4DFNA

Crystal structure of spleen tyrosine kinase complexed with an adamantylpyrazine inhibitor
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
274
structure length
269
Chain Sequence
VYLDRKLLTLEDKELGSGNFGTVKKGYYQMKKVVKTVAVKILKPALKDELLAEANVMQQLDNPYIVRMIGICEAESWMLVMEMAELGPLNKYLQQNRHVKDKNIIELVHQVSMGMKYLEESNFVHRDLAARNVLLVTQHYAKISDFGLSKALRADENYYKAQTHGKWPVKWYAPECINYYKFSSKSDVWSFGVLMWEAFSYGQKPYRGMKGSEVTAMLEKGERMGCPAGCPREMYDLMNLCWTYDVENRPGFAAVELRLRNYYYDVVNE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Pyrazine-based Syk kinase inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
molecule keywords Tyrosine-protein kinase SYK
total genus 83
structure length 269
sequence length 274
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2012-01-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4dfnA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4dfnA01
3PFQA 2I0VA 3LM0A 3BEAA 1ZMVA 4Q9SA 4AGUA 4BCFA 5IA0A 4R3PA 2R4BA 2QODA 4O2ZA 4K18A 4RLLA 4IAYA 4JRNA 2JLDA 2OJ9A 3LCTA 4UN0C 2ITTA 2V62A 4I5PA 2X0GA 3QRTA 4NKSA 4WRGA 4QP9A 4BDHA 3A99A 4CZYB 4ZZNA 3HV7A 5GINE 4L45A 5C9CA 3AC8A 2CNVA 2GMXA 4M14A 3C4CA 4RX9A 2R3PA 4ANLA 4WUNA 3LMHA 3LXKA 3BHVA 2B55A 4QYGA 4EZ7A 3NIEA 3Q53A 4CFUA 5CANA 3R8MA 4H39A 5CYIA 2A2AA 3W2OA 2FUMA 3HZTA 3OXIA 4FTAA 4AW2A 3ZBXA 4E8AA 5LWNA 4AA4A 1CTPE 2Y4PA 3WBLA 1H24A 2JC6A 2V22A 2YJRA 1YHVA 2XJ1A 2A0CX 5CSXA 3W2QA 4EOOA 3QQGA 1ZY4A 4MWHA 4YZBA 3AC3A 3MN3A 4O0SA 5JSMA 2F4JA 5HIEA 1UWHA 3FLSA 4ZJJA 3HLLA 5AP7A 1P4OA 3V8SA 2IPXA 1B38A 3VS4A 4MEDA 1OPJA 4XLVA 5B0XA 1WVXA 4IX4A 1RE8A 4HVSA 2J6MA 2X8IA 4QP4A 4MNEB 4RBLA 4X2FA 1U59A 5CU3A 5GZ9A 4DTBA 2ITOA 3C4XA 1WBWA 4FSWA 2PPQA 5EM7A 2IO6A 4N6YA 4WBBB 3HV4A 3S4QA 4WUAA 3NUNA 4AXAA 4EH3A 3KMMA 3NVKI 2W05A 2GQGA 1GIJA 3PP0A 5FRIA 2VO0A 4FC0A 4BZDA 3TDVA 3DXQA 3EQFA 4PTEA 4RIYB 3L9NA 3NAYA 4XS2A 4F9YA 4W9XA 4QYHA 3LFNA 3MY1A 3OHTA 3TL8A 4FIHA 2J90A 5TOZA 2HWOA 4RZVA 3MVJA 2XIKA 1H00A 2VRXA 5BVEA 2FYSA 3MPAA 3PXZA 4NL0A 3LPBA 3FY0A 4CMOA 1YDSE 3GQIA 3K3IA 3MPMA 2R3LA 1W84A 2WO6A 5HKMA 4BCJA 3HNGA 3IK3A 4L42A 1XH5A 1YI3A 2I6LA 3B8RA 1KE7A 2H6DA 3MVMA 3VUHA 1IA9A 3NUAA 2UZVA 3G6HA 2UW7A 3WF8A 5AUVA 3I5ZA 2ONLA 2VZ6A 4G16A 3I79A 4FEQA 1ND4A 3R71A 3DS6A 4PPCA 4RX5A 3CQUA 4RJ8A 2C6LA 2HZNA 2QD9A 4ZTLA 2PZIA 2PUNA 2WOUA 2PMOX 1J7LA 5BQ0A 3K3JA 4HOKA 2BFYA 3DDPA 2IZTA 4YC8A 4C4HA 1E1VA 1Q8YA 4JQ7A 3UZPA 4O6LA 5HEZA 3PVWA 5I0BA 3FXZA 1XH9A 2QOIA 3C9WA 4E6AA 1YWNA 5IQIA 3G6GA 4IADA 4NM5A 3QLFA 2JFLA 5EI6A 5IQBA 3DQWA 3MB6A 5IISA 4HYHA 3R1QA 2O63A 3FDNA 1ZY5A 5E8XA 3RKBA 1WBVA 4YJVA 2RFSA 3R2YA 5E8VA 5AV2A 2JDOA 4EEVA 5M4FA 1J3HA 4RWIA 4FZ7A 3BYSA 2VTSA 4QQJA 3CEKA 1Z9XA 3LHJA 4U7ZA 4I23A 3KGAA 5H8BA 4BZNA 4MH7A 5IDNA 1PYXA 3VQHA 2WGJA 1Q8WA 4I6FA 3W1FA 3OP5A 2QKWB 3V8WA 4ZSAA 3RAWA 4M68A 1GZKA 5DH3A 2ACXA 5HZNA 4AS0A 4N4SA 4ASEA 1XKKA 3E5AA 3TKIA 4E4LA 1DI9A 3QTIA 3QTUA 4EK6A 3MH3A 1XH8A 4F4PA 2UZBA 5IQDA 3V3VA 3UIMA 3WI6A 4EQMA 4G9RA 5IUGA 3BPRA 4LOQA 5DNRA 3W8QA 4D2WA 2XRUA 5HG9A 5GJDA 1K3AA 4LOOA 3LE6A 3QCXA 3QZGA 5I5ZA 4JVGA 3ZRKA 4CRSA 4PMSA 1U5RA 3OCTA 2XNEA 4O86A 2H8HA 3LJ1A 3I0QA 2HZIA 4H36A 3NNUA 3FKNA 3NYVA 4MF1A 4FNWA 4G2FA 4IC7A 5CEQA 3T8OA 3WZJA 3QGYA 4BCNA 4AZTA 3C1XA 5E8WA 4I5CA 5IH6A 4H3PA 2OKRA 4U42A 4I93A 4FV2A 3ZONA 3CY3A 3CLYA 4CVAA 3O2MA 2FA2A 4XBRA 3BWFA 5AV1A 1Q97A 4IZ7A 5DT3A 1DI8A 3DKCA 2I0HA 4FR4A 1W8CA 3DB6A 5J1VA 5DRDA 1REKA 2YABA 3TG1A 1MQ4A 2OK1A 1YXTA 2UVYA 2RSVA 4FSQA 4F7JA 4NZWB 3NS9A 4DEEA 5HIDA 4WBOA 3ULIA 4ID7A 3QL8A 4XG9A 2CDZA 2V7OA 4YJTA 3ZCLA 4DH1A 1PJKA 3DXPA 2C1AA 3KXXA 5E8ZA 5KO1A 2UW9A 4GK3A 4F9AA 2QQ7A 1ZYLA 3FMNA 4FTCA 5EHYA 5AAFA 3ZOSA 4AUAA 3LFFA 4HVGA 4K1BA 3OZ6A 2NP8A 2RFDA 3OWLA 1WVYA 1XQZA 2EXEA 4KBCA 1OVEA 3MW1A 3EQRA 3F7ZA 4DBXA 4FI1A 4FSTA 4L9IA 4I0RA 3QRKA 2E2BA 4R3CA 4C8BA 3V8TA 1OKVA 3QZFA 2IW9A 1VR2A 4KBAA 1LEWA 3VBXA 5HCYA 3WE4A 2YERA 4DINA 3U8WA 4P2KA 2VTIA 3F5XA 4M84A 5AP4A 4M12A 3E3PA 3QWJA 4FL2A 3FZTA 5EOBA 2GFCA 3VBTA 5M53A 2A1AB 4F7SA 4AOIA 4G31A 3UO6A 4KRDA 3I7BA 3ORTA 3ZDUA 1OL1A 3QF9A 5DEYA 5JEBA 3LMIA 3WE8A 1M7QA 4UXLA 2PVMA 5BVOA 2R2PA 2QLUA 4GYIA 3TUCA 3Q32A 3OY1A 4EH5A 2W1DA 1OKYA 4YNOA 2PZYA 3A4PA 3QBNA 4QMSA 1FGIA 5CWZA 4USDA 3HKOA 1GJOA 4NFNA 5AP3A 1OIUA 5I3RA 3EWHA 1JKKA 4XP3A 3FQEA 4XMOA 3FI8A 3DZOA 2YDKA 4FKQA 4JNWA 4FT3A 5DR6A 5HHWA 3DLSA 3W2RA 3EN9A 3WZDA 4IACA 4IB1A 3OOGA 4MXAA 4O7ZA 5ETFA 2BKZA 3OUNB 3V6SA 3A7GA 2W1IA 3IQ7A 4FG9A 4I4FA 4H05A 4XG2A 3QLGA 3IGGA 5TF9A 4Z7HA 4NU1A 3RK9A 2O65A 3BWJA 4G3CA 5JN2A 3FV8A 4ZK5A 4ZY4A 3R7VA 3UQCA 2KULA 3A7JA 3RINA 5AV4A 3FL5A 2C0IA 4UBAA 2YCSA 3MFRA 3ZFMA 3DNDA 1TVOA 4RJ7A 3R9HA 3WOWA 4C02A 5CAOA 5J5SA 3OG7A 4O7TA 5KKRC 3PG1A 2DWBA 4ANMA 1ZARA 1Q8UA 2IVUA 3AT4A 3K5UA 3D7TA 4RWKA 5C26A 3P23A 4J53A 4F08A 4AZEA 5AIRA 2Y4IB 4BFMA 3ZRLA 3ELJA 2OZAB 3BYMA 2OXXA 4L6QA 4NEUA 2VWVA 3EN4A 4RC4A 3KC3A 3NIZA 4DN5A 1L8TA 3CPCA 4FNYA 4OTPA 2VTPA 5CEKA 3BEGA 2ITYA 3FSKA 1NXKA 2WB8A 5AP0A 3S3IA 2AC5A 4FT0A 5KZ0A 3OT3A 2C3JA 5DGZA 2LGCA 1E1XA 1ZMUA 4I24A 5GJGA 3KRWA 3ZBFA 3GB2A 4BCGA 4C36A 4CQEA 1S9JA 5JFVA 3JS2A 3KXZA 4ITIA 4UMUA 5HVYA 3UZTA 3MVLA 5FP6A 2R5TA 5LCKA 4ANNA 4L46A 4BBFA 3BU5A 4HGSA 4D55A 4ASDA 1LPUA 2X39A 4MXCA 4NW5A 2XNOA 3IOPA 4OW8A 2BKKA 4ZMEA 2C1BA 5E7RA 3MSSA 4YTIA 3Q4ZA 3E8CA 3NUPA 1PXJA 1OIRA 3UDBA 5HI2A 3VUKA 4EOJA 1IR3A 5K5NA 3ZC6A 5H8GA 1IEPA 3KK8A 3U9NA 3R63A 2ZB0A 2UW6A 3R9NA 4QMUA 5EH0A 3F9NA 4YTCA 2PVHA 3QQUA 4E5BA 4EHZA 2ZV7A 5EHLA 2Y7JA 5DPVA 3KULA 4DH7A 1Q3WA 5ANEA 4C58A 3CC6A 5LQFA 2XNGA 4BBMA 3AG9A 3PXFA 3R6XA 1MRVA 1NVQA 3CS9A 3SRVA 1OZ1A 3L9MA 3DU8A 3FYJX 2DS1A 5ETAA 2JKMA 4QYEA 3OMVA 3ZLYA 4ZEGA 3GUBA 3MYGA 4J1RA 1VYZA 3R0TA 5AWMA 3DNEA 3DGKA 3IOKA 4LRKA 4FV5A 3LVPA 1R78A 3FKLA 4L8MA 4M7IA 2GS2A 3VRYA 3HGKA 2J51A 3PIXA 5CT0A 5CF8A 3WARA 3PY3A 4LGGA 3G51A 3HV5A 2ZDTA 5A6NA 4RRVA 5A6OA 5CEPA 3WF5A 2GNLA 3GT8A 3IGOA 2YIRA 3L1SA 3T9TA 5CF5A 4RIWA 5ANGA 3QQFA 2GTMA 2NPQA 4U44A 5AX9A 2Q83A 3V04A 3LFSA 2Y6MA 4DEAA 4WRSA 2WQOA 1U54A 3A7FA 5IA4A 3BLHA 3AC1A 4AG8A 3BHHA 4X6RA 3VRZA 5B2LA 4EKKA 4M8TA 2YDIA 4I1ZA 4FIEA 4L3JA 3RPOA 4FKGA 5IQCA 3OT8A 4IH8A 4IWQA 3PUPA 3AMAA 3CKWA 4MWIA 5HVKA 4EC9A 3CCNA 3KU2A 4MXYA 2AYPA 5A54A 3W55A 4M13A 3FHRA 4FVPA 5L8LA 1A48A 4A9TA 1GIHA 1MRYA 4BCQA 5DT4A 4GKIA 4GL9A 1M52A 5ANKA 4YZMA 5HICA 1Q8TA 3ZLSA 1G5SA 4G5JA 3EYGA 3NYNA 1W0XC 2J0IA 4FV9A 5K3YA 4F0GA 2YAAA 2HCKA 2VGOA 3SV0A 1VEBA 5CSPA 5CVHA 1B6CB 1QMZA 3TNWA 3E7VA 1NVRA 3DJ7A 5L2QA 4WG3A 1W82A 3EOCA 3P08A 3RGFA 4FIJA 5TKDA 4A4LA 3DK6A 4TN6A 4DGNA 1APME 2RGPA 3CJFA 3GFWA 5KMIA 4FTTA 4AX8A 3EFKA 5EI8A 1DS5A 4RIXB 3ZZEA 4BDBA 2DYLA 4U9AA 3HVCA 4FTNA 4K9YA 2XIRA 4PDPA 2BHEA 3GQLA 4MXXA 5FM2A 5AM7A 1WBPA 2W17A 4JAIA 5AR4A 4ZZOA 3C50A 3FZOA 3VS0A 2WMRA 2X9FA 3HP5A 2QC6A 4NM7A 1NW1A 2HOGA 4NSTA 2W7XA 3OOMA 3ZUTA 4FICA 3ODZX 1URWA 4WNOA 4EH2A 4KS7A 4EZ5A 3K2LA 3FYKX 1JLUE 2ZOQA 4UZHA 2W1HA 3D2IA 4DGLC 2WMTA 1FVTA 2O2UA 3FJQE 4TYHA 5DWRA 4CV9A 4BHZA 2ITZA 5L8KA 4CNHA 3R9RA 4XP0A 4DFZE 4FT7A 3V6RA 4M0YA 3RAKA 4FF8A 4Y83A 5J7HA 4W4XA 4JG6A 3TACA 4E6CA 4ALUA 3UNKA 4PDOA 1W7HA 4L53A 2VN9A 2UZEA 4W8DA 3V5TA 5DEWA 2YM5A 4IX3A 5KBQA 4CZTA 4O82A 4O0VA 4I3ZA 1PYEA 4XG8A 2XKDA 1JNKA 4EK8A 3RCJA 5B7VA 4CD0A 2QO7A 5HD4A 3RWQA 1Q24A 5EM6A 4JDJA 3OXZA 4EH6A 3BGZA 3PDTA 3S1HA 4V0GA 4FODA 2GNGA 5CLPA 2WNTA 3A7HA 4TY1A 4D5KA 4I6QA 3BIZA 4NH1A 2YISA 3MB7A 1U54B 4V04A 4UMQA 3UMXA 4EHGA 4NJDA 4FG8A 4AT3A 4M97A 5FDPA 4J8MA 2OJJA 4JAJA 3MTLA 4UEUA 3RNIA 4X3FC 4A9SA 5HE1A 3LM5A 1Q99A 2WOTA 2VD5A 3AC5A 3ATSA 3HYHA 4CTCA 3ZSHA 2F57A 4CMTA 3EZRA 4FVQA 4IX5A 3PIYA 3TXOA 4YGAA 1B39A 4IANA 1ZZLA 4F6SA 5E1SA 3CTQA 4BB4A 2XYNA 5FD2A 2HY81 3VHEA 3P79A 1QPDA 4S32A 3U51A 2WMSA 1JOWB 5CU0A 4FUYA 4G17A 5FQDC 3UODA 4ACMA 1ZRZA 2NRYA 1ZMWA 3V51A 3QC4A 4BDCA 4BDFA 4G34A 2X6DA 3BGQA 3MFSA 1O6LA 2VTJA 3G0EA 3OC1A 4R7HA 3KULB 4O7LA 3ZUUA 2VWIA 3GU5A 3T3VA 4DF3A 4APPA 2UW0A 3G0FA 3AT3A 2FH9A 4AZFA 3TTJA 5HTBA 1M2RA 2WEVA 4C59A 1HCKA 2PY3A 3LCDA 3OBJA 4AW5A 5KBRA 2BFXA 3SXSA 3DFAA 1CDKA 5A4LA 3LCOA 3ID6C 2B7AA 3TNQB 4CKIA 2HWPA 1BKXA 3U4UA 4QP8A 4YJPA 5HE2A 4PP7A 2QOCA 5IPJA 3W2CA 4AA0A 2OSCA 5HX8A 2VX0A 4CYIA 4ZZMA 1HOWA 3OTVA 5ANJA 4JRVA 2R7IA 2F2UA 2VO6A 5M51A 3EHAA 1BMKA 3E63A 5HE0A 4X0MA 2Z7SA 5L2IA 4EOSA 5D11A 1G8AA 3EFLA 3IDPA 5BVDA 4OTFA 2ITVA 3ZSGA 1PKGA 4DYMA 2A27A 4RFYA 2X4FA 2VTQA 3SOCA 3HA6A 3UVQA 2C6TA 3U4WA 1FGKA 3ITZA 2R3FA 2YCRA 4EHEA 4Y5QA 4UYNA 5EYMA 5I3OA 1FPUA 2XRWA 4BRXA 5J1WA 3FUPA 5AEPA 3O51A 3DTWA 2XK8A 1H0WA 3SG8A 4L43A 2B1PA 4QMWA 4ANOA 4IIRA 2PE2A 1ATPE 1PW2A 4OTQA 2FSLX 3S0OA 4YR8A 3UO5A 1KE8A 2BIYA 3MDYA 4CFMA 4QTAA 3D7TB 1X8BA 1YDTE 3MA6A 3MGYA 3ORZA 4KIKB 1ZYJA 5IUHA 4KUJA 4HNFA 3LW0A 2PWLA 4HZSA 3JVRA 1DAYA 1PMEA 4FYOA 5C8MA 4EK5A 3NNXA 2ERKA 3SW4A 1WBTA 4K77A 3I60A 4FMQA 4QMLA 4FK3A 4DT9A 5JQ8A 5C03A 4EUTA 3FQHA 3MV5A 4EK4A 4EUUA 1H28A 4B6LA 2WTKC 3RPSA 1PXLA 5T68A 1H25A 3ENHA 5KHWA 4LGHA 3C0HA 5ANIA 1OM1A 2QONA 4FSZA 4OGRA 5G6VA 4DFLA 2VO3A 4M67A 4U0IA 4W4WA 4Y72A 2VWBA 3R01A 4EHVA 4F99A 4UZDA 3S95A 3A8WA 2RF9A 3OEFX 3UVPA 4BICA 4O1PA 4GRBA 4TYGA 4KWPA 3VBWA 1KUTA 4IVBA 1KOBA 4C61A 2P0CA 4FK6A 5CT7A 5H9BA 5C8KA 5IEXA 4CLIA 5CAPA 3FLNC 4DTAA 4RIWB 4K2RA 3SOAA 3O17A 2PZ5A 1OL6A 1ZLTA 3UVRA 4KABA 4LL0A 1OL2A 1QL6A 3GXLA 3PJ8A 4O1OA 3WILA 2XNNA 2C5YA 3HV6A 2C6EA 3II5A 3DK7A 4NTSA 2BTSA 5B2KA 3TV4A 3VUMA 4EWHA 3CGFA 3O8TA 1XH6A 4A07A 5FEDA 4YLJA 5ITAA 2W0JA 2F9GA 3HX4A 2CGWA 5M4CA 4L52A 5DG5A 1UU7A 1SVHA 2P33A 3QRUA 1BI7A 5JH6A 2XK9A 4PY1A 5F94A 4O38A 4ZLOA 4LI5A 2OWBA 3WF7A 1BUHA 3BX5A 3PPJA 4UALA 2YM4A 4PPAA 4YZCA 5A9UA 2BVAA 3T3UA 5HU9A 2PYWA 5KMKA 5EFQA 3F5PA 4QP2A 3LCKA 4LMNA 4PL3A 3P1AA 3VW8A 4F9CA 2XEYA 4A4XA 5AJQA 3R8LA 1I44A 2C0TA 3HDMA 3UYTA 4R78A 2WMUA 5AUZA 3UPXA 4D2RA 2J0JA 4KKEA 1E9HA 4D5HA 3A7IA 5FXSA 2PE0A 4QD6A 1J1BA 3H0YA 3H9FA 4MNEA 3FAAA 2OLCA 2YM6A 2C68A 1Q3DA 5EI2A 4ZSGA 5JFSA 2Z2WA 3VO3A 3WYXA 5GIPE 3F2AA 4QQTA 1Y6AA 2HK5A 3TCPA 3E62A 3UJGA 3QFVA 2I40A 4FSUA 2C3LA 1VYWA 3QU0A 3R83A 3DKGA 1H1QA 4ONAA 1JKLA 3CIKA 1PXKA 4MVFA 3EL8A 1H8FA 5HCXA 4EONA 4O7WA 2P3GX 3HMIA 1RJBA 3GCPA 3VF8A 3R22A 4F1OA 2Z7LA 4M0ZA 3TTIA 4I92A 3VJNA 2JKKA 2VX3A 2XB7A 2WMAA 4GYGA 4RG0A 5CU6A 2ONLC 2BRNA 5CI7A 3TEIA 1ZYCA 5A14A 3H9RA 3RALA 3O0GA 5D12A 3M42A 3W18A 5DFPA 3VS2A 3WZUA 4R8QA 2ZV8A 4NT4A 1IASA 5HOAA 3R9DA 5FTOA 3MESA 2H34A 5K5XA 4DE4A 2GHGA 4S34A 3C4EA 1TQIA 2WZJA 1TQPA 3CXWA 4CZUA 3D5UA 2X9EA 2WTIA 5I4NA 4IM3A 4DFUA 5EDPA 3UTOA 1WMKA 3R21A 4XOZA 5K0KA 2HYYA 4BKZA 2XBAA 3TI1A 5BX0A 3HV3A 3NRMA 3RM6A 4DA5A 3SDJA 2XM9A 1AD5A 4QNAA 3D5WA 3PIZA 4ARKA 4PRJA 4KINA 2VTMA 3JYAA 4HVIA 3OW3A 1KSWA 4BC6A 3R1SA 4BN1A 5CAUA 5L6OA 1SVEA 3VHKA 4MD8E 1UV5A 3AD6A 4ZSLA 2ZAZA 3LFCA 3E93A 3LXLA 5AM6A 4HW7A 3SVVA 4LYNA 1XBCA 1UNGA 2PVFA 3ANRA 5BUEA 3R30A 5KMLA 5FDXA 4ASZA 3DAJA 4GCJA 4DBNA 4ACCA 1M2PA 4GS6A 5DR9A 2Q0NA 2XF0A 2PVRA 2GQSA 3V5PA 3HRBA 2WU6A 5HG5A 3FKOA 3P4KA 4YLLA 3PXKA 3Q9ZA 3U6IA 5JT2A 4PPBA 5CF6A 3ZYAA 5M09A 3F88A 2B9IA 4USEA 1LP4A 4CV8A 1Y57A 3UOLA 2IW6A 4QP1A 4ALWA 4AAAA 4I5MA 4V0GB 2BRGA 5K0XA 2PK9A 3E7OA 4Y95A 2WELA 1O6YA 3W10A 4F7LA 2IVTA 2W06A 1PMVA 3VC4A 4XUFA 4UMPA 3BKBA 5KE0A 2X7OA 3OROA 2CJMA 4E6DA 4BDKA 2OJGA 4WSQA 3CP9A 3DFCB 3PJ3A 4TYJA 4XYFA 3O50A 4CFNA 2C5NA 2HIWA 5TO8A 4C7TA 1H0VA 4NYEA 1G8SA 4NWMA 4UWYA 3FI3A 3U87A 4C4EA 2C30A 2XKEA 4OBQA 3F3WA 5EYCA 1JWHA 1W83A 1IAJA 4AT4A 4GUBA 3R7OA 4QTEA 3NVMB 4CFWA 2J0KA 2UUEA 3HRCA 3UE4A 3ZO2A 1JKTA 3OTUA 3GC0A 4D28A 4EKLA 4PUZA 5CU2A 3O8UA 4FV7A 2CKQA 4DEBA 2BPMA 3IDBA 1OL7A 5HBEA 4U3YA 4A7CA 3HMNA 1Q41A 4AGWA 4MXZA 2OO8X 5JZNA 4DFXE 2GHMA 5IMEA 3G15A 3Q9XA 2VTTA 4JQEA 2BIKB 4GU9A 3D94A 3ZRMA 1R3CA 3FMKA 4CG9A 4D1XA 3B2WA 4QTBA 4U41A 3RTPA 3ZU7A 4DH8A 2P2HA 3LQ5A 5A4CA 4AW0A 4O96A 1ZOEA 2YWVA 3QYWA 4FTKA 4LUEA 2WTKB 4EQCA 3NGAA 3OY3A 4LFIA 4O7VA 1MRUA 1OKZA 2VWZA 3ZC5A 4QMTA 2OF4A 5EDRA 5GJFA 3P5KA 2QURA 4EOKA 2G01A 3PA3A 1SM2A 3RHXA 2Z60A 4X21A 5CNNA 5HGIA 1BL6A 2ETMA 4AE6A 4QYYA 5F1ZA 4XV3A 3IONA 3O71A 4PV0A 4YPSA 4RIOA 4C35A 4U6RA 4S2ZA 3AOXA 4DEGA 4ZTNA 1QPJA 4KKGA 5IA3A 5DLSA 4NIFB 5D41A 3Q9WA 4F64A 3O7LB 2WD1A 5IQGA 5M44A 2BZIB 4USFA 3P0MA 4FZAB 1UU9A 2XK6A 4FEVA 4R1YA 2XK7A 1YI4A 2OH4A 3U55A 4LRJA 4D2PA 4IM2A 3B2TA 5FXQA 2QI8A 4ACDA 3KRLA 3DKOA 3M1SA 2W1GA 4S31A 4A9RA 5DBXA 3QHWA 4CSVA 4O21A 1UKHA 2WEIA 4YBKA 3PA4A 4W9WA 4E5AX 2P2IA 4MD9E 3ZH8A 3QQLA 3UMWA 5EQPA 4Q5HA 1J1CA 4GSBA 3QTWA 5A46A 4RT7A 5LVLA 2UZTA 4EOMA 2R3OA 2JDTA 4ALVA 2WTJA 4IFCA 4G3FA 2ZMCA 1BYGA 3BHUA 3COKA 4JIAA 4OBPA 4GJ3A 3SHEA 4D4VA 3RWPA 2H96A 4F9WA 4YU2A 4TW9A 5LOHA 3EQPA 1UWJA 3G5DA 3VUGA 3ZFXA 1UA2A 4C3PA 3DB8A 3CD3A 3QD3A 2BCJA 4FZDB 3RNYA 5BVFA 1R39A 2BHHA 4PDYA 3Q52A 2VWWA 5EYDA 5CAQA 3CE3A 4M69A 4NK9A 1BX6A 1AQ1A 2QLQA 4XX9A 3FEGA 3IS5A 3ORNA 2BZJA 2VWUA 3H3CA 2FSMX 3OS3A 4C38A 3SG9A 2ZV2A 2J5FA 4B9DA 5HLWA 2QO9A 3VUIA 1ERKA 3COHA 3ZXZA 4AN2A 4C37A 3OVVA 2X81A 2IN6A 1EH4A 5F95A 4DT8A 5DN3A 2FVDA 1OECA 4QMPA 4C62A 5J7BA 4BCOA 3ERKA 3P7CA 3NYOA 2VGPA 4FT9A 4K0YA 5AADA 5JGBA 4ZSEA 2BRHA 4LV5A 4YJOA 4GG5A 4UMRA 1CM8A 4YMJA 4P90A 1UKIA 4DITA 2W5AA 3RJCA 2UW8A 5BYZA 4BCKA 3ETAA 4ITHA 4IVAA 4WG4A 4L7FA 4ZLZA 3PJ1A 3L8VA 3UP7A 1OB3A 4AOTA 2W1ZA 3E87A 3QX4A 4ZSJA 2C5OA 3R8ZA 4CLJA 1PY5A 2QOKA 2JIUA 3OF0A 1J7UA 3FLZA 2ITNA 3CTJA 3QZIA 2Y0AA 4QRCA 1XBAA 3C0GA 2E9UA 3HDNA 4NUSA 3QALE 1OITA 3VNTA 5CS6A 4YHTA 4GV1A 3U6JA 1P4FA 3EQGA 3C4ZA 2QU5A 1OPKA 3NCZA 4I5HA 4W8EA 2XUUA 5K4JA 5D7VA 5ACBC 3HMMA 3R8PA 4PMPA 2PZRA 3KL8A 4PP9A 4IAFA 4B0GA 3H30A 2PSQA 3MPTA 2E9PA 4JX3A 4GIIA 5J8IA 4Y5HA 4XG7A 3RBWA 4B8LA 3CR0A 4EZ3A 5HESA 5JKGA 4NM3A 1YW2A 1V1KA 5J9YA 1PF8A 3MFTA 3F61A 4PMMA 2HY0A 2CKEA 4ZTHA 1GZNA 2YAKA 2BAKA 2YACA 5CTPA 3E92A 2QNJA 3DQXA 3NR9A 5DR2A 3LFQA 4BDJA 3CBLA 3PPZA 1NY3A 4JX7A 3DJ5A 4EH7A 3FPMA 4DLIA 2YWPA 5M4UA 4F1TA 3F2RA 4D9TA 5JQ5A 1ZZ2A 2BDJA 4JQ8A 5IZFA 3PSBA 5GIOE 3C7QA 5DOSA 5IG1A 1A06A 3M11A 2W99B 4DGOA 2GPHA 5JFWA 3FMLA 2GCDA 4TPTA 4JBPA 2P4IA 4O7YA 4IC8A 5C27A 4M66A 2VV9A 2F7ZE 3EB0A 5M55A 2Q0BA 5EYKA 4RMZA 5CEIA 4N57A 3DJ6A 5KMJA 3UGCA 4BWPA 2RG6A 3CKXA 4BDEA 4BCPA 4Z7GA 3H4JA 5KZIA 4IZYA 3NNWA 1CKJA 2UVXA 3KXGA 5CZHA 5E8YA 1Q8ZA 1SVGA 4BTJA 3PVUA 4JDIA 5DRBA 3KN6A 2C6OA 4HGEA 2V5QA 4IBMA 4BCHA 5J95A 3TKUA 1JSVA 3QKKA 4FKLA 5AV0A 4MBLA 4QO9A 3F69A 2JAVA 1SNUA 4RA5A 3AD5A 5A4EA 2WAJA 1ZWSA 4GIHA 1R1WA 2PL0A 3V5WA 3CY2A 3FL4A 3P7AA 3NZ0A 5BPYA 2GFSA 3BYUA 1OIQA 2C6KA 4ORKA 5J79A 4RWLA 2ITPA 1BL7A 3PG3A 3NUSA 4ZIMA 4GKHA 4P4CA 4UB7A 2QVSE 3ROYA 5BMSA 3KVXA 3HUBA 5HORA 4UY9A 2YIXA 2GNHA 3DKFA 3LFAA 3VQUA 3Q3BA 2PVKA 4FKJA 4K6ZA 3E8DA 4WNKA 4WOVA 3ZO3A 4DH5A 3N4TA 4MHAA 3FI4A 2IW8A 2ZJWA 4YJRA 3A2CA 4I6HA 3HP2A 4BDDA 3FY2A 4IJ9A 1BLXA 3ANQA 4FIFA 4YHJA 5GNKA 2YIWA 1IG1A 3ALOA 4OAUC 4FTMA 1QPCA 2R3QA 5CALA 3EN6A 2B9FA 3AXWA 3HMOA 3NSZA 3PY1A 4GJ2A 4HNIA 4I4EA 1KV1A 4XBUA 2QR8A 3NW6A 4NTTA 2HW6A 5EW9A 3QA8A 4DGGA 2G2FA 4GUEA 3D9VA 3G33A 4D58A 1Q61A 3DZQA 4FL3A 4IAAA 4TYEA 2GNIA 3V01A 4JI9A 4BKYA 3WZKA 2XIZA 3ULZA 4ENYA 2I7QA 3PPKA 4IZ5A 2PE1A 4QNYA 3W2PA 3E3BX 5EKNA 1WVWA 3ZO1A 1O6KA 4D4SA 4EJNA 3R8VA 4C2VA 1GZOA 2RL5A 1GY3A 3G9LX 3F7WA 2X8DA 4GK4A 5HE3A 4U45A 2IVSA 2VTRA 2X2MA 3UIUA 2HELA 3FMEA 2Y9QA 5IA5A 3QTQA 3ZS5A 5IDPA 5L2TA 3PXRA 4PDSA 3KF7A 4CG8A 3TZ8A 1XH4A 4EOPA 4IWPA 4WNMA 4TNDA 5TE0A 4LUDA 2PUUA 3IKAA 2BZHB 2OH0E 3SW7A 2X1NA 4DFBA 2BZKB 4E3CA 3R2BA 4BWKA 3DOGA 4OTIA 2A4LA 1H27A 4J7BA 4CKRA 1I09A 2IZRA 2PVJA 3CD8A 3QD0A 5FGKA 4AU8A 4UX9A 1OIYA 2ITXA 3A4OX 4GH2A 1XWSA 3TWJA 1FVVA 2R0UA 3QKLA 4G9CA 4HGTA 3A62A 2GNFA 3GU6A 1IA8A 3QRJA 2WMWA 3PWDA 4FTJA 4Q5EA 4RPVA 2XKCA 3BBTB 4L01A 4DFYA 4MTAA 2YITA 3ZLWA 2OZOA 5EW8A 4M15A 3ATTA 4FEWA 3NW7A 5LVMA 3GCVA 1FQ1B 1JKSA 4KNBA 1ZYDA 1YHSA 4JLCA 3ZEWA 2R64A 4MX9A 4KKHA 5FM3A 3VJOA 4AE9A 5HTIA 4RJ3A 4D4YA 5AAEA 3Q4UA 4G6NA 4ZJVA 3ET7A 2ITQA 4RJ5A 2XYUA 4BTMA 1OBGA 4TZRA 2KTYA 3C51A 3MH0A 3KXNA 5G1XA 5IQHA 2OZAA 3G9NA 3QXOA 4FT5A 4HZRA 4IB3A 4QMOA 4Y8DA 4XCUA 4ACGA 4F0FA 5LVNA 4WSYA 1ZAOA 1YQJA 4DEDA 3GGFA 1P14A 3DPKA 2HAKA 4MXOA 5AUTA 5BNJA 4MBJA 4CTBA 4I41A 2CKPA 4BTKA 4YO6A 5BYLA 2OJFE 3TIZA 3PRFA 3LFBA 3Q2JA 4TWNA 4CKJA 2QHMA 5DE2A 2EXMA 5IH4A 2GHLA 4FKSA 2F7EE 3C13A 3TM0A 4DEHA 4EBWA 3EH9A 2JDVA 4ZXTA 5KKRB 1URCA 3UC3A 4LRMA 2YM3A 4L3PA 4G6LA 5CEMA 1XJDA 2X8EA 2VTHA 2JBPA 2WQMA 4UWCA 3H9OA 2GDOA 4JS8A 2W1EA 3HUCA 2EUFB 4YP8A 4V05A 3PP1A 4NW6A 3GOPA 5ACKA 5L6WL 4RVLA 4GFOA 2OFVA 2WTWA 4KIKA 4AN9A 5E8TA 4J71A 3EYHA 4FKPA 3KREA 2R3HA 4C57A 3SQQA 4RGJA 2AC3A 4DCAA 3ZTXA 3ACJA 4AZWA 2Y6OA 4DFNA 2BDWA 2JKOA 3F2NA 3PSCA 4Z3VA 1MUOA 2C3KA 3TN8A 3PZEA 4B7TA 5IEVA 2B52A 4F65A 2C5XA 4FTQA 3RZBA 3MY5A 4HVHA 3OFMA 3ORKA 1DAWA 2WHBA 4OTDA 5E91A 2W9ZB 3GCQA 5EQEA 3MI9A 4D0XA 2B54A 1XBBA 2UZLA 2XJ2A 3AGLA 4EBVA 2R3GA 4ZP5A 3GCSA 3MH1A 4OLIA 4FNZA 4QMMA 4XH6A 3ZFYA 3DBEA 3REPA 4DG0E 2OIBA 3KRRA 3UOJA 2JIVA 4FSMA 3TKHA 2RIOA 5EQYA 2VWYA 5KHXA 3FPQA 4RJ4A 2DQ7X 3QD2B 5AP2A 5HNGA 3NX8A 4B99A 4BGGA 5DA3A 3ZHPC 5IEYA 5KNJA 4BI2A 4J52A 3NUUA 4G3DA 2JEDA 3FBVA 3L8PA 4PNKA 2C0OA 4IDTA 4S33A 4RZWA 4UMTA 5AR5A 2ZB1A 3SRVB 3BHYA 5AV3A 4MCVA 3UNZA 3IG7A 3R28A 5E4HA 2XBJA 3BLRA 5CX9A 3EIDA 2G2HA 4XEYA 4II5A 1PKDA 5D7AA 2JDSA 2QG5A 3CTHA 4KSQA 3ZXTA 3K5VA 4M3QA 4CCBA 3I7CA 2PVNA 5IQAA 3LXPA 3JXWA 4YUQA 3GU8A 2HZ4A 4D0WA 2XCHA 4GG7A 2BR1A 5AP5A 3RCDA 2B9HA 1WZYA 2B4SB 2PMNX 4H1JA 5GHVA 3RP9A 3QTRA 3QCYA 3TIYA 2VAGA 3PVGA 3BGPA 3F66A 4OR5A 3AC2A 5C8NA 1YOMA 5M08A 4U79A 4DCEA 3Q2MA 4FX3A 4FSNA 3LMGA 5BMMA 2OICA 4EH4A 3KRJA 5IQFA 2W96B 3P9JA 4G3GA 5I9WA 4L00A 2UW4A 4FGBA 5BUJA 1OBDA 3R00A 2RFEA 1RW8A 1OGUA 4E4MA 5DVRA 5ANDA 3UG1A 2JGZA 4JBOA 2CN8A 5C4KA 4C34A 2QKRA 1TKIA 3PXQA 2HENA 4CQGA 1VZOA 5L8JA 3UQFA 5IF1A 2QR7A 4PL4A 5E8SA 5HX6A 2UZWE 3KA0A 5DHJA 3KB7A 4G5PA 4DTKA 3KCKA 4NM0A 4KA3A 5E1EA 3S2PA 3V5JA 4I20A 3MJ1A 4CEGA 3AC4A 5FBOA 3OUKA 2CSNA 2YZAA 4FVRA 1FOTA 3KEXA 4PQNA 4MF0A 1YXSA 1IRKA 4Z55A 1J7IA 1GNGA 2HZ0A 4TL0A 2OGVA 4EH8A 4ANQA 5H2UA 1M2QA 4C4IA 4CMUA 5KCVA 5IA2A 4A9UA 3EQBA 2XK3A 4D2TA 2CCIA 5CSWA 2XKFA 4TWOA 4XNEA 3BV2A 2WMBA 3GI3A 3RMFA 3VF9A 3VS1A 3W16A 4APCA 4BIEA 2O64A 4RX8A 5HTCA 4F63A 4QMYA 4JR7A 3DBQA 3QUPA 4E20A 2B0QA 3K54A 4ITJA 2WQNA 1UU3A 3CQEA 3W2SA 3PVBA 1PXOA 1LR4A 2PVLA 4R7IA 3RZFA 1UVRA 4LOPA 3PYYA 4YSMA 3QTSA 2OXDA 4GFMA 5CQWA 3TV6A 2XS0A 4IVCA 5HBHA 2XIYA 4IWOA 1JAMA 1NA7A 4O0YA 1PRYA 1JSUA 4BYJA 4IXPA 5EM5A 2VO7A 3AGMA 4IVDA 2PULA 5E90A 1GIIA 4IDVA 4DG2E 3ROCA 4ZS4A 2JITA 4JIKA 2GSFA 3RI1A 4O0TA 4DAWA 4OTRA 1JQHA 3O23A 1PXNA 2XP2A 4AT5A 2OIDA 2WXVA 4I6BA 4KS8A 2BRMA 2OXYA 3UP2A 2ETRA 4O83A 4Y46A 3AMYA 4JG8A 4B8MA 1H4LA 3ZLXA 2YIQA 5D1JA 2E9NA 2XM8A 3DV3A 4IWDA 3GOKA 3U9CA 5E92A 1V0BA 2W4KA 2J0LA 5J5TA 4U97A 1FMOE 3BHTA 3HAVA 2YDJA 3QUEA 5D10A 3NUYA 3FI2A 4YC6A 3NMUF 4FV4A 4RQKA 4QTDA 5KUPA 3DK3A 2VUWA 1LEZA 2JKQA 3NDMA 4EI4A 4XHKB 2QOQA 5FXRA 3E88A 3C4WA 4HYUA 2REIA 2VX1A 3MY0A 2ETKA 2YFXA 4B4LA 4BZOA 1FVRA 3UYSA 4CFVA 4X2NA 4AF3A 4D2SA 4GFGA 3GCUA 4IW0A 1PHKA 2VTNA 1R0PA 3LQ3A 1O9UA 2C4GA 4A06A 3EJ1A 2WTDA 3EFWA 5HO7A 2QCSA 2CN5A 3DDQA 3KF4A 3TNHA 5HCZA 3VULA 2GS6A 2ESMA 4ZJIA 3DTCA 4XV2A 4Y85A 1NVSA 1GZ8A 5IA1A 4N6ZA 3I4BA 3MFUA 5HLPA 5AR8A 4ERWA 4L44A 5IKWA 5JFXA 3E8NA 3P78A 5LWMA 2NRUA 1LUFA 1PXPA 5DI1A 4ZAUA 5HU3A 2G15A 3TZ7A 3VBQA 3PXYA 1BI8A 4F1MA 4N0SA 4YURA 4RFMA 2XEZA 2ZV9A 3MH2A 3R73A 5FTQA 5JMSA 1J91A 4KBKA 2C6MA 3FMMA 4LGDA 4Z16A 4XLIA 2FO0A 3D14A 4F9BA 3FSFA 2XVDA 2VTLA 2R3NA 3KFAA 5FWKK 1QPEA 4D4RA 2IG7A 3QKMA 1Y91A 5JGDA 1GOLA 1H26A 1WAKA 3MA3A 4IE9A 3UC4A 4UYAA 5GZAA 1U4DA 1SZMA 1ZOHA 5H3QA 1MP8A 2YA9A 4AACA 5EKOA 3I1AA 3W33A 3HL7A 4FZ6A 3RPVA 4D1SA 1YVJA 2YZLA 3Q9YA 3NNVA 2QU6A 2EB3A 5AP6A 5CU4A 5A3XA 2BMCA 2YJSA 3EZVA 3I6UA 1Z57A 1JPAA 4TT7A 4OTGA 2FB8A 3UG2A 4JR3A 4M69B 2X4ZA 3C5IA 3O7LD 4LQMA 3A8XA 4EC8A 3D83A 3ODYX 5ETIA 2ZYBA 3BRBA 3NEWA 4RVMA 5C01A 3T9IA 5LMKC 2CMWA 2CGVA 4YSJA 1KV2A 2ZVAA 2EU9A 4HPTE 3QAME 5EG3A 4AA5A 5JRSA 1Y8GA 4FKIA 4AGCA 2YHVA 5EM8A 1KE5A 5C4LA 2G9XA 4WD5A 4A4OA 4AFJA 3QZHA 5LVOA 1U46A 3LOKA 4O22A 4MKCA 2J50A 2ERZE 4NFMA 4OTHA 3ENMA 4QT1A 2IZUA 3PLSA 4YC3A 4O2PA 3R8UA 1Q4LA 5M4IA 1UNHA 2XJ0A 4NIFA 3GP0A 4YJUA 5AP1A 1JBPE 4O27B 2CHLA 3FMHA 3BV3A 4BBEA 4IHPA 4JDKA 4LL5A 4Q2AA 5HG7A 1OL5A 3Q6UA 5E8UA 3POZA 4XG6A 5I9ZA 2R3IA 5M07A 2WTCA 4W4YA 5AUUA 2CNUA 3TUBA 4AWIA 4F0IA 3D15A 3R7EA 4IMYA 3CQWA 4FNXA 4IX6A 5IH5A 2UVZA 2X7FA 3OWPA 2CLQA 3P7BA 3P86A 5H8EA 3V5QA 4WA9A 4FOCA 2LAVA 2BDFA 4EH9A 3RAIA 5K9IA 1KE9A 1SMHA 3G2FA 4EOQA 3FWQA 3IW6A 5AAGA 1YDRE 1SYKA 4MQ2A 4V01A 4U5JA 1K2PA 4YTHA 1G3NA 2XNMA 3IPHA 2PMIA 4IQ6A 3RPRA 4O0XA 4FV1A 3F6XA 5E9EA 4YO4A 3Q96A 4PNIA 3TUDA 4EJ7A 4BL1A 5I9XA 1V0OA 2J2IB 4DC2A 4OT6A 4PTCA 4FBXA 3UIXA 4IAZA 3EMGA 4ANSA 3F5UA 4IB0A 3KK9A 3RK7A 5BYYA 4H3QA 2C47A 2YIYA 4QMNA 2O3PA 1CSNA 3EQDA 3KXMA 4IEBA 5HVJA 3UQGA 5AR3A 2YEXA 3FMJA 3QYZA 3VBYA 4EYMA 2PUIA 3JY9A 2VWXA 4QP3A 4PMTA 3G90X 4PTGA 4YZDA 3AQVA 5FEQA 4CYJA 4GVJA 4PF4A 3DBFA 4FA2A 4FTOA 5CVFA 1H01A 3OBGA 2X2LA 1ZOGA 5AUWA 3Q60A 3Q6WA 4Z9LA 3ORXA 4C4GA 3BLQA 4QP6A 1M7NA 5DIAA 3FLYA 3ZDIA 5LMAA 1QCFA 1WCCA 2G2IA 3E64A 2I0EA 1REJA 4ZY5A 4J8NA 4JJRA 5LMKA 3LXNA 3OWKA 4UWBA 3SXFA 4CCUA 3L8SA 2ZM4A 3FQSA 4BKJA 2HXLA 4LG4A 4RSSA 5KX8A 5T3QA 3A61A 4FV8A 2XNBA 2VU3A 2B9JA 4FIIA 4X6QC 2WMXA 5BUIA 4FSYA 4YJQA 3QWKA 3FZPA 1AGWA 1H1SA 4QYFA 4WO5A 4KRCA 2UZOA 4R6VA 3EQCA 4XJ0A 3UIBA 4QPAA 4BGQA 2OJIA 2IWIA 2C3IB 4TRLA 4JDHA 5F4NA 4U3ZA 3EFJA 3F3ZA 3VS5A 4IAIA 2XH5A 4GW8A 5FBNC 4FE2A 3LCSA 2W1CA 2Z7QA 4U80A 4EYJA 3KXHA 4FEUA 2W1FA 3OEZA 3KMUA 3MJ2A 5KMNA 2QO2A 2VNYA 4FOBA 3SA0A 3MS9A 4ASXA 2J5EA 4AZSA 3COIA 4CXAA 4IFGA 5CXZA 2RG5A 3FZSA 3QHRA 3N4UA 4F6WA 4BDGA 2EXCX 2HW7A 3PTGA 2F7XE 2VNWA 4FYNA 4X2JA 4YLKA 4DG3E 3N4VA 3D4QA 2VTAA 4HYIA 5CI6A 5L6PA 3HRFA 4ENXA 3R04A 4RWJA 3UBDA 3H10A 2W5BA 3A60A 3BYOA 3C0IA 2IZSA 3PLAE 4WNPA 3UOKA 2W4JA 4GU6A 3GFEA 2PZPA 4ZY6A 4UXQA 2I1MA 2RFNA 5EK7A 3QUDA 3F3TA 4CFXA 3DBDA 5FEEA 4F70A 1MQBA 4JG7A 3ZM4A 3UZRA 2J4ZA 3W8LA 1ZYSA 3LIJA 4DH3A 2VTOA 4RC3A 1GAGA 3EN7A 3I6WA 5HIBA 4HCVA 2IVVA 5EW3A 3SD0A 5GZ8A 5IMXA 1ZXEA 4BDAA 1HCLA 4X3FB 4EK3A 4L67A 2FSTX 4RQVA 4HVDA 2JIIA 1YXUA 1S9IA 3E8EA 1WFCA 3JUHA 4J96A 4X2GA 5FLFA 4O91A 3TNPC 4FEXA 4QP7A 1F3MC 3COMA 3TJCA 3RAHA 4S30A 5K4IA 3NW5A 4RVKA 4XG3A 2CPKE 4C33A 3UPZA 3JR1A 3KVWA 4MNFA 4XV9A 2YLFA 3OCSA 5CAVA 5AX3A 1R0EA 4C3RA 2QG7A 3BU6A 4CRLA 3KQ7A 4GT4A 5M56A 1Z5MA 4IM0A 5FP5A 2WFYA 3ORPA 3PJCA 3VS3A 4E7WA 4I0SA 2ZMDA 3R7GA 3L9PA 3VN9A 2NO3A 4I22A 2UW3A 2CLXA 1K9AA 1JSTA 2BALA 2WMQA 3GNIB 3HECA 3QC9A 4HCTA 3DLZA 4L7SA 3SX9A 2YCQA 4XRLA 3FZ1A 4BF2A 1P2AA 3KCFA 4YJSA 5HO8A 4HYSA 5F20A 4E4NA 3IW7A 3IECA 4RC2A 2PU8A 4ERKA 4BIBA 4IJPA 3DY7A 1YHWA 4YZNA 4YNEA 2OG8A 3QQKA 5TT7A 3Q5IA 2SRCA 4X7QA 4FV0A 3BBWA 2JDRA 4TTHB 3VBVA 3WZEA 3D5XA 4FL1A 2YLEA 2C69A 1OUYA 1CKPA 3SKCA 3L8XA 2GTNA 3O8PA 5T6KA 4GMYA 1KWPA 3SXRA 4K8AA 1H1WA 3BU3A 4GT5A 3VUTA 4D2VA 3KN5A 4PX6A 4O0UA 3LZBA 4EORA 5J9LA 1M17A 3LLAA 5AUXA 2CCHA 4KSPA 3ORLA 4ZTQA 3CSVA 4BCMA 2NNWB 4EOIA 4FKTA 3POOA 2I0YA 5DT0A 3MIAA 1RQQA 3ZM9A 5CZIA 4AOJA 2Z8CA 3LAUA 3MVHA 5EOLA 2XA4A 3PY0A 3QX2A 4WIHA 3PE1A 3N51A 3RM7A 4BWXA 4O7NA 4R7BA 3R1YA 5HNIX 3FXWA 1YXVA 4BYIA 5AFVA 4EWQA 2R3MA 2WU7A 3NLBA 2O8YA 2J0MB 2WIPA 5CF4A 5ICPA 4EOLA 1YOJA 4KD1A 3IDCA 4LMUA 1YXXA 3EL7A 4X2KA 2X2KA 3ZEPA 3HA8A 3IW5A 3R7UA 2ITUA 4FTLA 5JK3A 4R77A 1L3RE 3GC8A 2ZM1A 3L9LA 4R5YA 4KIQA 2WIHA 2UZDA 4AN3A 3JY0A 3VUDA 2R3RA 3QTXA 5IUIA 2ZM3A 4IB5A 2QOFA 2YN8A 3O96A 4HCUA 3F5GA 3D5VA 4HGLA 2F49A 3DAKA 4FKWA 5BVNA 4IAKA 4BI0A 4A9YA 2PMLX 4MK0A 3FE3A 5LJJA 3S00A 1OPLA 1V0PA 1Q62A 4PWNA 4LM5A 3W32A 3SLSA 1FINA 4CT1A 4Q9ZA 2DUVA 2YCFA 3MIYA 5LARA 1F5QA 1CKIA 2BUJA 3CJGA 2HXQA 3HMPA 3QRIA 4H1MA 4RA4A 4BGHA 4E5WA 1OI9A 3M2WA 5CENA 1XH7A 4QMQA 2BROA 1YRPA 5A4TA 5IQEA 4WHZA 3R1NA 4PL5A 4BHNA 4AP7A 3UO4A 2V55A 2WMVA 3OXTA 4FTRA 4ZTSA 4FSRA 3VVHA 4FTIA 5AR2A 2A19B 3DXNA 4MBIA 3OW4A 4U40A 2OW3A 4ZOGA 3FC1X 2H9VA 4JL9A 2FGIA 4TWCA 2W9FB 5AR7A 4AQCA 4AZVA 4OAVB 2CKOA 5M06A 4QPSA 2FSOX 3D7ZA 4E26A 2X6EA 3TDWA 4DEIA 3IW8A 4QMZA 4BCIA 2QOHA 5KMOA 3R7YA 5CSHA 2JBOA 2WQBA 3WF9A 4P5ZA 4AFEA 2WQEA 3FC2A 2XNPA 4JXFA 4FGRA 3QA0A 3CGOA 1DM2A 3QQHA 2W5HA 1WBSA 3I81A 4FUXA 3EKKA 4KB8A 4EL9A 4MAOA 4QOXA 3LFEA 1H08A 3B8QA 4X3JA 5I9UA 2YM7A 3GC9A 4ACHA 5M57A 5C1QB 4BI1A 3TNIA 5J87A 3V5LA 2PUPA 1Q5KA 4TNBA 3QGWA 4NKAA 3D0EA 4ANBA 2JAMA 3NYXA 1OUKA 3CPBA 4P7EA 3ORIA 5B2MA 5LVPA 3ALNA 5LXMA 3BI6A 4BR3A 3Q4TA 4HJOA 4U81A 3RPYA 2OBJA 2UW5A 1FMKA 3LJ0A 2OFUA 3F82A 3IO7A 1KE6A 3WIKA 3EN5A 3C5UA 4QTCA 1NT2A 5I9VA 3THBA 4E93A 4EQUA 3SGCA 3QCSA 2R3JA 3PSDA 4OBOA 4YTFA 3RK5A 5CASA 2R0IA 3NPCA 4BDIA 3JVSA 4UV0A 2PVYA 5ANOA 5HLNA 1H1PA 3PE2A 2QOLA 3TZ9A 2UZUE 3FLWA 4DLJA 2PHKA 5CNOA 1YI6A 4G3EA 1RDQE 2RKUA 2Y8OA 4XG4A 3VIDA 3MBLA 2BTRA 5CXHA 2CNQA 3GU7A 4O0WA 2BAQA 2EWAA 3TJDA 2B53A 1UU8A 5L4QA 4GK2A 4L68A 4E4XA 3ACKA 3I5NA 4WKQA 2C6DA 1W98A 3VS7A 3BE9A 1FBNA 3SC1A 4BIDA 5DYJA 4J99A 2XMYA 3EKNA 4WT6A 4LV8A 1P5EA 4ZMFA 2QHNA 3OCGA 5AA9A 4J95A 3I0OA 2WTVA 3ORMA 1VJYA 4RFZA 3TV7A 5CEOA 1SNXA 3BZ3A 4C0TA 5HD7A 3OD6X 4F7NA 3DA6A 4GT3A 5F9EA 4YPDA 1U5QA 1YKRA 2BILB 4G6OA 3VW6A 1H07A 5EDQA 3WYYA 4TYHB 3GENA 2GU8A 4MQ1A 3HEGA 2Z7RA 3H0ZA 4JBQA 4JOAA 2EB2A 3Q04A 3QTZA 3NCGA 3ZZWA 3MWUA 2WPAA 4FG7A 2Z02A 3AT2A 1A9UA 3Q5ZA 2CGXA 2IJMA 2XIXA 1PXMA 3WF6A 2X7GA 2E9VA 4TYIA 2QOOA 1WBNA 4F6UA 1XR1A 3VAPA 4QQCA 3TT0A 1UNLA 2C6IA 3PA5A 3BELA 4RIYA 4FZFB 1H1RA 5FUTA 4O81A 4XP2A 4FKOA 5LMBA 2AUHA 1WBOA 2XCKA 2EVAA 3AMBA 4NCTA 4QMXA 4E73A 2R9SA 3U6HA 3DCVA 2ITWA 1XO2B 2V0DA 4IZAA 5HO6A 3EQHA 3KRXA 4K33A 4U8ZA 2UV2A 4TWPA 4WG5A 2V7AA 4I94A 3DBCA 4NJ3A 4ZS0A 3IW4A 3LQ8A 3PWYA 4TXCA 4D1ZA 5JZJA 4AGDA 1Y8YA 1T45A 3D2KA 4RX7A 3R02A 5AUYA 5HG8A 4FV3A 4C4JA 2GQRA 3UOHA 2UZNA 5D9HA 2OI4X 1YWRA 4R1VA 4RIXA 3QXPA 4C3FA 2G1TA 3F3UA 2R3KA 3FLQA 4ZLYA 3PRIA 5HBJA 4O6EA 3NUXA 3ZSIA 5L2WA 4BTFA 2BAJA 4W4VA 1IAHA 3DT1A 2YM8A 3ZMMA 5HQ0A 3KY2A 4FTUA 4J98A 4O0RA 3ZUVA 4C2WA 3C4FA 1YWVA 1PMUA 4K11A 3R9OA 1YOLA 1PXIA 2PTKA 3UNJA 4MD7E 3PZHA 2GNJA 4OT5A 1CMKE 3DAEA 4YZ9A 5HNBA 4E1ZA 4XV1A 3BYVA 5AA8A 2CGUA 5L3AA 3RVGA 3U54A 3FXXA 3BCEA 4FKUA 4C4FA 3EQIA 5CQUA 4O84A 5ETCA 2WKMA 4N70A 5AMNA 4BY9E 3GC7A 4MYGA 4KIPA 4XRJA 4FV6A 2GS7A 3JPVA 4D9UA 4YHFA 4X3FA 3LKMA 1PMNA 3SAYA 2BRBA 4AW1A 3N9XA 3GVUA 2Y4IC 4YBJA 4YJNA 4E6QA 5KMMA 4QPMA 5FTGA 5I9YA 2J7TA 5JRQA 5TR6A 4GVAA 2C5VA 2OU7A 2P55A 2XZSA 3AD4A 4I0TA 3VWAA 3HAMA 5IU2A 4RLKA 4R5SA 4DGMA 1KOAA 5CVGA 2OIQA 3BE2A 3WIGA 3PJ2A 4NCTC 3VS6A 3QCQA 2JFMA 4FKVA 4I21A 3FHIA 2OF2A 4H3BA 3QD4A 3FMDA 1M14A 5AIKA 3MTFA 1TQMA 4RVTA 2E9OA 2JD5A 3KMWA 4Y73A 5J9ZA 4CFFA 4O7RA 1JVPP 4GEOA 1F0QA 3GBZA 2QOBA 4U43A 3NAXA 3OWJA 4KAOA 1Y6BA 3LJ2A 4L3LA 4CT2A 2ZDUA 4J97A 4O7SA 5DMZA 4H58A 4CGAA 4DHFA 3RHKA 4ZTMA 3Q4CA 1OMWA 2O5KA 1STCE 5CY3A 5JGAA 4OUCA 4XOYA 5LCJA 4HPUE 5A4QA 4QMVA 3GEQA 4OTWA 2R7BA 5EHOA 5BVKA 3LFDA 1T46A 4BVUA 3OCBA 2O0UA 3ZO4A 4F09A 4JT3A 1XHAA 4FIGA 3R7IA 4R3RA 4JBVA 1OKWA 3BQCA 5BVWA 3NWWA 4FKRA 4P5QA 4QQ5A 4TKSA 5FG8A 5L2SA 3KKVA 3QQJA 4G1WA 2J9MA 3LLTA 3BQRA 3F3VA 3GU4A 4KIOA 2XK4A 2F2CB 4RJ6A 5CSVA 4ZTRA 3FZRA 2W4OA 3TZMA
chains in the Genus database with same CATH superfamily
3PFQA 2I0VA 3LM0A 3BEAA 1ZMVA 4Q9SA 4AGUA 4BCFA 5IA0A 4R3PA 2R4BA 2QODA 4O2ZA 4K18A 4RLLA 4IAYA 4JRNA 2JLDA 2OJ9A 3LCTA 4UN0C 2ITTA 2V62A 4I5PA 2X0GA 3QRTA 4NKSA 4WRGA 4QP9A 4BDHA 3A99A 4CZYB 4ZZNA 3HV7A 5GINE 4L45A 5C9CA 4O4DA 3AC8A 2CNVA 2GMXA 4M14A 3C4CA 4RX9A 2R3PA 4ANLA 4WUNA 3LMHA 3LXKA 3BHVA 2B55A 4QYGA 4EZ7A 3NIEA 3Q53A 4CFUA 5CANA 3R8MA 4H39A 5CYIA 2A2AA 3W2OA 2FUMA 3HZTA 3OXIA 4FTAA 4AW2A 3ZBXA 4E8AA 5LWNA 4AA4A 1CTPE 2Y4PA 3WBLA 1H24A 2JC6A 2V22A 2YJRA 1YHVA 2XJ1A 2A0CX 5CSXA 3W2QA 4EOOA 3QQGA 1ZY4A 4MWHA 4YZBA 3AC3A 3MN3A 4O0SA 5JSMA 2F4JA 1ST0A 5HIEA 1UWHA 3FLSA 4ZJJA 3HLLA 5AP7A 1P4OA 3V8SA 2IPXA 1B38A 3VS4A 4MEDA 1OPJA 4XLVA 5B0XA 1WVXA 4IX4A 1RE8A 4HVSA 2J6MA 2X8IA 4QP4A 4MNEB 4RBLA 4X2FA 1U59A 5CU3A 5GZ9A 4DTBA 2ITOA 3C4XA 1WBWA 4FSWA 2PPQA 5EM7A 2IO6A 4N6YA 4WBBB 3HV4A 3S4QA 4WUAA 3NUNA 4AXAA 4EH3A 3KMMA 3NVKI 2W05A 2GQGA 1GIJA 3PP0A 5FRIA 2VO0A 4FC0A 4BZDA 3TDVA 3DXQA 3EQFA 4PTEA 4RIYB 3L9NA 3NAYA 4XS2A 4F9YA 4W9XA 4QYHA 3LFNA 3MY1A 3OHTA 3TL8A 4FIHA 2J90A 5TOZA 2HWOA 4RZVA 3MVJA 2XIKA 1H00A 2VRXA 5BVEA 2FYSA 3MPAA 3PXZA 4NL0A 3LPBA 3FY0A 4CMOA 1YDSE 3GQIA 3K3IA 3MPMA 2R3LA 1W84A 2WO6A 5HKMA 4BCJA 3HNGA 3IK3A 4L42A 1XH5A 1YI3A 2I6LA 3B8RA 1KE7A 2H6DA 3MVMA 3VUHA 1IA9A 3NUAA 2UZVA 4FJVA 3G6HA 2UW7A 3WF8A 5AUVA 3I5ZA 2ONLA 2VZ6A 4G16A 3I79A 4FEQA 1ND4A 3R71A 3DS6A 4PPCA 4RX5A 3CQUA 4RJ8A 2C6LA 2HZNA 2QD9A 4ZTLA 2PZIA 2PUNA 2WOUA 2PMOX 1J7LA 5BQ0A 3K3JA 4HOKA 2BFYA 3DDPA 2IZTA 4YC8A 4C4HA 1E1VA 1Q8YA 4JQ7A 3UZPA 4O6LA 5HEZA 3PVWA 5I0BA 3FXZA 1XH9A 2QOIA 3C9WA 4E6AA 1YWNA 5IQIA 3G6GA 4IADA 4NM5A 3QLFA 2JFLA 5EI6A 5IQBA 3DQWA 3MB6A 5IISA 4HYHA 3R1QA 2O63A 3FDNA 1ZY5A 5E8XA 3RKBA 1WBVA 4YJVA 2RFSA 3R2YA 5E8VA 5AV2A 2JDOA 4EEVA 5M4FA 1J3HA 4RWIA 4FZ7A 3BYSA 2VTSA 4QQJA 3CEKA 1Z9XA 3LHJA 4U7ZA 4I23A 3KGAA 5H8BA 4BZNA 4MH7A 5IDNA 1PYXA 3VQHA 2WGJA 1Q8WA 4I6FA 3W1FA 3OP5A 2QKWB 3V8WA 4ZSAA 3RAWA 4M68A 1GZKA 5DH3A 2ACXA 5HZNA 4AS0A 4N4SA 4ASEA 4LDTA 1XKKA 3E5AA 3TKIA 4E4LA 1DI9A 3QTIA 3QTUA 4EK6A 3MH3A 1XH8A 4F4PA 2UZBA 5IQDA 3V3VA 3UIMA 3WI6A 4EQMA 4G9RA 5IUGA 3BPRA 4LOQA 5DNRA 3W8QA 4D2WA 2XRUA 5HG9A 3W0OA 5GJDA 1K3AA 4LOOA 3LE6A 3QCXA 3QZGA 5I5ZA 4JVGA 3ZRKA 4CRSA 4PMSA 1U5RA 3OCTA 2XNEA 4O86A 2H8HA 3LJ1A 3I0QA 2HZIA 4H36A 3NNUA 4QEBA 3FKNA 3NYVA 4MF1A 4FNWA 4G2FA 4IC7A 5CEQA 3T8OA 3WZJA 3QGYA 4BCNA 4AZTA 3C1XA 5E8WA 4I5CA 5IH6A 4H3PA 2OKRA 4U42A 4I93A 4FV2A 3ZONA 3CY3A 3CLYA 4CVAA 3O2MA 2FA2A 4XBRA 3BWFA 5AV1A 1Q97A 4IZ7A 5DT3A 1DI8A 3DKCA 2I0HA 4FR4A 1W8CA 3DB6A 5J1VA 5DRDA 3VONA 1REKA 2YABA 3TG1A 1MQ4A 2OK1A 1YXTA 2UVYA 2RSVA 4FSQA 4F7JA 4NZWB 3NS9A 4DEEA 5HIDA 4WBOA 3ULIA 4ID7A 3QL8A 4XG9A 2CDZA 2V7OA 4YJTA 3ZCLA 4DH1A 1PJKA 3DXPA 2C1AA 3KXXA 5E8ZA 5KO1A 2UW9A 4GK3A 4F9AA 2QQ7A 1ZYLA 3FMNA 4FTCA 5EHYA 5AAFA 3ZOSA 4AUAA 3LFFA 4HVGA 4K1BA 3OZ6A 2NP8A 2RFDA 3OWLA 1WVYA 1XQZA 2EXEA 4KBCA 1OVEA 3MW1A 3EQRA 3F7ZA 4DBXA 4FI1A 4FSTA 4L9IA 4I0RA 3QRKA 2E2BA 4R3CA 4C8BA 3V8TA 1OKVA 3QZFA 2IW9A 1VR2A 4KBAA 1LEWA 3VBXA 5HCYA 3WE4A 2YERA 4DINA 3U8WA 4P2KA 2VTIA 3F5XA 4M84A 5AP4A 4M12A 3E3PA 3QWJA 4FL2A 3FZTA 5EOBA 2GFCA 3VBTA 5M53A 2A1AB 4F7SA 4AOIA 4G31A 3UO6A 4KRDA 3I7BA 3ORTA 3ZDUA 1OL1A 3QF9A 5DEYA 5JEBA 3LMIA 3WE8A 1M7QA 4UXLA 2PVMA 2XAOA 5BVOA 2R2PA 2QLUA 4GYIA 3TUCA 3Q32A 3OY1A 4EH5A 2W1DA 1OKYA 4YNOA 2PZYA 3A4PA 3QBNA 4QMSA 1FGIA 5CWZA 4USDA 3HKOA 1GJOA 4NFNA 5AP3A 1OIUA 5I3RA 3EWHA 1JKKA 4XP3A 3FQEA 4XMOA 3FI8A 3DZOA 2YDKA 4FKQA 4JNWA 4FT3A 5DR6A 5HHWA 3DLSA 3W2RA 3EN9A 3WZDA 4IACA 4IB1A 3OOGA 4MXAA 4O7ZA 5ETFA 2BKZA 3OUNB 3V6SA 3A7GA 2X0QA 2W1IA 3IQ7A 4FG9A 4I4FA 4H05A 4XG2A 3QLGA 3IGGA 5TF9A 4Z7HA 4NU1A 3RK9A 2O65A 3BWJA 4G3CA 5JN2A 3FV8A 4ZK5A 4ZY4A 3R7VA 4AXEA 3UQCA 2KULA 3A7JA 3RINA 5AV4A 3FL5A 2C0IA 4UBAA 2YCSA 3MFRA 3ZFMA 3DNDA 1TVOA 4RJ7A 3R9HA 3WOWA 4C02A 5CAOA 5J5SA 3OG7A 4O7TA 5KKRC 3PG1A 2DWBA 4ANMA 1ZARA 1Q8UA 2IVUA 3AT4A 3K5UA 3D7TA 4RWKA 5C26A 3P23A 4J53A 4F08A 4AZEA 5AIRA 2Y4IB 4BFMA 3ZRLA 3ELJA 2OZAB 3BYMA 4AXDA 2OXXA 4L6QA 4NEUA 2VWVA 3EN4A 4RC4A 3KC3A 3NIZA 4DN5A 1L8TA 3CPCA 4FNYA 4OTPA 2VTPA 5CEKA 3BEGA 2ITYA 3FSKA 1NXKA 2WB8A 5AP0A 3S3IA 2AC5A 4FT0A 5KZ0A 3OT3A 2C3JA 5DGZA 2LGCA 1E1XA 1ZMUA 4I24A 5GJGA 3KRWA 3ZBFA 3GB2A 4BCGA 4C36A 4CQEA 1S9JA 5JFVA 3JS2A 3KXZA 4ITIA 4UMUA 5HVYA 3UZTA 3MVLA 5FP6A 2R5TA 5LCKA 4ANNA 4L46A 4BBFA 3BU5A 4HGSA 3ML1A 4D55A 4ASDA 1LPUA 2X39A 4MXCA 4NW5A 2XNOA 3IOPA 4OW8A 2BKKA 4ZMEA 2C1BA 5E7RA 3MSSA 4YTIA 3Q4ZA 3E8CA 3NUPA 1PXJA 1OIRA 3UDBA 5HI2A 3VUKA 4EOJA 1IR3A 5K5NA 3ZC6A 5H8GA 1IEPA 3KK8A 3U9NA 3R63A 2ZB0A 2UW6A 3R9NA 4QMUA 5EH0A 3F9NA 4YTCA 2PVHA 3QQUA 4E5BA 4EHZA 2ZV7A 5EHLA 2Y7JA 5DPVA 3KULA 4DH7A 1Q3WA 5ANEA 4C58A 3CC6A 5LQFA 2XNGA 4BBMA 3AG9A 3PXFA 3R6XA 1MRVA 1NVQA 3CS9A 3SRVA 1OZ1A 3L9MA 3DU8A 3FYJX 2DS1A 5ETAA 2JKMA 4QYEA 3OMVA 3ZLYA 4ZEGA 3GUBA 3MYGA 4J1RA 1VYZA 3R0TA 5AWMA 3DNEA 3DGKA 3IOKA 4LRKA 4FV5A 3LVPA 1R78A 3FKLA 4L8MA 4M7IA 2GS2A 3VRYA 3HGKA 2J51A 3PIXA 5CT0A 5CF8A 3WARA 3PY3A 4LGGA 3G51A 3HV5A 2ZDTA 5A6NA 4RRVA 5A6OA 5CEPA 3WF5A 2GNLA 3GT8A 3IGOA 2YIRA 3L1SA 3T9TA 5CF5A 4RIWA 5ANGA 3QQFA 2GTMA 2NPQA 4U44A 5AX9A 2Q83A 3V04A 3LFSA 2Y6MA 4DEAA 4WRSA 2WQOA 1U54A 3A7FA 5IA4A 3BLHA 3AC1A 4AG8A 3BHHA 4X6RA 3VRZA 5B2LA 4EKKA 4M8TA 2YDIA 4I1ZA 4FIEA 4L3JA 3RPOA 4FKGA 5IQCA 3OT8A 4IH8A 4IWQA 3PUPA 3AMAA 3CKWA 4MWIA 5HVKA 4EC9A 3CCNA 3KU2A 4MXYA 2AYPA 5A54A 3W55A 4M13A 3FHRA 4FVPA 5L8LA 1A48A 1G8JA 4A9TA 1GIHA 1MRYA 4BCQA 5DT4A 4GKIA 4GL9A 1M52A 5ANKA 2IF8A 4YZMA 1Q8TA 5HICA 3ZLSA 1G5SA 2XALA 4G5JA 3EYGA 3NYNA 1W0XC 2J0IA 4FV9A 5K3YA 4F0GA 2YAAA 2HCKA 2VGOA 3SV0A 1VEBA 5CSPA 5CVHA 1B6CB 1QMZA 3TNWA 3E7VA 1NVRA 3DJ7A 5L2QA 4WG3A 1W82A 3EOCA 3P08A 3RGFA 4FIJA 5TKDA 4A4LA 3DK6A 4TN6A 4DGNA 1APME 2RGPA 3CJFA 3GFWA 5KMIA 1G8KA 4FTTA 4AX8A 3EFKA 5EI8A 1DS5A 4RIXB 3ZZEA 4BDBA 2DYLA 4U9AA 3HVCA 4FTNA 4K9YA 2XIRA 4PDPA 2BHEA 3GQLA 4MXXA 5FM2A 5AM7A 1WBPA 2W17A 4JAIA 5AR4A 4ZZOA 3C50A 3FZOA 3VS0A 2WMRA 2X9FA 3HP5A 2QC6A 4NM7A 1NW1A 2HOGA 4NSTA 2W7XA 3OOMA 3ZUTA 4FICA 3ODZX 1URWA 4WNOA 4EH2A 4KS7A 4EZ5A 3K2LA 3FYKX 1JLUE 2ZOQA 4UZHA 3UDSA 2W1HA 3D2IA 4DGLC 2WMTA 1FVTA 2O2UA 3FJQE 4TYHA 5DWRA 4CV9A 4BHZA 2ITZA 5L8KA 2ZFYA 4CNHA 3R9RA 4XP0A 4DFZE 4FT7A 3V6RA 4M0YA 3RAKA 4FF8A 4Y83A 5J7HA 4W4XA 4JG6A 3TACA 4E6CA 4ALUA 3UNKA 4PDOA 1W7HA 4L53A 2VN9A 2UZEA 4W8DA 3V5TA 5DEWA 2YM5A 4IX3A 5KBQA 4CZTA 4O82A 4O0VA 4I3ZA 1PYEA 4XG8A 2XKDA 1JNKA 4EK8A 3RCJA 5B7VA 4CD0A 2QO7A 5HD4A 2X0OA 1Q24A 3RWQA 5EM6A 4JDJA 3OXZA 4EH6A 3BGZA 3PDTA 3S1HA 4V0GA 4FODA 2GNGA 5CLPA 2WNTA 3A7HA 4TY1A 4D5KA 4I6QA 3BIZA 4NH1A 2YISA 3MB7A 1U54B 4V04A 4UMQA 3O5AA 3UMXA 4EHGA 4NJDA 4FG8A 4AT3A 4M97A 5FDPA 4J8MA 2OJJA 4JAJA 3MTLA 4UEUA 3RNIA 4X3FC 4A9SA 5HE1A 3LM5A 1Q99A 2WOTA 2VD5A 3AC5A 3ATSA 3HYHA 4CTCA 3ZSHA 2F57A 4CMTA 3EZRA 4FVQA 4IX5A 3PIYA 3TXOA 4YGAA 1B39A 4IANA 1ZZLA 4F6SA 5E1SA 3CTQA 4BB4A 2XYNA 5FD2A 2HY81 3VHEA 3BL9A 3P79A 1QPDA 4S32A 3U51A 2WMSA 1JOWB 5CU0A 4FUYA 4G17A 5FQDC 3UODA 4ACMA 1ZRZA 2NRYA 1ZMWA 3V51A 3QC4A 4BDCA 4BDFA 4G34A 2X6DA 3BGQA 3MFSA 1O6LA 2VTJA 3G0EA 3OC1A 4R7HA 3KULB 4O7LA 3ZUUA 2VWIA 3GU5A 3T3VA 4DF3A 4APPA 2UW0A 3G0FA 3AT3A 2FH9A 4AZFA 3TTJA 3TMOA 5HTBA 1M2RA 2WEVA 4C59A 1HCKA 2PY3A 3LCDA 3OBJA 4AW5A 5KBRA 2BFXA 3SXSA 3DFAA 1CDKA 5A4LA 3LCOA 3ID6C 2B7AA 3TNQB 4CKIA 2HWPA 1BKXA 3U4UA 4QP8A 4YJPA 5HE2A 4PP7A 3W0MA 2QOCA 5IPJA 3W2CA 4AA0A 2OSCA 5HX8A 2VX0A 4CYIA 4ZZMA 1HOWA 3OTVA 5ANJA 4JRVA 2R7IA 2F2UA 2VO6A 5M51A 3EHAA 1BMKA 3E63A 5HE0A 4X0MA 2Z7SA 5L2IA 4EOSA 5D11A 1G8AA 3EFLA 3IDPA 5BVDA 4OTFA 2ITVA 3ZSGA 1PKGA 4DYMA 2A27A 4RFYA 2X4FA 2VTQA 3SOCA 3HA6A 3UVQA 2C6TA 3U4WA 1FGKA 3ITZA 2R3FA 2YCRA 4EHEA 4Y5QA 4UYNA 5EYMA 5I3OA 1FPUA 2XRWA 4BRXA 5J1WA 3UDTA 3FUPA 5AEPA 3O51A 3DTWA 2XK8A 1H0WA 3SG8A 4L43A 2B1PA 4QMWA 4ANOA 4IIRA 2PE2A 1ATPE 1PW2A 4OTQA 2FSLX 3S0OA 4YR8A 3UO5A 3NFFB 1KE8A 2BIYA 3MDYA 4CFMA 4QTAA 3D7TB 1X8BA 1YDTE 3MA6A 3MGYA 3ORZA 4KIKB 1ZYJA 5IUHA 4KUJA 4HNFA 3LW0A 2PWLA 4HZSA 3JVRA 1DAYA 1PMEA 4FYOA 5C8MA 4EK5A 3NNXA 2ERKA 3SW4A 1WBTA 4K77A 3I60A 4FMQA 4QMLA 4FK3A 4DHZA 5JQ8A 5C03A 4DT9A 4EUTA 3FQHA 3MV5A 4EK4A 4EUUA 1H28A 4B6LA 2WTKC 3RPSA 1PXLA 5T68A 1H25A 3ENHA 5KHWA 4LGHA 3C0HA 5ANIA 1OM1A 2QONA 4FSZA 4OGRA 5G6VA 4DFLA 2VO3A 4M67A 4U0IA 4W4WA 4Y72A 2VWBA 3R01A 4EHVA 4F99A 4UZDA 3S95A 3A8WA 2RF9A 3OEFX 3UVPA 4BICA 4O1PA 4GRBA 4TYGA 4KWPA 3VBWA 1KUTA 4IVBA 1KOBA 4C61A 2P0CA 4FK6A 5CT7A 5H9BA 5C8KA 5IEXA 4CLIA 5CAPA 3FLNC 4DTAA 4RIWB 4K2RA 3SOAA 3O17A 2PZ5A 1OL6A 1ZLTA 3UVRA 4KABA 4LL0A 1OL2A 1QL6A 3GXLA 3PJ8A 4O1OA 3WILA 2XNNA 2C5YA 3HV6A 2C6EA 3II5A 3DK7A 4NTSA 2BTSA 5B2KA 3TV4A 3VUMA 4EWHA 3CGFA 3O8TA 1XH6A 4A07A 5FEDA 4YLJA 5ITAA 2W0JA 2F9GA 3HX4A 2CGWA 5M4CA 4L52A 5DG5A 1UU7A 1SVHA 2P33A 4FRFA 3QRUA 1BI7A 5JH6A 2XK9A 4PY1A 5F94A 4O38A 4ZLOA 4LI5A 2OWBA 3WF7A 1BUHA 3BX5A 3PPJA 4UALA 2YM4A 4PPAA 4YZCA 5A9UA 2BVAA 3T3UA 5HU9A 2PYWA 5KMKA 5EFQA 3F5PA 4QP2A 3LCKA 4LMNA 4PL3A 3P1AA 3VW8A 4F9CA 2XEYA 4A4XA 5AJQA 3R8LA 1I44A 2C0TA 3HDMA 3UYTA 4R78A 2WMUA 5AUZA 3UPXA 4D2RA 2J0JA 4KKEA 1E9HA 4D5HA 3A7IA 5FXSA 2PE0A 4QD6A 4O4CA 1J1BA 3H0YA 3H9FA 4MNEA 3FAAA 2OLCA 2YM6A 2C68A 1Q3DA 5EI2A 4ZSGA 5JFSA 2Z2WA 3VO3A 3WYXA 5GIPE 3F2AA 4QQTA 1Y6AA 2HK5A 3TCPA 3E62A 3UJGA 3QFVA 2I40A 4FSUA 2C3LA 1VYWA 3QU0A 3R83A 3DKGA 1H1QA 4ONAA 1JKLA 3CIKA 1PXKA 4MVFA 3EL8A 1H8FA 5HCXA 4EONA 4O7WA 2P3GX 3HMIA 1RJBA 3GCPA 3VF8A 3R22A 4F1OA 2Z7LA 4M0ZA 3TTIA 2NYAA 4I92A 3VJNA 2JKKA 2VX3A 2XB7A 2WMAA 4GYGA 4RG0A 5CU6A 2ONLC 2BRNA 5CI7A 3TEIA 1ZYCA 5A14A 3H9RA 3RALA 3O0GA 5D12A 3M42A 3W18A 5DFPA 3VS2A 3WZUA 4R8QA 2ZV8A 4NT4A 1IASA 5HOAA 3R9DA 5FTOA 3MESA 2H34A 5K5XA 4DE4A 2GHGA 4S34A 3C4EA 1TQIA 2WZJA 1TQPA 3CXWA 4CZUA 3D5UA 2X9EA 2WTIA 5I4NA 4IM3A 4DFUA 5EDPA 3UTOA 1WMKA 3R21A 4XOZA 5K0KA 2HYYA 4BKZA 2XBAA 3TI1A 5BX0A 3HV3A 3NRMA 3RM6A 4DA5A 3SDJA 2XM9A 1AD5A 4QNAA 3D5WA 3PIZA 4ARKA 4PRJA 4KINA 2VTMA 3JYAA 4HVIA 3OW3A 1KSWA 4BC6A 3R1SA 4BN1A 5CAUA 5L6OA 1SVEA 3VHKA 4MD8E 1UV5A 3AD6A 4ZSLA 2ZAZA 3LFCA 3E93A 3LXLA 5AM6A 4HW7A 3SVVA 3PUFC 4LYNA 1XBCA 1UNGA 2PVFA 3ANRA 5BUEA 3R30A 5KMLA 5FDXA 4ASZA 3DAJA 4GCJA 4DBNA 4ACCA 1M2PA 4GS6A 5DR9A 2Q0NA 2XF0A 2PVRA 2GQSA 3V5PA 3HRBA 2WU6A 5HG5A 3FKOA 3P4KA 4YLLA 3PXKA 3Q9ZA 3U6IA 5JT2A 4PPBA 5CF6A 3ZYAA 5M09A 3F88A 2B9IA 4USEA 1LP4A 4CV8A 1Y57A 3UOLA 2IW6A 4QP1A 4ALWA 4AAAA 4I5MA 4V0GB 2BRGA 5K0XA 2PK9A 3E7OA 4Y95A 2WELA 1O6YA 3W10A 4F7LA 2IVTA 2W06A 1PMVA 3VC4A 4XUFA 4UMPA 3UDZA 3BKBA 5KE0A 2X7OA 3OROA 2CJMA 4E6DA 4BDKA 2OJGA 4WSQA 3CP9A 3DFCB 3W0PA 3PJ3A 4TYJA 4XYFA 3O50A 4CFNA 2C5NA 2HIWA 5TO8A 4C7TA 1H0VA 4NYEA 1G8SA 4NWMA 4UWYA 3FI3A 3U87A 4C4EA 2C30A 2XKEA 3P5JC 4OBQA 3F3WA 5EYCA 1JWHA 1W83A 4O4BB 1IAJA 4AT4A 4GUBA 3R7OA 4QTEA 3NVMB 4CFWA 2J0KA 2UUEA 3HRCA 3UE4A 3ZO2A 1JKTA 3OTUA 3GC0A 4D28A 4EKLA 4PUZA 5CU2A 3O8UA 4FV7A 2CKQA 4DEBA 2BPMA 3IDBA 1OL7A 5HBEA 4U3YA 4A7CA 3HMNA 1Q41A 4AGWA 4MXZA 2OO8X 5JZNA 4DFXE 2GHMA 5IMEA 3G15A 3Q9XA 2VTTA 4JQEA 2BIKB 4GU9A 3D94A 3ZRMA 1R3CA 3FMKA 4CG9A 4D1XA 3B2WA 4QTBA 4U41A 3RTPA 3ZU7A 4DH8A 2P2HA 3LQ5A 5A4CA 4AW0A 4O96A 1ZOEA 2YWVA 3QYWA 4FTKA 4LUEA 2WTKB 4EQCA 3NGAA 3OY3A 4LFIA 4O7VA 1MRUA 1OKZA 2VWZA 3ZC5A 4QMTA 2OF4A 5EDRA 5GJFA 3P5KA 2QURA 4EOKA 2G01A 3PA3A 1SM2A 3RHXA 3W0RA 2Z60A 4X21A 5CNNA 5HGIA 1BL6A 2ETMA 4AE6A 4QYYA 5F1ZA 4XV3A 3IONA 3O71A 4PV0A 4YPSA 4RIOA 4C35A 4U6RA 4S2ZA 3AOXA 4DEGA 4ZTNA 1QPJA 4KKGA 5IA3A 5DLSA 4NIFB 5D41A 3Q9WA 4F64A 3O7LB 2WD1A 5IQGA 5M44A 2BZIB 4USFA 3P0MA 4FZAB 1UU9A 2XK6A 4FEVA 4R1YA 2XK7A 1YI4A 2OH4A 3U55A 4LRJA 4D2PA 4IM2A 3B2TA 5FXQA 2QI8A 4ACDA 3KRLA 3DKOA 3M1SA 2W1GA 4S31A 4A9RA 5DBXA 3QHWA 4CSVA 4O21A 1UKHA 2WEIA 4YBKA 3PA4A 4W9WA 4E5AX 2P2IA 4MD9E 3ZH8A 4AXFA 3QQLA 3UMWA 5EQPA 4Q5HA 1J1CA 4GSBA 4I6LA 3QTWA 5A46A 4RT7A 5LVLA 2UZTA 4EOMA 2R3OA 2JDTA 4ALVA 2WTJA 4IFCA 4G3FA 2ZMCA 1BYGA 3BHUA 3COKA 4JIAA 4OBPA 4GJ3A 3SHEA 4D4VA 3RWPA 2H96A 4F9WA 4YU2A 4TW9A 5LOHA 4AQKA 3EQPA 1UWJA 3G5DA 3VUGA 3ZFXA 1UA2A 4C3PA 3DB8A 3CD3A 3QD3A 2BCJA 4FZDB 3RNYA 5BVFA 1R39A 2BHHA 4PDYA 3Q52A 2VWWA 5EYDA 5CAQA 3CE3A 4M69A 4NK9A 1BX6A 1AQ1A 2QLQA 4XX9A 3FEGA 3IS5A 3ORNA 2BZJA 2VWUA 3H3CA 2FSMX 3OS3A 4C38A 3SG9A 2ZV2A 2J5FA 4B9DA 5HLWA 2QO9A 3VUIA 1ERKA 3COHA 3ZXZA 4AN2A 4C37A 3OVVA 2X81A 2IN6A 1EH4A 5F95A 4DT8A 5DN3A 2FVDA 1OECA 4QMPA 4C62A 5J7BA 4BCOA 3ERKA 3P7CA 3NYOA 2VGPA 4FT9A 4K0YA 5AADA 5JGBA 4ZSEA 2BRHA 4LV5A 4YJOA 4GG5A 4UMRA 1CM8A 4YMJA 4P90A 1UKIA 4DITA 2W5AA 3RJCA 2UW8A 5BYZA 4BCKA 3ETAA 4ITHA 4IVAA 4QDEA 4WG4A 4L7FA 4ZLZA 3PJ1A 3L8VA 3UP7A 1OB3A 4AOTA 2W1ZA 3E87A 3QX4A 4ZSJA 2C5OA 3R8ZA 4CLJA 1PY5A 2QOKA 2JIUA 3OF0A 1J7UA 3FLZA 2ITNA 3CTJA 3QZIA 2Y0AA 4QRCA 1XBAA 3C0GA 2E9UA 3HDNA 4NUSA 3QALE 1OITA 3VNTA 5CS6A 4YHTA 4GV1A 3U6JA 1P4FA 3EQGA 3C4ZA 2QU5A 1OPKA 3NCZA 4I5HA 4W8EA 2XUUA 5K4JA 5D7VA 5ACBC 3HMMA 3R8PA 4PMPA 4O4FA 2PZRA 3KL8A 4PP9A 4IAFA 4B0GA 3H30A 2PSQA 3MPTA 2E9PA 4JX3A 4GIIA 5J8IA 4Y5HA 4XG7A 3RBWA 4B8LA 3CR0A 4EZ3A 5HESA 5JKGA 4NM3A 1YW2A 1V1KA 5J9YA 1PF8A 3MFTA 3F61A 4PMMA 2HY0A 2CKEA 4ZTHA 4DDIA 1GZNA 2YAKA 2BAKA 2YACA 5CTPA 3E92A 2QNJA 3DQXA 3NR9A 5DR2A 3LFQA 4BDJA 3CBLA 3PPZA 1NY3A 4JX7A 3DJ5A 4EH7A 3FPMA 4DLIA 2YWPA 5M4UA 4F1TA 3F2RA 4D9TA 5JQ5A 1ZZ2A 2BDJA 4JQ8A 5IZFA 3PSBA 5GIOE 3C7QA 5DOSA 5IG1A 1A06A 1TZDA 3M11A 2W99B 4DGOA 2GPHA 5JFWA 3FMLA 2GCDA 4TPTA 4JBPA 2P4IA 4O7YA 4IC8A 5C27A 4M66A 2VV9A 2F7ZE 3W0QA 3EB0A 5M55A 2Q0BA 5EYKA 4RMZA 5CEIA 4N57A 3DJ6A 5KMJA 3UGCA 4BWPA 2RG6A 3CKXA 4BDEA 4BCPA 4Z7GA 3H4JA 5KZIA 5BV3A 4IZYA 3NNWA 1CKJA 2UVXA 3KXGA 5CZHA 5E8YA 1Q8ZA 1SVGA 4BTJA 3PVUA 4JDIA 5DRBA 3KN6A 1TFFA 2C6OA 4HGEA 2V5QA 4IBMA 2XANA 4BCHA 5J95A 3TKUA 1JSVA 3QKKA 4FKLA 5AV0A 4MBLA 4QO9A 3F69A 2JAVA 1SNUA 4RA5A <