4DFNA

Crystal structure of spleen tyrosine kinase complexed with an adamantylpyrazine inhibitor
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
274
structure length
269
Chain Sequence
VYLDRKLLTLEDKELGSGNFGTVKKGYYQMKKVVKTVAVKILKPALKDELLAEANVMQQLDNPYIVRMIGICEAESWMLVMEMAELGPLNKYLQQNRHVKDKNIIELVHQVSMGMKYLEESNFVHRDLAARNVLLVTQHYAKISDFGLSKALRADENYYKAQTHGKWPVKWYAPECINYYKFSSKSDVWSFGVLMWEAFSYGQKPYRGMKGSEVTAMLEKGERMGCPAGCPREMYDLMNLCWTYDVENRPGFAAVELRLRNYYYDVVNE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase/transferase inhibitor
molecule keywords Tyrosine-protein kinase SYK
publication title Pyrazine-based Syk kinase inhibitors.
pubmed doi rcsb
source organism Homo sapiens
total genus 83
structure length 269
sequence length 274
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2012-01-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4dfnA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4dfnA01
3L8SA 4O0TA 3VS7A 3GU5A 4NIFA 5A6NA 1FVVA 3DAJA 5DYJA 3CJGA 1W84A 4P5ZA 3MN3A 1UU3A 2B55A 4O86A 1R39A 1DI9A 2RG6A 4GG5A 4BWKA 3QTRA 3OUKA 2YA9A 3PE2A 3KRJA 4XRJA 3RNIA 5JH6A 5BVFA 3DKGA 3AMAA 5CU2A 5BQ0A 3COKA 2BMCA 4UYAA 2PU8A 2R3IA 3R28A 4WO5A 4NTTA 2YIWA 4TPTA 4C8BA 2GNLA 3IW5A 5IDNA 1V1KA 5IPJA 1P4FA 3COIA 3DBEA 4FKRA 3VS1A 4ZMEA 3ODZX 3Q4ZA 2GHLA 5HX6A 2VTAA 1URWA 2B9FA 4RZWA 5CU0A 1NXKA 1CSNA 1M2PA 4IAZA 2KTYA 3LVPA 3ZEPA 4EH4A 5AAEA 2WMUA 1KUTA 4GU9A 4RC2A 4YMJA 1U46A 2Y0AA 3C4FA 4EK4A 4E73A 5KO1A 2PMIA 5D11A 3DB8A 4GJ3A 4L52A 4E5BA 4D1XA 5BNJA 4EQUA 4BIBA 3UIMA 4C33A 4GSBA 1Y57A 3EQHA 4GYGA 4W4XA 4RVMA 3FAAA 4OTGA 5T3QA 3Q2MA 4M67A 4QMZA 4N57A 2W17A 2ZB1A 1CKJA 1B6CB 2CMWA 3HECA 4FL3A 2WHBA 4H3QA 4MWIA 4XG8A 4FIIA 4FT0A 5ACKA 5JRQA 2F7XE 3MV5A 3OP5A 4I4EA 3TV6A 3TDWA 5CNOA 5BVWA 2HCKA 5IZFA 3MVLA 1S9IA 1YWNA 5CZIA 5IEVA 3WF7A 1I09A 4C0TA 2WGJA 3JYAA 4U80A 3HV6A 4F0IA 4UBAA 3PPJA 4AE6A 4JG7A 3SOCA 2GQGA 4YBKA 2BDWA 2VNYA 3FZOA 1JSTA 2VTQA 4MF0A 5F20A 2UZOA 4D5HA 5L8KA 4ZTNA 4EC9A 2PWLA 2F2CB 3I5NA 5KMMA 4ID7A 4F6WA 1PXPA 2UW9A 2PE1A 3C5UA 3NCGA 3BX5A 5C26A 3QLFA 3NUSA 1OB3A 4ENXA 4QP8A 2IW6A 2J7TA 4X3JA 3MGYA 5IISA 2BROA 3AMBA 4WD5A 3CTQA 4R5SA 3R9NA 1MQ4A 3R04A 1YOLA 4DEAA 2WMSA 3QRUA 4UV0A 5JSMA 2C5XA 4RJ7A 5KE0A 5IA0A 4R3CA 5HNIX 4FSQA 5ANDA 3S0OA 1JNKA 4N0SA 1DI8A 3CPBA 3SW4A 3W8LA 4S2ZA 4YO6A 3PJ2A 2VTJA 5AR3A 4MNEA 3SLSA 2YJRA 2WNTA 4OTQA 3FI4A 2W1ZA 3M42A 4AAAA 3BU5A 3ZXTA 5FLFA 2QOQA 4HJOA 3DK6A 4C4GA 4J71A 4A4LA 4ACCA 2IG7A 2VV9A 2CGVA 3ORTA 4P2KA 4F0GA 4RA5A 5BYLA 3CD8A 4GRBA 2GTMA 3DXNA 4ZTSA 4BCHA 5D7AA 4CFWA 5M57A 2VWBA 1WBNA 4QMYA 4XCUA 5AP0A 4GVJA 1RE8A 4G6OA 3DXPA 5IH6A 4AQCA 5LXMA 3A7HA 3WF8A 3RAWA 3UPXA 1H8FA 3R8MA 2BKKA 4GKIA 5KMNA 2E9OA 5FEEA 3LFCA 5FTGA 5EDRA 3W8QA 4R77A 5FP5A 4BCPA 5C4LA 4RZVA 1QPDA 4RIWB 3RK5A 4EI4A 4BI0A 3DDQA 3U6HA 3ZSIA 3E62A 4BYJA 2JKOA 3BWJA 3EZVA 4IAAA 5EI2A 4F7JA 4FE2A 4XV9A 5BVOA 4O2ZA 1BKXA 4MNFA 4JAJA 4FK6A 4EOMA 4MTAA 4F9CA 4H3BA 3I7BA 5HX8A 4G3EA 1IA8A 5F9EA 4RIXB 5FBOA 3WZKA 5FM2A 4J53A 4IEBA 5HIBA 3IONA 3ZUVA 5A4EA 3GCQA 4YBJA 5AP2A 3UG2A 3DT1A 3K54A 3C0GA 4FVPA 1G3NA 5JEBA 3LXNA 4ZTMA 3BU6A 1DAYA 2WELA 4PDSA 3PRIA 5IA2A 5HCZA 4F1MA 3ZO1A 1U54B 3GVUA 4RJ3A 4PPBA 2GTNA 3R1QA 3R02A 4O7ZA 2YM5A 3B2WA 4YJQA 2F7EE 3AD5A 4ALWA 4BDEA 5I9XA 3D4QA 5DE2A 3PIZA 4LRJA 2GQSA 1Q41A 2R3NA 4DG3E 5E8TA 3SXFA 1NVQA 5A46A 1F0QA 3UZRA 4OAVB 1OITA 4FSMA 3LJ1A 1OIQA 2CCIA 2O8YA 4G6NA 4BIDA 5JKGA 2YZLA 4DITA 3IGGA 4WUAA 4KBCA 3GB2A 3FEGA 5HLPA 5CAQA 4BTMA 3TIYA 4IB0A 1KE9A 2EWAA 2XK6A 2ZV8A 2WQBA 4O96A 3TJDA 3OXZA 4GUEA 4AS0A 3ROCA 3NVKI 1O6LA 5CXHA 3D9VA 3OTUA 1W0XC 2X0GA 2XK8A 4P5QA 5LCKA 3REPA 4ANQA 2IVUA 3NSZA 4EKKA 3QZGA 5IQDA 1JPAA 3F2NA 2XYUA 3RJCA 3ODYX 2V22A 4ACGA 2BZHB 5CF8A 3U87A 4D1ZA 3O8PA 5J9ZA 5LJJA 1EH4A 3CTJA 5IU2A 1I44A 2I0EA 4FKGA 2WQEA 4K77A 5AUWA 2ZB0A 4KS8A 4NCTA 4ZLOA 1VYWA 3DFCB 4WNOA 2OO8X 5CEPA 2JBPA 3G0EA 4S31A 5HNGA 4UMRA 2XB7A 3VW8A 3HV3A 1JKLA 5HU9A 1A9UA 3P23A 5GZ8A 3M2WA 4NFMA 3ETAA 1L3RE 1XH9A 3BEGA 3L9LA 2CNQA 3ENHA 4GH2A 2PZPA 1WBVA 2XEZA 4DH3A 2I0HA 4C38A 1Q3WA 3JY9A 3RINA 2G2FA 2IZTA 5CVFA 1O9UA 5HCXA 4N70A 4IC7A 5CU6A 3UMXA 2OI4X 2WAJA 4G3FA 3CQWA 5J79A 4XOZA 4BCKA 2VO0A 3NZ0A 3NCZA 3F66A 2RFEA 2XIKA 4IAKA 3TWJA 2XNMA 1E9HA 4GU6A 4TRLA 4BC6A 5EM5A 5IA5A 3F82A 3ZM9A 2JBOA 4FTQA 2RL5A 3GXLA 4D58A 2WMWA 1M2RA 3FC2A 3SRVB 4RVLA 4LOQA 1YXTA 2JIUA 3KULB 3QKKA 4FTIA 1Q99A 1VEBA 3CXWA 4RWLA 3A8XA 2ETKA 3C4CA 4IX4A 3UIXA 3VJOA 3ZS5A 3ZLYA 5AV4A 4CLJA 5HD4A 4FTKA 4H3PA 2R3FA 4LGHA 3NNWA 3BPRA 4IB1A 5DN3A 2XNGA 3HRFA 4D5KA 3DKOA 2BRNA 3ACKA 4ZSJA 2J50A 3P7CA 4EK3A 5HIDA 3HX4A 3G51A 5FP6A 4I24A 3TKUA 4F9WA 3D5XA 5J7HA 3QQGA 5LCJA 3VUHA 3LCKA 2OLCA 3CQUA 3PRFA 4F6UA 2ZV7A 1PMEA 2BDFA 3S1HA 3ZRLA 3IGOA 4DCAA 2Y4PA 3ELJA 3OTVA 5KMIA 4QD6A 2C0IA 4KD1A 5LARA 4Q5HA 1O6YA 4S32A 5F4NA 4D28A 4RVTA 2VTPA 3DK7A 2W1EA 3LFDA 3FMKA 5IEYA 5KUPA 3F9NA 5DVRA 3TXOA 2OXDA 2WEVA 1R1WA 4IAYA 1OZ1A 3PFQA 3F3WA 4UXQA 5HORA 2XKEA 3QCSA 4NW5A 3SGCA 4PTGA 2VX3A 4WKQA 1H1WA 3RKBA 1YOJA 3S3IA 5C4KA 3VBXA 1WMKA 1IEPA 1XHAA 2YCFA 4FTMA 4NM7A 3PVBA 4F9BA 4FGRA 4BGHA 4YU2A 3HL7A 3H9FA 4KWPA 4RX7A 3IDCA 3GC7A 4RIYA 4G16A 4FNWA 2LGCA 3DNEA 5CU3A 2EXEA 5BVKA 1J91A 3MIAA 4D1SA 2W1FA 2X6EA 5GIPE 3QUPA 1XKKA 4BBMA 3W2RA 4I5HA 1QPCA 3ZEWA 3TZ9A 4Z55A 1Y6AA 4FNYA 4O7YA 3AGLA 1IG1A 2GU8A 2OJJA 3UYSA 4LMNA 3HLLA 3R01A 3FLYA 4LOPA 5ETAA 5HCYA 4HCTA 4DAWA 1YRPA 4U8ZA 4O0SA 3C9WA 4K1BA 4B99A 2SRCA 4PDOA 3CBLA 3LFFA 4WHZA 3O7LD 3GFEA 4IVBA 4ACHA 4QQTA 1UWJA 3VRYA 1WBTA 4USEA 2OKRA 3PP1A 2J5FA 3QRTA 2W05A 4KS7A 4WT6A 4CKRA 1KE6A 1M14A 4QP3A 2ITYA 4U42A 5EW9A 3CKWA 4RJ8A 3VC4A 5IH5A 3O96A 4ITIA 4PTEA 4G5JA 3R9HA 5CF4A 3N9XA 4G3DA 4YC3A 1QMZA 2ZYBA 3KRRA 3DXQA 4C3FA 1ZYJA 3FMDA 1FMOE 3OW4A 5A54A 3GCVA 3BHHA 1H27A 2F4JA 4CQEA 2VO6A 4XYFA 4DEHA 3EMGA 1URCA 2XNBA 2YDKA 5HIEA 4W9XA 3SC1A 3R7EA 3PY3A 4BCGA 4DN5A 3AGMA 3JVRA 4DH1A 1G5SA 1V0PA 2NPQA 2WD1A 3LXKA 3ZO4A 2C47A 2C5NA 3FL4A 3LQ5A 4QTCA 4J95A 4BVUA 4BYIA 3R21A 4NEUA 4X3FB 4EEVA 2GNHA 2OF4A 1SNUA 2ZAZA 3QKMA 3R83A 4AGUA 3OXIA 4EBVA 5AA8A 3GOKA 4FTCA 5CANA 2AC3A 4A9RA 4B4LA 5TF9A 5DEWA 4JG6A 3E8CA 2F9GA 3FE3A 4FYNA 3DOGA 4FV2A 4YR8A 2ITTA 3MW1A 2YERA 3N4UA 3EL7A 3F3UA 1J7LA 4EHEA 4EH8A 5FXRA 3KXNA 4CZUA 5EHOA 2WOTA 2G01A 3NW6A 4LV5A 4PV0A 4QMPA 2PL0A 4OTDA 4EYMA 3ID6C 5LVOA 3DJ5A 4ZTHA 4FOBA 2WU7A 3FYKX 3VS2A 3RPRA 5I9WA 4G31A 5IQAA 5CVHA 3MB6A 3RPOA 1XBCA 1OM1A 3SX9A 2YIXA 2BVAA 2YDJA 5E90A 3QBNA 4BWPA 4F64A 5HTBA 5EQYA 1XH6A 4DF3A 2V5QA 3LMGA 2XJ1A 3LHJA 4IHPA 2VZ6A 4GS6A 4I6QA 4MH7A 5BVEA 1NVRA 4YSJA 3TTJA 3QC4A 4NZWB 4ANSA 4FZFB 3BGQA 4E4NA 4RLKA 3EQGA 4JR3A 3PWDA 4FSRA 4KRCA 5CSXA 4HVIA 5LMKC 3R2YA 4QOXA 4U3ZA 2QU5A 4F1TA 3ZUTA 4Q2AA 2EB2A 4I20A 2PUNA 3R2BA 3C50A 1STCE 1KOBA 4DH5A 4CGAA 2BAQA 2W1DA 3CY2A 2JIIA 4PMTA 3PPKA 4W8DA 4IVDA 4W4WA 4OTFA 4MXYA 4BIEA 4O7LA 3P7AA 3PG3A 3VS3A 4R7HA 1OUYA 1ZMWA 1OVEA 4RWKA 2J0IA 4CFVA 1FGKA 2OF2A 4L7FA 2HOGA 4D4SA 4C57A 3Q9ZA 3PY0A 4C4HA 4XJ0A 2IWIA 3NPCA 3PE1A 1YWRA 4E6AA 4BTKA 1CTPE 4JAIA 2PMLX 4RRVA 1ZLTA 5EI6A 3DQXA 4A07A 1PXNA 4BDDA 5LVMA 3LAUA 4EQCA 3O17A 4JNWA 4XLIA 3BHYA 5ANEA 5AV3A 3A4PA 2UZBA 4ZSGA 4U40A 4QP4A 3DDPA 4D2TA 2VX1A 2YISA 2WEIA 1WFCA 3ZO3A 2XUUA 4KABA 2QLQA 3NGAA 3SAYA 3EQRA 3LQ3A 2UZVA 4TN6A 3TNIA 4AZTA 3VS4A 3E5AA 5M08A 3TNPC 1H00A 4U7ZA 2BCJA 2XNNA 3R7YA 4F65A 3LLTA 1FVRA 1H0VA 4F63A 4KB8A 4PL5A 4QP7A 3NYVA 4L00A 4TYHB 3RCJA 3LFSA 4KIPA 4EHZA 3CE3A 3DNDA 3TIZA 4FSZA 4JBVA 3UNKA 2VTTA 2QKRA 2DUVA 2C30A 2I1MA 4QYFA 2R3HA 4R3RA 1YDSE 4TYGA 4HVSA 2XJ0A 2OH0E 4TWCA 5ETIA 3I1AA 1YOMA 2X8EA 3PY1A 4BB4A 4HCVA 3DBQA 3WYYA 4YSMA 2V7OA 3T9TA 3C51A 3OD6X 5AUZA 5HO6A 3B2TA 2VO7A 2UW6A 1MRUA 3UE4A 2CLXA 4JBQA 4U79A 4M68A 4WSYA 3EQPA 2UW0A 4YHJA 5DR2A 1Q62A 3HYHA 5EFQA 3TTIA 5DLSA 4KNBA 5E92A 4KIQA 4TTHB 1FINA 3GCUA 3MH2A 1WCCA 5DEYA 5HNBA 4GJ2A 5CVGA 3GU7A 2QU6A 3K3IA 3WILA 4D9UA 3JS2A 2W1CA 4L01A 3UYTA 1UU8A 4IH8A 3KXMA 3QQFA 3I7CA 4CMTA 5I4NA 4PQNA 2BZIB 3S2PA 4EKLA 2WPAA 3QCQA 5K9IA 3FSFA 4IZ7A 1K2PA 5KNJA 3BE2A 4FKWA 4FSTA 4Z16A 5ANGA 2OZAA 2F49A 4FA2A 2VRXA 3PSBA 3WZDA 4LG4A 1XBBA 2YACA 2GMXA 2YFXA 2Z7SA 3EFKA 4NCTC 3VS6A 2R7IA 3BWFA 3Q32A 4B6LA 4JG8A 3VF8A 4FSUA 4I3ZA 2XMYA 1V0BA 3QWJA 4PDPA 5L2WA 4QYHA 3FZPA 4MQ2A 3PYYA 3D14A 5J95A 4FVQA 2VD5A 3BYOA 3GCPA 3TKIA 4I6FA 5FGKA 4CFUA 4FT5A 2PUUA 2GQRA 4O0YA 1WBOA 3W2OA 5FEQA 2QNJA 2WMVA 4L45A 4MXAA 3LFQA 4AW5A 1FOTA 4FV4A 4HGTA 5IG1A 2JAMA 3JXWA 2C6DA 4O0VA 5CEQA 4CEGA 3VBYA 1W83A 4JOAA 4FTLA 4FVRA 5EYDA 3QTWA 3V6RA 3WI6A 3V5WA 3P5KA 3RI1A 2OK1A 3N4VA 4DFLA 3FLQA 3VUIA 3AD4A 4E8AA 4K0YA 4XBRA 4MBLA 3N4TA 3BLHA 2GNJA 4O7VA 3QALE 4WG4A 4Y73A 4TXCA 2AUHA 1ZZLA 2REIA 4WNMA 5AIRA 3UC4A 3VS0A 4GCJA 4C58A 5FWKK 4H39A 2WMRA 1J1CA 3ZO2A 1OIUA 4CD0A 2PE0A 3QZHA 4AGDA 4FUXA 4JX7A 4FKJA 4XUFA 3NR9A 5KZIA 4ZIMA 4EHGA 4MYGA 5EKNA 3COHA 3IW4A 3AT4A 3NYOA 3L9NA 3QKLA 4FT9A 5I9YA 4LL0A 3OCBA 4IWOA 3R71A 4IX5A 4K2RA 4X7QA 5T68A 5LVLA 3V5LA 3UC3A 2PVKA 2X39A 4IB3A 4QTBA 5DWRA 1ND4A 3GGFA 3P08A 5KMJA 4PY1A 3VQHA 4ZSLA 4EOSA 4R1VA 2F2UA 3TJCA 4FEVA 4RWIA 3CPCA 4E6DA 4K18A 2ZV9A 4G9RA 2ITUA 4WNPA 4CCBA 4RVKA 3U4UA 2WKMA 4HYHA 5AUTA 4AFJA 2XA4A 3WARA 4BDAA 5AUVA 3VIDA 5IA1A 3FLWA 1LEZA 3NNXA 2CSNA 4FKLA 5B2MA 3MFRA 5AIKA 3MDYA 4LRKA 4NYEA 4DBXA 3NIEA 3OROA 2QURA 3FZRA 1TQPA 4MK0A 4FF8A 4HZRA 3QRJA 4F7NA 3F3TA 4O6LA 5K5NA 5M4CA 1Q8TA 3TUDA 2JKKA 3FMLA 3HMNA 3HRBA 4AOIA 5KBQA 1G8AA 4L8MA 2QOOA 1GIJA 3H30A 3OCSA 4IVAA 4EONA 3RPYA 1A48A 4JDKA 3UP7A 2W96B 2ZM1A 4FZAB 4DLIA 3LOKA 1BI7A 1XH7A 5L3AA 3BBTB 1GJOA 2QO7A 4I93A 3LCDA 2J6MA 4CV9A 4KKHA 3P0MA 4R78A 1JKSA 3ZSHA 1XH4A 2XEYA 2R3RA 1XH8A 3O7LB 3QZIA 1NY3A 2PVRA 4FT7A 5E1EA 3V6SA 4ACDA 1Z9XA 2RFDA 4ARKA 4FI1A 4CT2A 2C3IB 3BYMA 4WOVA 3V5JA 1OIYA 5TT7A 5IF1A 2OW3A 2QHMA 4UYNA 2CKPA 2C6KA 4FSWA 2RKUA 2HY81 3RK7A 4C4IA 5LOHA 4YJUA 4XP3A 4IAIA 4RJ4A 3HP2A 4FICA 4RQVA 3ZC6A 4DC2A 2AYPA 5AM7A 4RGJA 5L6WL 2XNOA 5J9YA 2BAKA 2XIRA 3HMIA 3VVHA 4EORA 1GZ8A 1FGIA 3W2PA 3LXLA 1SNXA 2QOFA 1Y8GA 2PSQA 3S95A 2VTRA 4Y46A 2A4LA 4ZLZA 4ZZOA 1RJBA 1WVXA 2G2IA 3SHEA 3U6JA 4UWCA 3EQFA 4JQ7A 4BR3A 3KL8A 3Q60A 2PVMA 3OT8A 3I0OA 3LIJA 4L3PA 2UV2A 3RTPA 3GENA 3DK3A 3KF7A 4QNYA 5IMXA 2PVLA 3GU6A 1MP8A 3F88A 4BCNA 1P4OA 2RFSA 2ZVAA 3BE9A 5F94A 3W2QA 4EK6A 2H34A 5AX9A 4DTKA 3VBWA 1H0WA 2ZMCA 4I6BA 2ZM4A 1DAWA 2QO2A 4PP9A 2B9HA 4GIIA 4PP7A 1OL6A 4MWHA 3QQKA 4O82A 1R3CA 3Q9YA 5I0BA 3A2CA 2W7XA 3RP9A 4QMQA 1ZYCA 2C1BA 3D7TB 3OS3A 5GINE 2GNGA 3HMMA 4FEXA 4KBAA 5CF5A 3KMWA 4GVAA 1DM2A 4AOJA 1QCFA 2JKQA 3FHIA 3MVMA 3OOGA 3KRWA 1CDKA 3GFWA 4G9CA 4DG0E 3U9NA 2RG5A 5HICA 4TY1A 4IIRA 4JQ8A 4X3FC 4ONAA 2OG8A 4E3CA 3WF6A 3QWKA 3UBDA 3UZPA 1YDRE 2J4ZA 2W4KA 2B52A 2FB8A 2XM9A 4QQJA 4LI5A 2QKWB 3DTCA 3S00A 3WYXA 4PDYA 3ATTA 4I0SA 3VBQA 4BHNA 5IUIA 4IZ5A 3PJ8A 4D0WA 5L2IA 5LVPA 4MCVA 4QYGA 1PXOA 2C6EA 2OJFE 5K4JA 2Y7JA 3EQIA 2XIYA 3AXWA 2UUEA 3KCFA 3QF9A 3KXGA 2QG7A 3GU8A 5LMKA 2J0MB 3NYXA 3ORPA 4IWDA 2DYLA 3QFVA 4I0RA 3VHKA 2BFYA 2W06A 2HY0A 4UWYA 2OJ9A 3QD2B 4OR5A 4AZFA 1XBAA 4PNIA 5EKOA 2YCRA 3PDTA 3OZ6A 1GZNA 3R1NA 2HWOA 5FTQA 5KKRB 4RFMA 4L68A 4EWQA 4YJNA 2ERZE 4S34A 3F61A 3FZ1A 5E9EA 2ITWA 1Q4LA 3QTXA 4O1OA 4BKZA 4M15A 2BZKB 5KHXA 3MWUA 5DHJA 4YZNA 5L8JA 4AOTA 4EWHA 3ORZA 3FLSA 4D55A 2WMXA 4EH9A 1WBPA 2XRUA 3A7IA 4N6YA 3TZ8A 4U81A 1PXLA 3POOA 2IW8A 1JBPE 3W33A 5HE2A 1OPLA 1Q8WA 2A1AB 4JX3A 5HVYA 3SV0A 2YWVA 5AFVA 1XR1A 1K3AA 1P14A 4XS2A 3QX4A 2GNIA 4BWXA 4PNKA 2GSFA 3IQ7A 2EU9A 5AEPA 3LW0A 3EH9A 3PXKA 4BCMA 3H9RA 3ORNA 1PF8A 5DT0A 4XHKB 2HZ0A 4RIWA 2GDOA 3QYZA 4O0XA 3C7QA 3NEWA 1KSWA 3PVGA 4NW6A 4XG9A 4QQ5A 3ALNA 4F4PA 3SA0A 4F99A 4U6RA 4DH8A 2C3KA 5EHYA 3VULA 1CM8A 1T46A 2QONA 2W4JA 2VU3A 5T6KA 2JDRA 3MY1A 3C1XA 1AGWA 3R9DA 4FX3A 2IZSA 3BYSA 4RIXA 5K0KA 3PA4A 5K4IA 1YHVA 1BMKA 1OIRA 2JITA 3TNQB 4DINA 5ANIA 4LOOA 2JGZA 5BUEA 3ROYA 4AW0A 3CR0A 5E8XA 2WOUA 3ZLWA 5E8YA 5AV0A 5BPYA 5I3OA 2ETRA 3DBDA 4F6SA 4CNHA 1UKHA 2WMQA 3PWYA 4EK8A 3DBCA 1U54A 4LFIA 3I4BA 2QVSE 2DS1A 4F70A 3DFAA 2WTDA 3G0FA 3A7JA 3F3VA 3QQHA 4FKUA 4PX6A 2BFXA 4WUNA 3ERKA 3WZUA 5CSWA 5GIOE 4AU8A 3UQFA 2CNUA 1F5QA 4QMLA 4JRNA 2NRYA 2C6IA 2XYNA 3KGAA 5J5SA 2A27A 4IMYA 4L6QA 5AUXA 1ZYSA 1NVSA 2JAVA 3O51A 5AM6A 4M97A 5HG8A 4CLIA 4IANA 4TYEA 4OT5A 3SG8A 4GK4A 1OBGA 3F5UA 5IQIA 5DA3A 3NRMA 3Q9XA 3R6XA 4C62A 1AD5A 2BKZA 5HE1A 3KCKA 1OPKA 3RPSA 4BGGA 4C36A 5L8LA 4IZAA 1IAJA 3OC1A 3DB6A 3EB0A 5C01A 4HW7A 3VW6A 1BL6A 4AA0A 1W7HA 1OBDA 1Q97A 2X7FA 2IW9A 1BX6A 3UG1A 4RX5A 3II5A 3HV4A 3R9OA 3NUPA 1Z5MA 2IJMA 3A4OX 4H36A 2PPQA 3V8SA 5CS6A 2VWUA 2QOKA 3QTQA 4D2VA 3BQRA 4YZ9A 3KEXA 3MH3A 2C3LA 3DAKA 4Y8DA 4D2SA 1YXUA 1H08A 1CMKE 1PKGA 4C3PA 4IM2A 4H1JA 3PP0A 5I9VA 2XBAA 2PYWA 3KB7A 5CEKA 2X6DA 3NLBA 4YJVA 4EOLA 3EJ1A 5K0XA 2C6TA 2OIDA 2EXCX 5EM6A 5CAPA 5TKDA 2BRBA 4BCQA 3OWKA 3HA8A 3SOAA 2QOCA 3BQCA 3EWHA 4V05A 2BDJA 3F7WA 3MVHA 4Z3VA 1E1XA 5FTOA 2UZNA 1LR4A 3UNJA 4MX9A 2O2UA 3BCEA 3R1YA 2XNEA 3ZM4A 1BL7A 2ITXA 1MRYA 5F1ZA 3UIBA 1JWHA 5E8ZA 2YABA 4K11A 5JMSA 3KFAA 2QD9A 4AXAA 3HA6A 3EOCA 4YHFA 3Q5IA 4PRJA 3R1SA 2CLQA 4A9YA 4RA4A 2C0TA 1BLXA 4BDBA 1Q8ZA 3IG7A 3HNGA 4PPAA 3E64A 5EH0A 5AUUA 4C02A 5JFSA 2ITPA 4FKVA 4J7BA 5FRIA 5J8IA 3LMHA 3DKCA 3PXRA 5I9ZA 3QC9A 4O22A 3ZLXA 3TDVA 3EFLA 3NX8A 1JVPP 4RMZA 3G5DA 3MPAA 2XM8A 5EW3A 1PYXA 3BGZA 4FV1A 4KIKB 2VUWA 3VRZA 2W99B 3KULA 2R3GA 3R7UA 3ZYAA 2X4ZA 4JDJA 3VBTA 2GFSA 4MXXA 3AC8A 2NP8A 2WIHA 3A99A 3V5QA 4CFNA 4MKCA 4LYNA 4E6QA 2X2KA 5D7VA 3HDNA 4RG0A 2HXQA 3TNWA 3FKNA 5CU4A 3UOHA 4QO9A 1PMNA 5JQ5A 2B0QA 4X0MA 3KXZA 4O0RA 2OJIA 3UVQA 3F3ZA 2VWIA 4PMSA 5ETCA 1ZARA 5DMZA 4TZRA 5DFPA 1PY5A 2FGIA 4YPSA 1Q61A 2OFUA 4AT5A 4FEUA 2WO6A 3QCXA 4GG7A 4BY9E 4FKQA 2C3JA 4QMNA 4YZCA 4J1RA 1UU9A 4UMUA 1SVGA 4NM0A 4IADA 3I60A 5EM8A 3OY1A 4OGRA 5IQBA 2OFVA 4CZTA 3F6XA 2CN8A 3TV4A 2RFNA 3FZTA 3OCTA 3ZDUA 2R5TA 4IE9A 4FL2A 2C6LA 2UZDA 4XV1A 4AT3A 3VS5A 1B38A 3EN4A 4FIJA 4XG4A 2XZSA 2BIYA 1WBSA 3RBWA 3R00A 2ONLC 2Y6OA 4HPTE 3FI3A 3DV3A 4F0FA 3JVSA 2PVFA 5CI7A 3H0ZA 4P4CA 4FV6A 5AR8A 2E9PA 3FYJX 4QYYA 4IJPA 4XNEA 3EN7A 5CSHA 3ULZA 5JGAA 2XRWA 2FSTX 2I0YA 4ZY6A 5IQGA 1FMKA 1ZAOA 3G33A 5A4QA 4CG9A 4XOYA 4TWPA 3IPHA 1XH5A 5H3QA 5AJQA 3UOKA 5K5XA 2X9FA 2BRHA 4B8LA 2IZUA 4I5CA 4XMOA 3CY3A 4EBWA 3ORLA 2PUIA 1Z57A 4RFYA 3V01A 4ZS4A 4AZEA 2IVVA 2RGPA 3BV2A 3NWWA 3EL8A 4QTAA 4L46A 5CXZA 3D5WA 5LVNA 1TVOA 3I0QA 4ZSEA 5DIAA 3V51A 4QRCA 2OXYA 2Z02A 4G3GA 2R3LA 2P55A 3GOPA 1YXXA 3SG9A 4A9SA 3A60A 5HGIA 5DT4A 4XG3A 3GNIB 4L7SA 1AQ1A 3R63A 3Q4UA 2HWPA 5CY3A 2UW3A 3ZZEA 4ZLYA 3P9JA 4FK3A 1M52A 3KMUA 5HG9A 1PRYA 1BUHA 3WIGA 5FEDA 5JFVA 2EXMA 2XBJA 3DZQA 3C4ZA 5GJFA 1OL7A 4CKJA 4K6ZA 4C35A 2YITA 3F5XA 2JFMA 4YGAA 3KRLA 2PVJA 2GS6A 3RWQA 2ZDTA 3MH0A 4I41A 5D9HA 3M11A 3OG7A 3L8XA 2JEDA 5EYKA 5FM3A 3BHUA 4C4EA 3G6HA 5FDXA 3A8WA 1DS5A 3EZRA 3E3PA 3DLZA 4Z7HA 1H1RA 2QO9A 3DAEA 4B7TA 2C6MA 4AT4A 3WIKA 4FZ6A 2CGXA 2XF0A 4X3FA 4G34A 4IVCA 3E7OA 3Q53A 5M4UA 2XJ2A 1SZMA 2Y6MA 4QPSA 3TZMA 4TYJA 4QT1A 4ZZMA 5FXQA 2HZ4A 3QHRA 3C0IA 4HCUA 4MD9E 4I23A 4DGNA 4EZ5A 1T45A 4FKOA 5EQPA 2ACXA 3P86A 5CEOA 4BDHA 3R0TA 4M66A 5FQDC 5L2TA 3PLAE 3CJFA 3AT3A 1NW1A 2P2HA 4AN2A 4FOCA 4UY9A 4D2RA 5FUTA 3UQCA 4EOJA 3QXOA 3RNYA 5HTCA 4LUEA 3JPVA 3RCDA 4WSQA 2VWVA 3OEFX 1X8BA 2XCKA 4YLLA 5JT2A 1B39A 4NJDA 5KHWA 2WIPA 3NNVA 3PUPA 3MSSA 4BDGA 4GIHA 5JN2A 2X7GA 4ZS0A 3HEGA 4Y72A 2QHNA 5CENA 4CFXA 1SVHA 2W9FB 4KSQA 4BCJA 2NRUA 4KRDA 4M14A 1U4DA 5KMOA 2Z8CA 5CZHA 3KMMA 3Q5ZA 1APME 2ZOQA 4O0UA 4E26A 3ZTXA 2X2MA 3KY2A 2JDOA 4DE4A 4L9IA 2HK5A 4AP7A 2C68A 2C5VA 1LEWA 4JJRA 4RPVA 4MVFA 3EHAA 2JKMA 2QODA 4FUYA 4BF2A 4HYSA 2CDZA 2CGUA 3SQQA 3T9IA 3W18A 5AA9A 3PXYA 3ZZWA 3FQSA 3F5PA 5D10A 4QNAA 3R8UA 4I94A 5FDPA 5AV1A 4XX9A 5KBRA 4A4OA 2R3JA 4FG7A 5ANOA 3EYGA 2R3MA 2OZOA 3AD6A 3DKFA 5KKRC 5FBNC 3AG9A 4O0WA 3PXFA 1Y91A 5LWMA 1OPJA 4FZDB 2OJGA 5CNNA 3CEKA 1KWPA 3C0HA 4EUUA 3HVCA 1FVTA 4HGLA 4KIOA 3LKMA 3O8TA 2VTOA 4L42A 4QPMA 4FNZA 4M84A 3F5GA 3HDMA 4B0GA 3UVRA 3UOLA 4UZHA 3FMEA 1LP4A 4Y83A 5L6PA 5IQFA 3UO4A 3TM0A 2E9NA 3DJ7A 4I4FA 3LPBA 5BMSA 3TZ7A 3VO3A 3NUNA 5KZ0A 2G15A 2HZNA 4C59A 2QCSA 4KINA 5EK7A 1PXKA 2BRMA 3HV5A 5GHVA 3V8WA 4IXPA 5E8SA 4BTJA 4TT7A 4Z9LA 4OTHA 5A14A 3RALA 4E5AX 4U41A 1R0EA 3BYUA 4FIFA 4IM3A 4XV2A 3FLZA 5LMAA 4UZDA 3V04A 1XWSA 4FNXA 3A7GA 4NSTA 3BU3A 4NK9A 4CV8A 4XP0A 2PMOX 1SM2A 2HENA 3QTIA 4TYHA 2UW5A 2YLFA 2B9IA 4AF3A 5DH3A 3QTUA 4B8MA 2VWYA 2PUPA 3DTWA 3MJ1A 4L67A 3P1AA 5DNRA 2WTCA 4UMTA 4O91A 4RJ6A 3IOKA 3CKXA 4WIHA 3DQWA 4JVGA 4M0YA 3T8OA 2FVDA 4C2WA 1P5EA 4MBIA 1VR2A 5HEZA 3MESA 3G9LX 4DGGA 5IEXA 4DT9A 2Z7RA 4BGQA 1UNHA 4HNFA 2YM8A 5JZNA 2RIOA 4D2PA 4GK3A 2P0CA 3A7FA 4GV1A 5JGDA 3IK3A 5E8VA 4MAOA 3W16A 4E4MA 2UZUE 4UMQA 4YUQA 1W98A 2Y4IB 1TQIA 3R7GA 2C0OA 4FEQA 4QP2A 4XG6A 4ASXA 3E93A 2WTWA 1PXIA 4JI9A 2Q0BA 3VUMA 3F7ZA 1PHKA 4YTIA 2VTSA 5CT7A 3B8RA 5GNKA 5EQEA 4X2KA 3GQIA 4WBOA 2XNPA 1W82A 3KF4A 1GOLA 2C4GA 3QGWA 5HE3A 2B1PA 2I0VA 3PG1A 4J8NA 5EDQA 1XQZA 3VUTA 3MFSA 4W4YA 2CNVA 4AA5A 5ANKA 2VO3A 4A7CA 5L4QA 1PKDA 2GNFA 3SRVA 3I6UA 3OMVA 3QD4A 1RDQE 2XK9A 4HGEA 3RM6A 4X6QC 3PJ1A 3DGKA 4IWQA 3VUKA 4EC8A 5CF6A 2PVYA 1ZMUA 2PMNX 2WQNA 4JDIA 2OWBA 3DU8A 3WF9A 4I1ZA 3GP0A 4I5MA 4OTWA 1CKIA 3GC9A 4GL9A 4NU1A 3K2LA 2F57A 2HAKA 2PK9A 4ZTQA 4YLKA 4C61A 2IZRA 2ZDUA 3DCVA 2C5OA 4G2FA 5BYZA 4E4LA 4FTNA 2R4BA 2R3QA 3FV8A 3OWLA 4DFYA 5IQCA 3NW7A 4UEUA 2H8HA 1JQHA 2BPMA 4AX8A 3Q52A 5AP7A 4AGWA 2CHLA 2CJMA 3POZA 4EYJA 3ULIA 4AUAA 4BZNA 4TNDA 4CYJA 5CASA 4ZY4A 3OY3A 2WB8A 1OUKA 4ZJIA 4TWOA 4BTFA 4PL3A 5CSVA 3KVWA 3O71A 3TCPA 5HKMA 3R8ZA 3BLRA 5AP5A 4OUCA 1IRKA 4DA5A 3IOPA 4QPAA 5KCVA 3ANRA 4OTIA 1QPJA 1ZOHA 4PL4A 5ITAA 2ZM3A 3DZOA 4I6HA 4G3CA 4ZZNA 3TKHA 3BKBA 4IAFA 1CKPA 3NIZA 5HTIA 3UOJA 3KKVA 5B7VA 1U5QA 5E91A 2YM3A 4M69B 1UVRA 3JY0A 3RVGA 3QA8A 3CD3A 3ZRMA 2Z60A 3OWJA 3BHTA 5AR7A 5JRSA 4YJPA 5L2QA 5HO7A 2QC6A 2UZWE 4DFNA 5J1WA 5IUHA 1OI9A 5ACBC 5DOSA 5C27A 1P2AA 2XKCA 3HRCA 3F2RA 2HXLA 4LRMA 1Q8YA 1GIIA 3D0EA 2BZJA 3DY7A 3HP5A 3O2MA 5EI8A 4DLJA 2QOHA 5BYYA 1GAGA 2PE2A 5M55A 4DCEA 3PA3A 1ZYLA 1FQ1B 2JLDA 4GEOA 2ESMA 2WU6A 4X2FA 4YC8A 3D2IA 4V0GB 2ITZA 2VTMA 4FZ7A 5M07A 2HZIA 4YJSA 4EK5A 4XBUA 2PY3A 4Y85A 3KK8A 3ZFYA 2YAKA 1WVWA 2J2IB 4J96A 5CQUA 4NIFB 3G15A 3AQVA 2J90A 3IDBA 4NT4A 4A06A 1JSVA 3NUAA 4ORKA 4C3RA 4C37A 3HMPA 1GNGA 3E63A 2YEXA 4X2JA 5C8NA 1RQQA 2W5AA 2EB3A 4JBOA 2VX0A 5J87A 4MD8E 2ONLA 3UZTA 3HGKA 2J9MA 4CSVA 1ATPE 1Q8UA 2QG5A 2R9SA 4YLJA 4F09A 5IA4A 4FIHA 3L9MA 3U51A 5HLWA 4CXAA 5AADA 4NL0A 1GIHA 3DPKA 2XH5A 3O50A 2PZYA 2VGOA 4UN0C 1OKYA 2QLUA 4F9YA 2X4FA 4F1OA 5GJDA 3V5PA 2DWBA 1G8SA 4BL1A 3IS5A 3MIYA 3I5ZA 1H4LA 4NM5A 1PXJA 5ICPA 2R0IA 1MUOA 1FBNA 2FH9A 3BYVA 2FSOX 3CTHA 4IZYA 2CCHA 4WRSA 2YHVA 3MI9A 2XKFA 3QRIA 2YLEA 3QU0A 4X2NA 1GY3A 4NM3A 5IQEA 1YHSA 4KKEA 4GW8A 3UGCA 4FV3A 3RAHA 4BCFA 5HBHA 3C4WA 3VF9A 4BFMA 5HVJA 4X21A 4K8AA 3THBA 4TKSA 3H4JA 4L53A 1HOWA 4ZK5A 5G6VA 2I40A 2XS0A 3C13A 4NH1A 4P7EA 3Q4CA 4W9WA 4YO4A 3GEQA 3NUYA 4WG5A 3PPZA 3IKAA 5GJGA 5HLNA 3ZLSA 2FSMX 3GQLA 4L3JA 3C5IA 4FTJA 4LUDA 4EOQA 1REKA 4B9DA 5BMMA 3U6IA 1OL1A 2YM7A 3KXXA 3MFUA 4E4XA 2F7ZE 3WOWA 1SYKA 4FMQA 3CLYA 4JS8A 4NFNA 4BDCA 3RZBA 3P4KA 4M7IA 4XG7A 2B53A 4Z7GA 5HVKA 3VWAA 1GZOA 1Q5KA 3VQUA 2ETMA 4IQ6A 4A9UA 3AC4A 4O2PA 5EYMA 3ORMA 2NNWB 5CWZA 3R9RA 3LJ2A 2XIXA 4RX8A 5HZNA 3OHTA 2Y9QA 3IDPA 3LE6A 4U97A 5AR2A 3U8WA 2VTIA 2C6OA 5HHWA 2X7OA 3U54A 3W1FA 1ZXEA 3U55A 3MS9A 4C34A 4O7SA 3TI1A 1JKKA 5AP4A 2WTKB 4TW9A 4EZ7A 5HG7A 3QQLA 1YVJA 2P33A 3D7TA 5HI2A 3LFBA 2ITOA 4ANLA 5D41A 3LFAA 4ZJJA 3ORXA 3MVJA 2O3PA 4MNEB 3FLNC 3G9NA 2CPKE 2O64A 3BHVA 3QXPA 4UMPA 3A62A 4KBKA 1YXSA 3GU4A 3PSCA 4FG8A 4W8EA 3ZH8A 5E8UA 4ZOGA 3P7BA 4IB5A 1WZYA 2C1AA 2H9VA 1YWVA 1IASA 2FSLX 3QD3A 1ZY4A 2QR8A 3E87A 3NDMA 4IFCA 4L44A 1QPEA 4U44A 5AP1A 3ZFMA 4WG3A 3ZBFA 4BDFA 2JC6A 5AX3A 5M53A 2J0KA 4E5WA 3IW8A 3SDJA 1M7NA 1L8TA 4OTRA 4JBPA 5DI1A 3ZC5A 4ANOA 3ORKA 4FYOA 4IWPA 3VN9A 1JKTA 2UW7A 3KQ7A 4OW8A 4YTFA 4DFXE 2UVYA 3KN5A 4HGSA 3ZOSA 3FC1X 4XV3A 2BAJA 4O83A 2YIYA 5J7BA 2HYYA 5DG5A 1H1SA 1ZOGA 3VHEA 1WVYA 4QMUA 4TYIA 1TKIA 3VUDA 2HW6A 2WTIA 4QMVA 5J5TA 3AC5A 3EKNA 3I81A 3VJNA 4EJNA 2O0UA 4HVHA 2YM4A 3CP9A 3R7VA 3KA0A 5C1QB 4RLLA 3ZDIA 2JD5A 4PUZA 5F95A 3VNTA 2GS2A 5I9UA 2VNWA 1KOAA 4U9AA 4P90A 3EN5A 2BUJA 4C4JA 3TUCA 4ERWA 4V04A 4QMSA 5M44A 3AT2A 3K3JA 4BZOA 4IX6A 2FO0A 1IR3A 3C4XA 2OICA 1XO2B 4U43A 4UB7A 3ZCLA 1O6KA 5L2SA 5CQWA 4KA3A 4A9TA 4FKTA 4I22A 4AFEA 4BCIA 4JXFA 2QR7A 4QQCA 4IFGA 4EOKA 5AP3A 4D4YA 2VAGA 3MJ2A 1E1VA 1H01A 3MY5A 3LMIA 3E88A 4KKGA 1TQMA 2Z7QA 3LZBA 1JSUA 5JK3A 1YI3A 3KK9A 1FPUA 4J52A 4LGDA 4RSSA 2VWXA 4ASDA 3LXPA 2CKQA 4FBXA 4D4VA 3ACJA 3FBVA 5CAOA 4JRVA 1ERKA 5LMBA 1YHWA 4ZP5A 3ALOA 1H28A 3UIUA 2ERKA 4GKHA 4CKIA 3OF0A 3CS9A 3R8PA 2X9EA 3D5VA 4CVAA 1R0PA 3OOMA 3C4EA 4ANMA 1J7IA 4DEBA 3LFNA 3FKLA 4II5A 4MXOA 4CYIA 5A4LA 4V01A 4EH7A 4FTUA 5IUGA 3CSVA 5H8GA 4K9YA 4ZAUA 4XG2A 2EUFB 4ZTLA 4DEEA 3OW3A 3SW7A 3FY0A 4FIGA 4IM0A 2GHGA 2ITQA 5AP6A 1JLUE 3NUXA 4NUSA 3UJGA 1VYZA 2XP2A 4J99A 5CSPA 3MPTA 2KULA 3MA3A 2V55A 3Q4TA 5EG3A 3DA6A 4M13A 4CCUA 5HU3A 1IAHA 2O63A 4F7SA 5TE0A 4CRLA 2XK4A 1YI6A 4BDJA 3VAPA 4RQKA 3FQEA 4M0ZA 2GHMA 3I79A 5M51A 5AR4A 4JIKA 3L8PA 4HVDA 4NKSA 4BHZA 4WNKA 4AGCA 4CTBA 1J1BA 4CMOA 3OEZA 3UMWA 5CTPA 2QI8A 3D2KA 2B9JA 3COMA 1MRVA 3FUPA 5ANJA 3L8VA 4EQMA 4YNOA 3FSKA 2YAAA 4GT3A 4RT7A 5DR9A 2YJSA 4A4XA 5KX8A 1WBWA 2YCSA 4G5PA 4DEGA 2VTHA 2J5EA 4AE9A 1IA9A 3UDBA 2BHHA 4JQEA 4L3LA 2XK7A 1Y6BA 2OH4A 3Q3BA 5GZ9A 5EOBA 2QOLA 4ZTRA 5HO8A 4O21A 3HAVA 3QL8A 4YC6A 2BTSA 5B0XA 3BZ3A 5FD2A 3FMJA 2Y4IC 3G90X 5DT3A 4DTBA 4I5PA 2QQ7A 4ACMA 2H96A 3FZSA 4IJ9A 2J0JA 4JR7A 4X6RA 3KREA 1UWHA 1ZWSA 2ITVA 3ZRKA 2JIVA 3Q04A 4Q5EA 3AC1A 4RFZA 2X1NA 4KUJA 4QMOA 3RHXA 4M8TA 4AWIA 2G1TA 3QHWA 4MD7E 5M4FA 5M4IA 2VGPA 3UTOA 1NT2A 4IC8A 4E20A 5KMLA 2UVXA 3A61A 3QLGA 4FV9A 4FV8A 3KVXA 4I92A 5CAVA 5ETFA 4CFMA 4PTCA 1RW8A 4R1YA 3UNZA 2EVAA 3FI8A 3BV3A 3H3CA 3FXWA 4QP6A 1VJYA 4M3QA 3FMNA 2BTRA 3W2CA 4CZYB 2YIQA 4YZBA 5TOZA 3SD0A 3BGPA 2YN8A 4M12A 4JT3A 1YDTE 4KSPA 2E9VA 5CX9A 5I3RA 3PJ3A 5BVNA 4K33A 4R7IA 4ZXTA 3BBWA 2CKOA 2JDTA 1KE8A 3E3BX 3HKOA 3L9PA 3GCSA 4FV0A 3MY0A 4NJ3A 2P2IA 2R3OA 2W5BA 5HESA 5HQ0A 2HIWA 2YM6A 3AOXA 4S33A 1HCKA 1W8CA 4YPDA 4D2WA 4QTEA 4AN9A 3DS6A 1LPUA 2Q0NA 5LQFA 1JOWB 4APCA 3SXRA 4BCOA 3UO5A 3W10A 4FV7A 4FV5A 4IDTA 3NUUA 1J7UA 5E1SA 2C5YA 2VWZA 2A19B 3NYNA 1H1PA 4O38A 3WF5A 4BICA 4E7WA 3EQDA 3FXXA 1ZOEA 4FT3A 3TUBA 2IPXA 4AA4A 3LM0A 3FKOA 4OBOA 1KV2A 4Y5HA 3QQUA 3PXQA 5HG5A 2GCDA 3RHKA 4L43A 1Q3DA 3GUBA 4YURA 1UNGA 4KIKA 3RAIA 4RIYB 4EZ3A 3LQ8A 1PXMA 2OSCA 4UXLA 5EDPA 2IN6A 4YTCA 1REJA 3SVVA 5H9BA 5M56A 1F3MC 3O0GA 3PJCA 4O84A 2BR1A 4OT6A 4EH3A 2WTVA 3N51A 3BELA 4EUTA 2PTKA 3BIZA 3PTGA 3EQCA 2WZJA 3LCSA 4LM5A 3ET7A 3Q6WA 4U3YA 3CIKA 3RM7A 4ERKA 4N6ZA 2R7BA 4R8QA 4RC3A 2R3KA 4FSYA 5AMNA 4GT4A 3WE8A 3RK9A 4DYMA 4Y5QA 4YJTA 4JIAA 3D83A 3L1SA 3ORIA 4XP2A 3LJ0A 4FTRA 1OKWA 5CLPA 4OAUC 3RAKA 4BI1A 3SXSA 2E9UA 2WTJA 3VUGA 3ZONA 4CTCA 3FDNA 2PULA 2UZEA 2UZTA 2PZ5A 2X8DA 4LL5A 2X2LA 4U0IA 3ITZA 1HCLA 3FHRA 3PIXA 4I21A 2V0DA 2R3PA 4DG2E 4HOKA 1VZOA 2BHEA 3GBZA 1OKZA 3KC3A 5C8MA 3WBLA 5IKWA 5A3XA 2WMBA 3TT0A 4ZSAA 3QTSA 2W9ZB 1ZY5A 3GI3A 3OXTA 3ZBXA 4F08A 5FXSA 5E7RA 2CKEA 4EOPA 3K5VA 4DTAA 1UU7A 2I6LA 3MH1A 2IVSA 2PHKA 4ANBA 3G6GA 5HD7A 3V5TA 3RMFA 1H1QA 4EH6A 4O7TA 3Q6UA 5DR6A 2UZLA 3FMHA 5DBXA 1V0OA 4JLCA 3CCNA 3QTZA 3PXZA 4F7LA 4FGBA 4O81A 5JFWA 4PWNA 4TNBA 5BX0A 2X8IA 4BDKA 4YHTA 4YJRA 3D15A 4NWMA 2DQ7X 1YQJA 2A0CX 3TL8A 2W1IA 3S4QA 3FPQA 4IW0A 5CAUA 3H10A 5FG8A 3E7VA 3R30A 4J97A 1KV1A 2IO6A 2J51A 3P79A 3H9OA 3MB7A 1Y8YA 2G9XA 3PIYA 4FC0A 2CGWA 4BZDA 3PLSA 3G2FA 3ANQA 3V8TA 3BI6A 3EYHA 3OT3A 4D4RA 4TWNA 2R2PA 5IQHA 4ITHA 1M17A 4UWBA 4GYIA 3QCYA 3O8UA 3QYWA 2WQMA 4OTPA 5IDPA 1YXVA 1YKRA 3WZEA 3LM5A 3TNHA 5TO8A 2BALA 4DEDA 3EKKA 3BLQA 4ZEGA 4FTOA 4C2VA 4BKYA 4HYIA 3UQGA 1QL6A 5HOAA 4IBMA 4UALA 2W1GA 3U4WA 3UP2A 4RC4A 2I7QA 4IDVA 4HZSA 4DFZE 2BIKB 3OFMA 5IA3A 5HE0A 3Q96A 4JL9A 4ANNA 4APPA 3U9CA 3CQEA 5BVDA 1XJDA 4MXCA 5EM7A 4H05A 4USDA 4DGLC 5CEIA 4GFGA 1UA2A 2LAVA 1K9AA 4TL0A 5DRDA 3JUHA 4WRGA 5A4TA 4MBJA 4R6VA 4ITJA 4HYUA 3CC6A 5BUIA 2WTKC 1A06A 4O6EA 3MTLA 4YJOA 4MHAA 2W0JA 3NS9A 2YIRA 3IO7A 1U5RA 2XVDA 3KRXA 5JZJA 4ENYA 1ZRZA 3AC2A 3OVVA 3R73A 5LWNA 5C8KA 1U59A 5G1XA 4PMPA 5BUJA 5IH4A 3WE4A 3TN8A 5A9UA 2ITNA 3NAXA 4R7BA 3NVMB 4KAOA 3EFJA 3VBVA 4YZMA 3HMOA 2WQOA 4DT8A 4RX9A 3ZSGA 3NW5A 1YI4A 2BRGA 1OMWA 1KE5A 3AMYA 4N4SA 3RGFA 1PMUA 4LQMA 3RPVA 3TACA 1PW2A 3MA6A 2ZV2A 3QUEA 3MFTA 4DFUA 2O5KA 2RSVA 3QAME 2R0UA 5DRBA 3W2SA 5CI6A 3UO6A 3H0YA 1M2QA 4Q9ZA 4QMMA 4AZWA 3IW7A 5J9LA 3NMUF 4D9TA 4BBEA 3KN6A 3E8NA 1M7QA 2VN9A 2V7AA 3HZTA 4G17A 4ALVA 3FJQE 3Q9WA 3CGOA 3FWQA 4CFFA 2W1HA 3IECA 2GS7A 2FUMA 4O7RA 3R7OA 3E92A 4FKSA 1OL2A 2B54A 4GFOA 4BKJA 1OKVA 3HV7A 1GZKA 2Z7LA 4HVGA 2OGVA 2B7AA 4ASZA 3FL5A 4EL9A 4G6LA 3ZUUA 3QUDA 2XIZA 5A4CA 4YTHA 3OCGA 4HNIA 4ZMFA 2Z2WA 3T3UA 1OECA 4O7NA 4DGMA 3E8EA 4ZJVA 4DEIA 3R8LA 2PVNA 2WFYA 3QD0A 3ENMA 1PMVA 4PF4A 3RWPA 3RZFA 1H25A 4LV8A 5AUYA 2W4OA 4OBPA 3FQHA 2WXVA 3KXHA 4CRSA 5H2UA 4J98A 4PPCA 4FL1A 3EFWA 3ZXZA 5J1VA 3FY2A 1ZMVA 3MPMA 2OXXA 1SVEA 1ZZ2A 4ZY5A 1JAMA 1OL5A 4OBQA 3D5UA 4OLIA 4U5JA 2YDIA 4YP8A 3HUCA 1PJKA 2JDSA 4AZVA 1BI8A 3UVPA 2A2AA 5E4HA 4QTDA 4YZDA 4RJ5A 4EOIA 3DLSA 2HW7A 3HAMA 4MEDA 4E6CA 3HUBA 4CMUA 3DJ6A 1H07A 3LCTA 3PVUA 3QZFA 3SKCA 3QGYA 4GUBA 3KU2A 1PYEA 2VTNA 4H58A 2OZAB 3EIDA 3QA0A 4FEWA 2RF9A 4CQGA 4QMWA 2OIBA 2XKDA 3OWPA 3BEAA 4DH7A 2XCHA 4R5YA 4O27B 3DBFA 2FYSA 2XK3A 4IX3A 2V62A 4QMXA 4E1ZA 4GFMA 5D1JA 3ZMMA 4MXZA 4YNEA 3D94A 3K5UA 5HBJA 4DHFA 3B8QA 5E8WA 3MBLA 2CN5A 2Y8OA 4ALUA 4EOOA 1LUFA 3CGFA 3NNUA 4J8MA 3PVWA 2ZMDA 4GK2A 4FIEA 4C4FA 5M09A 2BILB 2NO3A 4X2GA 2E2BA 3AC3A 3F69A 4AW2A 4EH2A 3PZEA 2W5HA 4GT5A 5KMKA 4FTTA 2Q83A 1SMHA 4XLVA 4I0TA 4RWJA 2UW8A 3QQJA 5AR5A 4E93A 5D12A 3UPZA 4EJ7A 5I5ZA 4BI2A 4DFBA 5M06A 3TEIA 3GC8A 3R22A 1BYGA 2O65A 2UW4A 2VWWA 4D0XA 5GZAA 4ASEA 3EN9A 4RBLA 2UVZA 1OGUA 1MQBA 2YCQA 4FSNA 4NKAA 4FODA 2OIQA 4U45A 3T3VA 4AZSA 4LGGA 5EOLA 4QP1A 2AC5A 2JDVA 1H24A 3WZJA 5C03A 1UKIA 4BBFA 3M1SA 3IW6A 5EW8A 4EHVA 5CEMA 4O7WA 1UNLA 5CYIA 4O1PA 1S9JA 5DGZA 4BDIA 2JFLA 3OUNB 3I6WA 5JFXA 5H8EA 1YW2A 5K3YA 4BRXA 4HPUE 2VTLA 3ZU7A 2HELA 3W55A 4AW1A 4UX9A 5AAFA 3ZHPC 5B2KA 4GMYA 5CALA 1ZYDA 4FKIA 5H8BA 3Q2JA 5JGBA 4FR4A 4Q9SA 5IMEA 4G1WA 3LLAA 2P3GX 5EHLA 1R78A 2GFCA 4XEYA 3O23A 2P4IA 5C9CA 2X81A 2WMAA 3F2AA 3BRBA 4PMMA 2PZRA 2ZJWA 3TV7A 4F9AA 3PSDA 3ZFXA 4BN1A 5A6OA 3R7IA 4USFA 4WBBB 4QP9A 5CT0A 5AWMA 4FG9A 4WA9A 5AAGA 3EQBA 2R64A 1H26A 4AN3A 4XH6A 1NA7A 4QMTA 5DPVA 3W32A 2H6DA 3LFEA 4AACA 2FA2A 5HBEA 3FPMA 3QX2A 1KE7A 2B4SB 1UV5A 3GT8A 4W4VA 4FKPA 5L6OA 2OBJA 3FMMA 5B2LA 2YWPA 3TG1A 3PZHA 3FI2A 3FXZA 4R3PA 2QOBA 1WAKA 4AG8A 3UODA 4C7TA 2WMTA 5JQ8A 4M69A 3E8DA 3EN6A 4DGOA 3V3VA 1Q24A 4S30A 4EH5A 2GPHA 3D7ZA 4CG8A 4RIOA 2PZIA 4Y95A 3PA5A 3P78A 2C69A 3MTFA 3ATSA 4FTAA 3JR1A 4CT1A 4H1MA 2YZAA 4LMUA 3OBJA 4JDHA 4MF1A 4QYEA 5TR6A 4MQ1A 4NTSA 4IACA 2G2HA 3QRKA 3LCOA 2QOIA 4V0GA 3OBGA 3GC0A 5AV2A 2J0LA 4DBNA 2IVTA 4XRLA 5EYCA 3NAYA 3MYGA 2PVHA 1J3HA 3R8VA 2OU7A
chains in the Genus database with same CATH superfamily
3L8SA 4O0TA 3VS7A 3GU5A 4NIFA 2AEGA 5A6NA 1FVVA 3DAJA 5DYJA 3CJGA 1W84A 4P5ZA 3MN3A 1UU3A 2B55A 4O86A 1R39A 1DI9A 2RG6A 4GG5A 4BWKA 3QTRA 3OUKA 2YA9A 3PE2A 3KRJA 4XRJA 3RNIA 5JH6A 5BVFA 3DKGA 3AMAA 5CU2A 5BQ0A 3COKA 2BMCA 4UYAA 2PU8A 2R3IA 3R28A 4WO5A 4NTTA 2YIWA 4TPTA 4C8BA 2GNLA 3IW5A 5IDNA 1V1KA 5IPJA 1P4FA 3COIA 3DBEA 4FKRA 3VS1A 4ZMEA 3ODZX 3Q4ZA 2GHLA 5HX6A 2VTAA 1URWA 2B9FA 4RZWA 5CU0A 1NXKA 1CSNA 1M2PA 4IAZA 2KTYA 3LVPA 3ZEPA 4EH4A 5AAEA 2WMUA 1KUTA 4GU9A 4RC2A 4YMJA 1U46A 2Y0AA 3C4FA 4EK4A 4E73A 5KO1A 2PMIA 5D11A 3DB8A 4GJ3A 4L52A 4E5BA 4D1XA 5BNJA 4EQUA 3VONA 4BIBA 3UIMA 4C33A 4GSBA 1Y57A 3EQHA 4GYGA 4W4XA 4RVMA 3FAAA 4OTGA 5T3QA 3Q2MA 4M67A 4QMZA 4N57A 2W17A 2ZB1A 1CKJA 1B6CB 2CMWA 3HECA 4FL3A 2WHBA 4H3QA 4MWIA 4XG8A 4FIIA 4FT0A 5ACKA 5JRQA 2F7XE 3MV5A 3OP5A 4I4EA 3TV6A 3TDWA 5CNOA 5BVWA 2HCKA 5IZFA 3MVLA 1S9IA 1YWNA 5CZIA 5IEVA 3WF7A 1I09A 4C0TA 2WGJA 3JYAA 4U80A 3HV6A 4F0IA 4UBAA 3PPJA 4AE6A 4JG7A 3SOCA 2GQGA 4YBKA 2BDWA 2VNYA 3FZOA 1JSTA 2VTQA 4QDEA 4MF0A 5F20A 2UZOA 4D5HA 5L8KA 4ZTNA 4EC9A 2PWLA 2F2CB 3I5NA 4O4BB 5KMMA 4ID7A 4F6WA 1PXPA 2UW9A 2PE1A 3C5UA 3NCGA 3BX5A 5C26A 3QLFA 3NUSA 1OB3A 4ENXA 4QP8A 2IW6A 2J7TA 4X3JA 3MGYA 5IISA 5BV3A 2BROA 3AMBA 4WD5A 3CTQA 4R5SA 3R9NA 1MQ4A 3R04A 1YOLA 4DEAA 2WMSA 3QRUA 4UV0A 5JSMA 2C5XA 4RJ7A 5KE0A 5IA0A 4R3CA 5HNIX 4FSQA 5ANDA 3S0OA 1JNKA 4N0SA 1DI8A 3CPBA 3SW4A 3W8LA 4S2ZA 4YO6A 3PJ2A 2VTJA 5AR3A 4MNEA 3SLSA 2YJRA 2WNTA 4OTQA 3FI4A 2W1ZA 3M42A 4AAAA 3BU5A 3ZXTA 5FLFA 2QOQA 4HJOA 3DK6A 4C4GA 4J71A 4A4LA 4ACCA 2IG7A 2VV9A 2CGVA 3ORTA 4P2KA 4F0GA 4RA5A 5BYLA 3CD8A 4GRBA 2GTMA 3DXNA 4ZTSA 4BCHA 5D7AA 4CFWA 5M57A 2VWBA 1WBNA 4QMYA 4XCUA 5AP0A 4GVJA 1RE8A 4G6OA 3DXPA 5IH6A 4AQCA 5LXMA 3A7HA 3WF8A 3RAWA 3UPXA 1H8FA 3R8MA 2BKKA 4GKIA 5KMNA 2E9OA 5FEEA 3LFCA 5FTGA 5EDRA 3W8QA 4R77A 5FP5A 4BCPA 5C4LA 4RZVA 1QPDA 4RIWB 3RK5A 4EI4A 4BI0A 3DDQA 3U6HA 3ZSIA 3E62A 4BYJA 2JKOA 3BWJA 3EZVA 4IAAA 5EI2A 4F7JA 4FE2A 4XV9A 5BVOA 4O2ZA 1BKXA 4MNFA 4JAJA 4FK6A 4EOMA 4MTAA 4F9CA 4H3BA 3I7BA 5HX8A 4G3EA 4AXCA 1IA8A 5F9EA 4RIXB 5FBOA 3WZKA 5FM2A 4J53A 4IEBA 5HIBA 3IONA 3ZUVA 5A4EA 3GCQA 4YBJA 5AP2A 3UG2A 3DT1A 3K54A 3C0GA 4FVPA 1G3NA 5JEBA 3LXNA 4ZTMA 3BU6A 1DAYA 2WELA 4PDSA 3PRIA 5IA2A 5HCZA 4F1MA 3ZO1A 1U54B 3GVUA 4RJ3A 4PPBA 2GTNA 3R1QA 3R02A 4O7ZA 2YM5A 3B2WA 4YJQA 2F7EE 3AD5A 4ALWA 4BDEA 5I9XA 3D4QA 3BLAA 5DE2A 3PIZA 4LRJA 2GQSA 1Q41A 2R3NA 4DG3E 5E8TA 3SXFA 1NVQA 5A46A 1F0QA 3UZRA 4OAVB 1OITA 4FSMA 3LJ1A 1OIQA 2CCIA 2O8YA 4G6NA 4BIDA 5JKGA 2YZLA 4DITA 3IGGA 4WUAA 4KBCA 3GB2A 3FEGA 5HLPA 5CAQA 4BTMA 3TIYA 4IB0A 1KE9A 2EWAA 2XK6A 2ZV8A 2WQBA 4O96A 3TJDA 3OXZA 4GUEA 4AS0A 3ROCA 3NVKI 1O6LA 5CXHA 3D9VA 3OTUA 1W0XC 2X0GA 2XK8A 4P5QA 5LCKA 3REPA 4ANQA 2IVUA 4O4EA 3NSZA 4EKKA 3QZGA 5IQDA 1JPAA 3F2NA 2XYUA 3RJCA 3ODYX 2V22A 4ACGA 2BZHB 5CF8A 3U87A 4D1ZA 3O8PA 5J9ZA 5LJJA 1EH4A 3CTJA 5IU2A 1I44A 2I0EA 4FKGA 2WQEA 4K77A 5AUWA 2ZB0A 4KS8A 4NCTA 4ZLOA 1VYWA 3DFCB 4WNOA 2OO8X 5CEPA 2JBPA 3G0EA 4S31A 5HNGA 4UMRA 2XB7A 3VW8A 3HV3A 1JKLA 5HU9A 1A9UA 3P23A 5GZ8A 3M2WA 4NFMA 3ETAA 1L3RE 1XH9A 3BEGA 3L9LA 2CNQA 3ENHA 4GH2A 2PZPA 1WBVA 2XEZA 4DH3A 2I0HA 2AQXA 4C38A 1Q3WA 3JY9A 3RINA 2G2FA 2IZTA 5CVFA 1O9UA 5HCXA 4N70A 4IC7A 5CU6A 3UMXA 2OI4X 2WAJA 4G3FA 3CQWA 5J79A 4XOZA 4BCKA 2VO0A 3NZ0A 3NCZA 3F66A 2RFEA 2XIKA 4IAKA 3TWJA 2XNMA 1E9HA 4GU6A 2A98A 4TRLA 4BC6A 5EM5A 5IA5A 3F82A 3ZM9A 2JBOA 4FTQA 2RL5A 3GXLA 4D58A 2WMWA 1M2RA 3FC2A 3SRVB 4RVLA 4LOQA 1YXTA 2JIUA 3KULB 3QKKA 2XAMA 4FTIA 1Q99A 1VEBA 3CXWA 4RWLA 3A8XA 2ETKA 3C4CA 4IX4A 3UIXA 3VJOA 3ZS5A 3ZLYA 5AV4A 4CLJA 5HD4A 4FTKA 4H3PA 3AKKA 2R3FA 4LGHA 3NNWA 3BPRA 4IB1A 5DN3A 2XNGA 3HRFA 4D5KA 3DKOA 2BRNA 3ACKA 4ZSJA 2J50A 3P7CA 4EK3A 5HIDA 3HX4A 3G51A 5FP6A 4I24A 3TKUA 4F9WA 3D5XA 5J7HA 3QQGA 5LCJA 3VUHA 3LCKA 2OLCA 3CQUA 3PRFA 4F6UA 2ZV7A 1PMEA 2BDFA 3S1HA 3W0QA 3ZRLA 3IGOA 4DCAA 2Y4PA 3ELJA 3OTVA 5KMIA 4QD6A 2C0IA 4KD1A 5LARA 4Q5HA 1O6YA 4S32A 5F4NA 4D28A 4RVTA 2VTPA 3DK7A 2W1EA 3LFDA 4DDIA 3FMKA 5IEYA 5KUPA 3F9NA 5DVRA 3TXOA 2OXDA 2WEVA 1R1WA 4IAYA 1OZ1A 3PFQA 3F3WA 4UXQA 5HORA 2XKEA 3QCSA 4NW5A 3SGCA 4PTGA 2VX3A 4WKQA 1H1WA 3RKBA 1YOJA 3S3IA 5C4KA 3VBXA 1WMKA 1IEPA 1XHAA 2YCFA 4FTMA 4NM7A 3PVBA 4F9BA 4FGRA 4BGHA 4YU2A 3HL7A 3H9FA 4KWPA 4RX7A 3IDCA 3GC7A 4RIYA 4G16A 4FNWA 2LGCA 3DNEA 5CU3A 2EXEA 5BVKA 1J91A 3MIAA 4D1SA 2W1FA 2X6EA 5GIPE 3QUPA 1XKKA 4BBMA 3W2RA 4I5HA 1QPCA 3ZEWA 3TZ9A 4Z55A 1Y6AA 4FNYA 4O7YA 3AGLA 1IG1A 2GU8A 2OJJA 3UYSA 4LMNA 3HLLA 3R01A 3FLYA 4LOPA 5ETAA 5HCYA 4HCTA 4DAWA 1YRPA 4U8ZA 4O0SA 3C9WA 4K1BA 4B99A 2SRCA 4PDOA 3CBLA 3LFFA 4WHZA 3O7LD 3GFEA 4IVBA 4ACHA 4QQTA 1UWJA 3VRYA 1WBTA 4USEA 2OKRA 3PP1A 1TZDA 2J5FA 2W05A 3QRTA 4KS7A 4WT6A 4CKRA 1KE6A 1M14A 4QP3A 2ITYA 4U42A 5EW9A 3CKWA 4RJ8A 3VC4A 4DHIB 5IH5A 3O96A 4ITIA 4PTEA 2XALA 4G5JA 3R9HA 5CF4A 3N9XA 4G3DA 4YC3A 1QMZA 2ZYBA 3KRRA 3DXQA 4C3FA 1ZYJA 3FMDA 1FMOE 3OW4A 5A54A 3GCVA 3BHHA 1H27A 2F4JA 1ST0A 4CQEA 2VO6A 4XYFA 4DEHA 3EMGA 1URCA 2XNBA 2YDKA 5HIEA 4W9XA 3SC1A 3R7EA 3PY3A 4BCGA 4DN5A 3AGMA 3JVRA 4DH1A 1G5SA 1V0PA 2NPQA 2WD1A 3LXKA 3ZO4A 2C47A 2C5NA 3FL4A 3LQ5A 4QTCA 4J95A 4BVUA 4BYIA 3R21A 4NEUA 4X3FB 4EEVA 2GNHA 2OF4A 1SNUA 2ZAZA 3QKMA 3R83A 4AGUA 3OXIA 4EBVA 5AA8A 1G8JA 3GOKA 4FTCA 5CANA 2AC3A 4A9RA 4B4LA 5TF9A 5DEWA 4JG6A 3E8CA 2F9GA 3FE3A 4FYNA 3DOGA 4FV2A 4YR8A 2ITTA 3MW1A 2YERA 3N4UA 3EL7A 3F3UA 1J7LA 4EHEA 4EH8A 5FXRA 3KXNA 4CZUA 3W0NA 3ML1A 5EHOA 2WOTA 2G01A 3NW6A 4LV5A 4PV0A 4QMPA 2PL0A 4OTDA 4EYMA 3ID6C 5LVOA 3DJ5A 4ZTHA 4FOBA 2WU7A 3FYKX 3VS2A 3RPRA 5I9WA 4G31A 5IQAA 5CVHA 3MB6A 3RPOA 1XBCA 1OM1A 3SX9A 2YIXA 2BVAA 2YDJA 5E90A 3QBNA 4BWPA 4F64A 5HTBA 5EQYA 1XH6A 4DF3A 2V5QA 3LMGA 2XJ1A 3LHJA 4IHPA 2VZ6A 4GS6A 4I6QA 4MH7A 5BVEA 1NVRA 4YSJA 3TTJA 3QC4A 4NZWB 4ANSA 4FZFB 3BGQA 4E4NA 4RLKA 3EQGA 4JR3A 3PWDA 4FSRA 4KRCA 5CSXA 4HVIA 5LMKC 3R2YA 4QOXA 4U3ZA 2QU5A 4F1TA 3ZUTA 4Q2AA 2EB2A 4I20A 2PUNA 3R2BA 3C50A 1STCE 1KOBA 4DH5A 4CGAA 2BAQA 2W1DA 3CY2A 2JIIA 4PMTA 3PPKA 4W8DA 4IVDA 4W4WA 4OTFA 4MXYA 4BIEA 4O7LA 3P7AA 3PG3A 3VS3A 4R7HA 1OUYA 1ZMWA 1OVEA 4RWKA 2J0IA 4CFVA 1FGKA 2OF2A 4L7FA 4QEBA 2HOGA 4D4SA 4C57A 3Q9ZA 3PY0A 4C4HA 4XJ0A 2IWIA 3NPCA 3PE1A 1YWRA 1W2CA 4BTKA 4E6AA 1CTPE 4JAIA 3P5JC 2PMLX 4RRVA 1ZLTA 5EI6A 3DQXA 4A07A 1PXNA 4BDDA 5LVMA 3LAUA 4EQCA 3O17A 4JNWA 4XLIA 3BHYA 5ANEA 5AV3A 3A4PA 2UZBA 4ZSGA 4U40A 4QP4A 3DDPA 4D2TA 2VX1A 2YISA 2WEIA 1WFCA 3ZO3A 2XUUA 4KABA 2QLQA 3NGAA 3SAYA 3EQRA 3LQ3A 2UZVA 4TN6A 3TNIA 4AZTA 3VS4A 3E5AA 5M08A 3TNPC 1H00A 4U7ZA 2BCJA 2XNNA 3R7YA 4F65A 3LLTA 1FVRA 3NFGB 1H0VA 4F63A 4KB8A 4PL5A 4QP7A 3NYVA 4L00A 4TYHB 3RCJA 3LFSA 4KIPA 4EHZA 3CE3A 3DNDA 3TIZA 4FSZA 4JBVA 3UNKA 2VTTA 2QKRA 2DUVA 2C30A 2I1MA 4QYFA 2R3HA 4R3RA 1YDSE 4TYGA 4HVSA 3NFFB 2XJ0A 2OH0E 4TWCA 5ETIA 3I1AA 1YOMA 4LV7A 2X8EA 3PY1A 4BB4A 4HCVA 3DBQA 3WYYA 4YSMA 2V7OA 3T9TA 3C51A 3OD6X 5AUZA 5HO6A 3B2TA 2VO7A 2UW6A 1MRUA 3UE4A 2CLXA 4JBQA 4U79A 4M68A 4WSYA 3EQPA 2UW0A 4YHJA 5DR2A 1Q62A 3HYHA 5EFQA 3TTIA 5DLSA 4KNBA 5E92A 4KIQA 4TTHB 1FINA 3GCUA 3MH2A 1WCCA 5DEYA 5HNBA 4GJ2A 5CVGA 3GU7A 2QU6A 3K3IA 3WILA 4D9UA 3AKLA 3JS2A 2W1CA 4L01A 3UYTA 1UU8A 4IH8A 3KXMA 3QQFA 3I7CA 4CMTA 5I4NA 4PQNA 2BZIB 3S2PA 4EKLA 2WPAA 3QCQA 5K9IA 3FSFA 4IZ7A 1K2PA 5KNJA 3BE2A 4FKWA 4FSTA 4Z16A 5ANGA 2OZAA 2F49A 4FA2A 2VRXA 3PSBA 3WZDA 3PUFC 4LG4A 1XBBA 2YACA 2GMXA 2YFXA 2Z7SA 3EFKA 4NCTC 3VS6A 2R7IA 3BWFA 3Q32A 4B6LA 4JG8A 3VF8A 4FSUA 4I3ZA 2XMYA 1V0BA 3QWJA 4PDPA 5L2WA 4QYHA 3FZPA 4MQ2A 3PYYA 3D14A 5J95A 4FVQA 2VD5A 3BYOA 3GCPA 3TKIA 4I6FA 5FGKA 4CFUA 4AXEA 4FT5A 2PUUA 2GQRA 4O0YA 1WBOA 3W2OA 5FEQA 2QNJA 2WMVA 4L45A 4MXAA 3LFQA 4AW5A 1FOTA 4FV4A 4HGTA 5IG1A 2JAMA 3JXWA 2C6DA 4O0VA 5CEQA 4CEGA 3VBYA 1W83A 4JOAA 4FTLA 4FVRA 5EYDA 3QTWA 3V6RA 3WI6A 3V5WA 3P5KA 3RI1A 2OK1A 3N4VA 4DFLA 3FLQA 3VUIA 3AD4A 4E8AA 4K0YA 4XBRA 4MBLA 3N4TA 3BLHA 2GNJA 4O7VA 3QALE 4WG4A 4Y73A 4TXCA 2AUHA 1ZZLA 2REIA 4WNMA 5AIRA 3UC4A 3VS0A 4GCJA 4C58A 5FWKK 4H39A 2WMRA 1J1CA 3ZO2A 1OIUA 4CD0A 2PE0A 3QZHA 4AGDA 4FUXA 4JX7A 4FKJA 4XUFA 3NR9A 5KZIA 4ZIMA 4EHGA 4MYGA 5EKNA 3COHA 3IW4A 3AT4A 3NYOA 3L9NA 3QKLA 4FT9A 5I9YA 4LL0A 3OCBA 4IWOA 3R71A 4IX5A 4K2RA 4X7QA 5T68A 5LVLA 3V5LA 3UC3A 2PVKA 2X39A 4IB3A 4QTBA 5DWRA 1ND4A 3GGFA 3P08A 5KMJA 4PY1A 3VQHA 4ZSLA 4EOSA 4R1VA 2F2UA 3TJCA 4FEVA 4RWIA 3CPCA 4E6DA 4K18A 2ZV9A 4G9RA 2ITUA 4WNPA 4CCBA 4RVKA 3U4UA 2WKMA 4HYHA 5AUTA 4AFJA 2XA4A 3WARA 4BDAA 5AUVA 3VIDA 5IA1A 3FLWA 1LEZA 3NNXA 4LDTA 2CSNA 4FKLA 5B2MA 3MFRA 5AIKA 3MDYA 4LRKA 4NYEA 4DBXA 3NIEA 3OROA 2QURA 3FZRA 1TQPA 4MK0A 4FF8A 4HZRA 3QRJA 4F7NA 3F3TA 4O6LA 5K5NA 5M4CA 1Q8TA 3TUDA 2JKKA 3FMLA 3HMNA 3HRBA 4AOIA 5KBQA 1G8AA 4L8MA 2QOOA 1GIJA 3H30A 3OCSA 4IVAA 4EONA 3RPYA 1A48A 4JDKA 3UP7A 2W96B 2ZM1A 4FZAB 4DLIA 3LOKA 1BI7A 1XH7A 5L3AA 3BBTB 1GJOA 2QO7A 4I93A 3LCDA 2J6MA 4CV9A 4KKHA 3P0MA 4R78A 1JKSA 3ZSHA 1XH4A 2XEYA 2R3RA 1XH8A 3O7LB 3QZIA 1NY3A 2PVRA 4FT7A 5E1EA 3V6SA 4ACDA 1Z9XA 2RFDA 4ARKA 4FI1A 4CT2A 2C3IB 3BYMA 4WOVA 3V5JA 1OIYA 5TT7A 5IF1A 2OW3A 2QHMA 4UYNA 2CKPA 2C6KA 4FSWA 2RKUA 2HY81 3RK7A 4C4IA 5LOHA 4YJUA 4XP3A 4IAIA 4RJ4A 3HP2A 4FICA 4RQVA 3ZC6A 4DC2A 2AYPA 5AM7A 4RGJA 5L6WL 2XNOA 5J9YA 2BAKA 2XIRA 3HMIA 3VVHA 4EORA 1GZ8A 1FGIA 3W2PA 3LXLA 1SNXA 2QOFA 1Y8GA 2PSQA 3S95A 2VTRA 4Y46A 2A4LA 4ZLZA 4ZZOA 1RJBA 1WVXA 2G2IA 3SHEA 3U6JA 4UWCA 3EQFA 4JQ7A 4BR3A 3KL8A 3Q60A 2PVMA 3OT8A 3I0OA 3LIJA 4L3PA 2UV2A 3RTPA 3GENA 3DK3A 3KF7A 4QNYA 5IMXA 2PVLA 3GU6A 1MP8A 3F88A 4BCNA 1P4OA 2RFSA 2ZVAA 3BE9A 5F94A 3W2QA 4EK6A 3O5AA 2H34A 5AX9A 4DTKA 3VBWA 1H0WA 2ZMCA 4I6BA 2ZM4A 1DAWA 2QO2A 4PP9A 2B9HA 4GIIA 4PP7A 1OL6A 4MWHA 3QQKA 4O82A 1R3CA 3Q9YA 5I0BA 3A2CA 2W7XA 3RP9A 4QMQA 1ZYCA 2C1BA 3D7TB 3OS3A 5GINE 2GNGA 3HMMA 4FEXA 4KBAA 5CF5A 3KMWA 4GVAA 1DM2A 4AOJA 1QCFA 2JKQA 3FHIA 3MVMA 3OOGA 3UDSA 3KRWA 1CDKA 3GFWA 4G9CA 4DG0E 3U9NA 2RG5A 5HICA 4TY1A 4IIRA 4JQ8A 4X3FC 4ONAA 2OG8A 4E3CA 3WF6A 3QWKA 3UBDA 3UZPA 1YDRE 2J4ZA 2W4KA 2B52A 2FB8A 2XM9A 4QQJA 4LI5A 2QKWB 3DTCA 3S00A 3WYXA 4PDYA 3ATTA 4I0SA 3VBQA 4BHNA 5IUIA 4IZ5A 3PJ8A 4D0WA 5L2IA 5LVPA 4MCVA 4QYGA 1PXOA 2C6EA 2OJFE 5K4JA 2Y7JA 3EQIA 2XIYA 3AXWA 2UUEA 3KCFA 3QF9A 3KXGA 2QG7A 3GU8A 5LMKA 2J0MB 3NYXA 3ORPA 4IWDA 2DYLA 3QFVA 4I0RA 3VHKA 2BFYA 2W06A 2HY0A 4UWYA 2OJ9A 3QD2B 4OR5A 4AZFA 1XBAA 4PNIA 5EKOA 2YCRA 3PDTA 3OZ6A 1GZNA 3R1NA 2HWOA 5FTQA 5KKRB 4RFMA 4L68A 4EWQA 4YJNA 2ERZE 4S34A 3F61A 3FZ1A 5E9EA 2ITWA 1Q4LA 3QTXA 4O1OA 4BKZA 4M15A 2BZKB 5KHXA 3MWUA 5DHJA 4YZNA 5L8JA 4AOTA 4EWHA 3ORZA 3FLSA 4D55A 2WMXA 4EH9A 1WBPA 2XRUA 3A7IA 4N6YA 3TZ8A 4U81A 1PXLA 3POOA 2IW8A 1JBPE 3W33A 5HE2A 1OPLA 1Q8WA 2A1AB 4JX3A 5HVYA 3SV0A 2YWVA 5AFVA 1XR1A 1K3AA 1P14A 4XS2A 3QX4A 2GNIA 4BWXA 4PNKA 2GSFA 3IQ7A 2EU9A 5AEPA 3LW0A 3EH9A 3PXKA 4BCMA 3H9RA 3ORNA 1PF8A 5DT0A 4XHKB 2HZ0A 4RIWA 2GDOA 3QYZA 4O0XA 3C7QA 3NEWA 1KSWA 3PVGA 4NW6A 4XG9A 4QQ5A 3ALNA 4F4PA 3SA0A 4F99A 4U6RA 4DH8A 2C3KA 5EHYA 3VULA 1CM8A 1T46A 2QONA 2W4JA 2VU3A 5T6KA 2JDRA 3MY1A 3C1XA 4O4CA 1AGWA 3R9DA 4FX3A 2IZSA 3BYSA 4RIXA 5K0KA 3PA4A 5K4IA 1YHVA 1BMKA 1OIRA 2JITA 3TNQB 4DINA 5ANIA 4LOOA 2JGZA 5BUEA 3ROYA 4AW0A 3CR0A 5E8XA 2WOUA 3ZLWA 5E8YA 5AV0A 5BPYA 5I3OA 2ETRA 3DBDA 4F6SA 4CNHA 1UKHA 2WMQA 3PWYA 4EK8A 2XAOA 3DBCA 1U54A 4LFIA 3I4BA 2QVSE 2DS1A 4F70A 3DFAA 2WTDA 3W0PA 3G0FA 3A7JA 3F3VA 3QQHA 4FKUA 4PX6A 2BFXA 4WUNA 3ERKA 3WZUA 5CSWA 5GIOE 4AU8A 3UQFA 2CNUA 1F5QA 4QMLA 4JRNA 2NRYA 2C6IA 2XYNA 3KGAA 5J5SA 2A27A 4IMYA 4L6QA 5AUXA 4AAYA 1ZYSA 1NVSA 2JAVA 3O51A 5AM6A 4M97A 5HG8A 4CLIA 4IANA 4TYEA 4OT5A 3SG8A 4GK4A 1OBGA 3F5UA 5IQIA 5DA3A 3NRMA 3Q9XA 3R6XA 4C62A 1AD5A 2BKZA 5HE1A 3KCKA 1OPKA 3RPSA 4BGGA 4C36A 5L8LA 4IZAA 1IAJA 3OC1A 3DB6A 3EB0A 5C01A 1W2DA 2IEWA 4HW7A 3VW6A 1BL6A 4AA0A 1W7HA 1OBDA 3UDZA 1Q97A 2X7FA 2IW9A 1BX6A 3UG1A 4RX5A 3II5A 3HV4A 3R9OA 3NUPA 1Z5MA 2IJMA 3A4OX 4H36A 2PPQA 3V8SA 5CS6A 2VWUA 3BL9A 2QOKA 3QTQA 4D2VA 3BQRA 4YZ9A 3KEXA 3MH3A 2C3LA 3DAKA 4Y8DA 4D2SA 1OGYA 1YXUA 1H08A 1CMKE 1PKGA 4C3PA 4IM2A 4H1JA 3PP0A 5I9VA 2XBAA 2PYWA 3KB7A 5CEKA 2X6DA 3NLBA 4YJVA 4EOLA 3EJ1A 5K0XA 2C6TA 2OIDA 2ZFYA 2EXCX 5EM6A 5CAPA 5TKDA 2BRBA 4BCQA 3OWKA 3HA8A 3SOAA 2QOCA 3BQCA 3EWHA 4V05A 2BDJA 3F7WA 3MVHA 4Z3VA 1E1XA 5FTOA 2UZNA 1LR4A 3UNJA 4MX9A 2O2UA 3BCEA 3UDTA 3R1YA 2XNEA 3ZM4A 1BL7A 2ITXA 1MRYA 5F1ZA 3UIBA 1JWHA 5E8ZA 4MUQA 2YABA 4K11A 5JMSA 3KFAA 2QD9A 4AXAA 3HA6A 3EOCA 4YHFA 3Q5IA 4PRJA 3R1SA 2CLQA 4A9YA 4RA4A 2C0TA 1BLXA 4BDBA 1Q8ZA 3IG7A 3HNGA 4PPAA 3E64A 5EH0A 5AUUA 4C02A 5JFSA 2ITPA 4FKVA 4J7BA 5FRIA 5J8IA 3LMHA 3DKCA 3PXRA 5I9ZA 3QC9A 4O22A 3ZLXA 3TDVA 3EFLA 3NX8A 1JVPP 4RMZA 3G5DA 3MPAA 2XM8A 5EW3A 1PYXA 3BGZA 4FV1A 4KIKB 2VUWA 3VRZA 2W99B 3KULA 3W0MA 2R3GA 3R7UA 3ZYAA 2X4ZA 4JDJA 3VBTA 2GFSA 4MXXA 3AC8A 2NP8A 2WIHA 3A99A 3V5QA 4CFNA 4MKCA 4LYNA 4E6QA 2X2KA 5D7VA 3HDNA 4RG0A 2HXQA 3TNWA 3FKNA 5CU4A 3UOHA 4QO9A 1PMNA 5JQ5A 2B0QA 4DHJA 4X0MA 3KXZA 4O0RA 2OJIA 3UVQA 3F3ZA 2VWIA 4PMSA 5ETCA 1ZARA 5DMZA 4TZRA 5DFPA 1PY5A 2FGIA 4YPSA 1Q61A 2OFUA 4AT5A 4FEUA 2WO6A 3QCXA 4GG7A 4BY9E 4FKQA 2C3JA 4QMNA 4YZCA 4J1RA 1UU9A 4UMUA 1SVGA 4NM0A 4IADA 3I60A 4O4DA 3OY1A 4OGRA 5EM8A 2OFVA 5IQBA 4CZTA 3F6XA 2CN8A 3TV4A 3TYKA 2RFNA 3FZTA 3OCTA 3ZDUA 2R5TA 4IE9A 1ST4A 4FL2A 2C6LA 2UZDA 4XV1A 4AT3A 3VS5A 1B38A 3EN4A 4FIJA 4XG4A 2XZSA 2BIYA 1WBSA 3RBWA 3R00A 2ONLC 2Y6OA 4HPTE 3FI3A 3DV3A 4F0FA 3JVSA 2PVFA 5CI7A 3H0ZA 4P4CA 4FV6A 5AR8A 2E9PA 3FYJX 4QYYA 4IJPA 4XNEA 3EN7A 5CSHA 3ULZA 5JGAA 2XRWA 2FSTX 2I0YA 4ZY6A 5IQGA 1FMKA 1ZAOA 3G33A 5A4QA 4CG9A 4XOYA 4TWPA 3IPHA 1XH5A 5H3QA 5AJQA 3UOKA 5K5XA 2X9FA 2BRHA 4B8LA 2IZUA 4I5CA 4XMOA 3CY3A 4EBWA 3ORLA 2PUIA 1Z57A 4RFYA 3V01A 4ZS4A 4AZEA 2IVVA 2RGPA 3BV2A 3NWWA 3EL8A 4QTAA