 3HEGA 2ITPA 1G8SA 4AE6A 1G3NA 4S32A 2H34A 3HMMA 1KOAA 3NNXA 3PLSA 3UMWA 1GIIA 4L8MA 5LVNA 4FNXA 3VBVA 2PVKA 5HO8A 1R39A 2QOKA 3MTFA 5BX0A 3E92A 4D55A 3RGFA 5CEQA 1Z5MA 4D1XA 2WMXA 5E8TA 1FVRA 1LP4A 1A06A 2IZUA 4NM0A 5LMKA 2DYLA 3K3IA 1OBDA 1AQ1A 1LPUA 2WFYA 3QRJA 2O63A 4R3CA 1J7LA 5CSPA 5FG8A 4N6ZA 3TKUA 4CSVA 3ZM9A 3FL4A 2C68A 4QMYA 1LR4A 3NUAA 5JT2A 4YP8A 3D5XA 3W2PA 2X0GA 5KMOA 5ACBC 3CR0A 2C6DA 3EKNA 3PJ3A 4RJ5A 5DH3A 5E90A 4EOSA 2VTQA 4FV1A 3QYWA 4RIWA 2KULA 2QG7A 3C7QA 4ZSGA 3SW4A 5C8MA 4DH3A 3DCVA 4EYMA 3L8SA 3KGAA 2B9JA 3WIGA 1XO2B 2UZTA 1O9UA 5IA4A 1OIUA 2W1HA 1J1CA 2WQNA 3OUNB 4V05A 5M4FA 3KK8A 3CSVA 3MPAA 3EFLA 4ZLYA 4FE2A 3VS5A 2GHLA 4JBOA 3R9NA 5KUPA 2I6LA 2J0KA 3BEGA 4IAIA 3GUBA 2WMRA 3DT1A 3EQPA 4J1RA 4V0GB 2VX1A 1DAYA 4RIXA 4BBFA 4ENXA 3GOKA 4FZ7A 3ZC6A 2WMQA 2PWLA 2X2KA 4D5HA 3EL7A 1WCCA 2RSVA 1W83A 4TW9A 5HNGA 4OR5A 4QMTA 1GZKA 2IZSA 4BDDA 4BVUA 2CCHA 3P79A 2UW4A 3KVWA 4FEQA 2PHKA 4D9UA 4R5SA 1M17A 2XCKA 2XNBA 4DEGA 5GJGA 4FSZA 4I22A 4RZVA 4FSMA 3LXKA 3OF0A 5BVOA 5AP5A 2ITWA 3FV8A 4ASZA 1Q8TA 4FOCA 4BCQA 2QO2A 2GNLA 2IN6A 2KTYA 2ZDUA 4E20A 3MJ1A 3BGQA 5HO6A 4YUQA 3JUHA 4FNZA 3RAIA 1YWNA 5J1WA 1URCA 3C9WA 1PYEA 4P5QA 2C5VA 2YZAA 3I4BA 4NH1A 4D58A 5HIBA 3W18A 5KBQA 4BDEA 3LFDA 2OJGA 3OVVA 4IANA 1W82A 3BU3A 4OTQA 3V5QA 2BFYA 4XP2A 2E9VA 1YOLA 3QRKA 4OTHA 3A7JA 4F6WA 3FI8A 4FSTA 3NUYA 4LRKA 3SRVB 1SNXA 2OXXA 2BVAA 3NDMA 4IAZA 3OEZA 4BICA 2X7GA 4KS7A 3OD6X 4EYJA 4FEWA 3WF5A 3ROYA 2R7IA 1PXNA 4BIEA 3ULZA 4EH6A 1IA8A 3COMA 4UWYA 4EQCA 1Q3WA 1E1XA 4W8EA 4C02A 4O84A 4RRVA 4TWPA 3BQRA 1M7NA 3RK5A 2G2FA 1NA7A 2B9FA 4DG3E 2FH9A 3EB0A 4KIOA 4Y83A 2ZM1A 4YJQA 2BMCA 2ZJWA 5CVFA 3C0IA 3ODYX 4FV3A 4JIAA 3SVVA 4YPDA 4RQVA 1R3CA 3QLGA 1Z9XA 5AAEA 4ZY4A 3MS9A 3VQUA 3A7IA 5C4LA 4MTAA 3CPCA 4IXPA 5J7HA 3KRLA 3LFQA 2XM8A 4AT5A 4O22A 3BCEA 3ZS5A 5K4JA 2OF2A 3BYMA 3JR1A 3UG1A 4QMOA 4YTCA 2ETMA 4GUBA 3CCNA 4FTCA 4I4FA 5JFXA 1PMVA 3ORXA 3LQ5A 3IK3A 2AC3A 2W06A 3FZTA 4Q9ZA 1JSUA 3CGOA 2CNQA 5HIDA 5GZ9A 3NW5A 4L6QA 3SG9A 3S3IA 2QLQA 4H39A 2PZPA 3QKMA 4JT3A 2R3OA 2I7QA 5E8YA 3O7LD 5DOSA 3MH1A 3V5TA 1PXIA 1YI3A 2WQMA 1OM1A 3U9NA 2B4SB 3T8OA 4CT2A 3REPA 3MIYA 1WBVA 1QCFA 2WNTA 5BUJA 3PZHA 4BDCA 5JGDA 3TNHA 4FT0A 4ANNA 2Z7SA 5KO1A 5HX8A 5EH0A 2RF9A 3A8XA 3QKKA 5T3QA 3RCJA 3DZQA 1O6LA 4YJSA 5IU2A 2R3JA 2FSLX 5IG1A 4FEVA 2ITVA 4FZAB 3QBNA 3FZRA 3H9RA 5KKRB 3I7CA 4ZJIA 3UIUA 2VTHA 3ATTA 4I3ZA 4AWIA 4F08A 5LVOA 3KF7A 4XP0A 1M7QA 2F7ZE 3FLNC 5D9HA 1U5RA 4XX9A 4KIKA 3D15A 1OPLA 3FHRA 1J7IA 4UV0A 2WTKC 3HV6A 5LWMA 2G9XA 1PW2A 2CGVA 4KAOA 5EDQA 3BRBA 4NIFB 3SX9A 4FNYA 5AWMA 2UVYA 4KIQA 1PMUA 3F69A 4LUEA 4ZTNA 2JKOA 3KMUA 1OPJA 1IG1A 3GB2A 3LJ2A 3FI4A 2V22A 3LM5A 1XH8A 3GP0A 4FTQA 4QP8A 5BYZA 4D0XA 4XG9A 4FODA 4DG2E 2HOGA 3ZBXA 4JDIA 5K5NA 4W8DA 3FMJA 3GFEA 2LAVA 3UQCA 3SW7A 4BTKA 3I7BA 4PWNA 3ROCA 5IA0A 4YO6A 2E9UA 3E8CA 3FXWA 3H0YA 2JAMA 4BDHA 5DIAA 1HOWA 2UZDA 5A14A 2WMUA 2GSFA 2RKUA 4L00A 4AFJA 4BYIA 4XOZA 4KBCA 2YIWA 3I5ZA 3NLBA 2F49A 2OK1A 2YFXA 4XYFA 4CG9A 3BWFA 2A1AB 5AUUA 2GCDA 4EONA 3DNDA 2O3PA 3HRBA 2XJ2A 2C5OA 2DUVA 1G5SA 5BVEA 3IG7A 1Y6AA 3Q9XA 4GU6A 3WE4A 4CTCA 4F7SA 3ATSA 2JBPA 3RWQA 3DXQA 2H96A 1ZOEA 5DWRA 3A8WA 1HCLA 2ERKA 3C0GA 5CU4A 4L01A 1PF8A 3VBWA 3OZ6A 3ZSIA 4RJ3A 1JWHA 3G2FA 3IW4A 4WUAA 5AX9A 2WELA 3NEWA 3VIDA 1QPCA 3IONA 2CSNA 2Z02A 5E4HA 3RM6A 4FKQA 2YWPA 3PY3A 1KOBA 3QGWA 5CT0A 4ANOA 3ZCLA 3I0QA 4M69B 4ZLOA 4S2ZA 1M2QA 1TVOA 3R04A 3R8LA 3NRMA 1IEPA 3E64A 3NW7A 4RVMA 4U81A 4AFEA 3CQWA 1I09A 4FIHA 5I3OA 2XS0A 3CQEA 2NNWB 4ZXTA 3NUUA 3ZC5A 2Q0NA 3FI2A 3P4KA 5KMKA 4MNFA 3RPOA 2VWVA 2R3QA 4LL0A 5HICA 4KKGA 3EHAA 5CLPA 2J0IA 3AQVA 4BZOA 3OUKA 3N4TA 1YHVA 5EQEA 1YXXA 4Z3VA 4ZZNA 3B2WA 4C4JA 4NWMA 5CU2A 4IVCA 3TT0A 5M53A 4HZSA 3I79A 4BIDA 4PP9A 4Q2AA 3RHXA 4EQMA 1PXLA 5I4NA 5AV4A 1Y6BA 2VTNA 4Z9LA 3KN5A 5A46A 4S31A 4YHFA 3KQ7A 1OKVA 5HBJA 5IDNA 2HAKA 4DEEA 2W4JA 3E3BX 2RL5A 4TYIA 4IM2A 5FEQA 3JY9A 4FK3A 4FSRA 4N0SA 3MH0A 4EOOA 5M44A 2UZUE 5DEYA 5KZ0A 4TNDA 3C4ZA 4CCBA 2X4FA 4GL9A 2JDVA 1V0PA 4D2SA 4RGJA 4PTEA 3UVRA 3TZ9A 5CEPA 5HIEA 5CU6A 4BDAA 2OZAA 3HUCA 1I44A 4XOYA 2X2LA 4C38A 2XYNA 4NM5A 2YAAA 3F88A 4OBQA 2XIRA 2YCSA 3R7IA 2PE0A 3V8TA 4JG8A 5EHOA 1FPUA 4CFNA 3HV7A 3GI3A 2W9FB 5A4CA 3D5VA 2YERA 3OC1A 3TKHA 5F9EA 3DXNA 1A48A 5DEWA 5J5TA 3PSDA 2W1GA 2V7OA 2XK4A 3PPKA 4GKIA 4RVTA 4AGCA 4ZMFA 4FNWA 1U5QA 4ZSJA 4F4PA 2AYPA 3C4CA 3DLSA 1H1RA 4QYFA 4YJPA 4YJTA 3T9TA 5FTGA 3FXXA 1ZAOA 4NFNA 1JKLA 2NRYA 2GDOA 4EK5A 4YR8A 3MWUA 5CEMA 3CS9A 3BHYA 4UEUA 4N4SA 5AP6A 1FGIA 4AN3A 4BN1A 3FLWA 3BE2A 5HORA 2X8IA 4EHZA 5K4IA 4WKQA 1T46A 4G17A 3F6XA 3LXNA 3JPVA 2QOBA 1NW1A 4ASEA 2FB8A 5KHXA 3BV3A 3EQIA 4LUDA 1G8AA 4PV0A 4ZIMA 4IX5A 2IVTA 3BIZA 3FWQA 3NUSA 3K2LA 4HYSA 4I1ZA 3TEIA 1BX6A 5AV0A 3WIKA 1ZZLA 3WZDA 3BQCA 5L6OA 4L3LA 5FGKA 3LQ3A 2AUHA 1PJKA 2V55A 3PYYA 5BVWA 3L1SA 3R2YA 3OWKA 3EN5A 4TYHB 4BTMA 4PMMA 3CC6A 5IA2A 3ITZA 4YZBA 1M52A 1S9JA 4A9UA 3KL8A 2VTAA 2VNYA 3Q6UA 3BKBA 1Y8YA 3VHKA 2QI8A 4HYHA 4UXLA 3R9HA 5JK3A 4FV6A 4ENYA 4YTHA 4H3QA 2GHMA 2JC6A 5HVKA 5JZJA 1TQIA 3HDNA 3LCTA 3VUDA 3OWLA 4CMTA 4QYEA 4ERWA 2IO6A 4IJ9A 5HD4A 4FVRA 2CGXA 4DH1A 4LI5A 3WBLA 1GIJA 3FEGA 3H9FA 2F4JA 3MH3A 3MY0A 2WPAA 2PK9A 4JNWA 4RWKA 4NW6A 4C0TA 2PVLA 3FY0A 4YJVA 4TNBA 5D41A 3SQQA 3S4QA 1GOLA 1NT2A 4RFMA 4RG0A 5CAQA 3ZUVA 2A0CX 4D4YA 1IA9A 5TE0A 2JGZA 4BCPA 4Z16A 4OW8A 3ZRMA 4D4RA 3CPBA 2B7AA 4I23A 2R0IA 4NU1A 5FRIA 2C3LA 4BCMA 1FMKA 2GNJA 3JVRA 5AP1A 5CALA 1FBNA 3GNIB 3VUGA 4F1TA 1L3RE 5HG8A 4ZLZA 5C8NA 5I0BA 4O1PA 4FIEA 2RFEA 1H08A 4NM3A 2WMWA 2E9PA 3DU8A 3MYGA 4FICA 5F1ZA 2IVUA 5FBNC 2NP8A 5IDPA 1L8TA 3R7EA 1KV2A 3TJDA 3EL8A 1YHSA 4PPCA 4A4XA 4IAFA 3AD5A 2JIIA 1JKTA 3O96A 4LYNA 5IH5A 4U5JA 2J6MA 3PG1A 3VUMA 3ZUUA 4XH6A 1KE9A 4YZDA 4WNKA 3LMGA 2QKRA 4FV8A 2ONLC 3UZPA 3FSKA 2YLFA 3A4OX 2R0UA 3MI9A 1WBWA 4O91A 1P4FA 4MCVA 3DFCB 3DAEA 3D0EA 1MP8A 4O0TA 5A4TA 5HE2A 2BRMA 2QKWB 3ZLXA 1YQJA 3ORKA 4NEUA 4IX4A 2CPKE 2JDSA 3G51A 4G3DA 4NCTC 4F1MA 2ZM3A 2CGUA 4GKHA 3E93A 2WQEA 4TPTA 1K2PA 4WOVA 5FEEA 5HVYA 4PDPA 4HYIA 3VO3A 4GJ3A 3OCTA 2UW7A 1Y91A 4HVSA 4FA2A 4JOAA 1Q8WA 3DGKA 3I6WA 2F2CB 3HYHA 3LFBA 5AM6A 5CU0A 2Q83A 4AE9A 3MESA 3DS6A 4IH8A 4CRSA 4O7ZA 2XBAA 3VF8A 2RFSA 3EQDA 4UWCA 3WYYA 4WNMA 4B0GA 4C58A 4DBNA 4QTEA 2P2IA 4HW7A 1OITA 1V0OA 4YZNA 3F5PA 4AA0A 3DKCA 2J5FA 3UBDA 4D2PA 4EOIA 4L9IA 1XH6A 5E8VA 4CFVA 3R8UA 3E87A 2YEXA 3FDNA 3QTXA 3FPMA 3D14A 2UZOA 4U3YA 4WNPA 2WZJA 4RJ7A 5HTCA 4GRBA 4KINA 3TCPA 4E93A 4X3FA 5M08A 4S30A 3C1XA 3UODA 3VBTA 5D7AA 3EKKA 5C03A 2RG6A 3FQEA 2JFLA 3R8VA 4A4OA 1OUKA 2C6KA 3ACKA 2XIYA 3OBGA 4K1BA 3ZRLA 4F0FA 3TDVA 2QO7A 4DINA 4YGAA 5L2QA 3ODZX 3I5NA 5HU9A 4TY1A 5E8UA 2WO6A 3TACA 3UPZA 3ZUTA 4G9CA 4IIRA 3UNZA 3COIA 3MV5A 3QTRA 3R71A 3DBQA 5IUIA 4HNIA 3D83A 4ANSA 3ZFYA 1JSVA 3NX8A 4CT1A 3ORLA 2O0UA 3VRZA 3AT2A 3FI3A 3RK9A 3VUKA 3MBLA 2XJ1A 4LM5A 4KB8A 4WO5A 4OTDA 4A9TA 3MVHA 4FT7A 4WUNA 3Q5IA 5J79A 4C4GA 3NVMB 2R9SA 3MVJA 4RVKA 4J95A 3ZBFA 3GBZA 3MA3A 4QTDA 2W1DA 4UBAA 4ACGA 5BVFA 4BF2A 2C5XA 3IW8A 2OI4X 3BYVA 4ZJJA 5DGZA 4ZS4A 3UO4A 3G0FA 4ACDA 4G34A 4ASDA 4LGDA 3MN3A 4AACA 3HGKA 3VUHA 1VR2A 4J96A 2UZWE 2WTCA 3SXRA 3MB6A 4AGDA 4H58A 4HGEA 4IVBA 4WG4A 4R1YA 3L8XA 2YIYA 3VC4A 4IJPA 4PL5A 3TDWA 4FK6A 4M84A 1UU3A 3PIYA 1CKJA 3PP0A 2HY81 2VWWA 4C3PA 1P4OA 3IDBA 3D7ZA 2C3IB 4IVDA 4FSUA 5EYCA 3CTQA 2EWAA 2G2IA 5J8IA 2ITZA 3RZBA 1J7UA 4EZ3A 5EKNA 1OI9A 5HLPA 5HBHA 2BTRA 4OUCA 2PUUA 2VTOA 3N4VA 1WMKA 1RW8A 3BEAA 1U59A 2YWVA 5A4QA 2R3PA 4E3CA 3FQSA 2QLUA 3LCKA 3SD0A 3IOKA 2UW0A 3DKFA 5TKDA 3NMUF 2JD5A 2EB3A 3OROA 4JS8A 5ETIA 2ITNA 5HG5A 5FM2A 2X8DA 4C57A 3W1FA 5KKRC 2J90A 2ONLA 4RIOA 5DR6A 3LFCA 4FT3A 3H30A 1JSTA 4YC6A 3ZDUA 4ZS0A 2X39A 3UZTA 5AR4A 1ZMWA 3MGYA 5EOBA 2R7BA 3OCGA 5D10A 4U0IA 2ESMA 3WZUA 3ZLSA 3ZSGA 5DN3A 5CF4A 3EJ1A 4FTTA 2WMBA 2R3HA 5GZAA 4DGOA 4PL4A 2C0OA 3Q96A 2Y4IB 4YNEA 3F7WA 3QQJA 4OAVB 4JDHA 3G0EA 3IQ7A 3TNWA 4UN0C 1X8BA 5M4UA 4FL3A 5L3AA 3S00A 2G1TA 4I6QA 1MQBA 4PY1A 3V6SA 4FX3A 4AUAA 2JKQA 4MHAA 4O6EA 2OKRA 1KV1A 4IWOA 4OTRA 3R7GA 2JKKA 4R7HA 4Q5EA 4V0GA 5HE3A 4KSQA 4I6BA 5J87A 2EXMA 4P5ZA 4U9AA 3UOKA 4YO4A 3FJQE 5L2IA 4GU9A 2B9HA 4RX7A 3ZTXA 4X6QC 4BFMA 2WOUA 2WGJA 3ORIA 4GT3A 5CASA 5CF8A 3VN9A 3EQCA 3LMIA 3DDPA 4CRLA 3P78A 2JDRA 4IC8A 5AUYA 2XM9A 5CAPA 3DBFA 3QTZA 4N70A 5CVGA 4O7RA 2JKMA 4I6HA 3QU0A 5KE0A 5KMLA 4UXQA 5CNOA 4KRDA 4GEOA 2BRBA 4GYIA 1SVHA 2Y9QA 5IEVA 2ZOQA 3WF8A 3ETAA 5DBXA 3CKWA 4F9YA 4WT6A 2VTSA 3IW7A 4J98A 2GHGA 4CG8A 3KK9A 4D1ZA 5E91A 4U44A 3FSFA 2C47A 4FV9A 3F82A 5KX8A 3QGYA 2PMLX 4IWPA 4JI9A 2SRCA 2J4ZA 3ORMA 3C0HA 3EQRA 3P9JA 3LQ8A 4K18A 4IM0A 2YCRA 2OZOA 4W4YA 4O0RA 5CS6A 5DPVA 4BCOA 5JQ8A 2XIKA 4W9WA 4EI4A 4O0VA 3QTUA 3AC2A 1JBPE 4F9WA 3SRVA 5CEOA 1H4LA 1YDRE 3AGLA 4TRLA 5L2WA 4FTUA 3VWAA 2OSCA 5JFSA 3WZKA 3TKIA 4TKSA 4X0MA 4GVAA 3FLQA 4X3JA 4BYJA 5LCJA 3PXYA 3F5XA 3CXWA 4AG8A 4DEHA 4RA5A 2BROA 1CKPA 5EI8A 4R3RA 4G5PA 2R3GA 3G15A 3DNEA 2C6OA 4A07A 4FIIA 3Q6WA 1GZNA 1KSWA 2C69A 4RFZA 5EW3A 4CFWA 4EH8A 3QXOA 3UIXA 2PMNX 3GC0A 4QP4A 5IISA 5I9ZA 3CY2A 1KE7A 2BRHA 4IM3A 4M97A 3VBXA 4YURA 4AX8A 3GQIA 3PXRA 3HUBA 3EMGA 4QOXA 3KA0A 3SG8A 4H1MA 2X1NA 3EN6A 3V5LA 5LOHA 3ACJA 5G1XA 3BGPA 3TV6A 2Z60A 3OS3A 1LEWA 2YM7A 2OJ9A 3KRJA 4FVQA 4L44A 4EBWA 2PYWA 4CD0A 4FTMA 3JXWA 4ZSLA 2OBJA 3EQHA 3UNJA 1WBPA 3HMOA 4LRJA 3WZEA 3IOPA 3QYZA 3Q4TA 4GT4A 4I5HA 3RBWA 2PZIA 4C2VA 5KMIA 4DE4A 4R1VA 5K5XA 3V5WA 4AZWA 3NVKI 3PA4A 2FSTX 3KKVA 3E7OA 4FT9A 2IG7A 2GS2A 5BVDA 3DY7A 1OGUA 2XK3A 3E5AA 3Q4CA 1OB3A 4TWCA 5HE0A 3RP9A 2ZV7A 3DB8A 1YXTA 2HZIA 3O51A 4I92A 3WZJA 4UYNA 3C4XA 2C0TA 2W17A 4JQEA 4XV1A 2XBJA 4L7FA 4QMSA 3ZOSA 3ZYAA 5L6PA 2R3LA 2ZM4A 4ZZOA 2X6EA 4MD7E 1Q8ZA 3VS4A 3FYKX 3KF4A 1K3AA 4JQ8A 5EFQA 5CF6A 3DTCA 3OEFX 2WD1A 4NIFA 3OY3A 3AGMA 4NW5A 2OF4A 5I3RA 4IC7A 1OPKA 3TZMA 4QQCA 1OL7A 4ITJA 5HVJA 5AA9A 5HE1A 2HW7A 2V0DA 3R7OA 3VUIA 2W1EA 4R7IA 1Y57A 4DG0E 4O82A 5IQBA 2W5AA 3QQFA 3ET7A 2B52A 4BL1A 4U79A 3HMNA 4GVJA 4E4MA 1PRYA 2QHNA 5GIPE 4M66A 4Y8DA 4KNBA 3CGFA 4LOOA 4FKPA 4U45A 3D4QA 5J9ZA 4WD5A 5IA5A 3FY2A 3L8VA 2UW9A 3LXLA 5E8XA 5AUZA 4FTKA 2YM6A 3QCYA 4GCJA 4PF4A 4DFYA 4U42A 5M4CA 5F20A 5HNIX 4FVPA 4ID7A 5I9VA 1H8FA 3LPBA 3E88A 4PMTA 1QMZA 2HY0A 4FTLA 1Q5KA 4RIYB 4FR4A 4UY9A 4L43A 2UUEA 4QYGA 4DFLA 5LMBA 2YDJA 3ORTA 4MAOA 4G6NA 3RAHA 1XBAA 2R3RA 3NWWA 4O7SA 4BB4A 5AP4A 2PUNA 4FTJA 5FD2A 3UMXA 3A60A 4N57A 2YACA 4EOJA 4HCVA 3UG2A 4FKJA 4G6LA 1H24A 4M69A 5A6NA 5KMMA 4PUZA 4IWQA 3DDQA 3N51A 5IQHA 4D2VA 4EH7A 4O21A 4MNEB 3R02A 5L8KA 4PNIA 4DH7A 3DFAA 3ANRA 3MY1A 3LCOA 2F7XE 4BBMA 2WAJA 3SC1A 1H00A 4FTOA 4DCEA 3DA6A 3HAMA 1YXVA 2UZBA 4IB0A 4O81A 3FUPA 2VTJA 5TR6A 1YVJA 3FZPA 1YWRA 5HOAA 3OT8A 5M06A 4ANBA 4FBXA 3GCSA 2B53A 3FE3A 3HX4A 3K54A 3BLHA 3LIJA 5EYKA 4RIWB 1LEZA 3GU4A 4YBJA 4ZTLA 2H9VA 2XEZA 3SXSA 3CD8A 3DZOA 1VYZA 3V3VA 4DC2A 2QOCA 2OJIA 1VEBA 3FMMA 2OO8X 3CP9A 2GNFA 4JIKA 4QP7A 2VTRA 3MIAA 3RPVA 3RNIA 3RZFA 5GZ8A 3D2KA 5LCKA 2BKKA 5B2MA 3MH2A 4CFXA 3AC4A 3NYXA 4K8AA 4D4VA 4DEIA 2PVRA 2W1IA 3O0GA 5BQ0A 1H0WA 2PZRA 4F7JA 1J3HA 2BAQA 3F5GA 4G31A 3TM0A 4BI2A 3HNGA 2WQOA 3OMVA 2Z7LA 3Q60A 3BHUA 5CAVA 3ZFXA 1DS5A 1Q99A 3KFAA 4CV9A 4X2JA 2Y7JA 2GS6A 3VQHA 2GNHA 3F5UA 4OT6A 3QQUA 3FYJX 4XMOA 4OTFA 5IA3A 4I5MA 4KABA 4JJRA 3A61A 5T6KA 4FOBA 3V51A 4C61A 3RALA 4L67A 2UVXA 3RI1A 4RC4A 3EYHA 4FKSA 5GINE 3FPQA 4DT9A 2YA9A 4GV1A 3EH9A 5DRBA 1H1SA 1P5EA 2C3JA 3R7UA 4DBXA 4Y85A 4R78A 1CMKE 4XV3A 3EWHA 5C26A 4DGNA 2YM5A 3HMIA 2A4LA 2BALA 3R21A 3VRYA 4EJ7A 5CQUA 3QWKA 5EM8A 3NYNA 4UMUA 3VS1A 4LV5A 3R6XA 4GFOA 4I93A 3BU5A 4EORA 2PVMA 5DR9A 4L68A 2HENA 4K77A 4ZY6A 3OW3A 1IASA 3PJ2A 5EW8A 2R64A 4ZSAA 3Q9ZA 3R8ZA 3CEKA 4CNHA 4II5A 3ZEPA 5CVHA 3QQKA 5AEPA 5AP7A 4GK2A 2X7FA 3KVXA 4JBQA 3FLSA 3MB7A 1ZOGA 3UTOA 4AQCA 5K9IA 4M12A 1GAGA 4JDJA 5CZHA 3HP5A 4WHZA 3V8WA 4D1SA 2VTLA 3PFQA 5CI6A 5AUWA 4E5AX 2FVDA 4BY9E 2RFNA 3RCDA 4TYHA 4FYOA 5HG9A 3UQFA 2PZYA 2IW6A 2VUWA 5M55A 1F5QA 2H6DA 2HWPA 5IQCA 4WG3A 4U3ZA 4ANMA 3QUPA 3ERKA 4CKRA 5A9UA 1MUOA 1W7HA 1SNUA 3ALNA 3AXWA 3IGGA 5B2KA 3VULA 4ARKA 1ZLTA 5DT3A 3V5JA 3G9NA 3P1AA 5G6VA 2GU8A 3OOMA 5AP0A 3VNTA 1ND4A 1ZMUA 4IZ5A 2VTMA 1YXSA 4BTJA 4RJ4A 1OKWA 1PXOA 2C3KA 2OXDA 5HG7A 2VGPA 4E4LA 3TN8A 2GNIA 3PA3A 5AUVA 4D0WA 2WMTA 3HV5A 2VTIA 4TWNA 1H01A 1H1QA 2PY3A 4M0YA 1BL7A 3H9OA 3K5UA 1UU9A 2Y0AA 4ACCA 4ZEGA 2P4IA 4ANQA 3LE6A 2HXQA 4PMSA 4K2RA 4L42A 4IACA 3MTLA 2QNJA 1UWHA 3QALE 3UQGA 4OBPA 2XMYA 4GFGA 3WOWA 2YABA 2WEVA 4Z7HA 1EH4A 5A6OA 4IB1A 3D9VA 3NUNA 2WOTA 4NJDA 2F7EE 5JGAA 4AZFA 3POOA 2YAKA 2F2UA 4RLKA 5IEYA 3BELA 2I40A 3R30A 1IR3A 4UX9A 3ZSHA 3TI1A 2A19B 3PVBA 1W8CA 4X21A 1H28A 3UOJA 3SKCA 3E8NA 2ERZE 2UZNA 4RT7A 5TO8A 3KCFA 3O17A 4YC8A 2C6MA 4XNEA 1FVVA 2CN5A 4X2FA 2WQBA 4C4EA 4RQKA 4EJNA 3PRIA 5FQDC 3Q5ZA 3VS3A 3NIEA 4D28A 2ETKA 2CKEA 3OFMA 5J95A 5FDXA 2FSMX 3RVGA 4DN5A 4A9RA 4WBBB 3ZM4A 4E1ZA 5GIOE 1SZMA 1JKKA 3ENMA 3EOCA 3MSSA 3PY0A 4IAAA 2UW8A 2YM3A 3NUXA 2W96B 3TJCA 3SV0A 5M51A 5LMAA 4RPVA 4X3FC 2CKQA 4G16A 2XP2A 5FXSA 3F61A 5AR3A 4NSTA 5FXRA 3ZFMA 2XIZA 2EXEA 3EQGA 4I5PA 4EKKA 3LFAA 4XV2A 4ZZMA 3C51A 2C5YA 1O6YA 3DJ5A 4J7BA 4LGGA 2PUIA 3WF9A 4YSJA 3MY5A 3RKBA 4K0YA 4FF8A 4RJ6A 1H07A 2UVZA 4ZJVA 4Z7GA 4DGGA 3HRCA 2ITYA 5CAUA 1PMEA 3CD3A 3KMWA 2QR8A 5DE2A 4U40A 4O38A 4Y73A 3ZXTA 1BYGA 2RG5A 3BZ3A 4ONAA 4QYHA 5ETAA 4ANLA 4BDFA 3QCXA 1NVQA 1T45A 3KEXA 3LFSA 1WBOA 2ITUA 1Q97A 4E4NA 4AZEA 2OFVA 2ZV8A 3PXFA 2VO3A 1OUYA 1YXUA 4FUXA 3ZEWA 4FKWA 3W2QA 3UP7A 3S0OA 3G6HA 4RLLA 3SA0A 4NT4A 2QODA 3TV7A 1DI8A 2NPQA 3L9MA 1M2PA 5BUEA 4QMWA 4QPMA 4FTNA 1GIHA 3GC8A 5EI6A 2ZVAA 4C4FA 3AT3A 3QZHA 4F99A 3Q4ZA 2OH4A 3E8DA 3IKAA 2C4GA 1APME 1ZZ2A 4O0SA 3TZ8A 4BDGA 4XG8A 3ZO3A 3TUCA 5M56A 1NVRA 2G2HA 2AC5A 5CANA 4UMQA 2H8HA 2PMOX 5HI2A 3ULIA 3MFUA 5M09A 4R8QA 5AAFA 4GT5A 4XLVA 5FM3A 1UKIA 3OHTA 3DBEA 4K6ZA 4MWIA 5J5SA 3K3JA 4F9CA 1GNGA 4FGBA 4M0ZA 4BCNA 4TYEA 4BRXA 4IE9A 2YITA 3ALOA 2YM8A 3EQBA 2XCHA 1XWSA 4FKVA 4WSYA 2NO3A 5CU3A 3EFWA 4QP6A 3LLAA 3AD6A 5HHWA 3F7ZA 2VO7A 3QF9A 3NYOA 4W4VA 2J50A 4MBJA 2X9EA 5DI1A 1RJBA 3EZVA 4O7YA 5LARA 3ORZA 4QNAA 3DQWA 1SMHA 5CZIA 4QMUA 5DA3A 4FZ6A 2IW9A 4HOKA 1QL6A 4I0RA 3KRRA 4UZHA 4BC6A 3T3UA 3ORNA 4MKCA 2WHBA 4NK9A 3LVPA 3WILA 4BDBA 2W0JA 3CJGA 4LMNA 4F7NA 2OJJA 4V04A 3KULB 2JEDA 2XNGA 4OLIA 5BNJA 2YHVA 4YTIA 1B38A 4FEXA 5KMJA 2QD9A 3I81A 2X81A 5HLNA 4ZK5A 3R7VA 2PVHA 4TYGA 4QMVA 1XH9A 3RNYA 1V0BA 4LOPA 4GH2A 3R63A 4QP3A 3SDJA 4BGQA 2VO0A 2UZEA 4O1OA 2VGOA 2GMXA 4FKOA 2ZMCA 4DLJA 2VU3A 4XEYA 3VBYA 1F0QA 4ZY5A 2QOQA 1OIYA 1OIRA 1UNHA 3A99A 1JOWB 1ZYDA 2Z7RA 4AOJA 4AW5A 5FBOA 1H26A 4NKAA 4QTBA 3D5WA 4CMOA 4FV0A 3DOGA 1H1WA 3FZOA 4FMQA 4C3FA 2EB2A 4QMQA 2I0HA 3AC8A 1QPDA 2VD5A 2YDKA 3BPRA 4G6OA 4DEDA 4FG9A 3T3VA 2J51A 1OECA 3D94A 3E62A 3R83A 3NCGA 4YLLA 2VN9A 4V01A 1YKRA 3PE1A 4L3JA 4XG2A 5AIKA 4J8MA 1OZ1A 3PXQA 4JR3A 1AD5A 3PVWA 4OTWA 4HGLA 2OU7A 4AS0A 1P14A 4F0GA 3GCVA 2HWOA 3BX5A 3KXGA 3QD0A 3QTIA 4AGUA 4CGAA 5H8EA 4C2WA 3RAKA 3R1SA 2JDOA 4NKSA 4I6FA 4RX9A 3C5IA 3AOXA 4CFFA 4CZYB 1YRPA 2R3KA 4MYGA 4IZAA 1M2RA 2W9ZB 4C35A 5TF9A 4ZMEA 4RFYA 5E7RA 2VTTA 1FINA 4EZ7A 3FKOA 4OT5A 2GTMA 1NXKA 4RA4A 3LFFA 3R9DA 2WMAA 3A7FA 3QA8A 4R5YA 4NL0A 4HGTA 2O2UA 2PE1A 3R00A 2BUJA 2IZRA 2BAJA 2WTWA 4AA4A 4IZYA 3ID6C 1CSNA 4A7CA 4WNOA 1E1VA 4IAKA 5HNBA 4F0IA 1OL5A 3NAYA 2BDWA 4PTCA 2YZLA 3FHIA 4GIIA 2W4KA 4FKLA 3GGFA 2QG5A 4NUSA 3NIZA 4Y5QA 2C6EA 4DAWA 5IUGA 3EYGA 3RTPA 1YDSE 3LCDA 5FP6A 3UO6A 4NZWB 2FYSA 4MD8E 4QPSA 3VHEA 3U8WA 3VS0A 3EN4A 3OCSA 4YJOA 4D2WA 5B7VA 5BPYA 3NR9A 4Y46A 1BLXA 3QX4A 3R0TA 4ASXA 5AMNA 4B6LA 3AC1A 3QQLA 4QT1A 4WSQA 4ZTRA 3PE2A 4MBIA 4J97A 1BMKA 3OXTA 4CFUA 3NZ0A 3O71A 4C8BA 1Q8YA 2E9OA 4KS8A 4G3EA 4RBLA 1XH7A 2QR7A 3QCSA 4UZDA 5HGIA 3SLSA 3VAPA 4D2RA 4CLJA 4MX9A 2WIPA 5M57A 2CKOA 4HJOA 4M13A 4IX6A 3HECA 2DWBA 2BRNA 4GS6A 2VWZA 1H1PA 3WF6A 4YPSA 4ZTMA 2XKEA 3GCPA 4EUUA 3DXPA 4AN2A 4DH8A 3QHWA 3OT3A 4W4WA 5EDPA 2XNEA 2X8EA 3HA6A 3AMBA 4EOPA 5IUHA 2EUFB 2VZ6A 4Q5HA 4C34A 4QMNA 5B2LA 1UNLA 2BKZA 1ZYSA 3O8UA 4LG4A 4JX3A 4MXYA 4XLIA 4G3CA 3ZZWA 3BWJA 3W33A 4FIGA 3BE9A 4FI1A 4H3BA 2JFMA 4XJ0A 1JNKA 5H3QA 3UIMA 4E6QA 2O8YA 5AV3A 4D5KA 2OFUA 2B54A 5BMMA 3UPXA 3E3PA 1OL1A 4JX7A 4MXZA 4OTPA 2X4ZA 4IW0A 5AADA 5CF5A 1ZYJA 3GC9A 4RWLA 4WRGA 4Y72A 2CN8A 4JBPA 2XUUA 2WU7A 4ITIA 4IZ7A 2HELA 4EOLA 3MDYA 3AD4A 2PVJA 2OG8A 5J1VA 4OGRA 1Q62A 4FSWA 2VWYA 1IRKA 4BGGA 4EOQA 5BMSA 4DTAA 4PPBA 2GPHA 4IEBA 1OL2A 5ACKA 3RPSA 3QZGA 5ETCA 2BDFA 3AG9A 3FZ1A 2CHLA 4EHVA 4JVGA 2B0QA 3K5VA 4DEBA 1WZYA 3EN7A 4EK4A 3HAVA 4C37A 3VS2A 4F70A 5AV2A 1YW2A 2YIQA 1H0VA 3UZRA 4D4SA 4TN6A 1A9UA 3R2BA 5KMNA 2DS1A 3P7CA 3QTQA 2IPXA 4W9XA 2BZJA 2O5KA 3LJ1A 4K11A 2PVFA 5K3YA 4DH5A 4XHKB 5AV1A 3COHA 4QD6A 2EU9A 5FTOA 3QTWA 4Z55A 2J0MB 4GSBA 3TXOA 3C4EA 2WEIA 3F3WA 1REKA 2P33A 1URWA 2ITXA 2IZTA 3HV3A 2XVDA 4N6YA 4HZRA 2ZAZA 3A7GA 5LXMA 3OCBA 3R1YA 2C6IA 4WA9A 4RX8A 3NNVA 3GU8A 3QD3A 4R6VA 4EUTA 2YIXA 2YJRA 3C13A 4ZTQA 4YBKA 4FYNA 2QVSE 3EIDA 2QC6A 2IVVA 4YNOA 2QONA 5C9CA 4CMUA 4TTHB 4BZDA 5IA1A 4X7QA 4BKZA 4R3PA 4EOMA 1U46A 3KREA 3EQFA 5DG5A 5I9WA 4ACHA 1R0PA 5CY3A 2C30A 5CSHA 3WE8A 3HRFA 4LFIA 4S33A 4B8LA 4AOIA 4G1WA 3QTSA 4L46A 4IADA 5CNNA 4PDYA 4FV7A 3LFEA 3F9NA 3FMNA 1YI4A 2J5EA 4FTAA 4RSSA 5IPJA 4HVHA 2W5HA 2W4OA 3F66A 4MXAA 4QYYA 5TOZA 3E63A 4HGSA 5JSMA 5KBRA 4P7EA 5GHVA 3O8PA 4TZRA 3PPJA 2BTSA 2OWBA 2OW3A 4LMUA 3FKNA 2UZVA 4J53A 3ZRKA 2YLEA 3D7TB 4I20A 4E73A 1GZ8A 4YTFA 4RC3A 5JFWA 1BL6A 4RIYA 2CGWA 3UNKA 4EK3A 2OIQA 3N9XA 1QPEA 2YCQA 3NAXA 4YZ9A 2GQRA 2CNUA 5IMEA 4RX5A 2Z8CA 2FGIA 1FVTA 4A06A 5IZFA 4JAJA 5HZNA 4BGHA 3TZ7A 2HIWA 4FKUA 3PA5A 3RM7A 4AT3A 5GNKA 4E6AA 1DAWA 3R7YA 4G3FA 4PPAA 2YJSA 3POZA 4UB7A 5AX3A 4ALUA 2PPQA 2ZV9A 3W32A 4MNEA 2XJ0A 3VS6A 4ZTSA 1DI9A 4DA5A 2XYUA 4EH4A 5I9XA 4H3PA 5HQ0A 3DKGA 4DHFA 4WBOA 5AP3A 4B9DA 4CV8A 4ALWA 2QU6A 1KE5A 1BKXA 2IJMA 3BU6A 4YLKA 2GS7A 1ATPE 5A4LA 3I1AA 4DF3A 4BCJA 3PJ1A 3RMFA 4EKLA 1STCE 3FXZA 5CAOA 4M3QA 2PULA 4IWDA 2OH0E 3BHTA 4JDKA 3VW6A 3BLQA 4O0WA 5IQDA 2C6TA 4EQUA 3G5DA 2BZIB 2F57A 4O83A 4XBRA 4F9BA 5KNJA 3LJ0A 5EQYA 4DFUA 1YI6A 4AA5A 5DVRA 2HZ0A 3QXPA 4IDVA 4FKTA 4FG7A 5BYLA 1WVXA 3RWPA 5H8BA 4KKEA 3F3TA 2E9NA 2XEYA 5JRSA 3UOLA 1U54B 3L9LA 3UP2A 5JN2A 5K0KA 2WKMA 3HZTA 2R3NA 4CTBA 4KBKA 5M07A 1RDQE 4L45A 3OBJA 2XNMA 2XH5A 4EWHA 4ITHA 5EM7A 2XKDA 2W05A 3UVQA 3VF9A 5CXHA 4EK6A 2VWBA 5LVLA 1YOJA 4KSPA 5IQIA 2XF0A 2O65A 3CLYA 3MPTA 2GQGA 2JIUA 2XKCA 3FMKA 3OY1A 1ZWSA 4XRLA 4L53A 2DQ7X 3W2SA 3IW5A 4QP2A 4HVIA 3AC3A 1R78A 2XK6A 1XBBA 3LLTA 3QC9A 4TYJA 2E2BA 3HP2A 2WTJA 3F3UA 4C62A 3R9OA 4CQGA 3KXMA 5F4NA 4QQ5A 4AOTA 4O27B 3CE3A 4QQTA 5AJQA 4APCA 3IO7A 4HCTA 5CEKA 3FAAA 2I0YA 1NY3A 4QPAA 3A2CA 3FLZA 4O0YA 4BCIA 2Y6OA 4ZTHA 4AZSA 4NM7A 4DITA 5ANGA 2OGVA 2GNGA 3LM0A 3QRUA 4P4CA 4E6DA 3BHHA 3M42A 2J7TA 4Y5HA 4AP7A 3PVUA 2JIVA 4QTCA 3DK6A 1JKSA 5I5ZA 1JAMA 4BWKA 5L8LA 2BR1A 4IQ6A 3FMEA 2ETRA 3V8SA 3RAWA 5ANDA 5GJDA 4GG5A 5EYMA 3NW6A 4YZCA 1UU8A 5DRDA 4E5WA 3A62A 2Y6MA 3PWYA 5ANOA 4UWBA 2C5NA 4BCFA 5E8SA 4DTKA 3JS2A 4IX3A 3U87A 3UE4A 4PMPA 4FV4A 4YC3A 2XZSA 4PX6A 5AR8A 4AW1A 3MW1A 4XBUA 5BUIA 4GUEA 4J52A 4C59A 2ZYBA 2J0LA 1Z57A 4O96A 5HTIA 3TV4A 3D5UA 5CI7A 5HCYA 5E9EA 4MBLA 4PDOA 5HX6A 4S34A 1V1KA 3L9NA 5DHJA 3GU5A 4G2FA 4BTFA 5C1QB 3GU6A 4ALVA 3PDTA 4CXAA 4KBAA 3OTVA 4RWIA 5JFVA 4LRMA 3QZIA 5L8JA 3OWJA 3MFSA 1UVRA 4AGWA 1B39A 3Q53A 3GOPA 3AC5A 1OBGA 2YDIA 1YWVA 2HZNA 2QCSA 3W55A 4B8MA 3KY2A 2F9GA 4DGLC 3E7VA 3ZMMA 4UMRA 2W1ZA 2Z2WA 4U43A 4JLCA 4RIXB 3LW0A 1ZOHA 3TG1A 3TUBA 1R1WA 1O6KA 4QMXA 4TWOA 1J1BA 2R3IA 5CX9A 3U9CA 1S9IA 4F65A 4I41A 4E6CA 4PP7A 3GCQA 4QQJA 4KKHA 4KD1A 3O23A 3LAUA 5FDPA 5LVPA 2Z7QA 3UYTA 2X9FA 4BCHA 5I9UA 3JYAA 3NNUA 2XK7A 4U41A 2CMWA 3MVLA 4FC0A 2X7OA 4CQEA 3CKXA 1VZOA 3RPRA 4YJRA 1KWPA 3GFWA 3R8MA 3V5PA 3PXZA 3OOGA 4H36A 2O64A 3DLZA 4EZ5A 2C0IA 3W10A 3DQXA 4AN9A 3GVUA 4USDA 3HA8A 5A3XA 3ELJA 4CYJA 3U4UA 4KIPA 3AMYA 3AMAA 3O7LB 4H1JA 2RFDA 5M4IA 4PRJA 3H4JA 4JG7A 1KUTA 3QRTA 3CTJA 1PY5A 1DM2A 5ITAA 4M8TA 2HXLA 4XG7A 5TT7A 4J8NA 2PL0A 4IMYA 3KXZA 2OIBA 4JR7A 5HESA 3TWJA 4EOKA 4D2TA 5CWZA 4KUJA 5CEIA 3P23A 5HBEA 3HLLA 4M15A 3RJCA 3QUDA 2WTVA 5EK7A 3A4PA 3R1QA 3MJ2A 3FC1X 5IQEA 2W1CA 2OXYA 4QMMA 3SHEA 4BKJA 4FG8A 3W8LA 3UO5A 4QO9A 2VTPA 2J9MA 4EC9A 5AUTA 3BGZA 4FSYA 4FV2A 4XCUA 5HLWA 4MF0A 1UA2A 2WMSA 4MVFA 4JQ7A 5A4EA 5IQGA 3KB7A 3CQUA 4QNYA 4CEGA 2BHHA 2EVAA 3QQHA 5IEXA 4F9AA 2JLDA 5C8KA 2ITTA 3OWPA 4BDIA 3KXXA 1YHWA 2HK5A 4UMPA 5H8GA 4F1OA 5C4KA 4JXFA 3G6GA 3HMPA 2VX0A 3NCZA 2JBOA 4MWHA 1CTPE 1H25A 4I0SA 3Q2JA 5DT0A 5LVMA 4XUFA 3DPKA 5EI2A 5EHLA 3WF7A 4LOQA 2XNOA 3EN9A 3HL7A 1FOTA 3MFRA 3FQHA 4U80A 1H27A 2VO6A 2PSQA 3PY1A 3VW8A 2WU6A 3TNQB 2J0JA 4BDKA 5ICPA 2QO9A 4JRVA 2XKFA 4F64A 3BI6A 5JH6A 5FUTA 2Y4PA 4ZP5A 4FSNA 5JZNA 3WARA 1OKZA 3QKLA 1Q3DA 3S1HA 2PVNA 4B7TA 3IECA 5FP5A 2BILB 3Q4UA 3GT8A 4O7TA 2HYYA 4R7BA 4H05A 1Q24A 4YU2A 2ZB0A 3RINA 3H0ZA 4KRCA 5E1EA 3TUDA 4MXXA 3CIKA 2ZB1A 3PJCA 4FUYA 3ZDIA 5C27A 4GK4A 2GTNA 4I24A 3VS7A 2VRXA 3C4FA 3FL5A 2IVSA 1ZRZA 2VAGA 2QOLA 2XRWA 4L3PA 3QA0A 3P0MA 3V01A 4A4LA 3PLAE 5AM7A 1ZYCA 3EFJA 4KIKB 3C5UA 5HD7A 3W16A 5EOLA 3QD4A 4HPUE 1PXJA 1WVWA 4U6RA 3QL8A 5EM6A 2OJFE 1Q41A 3IPHA 2CDZA 3KULA 4QMLA 4BDJA 2UZLA 3Q52A 4JBVA 3DBCA 3LHJA 3FZSA 5DT4A 3OTUA 5HO7A 4IB3A 3TTJA 2BPMA 2FA2A 3SAYA 4U7ZA 5J9LA 5HCXA 4IBMA 4O7NA 4NTTA 3FMLA 3U55A 4GG7A 4HVDA 1Q4LA 1Y8GA 3W2RA 5DYJA 1ZY5A 2HZ4A 3MFTA 4ZOGA 3FMDA 3MVMA 4R77A 3FLYA 2OICA 3BBTB 3BHVA 4DGMA 4F09A 4A9SA 5ANKA 2Y4IC 3UC4A 5EG3A 3SXFA 3NSZA 5CYIA 1OIQA 4G3GA 3OXIA 3U51A 5DLSA 4B4LA 1BI7A 3V6RA 5CSWA 4AT4A 2PVYA 3NGAA 3BLRA 4X2NA 5LWNA 2G15A 4HYUA 1QPJA 3P7BA 3R9RA 3IDPA 2BHEA 2JAVA 4MH7A 4X2GA 5FWKK 5BVKA 3ZO2A 3ZZEA 5JMSA 3Q9WA 2WTIA 4QMZA 5H9BA 2HW6A 4OAUC 3TIZA 4AW0A 3TL8A 5CT7A 2BZKB 5CXZA 3KRXA 5IQFA 3LFNA 1SVGA 4EL9A 4PNKA 4Q9SA 2VWXA 3G90X 4BIBA 1WBNA 1TQMA 1HCKA 1TKIA 3NPCA 3IDCA 4FZFB 4IFCA 3QC4A 4KWPA 1XHAA 4QTAA 4KA3A 5DR2A 3ZO1A 3L8PA 1JPAA 2W5BA 5BYYA 4I4EA 1R0EA 3CTHA 3HDMA 1SM2A 4TT7A 3B8QA 3ZH8A 4BWXA 4E8AA 4EC8A 4ERKA 4Y95A 1JQHA 3P08A 3QD2B 4ZAUA 2IWIA 2WXVA 3B2TA 5DNRA 4YHJA 4U8ZA 4C4HA 2CKPA 3FC2A 2P2HA 3DK3A 3PP1A 3EZRA 3B8RA 3DJ6A 4G5JA 4NFMA 1MRYA 2WTDA 3LXPA 4YSMA 5CENA 3VBQA 2NRUA 4GMYA 3T9IA 4CKIA 3I60A 3IS5A 2PU8A 3Q9YA 4EH2A 2WIHA 4WG5A 4MXOA 3QCQA 5DMZA 5AFVA 4AZTA 3C50A 4MF1A 3IGOA 4BBEA 1XBCA 2ZV2A 2XNPA 3PUPA 5CSVA 3BYOA 4GJ2A 3SOAA 3UDBA 2YIRA 2LGCA 2XK8A 3II5A 3R01A 4M68A 3Q2MA 2XK9A 4APPA 2VNWA 5L6WL 4AF3A 4C33A 1P2AA 2G01A 4XRJA 2YM4A 4CFMA 2GFSA 2RGPA 3QLFA 4GYGA 3NNWA 1PYXA 4OBOA 5EHYA 2PE2A 3PG3A 4X2KA 5AA8A 3RHKA 3RPYA 5JKGA 2YISA 4K9YA 5EYDA 1CDKA 3DB6A 4JRNA 3DBDA 3ENHA 4MQ2A 1KE6A 4WIHA 5FTQA 4NYEA 1K9AA 3CY3A 3LZBA 4XS2A 2V5QA 4XG4A 3OXZA 3TIYA 5HTBA 2XRUA 2ACXA 2GFCA 1MQ4A 1OKYA 4FIFA 4BZNA 4E26A 3O8TA 4DT8A 5LQFA 2RIOA 1ZYLA 4CLIA 1IAJA 3DTWA 2OZAB 4O2PA 3U54A 2CJMA 3QAME 3PXKA 3W2OA 2W1FA 2ITQA 2C6LA 3P86A 3QQGA 1CM8A 4J99A 4XP3A 2IW8A 1FQ1B 2QOIA 2QOOA 2BFXA 4LQMA 3U6HA 4EHGA 5F95A 4O7LA 4PL3A 5FLFA 1BI8A 4EH3A 4JL9A 5JEBA 4BKYA 4IVAA 4CZUA 5ANJA 4FTIA 4M7IA 1B6CB 3PSCA 5CTPA 3FBVA 5AR2A 5IF1A 3IW6A 3DAKA 4G9RA 5AIRA 4YMJA 4CCUA 3DJ7A 4DFXE 2C1AA 5K0XA 5EKOA 4YLJA 3ZHPC 3I6UA 3HV4A 3ZONA 4W4XA 2X2MA 3VJOA 3W8QA 4C3RA 4M67A 4C4IA 3TNPC 5LJJA 3O2MA 3DKOA 1REJA 2R3MA 2ITOA 2XB7A 2YN8A 2WTKB 4C36A 5HU3A 4IFGA 2JITA 4AU8A 3U6JA 3BYSA 5KZIA 3LMHA 4FV5A 1ERKA 1UNGA 3VVHA 3DAJA 1SYKA 4RVLA 4EEVA 2CCIA 4EK8A 4MD9E 5IH4A 4B99A 4BR3A 5KCVA 1LUFA 1JLUE 5JRQA 3QRIA 1RE8A 2Y8OA 1XH4A 3HVCA 4FIJA 4CZTA 1ZXEA 4E5BA 1Q61A 4FZDB 1UV5A 1WVYA 5FEDA 2REIA 4F6UA 5J7BA 4LGHA 4DLIA 1ZMVA 1XH5A 1M14A 3R73A 1SVEA 2QOHA 2B1PA 1PKDA 3F2AA 1XQZA 2UW5A 5EW9A 3LKMA 5GJFA 5EM5A 2UW6A 1PHKA 3MA6A 3UOHA 4IHPA 3F3ZA 2P0CA 2XNNA 3COKA 3R28A 4QP9A 2R5TA 4QP1A 4TL0A 3QWJA 4RC2A 2FUMA 3JY0A 4GK3A 3PWDA 3V04A 2R4BA 5L2TA 2X6DA 2R3FA 3PTGA 5IH6A 2UV2A 1PXPA 3GC7A 3PPZA 3I0OA 4I94A 3TNIA 1GJOA 1U4DA 4E7WA 5EQPA 4LV8A 3OP5A 5D11A 5A54A 3RK7A 4GW8A 5L2SA 4DTBA 2ZDTA 3ZLWA 1UKHA 2JDTA 3R22A 4HVGA 4MQ1A 1OVEA 3EFKA 5HEZA 2W7XA 3ZLYA 2UW3A 2VWUA 4XV9A 3P5KA 3QUEA 4P90A 3UVPA 2VWIA 4MEDA 3UC3A 2QQ7A 5F94A 4O6LA 3R1NA 3ZO4A 4LL5A 1TQPA 4USFA 2ZMDA 2B55A 2R2PA 3QFVA 4FKRA 4RZWA 4FKIA 1IAHA 2V7AA 4RMZA 4USEA 3LOKA 4DFBA 4U97A 4IAYA 2BAKA 4MK0A 2J2IB 4EH5A 4F6SA 3U6IA 5DFPA 3UGCA 5AAGA 2CLXA 2EXCX 2CNVA 4J71A 5E92A 4CVAA 4GFMA 3SGCA 1OMWA 3Q04A 3WYXA 5LMKC 3F3VA 4OTIA 4CYIA 2P55A 3AT4A 3GXLA 4O2ZA 4OTGA 4F7LA 2HCKA 1XR1A 1AGWA 4O0UA 2W99B 1XKKA 2VX3A 3PZEA 4AAAA 2OIDA 2QHMA 3L9PA 3H10A 5AUXA 2XIXA 5E8ZA 3D7TA 4RWJA 3M1SA 1W84A 1Q8UA 4L52A 3Q32A 1UU7A 3FKLA 3WI6A 4YHTA 4HCUA 3JVSA 4NJ3A 3DK7A 3KRWA 3ZU7A 1GY3A 4DFZE 4EWQA 1UWJA 4PDSA 4AZVA 4K33A 1YOMA 3CJFA 1F3MC 4XG3A 4NTSA 1J91A 4BHNA 2I0EA 4BI0A 4F63A 5L4QA 2BCJA 2PMIA 4C7TA 2PUPA 2WB8A 3G9LX 3H3CA 3PRFA 2YCFA 4QRCA 5D7VA 3SOCA 5EDRA 2V62A 5CQWA 2OLCA 4D9TA 3KN6A 3QHRA 4HNFA 2A27A 1PXMA 2C1BA 4FT5A 1FGKA 3S95A 3KXNA 1XJDA 1PMNA 3R8PA 2PTKA 3DV3A 4DYMA 4IDTA 5H2UA 2FSOX 2B9IA 2BIKB 3KC3A 5E8WA 4FSQA 3QX2A 4RJ8A 3VJNA 4BI1A 2PZ5A 4I21A 3UIBA 4I5CA 3S2PA 1OL6A 3KU2A 3LCSA 4M14A 5CSXA 4ZSEA 3N4UA 4X3FB 3C4WA 4JG6A 3VUTA 3OW4A 4BWPA 3KXHA 4WRSA 2BRGA 3GCUA 3GENA 1WFCA 2Q0BA 2QURA 4NCTA 4EHEA 3PIZA 1YDTE 4UMTA 4I0TA 1W0XC 4XG6A 4BCKA 3ZXZA 2I0VA 2VV9A 1NVSA 3KMMA 1BUHA 1VYWA 1WAKA 3GU7A 3F2NA 4FTRA 2P3GX 4FL1A 3MPMA 4ACMA 5BVNA 4E4XA 3GQLA 4AW2A 5JQ5A 3BBWA 1FMOE 1U54A
chains in the Genus database with same CATH superfamily
3NS9A 3QZFA 4UALA 4MXCA 4A9YA 3P7AA 2XA4A 4DCAA 2FO0A 1GZOA 2GQSA 2CLQA 5HCZA 5J9YA 3BYUA 3KCKA 3PJ8A 5T68A 3PSBA 3M11A 3BV2A 5IQAA 4PQNA 5FXQA 3HKOA 3PIXA 3OG7A 1VJYA 4BHZA 1E9HA 2WMVA 4DEAA 5HKMA 3NYVA 3W2CA 5AR7A 1RQQA 2A2AA 2BIYA 4YZMA 3U4WA 3CBLA 4O7VA 5AR5A 1ZY4A 4UYAA 5D12A 4QMPA 5B0XA 4O0XA 3G33A 4YJNA 3NUPA 4FKGA 1MRVA 1ZARA 4JAIA 4AXAA 3UJGA 3GEQA 5I9YA 1KE8A 4L7SA 2BDJA 2BZHB 3F2RA 1JVPP 4FL2A 1W98A 3E8EA 4CKJA 3Q3BA 5AP2A 5IMXA 1PKGA 4EBVA 3TTIA 1WBSA 5ETFA 4ORKA 3THBA 4PTGA 4P2KA 5C01A 3A7HA 4IB5A 5ANEA 4DFNA 4O7WA 1MRUA 4EH9A 2QU5A 5E1SA 3UYSA 4BCGA 4FEUA 4YJUA 5IKWA 5D1JA 3ANQA 1PXKA 4GIHA 1WBTA 3D2IA 4O86A 3ORPA 3M2WA 5JGBA 3PVGA 4HPTE 1CKIA 4X6RA 2QOFA 3O50A 4FGRA 3FMHA 5KHWA 5ANIA 4TXCA 2I1MA 4DHIB 3HEGA 2ITPA 1G8SA 4AE6A 1G3NA 4S32A 2H34A 3HMMA 3ML1A 1KOAA 3NNXA 3PLSA 3UMWA 1GIIA 4L8MA 5LVNA 4FNXA 3VBVA 2PVKA 5HO8A 1R39A 2QOKA 3MTFA 5BX0A 3E92A 4D55A 3RGFA 5CEQA 1Z5MA 4D1XA 2WMXA 5E8TA 1FVRA 1LP4A 1A06A 2IZUA 4NM0A 5LMKA 2DYLA 3K3IA 1OBDA 1AQ1A 1LPUA 2WFYA 3QRJA 2O63A 4R3CA 1J7LA 5CSPA 5FG8A 4N6ZA 3TKUA 4CSVA 3ZM9A 3FL4A 2C68A 4QMYA 1LR4A 3NUAA 5JT2A 4YP8A 3D5XA 3W2PA 2X0GA 5KMOA 5ACBC 3CR0A 2C6DA 3EKNA 3PJ3A 4RJ5A 5DH3A 5E90A 4EOSA 2VTQA 4FV1A 3QYWA 4RIWA 2KULA 2QG7A 3C7QA 4ZSGA 3SW4A 5C8MA 4DH3A 3DCVA 4EYMA 3L8SA 3KGAA 2B9JA 3WIGA 1XO2B 2UZTA 1O9UA 5IA4A 1OIUA 2W1HA 1J1CA 2WQNA 3OUNB 4V05A 5M4FA 3KK8A 3CSVA 3MPAA 3EFLA 4ZLYA 4FE2A 3VS5A 2GHLA 4JBOA 3R9NA 5KUPA 2I6LA 2J0KA 3BEGA 4IAIA 3GUBA 2WMRA 3DT1A 3EQPA 4J1RA 4V0GB 2VX1A 1DAYA 4RIXA 4BBFA 4ENXA 3GOKA 4FZ7A 3ZC6A 2WMQA 2PWLA 2X2KA 4D5HA 3EL7A 1WCCA 2RSVA 1W83A 4TW9A 5HNGA 4OR5A 4QMTA 1GZKA 2IZSA 4BDDA 4BVUA 2CCHA 3P79A 2UW4A 3KVWA 4FEQA 2PHKA 4D9UA 4R5SA 1M17A 2XCKA 2XNBA 4DEGA 5GJGA 4FSZA 4I22A 4I6LA 4RZVA 4FSMA 3LXKA 3OF0A 5BVOA 5AP5A 2ITWA 3FV8A 4ASZA 1Q8TA 4FOCA 4BCQA 2QO2A 2GNLA 2IN6A 2KTYA 2ZDUA 4E20A 3MJ1A 3BGQA 5HO6A 4YUQA 3JUHA 4FNZA 3RAIA 1YWNA 5J1WA 1URCA 3C9WA 4O4DA 1PYEA 4P5QA 2C5VA 2YZAA 3I4BA 4NH1A 4BJJA 4D58A 5HIBA 3W18A 5KBQA 4BDEA 3LFDA 2OJGA 3OVVA 4IANA 1W82A 3BU3A 4OTQA 3V5QA 2BFYA 4XP2A 2E9VA 1YOLA 3QRKA 4OTHA 3A7JA 4F6WA 3FI8A 4FSTA 3NUYA 4LRKA 3SRVB 1SNXA 2OXXA 2BVAA 3NDMA 4IAZA 3OEZA 4BICA 2X7GA 4KS7A 3OD6X 4EYJA 4FEWA 4LDTA 3WF5A 3ROYA 2R7IA 1PXNA 4BIEA 3ULZA 4EH6A 1IA8A 3COMA 4UWYA 4EQCA 1Q3WA 1E1XA 4W8EA 4C02A 4O84A 4RRVA 4TWPA 3BQRA 1M7NA 3RK5A 2G2FA 1NA7A 2B9FA 4DG3E 2FH9A 3EB0A 4KIOA 4Y83A 2ZM1A 4YJQA 2BMCA 2ZJWA 5CVFA 3C0IA 3ODYX 4FV3A 4JIAA 3SVVA 4YPDA 4RQVA 1R3CA 3QLGA 1Z9XA 5AAEA 4ZY4A 3MS9A 3VQUA 3A7IA 5C4LA 4MTAA 3CPCA 4IXPA 5J7HA 3KRLA 3LFQA 2XM8A 4AT5A 4O22A 3BCEA 3ZS5A 5K4JA 2OF2A 3BYMA 3JR1A 3UG1A 4QMOA 4YTCA 2ETMA 4GUBA 3CCNA 4FTCA 4I4FA 5JFXA 1PMVA 3ORXA 3LQ5A 3BL7A 3IK3A 2AC3A 2W06A 3FZTA 4Q9ZA 1JSUA 3CGOA 2CNQA 5HIDA 5GZ9A 3NW5A 4L6QA 3SG9A 3S3IA 2QLQA 4H39A 2PZPA 3QKMA 4JT3A 2R3OA 2I7QA 5E8YA 3O7LD 5DOSA 3MH1A 3V5TA 1PXIA 1YI3A 2WQMA 1OM1A 3U9NA 2B4SB 3T8OA 4CT2A 3REPA 1G8KA 3MIYA 1WBVA 1QCFA 2WNTA 5BUJA 3PZHA 4BDCA 5JGDA 3TNHA 4FT0A 4ANNA 2Z7SA 5KO1A 5HX8A 5EH0A 2RF9A 3A8XA 3QKKA 5T3QA 3RCJA 3DZQA 1O6LA 4YJSA 5IU2A 2R3JA 2FSLX 5IG1A 4FEVA 2ITVA 4FZAB 3QBNA 3FZRA 3H9RA 5KKRB 3I7CA 4ZJIA 3UIUA 2VTHA 3ATTA 4I3ZA 4AWIA 4F08A 5LVOA 3KF7A 4XP0A 1M7QA 2F7ZE 3FLNC 5D9HA 1U5RA 4XX9A 4KIKA 3D15A 1OPLA 3FHRA 1J7IA 4UV0A 2WTKC 3HV6A 5LWMA 2G9XA 2XARA 1PW2A 2CGVA 4KAOA 5EDQA 3BRBA 4NIFB 3SX9A 4FNYA 5AWMA 2UVYA 4KIQA 1PMUA 3F69A 4LUEA 4ZTNA 2JKOA 3KMUA 1OPJA 1IG1A 3GB2A 3LJ2A 3FI4A 2V22A 3LM5A 1XH8A 3GP0A 4FTQA 4QP8A 5BYZA 4D0XA 4XG9A 4FODA 4DG2E 2HOGA 3ZBXA 4JDIA 5K5NA 4W8DA 3FMJA 3GFEA 2LAVA 3UQCA 3SW7A 4DHZA 4BTKA 3I7BA 4PWNA 3ROCA 5IA0A 4YO6A 2E9UA 3E8CA 3FXWA 3H0YA 2JAMA 4BDHA 5DIAA 1HOWA 2UZDA 5A14A 2WMUA 2GSFA 2RKUA 4L00A 4AFJA 4BYIA 4XOZA 4KBCA 2YIWA 3I5ZA 3NLBA 2F49A 2OK1A 2YFXA 4XYFA 4CG9A 3BWFA 2A1AB 5AUUA 2GCDA 4EONA 3DNDA 2O3PA 3HRBA 2XJ2A 2C5OA 2DUVA 1G5SA 5BVEA 3IG7A 1Y6AA 3Q9XA 4GU6A 3WE4A 4CTCA 4F7SA 3ATSA 3P5JC 2JBPA 3RWQA 3DXQA 2H96A 1ZOEA 5DWRA 3A8WA 1HCLA 2ERKA 3C0GA 5CU4A 4L01A 1PF8A 3VBWA 3OZ6A 3ZSIA 4RJ3A 1JWHA 3G2FA 3IW4A 4WUAA 5AX9A 2WELA 3NEWA 3VIDA 1QPCA 3IONA 2CSNA 2Z02A 5E4HA 3RM6A 4FKQA 2YWPA 3PY3A 1KOBA 3QGWA 5CT0A 4ANOA 3ZCLA 3I0QA 4M69B 4ZLOA 4S2ZA 1M2QA 1TVOA 3R04A 3R8LA 3NRMA 1IEPA 3E64A 3NW7A 4RVMA 4U81A 4AFEA 3CQWA 1I09A 4FIHA 5I3OA 2XS0A 3CQEA 2NNWB 4ZXTA 3NUUA 3ZC5A 2Q0NA 3FI2A 3P4KA 5KMKA 4MNFA 3RPOA 2VWVA 2R3QA 4LL0A 5HICA 4KKGA 3EHAA 5CLPA 5BV3A 2J0IA 3AQVA 4BZOA 3OUKA 3N4TA 1YHVA 5EQEA 1YXXA 4Z3VA 4ZZNA 3B2WA 3TYKA 4C4JA 4NWMA 5CU2A 4IVCA 3TT0A 5M53A 4HZSA 3I79A 4BIDA 4PP9A 4Q2AA 3RHXA 4EQMA 1PXLA 5I4NA 5AV4A 1Y6BA 2VTNA 4Z9LA 3KN5A 5A46A 4S31A 4YHFA 3KQ7A 1OKVA 5HBJA 5IDNA 2HAKA 4DEEA 2W4JA 3E3BX 2RL5A 4TYIA 4IM2A 5FEQA 3JY9A 4FK3A 4FSRA 4N0SA 4DHJA 3MH0A 4EOOA 5M44A 2UZUE 5DEYA 5KZ0A 4TNDA 3C4ZA 4CCBA 2X4FA 4GL9A 2JDVA 1V0PA 4D2SA 4RGJA 4PTEA 3UVRA 3TZ9A 5CEPA 5HIEA 5CU6A 4BDAA 2OZAA 3HUCA 1I44A 4XOYA 2X2LA 4C38A 2XYNA 4NM5A 2YAAA 3F88A 4OBQA 2XIRA 2YCSA 3R7IA 2PE0A 3V8TA 4JG8A 5EHOA 1FPUA 4CFNA 3HV7A 3GI3A 2W9FB 5A4CA 3D5VA 2YERA 3OC1A 3TKHA 5F9EA 3DXNA 1A48A 5DEWA 5J5TA 3PSDA 2W1GA 2V7OA 2XK4A 3PPKA 4GKIA 4RVTA 4AGCA 4ZMFA 4FNWA 1U5QA 4ZSJA 4F4PA 2AYPA 3C4CA 3DLSA 1H1RA 4QYFA 4YJPA 4YJTA 3T9TA 5FTGA 3FXXA 1ZAOA 4NFNA 1JKLA 2NRYA 2GDOA 4EK5A 4YR8A 3MWUA 5CEMA 3CS9A 3BHYA 4UEUA 4N4SA 5AP6A 1FGIA 4AN3A 4BN1A 3FLWA 3BE2A 5HORA 2X8IA 4EHZA 5K4IA 4WKQA 1T46A 4G17A 3F6XA 3LXNA 3JPVA 2QOBA 1NW1A 4ASEA 2FB8A 5KHXA 3BV3A 3EQIA 4LUDA 1G8AA 4PV0A 4ZIMA 4IX5A 2IVTA 3BIZA 3FWQA 3NUSA 3K2LA 4HYSA 4I1ZA 3TEIA 1BX6A 5AV0A 3WIKA 1ZZLA 3WZDA 3BQCA 5L6OA 4L3LA 5FGKA 3LQ3A 2AUHA 1PJKA 2V55A 3PYYA 5BVWA 3L1SA 3R2YA 3OWKA 3EN5A 4TYHB 4BTMA 4PMMA 3CC6A 5IA2A 3ITZA 3W0PA 4YZBA 1M52A 1S9JA 4A9UA 3KL8A 2VTAA 2VNYA 3Q6UA 3BKBA 1Y8YA 3VHKA 2QI8A 4HYHA 4UXLA 3R9HA 5JK3A 4FV6A 4ENYA 4YTHA 4H3QA 2GHMA 2JC6A 5HVKA 5JZJA 1TQIA 3HDNA 3LCTA 3VUDA 3OWLA 4CMTA 4QYEA 4ERWA 2IO6A 4IJ9A 5HD4A 4FVRA 2CGXA 4DH1A 4LI5A 3WBLA 1GIJA 3FEGA 3H9FA 2F4JA 3MH3A 3MY0A 2WPAA 2PK9A 4JNWA 4RWKA 4NW6A 4C0TA 2PVLA 3FY0A 4YJVA 4TNBA 5D41A 3SQQA 3S4QA 1GOLA 1NT2A 4RFMA 4RG0A 5CAQA 3ZUVA 2A0CX 4D4YA 1IA9A 5TE0A 2JGZA 4BCPA 4Z16A 4OW8A 3ZRMA 4D4RA 1TZDA 3CPBA 2B7AA 4I23A 2R0IA 4NU1A 5FRIA 2C3LA 4BCMA 1FMKA 2GNJA 3JVRA 5AP1A 5CALA 1FBNA 3GNIB 3VUGA 4F1TA 1L3RE 5HG8A 4ZLZA 5C8NA 5I0BA 4O1PA 4FIEA 2RFEA 1H08A 4NM3A 2WMWA 2E9PA 3DU8A 3MYGA 4FICA 5F1ZA 2IVUA 5FBNC 2NP8A 5IDPA 1L8TA 3R7EA 1KV2A 3TJDA 3EL8A 1YHSA 4PPCA 4A4XA 2XAMA 4IAFA 3AD5A 2JIIA 1JKTA 3O96A 4LYNA 5IH5A 4U5JA 2J6MA 3PG1A 3VUMA 3ZUUA 4XH6A 1KE9A 4YZDA 4WNKA 3LMGA 2QKRA 4FV8A 2ONLC 3UZPA 3FSKA 2YLFA 3A4OX 2R0UA 3MI9A 1WBWA 4O91A 3W0MA 1P4FA 4MCVA 3DFCB 3DAEA 3D0EA 1MP8A 4O0TA 5A4TA 5HE2A 2BRMA 2QKWB 3ZLXA 4AAYA 1YQJA 3O5AA 3ORKA 4NEUA 4IX4A 2CPKE 2JDSA 3G51A 4G3DA 4NCTC 4F1MA 2ZM3A 2CGUA 4GKHA 3E93A 2WQEA 4TPTA 1K2PA 4WOVA 5FEEA 5HVYA 4PDPA 4HYIA 3VO3A 4GJ3A 3OCTA 2UW7A 1Y91A 4HVSA 4FA2A 4JOAA 1Q8WA 3DGKA 3I6WA 2F2CB 3HYHA 3LFBA 5AM6A 5CU0A 2Q83A 4AE9A 3MESA 3DS6A 4IH8A 4CRSA 4O7ZA 2XBAA 3VF8A 2RFSA 3EQDA 4UWCA 3WYYA 4WNMA 4B0GA 4C58A 4DBNA 4QTEA 2P2IA 4HW7A 1OITA 1V0OA 4YZNA 3F5PA 4AA0A 3DKCA 2J5FA 3UBDA 4D2PA 4EOIA 4L9IA 1XH6A 5E8VA 4CFVA 3R8UA 3E87A 3AKLA 2YEXA 3FDNA 3QTXA 3FPMA 3D14A 2UZOA 4U3YA 4WNPA 2WZJA 4RJ7A 5HTCA 4GRBA 4KINA 3TCPA 4E93A 4X3FA 5M08A 4S30A 3C1XA 3UODA 3VBTA 5D7AA 3EKKA 5C03A 2RG6A 3FQEA 2JFLA 3R8VA 4A4OA 1OUKA 2C6KA 3ACKA 2XIYA 3OBGA 4K1BA 3ZRLA 4F0FA 3TDVA 2QO7A 4DINA 4YGAA 5L2QA 3ODZX 3I5NA 5HU9A 4TY1A 5E8UA 2WO6A 3TACA 3UPZA 3ZUTA 4G9CA 4IIRA 3UNZA 3COIA 3MV5A 3QTRA 3R71A 3DBQA 5IUIA 4HNIA 3D83A 4ANSA 3ZFYA 1JSVA 3NX8A 4CT1A 3ORLA 2O0UA 3VRZA 3AT2A 3FI3A 3RK9A 3VUKA 3MBLA 2XJ1A 4LM5A 4KB8A 4WO5A 4OTDA 4A9TA 3MVHA 4FT7A 4WUNA 3Q5IA 5J79A 4C4GA 3NVMB 2R9SA 3MVJA 4RVKA 4J95A 3ZBFA 3GBZA 3MA3A 4QTDA 2W1DA 4UBAA 4ACGA 5BVFA 4BF2A 2C5XA 3IW8A 2OI4X 3BYVA 4ZJJA 5DGZA 4ZS4A 3UO4A 3G0FA 4ACDA 4G34A 4ASDA 4LGDA 3MN3A 4AACA 3HGKA 3VUHA 1VR2A 4J96A 2UZWE 2WTCA 3SXRA 3MB6A 4AGDA 4H58A 4HGEA 4IVBA 4WG4A 4R1YA 3L8XA 2YIYA 3VC4A 4IJPA 4PL5A 3TDWA 4FK6A 4M84A 1UU3A 3PIYA 1CKJA 3PP0A 2HY81 2VWWA 4C3PA 1P4OA 3IDBA 3D7ZA 2C3IB 4IVDA 4FSUA 5EYCA 3CTQA 2EWAA 2G2IA 5J8IA 2ITZA 3RZBA 1J7UA 1VLRA 4EZ3A 5EKNA 1OI9A 5HLPA 5HBHA 2BTRA 4OUCA 2PUUA 2VTOA 3N4VA 1WMKA 1RW8A 3BEAA 1OGYA 1U59A 2YWVA 5A4QA 2R3PA 4E3CA 3FQSA 2QLUA 3LCKA 3SD0A 3IOKA 2UW0A 3DKFA 5TKDA 3NMUF 2JD5A 2EB3A 3OROA 4JS8A 5ETIA 2ITNA 5HG5A 5FM2A 2X8DA 4C57A 3W1FA 5KKRC 2J90A 2ONLA 4RIOA 5DR6A 3LFCA 4FT3A 3H30A 1JSTA 4YC6A 3ZDUA 4ZS0A 2X39A 3UZTA 5AR4A 1ZMWA 3MGYA 5EOBA 2R7BA 3OCGA 5D10A 4U0IA 2ESMA 3WZUA 3ZLSA 3ZSGA 5DN3A 5CF4A 3EJ1A 4FTTA 2WMBA 2R3HA 5GZAA 4DGOA 4PL4A 2C0OA 3Q96A 2Y4IB 4YNEA 3F7WA 3QQJA 4OAVB 4JDHA 3G0EA 3IQ7A 3TNWA 4UN0C 1X8BA 3PUFC 2A98A 5M4UA 4FL3A 5L3AA 3S00A 2G1TA 4I6QA 1MQBA 4PY1A 3V6SA 4FX3A 4AUAA 2JKQA 4MHAA 4O6EA 2OKRA 1KV1A 4IWOA 4OTRA 3R7GA 2JKKA 4R7HA 4Q5EA 4V0GA 5HE3A 4KSQA 4I6BA 5J87A 2EXMA 4P5ZA 4U9AA 3UOKA 4YO4A 3FJQE 5L2IA 4GU9A 2B9HA 4RX7A 3ZTXA 4X6QC 4BFMA 2WOUA 2WGJA 3ORIA 4GT3A 5CASA 5CF8A 3VN9A 3EQCA 3LMIA 3DDPA 4CRLA 3P78A 2JDRA 4IC8A 5AUYA 2XM9A 5CAPA 2XANA 3DBFA 3QTZA 4N70A 5CVGA 4O7RA 2JKMA 4I6HA 3QU0A 5KE0A 5KMLA 4UXQA 5CNOA 4KRDA 4GEOA 2BRBA 4GYIA 1SVHA 2Y9QA 5IEVA 2ZOQA 3WF8A 3ETAA 5DBXA 3CKWA 4F9YA 4WT6A 2VTSA 3IW7A 4J98A 2GHGA 4CG8A 3KK9A 4D1ZA 5E91A 4U44A 3FSFA 2C47A 4FV9A 3F82A 2ZFYA 5KX8A 3QGYA 2PMLX 4IWPA 4JI9A 2SRCA 2J4ZA 3ORMA 3C0HA 3EQRA 3P9JA 3LQ8A 4K18A 4IM0A 2YCRA 2OZOA 4W4YA 4O0RA 5CS6A 5DPVA 4BCOA 5JQ8A 2XIKA 4W9WA 4EI4A 4O0VA 3QTUA 3AC2A 1JBPE 4F9WA 3SRVA 5CEOA 1H4LA 1YDRE 3AGLA 4TRLA 5L2WA 4FTUA 3VWAA 2OSCA 5JFSA 3WZKA 3TKIA 4TKSA 4X0MA 4GVAA 3FLQA 4X3JA 4BYJA 5LCJA 3PXYA 3F5XA 3CXWA 4AG8A 4DEHA 4RA5A 2BROA 1CKPA 5EI8A 4R3RA 4G5PA 2R3GA 3G15A 3DNEA 2C6OA 4A07A 4FIIA 3Q6WA 1GZNA 1KSWA 2C69A 4RFZA 5EW3A 4CFWA 4EH8A 3QXOA 3UIXA 2PMNX 3GC0A 4QP4A 5IISA 5I9ZA 1KE7A 3CY2A 2BRHA 4IM3A 4M97A 3VBXA 4YURA 4AX8A 3GQIA 3PXRA 3HUBA 3EMGA 4QOXA 3KA0A 3SG8A 4H1MA 2X1NA 3EN6A 3V5LA 5LOHA 3ACJA 5G1XA 3BGPA 3TV6A 2Z60A 3OS3A 1LEWA 2YM7A 2OJ9A 3KRJA 4FVQA 4L44A 4EBWA 2PYWA 4CD0A 4FTMA 3JXWA 4ZSLA 2OBJA 3EQHA 3UNJA 1WBPA 3HMOA 4LRJA 3WZEA 3IOPA 3QYZA 3Q4TA 4GT4A 4I5HA 3RBWA 2PZIA 4C2VA 5KMIA 4DE4A 4R1VA 5K5XA 3V5WA 4AZWA 3NVKI 3PA4A 4JMQA 2FSTX 3KKVA 3E7OA 4FT9A 2IG7A 2GS2A 5BVDA 3DY7A 1OGUA 2XK3A 3E5AA 3Q4CA 1OB3A 4TWCA 5HE0A 3RP9A 2ZV7A 3DB8A 1YXTA 2HZIA 3O51A 4I92A 3WZJA 4UYNA 3C4XA 2C0TA 2W17A 4JQEA 4XV1A 2XBJA 4L7FA 4QMSA 3ZOSA 3ZYAA 5L6PA 2R3LA 2ZM4A 4ZZOA 2X6EA 4MD7E 1Q8ZA 3VS4A 3FYKX 3KF4A 1K3AA 4JQ8A 5EFQA 5CF6A 3DTCA 3OEFX 2WD1A 4MUQA 4NIFA 3OY3A 3AGMA 4BJJB 4NW5A 2OF4A 5I3RA 4IC7A 1OPKA 3TZMA 4QQCA 1OL7A 4ITJA 5HVJA 5AA9A 5HE1A 2HW7A 2V0DA 3R7OA 3VUIA 2W1EA 4R7IA 1Y57A 4DG0E 4O82A 5IQBA 2W5AA 3QQFA 3ET7A 2IF8A 2B52A 4BL1A 4U79A 3HMNA 4GVJA 4E4MA 1PRYA 3W0RA 2QHNA 5GIPE 4M66A 4Y8DA 4KNBA 3CGFA 4LOOA 4FKPA 4U45A 3D4QA 5J9ZA 4WD5A 5IA5A 3FY2A 3L8VA 2UW9A 3LXLA 5E8XA 5AUZA 4FTKA 2YM6A 3QCYA 4GCJA 4PF4A 4DFYA 4U42A 5M4CA 5F20A 5HNIX 4FVPA 4ID7A 1TFFA 5I9VA 1H8FA 3LPBA 3E88A 4PMTA 1QMZA 2HY0A 4FTLA 1Q5KA 4RIYB 4DDIA 4FR4A 4UY9A 4L43A 2UUEA 4QYGA 4DFLA 5LMBA 2YDJA 3ORTA 4MAOA 4G6NA 3RAHA 1XBAA 2R3RA 3NWWA 4O7SA 4BB4A 5AP4A 2PUNA 4FTJA 5FD2A 3UMXA 3A60A 4N57A 2YACA 4EOJA 4HCVA 3UG2A 4FKJA 4G6LA 1H24A 4M69A 5A6NA 5KMMA 4PUZA 4IWQA 3DDQA 3N51A 5IQHA 4D2VA 4EH7A 4O21A 4MNEB 3R02A 5L8KA 4PNIA 4DH7A 3DFAA 3ANRA 3MY1A 3LCOA 2F7XE 4BBMA 2WAJA 3SC1A 1H00A 4FTOA 4DCEA 3DA6A 3HAMA 1YXVA 2UZBA 4IB0A 4O81A 3FUPA 3AKJA 2VTJA 5TR6A 1YVJA 3FZPA 1YWRA 5HOAA 3OT8A 5M06A 4ANBA 4FBXA 3GCSA 2B53A 3FE3A 3HX4A 3K54A 3BLHA 3LIJA 5EYKA 4RIWB 1LEZA 3GU4A 4YBJA 4ZTLA 2H9VA 2XEZA 3SXSA 3CD8A 3DZOA 1VYZA 3V3VA 4DC2A 2QOCA 2OJIA 1VEBA 3FMMA 2OO8X 3CP9A 2GNFA 4JIKA 4QP7A 2VTRA 3MIAA 3RPVA 3RNIA 3RZFA 5GZ8A 3D2KA 5LCKA 2BKKA 5B2MA 3MH2A 4CFXA 3AC4A 3NYXA 4K8AA 4D4VA 4DEIA 2PVRA 2W1IA 3O0GA 5BQ0A 1H0WA 2PZRA 4F7JA 1J3HA 2BAQA 3F5GA 4G31A 3TM0A 4BI2A 3HNGA 2WQOA 3OMVA 2Z7LA 3Q60A 3BHUA 5CAVA 3ZFXA 1DS5A 1Q99A 3KFAA 4CV9A 4X2JA 2Y7JA 2GS6A 3VQHA 2GNHA 3F5UA 4OT6A 3QQUA 3FYJX 4XMOA 4OTFA 5IA3A 4I5MA 4KABA 4JJRA 3A61A 5T6KA 4FOBA 3V51A 4C61A 3RALA 4L67A 2UVXA 3RI1A 4RC4A 3EYHA 4FKSA 5GINE 3FPQA 4DT9A 2YA9A 4GV1A 3EH9A 5DRBA 1H1SA 1P5EA 2C3JA 3R7UA 4DBXA 4Y85A 4R78A 1CMKE 4XV3A 3EWHA 5C26A 4DGNA 2YM5A 3HMIA 2A4LA 2BALA 3R21A 3VRYA 4EJ7A 5CQUA 3QWKA 5EM8A 3NYNA 4UMUA 3VS1A 4LV5A 3R6XA 4GFOA 4I93A 3BU5A 4EORA 2PVMA 5DR9A 4L68A 2HENA 4K77A 4ZY6A 3OW3A 1IASA 3PJ2A 5EW8A 2R64A 4ZSAA 3Q9ZA 3R8ZA 3CEKA 4CNHA 4II5A 3ZEPA 5CVHA 3QQKA 5AEPA 5AP7A 4GK2A 2X7FA 3KVXA 4JBQA 3FLSA 3MB7A 1ZOGA 3UTOA 4AQCA 5K9IA 4M12A 1GAGA 4JDJA 5CZHA 3HP5A 4WHZA 3V8WA 4D1SA 2VTLA 3PFQA 5CI6A 5AUWA 4E5AX 2FVDA 4BY9E 2RFNA 3RCDA 2AQXA 4TYHA 4FYOA 5HG9A 3UQFA 2PZYA 2IW6A 2VUWA 5M55A 1G8JA 1F5QA 2H6DA 2HWPA 5IQCA 4WG3A 4U3ZA 4ANMA 3QUPA 3ERKA 4CKRA 5A9UA 1MUOA 1W7HA 1SNUA 3ALNA 3AXWA 3IGGA 5B2KA 3VULA 4ARKA 1ZLTA 5DT3A 3V5JA 3G9NA 3P1AA 5G6VA 2GU8A 3OOMA 5AP0A 3VNTA 1ND4A 1ZMUA 4IZ5A 2VTMA 1YXSA 4BTJA 4RJ4A 1OKWA 1PXOA 2C3KA 2OXDA 5HG7A 2VGPA 4E4LA 3TN8A 2GNIA 3PA3A 5AUVA 4D0WA 2WMTA 3HV5A 2VTIA 4TWNA 1H01A 1H1QA 2PY3A 4M0YA 1BL7A 3H9OA 3K5UA 1UU9A 2Y0AA 4ACCA 4ZEGA 2P4IA 4ANQA 3LE6A 2HXQA 4PMSA 4K2RA 4L42A 4IACA 3MTLA 2QNJA 1UWHA 3QALE 3UQGA 4OBPA 2XMYA 4GFGA 3WOWA 2YABA 2WEVA 4Z7HA 1EH4A 5A6OA 4IB1A 3D9VA 3NUNA 2WOTA 4NJDA 2F7EE 5JGAA 4AZFA 3POOA 2YAKA 2F2UA 4RLKA 5IEYA 3BELA 2I40A 3R30A 1IR3A 4UX9A 3ZSHA 3TI1A 2A19B 3PVBA 1W8CA 4X21A 1H28A 3UOJA 3SKCA 3E8NA 2ERZE 2UZNA 4RT7A 4QEBA 5TO8A 3KCFA