2PVKA

Structure-based design of pyrazolo[1,5-a][1,3,5]triazine derivatives as potent inhibitors of protein kinase ck2
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
328
structure length
327
Chain Sequence
MSKARVYADVNVLRPKEYWDYEALTVQWGEQDDYEVVRKVGRGKYSEVFEGINVNNNEKCIIKILKPVKKKKIKREIKILQNLGGPNIVKLLDIVRDQHSKTPSLIFEYVNNTDFKVLYPTLTDYDIRYYIYELLKALDYCHSQGIMHRDVKPHNVMIDHELRKLRLIDWGLAEFYHPGKEYNVRVASRYFKGPELLVDLQDYDYSLDMWSLGCMFAGMIFRKEPFFYGHDNHDQLVKIAKVLGTDGLNAYLNKYRIELDPQLEALVGRHSRKPWLKFMNADNQHLVSPEAIDFLDKLLRYDHQERLTALEAMTHPYFQQVRAAENS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure-based design, synthesis, and study of pyrazolo[1,5-a][1,3,5]triazine derivatives as potent inhibitors of protein kinase CK2.
pubmed doi rcsb
source organism Zea mays
molecule tags Transferase
molecule keywords Casein kinase II subunit alpha
total genus 114
structure length 327
sequence length 328
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2007-05-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2pvkA01
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2pvkA02
3UP7A 2BILB 5JRQA 2PMNX 5TO8A 3Q4ZA 1Y57A 3PXFA 1DM2A 5AR3A 2BMCA 5D9HA 5IA3A 4UZHA 1P14A 4XG8A 4NTSA 2R4BA 3MVHA 3MYGA 3ORXA 5DIAA 5A4QA 1PRYA 4RFMA 2WMXA 3L9LA 3GCQA 4BI1A 3W8LA 4F1TA 3VBTA 3EN4A 5HO6A 2X0GA 5FP6A 4E4MA 2Z7LA 2XKCA 3QYWA 4XV3A 3I0QA 3QRIA 3VUHA 3NNXA 4E6DA 2GU8A 4FKLA 1KE8A 2ESMA 3QCSA 5L2TA 3L8PA 5FEDA 4ZJIA 2R3JA 4DLIA 3BKBA 3HVCA 1JAMA 1YRPA 3TNWA 3RZFA 5KMIA 2CLQA 3P7BA 2C30A 1FGIA 4FSUA 3HNGA 2HELA 4IB0A 5H8EA 3SXSA 3WZKA 3W2PA 2W5BA 5GZ9A 5JRSA 3CKWA 2VO0A 4GU6A 4NSTA 3A2CA 4S34A 4F7LA 1PXOA 3DAKA 5BQ0A 2GNJA 4CKRA 3R00A 5C4KA 4G9RA 1Y8GA 4AN3A 3EQIA 4C59A 4FSNA 2WKMA 5I9XA 3E93A 3OCGA 3PA4A 4BDIA 2XCHA 4O2PA 4FIHA 5D11A 3VUGA 1OPJA 1WFCA 3MH0A 3QZGA 1GJOA 4BY9E 5C4LA 3U6HA 2UW5A 3BLHA 3G51A 1CM8A 2VWZA 3HMMA 4QTCA 4FZ7A 3ORNA 3O7LB 3DZQA 1VJYA 4WO5A 1IG1A 4O7LA 4TYHA 3FL5A 1JVPP 5KUPA 4GUEA 1OL1A 3K54A 3R7VA 3O96A 3TIZA 2W17A 5DGZA 4D4RA 3ZFMA 4FSYA 4Y85A 5CWZA 2HW6A 4J53A 5G6VA 5DWRA 2QOIA 3TEIA 5BVWA 3QTWA 4M66A 1ZYDA 5HTCA 3NUAA 1GIHA 2C3JA 4JVGA 4UMQA 4FK3A 3KB7A 2SRCA 4WKQA 1J3HA 1U54A 3NIEA 4CV8A 4E93A 4X3FA 2R3RA 4OTGA 3K3IA 3G9NA 3JY9A 3CP9A 3P5KA 1K2PA 1MRYA 3PG1A 3ZTXA 2W4JA 1XH8A 3AG9A 3UIBA 3KN5A 1Q62A 3PJ3A 4D58A 5BPYA 1R39A 2CCIA 2YM6A 4QNAA 5E4HA 2BFYA 3IPHA 5ANGA 5M57A 4BDKA 4RJ5A 1XQZA 3R83A 4NL0A 3WZDA 4QO9A 4BCJA 1UNGA 1L3RE 1YXXA 2HZNA 3TNPC 3B8QA 2EXMA 4F0IA 3QQKA 3BYSA 2O64A 4FSMA 5CVFA 4CMTA 2CN8A 4CV9A 4WUAA 4QP9A 4MX9A 4ZTHA 3ALNA 4AA4A 5KMOA 2OF2A 2WTDA 4S33A 3TZMA 3VS6A 4EI4A 2W1EA 5F9EA 2OF4A 2J0KA 2O8YA 3O2MA 1YWNA 2P2HA 2OWBA 4EH4A 4EH8A 5IQIA 3ZOSA 4O84A 4J52A 3IS5A 5BVNA 2PUNA 3F5PA 3KCFA 3U9NA 4K1BA 3MY0A 4AT4A 4EWQA 3GQLA 2ZM4A 3UC3A 4MXYA 4FE2A 2A4LA 4C3FA 1NT2A 3ZO2A 3IGOA 1YXVA 3CC6A 3LJ0A 5AUUA 4JRNA 3WBLA 2C6EA 2I1MA 5FXQA 2EXCX 2G01A 3H9FA 2BRBA 3A99A 3MDYA 4LYNA 1OZ1A 3R1NA 4MXZA 3H0ZA 2PSQA 2XB7A 2YHVA 2IVUA 4IX3A 3QQGA 4G9CA 3N4VA 3PXKA 1PMVA 2XK3A 3VUIA 3W1FA 4A7CA 1F0QA 3G15A 4Y46A 3SRVA 4CFNA 2G15A 1QPCA 1R0PA 3KXHA 5KZIA 4XP2A 1LEZA 3RBWA 3V01A 2ZAZA 3QQUA 2C5NA 3PXYA 3TZ9A 4IAFA 2GHLA 3MS9A 3DY7A 4YBKA 3UOKA 3P4KA 4DBNA 4XV9A 1XR1A 4FIFA 1GZOA 1TQMA 3RP9A 4NIFB 4RLLA 3OWJA 4O7YA 5M4CA 2Y4IB 4KKHA 4EUTA 3CGOA 3CEKA 2BHHA 4ANLA 4BCGA 4GFGA 3HZTA 2C4GA 2QOQA 5KZ0A 4G17A 3DQWA 4YZNA 3JS2A 1XH4A 3DBCA 2YFXA 4DEAA 3BU5A 4FF8A 3I1AA 5HU9A 3GNIB 3HAVA 4FZAB 2YWPA 5GINE 3FPQA 5DEYA 4KINA 2VTMA 2E9VA 4PY1A 4IVAA 1WAKA 1E1XA 4E20A 2GTNA 2XK7A 3HLLA 3IKAA 3DBQA 3VUKA 2YIYA 4EWHA 1ND4A 3PVUA 3RHXA 2DS1A 3VS1A 4C3RA 2BRGA 4U97A 4FG8A 4O0VA 5A4CA 4YLLA 2PVLA 5G1XA 4FTJA 4ZY4A 3C5UA 3AD6A 4EHZA 4RGJA 4EZ5A 3KF7A 4FTIA 3ORMA 4ONAA 4EH9A 3KRRA 5I4NA 3CPCA 1Q61A 3OW3A 4F0GA 3UZRA 4QMOA 1OKYA 5AIRA 4ZS4A 4JG6A 4FVQA 2YM8A 5CF8A 3BHHA 5IH4A 4C4HA 2OIDA 4R5SA 1V0BA 5EM7A 4IFGA 4DGOA 1U4DA 4E4NA 4FSQA 2IO6A 2XUUA 5HGIA 4DH3A 5LMKC 3A60A 2B9HA 5DH3A 2R3MA 4QT1A 4ZZNA 2PL0A 2X6DA 3EOCA 1OIYA 5CNNA 1IR3A 2YWVA 1PXMA 4QMQA 1WBWA 3FMKA 5CZHA 1XH6A 3TIYA 4DTKA 3ACKA 4RIYB 2G1TA 5AADA 2C3KA 1BLXA 1BKXA 2IVVA 3DK3A 1WBNA 4IM2A 5GJGA 1IASA 5EOLA 3VBQA 4C2WA 2BAJA 2JFLA 5IQCA 4NJ3A 2WTKB 3DDPA 4ZS0A 4BL1A 5CI7A 2ERZE 4EOPA 3MJ1A 1SYKA 4LUEA 1W7HA 4AA0A 4L7FA 2AC3A 4HGSA 3ZH8A 3O23A 2XBAA 3ROCA 1OL2A 3PXQA 4K8AA 2O0UA 3DPKA 1H1QA 5EYDA 3UQFA 4FNXA 4AXAA 3WZEA 4IZ7A 5EYMA 4MYGA 4F6SA 3RAHA 4RLKA 4KIPA 3UZPA 4USDA 2WFYA 3QD2B 3V5PA 3DK7A 4FC0A 2XVDA 3ODYX 4RZVA 4NZWB 4F4PA 2C6TA 2YJRA 4HCVA 3SA0A 5E90A 4GH2A 1YHSA 3VO3A 2C3LA 4GK3A 3OZ6A 3PPJA 4RJ8A 3HYHA 4RC3A 4BI0A 3EN6A 4LM5A 1PJKA 2C5YA 4YZCA 3U87A 4IVDA 1OKVA 4YPDA 3NRMA 3OHTA 2XJ0A 3R8MA 1YDTE 4I1ZA 4J99A 3ORTA 2UZEA 3FLNC 2NPQA 4EH7A 1PKDA 4EK5A 4BTMA 3DJ5A 4UEUA 4L6QA 3WZUA 4FSZA 4OAVB 4ALWA 2ZOQA 5CXHA 5A4TA 2H6DA 5AP0A 3HV6A 2B9IA 2C6LA 5HTBA 2VN9A 1Q8TA 2XRWA 4QPSA 5C1QB 4IAZA 5HU3A 3MGYA 3MV5A 2GNIA 1Z5MA 2OH4A 4ASXA 4YNOA 4PMTA 4X6RA 3QRKA 2IZUA 4MHAA 5HORA 4R78A 3GCVA 4UMTA 3OW4A 2V0DA 3NR9A 1JWHA 3PPZA 4FKOA 5LVLA 3VS4A 3PSDA 2PZPA 4ENYA 2A19B 2Z7QA 2VGPA 1J1BA 2YM3A 4B99A 3BV2A 4ACHA 3TDWA 4C2VA 2QG5A 3S3IA 4C36A 1YOJA 4BTKA 3LXPA 3QD0A 3R8ZA 1O6YA 3RZBA 4WNMA 3F3ZA 4FKTA 1L8TA 3QTQA 3QZFA 1S9IA 3D2KA 5AP5A 2BPMA 3FKNA 4NCTC 4GV1A 3VS7A 1PXJA 3W32A 3B2WA 3BLRA 3QX2A 1U46A 3LJ2A 1P5EA 4KABA 2X2LA 2P4IA 4RWLA 4O0XA 4WG4A 3SOAA 4YO4A 2IPXA 2PWLA 4ACCA 3PZEA 1XH9A 2REIA 3M2WA 2CHLA 4M0ZA 5C26A 4BYJA 3PJ1A 4CLIA 3R1QA 3EQRA 4W4YA 4A9TA 3GT8A 4IC7A 1OIUA 3FMLA 4FEWA 1PHKA 2BCJA 3KVXA 3KFAA 1YW2A 1CKJA 4IWOA 4O1OA 4KA3A 2J6MA 4YJVA 2PZYA 4NM7A 4D1SA 4YJQA 4F9BA 1IAJA 2HIWA 1ZY4A 4U40A 2G2IA 4LUDA 2VWBA 2HENA 1KV2A 4QTBA 5ETAA 3NNVA 4TYGA 4YZBA 4BCKA 5E8YA 3DFCB 3GQIA 4XOZA 1RJBA 2CNVA 3QFVA 1GAGA 3Q60A 4P5QA 4IIRA 4XX9A 4TYEA 3N51A 2X2MA 4W4XA 5FXSA 4C4EA 4C58A 3LPBA 1ZOGA 4GG5A 1WMKA 3LHJA 3GFWA 1FGKA 4LRMA 4GIHA 4YZMA 1OBGA 5E91A 4E5AX 3CPBA 4MEDA 2EB3A 4FEXA 3R1YA 1LPUA 2X2KA 4FKWA 1PW2A 1ZY5A 4GVJA 4QP2A 3ZUVA 3FJQE 5M56A 2OZAA 2ZM3A 3R6XA 4O0SA 3RWQA 4PDSA 3C5IA 4D9TA 4IEBA 4BCNA 2QOCA 3LQ8A 4YC3A 3TWJA 4BKZA 2HOGA 3FI4A 3R01A 3C0HA 3ENMA 4WUNA 2ITUA 3HMIA 1M7NA 3GP0A 5E8SA 4E8AA 4CFFA 4C61A 3E8NA 3LFQA 4CSVA 2OBJA 1YXSA 4FSTA 5H2UA 4JT3A 3FY2A 3Q6UA 4BIEA 1FOTA 1XJDA 3PSBA 4ITIA 5FDPA 2XF0A 3R02A 3VHKA 4BWPA 2Y7JA 1QL6A 4K33A 5KMKA 1K3AA 5FTOA 3BU6A 4JBOA 3D5WA 4M69B 4WNPA 3V8TA 3HA8A 4K18A 2ITVA 1SNXA 3NUSA 3SGCA 4USEA 3WI6A 2PMOX 4GU9A 4HVIA 2RKUA 4W4VA 3BHTA 2XEZA 4ZTQA 3PWYA 4L3PA 5J7HA 2WU7A 3QQFA 3MY1A 4FL2A 4O0WA 5ANJA 4L8MA 3EFKA 2PTKA 2WOUA 5HLPA 2CNUA 2Y9QA 2V62A 4B8MA 5IISA 4WRGA 4C4FA 1Q3WA 2F4JA 3T3VA 2XYUA 3WYXA 3OY1A 4WIHA 4TY1A 2GHMA 3DKGA 2UVXA 3VBYA 3FPMA 4I5PA 2E2BA 2HW7A 2ONLA 2F7XE 4ASZA 2O65A 2V7AA 3OG7A 5HIBA 1VYWA 3CTJA 3KXZA 3HV7A 1LUFA 3CS9A 4M14A 2BZHB 3CY2A 2WEVA 4RJ7A 5E8XA 5JGDA 4DCAA 2HXQA 3ZDIA 3TJDA 3LFEA 3EYHA 3MPMA 4I94A 3DK6A 2W06A 1Y91A 1OPKA 2B54A 3FMHA 4F7JA 4J71A 3TZ7A 4E6QA 3R30A 3IW7A 1ZYCA 4L3LA 5DHJA 3KK9A 4LOQA 5I9YA 1DI9A 3NYVA 4DF3A 2A27A 3KU2A 4NW6A 4QTAA 2W9FB 3I5NA 3NIZA 3VN9A 3L9MA 2C0OA 3IK3A 4EC9A 2WQNA 2UZTA 1GOLA 1M17A 1OPLA 3KXGA 4IM3A 5FEEA 3Q2JA 4M12A 3EFLA 4RIXB 3QUPA 4P7EA 3ETAA 2OKRA 3RTPA 4AA5A 3BQCA 2WHBA 2VTTA 2ZV8A 4C4GA 3JPVA 4FI1A 3O7LD 3Q4CA 2R7IA 2VU3A 1REJA 2QHNA 1GZKA 5BVKA 5LVPA 3E87A 4HJOA 2PVHA 3PYYA 3H9OA 4HYIA 4BHNA 5J7BA 3E92A 3LCDA 4JDKA 3RGFA 3LLAA 5CU6A 5T68A 5DPVA 3QCQA 4C02A 5A6OA 4FKIA 3FAAA 3NUPA 3PFQA 4F1OA 1ZOEA 5CANA 5CF5A 4JQ8A 4R5YA 3PA5A 4RFYA 4U80A 4F64A 4U81A 3TKUA 5A6NA 4QMTA 4BDGA 3D7ZA 3JXWA 3TUBA 3Q2MA 4TW9A 1H1SA 1G5SA 3F9NA 3KF4A 5CEIA 4XRJA 3DDQA 3E3PA 4P5ZA 2XNOA 4RG0A 4JAIA 4IZ5A 3W8QA 2BDJA 1OL6A 4G34A 3ORZA 1DAYA 3AMBA 3QKMA 2JAMA 5HBHA 5C01A 3VS0A 4DG0E 2RSVA 3OMVA 3ACJA 4UWCA 4M97A 2CSNA 4FKRA 5IZFA 1XH7A 4F63A 2HZ0A 4OTHA 3L8SA 2XKFA 4LMNA 2KTYA 4FG9A 2B1PA 2WMUA 5HICA 4AN2A 4BF2A 5M4IA 1WBVA 3NUXA 3NUUA 4D1ZA 4TKSA 4MCVA 5F1ZA 5F20A 1WVXA 4ANSA 4AZTA 2GPHA 1R1WA 3QGWA 3LFNA 5IH6A 4S2ZA 4HCUA 3CCNA 4EOJA 1BL7A 4IAIA 2W05A 4XOYA 3PXZA 3MB6A 3O8PA 4GVAA 4D2WA 3MESA 4JBQA 4RIWA 4WNKA 4NWMA 4D0WA 4EQUA 4PMPA 5J9LA 2JIVA 3VS5A 1JQHA 1OL7A 2P33A 3R63A 5AP7A 2OSCA 1LR4A 4FIIA 2F7ZE 2OXXA 4KKGA 1MRUA 4PDPA 3NW7A 4ANQA 4QTEA 1Q4LA 4NYEA 4EBVA 1YHVA 2Z7SA 5BVFA 2XK8A 3ORPA 1XHAA 5CU0A 1OUKA 3HDMA 3IOKA 4FV2A 4I5CA 3GC0A 5BUJA 1JKKA 4FL1A 2UZDA 2B53A 5CQUA 4FBXA 3TV6A 5IEVA 4XEYA 4GCJA 5HTIA 2OZOA 5IF1A 3QZIA 3WF9A 4I0TA 2I0VA 4A9SA 4ZSEA 3CQWA 4ZSJA 4F7SA 3FZOA 4BFMA 5GIPE 3DJ7A 4QP1A 3ZONA 3QA0A 4FYOA 4YO6A 4RX7A 2C47A 2I0HA 3KRLA 4YNEA 3FKLA 4TT7A 4DH7A 1FVVA 5LCJA 4WNOA 1EH4A 3OT8A 1KE6A 2VTRA 3DBDA 5CTPA 4CG9A 4JIAA 4Y83A 5ETIA 2R7BA 3C1XA 2GFCA 3CKXA 2CGVA 3MVMA 3GU4A 3KEXA 2F57A 1YI3A 3EQPA 4AE9A 5KX8A 4MNEB 4BZNA 2J4ZA 2W9ZB 2XK4A 2YJSA 3CBLA 3A7GA 4PWNA 4PP9A 2C5XA 2YABA 3PY1A 4RQKA 2YDIA 4R7IA 5BVEA 4V05A 4Y72A 5IEYA 2Z7RA 2OICA 4N6YA 4QP6A 2R9SA 4W4WA 5BUIA 4U5JA 5JFSA 2BROA 2J50A 3D94A 4XP3A 4MBJA 4YJUA 3FLWA 3GU7A 4BDJA 3ULZA 5FTGA 4AU8A 3QLGA 3MB7A 4BIDA 4X2FA 5EHYA 1SMHA 3EJ1A 3SW4A 2VO7A 4RC2A 3R9OA 3W2QA 4X3FB 3LFAA 4U79A 2NP8A 4M3QA 3EWHA 4Q2AA 2FGIA 3FY0A 4XG2A 4XV1A 4FNZA 4UMRA 4TYHB 5L2IA 3V04A 2JAVA 4O21A 4RA5A 5K5NA 3E8CA 2R64A 4FTRA 3CLYA 3NLBA 4G6NA 4QMLA 2Z8CA 4XHKB 3CD3A 4DGMA 3KL8A 3OVVA 3UODA 4CYIA 3LOKA 1J7LA 3OP5A 2XNBA 4IVCA 3R7GA 4JX7A 2PZIA 5DVRA 3FXWA 1WBPA 4FV5A 3LCKA 4RJ6A 3V5WA 3RM6A 2X39A 3DAEA 4E26A 4U0IA 3V8WA 4DG2E 2GQRA 4D1XA 1Q8YA 2WTCA 4ARKA 3FHRA 3FXXA 4XCUA 4BDCA 3AC8A 2VD5A 3AC5A 2C6KA 1M7QA 3D7TB 4XH6A 4LV5A 3RHKA 2CGWA 2EUFB 3QTSA 1DS5A 1YDRE 4N4SA 4B0GA 4XYFA 2LAVA 2PE1A 1P4OA 4U43A 2CDZA 4WG3A 3QZHA 4OLIA 4D28A 3C0IA 4O86A 3C0GA 4E5BA 1CMKE 2VWXA 2ZV2A 5ANIA 5JN2A 2BIYA 5EH0A 2W1HA 4JLCA 3UNKA 4R8QA 1OIRA 4AGDA 4OBQA 5JQ5A 3A4PA 5CF4A 3L8XA 2IZSA 3P1AA 3HX4A 3PJCA 4DLJA 3K2LA 5EM8A 5AM6A 2QHMA 3TJCA 3RK7A 5CEOA 4BVUA 3BCEA 5A14A 4IACA 4OTRA 4RVMA 2OJ9A 3HP2A 4CRSA 4OBPA 1LEWA 1AQ1A 2YM4A 3UE4A 5HQ0A 2R3OA 3OTVA 4LGHA 3TDVA 1Z57A 3COMA 5C8NA 2I7QA 1NVSA 2GMXA 2IVTA 5FP5A 4EC8A 2XKDA 4BDDA 1ZLTA 3HUBA 4IVBA 3PLAE 1JSVA 5KE0A 2QOFA 4ASEA 3VQUA 3IDBA 4OTFA 4D0XA 4C38A 3BRBA 3PPKA 3D15A 3FYKX 4Q9SA 1URWA 3G9LX 5ACKA 1J7IA 1H27A 1BUHA 5IEXA 2GS7A 2R3QA 2WMSA 1YOLA 5FGKA 4KUJA 5K0XA 2XM8A 2CNQA 1UA2A 3DB8A 3VF8A 2XH5A 3MW1A 4AZWA 4N70A 5EDRA 3VAPA 1O6LA 3OBGA 5IDPA 2QLUA 4JDJA 2A1AB 3DXNA 1Q8WA 4JR3A 4KBCA 3MTLA 3UJGA 1ZZLA 2QCSA 2ZMDA 4RT7A 3QRUA 1QCFA 5CVGA 5C8MA 4ZLYA 4J8MA 1UKHA 5J5TA 3VNTA 3LE6A 5CS6A 4YMJA 4I23A 2RG5A 3DXPA 4FT5A 4HW7A 2W96B 5IA0A 5ANOA 3U4WA 4ALVA 1Q3DA 2YCFA 3H3CA 4BYIA 5LWNA 1PY5A 2RGPA 4L67A 5L2QA 1WVWA 2BTRA 3I7CA 5CSHA 4IX5A 5J9ZA 3R21A 4FZDB 5CSPA 1DAWA 2UZOA 2YN8A 3HV4A 4QQ5A 4EYJA 4DFNA 3C4WA 5D1JA 2OGVA 2W4KA 5HE2A 3BLQA 1PMNA 1ZOHA 5E1EA 1Q41A 3WIKA 3HMOA 3E5AA 3QD4A 3G0FA 4DAWA 5AP3A 5DMZA 2W99B 5JK3A 1W82A 3V6SA 5AA9A 2BDWA 4ZLOA 4L01A 3UMWA 3F61A 3MA6A 3ZSHA 1OKZA 3B2TA 4K9YA 2GTMA 3S1HA 3EYGA 4HPUE 4EK3A 3ERKA 5GNKA 3W33A 2ACXA 5HE3A 5DFPA 2QKRA 5I0BA 5AFVA 4RX8A 1UKIA 3Q5IA 4BN1A 4YTFA 4ZTLA 1SZMA 5D10A 4BCHA 1OBDA 3PA3A 2Z02A 2XIZA 5AX3A 4DFLA 2G2FA 3DNDA 4D2VA 2BIKB 4FZ6A 1E1VA 2WIPA 3G6HA 4MVFA 2R2PA 4F9YA 5JH6A 3NMUF 3HV3A 3CR0A 5AP2A 3RCDA 2PYWA 2OJGA 4B4LA 3O51A 4BICA 4BWKA 3QTIA 4GJ2A 3ENHA 5AUYA 4BCMA 4I93A 2XIYA 3TNQB 4UXLA 2QVSE 1J91A 4EZ3A 3ZHPC 3KRWA 3HUCA 4YHTA 2QC6A 1ZARA 2VTSA 2Y6MA 4NT4A 2C69A 1LP4A 4FKJA 4KSQA 4Q5EA 4ACDA 4EUUA 4IM0A 3SV0A 4H1JA 5LWMA 3FI8A 4GSBA 1S9JA 2GQGA 4ANNA 4Y5HA 3OWLA 2YA9A 4FT0A 5LVNA 3KREA 4MF1A 3R8LA 4A4LA 2XRUA 5IA1A 5KHXA 5CSWA 4HZRA 2WD1A 3LQ5A 3R7YA 4D4YA 3UIXA 2WU6A 2YITA 3BELA 5HLWA 4A9UA 4G3GA 4IFCA 3MIAA 3S4QA 4QMXA 2OO8X 3WF6A 2JIIA 5L6WL 4IC8A 3ZBXA 4A9YA 3QUEA 4TXCA 3CD8A 4QMMA 1G8SA 5LMKA 5IQEA 4YSMA 3IW5A 3R7EA 2PVFA 1MQBA 3RAIA 4H3QA 4WD5A 5TE0A 2KULA 3NUYA 4QNYA 4W8DA 5CT7A 3UC4A 3OS3A 2LGCA 3AT4A 3T8OA 3UIMA 1Z9XA 4I3ZA 4J98A 5I9WA 4YURA 2UW9A 3NNWA 2IZTA 5K3YA 2IG7A 5DBXA 3FLYA 5DLSA 2XJ2A 2YDKA 3LZBA 2GNGA 3AGMA 3QWKA 4JXFA 4E6AA 4GT5A 2H8HA 3D5VA 3P08A 3QHRA 4AN9A 3BBTB 3GU8A 3MI9A 4YUQA 2DWBA 4EKLA 4MD9E 2PY3A 4ZSAA 2B52A 2W1CA 3NPCA 5L8KA 2B7AA 2WAJA 3LJ1A 4YLKA 4ERKA 3D14A 4MXOA 4JRVA 3Q96A 4NM3A 1JOWB 2BZIB 4XLIA 4K2RA 2IW9A 4X2JA 2JDVA 2NO3A 2XZSA 3CE3A 4O0RA 3G33A 4CG8A 1V0PA 2YCSA 2HAKA 2I0EA 1GY3A 3BEAA 4GFOA 4L53A 1KE5A 5EM6A 4A06A 4BBEA 5M06A 3GC7A 4LL0A 3P0MA 5HG9A 2VO6A 2IJMA 4FODA 3E62A 4H3BA 4YZ9A 2FSOX 3RPVA 2B9JA 1OMWA 5B2LA 2JLDA 4M8TA 4L46A 2RFNA 4O7TA 3A8XA 3LFCA 5ETCA 3WF5A 2EVAA 3BHYA 5TR6A 4RZWA 3EHAA 4AW1A 4CEGA 4JG8A 3OXZA 4EK6A 3EQCA 3NS9A 5LVOA 3F6XA 2BKZA 3EZRA 2QNJA 3KXMA 3BE2A 3PIZA 5AR5A 3ZYAA 2JKKA 5EDQA 2H9VA 4R7BA 1PXPA 3I6WA 1IAHA 2X8DA 4QOXA 4QYFA 2VWWA 3EIDA 5J87A 4IB1A 4PTCA 1APME 4GEOA 4AZEA 4QP4A 1H28A 3RALA 3R22A 3DGKA 4RRVA 4EH5A 1H1RA 5BNJA 2CKOA 3QX4A 3A4OX 1SVEA 4AW5A 2IVSA 2ONLC 3AD5A 5JQ8A 2FO0A 3F7WA 4FTOA 4TNDA 3UVPA 3NGAA 4F0FA 5IUGA 3ORIA 2WEIA 4EOIA 2R3FA 3QU0A 3KK8A 2ETRA 4YHJA 4DGLC 3OCTA 1BI8A 3FXZA 4X7QA 2Y0AA 2R3HA 5AM7A 4BCFA 3CQEA 3NDMA 4RSSA 4OGRA 3ZLYA 2YZAA 4G2FA 4A4OA 2UZNA 4YZDA 3NSZA 4IWQA 4D2SA 5F4NA 4DFZE 4CLJA 4DBXA 3AC2A 3TT0A 3FZPA 1X8BA 2FVDA 3FL4A 3V5TA 5FTQA 3CIKA 5CU3A 4DEIA 5HZNA 3P7CA 4XG3A 2WZJA 1Q99A 4PL4A 4BKJA 3R9DA 5DG5A 2QR8A 3A7JA 3TV4A 4BDAA 1VYZA 5F95A 3FZTA 4RX9A 2J5EA 5KHWA 3V5JA 2Z2WA 3PRFA 4G1WA 4HCTA 3MFTA 3QQLA 4XUFA 3SX9A 4AZSA 4GK4A 3TL8A 3QL8A 4JBVA 3F2RA 4DFBA 4ZSGA 1FMOE 3PIYA 2X7OA 3GI3A 2PUUA 3QC4A 3SDJA 1UU7A 1GNGA 2C3IB 2QOOA 3OWPA 5J95A 4FA2A 1H0VA 1KOAA 3EN9A 5A3XA 3ZM4A 2ZV9A 4R3RA 3KMWA 4O1PA 1ZYSA 2JDTA 3R1SA 3I79A 2CKPA 1CSNA 5C27A 4DE4A 2FB8A 3U8WA 3C4CA 1BI7A 3COKA 2UZVA 1W8CA 3S0OA 3TTJA 3FV8A 4DEDA 1K9AA 4YC6A 3LXLA 5IUIA 4KRDA 1VR2A 3U9CA 1TVOA 3QTRA 4P4CA 4BCIA 1PXNA 4X0MA 4C3PA 1BMKA 4DEGA 3KCKA 2ITWA 2XNMA 3BGPA 3LFFA 3LLTA 3PTGA 4G3FA 2CGUA 4DC2A 3DFAA 5HG7A 4UBAA 2HXLA 5TF9A 2PULA 2RIOA 3LAUA 4FL3A 4BBFA 5BMSA 4DITA 3FZRA 5CSVA 3R9RA 3P78A 3E8DA 2QD9A 2BHEA 2XNNA 2VWUA 3K5VA 2C68A 2VO3A 2VWVA 3Q6WA 4WBOA 4FV0A 3H9RA 3CY3A 3I7BA 1NA7A 5FM3A 3QCYA 1ZWSA 3NCGA 4XNEA 4B9DA 5AA8A 3BPRA 4IW0A 5ACBC 4L44A 4CFUA 3QKLA 4EYMA 3DA6A 3VJNA 4FV9A 3COIA 5AUWA 3RNYA 2GFSA 5IDNA 3LM5A 3PLSA 4AGUA 5CX9A 5KMNA 2YISA 3VVHA 3DOGA 2YCQA 5BX0A 2A0CX 2BAQA 4L3JA 4PQNA 4I6HA 3QAME 5HO8A 1VEBA 2JBPA 3A7IA 5CF6A 4EK8A 4N0SA 1URCA 4K77A 5HESA 5H8BA 5IKWA 1ZRZA 4CMOA 1ZMWA 2F2UA 5L2WA 5ANDA 3II5A 3LMGA 1FVRA 3EN5A 3R2YA 4MXXA 2VWYA 1FQ1B 5AAFA 4DA5A 2BFXA 1FINA 5BMMA 3ZFYA 2VAGA 2BAKA 3EH9A 3E88A 4TWCA 2WMTA 5LMAA 4MWIA 3DAJA 5I9ZA 4O7WA 5M08A 2QKWB 3DTWA 1OM1A 4O27B 3ATSA 4M84A 3S00A 4DEHA 3IW8A 3ZRKA 3ZRLA 5EQEA 3UOHA 2VGOA 5IQDA 3S95A 2YLFA 3ZLSA 2X81A 4CT1A 4E6CA 4BTJA 1PXIA 3QXPA 3KRXA 3F2AA 4KIKA 4YP8A 3S2PA 2Q83A 2GNLA 3AC1A 4H58A 2XNEA 5LQFA 1PYXA 4QQJA 5EHOA 1NY3A 4FICA 2PZRA 2WMRA 3HGKA 2QG7A 2CPKE 4Y73A 2ITNA 3R9NA 4H39A 4R3PA 3W2OA 1F3MC 3MH2A 3KC3A 4HVHA 4XG7A 3ZXTA 5AEPA 4XG9A 2YAAA 5L2SA 3LXKA 4ZMEA 1JNKA 3DB6A 3GC9A 4RIXA 5T3QA 4BDHA 5JSMA 2HZIA 5M51A 3TN8A 4CZUA 3E7VA 3FE3A 3CSVA 5FWKK 3LKMA 2WIHA 3TXOA 4OTDA 5IQBA 4PV0A 1PKGA 2ITYA 4PNKA 3G2FA 4O81A 3OFMA 5M09A 1UU9A 5DNRA 4ZTMA 1M14A 5DOSA 5CAUA 2VTHA 5E1SA 3U51A 2EXEA 5KKRB 4O2ZA 5EK7A 2A2AA 5HNBA 3GU6A 3LM0A 4YPSA 4MH7A 1FVTA 4PUZA 3QLFA 4D2PA 2OH0E 4LMUA 3ZBFA 5CEMA 3OOGA 4UMUA 1U59A 2V22A 4I0RA 4LGDA 1OI9A 3MPAA 4RPVA 2G9XA 4ITHA 5HCZA 4QMYA 5TOZA 3CTHA 4JDHA 3IO7A 3FEGA 4ID7A 3TM0A 3P7AA 1CKIA 5JFXA 3SC1A 2C5VA 3UQGA 4HOKA 4GMYA 4RFZA 4E1ZA 4EBWA 2FSMX 4UYNA 1Q24A 5HVKA 2WTIA 2I6LA 4APCA 1UWHA 5FRIA 4D5KA 4UALA 2WQMA 3KMMA 4BBMA 4FG7A 3RINA 4ASDA 3W16A 5KMLA 4Q5HA 5AJQA 5HNIX 4BB4A 1PYEA 3LFDA 4IXPA 3OCSA 5GJFA 3R7UA 3TTIA 1TQPA 4G3EA 3NAXA 4AGCA 4Z3VA 3ID6C 3OF0A 5CXZA 1YI6A 3SLSA 5BVOA 4N6ZA 2PVMA 4G5JA 3NYOA 3MFRA 5TKDA 4R77A 4IJPA 4BCQA 3K3JA 5BYYA 1SNUA 5FXRA 2UW6A 3ATTA 5FBNC 1H0WA 3F3VA 4XV2A 3BWJA 3QBNA 5EM5A 3Q9WA 4CYJA 5M4FA 4PTEA 3HKOA 3L9PA 4P2KA 4BRXA 4I22A 1Y6BA 2YIQA 4MD7E 3RPYA 2VTOA 3UG1A 4Z7HA 4GRBA 3LIJA 3QQHA 4KBKA 4ZIMA 1SVGA 2XBJA 3QTXA 2HZ4A 4KBAA 3P79A 4E5WA 2YAKA 2GCDA 4XBRA 3ZM9A 3U54A 2GHGA 5B2KA 5ICPA 3VULA 4UX9A 2R3NA 3LFBA 1PF8A 2XKEA 4FTNA 4DFXE 3LFSA 2QURA 5FD2A 4FKSA 3UO5A 4XRLA 2QU5A 1CDKA 4C0TA 3SVVA 4FEVA 5EQPA 3UNZA 2YZLA 4W9XA 3SG9A 2BRMA 3EQHA 1CTPE 2YCRA 3DBEA 5L3AA 3R2BA 4O22A 4IQ6A 3OBJA 5HHWA 2ETKA 4AOTA 4CCBA 2XK6A 4Z9LA 3QGYA 3ZC5A 3QHWA 2XNPA 1XO2B 3EKKA 4AF3A 4V0GB 4IANA 2X8IA 4GYGA 1MP8A 4S32A 4EOMA 1ATPE 5EDPA 5CENA 3T9TA 3UTOA 1O6KA 4FIJA 4P90A 4EJ7A 3CTQA 4FUXA 2BZKB 4LRKA 4Y5QA 1FMKA 4O6EA 3PP1A 4MBLA 3VUDA 4EEVA 4AWIA 4FV1A 2WMQA 3BQRA 4FMQA 2W1IA 4GK2A 4QPMA 5HCYA 4NFMA 5DEWA 4FV4A 3UOJA 3I6UA 4UWYA 5HG8A 3V51A 1WBTA 4I5MA 4C37A 3WILA 2JKOA 4HZSA 4IDVA 3LW0A 4AFJA 3RWPA 2VV9A 5AUTA 4AQCA 5DRDA 2OJFE 4F9WA 3ZSIA 4S30A 4JX3A 5GJDA 5LVMA 1UU3A 2WTVA 1RDQE 3ZS5A 2JKQA 2O63A 4PF4A 3P9JA 4QMPA 5DT3A 4R6VA 2XM9A 3Q9ZA 4FEQA 3E64A 1Q8UA 4G6LA 5AMNA 4WA9A 4AX8A 4AFEA 1UVRA 4BIBA 3OT3A 3UBDA 4FR4A 2OI4X 3FLZA 3KY2A 4QQCA 5BYZA 1J7UA 4C62A 3MA3A 3MWUA 2W1DA 2VTAA 3SRVB 2OLCA 2EU9A 1JSUA 1OKWA 1XH5A 4KWPA 5B2MA 4GJ3A 5GZ8A 4CXAA 4GT4A 5IMXA 4I21A 4R1YA 5M55A 5DA3A 3SD0A 4LOOA 2J0IA 2ZYBA 4JQEA 3GFEA 2WMAA 2UUEA 3GOKA 3LXNA 4NW5A 2YIXA 3BYMA 4MD8E 2UV2A 3C50A 4RIOA 1KWPA 2DYLA 5E92A 4B8LA 4BWXA 4ZY5A 3DTCA 3H4JA 4FGRA 4O38A 2CKEA 4JOAA 5FLFA 3DKFA 4MQ1A 2ZMCA 4X3FC 3KXNA 3W55A 3QTZA 5AV1A 3E8EA 3AT2A 5CNOA 4ZK5A 2ETMA 3Q9XA 1W98A 4LOPA 5L4QA 4AAAA 1I09A 2W0JA 2JC6A 1R0EA 1ZZ2A 4ZXTA 4EL9A 1A48A 5LARA 4HNFA 4BC6A 3WF8A 1KSWA 3C4EA 4LI5A 3ZEPA 4DTBA 3PJ2A 2Y4IC 3I81A 3BBWA 2WMBA 3NX8A 3ODZX 5CY3A 4FGBA 5DR2A 4FV6A 5DR6A 3ZO4A 3ZUTA 3W18A 2PUPA 2QR7A 4IH8A 4QP7A 4H36A 4BZDA 3ELJA 5AP6A 1B38A 3LCTA 2ERKA 3JVSA 1ZYJA 1ZXEA 3KXXA 4TN6A 3UO4A 2QO7A 4PP7A 4OAUC 3FMNA 4UMPA 3TUDA 4M15A 4WBBB 3LCOA 2YM7A 2FSTX 3ORKA 4HGTA 3FZSA 4LFIA 4NU1A 3VW8A 3FI3A 3VWAA 4NEUA 4OBOA 2IWIA 3HRCA 2VTPA 2W4OA 4YBJA 3QTUA 2VTIA 4JL9A 2IW8A 3AGLA 4U7ZA 4L42A 5LCKA 3AQVA 5A4EA 1NW1A 3MSSA 5JZNA 4J95A 3EQBA 3BHUA 4MKCA 4L68A 4FKVA 2EWAA 4QMVA 4QMSA 4RIWB 4PTGA 3AC3A 4YHFA 3UVRA 5HVYA 4RVKA 3GGFA 3V5LA 2BZJA 2PK9A 1MUOA 2H96A 4EQCA 4FTAA 3W2CA 3QRTA 3RAWA 3R8VA 4C34A 4CKIA 3DCVA 3ANQA 3E7OA 2YIWA 3NUNA 2WQEA 3DV3A 4YJOA 4IBMA 3EL8A 1H08A 4IX6A 1Q5KA 3BU3A 3VBWA 3NVKI 3SG8A 4YJPA 2P55A 5AR4A 3TG1A 3ZUUA 3HP5A 3MIYA 5IH5A 4NM5A 5AAEA 2R3LA 4DGGA 1WVYA 4ZZMA 4TTHB 5EG3A 1JLUE 2P3GX 3VIDA 2X7FA 4IB3A 5KCVA 4CZTA 3POZA 3TNHA 3UVQA 4IZAA 3NWWA 3EFJA 2OFVA 4O91A 3DLZA 3UYTA 2UZUE 2GDOA 5E8TA 2WTKC 2W7XA 3O71A 4PMSA 3I0OA 4FVRA 3AXWA 5HD4A 2J90A 3ZDUA 2WOTA 4ZTRA 3BWFA 4O0YA 5T6KA 2WELA 4EZ7A 5L8LA 2X8EA 3BYVA 5BVDA 2ZV7A 4XLVA 1WZYA 4I4EA 5E9EA 4U3YA 4WOVA 4F6UA 5HX6A 3HA6A 1UV5A 3I60A 2QU6A 3ZO3A 5KNJA 1H4LA 2R3GA 3RPOA 5IQGA 2YIRA 4R3CA 4HYHA 4E4XA 4QQTA 4CFXA 2WMWA 4CCUA 5IPJA 2Y6OA 4FV7A 1AD5A 5AV3A 3RK5A 1U5QA 4GG7A 2F7EE 3RCJA 4D9UA 1UNHA 3OY3A 4CVAA 4EHVA 4DH8A 3UGCA 5JFWA 1H24A 4GS6A 4F7NA 5CASA 3V5QA 5HIDA 4FTUA 5K4JA 3L9NA 4XBUA 5KBRA 3GOPA 5EKOA 3OOMA 2XIKA 3UOLA 3NYXA 3VW6A 4AUAA 5HX8A 2C0TA 4RQVA 3MVJA 3HV5A 3RPRA 2PVRA 4UN0C 4QPAA 2VTNA 2OG8A 4XP0A 3R9HA 4YU2A 1H00A 3UNJA 1H07A 4CQEA 2CJMA 4FV3A 5BUEA 1SM2A 4UB7A 5EKNA 5ITAA 4QYYA 4G6OA 5D7VA 3LMIA 4F70A 4J8NA 5L6OA 3P86A 3HAMA 1H26A 4PPBA 4RWIA 3VHEA 3MN3A 4FKQA 2C5OA 4KS8A 4AT5A 3IGGA 2B0QA 5HKMA 1KE9A 3EQGA 3F82A 2V55A 4C4IA 4JG7A 1QPDA 4KIQA 3SKCA 3FSFA 4WSQA 4EH2A 4ANBA 1REKA 3VJOA 4F9AA 1TQIA 1UU8A 2E9UA 3M11A 4FSWA 4MBIA 1ZYLA 3OC1A 3WF7A 3OD6X 2R3IA 4OW8A 3CJGA 2QLQA 5AP4A 4K6ZA 2ITQA 2VX1A 4LL5A 4O7ZA 4DG3E 3OXIA 4QRCA 5DRBA 4ANMA 3IW4A 5M53A 2JBOA 4IAKA 3Q3BA 4QYEA 3SHEA 2R3KA 3FUPA 4QYHA 3QD3A 3NVMB 4TL0A 2DQ7X 2QQ7A 4IMYA 4WG5A 3O0GA 2OU7A 3Q32A 3GCSA 3SXFA 3T3UA 5D41A 3F3WA 3WZJA 3ZU7A 2JDRA 2PMLX 4L52A 3WYYA 5LMBA 4QMZA 4O6LA 3DXQA 3EB0A 4Z7GA 4PL3A 4U6RA 3QALE 3RMFA 2WQOA 3CQUA 5DT0A 4YTCA 2FH9A 5EI2A 3OWKA 5GHVA 3MVLA 4NUSA 4O0TA 3TUCA 3PSCA 4FZFB 4DFYA 1M2QA 5JFVA 4AGWA 5IA5A 3EQDA 4I92A 4IZYA 3PVBA 4ERWA 4KNBA 1HCLA 3UMXA 5FEQA 5C03A 2AUHA 4OT6A 2H34A 2ZB1A 3KULB 3NW6A 1RQQA 3AT3A 2OZAB 3RK9A 4EOKA 3JY0A 3UYSA 5AV0A 1PMEA 1GIIA 1ZMVA 4U42A 2R3PA 3UO6A 3NCZA 3U55A 1R3CA 4NCTA 4QMNA 4IADA 5FUTA 2F2CB 3OROA 2O2UA 3D5UA 4KIKB 3UPXA 4C4JA 3A7FA 4EH6A 4FVPA 5CEPA 4FOBA 2JD5A 2IN6A 4D2RA 4G3DA 4UY9A 2J2IB 2OJIA 2RFEA 3MY5A 4BDBA 5E8WA 3ZZWA 5EYCA 5KO1A 2R5TA 1PXKA 5AUXA 4MK0A 3QYZA 5H9BA 3ZCLA 4B7TA 4MAOA 5A54A 2Y8OA 2X6EA 2X1NA 2FUMA 4ZEGA 1FPUA 1H25A 4FK6A 1HCKA 4IJ9A 4NJDA 5LJJA 1YQJA 2QOHA 3BZ3A 2E9PA 3FLSA 3LVPA 3OEFX 3FSKA 3H30A 5AP1A 1JKLA 4F6WA 3FMEA 2PVNA 3ORLA 4OTWA 5D7AA 2VWIA 5EW8A 4RC4A 3D0EA 4TZRA 4FT7A 4BGQA 2QOLA 5AAGA 4H1MA 4RMZA 5KBQA 3BHVA 4RJ3A 2DUVA 3RM7A 4PDYA 3AOXA 3LCSA 4UV0A 5AV4A 3M1SA 4CFMA 2R0IA 3EN7A 3SAYA 2PE0A 2W1ZA 3D5XA 3DJ6A 4LQMA 2OK1A 3E3BX 5E8UA 3UP2A 3QRJA 2FYSA 1AGWA 3IOPA 5CYIA 4Z16A 1IRKA 3BIZA 5K9IA 5KMJA 4CMUA 4O7RA 4WSYA 4E7WA 2J0LA 3POOA 4NIFA 5IQAA 3PXRA 4YJNA 4HGEA 2B9FA 4TWOA 4AT3A 3PDTA 4R1VA 1ZMUA 3FMJA 2HWOA 1VZOA 4YGAA 5AWMA 4RBLA 4ACGA 4JR7A 4QTDA 3GCUA 5FDXA 2XJ1A 2CLXA 2W1GA 4AACA 5DE2A 2YLEA 4MNEA 3F3UA 3EKNA 4AG8A 4O96A 3R04A 3FZ1A 3IONA 4BZOA 2CMWA 3PY0A 4OUCA 4XG4A 3RVGA 2XP2A 3I4BA 5D12A 4FUYA 2UVYA 2W1FA 2E9NA 4RWKA 5CAVA 2GNFA 3TV7A 1PMUA 3GCPA 4KD1A 4FT9A 2ZDUA 2JFMA 3BYUA 4RJ4A 3HMNA 2ITTA 2XYNA 3C51A 3C4ZA 2JIUA 2I0YA 5EFQA 3JYAA 5AUZA 3OUKA 3O8TA 2PVJA 1WCCA 2OJJA 3PUPA 4RVTA 1YI4A 5BYLA 3K5UA 3R28A 4ZJJA 4IWDA 2XK9A 2HWPA 3KMUA 3EFWA 4APPA 4AW0A 1YDSE 4C8BA 2QOKA 3OTUA 1A06A 2B55A 1F5QA 3G0EA 3MH3A 4B6LA 5AR2A 2PVYA 4ZMFA 2QODA 4F9CA 5CAPA 2VRXA 2NNWB 3IW6A 1JBPE 3F5UA 1Q97A 2Q0BA 2X4FA 3F2NA 1E9HA 2UVZA 3R71A 5CAOA 3RAKA 3ANRA 5IQHA 3ITZA 1NVQA 4HVDA 4FIEA 4EONA 2PPQA 3BGZA 4J1RA 4TYJA 2GSFA 4X2NA 4A9RA 4JBPA 5HLNA 5GIOE 4IHPA 3EMGA 3KQ7A 4RIYA 5AV2A 5I3OA 3R8UA 1GIJA 4AOJA 4FEUA 5I5ZA 4OTPA 2QI8A 3IECA 5AR8A 4D55A 2Z60A 4JJRA 4ALUA 4MXAA 3NNUA 4FKGA 4RVLA 2ITXA 3NW5A 4QP3A 2BKKA 2QO9A 4L00A 2JDOA 3IDCA 3MBLA 3NAYA 4ITJA 3KA0A 5CSXA 5TT7A 4I6BA 3RPSA 5E8ZA 4EH3A 5LOHA 4D4SA 4O7NA 4AE6A 3FBVA 1V1KA 2OIBA 3BI6A 3PVWA 5EHLA 1YOMA 2UW4A 4OTIA 4GKIA 5IQFA 3B8RA 4YC8A 3FHIA 4UWBA 4PDOA 1W84A 2J7TA 4MXCA 2Q0NA 4YLJA 3V3VA 4HVSA 2XEYA 4N57A 4TRLA 3VRYA 5JEBA 5C8KA 4FSRA 2HK5A 4CFVA 3FI2A 1UWJA 4BCPA 3BEGA 4FX3A 1B39A 4O0UA 4FT3A 5CU2A 4PRJA 5ANEA 2XNGA 2C6IA 1HOWA 4YJSA 4EOOA 3O8UA 3BX5A 4EORA 5CEKA 2YACA 4D4VA 2XIXA 3HEGA 3W2SA 3HECA 2YM5A 4PMMA 5J1VA 4I4FA 4ACMA 4C7TA 2C1BA 3MH1A 3NYNA 4I6FA 3RNIA 4IWPA 1OL5A 4F99A 5J9YA 3FKOA 2OIQA 3O50A 4K0YA 3WARA 3W2RA 1NXKA 5DR9A 5FQDC 3THBA 1KOBA 5IA4A 3U6JA 3ZSGA 4FKPA 1M52A 4YJTA 4GW8A 2BDFA 4NTTA 2G2HA 4ANOA 4C35A 3F3TA 5AR7A 2C6MA 3SQQA 4MWHA 4BCOA 2P2IA 4CT2A 1BL6A 2BVAA 1JKSA 3CXWA 3WIGA 2HY81 4DEEA 2F49A 2WTWA 3PRIA 4ZAUA 3PG3A 3VUTA 4GT3A 3C7QA 3PJ8A 3JR1A 2HCKA 5HE1A 1ERKA 3BE9A 3GU5A 4KS7A 3KVWA 5DN3A 3TACA 2XS0A 4ZOGA 3ZMMA 4KB8A 4YR8A 1QMZA 1Y6AA 3AMYA 2FA2A 2ITZA 4G16A 4LV8A 4HPTE 3TZ8A 3ZO1A 1MRVA 1GZNA 4RX5A 2ITOA 3PE1A 3OCBA 4G5PA 4FTKA 5CVHA 4EOSA 1IA8A 2XCKA 2OXDA 3LQ3A 4BR3A 2WO6A 1M2PA 3ET7A 3REPA 4CZYB 3FQEA 1B6CB 4H3PA 4M0YA 4U8ZA 4XJ0A 3VS2A 4ZTSA 4L9IA 2V5QA 4V04A 3WE4A 4E4LA 4ZTNA 5DI1A 4JAJA 4CTCA 5CI6A 1OVEA 3JUHA 1BYGA 3FQHA 4S31A 3VQHA 1OUYA 4HYSA 3KKVA 3GC8A 1I44A 3OUNB 3V6RA 4A07A 3TCPA 4LRJA 3P23A 5DYJA 3GUBA 3UDBA 5HG5A 4IE9A 4U41A 4I24A 3M42A 4D2TA 2UW0A 4L7SA 3FQSA 5IUHA 1H8FA 3QUDA 2J0JA 2NRUA 4X6QC 1M2RA 5E7RA 4I0SA 4EHEA 4II5A 4MTAA 3BV3A 5EI6A 2IZRA 3FMMA 3GBZA 4EKKA 4BHZA 3IQ7A 3T9IA 5B0XA 4C33A 3VBXA 4Y8DA 3A61A 3ZLWA 2YERA 3PWDA 3VC4A 2BR1A 5M07A 2X9FA 4TYIA 2RF9A 3C9WA 4F1MA 4FKUA 3DS6A 3PZHA 4CRLA 2PU8A 5IG1A 1H1PA 3VRZA 3C13A 4DCEA 3R7OA 5HD7A 3DKCA 1QPJA 2PMIA 5ETFA 3ZFXA 1SVHA 2ZB0A 4QMWA 4ENXA 5JGAA 2X9EA 4EOQA 5FG8A 3ZXZA 4FV8A 1XWSA 2HYYA 1FBNA 3KULA 2Y4PA 5CU4A 5FM2A 3GB2A 4NKAA 1CKPA 2RFSA 2W5AA 3ZZEA 2JDSA 4TNBA 3N4TA 2VTLA 4I20A 2RFDA 3AD4A 1A9UA 5AUVA 3PIXA 3PVGA 4ZLZA 2F9GA 4M7IA 5CLPA 2C1AA 3NEWA 5HO7A 5K0KA 4GL9A 3I5ZA 3VS3A 5B7VA 4DGNA 1U54B 1XBBA 4F09A 4YSJA 5HIEA 3MFSA 2PUIA 2QOBA 3Q4UA 4USFA 4H05A 2CKQA 4GYIA 4MF0A 4BGGA 3U4UA 4O7SA 4HYUA 3DZOA 3HDNA 4JDIA 4FTMA 1P4FA 4MNFA 5DT4A 3SW7A 1JKTA 1KV1A 1OITA 4FNWA 3Q5ZA 3IG7A 3RI1A 5JGBA 3Q53A 2RG6A 5AX9A 4R7HA 3D9VA 1XBAA 2GS2A 5CT0A 4DN5A 4LG4A 4UXQA 3F88A 1H1WA 3AMAA 4EHGA 1UNLA 2E9OA 3F69A 1W0XC 2C6DA 2CCHA 2WB8A 4BGHA 1TKIA 4M68A 4J97A 1DI8A 4FTTA 4NKSA 5A46A 4CKJA 1U5RA 2YDJA 3ZEWA 3EZVA 4CNHA 1Q8ZA 4BI2A 2VNWA 1JPAA 1YHWA 3G90X 4YJRA 3L8VA 5M44A 5J1WA 2PHKA 4FIGA 4UYAA 3U6IA 2ITPA 3R0TA 4AW2A 2PVKA 1PXLA 2BALA 2R0UA 3VF9A 5K5XA 3VBVA 1T45A 5A4LA 2VX3A 2UZLA 3A7HA 4X21A 4TWPA 2UW7A 2XMYA 4Y95A 2XIRA 5F94A 1W83A 4DT9A 3SOCA 4BKYA 5GZAA 5JKGA 4GFMA 3R7IA 3FC1X 4RWJA 3R8PA 3KN6A 4F08A 3KGAA 3FDNA 3HRBA 2NRYA 3FC2A 4EJNA 3C4FA 4FOCA 4FTCA 2EB2A 2ZVAA 4LGGA 1QPEA 1YXTA 5FBOA 3RKBA 4WRSA 4DINA 3OEZA 4G31A 4EQMA 3D4QA 4ZZOA 4NH1A 4L45A 4I41A 4JI9A 4ZY6A 2VX0A 2WMVA 3Q04A 4OT5A 4X2GA 4X3JA 1YWRA 4U44A 2J51A 1GZ8A 3FMDA 4CTBA 2WNTA 1OECA 3A8WA 3R73A 5J79A 3G5DA 4QMUA 4KIOA 5M4UA 1IEPA 1XKKA 2VTJA 2CN5A 1T46A 4ZJVA 4O83A 4XS2A 3C4XA 4BDFA 5JMSA 3ULIA 2C0IA 3JVRA 3TKHA 4TWNA 4FTQA 3VUMA 4DH1A 3PE2A 4GUBA 5H8GA 3COHA 3SXRA 5I9VA 3W10A 3KRJA 3H10A 5C9CA 3OXTA 4NK9A 1OB3A 5HOAA 2I40A 3E63A 3PP0A 1V0OA 3UQCA 4QD6A 5HI2A 2W5HA 2JGZA 2UZBA 5CAQA 5HBJA 5HBEA 4AZVA 3DU8A 2AYPA 3D7TA 3QCXA 4M13A 4WHZA 4W9WA 4PL5A 3TI1A 1G3NA 2J9MA 4HGLA 5I3RA 4DHFA 2B4SB 5K4IA 5HCXA 3FYJX 5IU2A 2C6OA 2OXYA 1O9UA 4E73A 3V8SA 2YEXA 4YTHA 4JNWA 2VNYA 2OFUA 4KSPA 2VUWA 2OW3A 4CQGA 4DT8A 2BUJA 3DT1A 3QQJA 3MTFA 3QA8A 5L8JA 3GXLA 2AC5A 4MQ2A 3EL7A 3UG2A 1RW8A 3L1SA 4Q9ZA 5AIKA 5CALA 3GEQA 2GNHA 4FNYA 4HNIA 4OTQA 2UW3A 2QO2A 2CGXA 2X4ZA 4OR5A 4O82A 2VTQA 3G6GA 1NVRA 1J1CA 3PY3A 2FSLX 3QXOA 4UZDA 3HRFA 2WTJA 4O7VA 3Q52A 2BRHA 3CJFA 4GIIA 4NM0A 1JSTA 4YTIA 5JT2A 4NFNA 4U45A 2WPAA 4ORKA 4IB5A 2PE2A 3Q9YA 5EW9A 5HEZA 4L43A 5EI8A 2UW8A 2V7OA 4FTLA 4PPAA 3CGFA 4EOLA 2QONA 4C57A 4AZFA 1XBCA 3IDPA 4JIKA 1KUTA 4M67A 4QYGA 1YVJA 2HY0A 3F66A 4RA4A 4PX6A 1H01A 4IAAA 3UZTA 4FYNA 2VZ6A 5J8IA 5JZJA 2X7GA 4PPCA 4QP8A 4IX4A 4EK4A 2ZDTA 3WOWA 5J5SA 3ZLXA 2PZ5A 3EQFA 1Y8YA 3N4UA 1BX6A 3QKKA 4E3CA 4HVGA 1RE8A 1YWVA 2ZJWA 2O5KA 4XMOA 3BYOA 4DEBA 3ZC6A 5EYKA 2BRNA 2BTSA 3N9XA 3HL7A 5ANKA 3DBFA 3ROYA 3FLQA 3QC9A 5EW3A 3MFUA 5LXMA 4DH5A 4ZP5A 5L6PA 3MJ2A 5EOBA 4DTAA 1WBSA 1OIQA 2IW6A 4CGAA 3TNIA 5KMMA 2WQBA 1MQ4A 3HMPA 5H3QA 1STCE 5KKRC 2GQSA 3GENA 3DNEA 3H0YA 1OGUA 4IDTA 2JEDA 4WT6A 3RJCA 3ALOA 1YXUA 3DQXA 2J5FA 3NZ0A 4G3CA 4K11A 4DYMA 4IAYA 2GS6A 2XA4A 4U3ZA 5CZIA 2ZM1A 4Z55A 4AP7A 4W8EA 5CEQA 4CFWA 4V0GA 1G8AA 2UZWE 3UIUA 4JS8A 3UPZA 1R78A 4X2KA 4XG6A 4KAOA 4PNIA 4J7BA 4GKHA 4M69A 3TKIA 1ZAOA 4KKEA 5A9UA 1IA9A 1P2AA 5HNGA 3F7ZA 5EQYA 4ZSLA 4BTFA 4JQ7A 3FWQA 2JKMA 1WBOA 2O3PA 3GVUA 4AOIA 2J0MB 3BGQA 4BDEA 3F5GA 2JITA 3D83A 5I9UA 4AS0A 4CD0A 5HE0A 3QWJA 2WXVA 3QF9A 1KE7A 5HVJA 4DFUA 4U9AA 2RL5A 2P0CA 3AC4A 4V01A 4A4XA 4F65A 4I5HA 4KRCA 3DLSA 5IMEA 3O17A 5E8VA 4J96A 3LMHA 1YKRA 2WGJA 5IA2A 3Q4TA 4I6QA 4D5HA 4TPTA 3WE8A 3F5XA 3DKOA 3D2IA 3MPTA 3ZRMA 5CQWA 3A62A
chains in the Genus database with same CATH superfamily
3UP7A 2BILB 5JRQA 2PMNX 5TO8A 3Q4ZA 1Y57A 3PXFA 1DM2A 5AR3A 2BMCA 5D9HA 5IA3A 4UZHA 1P14A 4XG8A 4NTSA 2R4BA 3MVHA 3MYGA 3ORXA 4O4EA 5DIAA 5A4QA 1PRYA 4RFMA 2WMXA 3L9LA 3GCQA 4BI1A 3W8LA 4F1TA 3VBTA 3EN4A 5HO6A 2X0GA 5FP6A 4E4MA 2Z7LA 2XKCA 3QYWA 4XV3A 3I0QA 3QRIA 3VUHA 3NNXA 4E6DA 2GU8A 4FKLA 1KE8A 2ESMA 3QCSA 5L2TA 3L8PA 5FEDA 4ZJIA 2R3JA 4DLIA 3BKBA 3HVCA 1JAMA 1YRPA 3TNWA 3RZFA 5KMIA 2CLQA 3P7BA 2C30A 1FGIA 4FSUA 3HNGA 2HELA 4IB0A 5H8EA 3SXSA 3WZKA 3W2PA 2W5BA 5GZ9A 5JRSA 3CKWA 2VO0A 4GU6A 4NSTA 3A2CA 4S34A 4F7LA 1PXOA 3DAKA 5BQ0A 2GNJA 4CKRA 3R00A 5C4KA 4G9RA 1Y8GA 4AN3A 3EQIA 4C59A 4FSNA 2WKMA 5I9XA 3E93A 3OCGA 3PA4A 4BDIA 2XCHA 4O2PA 4FIHA 5D11A 3VUGA 1OPJA 1WFCA 3MH0A 3QZGA 1GJOA 4BY9E 5C4LA 3U6HA 2UW5A 3BLHA 3G51A 1CM8A 2VWZA 3HMMA 4QTCA 4FZ7A 3ORNA 3O7LB 3DZQA 1VJYA 4WO5A 1IG1A 4O7LA 4TYHA 3FL5A 1JVPP 5KUPA 4GUEA 1OL1A 3K54A 3R7VA 3O96A 3TIZA 2W17A 5DGZA 4D4RA 3ZFMA 4FSYA 4Y85A 5CWZA 2HW6A 4J53A 5G6VA 5DWRA 2QOIA 3TEIA 5BVWA 3QTWA 4M66A 1ZYDA 5HTCA 3NUAA 1GIHA 2C3JA 4JVGA 4UMQA 4FK3A 3KB7A 2SRCA 4WKQA 1J3HA 1U54A 3NIEA 4CV8A 4E93A 4X3FA 2R3RA 4OTGA 3K3IA 3G9NA 3JY9A 3CP9A 3P5KA 1K2PA 1MRYA 3PG1A 3ZTXA 2W4JA 1XH8A 3AG9A 3UIBA 3KN5A 1Q62A 3PJ3A 4D58A 5BPYA 1R39A 2CCIA 2YM6A 4QNAA 5E4HA 2BFYA 3IPHA 5ANGA 5M57A 4BDKA 4RJ5A 1XQZA 3R83A 4NL0A 3WZDA 4QO9A 4BCJA 1UNGA 1L3RE 1YXXA 2HZNA 3TNPC 3B8QA 2EXMA 4F0IA 3QQKA 3BYSA 2O64A 4FSMA 5CVFA 4CMTA 2CN8A 1W2FA 4CV9A 4WUAA 4QP9A 4MX9A 4ZTHA 3ALNA 4AA4A 5KMOA 2OF2A 2WTDA 4S33A 3TZMA 3VS6A 4EI4A 2W1EA 5F9EA 2OF4A 2J0KA 2O8YA 3O2MA 1YWNA 2P2HA 2OWBA 4EH4A 4EH8A 5IQIA 3ZOSA 4O84A 4J52A 3IS5A 5BVNA 2PUNA 3F5PA 3KCFA 3U9NA 4K1BA 3MY0A 4AT4A 4EWQA 3GQLA 2ZM4A 3UC3A 4MXYA 4FE2A 4BJJB 2A4LA 4C3FA 1NT2A 3ZO2A 3IGOA 1YXVA 3CC6A 3LJ0A 5AUUA 4JRNA 3WBLA 2C6EA 2I1MA 5FXQA 2EXCX 2G01A 3H9FA 2BRBA 3A99A 3MDYA 4LYNA 1OZ1A 3R1NA 4MXZA 3H0ZA 2PSQA 2XB7A 2YHVA 2IVUA 4IX3A 3QQGA 4G9CA 3N4VA 3PXKA 4QDVA 1PMVA 2XK3A 3VUIA 3W1FA 4A7CA 1F0QA 3G15A 4Y46A 3SRVA 4CFNA 2G15A 1QPCA 1R0PA 3KXHA 5KZIA 4XP2A 1LEZA 3RBWA 3V01A 2ZAZA 3QQUA 2C5NA 3PXYA 3TZ9A 4IAFA 2GHLA 3MS9A 3DY7A 4YBKA 3UOKA 3P4KA 4DBNA 4XV9A 1XR1A 4FIFA 1GZOA 1TQMA 3RP9A 4NIFB 4RLLA 3OWJA 4O7YA 5M4CA 2Y4IB 4KKHA 4EUTA 3CGOA 3CEKA 2BHHA 4ANLA 4BCGA 4GFGA 3HZTA 2C4GA 2QOQA 5KZ0A 4G17A 3DQWA 4YZNA 3JS2A 1XH4A 3DBCA 2YFXA 4DEAA 3BU5A 4FF8A 3I1AA 5HU9A 3GNIB 3HAVA 4FZAB 2YWPA 5GINE 3FPQA 5DEYA 4KINA 2VTMA 2E9VA 4PY1A 4IVAA 1WAKA 1E1XA 4E20A 2GTNA 2XK7A 3HLLA 3IKAA 2XAOA 3DBQA 3VUKA 2YIYA 4EWHA 1ND4A 3PVUA 3RHXA 2DS1A 3VS1A 4C3RA 2BRGA 4U97A 4FG8A 4O0VA 5A4CA 4YLLA 2PVLA 5G1XA 4FTJA 4ZY4A 3C5UA 3AD6A 2XAMA 4EHZA 4RGJA 4EZ5A 3KF7A 4FTIA 3ORMA 4ONAA 4EH9A 3KRRA 5I4NA 3CPCA 1Q61A 3OW3A 4F0GA 3UZRA 4QMOA 1OKYA 5AIRA 4ZS4A 4JG6A 4FVQA 2YM8A 5CF8A 3BHHA 5IH4A 4C4HA 2OIDA 4R5SA 1V0BA 5EM7A 4IFGA 4DGOA 1U4DA 4E4NA 4FSQA 2IO6A 2XUUA 5HGIA 4DH3A 5LMKC 3A60A 2B9HA 5DH3A 2R3MA 4QT1A 4ZZNA 2PL0A 2X6DA 3EOCA 1OIYA 5CNNA 1IR3A 2YWVA 1PXMA 4QMQA 1WBWA 3FMKA 5CZHA 1XH6A 3TIYA 4DTKA 3ACKA 4RIYB 2G1TA 5AADA 2C3KA 1BLXA 1BKXA 2IVVA 3DK3A 1WBNA 4IM2A 5GJGA 1IASA 3W0NA 5EOLA 3VBQA 4DHZA 4C2WA 2BAJA 2JFLA 2X0OA 4NJ3A 5IQCA 2WTKB 3DDPA 4ZS0A 4BL1A 5CI7A 2ERZE 4EOPA 3MJ1A 1SYKA 4LUEA 1W7HA 4AA0A 4L7FA 2AC3A 4HGSA 3ZH8A 3O23A 2XBAA 3ROCA 1OL2A 3PXQA 4K8AA 2O0UA 3DPKA 1H1QA 5EYDA 3UQFA 4FNXA 4AXAA 3WZEA 4IZ7A 5EYMA 4MYGA 4F6SA 3RAHA 4RLKA 4KIPA 3UZPA 4USDA 2WFYA 3BLAA 3QD2B 3V5PA 3DK7A 4FC0A 2XVDA 3ODYX 4RZVA 4NZWB 4F4PA 3BL7A 2C6TA 2YJRA 4HCVA 3SA0A 5E90A 4GH2A 1YHSA 3VO3A 2C3LA 4GK3A 3OZ6A 3PPJA 4RJ8A 3HYHA 4RC3A 4BI0A 3EN6A 4LM5A 1PJKA 2C5YA 4YZCA 3U87A 4IVDA 1OKVA 4YPDA 3NRMA 3OHTA 2XJ0A 3R8MA 1YDTE 4I1ZA 4J99A 3ORTA 2UZEA 3FLNC 2NPQA 4EH7A 1PKDA 4EK5A 4BTMA 3DJ5A 4UEUA 4L6QA 3WZUA 4FSZA 4OAVB 4ALWA 2ZOQA 5CXHA 5A4TA 2H6DA 5AP0A 3HV6A 2B9IA 2C6LA 5HTBA 2VN9A 1Q8TA 2XRWA 4QPSA 5C1QB 4IAZA 5HU3A 3MGYA 3MV5A 2GNIA 1Z5MA 2OH4A 4ASXA 4YNOA 4PMTA 4X6RA 3QRKA 2IZUA 4MHAA 5HORA 4R78A 3GCVA 4UMTA 3OW4A 2V0DA 3NR9A 1JWHA 3PPZA 4FKOA 5LVLA 3VS4A 3PSDA 2PZPA 4ENYA 2A19B 2Z7QA 2VGPA 1J1BA 2YM3A 4B99A 3BV2A 4ACHA 3TDWA 4C2VA 2QG5A 3S3IA 4C36A 1YOJA 4BTKA 3LXPA 3QD0A 3R8ZA 1O6YA 3RZBA 4WNMA 1W2CA 3F3ZA 4FKTA 1L8TA 3QTQA 3QZFA 1S9IA 3D2KA 5AP5A 2BPMA 3FKNA 4NCTC 4GV1A 3VS7A 1PXJA 3W32A 3B2WA 3BLRA 3QX2A 1U46A 3LJ2A 1P5EA 4KABA 2X2LA 2P4IA 4RWLA 4O0XA 4WG4A 3SOAA 4YO4A 2IPXA 2PWLA 4ACCA 3PZEA 1XH9A 2REIA 3M2WA 2CHLA 4M0ZA 5C26A 4BYJA 3PJ1A 4CLIA 3R1QA 3EQRA 4W4YA 4A9TA 3GT8A 4IC7A 1OIUA 3FMLA 4FEWA 1PHKA 2BCJA 3KVXA 3KFAA 1YW2A 1CKJA 4IWOA 4O1OA 4KA3A 2J6MA 4YJVA 2PZYA 4NM7A 4D1SA 4YJQA 4F9BA 1IAJA 2HIWA 1ZY4A 4U40A 2G2IA 4LUDA 2VWBA 2HENA 1KV2A 4QTBA 5ETAA 3NNVA 4TYGA 4YZBA 4BCKA 5E8YA 3DFCB 3GQIA 4XOZA 1RJBA 2CNVA 3QFVA 1GAGA 3Q60A 4P5QA 4IIRA 4XX9A 4TYEA 3N51A 2X2MA 4W4XA 5FXSA 4C4EA 4C58A 3LPBA 1ZOGA 4GG5A 1WMKA 3LHJA 3GFWA 1FGKA 4LRMA 4GIHA 4YZMA 1OBGA 5E91A 4E5AX 3CPBA 4MEDA 2EB3A 4FEXA 3R1YA 1LPUA 2X2KA 4FKWA 1PW2A 1ZY5A 4GVJA 4QP2A 3ZUVA 3FJQE 5M56A 2OZAA 2ZM3A 3R6XA 4O0SA 3RWQA 4PDSA 4QEBA 3C5IA 4D9TA 4IEBA 4BCNA 2QOCA 3LQ8A 4YC3A 3TWJA 4BKZA 2HOGA 3FI4A 3R01A 3C0HA 3ENMA 4WUNA 2ITUA 3HMIA 1M7NA 3GP0A 5E8SA 4E8AA 4CFFA 4C61A 3E8NA 3LFQA 4CSVA 2OBJA 1YXSA 4FSTA 5H2UA 4JT3A 3FY2A 3Q6UA 4BIEA 1FOTA 1XJDA 3PSBA 4ITIA 5FDPA 2XF0A 3R02A 3VHKA 4BWPA 2Y7JA 1QL6A 4K33A 5KMKA 1K3AA 5FTOA 3BU6A 4JBOA 3D5WA 4M69B 4WNPA 3V8TA 3HA8A 4K18A 2ITVA 4AXCA 1SNXA 3NUSA 3SGCA 4USEA 3WI6A 2PMOX 4GU9A 4HVIA 2RKUA 4W4VA 3BHTA 2XEZA 4ZTQA 3PWYA 4L3PA 5J7HA 2WU7A 3QQFA 3MY1A 4FL2A 4O0WA 5ANJA 4L8MA 3EFKA 2PTKA 2WOUA 5HLPA 2CNUA 2Y9QA 2V62A 4B8MA 5IISA 4WRGA 4C4FA 1Q3WA 2F4JA 3T3VA 2XYUA 3WYXA 3OY1A 4WIHA 4TY1A 2GHMA 3DKGA 2UVXA 3VBYA 3FPMA 4I5PA 2E2BA 2HW7A 2ONLA 2F7XE 4ASZA 2O65A 2V7AA 3OG7A 5HIBA 1VYWA 3CTJA 3KXZA 3HV7A 1LUFA 3CS9A 4M14A 2BZHB 3CY2A 2WEVA 4RJ7A 5E8XA 5JGDA 4DCAA 2HXQA 3ZDIA 3TJDA 3LFEA 3EYHA 3MPMA 4I94A 3DK6A 2W06A 1Y91A 1OPKA 2B54A 3FMHA 4F7JA 4J71A 3TZ7A 4E6QA 3R30A 3IW7A 1ZYCA 4L3LA 5DHJA 3W0RA 3KK9A 4LOQA 5I9YA 1DI9A 3NYVA 4DF3A 2A27A 3KU2A 4NW6A 4QTAA 2W9FB 3I5NA 3NIZA 3VN9A 3L9MA 2C0OA 3IK3A 4EC9A 2WQNA 2UZTA 1GOLA 1M17A 1OPLA 3KXGA 4IM3A 5FEEA 3Q2JA 4M12A 3EFLA 4RIXB 3QUPA 4P7EA 3ETAA 2OKRA 3RTPA 4AA5A 3BQCA 2WHBA 2VTTA 1TZDA 2ZV8A 4C4GA 3JPVA 4FI1A 3O7LD 3Q4CA 2R7IA 2VU3A 1REJA 2QHNA 1GZKA 5BVKA 5LVPA 3E87A 4HJOA 3UDSA 2PVHA 3PYYA 3H9OA 4HYIA 4BHNA 5J7BA 3E92A 3LCDA 4JDKA 3RGFA 3LLAA 5CU6A 5T68A 5DPVA 3QCQA 4C02A 5A6OA 4FKIA 3FAAA 3NUPA 3PFQA 4F1OA 1ZOEA 5CANA 5CF5A 4JQ8A 4R5YA 3PA5A 4RFYA 4U80A 4F64A 4U81A 3TKUA 5A6NA 4QMTA 4BDGA 3D7ZA 3JXWA 3TUBA 3Q2MA 4TW9A 4DHIB 1H1SA 1G5SA 3F9NA 3KF4A 5CEIA 4XRJA 3DDQA 3E3PA 4P5ZA 2XNOA 4RG0A 4JAIA 4IZ5A 3W8QA 2BDJA 1OL6A 4G34A 3ORZA 1DAYA 3AMBA 3QKMA 2JAMA 5HBHA 5C01A 3VS0A 4DG0E 2RSVA 3OMVA 3ACJA 4UWCA 4M97A 2CSNA 4FKRA 5IZFA 1XH7A 4F63A 2HZ0A 4OTHA 3L8SA 2XKFA 4LMNA 2KTYA 4FG9A 2B1PA 2WMUA 5HICA 4AN2A 4BF2A 5M4IA 1WBVA 3NUXA 3NUUA 4D1ZA 4TKSA 4MCVA 5F1ZA 5F20A 1WVXA 4ANSA 4AZTA 2GPHA 1R1WA 3QGWA 3LFNA 5IH6A 4S2ZA 4HCUA 3CCNA 4EOJA 1BL7A 4IAIA 2W05A 3ML1A 4XOYA 2A98A 3PXZA 3MB6A 3O8PA 4GVAA 4D2WA 3MESA 4JBQA 4RIWA 4WNKA 4NWMA 4D0WA 4EQUA 4PMPA 5J9LA 2JIVA 3VS5A 1JQHA 1OL7A 2P33A 3R63A 5AP7A 2OSCA 1LR4A 4FIIA 2F7ZE 2OXXA 4KKGA 1MRUA 4PDPA 3NW7A 4ANQA 4QTEA 1Q4LA 4NYEA 4EBVA 1YHVA 3W0PA 2Z7SA 5BVFA 2XK8A 3ORPA 1XHAA 5CU0A 1OUKA 3HDMA 3IOKA 4FV2A 4I5CA 3GC0A 5BUJA 1JKKA 4FL1A 2UZDA 2B53A 5CQUA 4FBXA 3TV6A 5IEVA 4XEYA 4GCJA 5HTIA 2OZOA 5IF1A 3QZIA 3WF9A 4I0TA 2I0VA 4A9SA 4ZSEA 3CQWA 4ZSJA 4F7SA 3FZOA 4BFMA 5GIPE 3DJ7A 4QP1A 3ZONA 3QA0A 4FYOA 4YO6A 4RX7A 2C47A 2I0HA 3KRLA 4YNEA 3FKLA 4TT7A 4DH7A 1FVVA 3AKLA 5LCJA 4WNOA 1EH4A 3OT8A 1KE6A 2VTRA 3DBDA 5CTPA 4CG9A 4JIAA 4Y83A 5ETIA 2R7BA 3C1XA 2GFCA 3CKXA 2CGVA 3MVMA 3GU4A 3KEXA 2F57A 1YI3A 3EQPA 4AE9A 5KX8A 4MNEB 4BZNA 2J4ZA 2W9ZB 2XK4A 2YJSA 3CBLA 3A7GA 4PWNA 4PP9A 2C5XA 2YABA 3PY1A 4RQKA 2YDIA 4R7IA 5BVEA 4V05A 4Y72A 5IEYA 2Z7RA 2OICA 4N6YA 4QP6A 2R9SA 4W4WA 5BUIA 4U5JA 5JFSA 2BROA 2J50A 3D94A 4XP3A 4MBJA 4YJUA 3FLWA 3GU7A 4BDJA 3ULZA 5FTGA 4AU8A 3QLGA 3MB7A 4BIDA 4X2FA 5EHYA 1SMHA 3EJ1A 3SW4A 2VO7A 4RC2A 3R9OA 3W2QA 4X3FB 3LFAA 4U79A 2NP8A 4M3QA 3EWHA 4Q2AA 2FGIA 3FY0A 4XG2A 4XV1A 4FNZA 4UMRA 4TYHB 5L2IA 3V04A 2JAVA 4O21A 4RA5A 5K5NA 3E8CA 2R64A 4FTRA 3CLYA 3NLBA 4G6NA 4QMLA 2Z8CA 4XHKB 3CD3A 4DGMA 3KL8A 3OVVA 3UODA 4CYIA 3LOKA 1J7LA 3OP5A 2XNBA 4IVCA 3R7GA 4JX7A 2PZIA 5DVRA 3FXWA 1WBPA 4FV5A 3LCKA 4RJ6A 3V5WA 3RM6A 2X39A 3DAEA 4E26A 4U0IA 3V8WA 4DG2E 2GQRA 4D1XA 1Q8YA 2WTCA 4ARKA 3FHRA 3FXXA 4XCUA 4BDCA 3AC8A 2VD5A 3AC5A 2C6KA 1M7QA 1OGYA 3D7TB 4XH6A 4LV5A 3RHKA 2CGWA 2EUFB 3QTSA 5BV3A 1DS5A 1YDRE 4N4SA 4B0GA 4XYFA 2LAVA 2PE1A 1P4OA 4U43A 2CDZA 4WG3A 3QZHA 4OLIA 4D28A 3C0IA 4O86A 3C0GA 4E5BA 1CMKE 2VWXA 2ZV2A 5ANIA 5JN2A 2BIYA 5EH0A 2W1HA 4JLCA 3UNKA 4R8QA 1OIRA 4AGDA 4OBQA 5JQ5A 3A4PA 5CF4A 3L8XA 2IZSA 3P1AA 3HX4A 3PJCA 4DLJA 3K2LA 5EM8A 5AM6A 2QHMA 3TJCA 3RK7A 5CEOA 4BVUA 3BCEA 5A14A 4IACA 4OTRA 4RVMA 2OJ9A 3HP2A 4CRSA 4OBPA 1LEWA 1AQ1A 2YM4A 3UE4A 5HQ0A 2R3OA 3OTVA 4O4BB 4LGHA 3TDVA 1Z57A 3COMA 5C8NA 2I7QA 1NVSA 2GMXA 2IVTA 5FP5A 4EC8A 2XKDA 4BDDA 1ZLTA 3HUBA 4IVBA 4DDIA 1JSVA 5KE0A 3PLAE 2QOFA 4ASEA 3VQUA 3IDBA 4OTFA 4D0XA 4C38A 3BRBA 3PPKA 3D15A 3FYKX 4Q9SA 1URWA 3G9LX 5ACKA 1J7IA 1H27A 1BUHA 5IEXA 2GS7A 2R3QA 2WMSA 1YOLA 5FGKA 4KUJA 5K0XA 2XM8A 2CNQA 1UA2A 3DB8A 3VF8A 2XH5A 3MW1A 4AZWA 4N70A 5EDRA 3VAPA 1O6LA 3OBGA 5IDPA 2QLUA 4JDJA 2A1AB 3DXNA 1Q8WA 4JR3A 4KBCA 3MTLA 3UJGA 3UDTA 1ZZLA 2QCSA 2ZMDA 4RT7A 3QRUA 1QCFA 5CVGA 5C8MA 4ZLYA 4J8MA 1UKHA 5J5TA 3VNTA 3LE6A 5CS6A 4YMJA 4I23A 2RG5A 3DXPA 4FT5A 4HW7A 2W96B 5IA0A 5ANOA 3U4WA 4ALVA 1Q3DA 2YCFA 3H3CA 4BYIA 5LWNA 1PY5A 2RGPA 4L67A 5L2QA 1WVWA 2BTRA 3I7CA 5CSHA 4IX5A 5J9ZA 3R21A 4FZDB 5CSPA 1ST4A 1DAWA 2UZOA 2YN8A 3HV4A 4QQ5A 4EYJA 4LDTA 4DFNA 3C4WA 5D1JA 2OGVA 2W4KA 5HE2A 3BLQA 1PMNA 1ZOHA 5E1EA 1Q41A 3WIKA 3HMOA 3E5AA 3QD4A 3G0FA 4DAWA 5AP3A 5DMZA 2W99B 5JK3A 1W82A 3V6SA 5AA9A 2BDWA 4ZLOA 4L01A 3UMWA 3F61A 3MA6A 3ZSHA 1OKZA 3B2TA 4K9YA 2GTMA 3S1HA 3EYGA 4HPUE 4EK3A 3ERKA 5GNKA 3W33A 2ACXA 5HE3A 5DFPA 2QKRA 5I0BA 5AFVA 4RX8A 1UKIA 3Q5IA 4BN1A 4YTFA 4ZTLA 1SZMA 5D10A 4BCHA 1OBDA 3PA3A 2Z02A 2XIZA 5AX3A 4DFLA 2G2FA 3DNDA 4D2VA 2BIKB 4FZ6A 1E1VA 2WIPA 3G6HA 4MVFA 2R2PA 4F9YA 5JH6A 3AKJA 3NMUF 3HV3A 3CR0A 5AP2A 3RCDA 2PYWA 2OJGA 4B4LA 3O51A 4BICA 4BWKA 3QTIA 4GJ2A 3ENHA 5AUYA 4BCMA 4I93A 2XIYA 3TNQB 4UXLA 2QVSE 1J91A 4EZ3A 3ZHPC 3KRWA 3HUCA 4YHTA 2QC6A 1ZARA 2VTSA 2Y6MA 4NT4A 2C69A 1LP4A 4FKJA 4KSQA 4Q5EA 4ACDA 4EUUA 3W0SA 4IM0A 3SV0A 4H1JA 5LWMA 3FI8A 4GSBA 1S9JA 2GQGA 4ANNA 4Y5HA 3OWLA 2YA9A 4FT0A 5LVNA 1G8KA 3KREA 4MF1A 3R8LA 4A4LA 2XRUA 5IA1A 5KHXA 5CSWA 4HZRA 2WD1A 3LQ5A 3R7YA 4D4YA 3UIXA 2WU6A 2YITA 3BELA 5HLWA 4A9UA 4G3GA 4IFCA 3MIAA 3S4QA 4QMXA 2OO8X 3WF6A 2JIIA 5L6WL 4IC8A 3ZBXA 4A9YA 3QUEA 4TXCA 4F78A 3CD8A 4QMMA 1G8SA 5LMKA 5IQEA 4YSMA 3IW5A 3R7EA 2PVFA 1MQBA 3RAIA 4H3QA 4WD5A 5TE0A 2KULA 3NUYA 4QNYA 4W8DA 5CT7A 3UC4A 3OS3A 2LGCA 3AT4A 3T8OA 3UIMA 1Z9XA 4I3ZA 4J98A 4MUQA 5I9WA 4YURA 2UW9A 3NNWA 2IZTA 5K3YA 2IG7A 5DBXA 3FLYA 3KIOC 5DLSA 2XJ2A 2YDKA 3LZBA 2GNGA 3AGMA 3QWKA 4JXFA 4E6AA 4GT5A 2H8HA 3D5VA 3P08A 2ZFYA 3QHRA 4AN9A 3BBTB 3GU8A 3MI9A 4YUQA 2DWBA 4EKLA 4MD9E 2PY3A 4ZSAA 2B52A 2W1CA 3NPCA 5L8KA 2B7AA 2WAJA 3LJ1A 4YLKA 4ERKA 3D14A 4MXOA 4JRVA 3Q96A 4NM3A 1JOWB 2BZIB 4XLIA 4K2RA 2IW9A 4X2JA 2JDVA 2NO3A 2XZSA 3CE3A 4O0RA 3G33A 4BJJA 4CG8A 1V0PA 2YCSA 2HAKA 2I0EA 1GY3A 3BEAA 4GFOA 4L53A 1KE5A 5EM6A 4A06A 4BBEA 5M06A 3GC7A 4LL0A 3P0MA 5HG9A 2VO6A 2IJMA 4FODA 3E62A 4H3BA 4YZ9A 2FSOX 3RPVA 2B9JA 1OMWA 5B2LA 2JLDA 4M8TA 4L46A 2RFNA 4O7TA 3A8XA 3LFCA 5ETCA 3WF5A 2EVAA 3BHYA 5TR6A 4RZWA 3EHAA 4AW1A 4CEGA 4JG8A 3OXZA 4EK6A 3EQCA 3NS9A 5LVOA 3F6XA 4LV7A 2BKZA 3EZRA 2QNJA 3KXMA 3BE2A 3PIZA 5AR5A 3ZYAA 2JKKA 5EDQA 2H9VA 4R7BA 1PXPA 3I6WA 1IAHA 2X8DA 4QOXA 4QYFA 2VWWA 3EIDA 5J87A 4IB1A 4PTCA 1APME 4GEOA 4AZEA 4QP4A 1H28A 3RALA 3R22A 1W2DA 3DGKA 4RRVA 1H1RA 4EH5A 5BNJA 2CKOA 3QX4A 3A4OX 3PFYA 1SVEA 4AW5A 2IVSA 2ONLC 3AD5A 5JQ8A 2FO0A 3F7WA 4FTOA 4TNDA 3UVPA 3NGAA 4F0FA 5IUGA 3ORIA 2WEIA 4EOIA 2R3FA 3QU0A 3KK8A 2ETRA 4YHJA 4DGLC 3OCTA 1BI8A 3FXZA 4X7QA 2Y0AA 2R3HA 5AM7A 4BCFA 3CQEA 3NDMA 4RSSA 4OGRA 3ZLYA 2YZAA 4G2FA 4A4OA 2UZNA 4YZDA 3NSZA 4IWQA 4D2SA 5F4NA 4DFZE 4CLJA 4DBXA 3AC2A 3TT0A 3FZPA 1X8BA 2FVDA 3FL4A 3V5TA 5FTQA 3CIKA 5CU3A 4DEIA 5HZNA 3P7CA 4XG3A 2WZJA 1Q99A 4PL4A 4BKJA 3R9DA 5DG5A 2QR8A 3A7JA 3TV4A 4BDAA 1VYZA 5F95A 3FZTA 4RX9A 2J5EA 5KHWA 3V5JA 2Z2WA 3PRFA 4G1WA 4HCTA 3MFTA 3QQLA 4XUFA 3SX9A 4AZSA 4GK4A 3TL8A 3QL8A 4JBVA 3F2RA 4DFBA 4ZSGA 1FMOE 3PIYA 2X7OA 3GI3A 2PUUA 3QC4A 3SDJA 1UU7A 1GNGA 2C3IB 2QOOA 3OWPA 5J95A 4FA2A 1H0VA 1KOAA 3EN9A 5A3XA 3ZM4A 2ZV9A 4R3RA 3KMWA 4O1PA 1ZYSA 2JDTA 3R1SA 3I79A 2CKPA 1CSNA 5C27A 4DE4A 2FB8A 3U8WA 3C4CA 1BI7A 3COKA 2UZVA 1W8CA 3S0OA 3TTJA 3FV8A 4DEDA 1K9AA 4YC6A 3LXLA 5IUIA 4KRDA 1VR2A 3U9CA 1TVOA 3QTRA 4P4CA 4BCIA 1PXNA 4X0MA 4C3PA 1BMKA 4DEGA 3KCKA 2ITWA 2XNMA 3BGPA 3LFFA 3LLTA 3PTGA 4G3FA 2CGUA 4DC2A 3DFAA 5HG7A 4UBAA 2HXLA 5TF9A 2PULA 2RIOA 3LAUA 4FL3A 4BBFA 5BMSA 4DITA 3FZRA 5CSVA 3R9RA 3P78A 3E8DA 2QD9A 2BHEA 2XNNA 2VWUA 3K5VA 2C68A 2VO3A 2VWVA 3Q6WA 4WBOA 4FV0A 3H9RA 3CY3A 3I7BA 1NA7A 5FM3A 3QCYA 1ZWSA 3NCGA 4XNEA 4B9DA 5AA8A 3BPRA 4IW0A 5ACBC 4L44A 4CFUA 3QKLA 4EYMA 3DA6A 3VJNA 4FV9A 3COIA 5AUWA 3RNYA 2GFSA 5IDNA 3LM5A 3PLSA 4AGUA 5CX9A 5KMNA 2YISA 3VVHA 3DOGA 2YCQA 5BX0A 2A0CX 2BAQA 4L3JA 4PQNA 4I6HA 3QAME 5HO8A 1VEBA 2JBPA 3A7IA 5CF6A 4EK8A 4N0SA 1URCA 4K77A 5HESA