2PVKA

Structure-based design of pyrazolo[1,5-a][1,3,5]triazine derivatives as potent inhibitors of protein kinase ck2
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
328
structure length
327
Chain Sequence
MSKARVYADVNVLRPKEYWDYEALTVQWGEQDDYEVVRKVGRGKYSEVFEGINVNNNEKCIIKILKPVKKKKIKREIKILQNLGGPNIVKLLDIVRDQHSKTPSLIFEYVNNTDFKVLYPTLTDYDIRYYIYELLKALDYCHSQGIMHRDVKPHNVMIDHELRKLRLIDWGLAEFYHPGKEYNVRVASRYFKGPELLVDLQDYDYSLDMWSLGCMFAGMIFRKEPFFYGHDNHDQLVKIAKVLGTDGLNAYLNKYRIELDPQLEALVGRHSRKPWLKFMNADNQHLVSPEAIDFLDKLLRYDHQERLTALEAMTHPYFQQVRAAENS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure-based design, synthesis, and study of pyrazolo[1,5-a][1,3,5]triazine derivatives as potent inhibitors of protein kinase CK2.
pubmed doi rcsb
source organism Zea mays
molecule tags Transferase
molecule keywords Casein kinase II subunit alpha
total genus 114
structure length 327
sequence length 328
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2007-05-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2pvkA01
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2pvkA02
2OJFE 4ENYA 5HQ0A 4O6LA 5KCVA 1ZMWA 5GZAA 4O6EA 3DAEA 3DBEA 3DGKA 3GU4A 3VJNA 4APPA 1FGKA 4QTEA 3KGAA 3FY0A 2G2HA 4DFLA 4RWJA 4D1ZA 5LARA 4GT4A 3QFVA 1FPUA 2YIYA 3C4FA 3TJDA 4LUDA 3W2PA 4C3PA 4USFA 4IFGA 5EQYA 4BCJA 1WBPA 2BKKA 2YITA 4O0RA 3CXWA 3WZUA 1R78A 3MIYA 3GC0A 5IF1A 3PIZA 3PRIA 4DGMA 4KBCA 1ZOHA 2B7AA 3PYYA 4QMMA 4EZ7A 5GIOE 5HKMA 4ZMFA 3PPZA 1DI9A 4D4RA 1Z9XA 2PZYA 2VTPA 4BDAA 2XIKA 2CKPA 2UVYA 4GFMA 3COMA 2XVDA 3LXPA 2OGVA 5IQGA 2FH9A 2ZB0A 3RHKA 2QD9A 5KMLA 1PXIA 5AAFA 4RFYA 4LOPA 4WA9A 3W33A 4AN2A 4C38A 4CFUA 4QPSA 2BFXA 3TTIA 1ZYSA 3KCKA 1YHWA 3OCGA 4KRDA 3Q60A 5C8NA 4MNEB 3RP9A 3UNZA 2PVHA 1XR1A 3SG9A 2OIBA 2PE2A 4OTFA 3SOAA 4AAAA 1OZ1A 2B9JA 2YWPA 4WUAA 5BX0A 3R7EA 4F9AA 3TKHA 4FV2A 5LCJA 3W2QA 2R3JA 3SKCA 4BCKA 3G5DA 3LXLA 3MW1A 3GVUA 1O6YA 4XYFA 4CZTA 2CCHA 2ITTA 3AD6A 4RT7A 4BBMA 4J8NA 5HESA 2DQ7X 1OIQA 2W9FB 4IWOA 4C37A 3HUCA 3R21A 4C4FA 4L3PA 3ETAA 2VWUA 3VW6A 4NUSA 4YZDA 4U41A 3RMFA 2HW7A 5IQEA 4M12A 1DAWA 3QX4A 4JQ7A 2HY0A 5K4JA 4RIYB 3CJFA 4EH3A 3UE4A 3TI1A 3TZ7A 2JDRA 3VVHA 4EOPA 4QP4A 3R8LA 2UZOA 5CSXA 3QC4A 3SX9A 2BMCA 2QO2A 3W2OA 1QPEA 4PDSA 4G3CA 4KD1A 4PMTA 1GY3A 4LFIA 4CV9A 1OL7A 4HYSA 2PE1A 1DI8A 4LOQA 2RFDA 3K54A 4ZSEA 5JFXA 1ZYLA 3IO7A 3QAME 3H0ZA 3QUPA 2IVVA 2X2KA 3MFUA 1W84A 3RZBA 5EDRA 4IADA 3R73A 5M57A 3P7AA 4I6QA 3DBCA 4HGEA 3UIUA 2WMSA 4UB7A 3VQUA 4E20A 3PXYA 2XP2A 3AMYA 3QHWA 4PL4A 4ANMA 4CCUA 5BVKA 3DXNA 5LMKA 4CRSA 5FTOA 2WTWA 3I0OA 3LPBA 4IX6A 2B53A 4MAOA 3TIZA 3OT8A 1IR3A 2IZUA 4GUEA 5H8GA 3HNGA 4GG5A 4RJ7A 3UQGA 4BTJA 2R3HA 1MQ4A 1PXLA 3SAYA 2XMYA 1ZMUA 5J5TA 1WAKA 4ZY6A 4ZS4A 1MRYA 3OHTA 4AA0A 4FIIA 3L8XA 4AXAA 2HXLA 4YP8A 3G51A 3OVVA 3Q4TA 2UZDA 4HCVA 3I1AA 4JL9A 3W10A 2HXQA 2J0LA 2C0OA 4OTWA 4EK6A 4I5HA 5HCYA 2HW6A 2UW8A 3R7GA 3SGCA 5AR4A 5AR8A 5HCZA 2YCFA 4C34A 5IQDA 4EEVA 5KBRA 4BC6A 4AGDA 1A06A 3RM7A 2Y0AA 4ZTRA 2OO8X 1NVRA 2R0UA 2VAGA 4X3JA 2XBJA 2XIYA 4XNEA 4C33A 4X7QA 5HO6A 3RM6A 1ZZLA 2BZKB 3HP5A 2YIRA 2J6MA 1JBPE 3L9PA 4NTSA 4YHFA 3NEWA 5LVNA 4EH7A 1GNGA 3TIYA 3FLYA 5EK7A 3FI8A 3T9IA 3VBYA 5KX8A 4QOXA 4GJ3A 3ZDUA 4EZ5A 5DR6A 2J0KA 2Z8CA 3E87A 3IG7A 4R8QA 4RX9A 4V01A 5ACKA 4AUAA 4O84A 2R3OA 4P5ZA 2VTIA 2XNMA 5I9YA 5E1EA 4L45A 3V5QA 1UU9A 1SVEA 3QGWA 4WKQA 3NAXA 3MVHA 2C1AA 1IASA 4L8MA 2E2BA 5L2TA 4MD7E 3G0FA 5AIRA 5F1ZA 5IISA 4YJTA 1PXOA 5AUYA 3GUBA 4CFNA 4YGAA 4N57A 1Q97A 3QRKA 3CBLA 3E8NA 2J90A 3NWWA 5AV1A 5FTQA 3R7IA 4CFMA 4LMUA 5CALA 5L3AA 2I7QA 1Y91A 4GH2A 3BWFA 4RWIA 3ZDIA 3FXWA 4Y5HA 3WYYA 4OGRA 5J9LA 4E5BA 3GI3A 1G8AA 1Q3WA 2J7TA 3RCJA 4FKRA 4YU2A 5D7AA 3AC8A 3CQWA 4HYUA 4TWNA 1RQQA 2WD1A 3KMWA 2UW0A 3FQEA 2C0TA 4KB8A 4FVRA 3PG3A 4NT4A 5FUTA 4C36A 3EFKA 4OTQA 5FDXA 3FKLA 4FTIA 3BGPA 4FODA 2WTDA 4ITJA 3OZ6A 4CV8A 4DH5A 4FVQA 4FNXA 4FIEA 2BR1A 5AUZA 4EWQA 2BTRA 3UP2A 4FTTA 2RSVA 3FDNA 4JAIA 4I5CA 2OFVA 3QZFA 3ZLSA 5A6NA 2QOLA 5J5SA 4EJNA 4Y46A 2ZMDA 5M51A 2VWVA 3SW7A 4A4LA 3ZLWA 2GDOA 3QHRA 3K3IA 2KTYA 4GW8A 4FL1A 2OXYA 4FKUA 1ZY4A 3PY1A 2GFSA 4K0YA 2PMOX 3KRJA 4JX7A 2OWBA 4YTCA 1SYKA 1V1KA 2R3FA 5B0XA 2JIVA 4XRLA 4D1XA 2UW6A 3ZFMA 3C4CA 5E8XA 4PTGA 3A7JA 1OIRA 3LFEA 5BVEA 1VEBA 2Q0BA 4MQ1A 5AA8A 2BDWA 4QMPA 1F0QA 3QC9A 4BHZA 3QRJA 3U4UA 2XKDA 4K2RA 5IA5A 4ZJVA 5F4NA 3QZIA 5C27A 3UBDA 2EVAA 3ATTA 3SG8A 3HEGA 5IU2A 1TQPA 2IVUA 3N4VA 4NM7A 5D12A 1K9AA 5A4CA 3MVJA 1IA9A 5GNKA 1CTPE 2G1TA 2JITA 2QU6A 2IZSA 5EYCA 3FAAA 1V0BA 3CY3A 4JG7A 3B8RA 4JBVA 4J96A 3QU0A 4CD0A 2Z7LA 4MBIA 4GVJA 4CKIA 4H3BA 3O0GA 3KF7A 2GMXA 5IMXA 4I41A 2BAJA 3ZH8A 3KXMA 3EKNA 3G9NA 5IA0A 4PTEA 3KREA 3E88A 2XYNA 3EN5A 2IVSA 1R1WA 3RNYA 4NIFB 4BDGA 2GTNA 3C4EA 3KRLA 4UYAA 2H8HA 5DRDA 2C0IA 2VGPA 4H36A 3KK9A 3FQSA 4H3PA 2WHBA 3N4TA 4KINA 4RJ3A 1JKLA 3IDCA 2KULA 4QNAA 4YMJA 3KVXA 4FF8A 3VUDA 4X2JA 2BRBA 4PDYA 1OGUA 3TL8A 5HTCA 1CKPA 3KULA 3OOMA 1ZARA 4Y73A 3VF8A 3KXGA 4X2KA 4AX8A 3A7GA 2ZM1A 2PK9A 3AC4A 5CEPA 5M4IA 2WIPA 5CXHA 2FSMX 3MVLA 3D7TA 2AC5A 5AP6A 4GYIA 5F95A 2XK4A 5IUGA 3EKKA 3HDNA 2CN8A 5FXSA 1Y57A 2C3IB 1GZKA 3FHRA 4RQKA 2GQGA 3BGZA 2HZ4A 3PP0A 3FKNA 3FI4A 1YWNA 1YXUA 1O6LA 2JGZA 4H1JA 3O2MA 4PRJA 5HG7A 4I0TA 5LWNA 3TUDA 2QU5A 4N6ZA 4I1ZA 4M69A 2BAKA 1YKRA 2XRUA 1LEZA 2C1BA 2F9GA 3MPTA 1P2AA 3SQQA 4BRXA 3R9DA 3FI3A 3EYHA 4AS0A 2R0IA 4KS7A 4CQEA 3RALA 1XQZA 3GENA 5CEIA 2E9PA 4QD6A 4O7WA 2WKMA 2JKMA 2QLUA 1ERKA 5A9UA 2Y6MA 3F5UA 2JBOA 4UWBA 3VO3A 2WMBA 4DN5A 4S2ZA 3CD8A 4ONAA 3KU2A 4D2PA 3EZVA 3BE9A 3C0GA 3EB0A 1YDSE 3I6UA 3QKMA 3D2KA 5DA3A 4YUQA 2ZMCA 3DK6A 4FK3A 4O86A 2VWBA 3OROA 3PSDA 3GXLA 3OW3A 4IXPA 1KSWA 2QOKA 4FKWA 4FZ7A 1CMKE 4BGQA 1UNGA 5AV2A 1A48A 4IH8A 5F20A 2FO0A 5LVMA 3OWJA 1V0OA 4AW5A 3QRUA 2UW9A 3LOKA 5CSHA 2VTRA 2P3GX 4FIFA 3TKIA 3PZHA 4ZSLA 4FA2A 4H05A 4R3PA 2P2HA 2C6MA 4DEGA 2YN8A 3LQ5A 4G2FA 5C1QB 5FD2A 5LVLA 3QTUA 5DIAA 3DFCB 2JAMA 4RGJA 2Q83A 5L8LA 3TV7A 3LCDA 4YZ9A 3O50A 5F94A 5M4FA 5LXMA 3E7VA 4XX9A 3VRZA 4E1ZA 5AX9A 4U0IA 3JR1A 2G2IA 4QMSA 4ZTLA 1H1PA 5ANEA 4FKLA 3VBTA 4M97A 5JH6A 3IW8A 4J1RA 3LMIA 4BDJA 3ERKA 4RX8A 4D5HA 4YJSA 4HZRA 4KKEA 5HU3A 3NR9A 3MFTA 4E5WA 4IE9A 1Y6AA 4BI1A 5TE0A 3CSVA 1H27A 3KCFA 5DE2A 4NEUA 1UU3A 5AMNA 2Y4IB 3T3VA 1JWHA 4FX3A 5A4EA 4BDFA 4FSTA 4WOVA 2BKZA 4A4XA 2C68A 5AUUA 2E9UA 4WBOA 2ZDTA 4ACDA 4IAAA 1M14A 3FI2A 3GEQA 3UO6A 2UW4A 5EM6A 4G6LA 3LFBA 4GVAA 4I93A 1BX6A 4GKHA 3A7FA 4BDCA 1BKXA 4AFJA 2XNNA 4FK6A 4F7NA 2QO9A 3LXNA 4XRJA 2J0MB 3ELJA 2WMWA 4OAVB 3FMMA 3A2CA 1REJA 3MY1A 4RC2A 4W4YA 5I9ZA 4GIHA 4RIYA 1K3AA 3V01A 5AUWA 3UOHA 4D58A 2JKKA 3RTPA 2GQRA 3VJOA 4RRVA 2QURA 3QRIA 4W9XA 2QQ7A 3F82A 3FV8A 2X4FA 2YLFA 4IAIA 4ASXA 4BBFA 3MPMA 2OF2A 1ZMVA 4I6FA 2ITZA 1SVHA 3NYNA 5J7BA 1J3HA 5EKOA 4FSYA 4AOTA 3PE2A 3KRWA 3HA6A 3VHKA 5CU2A 4C7TA 4DINA 4UX9A 5EG3A 4AZWA 3KN5A 4AZTA 4CTCA 3KRXA 2C6KA 2F7XE 4KRCA 4QP3A 5HE2A 3R7UA 4DFXE 5I3OA 2O65A 2V55A 4FKGA 2WTVA 4JT3A 4RPVA 4GIIA 4U44A 4TXCA 4AN3A 3LCTA 5CASA 1NA7A 2ETMA 4BCGA 3RPSA 4OLIA 3F5XA 5IQFA 2BROA 1ATPE 2VTOA 3ID6C 3QWKA 3FUPA 4BZOA 5LQFA 2OBJA 2ITQA 3N51A 3UNJA 4U79A 4I20A 4FYOA 3QKLA 2V7OA 4TYHB 1Z5MA 3OWPA 4ACGA 5JGDA 4G34A 4O21A 1PRYA 5EW3A 5C4LA 4I23A 3R7VA 3HKOA 2VTLA 3F3WA 2Y8OA 3FPMA 2EWAA 5AP1A 4USDA 4DFYA 4DYMA 4E73A 5BNJA 5DYJA 3ZBFA 2XM8A 1OECA 1YWVA 3OP5A 3LJ1A 2X7OA 4G31A 1SNUA 1XH5A 3EQFA 3HRFA 3KQ7A 5DH3A 2YM8A 4AE6A 2QOHA 4FKQA 5A6OA 3WYXA 2IW6A 4KSPA 5C4KA 4M68A 4V04A 4FTJA 5FP5A 4WG3A 4G16A 3BU6A 2CLQA 2XJ2A 2XEZA 4JR3A 4CMUA 2BHEA 3ENMA 2RFNA 3OTUA 3OTVA 1H24A 3OWKA 4YLLA 3ZRLA 2CMWA 2A4LA 4GK4A 2OZOA 4UMRA 3N4UA 1OITA 5JRQA 2JDOA 3ZEPA 4FOCA 1LPUA 3ORZA 2FUMA 3ZTXA 3C4XA 2X6DA 3HV6A 1SZMA 1CKJA 5AP0A 5H8EA 3SA0A 4F65A 3C0HA 3ORTA 3V5WA 3IGOA 4AGCA 2BTSA 4DTKA 1OPKA 4GS6A 3H9RA 4AOJA 4OTDA 4GK3A 4DITA 3IS5A 4EYMA 4IM2A 5KBQA 5CT7A 4F64A 1MQBA 4FKPA 1V0PA 2PTKA 3NYXA 3CD3A 5HVJA 1H08A 1UNLA 3REPA 4F0FA 4OUCA 4K11A 2AYPA 1U5QA 3BYSA 3KXNA 1W83A 5FXRA 1FOTA 2XNPA 3BYUA 2ESMA 4IVAA 4EKLA 3O51A 4FG7A 2RG6A 2J4ZA 3K5VA 4OBQA 3GQLA 4IAYA 3U87A 3GOPA 2JBPA 3SV0A 3EYGA 3SD0A 2VNYA 4FR4A 4OBPA 4IJ9A 3K3JA 1Q99A 4KIPA 5EQPA 2FSOX 2OJ9A 3ACKA 2EU9A 4EL9A 3ORNA 1PYXA 2W05A 1H28A 4CT2A 4MH7A 5I9XA 5HD7A 4C2WA 5JQ5A 4YBJA 3D5XA 5DN3A 2RGPA 3ACJA 5LCKA 1UKIA 3WE8A 4DH1A 5J9ZA 3MA3A 2HY81 5EM7A 2E9NA 4G9RA 3EZRA 3UOJA 2CN5A 4RJ5A 4MEDA 3E8CA 3LAUA 4XP3A 5ETIA 4O83A 2PVRA 3VF9A 4PF4A 4ASEA 2PPQA 4CFXA 4EQUA 4KSQA 4R77A 5B2LA 2XKFA 3DK7A 4NCTC 5AADA 2GQSA 2YIQA 2Z02A 1NW1A 4CZUA 4EH8A 4JG8A 3BLRA 5CQWA 4CZYB 1JSUA 2O0UA 3TWJA 2R3MA 5J1VA 4XEYA 4C4EA 2X8IA 4ALWA 4PUZA 4P4CA 2CSNA 3FYJX 5T3QA 5HBHA 1XO2B 1O9UA 1Q5KA 4HOKA 3GP0A 3P23A 3QA8A 5KMIA 5G6VA 4EUUA 2YWVA 2GS6A 1F5QA 2O63A 4F6SA 3TDWA 4E4XA 1JKTA 3MIAA 3F5GA 4IDVA 2OJGA 4KAOA 4YZNA 3RAIA 4PDPA 1PMUA 5L2SA 3QZHA 1OKVA 3FSKA 2YM5A 4FTLA 3IW6A 4FKTA 4ANSA 4X3FB 4C61A 2ONLC 3QA0A 2BIKB 4LGGA 4YTFA 3RNIA 3W2SA 1B38A 2W4KA 2FGIA 3NCGA 3ORPA 3QD2B 4I3ZA 4J52A 4NH1A 3G0EA 3VULA 4R1YA 4FL2A 3QQGA 4YLKA 3RHXA 4TWPA 4K9YA 4AT3A 4IIRA 2XNGA 4IX5A 2B9HA 3FZOA 2A19B 5K9IA 2X2MA 4PMMA 2J0IA 4K77A 4RFMA 3CJGA 3BPRA 3L8VA 4RVKA 4IJPA 4QP7A 1HCLA 3FMEA 2HIWA 3TG1A 4LOOA 1U46A 4E93A 2YIWA 4TZRA 2OXDA 3ZM9A 2VTQA 2WMXA 5CS6A 4ZY5A 2OI4X 5DHJA 5KMNA 1H0WA 4JQEA 3VUKA 3IONA 2A0CX 1OPJA 1H25A 2CKEA 1YXTA 4NYEA 4XP0A 4J8MA 5CZIA 4IZ5A 4IACA 5KZ0A 5DT3A 4AZSA 1JPAA 2QCSA 4W4VA 5EHYA 5K5XA 1URCA 3W55A 3RK7A 4M67A 5BUEA 3BKBA 3QQKA 3VS6A 5JMSA 1BYGA 3G9LX 4FBXA 4JJRA 4U3YA 3VUTA 4KIKA 5LMAA 4FV9A 5CU3A 2ZAZA 3NPCA 4OBOA 3WILA 3LW0A 2P33A 4UWCA 4FT7A 3LKMA 3SXRA 3R9RA 2W99B 1H07A 2WIHA 3LVPA 3JXWA 4FSQA 5HNGA 3UVRA 2CJMA 3BEGA 1R39A 3BQCA 3ZBXA 3VHEA 3E93A 4AW0A 2PUNA 2Y9QA 1VZOA 4NW6A 1W8CA 4RVTA 3Q4CA 3PJ1A 2ITOA 2VUWA 3QD4A 4E4NA 2C5NA 2WMQA 1VYZA 1XKKA 3L8PA 4KKGA 5HORA 3EQPA 4IM3A 1PMVA 2YAAA 3TM0A 3QCQA 2QOOA 3QQLA 3B2WA 4RX5A 3OEZA 4EYJA 4F7JA 2GNFA 4M69B 2UW7A 1CDKA 2HCKA 2IW9A 3R8VA 1YQJA 4F09A 3RWQA 3QTZA 1OL2A 4QP9A 2FVDA 5CEQA 3R9OA 4LYNA 3R01A 4FTRA 1T46A 3R1SA 4O91A 3T8OA 2HELA 3R1NA 3WF9A 2PVMA 3I60A 4L68A 4O7ZA 3MH0A 2PULA 2WGJA 4FG9A 3FLQA 5JEBA 2YABA 5J7HA 3WZEA 4JR7A 4RA5A 2V62A 1PF8A 3C7QA 2ZM4A 4YZBA 4P90A 3IW7A 3FMKA 4EOQA 4YJOA 3JS2A 2VTNA 4RVLA 4Z16A 4XLIA 3LCOA 4AA5A 1KOAA 2B9IA 2ZOQA 3EQCA 2J50A 3KVWA 5M06A 4MBLA 2FSLX 3Q9XA 4L52A 4YJNA 1H00A 2HENA 3GT8A 3IECA 5EI2A 2BDJA 3PDTA 5H2UA 2HYYA 4E6AA 3OBJA 1H1SA 2W1EA 2Z2WA 4FKSA 4J99A 2VWXA 3WBLA 2H96A 2YISA 3PXZA 3PVUA 3U6HA 2BPMA 1I09A 3ANRA 1Q62A 3EH9A 4JOAA 2VZ6A 4YZMA 4R1VA 2O5KA 4ZP5A 4PL5A 5EYMA 4KIQA 5IH6A 4H39A 5CEKA 2ETRA 3ZXZA 4CSVA 4TYEA 4Y83A 5H3QA 3AD5A 4XMOA 3GB2A 3DK3A 4Y72A 4R78A 3C51A 3E8DA 5GIPE 3GNIB 3ZFXA 3MS9A 4MWIA 3JY0A 4Q2AA 3QQUA 4JBQA 2EUFB 4EORA 1G5SA 2CKOA 1IA8A 3ZHPC 5TR6A 5JZJA 5IQHA 4QMXA 4XHKB 3S0OA 4RIOA 4BBEA 1RDQE 4EC9A 2PHKA 4UXQA 4EH2A 2CGVA 4A9TA 4I21A 2WTJA 5IUHA 4MYGA 5EOLA 2B52A 4G3EA 4GJ2A 4Q9SA 3ATSA 3LFNA 4YC6A 2WXVA 3LLTA 4XBUA 2CCIA 5FEEA 4ASDA 3GCPA 3Q6UA 4FNZA 1GIHA 5IEVA 1XWSA 3C4WA 4EOJA 4A9RA 4FIJA 2PU8A 2CNVA 4FGRA 1U4DA 4ALUA 2UZTA 2HK5A 4FV3A 3HRBA 5CF5A 4C58A 1TVOA 3QBNA 3R6XA 3ODZX 3ROYA 4DFBA 3F66A 3AC5A 4O82A 4JRVA 3O71A 2YIXA 1Q8ZA 4O1OA 1MRVA 3DS6A 4CRLA 5B7VA 4M14A 3FBVA 3JUHA 4FEVA 3GU6A 4ACCA 4I4FA 2I0HA 2F57A 4WNPA 3V8TA 4ARKA 1ZOEA 2GPHA 2QLQA 3OG7A 4IC8A 3F5PA 1PKGA 4NTTA 4QQTA 5CU0A 5AAEA 3A7HA 4WD5A 3L8SA 3OBGA 4KA3A 3NYOA 4YTHA 2ERZE 2WQBA 4KS8A 4YBKA 3VS2A 4QYYA 5AUTA 4IQ6A 1KWPA 2Z7RA 2JKOA 4WNOA 3DKOA 3PXRA 5CYIA 2YJRA 2C5VA 4YURA 1OIYA 2UZVA 5KMJA 2X7FA 2NP8A 3F2AA 5DEYA 1H26A 3V6SA 3BRBA 1YWRA 3EL7A 2YACA 2JIUA 3G6GA 5DOSA 3O17A 5E8SA 2XK7A 5FM2A 4MF0A 1JVPP 1YXXA 2V0DA 5CAVA 5KZIA 3UMWA 2VWYA 1KV1A 4E26A 5ETFA 2NRYA 3AMAA 3ODYX 3VN9A 3O7LB 4FSNA 4I94A 5K3YA 2CHLA 3R9NA 3PVGA 3RVGA 2QG7A 4Q5EA 3SVVA 2ITUA 1X8BA 4ZSJA 2GNGA 3ZU7A 2XCKA 2XBAA 2WZJA 2W1DA 4APCA 2EXEA 1ZYDA 3PSBA 4GU6A 1TQMA 4YSMA 4FSMA 4V05A 3ZRKA 3UNKA 4PMSA 4QYHA 4BI0A 5BVDA 4QTCA 4HPTE 1YHVA 4QMZA 1NXKA 2Z7SA 3CE3A 3EJ1A 4S32A 4IZYA 2WOUA 4NW5A 3VAPA 3S2PA 4NKAA 3HA8A 3K5UA 4MXZA 4BCPA 4D9UA 4I24A 3SRVA 4KBKA 4Z3VA 5ETAA 1OM1A 4NM0A 4QTDA 4QMVA 4C62A 5AX3A 3P0MA 2UZBA 4MTAA 4B6LA 5IPJA 4CKRA 3TV4A 3BHVA 2ZV2A 4YJRA 3SHEA 4IB0A 3PXKA 1ND4A 2QOFA 3NNWA 2ZDUA 4R5SA 3ZXTA 4XG6A 4BWKA 4LMNA 4ZZOA 5IH5A 3NUAA 4FSWA 2XIXA 4IBMA 3KY2A 2C3LA 2YCSA 3NIEA 4ZJJA 1B6CB 2GNJA 4O2PA 4USEA 1WBSA 1BI7A 1HOWA 2WAJA 2GS7A 2VWIA 3QTRA 4O7RA 2R3LA 5HIDA 5KMOA 3U8WA 1Q41A 4ZTSA 4TYIA 5M09A 4EBVA 5AV4A 4EHZA 3CQUA 4A9SA 4D2RA 4FNYA 5FP6A 3FHIA 4U8ZA 2W1GA 5HX6A 5AR2A 4IVDA 3COKA 4C0TA 3BX5A 3QCSA 3K2LA 1ZOGA 2GFCA 2PUUA 3F9NA 4GRBA 5DGZA 5CNNA 4QYGA 2R3GA 5EOBA 4HPUE 3HRCA 4X3FC 3AGLA 1YRPA 4FVPA 3GGFA 3I5NA 3PWDA 4HNIA 4I92A 1JAMA 2QO7A 4QQ5A 3NVMB 3KMUA 1WMKA 2OFUA 4RIXA 5HCXA 1OPLA 5GHVA 1ZZ2A 3NDMA 3TV6A 3F7ZA 3UGCA 5BVFA 5JGAA 4FYNA 4N6YA 4PPBA 3ZO2A 4B99A 2I40A 1KUTA 3D94A 4GT3A 5EH0A 3DAJA 5IKWA 4R7HA 3ZRMA 4BL1A 4CT1A 3NW7A 4L9IA 3MTFA 5IQAA 1SVGA 2W5HA 4RIWA 3L9NA 5HO8A 2G2FA 1XH7A 1AGWA 2QONA 3F3VA 4F0GA 3EFWA 4YO6A 4U81A 3H0YA 4L67A 2BDFA 3LIJA 4PPAA 5IMEA 4D0WA 2UW5A 1M7NA 4CG8A 3CIKA 2CGUA 1QPJA 4G3GA 5ICPA 2ETKA 3VUGA 1SNXA 2BZIB 3TT0A 4JDIA 4HCUA 4PX6A 2WU7A 2PVYA 4R5YA 4DC2A 4U3ZA 5HLNA 5HG9A 4EOKA 2WTCA 4OTHA 3IDBA 4DEAA 2BFYA 2YA9A 3DJ5A 1FVRA 3NUNA 4EHVA 3EWHA 5AJQA 5L8KA 5HX8A 1U5RA 3UG2A 3QQFA 4ZOGA 4QPAA 4U97A 4RWKA 4F1MA 3DKFA 3R2YA 4E8AA 3NMUF 4L00A 1JSVA 2OU7A 4N70A 3F2NA 3LCKA 4UBAA 2QC6A 4FL3A 5AR3A 1L8TA 4IAZA 1Q3DA 5HLPA 1J1CA 4FV1A 5KKRC 3OCSA 5CAPA 3OUNB 4YR8A 4O0YA 5AFVA 3VUHA 4Q9ZA 4TN6A 1PXJA 5IDPA 2YHVA 4LRJA 4RWLA 5HOAA 1L3RE 4C4IA 1KE8A 5FM3A 3PP1A 1Q8WA 4BN1A 3C5UA 3FJQE 4F4PA 2B9FA 3OCBA 3P08A 4O0WA 4UZHA 3NZ0A 3BHTA 3FPQA 1H8FA 2OH4A 4ID7A 1I44A 1Q61A 5D9HA 4Q5HA 5IH4A 4ORKA 3S3IA 2OLCA 4UZDA 1WVXA 3DTCA 2QOIA 3LLAA 3P5KA 3PJ3A 2WMUA 3R00A 4AOIA 4DGGA 3DDPA 4J7BA 1XH9A 5AUXA 3BWJA 4L3JA 4GFOA 2W4OA 2Y4IC 2IN6A 4PV0A 3VIDA 1M2RA 3SXSA 3WZKA 2VO6A 4M15A 3TCPA 4EWHA 2JAVA 3RZFA 2VWZA 3DZOA 3OXIA 4BIEA 5BUJA 2YZAA 3EQDA 3DJ7A 4QP8A 3FQHA 4BIBA 3AC2A 5HE1A 4F63A 5I9WA 4OT6A 4DG3E 2PVNA 3PSCA 3ZLYA 3D0EA 4JBOA 4E6CA 5HE0A 4EOOA 2BRGA 3NNVA 4GG7A 3ORXA 3PVWA 5L4QA 4O7VA 2UW3A 1YDRE 3DBDA 4A06A 2LAVA 2I6LA 4FSZA 1XBBA 2BAQA 2OIDA 4BI2A 3DA6A 3D14A 4NCTA 4AWIA 4CXAA 3PJCA 2UZNA 4FKOA 3U9NA 2W06A 5D1JA 4Z7HA 3GU7A 1MRUA 2JFLA 4B8LA 1JKSA 5CF4A 2B55A 1FINA 4IAFA 3G15A 3PG1A 3HMMA 3RI1A 2VTAA 4BCNA 4BCQA 2VD5A 3I0QA 4CTBA 1JOWB 2Y4PA 3D7ZA 4J97A 3R8UA 1P4OA 3OXZA 3A7IA 4D2TA 2VX1A 2YM7A 3MN3A 5L2QA 2A2AA 3DB6A 3LFFA 5K4IA 3TZ9A 3Q9YA 4DG2E 3R30A 3FL4A 3PIYA 5CENA 3P4KA 1GIIA 5ANOA 5HTBA 1BL7A 1Q24A 4NM3A 1FVTA 2OSCA 3U54A 4EJ7A 4F9YA 4YSJA 3V5TA 3SXFA 2C5YA 4IVCA 2C6TA 3EQGA 1XJDA 4H58A 1O6KA 3C1XA 3H9FA 5AP3A 3BV3A 4FSRA 4EK5A 3UZTA 2NRUA 3D9VA 4D0XA 3S4QA 5JSMA 2CNQA 4IMYA 4X2NA 2I0EA 3QLGA 4YJQA 1YW2A 4JIKA 2UZEA 4GFGA 3OFMA 5M07A 2P0CA 4D2SA 3HUBA 3TEIA 4PTCA 4JNWA 4JLCA 5EI6A 4BCIA 3QTIA 2VO0A 1OI9A 4ZJIA 5AV0A 3ZOSA 1CSNA 1VYWA 3AMBA 4ITIA 2GCDA 1APME 1LUFA 4JDHA 3RK5A 3UOKA 2XZSA 2YM6A 3BQRA 4BGGA 4E4LA 3I7BA 3QD3A 5HG5A 3NAYA 2CNUA 3ZSGA 4KIOA 1PXKA 3ULIA 4MD9E 3RPRA 4G5PA 4BHNA 3FC1X 3PJ2A 1ZYCA 3ORKA 2XNBA 4I6BA 2C5XA 3LFDA 3ZFYA 5CF6A 5AP7A 5TOZA 2W5AA 5EM8A 1WZYA 3EHAA 3Q52A 4O27B 4QMLA 2QI8A 4NIFA 4UV0A 3VWAA 3NVKI 5HLWA 3H10A 1EH4A 4QT1A 5DRBA 4H3QA 5HNBA 5TT7A 1WBTA 4AZEA 5K0XA 4W4XA 3HGKA 3P7BA 4M8TA 5HNIX 3PWYA 3PFQA 4HZSA 3ZONA 3W8QA 3Q2JA 3FXXA 3VW8A 2Q0NA 3BV2A 2IG7A 2G15A 2V5QA 3Q3BA 4Y5QA 5EKNA 2IO6A 2VO7A 1OVEA 1NVQA 5J1WA 4FTAA 1QL6A 2QNJA 2R64A 2RIOA 2BZHB 5IUIA 2GTMA 3HV4A 4O0VA 4JDJA 2UUEA 2VN9A 1F3MC 5FEQA 4O2ZA 1ZYJA 2JDVA 2YDIA 4OW8A 4UMTA 1WVWA 4JDKA 5FWKK 5IQCA 3VBQA 2W1FA 3V04A 4AW2A 4A9UA 4Z7GA 4L42A 4FEWA 3KEXA 3H4JA 3O8TA 4DFUA 4IC7A 3NUSA 3POOA 4JI9A 3WF5A 2HZ0A 4C3RA 3PUPA 4QTBA 5E91A 3ORLA 4YO4A 2BILB 5DT0A 4DEBA 5IA2A 5A14A 2YM4A 4XV3A 4TWCA 2HAKA 1UU7A 4MXXA 3QRTA 1HCKA 2WTKB 2BCJA 5E1SA 5TF9A 4WBBB 5LJJA 3DBQA 2W1IA 3HL7A 1XH8A 4O38A 3FEGA 4RLLA 4FICA 4QRCA 3HZTA 5AEPA 1W82A 2BALA 5DI1A 4BCOA 2JC6A 2FSTX 2XRWA 2QR7A 2DS1A 4L7FA 1YI4A 3BCEA 4DEHA 3ALOA 3TN8A 2IPXA 3HV3A 4KBAA 4N4SA 1K2PA 2ITYA 2VRXA 3MWUA 3OOGA 3GCVA 5FRIA 4P5QA 4II5A 4ZS0A 4PDOA 2QG5A 3D7TB 3RAHA 2VU3A 4DLIA 3DFAA 5KKRB 4O7NA 2NNWB 2ZYBA 4O22A 4GSBA 3DOGA 3ZZWA 4BWXA 2F7EE 2G01A 4FOBA 2XA4A 4UMPA 3PA5A 4B4LA 2PVLA 4CVAA 1RJBA 1PXNA 3ZC6A 4ZLZA 1BI8A 5BVNA 4KKHA 2XS0A 3HMNA 3LZBA 4C59A 4C8BA 1FBNA 4FV8A 2ZV7A 2P2IA 5FBOA 3TZMA 4XH6A 3BBTB 3V6RA 4DFNA 2REIA 4FKJA 2WB8A 3GFEA 1U54A 2X81A 3HMIA 5IDNA 1P14A 4QP1A 3FYKX 2R3QA 2VWWA 2YM3A 4CFVA 3VNTA 3QQJA 3SW4A 3IW4A 3CGOA 1M7QA 3QXOA 5EHOA 3RK9A 4DT9A 4ACHA 3KMMA 5C03A 1NT2A 2W17A 4HVDA 2GNIA 3CPBA 3TUBA 3EQIA 2PUIA 4PPCA 4FT5A 4HW7A 1IAHA 3WF7A 2XK9A 4ITHA 1DAYA 4HNFA 5L2WA 3LFAA 4HCTA 4KIKB 4WSQA 4Y8DA 2PWLA 3V8SA 4QMNA 3EQRA 3MY0A 4TYGA 4AT5A 4QMQA 2XEYA 5C8MA 3UC3A 1J91A 2R3NA 3FZSA 2EXCX 3DPKA 3FMLA 1E1XA 3WIKA 4CKJA 3EFJA 3BZ3A 4F6UA 4MNFA 3LQ3A 2R3KA 2XF0A 3FY2A 5LWMA 1G3NA 3Q96A 4GU9A 3R8MA 3CQEA 2R4BA 4ASZA 1DS5A 2R7IA 3P86A 3P1AA 2PYWA 1YXSA 3OY1A 3RGFA 3ENHA 4I0RA 5JKGA 3PLAE 2QR8A 2WELA 3PPKA 2UZLA 4LRMA 4YJUA 5B2KA 2BHHA 3VRYA 5DVRA 5AP2A 3UO5A 3AT2A 3LFCA 3M2WA 4U80A 1VJYA 2YCRA 4TWOA 4CLIA 4M3QA 4ACMA 2RFSA 4DH7A 1KE6A 2C6LA 4M84A 3C13A 5HE3A 3F3UA 1SMHA 4IB1A 2WO6A 2WQNA 5HG8A 3WF8A 3RAWA 3UIMA 3WI6A 2RL5A 2PZPA 4NFMA 4BKZA 2YCQA 3QALE 2ZM3A 3KXXA 5A3XA 2J2IB 2GNLA 3L9MA 4FKIA 4QP6A 2J0JA 4U45A 4BCHA 2R5TA 4HGLA 1WBNA 3Q6WA 1OIUA 2J51A 4FT3A 4ANOA 1IRKA 2I0VA 4FGBA 2IVTA 3NYVA 4QYEA 3G2FA 3QX2A 1GOLA 1M17A 2V22A 3HYHA 2F49A 4BTFA 4E6DA 2ZV9A 4DH3A 4EHEA 1JSTA 2ZVAA 3PVBA 4PWNA 3TXOA 5K0KA 1WCCA 3WZDA 5C9CA 4CYJA 3ROCA 5C26A 1Q8TA 3W2CA 2OJJA 2W1HA 4IX4A 1PHKA 2PVFA 3R9HA 1H4LA 5IQIA 3C0IA 1DM2A 4PY1A 3FLZA 2NPQA 4IWDA 3LMHA 3QCYA 4RZVA 2YJSA 5L2IA 3V3VA 5E4HA 3OCTA 3QQHA 5JQ8A 3L9LA 4HVSA 3DKGA 3ORMA 3OXTA 2GS2A 4MKCA 3VS3A 4P2KA 4FEUA 4GCJA 1P4FA 1CKIA 4BY9E 3WF6A 3IOPA 2PVKA 2YDJA 3BHYA 4GEOA 4HVIA 4BZNA 4LV8A 2VGOA 2XJ0A 4WSYA 3LXKA 4MXYA 3BU5A 3R71A 3MFRA 4CMOA 4D9TA 1KV2A 3PZEA 3KC3A 2ERKA 3OUKA 4XOZA 5J9YA 3GC9A 3GU5A 3ZO4A 5EYDA 4J95A 3U51A 2PZIA 3DDQA 4L53A 3ZSHA 3Q5ZA 4BDKA 3TNWA 3HAVA 4BYJA 4AACA 4EC8A 1H01A 3SDJA 4LL0A 4RLKA 4TPTA 4HJOA 3TTJA 2UVZA 3MFSA 4LM5A 3DNEA 4PQNA 4CYIA 5EHLA 3CP9A 2CPKE 4DHFA 5CANA 4GMYA 4W8EA 4XUFA 3HAMA 3E63A 1IAJA 2F2UA 3AC3A 1KE5A 3EN4A 3FZTA 4IB3A 5KO1A 3OD6X 5FDPA 4G6NA 4QTAA 4WNMA 4MWHA 3QZGA 5M53A 3FMJA 3OWLA 4BTKA 4DE4A 3O7LD 3DU8A 1XH6A 3O23A 3R0TA 3P79A 4MQ2A 3W16A 4ZSAA 4RSSA 5KMMA 2FA2A 4C3FA 4FUXA 4JAJA 3TNHA 4CLJA 4XG3A 5E92A 1REKA 2B1PA 4I5PA 5F9EA 2ZV8A 3BU3A 2WU6A 2X4ZA 4TNDA 1PXPA 1R0EA 2C6OA 4FZ6A 3COHA 4OR5A 4XOYA 2X0GA 2W7XA 2XNEA 4W8DA 5E8VA 4QYFA 3DNDA 4U43A 2HZIA 3D5VA 4BDBA 2ITWA 3R22A 3TNQB 5JN2A 3MESA 1OBDA 4YJVA 1Y8YA 4S34A 3NUXA 3JPVA 4R6VA 4E4MA 4E3CA 3NW5A 5CU4A 3PLSA 4CEGA 4WRGA 1Y6BA 2JLDA 2RFEA 4ENXA 3UOLA 4EI4A 1W98A 2WQOA 3MV5A 3BELA 3NNUA 2Z7QA 4QMYA 4E5AX 1BUHA 4FEXA 4UMUA 4GK2A 1M52A 2RKUA 3U4WA 1Q8YA 3B8QA 1W0XC 2ACXA 4YNEA 3LM0A 4AW1A 2BVAA 3UYSA 4CFWA 3QYWA 3WOWA 4F1OA 5CAQA 3TACA 5J79A 5EQEA 3VS5A 3S1HA 4EZ3A 3R7OA 3BYMA 4YC8A 4FUYA 2H9VA 5JT2A 5HICA 3UC4A 4EH5A 4ZLYA 3NGAA 3HVCA 1GZOA 3FZRA 4FT0A 4DEDA 2IWIA 2R9SA 2Z60A 3HLLA 2OG8A 3MPAA 4QP2A 1QPCA 2VO3A 4LGHA 3ITZA 1UKHA 5BPYA 5KMKA 3DJ6A 3KF4A 3CKXA 3QCXA 4R3CA 5H9BA 4EQCA 1S9JA 4P7EA 3VC4A 3KXZA 4Y85A 3VS7A 1WBOA 2VTHA 3DQXA 2YZLA 1YXVA 1Q4LA 3MYGA 2VTSA 2I0YA 5T6KA 4JRNA 2HZNA 4XBRA 4AGUA 1RE8A 5HTIA 3TNIA 4WIHA 4ALVA 5M4CA 3ZSIA 4MD8E 5CWZA 1JQHA 3HECA 4EKKA 2R3RA 5E8ZA 1KE9A 4ZY4A 2XJ1A 3D15A 3D5WA 4MK0A 3LM5A 2IZTA 5HBEA 3NRMA 3BE2A 4O7SA 4N0SA 1YOLA 4FSUA 3IPHA 4EOSA 2BRHA 4XG7A 1FQ1B 2V7AA 4C4JA 1H1QA 2SRCA 4BICA 3QTWA 2AUHA 1BMKA 3HMPA 4XV1A 3S95A 4ERWA 5JFSA 1LP4A 3UIBA 1UV5A 3CTJA 1YDTE 4BWPA 2R2PA 4JQ8A 3PRFA 3LJ2A 2IZRA 5FBNC 4W9WA 3JYAA 4UYNA 5CVGA 5DBXA 4TW9A 4TYJA 3ANQA 1M2PA 5KHXA 4G5JA 1Z57A 1U54B 4XG2A 5EW9A 1MP8A 2XUUA 3QF9A 2YFXA 4U7ZA 4WO5A 3EFLA 5CNOA 4RA4A 5ACBC 3F6XA 3C4ZA 3F7WA 3QTSA 4K33A 5D10A 3OS3A 1CM8A 4RIXB 3T9TA 5CSPA 2ZJWA 3DV3A 1JLUE 3CR0A 3EQHA 2ITVA 1VR2A 4M0ZA 1WBVA 2JDSA 5FGKA 5G1XA 4D2VA 3WE4A 2F2CB 3BEAA 5T68A 5AR5A 5B2MA 4D4VA 1ZXEA 3R1QA 4YJPA 3CS9A 4RZWA 3OMVA 3MB6A 2OW3A 3M42A 4JX3A 4AT4A 2XK6A 3QTXA 5I5ZA 5K5NA 2PSQA 2OIQA 3LJ0A 3QTQA 4HYHA 2YAKA 3RJCA 2WMVA 3TZ8A 3R2BA 4IANA 4TY1A 4IX3A 4LGDA 4FV7A 3P9JA 4L7SA 4XG4A 3V51A 4R7BA 3HMOA 5GZ9A 5AM7A 4ANBA 3LQ8A 4CCBA 4D1SA 4DBNA 5GZ8A 1YOJA 5HU9A 2XH5A 2BZJA 3IOKA 4IWPA 4F7SA 3GC8A 2QODA 3PY3A 5DNRA 4AA4A 5EI8A 3FLSA 2F7ZE 5KNJA 4X6RA 1ZRZA 5AP5A 5HBJA 4MVFA 2E9OA 4RJ8A 4XV9A 3ZZEA 4K18A 4B0GA 4WT6A 2XIRA 4TTHB 4UALA 3GCUA 1LR4A 2X9FA 5BVOA 1KE7A 5ANJA 5DMZA 1UU8A 5ANDA 3D83A 3F88A 4O96A 4UN0C 2C3KA 3DY7A 5DR9A 4D4YA 5JRSA 3PIXA 3FKOA 4GYGA 2O3PA 4MHAA 3ZMMA 5I9VA 5EYKA 3AXWA 2OZAB 3UDBA 4MBJA 2OK1A 2HWOA 3Q9ZA 2QOBA 3R7YA 4Y95A 4WUNA 3VS0A 2NO3A 3CY2A 1J7IA 4L43A 4UY9A 3EIDA 3CKWA 4JXFA 3QUDA 3RPOA 4NL0A 4U42A 4EHGA 3UVQA 3LHJA 3HDMA 3DKCA 4AE9A 2X8DA 3NX8A 2C47A 3KB7A 1JNKA 3L1SA 3CCNA 3P78A 3FSFA 2PZRA 3EN9A 2WOTA 2J5FA 4TRLA 4EOMA 1ZAOA 2WFYA 3MJ1A 3Q2MA 3T3UA 3MBLA 4F99A 5GJDA 2WTKC 4TL0A 3HP2A 3UMXA 4G6OA 3AOXA 3TKUA 5CXZA 2YLEA 4FG8A 1NY3A 2X8EA 3JVSA 2J5EA 4BYIA 4OTPA 5DG5A 2R3IA 5DEWA 3AC1A 2CGWA 3FE3A 3FZPA 4DGOA 3CEKA 3VS4A 2XNOA 5BYLA 4D2WA 4KABA 3NS9A 4GKIA 4LRKA 5KHWA 3U55A 3MSSA 3R1YA 4F9WA 1RW8A 5I3RA 2XCHA 5TO8A 1OUKA 2P4IA 1OB3A 3D2IA 5KUPA 3R28A 5ANIA 1H1RA 2C30A 1XBAA 2ITXA 4GV1A 4RJ6A 4HVHA 5FG8A 4M0YA 5D11A 3BHHA 3KK8A 5E7RA 2JFMA 2VV9A 3P7CA 3E3BX 1J1BA 1G8SA 1P5EA 1NVSA 2PZ5A 4W4WA 5CT0A 4LG4A 3UJGA 1E9HA 3W8LA 3ZUVA 2PUPA 3IQ7A 1KOBA 5D7VA 4F70A 2DYLA 2W96B 4FIHA 4XJ0A 3A61A 3Q4ZA 3IK3A 4L3LA 4NK9A 2B4SB 4GT5A 3AG9A 4WG5A 4L46A 3TNPC 4D28A 2C6IA 3RINA 4X6QC 4BDEA 5IA4A 4E6QA 3DXPA 3E3PA 1XBCA 2X39A 2ITNA 3WIGA 4EK8A 1GAGA 4C4HA 2LGCA 4KNBA 2UVXA 2FB8A 4BDHA 1YI3A 5CSVA 4GUBA 4MX9A 4XG9A 2JKQA 4OTRA 4V0GA 3GOKA 5L6WL 5J95A 4L44A 5D41A 4K6ZA 2VX0A 2A1AB 5HGIA 3V8WA 4Z55A 4G3DA 4IDTA 2EB3A 3GQIA 4O81A 2ITPA 4EK4A 3QGYA 2X1NA 1TQIA 3SC1A 5AP4A 5J87A 4DFZE 5HVKA 2WTIA 2JEDA 3PJ8A 4ZZNA 1IG1A 1PW2A 3SRVB 2W5BA 4BDDA 4U40A 1E1VA 4C2VA 2XK3A 4XCUA 5AR7A 5HI2A 5A4TA 4O7TA 3QLFA 5A46A 5LOHA 1LEWA 3V5JA 3RBWA 4FV4A 4AZVA 3KN6A 3ZS5A 2OZAA 2C6EA 5CSWA 2IW8A 4D5KA 1PXMA 4AG8A 2WMAA 1JKKA 3CPCA 4HGSA 4RC4A 4ZAUA 3GU8A 3ET7A 4TKSA 3UVPA 4A9YA 4BCFA 2QVSE 1PKDA 4NJ3A 5CY3A 2C5OA 5I0BA 4OTGA 2WPAA 3DB8A 3CGFA 3Q53A 4CMTA 2B54A 2OH0E 3BI6A 3NUUA 3U9CA 5E90A 5IZFA 3FC2A 3EN7A 4JS8A 4EUTA 1FMOE 5EFQA 3DCVA 4FTUA 4FTMA 3I6WA 2ZB1A 2ONLA 4MCVA 2XM9A 4RQVA 4Z9LA 2GU8A 4QMWA 5KE0A 2CGXA 1BLXA 3R8PA 3NIZA 3VBXA 4AQCA 1OKZA 2PY3A 5HVYA 3W32A 4QMOA 3PTGA 3DBFA 3Q32A 1QMZA 3UTOA 2DUVA 4FIGA 4PP9A 1UNHA 1ZLTA 4PNKA 3RKBA 4B9DA 3R04A 1QCFA 5CVFA 3FZ1A 4ANNA 3GCQA 2VTMA 5DLSA 3ULZA 3ZLXA 4F08A 5I4NA 5DR2A 3UO4A 3DLZA 5HIBA 4E7WA 3AD4A 3BHUA 5A4QA 3NUPA 3AGMA 3F2RA 4O0UA 5DT4A 2W1ZA 4B7TA 5L6OA 5AM6A 3MB7A 5BVWA 3UQFA 3F3ZA 3FMDA 2HWPA 3PE1A 1FGIA 1STCE 1TKIA 2CKQA 4DCAA 3I81A 3C50A 1YOMA 3O96A 4G3FA 4S31A 2BIYA 5HD4A 1QPDA 2DWBA 5M4UA 1ZY5A 3UODA 3UG1A 4IEBA 4EH4A 4MXCA 3I7CA 5ANKA 4C57A 4DA5A 4DEEA 3LCSA 4DT8A 5L8JA 3TDVA 2YDKA 4XS2A 5FLFA 4PMPA 4G1WA 4WHZA 2OXXA 5IQBA 1H0VA 4QO9A 4JIAA 2C3JA 1AQ1A 3PPJA 3OF0A 1GZNA 3ORIA 3DT1A 5E8YA 3UP7A 3E5AA 2CLXA 2P55A 3KL8A 4KWPA 4WRSA 3CTHA 5H8BA 2F4JA 2BRNA 3UZPA 3PXQA 5C8KA 5DPVA 3DLSA 3A8XA 2GHLA 2WMRA 4TYHA 3KFAA 1WVYA 1AD5A 2I1MA 4FTOA 4FTKA 5FXQA 5BQ0A 3S00A 3H3CA 2CDZA 4EONA 4HVGA 5IG1A 4FTQA 2W0JA 4ZIMA 3R8ZA 4BF2A 2W4JA 3GCSA 3I4BA 2PMNX 3BGQA 3M1SA 4FTNA 1OUYA 1WFCA 4J98A 3LFQA 4MXOA 3EL8A 4IWQA 4RJ4A 3QKKA 4IM0A 5BMMA 4EOLA 5AV3A 4F9CA 1SM2A 3BIZA 3M11A 3Q9WA 4I4EA 5AIKA 4HYIA 4F6WA 2OJIA 3AQVA 3A62A 4MNEA 1FVVA 3BYOA 1R0PA 3FLNC 4IAKA 5IA3A 5BYZA 3UQCA 2C69A 3ALNA 3SLSA 2WEIA 3AT3A 2XK8A 5BMSA 3LE6A 5E8TA 3IKAA 4YPDA 2QOCA 3D4QA 4YPSA 3UYTA 3VBWA 3UPZA 5FTGA 3VQHA 5GJFA 4BIDA 1FMKA 3G90X 4FNWA 4NU1A 4AF3A 4FZDB 3Q4UA 2UZUE 3QWJA 3DZQA 2J9MA 2X9EA 2UV2A 3I79A 5CI7A 2WEVA 4QMTA 1M2QA 4RX7A 3R83A 3PY0A 4X0MA 4O0XA 4FMQA 5IEYA 3C5IA 5E9EA 3OY3A 3H30A 4MXAA 4RIWB 4DTBA 4AFEA 4XP2A 3E64A 3HX4A 2PMIA 4MF1A 3II5A 2H34A 2R3PA 4RG0A 5CVHA 4DH8A 1OKYA 4EBWA 4PP7A 4OT5A 1UWJA 4G17A 3GFWA 4NKSA 4YHTA 4YNOA 5JZNA 1R3CA 2XKCA 4KUJA 2WNTA 4AZFA 3NSZA 2QOQA 3A8WA 4ZMEA 3A4PA 4CG9A 5LMBA 5DFPA 3D5UA 4BGHA 5E8UA 3MDYA 5FEDA 1URWA 4A07A 1OKWA 3AT4A 4IHPA 4I5MA 4JVGA 3RWPA 4NJDA 5EDQA 4C4GA 4NSTA 3LFSA 5I9UA 4X2GA 4FV6A 3Q5IA 3ZO1A 1W7HA 2YEXA 5A4LA 3EOCA 5FQDC 3DTWA 4O1PA 4QMUA 2JD5A 3BBWA 4R7IA 5GINE 4ZZMA 5LVOA 4GL9A 2O64A 4YTIA 1ZWSA 1UVRA 2JIIA 4U9AA 3WZJA 4DGNA 2C6DA 1YVJA 4IW0A 1H1WA 2GHMA 4IFCA 4LQMA 3ZCLA 5EDPA 3ZEWA 4QQJA 2IJMA 3F61A 3GC7A 4UMQA 3MH3A 3O8PA 3PA3A 4NFNA 3PA4A 2X2LA 4QNYA 2GNHA 4JBPA 1PY5A 3VUMA 4EH6A 2X7GA 4AGWA 4HGTA 3KXHA 1Q8UA 4LI5A 1YHSA 1OL1A 2Y6OA 4ZTHA 3FXZA 3H9OA 4NM5A 4F0IA 3COIA 4FEQA 2H6DA 5J8IA 3V5LA 4DAWA 4ZSGA 5HZNA 3U6JA 4DEIA 3E92A 3HV7A 3RPVA 3W2RA 3OT3A 3BLHA 4CGAA 3IDPA 1GIJA 4BZDA 4F7LA 3ZYAA 4O7YA 1IEPA 1U59A 2RF9A 4U6RA 4ZXTA 4IZ7A 1J7UA 2Y7JA 3MGYA 3MTLA 2X6EA 3PXFA 4FZFB 4RVMA 1T45A 5DWRA 5AUVA 4D4SA 4FE2A 3R02A 2BUJA 4LL5A 4BB4A 3E7OA 3ZM4A 5EW8A 3ZC5A 4EOIA 4D55A 3RPYA 4I6HA 3MJ2A 1OMWA 3A4OX 2GSFA 4BCMA 4L01A 4ZTMA 5IA1A 2PMLX 4V0GB 5CU6A 5CZHA 4ZTNA 3SOCA 2RG5A 1XH4A 2VTTA 3W18A 4C02A 4NWMA 3QD0A 2W9ZB 3QL8A 3OC1A 4ERKA 5CI6A 4FZAB 3CTQA 3EN6A 2UZWE 3N9XA 3ZUTA 2OKRA 4YLJA 3BLQA 3FWQA 4C35A 4DGLC 4I22A 3NW6A 4I0SA 4NZWB 5CEOA 4FC0A 5HO7A 3I5ZA 3KA0A 5CLPA 4O7LA 4A7CA 1J7LA 3R63A 4FT9A 2O8YA 2VTJA 2PE0A 4FV5A 3JY9A 4U5JA 4BKJA 4DTAA 4JG6A 4X2FA 4FTCA 5ETCA 3MH1A 5TKDA 1Y8GA 2C4GA 4BFMA 3THBA 3ZUUA 5E8WA 3KKVA 1PMNA 2XB7A 4O0SA 4X3FA 5CQUA 5BUIA 4YC3A 1BL6A 2E9VA 3E8EA 1WBWA 3KULB 4RBLA 4FV0A 3IW5A 3UIXA 4G9CA 4ZTQA 4DF3A 5BYYA 4EH9A 3MA6A 1OL5A 2EB2A 3EQBA 4TNBA 4CNHA 2WMTA 3NLBA 4DG0E 5ANGA 3HV5A 4IZAA 5JFWA 2R7BA 3TJCA 3MVMA 2OF4A 4XG8A 1UWHA 3NUYA 2G9XA 2QHMA 4L6QA 4S30A 2QKWB 4A4OA 4ZK5A 4ANLA 5EM5A 4UXLA 2XIZA 5M44A 4UWYA 4AN9A 4BR3A 4PNIA 4BDIA 4FKVA 2BRMA 4O0TA 4X21A 4XV2A 4B8MA 2QKRA 3V5PA 4ANQA 3MI9A 5CAUA 5HIEA 5JFVA 2GHGA 3FMHA 4QPMA 5GJGA 5M08A 4CQGA 3C9WA 4UEUA 3F69A 4EK3A 2YERA 4YZCA 4S33A 2EXMA 1S9IA 3DQWA 4DBXA 2QHNA 2XKEA 3UPXA 3DAKA 3QYZA 4RC3A 5M55A 4RFZA 3GBZA 5M56A 3O8UA 3QUEA 4OTIA 3CC6A 5CX9A 3RCDA 4M66A 3RAKA 3TUCA 5AA9A 3MH2A 1XHAA 1OL6A 3E62A 3Q04A 2WQMA 4DCEA 3B2TA 4WNKA 4ZEGA 5LMKC 2FYSA 3FLWA 3OW4A 3ZO3A 4AP7A 4AU8A 4K8AA 2VX3A 5L6PA 1A9UA 5HEZA 3NCZA 3CLYA 3VBVA 4K1BA 2AC3A 4F1TA 1OBGA 3WARA 3EMGA 1UA2A 4RMZA 4M7IA 4YHJA 3OEFX 4BTMA 2OICA 4ZLOA 4FI1A 3FL5A 5LVPA 4XLVA 2VNWA 1YI6A 4BVUA 4F9BA 4TT7A 2O2UA 3G33A 5HHWA 2B0QA 2PL0A 3LMGA 4BKYA 3G6HA 4EQMA 1GJOA 2JDTA 3BYVA 4J71A 5CF8A 2A27A 5JK3A 4PL3A 4R3RA 5CTPA 3W1FA 4QQCA 4H1MA 3DXQA 1PYEA 1PJKA 5AWMA 3MY5A 3NNXA 3U6IA 2PVJA 3FMNA 1PMEA 3UZRA 4LUEA 1GZ8A 1MUOA 4OAUC 5CAOA 4CFFA 5C01A 4M13A 5CEMA 5ITAA 2XYUA 4IVBA 3IGGA 5AAGA 3QXPA 2W1CA 4IB5A 1B39A 5IEXA 3VUIA 4DLJA 4WG4A 5JGBA 2HOGA 5A54A 3A60A 3A99A 4J53A 3VS1A 3JVRA 4LV5A 3KRRA 3F3TA 2WQEA 3POZA
chains in the Genus database with same CATH superfamily
2OJFE 4ENYA 5HQ0A 4O6LA 5KCVA 1ZMWA 5GZAA 4O6EA 3DAEA 3DBEA 3DGKA 3GU4A 3VJNA 4APPA 1FGKA 4QTEA 3KGAA 3FY0A 2G2HA 4DFLA 4RWJA 4D1ZA 5LARA 4GT4A 3QFVA 1FPUA 2YIYA 3C4FA 3TJDA 4LUDA 3W2PA 4C3PA 4USFA 4IFGA 5EQYA 4BCJA 1WBPA 2BKKA 2YITA 4O0RA 3CXWA 3WZUA 1R78A 3MIYA 3GC0A 5IF1A 3PIZA 3PRIA 4DGMA 4KBCA 1ZOHA 2B7AA 3PYYA 4QMMA 4EZ7A 5GIOE 5HKMA 4ZMFA 3PPZA 1DI9A 4D4RA 1Z9XA 2PZYA 2VTPA 4BDAA 2XIKA 2CKPA 2UVYA 4GFMA 3COMA 2XVDA 3LXPA 2OGVA 5IQGA 2FH9A 2ZB0A 3RHKA 2QD9A 5KMLA 1PXIA 5AAFA 4RFYA 4LOPA 4WA9A 3W33A 4AN2A 4C38A 2AEGA 4CFUA 4QPSA 2BFXA 3TTIA 1ZYSA 3KCKA 1YHWA 3OCGA 4KRDA 3Q60A 5C8NA 4MNEB 3RP9A 3UNZA 2PVHA 1XR1A 3SG9A 2OIBA 2PE2A 4OTFA 3SOAA 4AAAA 1OZ1A 2B9JA 2YWPA 4WUAA 5BX0A 3R7EA 4F9AA 3TKHA 4FV2A 5LCJA 3W2QA 2R3JA 3SKCA 4BCKA 3G5DA 3LXLA 3MW1A 3GVUA 1O6YA 4XYFA 4CZTA 2CCHA 2ITTA 3AD6A 4RT7A 4BBMA 4J8NA 5HESA 2DQ7X 1OIQA 2W9FB 4IWOA 4C37A 3HUCA 3R21A 4C4FA 4L3PA 3ETAA 2VWUA 3VW6A 4NUSA 4YZDA 4U41A 3RMFA 2HW7A 5IQEA 4M12A 1DAWA 3QX4A 4JQ7A 2HY0A 5K4JA 4RIYB 3CJFA 4EH3A 3UE4A 3TI1A 3TZ7A 2JDRA 3VVHA 4EOPA 4QP4A 3R8LA 2UZOA 5CSXA 3QC4A 3SX9A 2BMCA 2QO2A 3W2OA 1QPEA 4PDSA 4G3CA 4KD1A 4PMTA 1ST0A 1GY3A 4LFIA 4CV9A 1OL7A 4HYSA 2PE1A 1DI8A 4LOQA 2RFDA 3K54A 4ZSEA 5JFXA 1ZYLA 3IO7A 3QAME 3H0ZA 3QUPA 2IVVA 2X2KA 3MFUA 1W84A 3RZBA 5EDRA 4IADA 3R73A 5M57A 3P7AA 4I6QA 3DBCA 2ZFYA 4HGEA 3UIUA 2WMSA 4UB7A 3VQUA 4E20A 3PXYA 2XP2A 3AMYA 3QHWA 4PL4A 4ANMA 4CCUA 5BVKA 3DXNA 5LMKA 4CRSA 5FTOA 2WTWA 3I0OA 3LPBA 4IX6A 2B53A 4MAOA 3TIZA 3OT8A 1IR3A 2IZUA 4GUEA 5H8GA 3HNGA 4GG5A 4RJ7A 3UQGA 4BTJA 2R3HA 1MQ4A 1PXLA 3SAYA 2XMYA 1ZMUA 5J5TA 1WAKA 4ZY6A 4ZS4A 1MRYA 3OHTA 4AA0A 4FIIA 3L8XA 4AXAA 2HXLA 4YP8A 3G51A 3OVVA 3Q4TA 2UZDA 4HCVA 3I1AA 4JL9A 3W10A 2HXQA 2J0LA 2C0OA 4OTWA 4EK6A 4I5HA 5HCYA 2HW6A 2UW8A 3R7GA 3SGCA 5AR4A 3W0QA 5AR8A 5HCZA 2YCFA 4C34A 5IQDA 4EEVA 5KBRA 4BC6A 4AGDA 1A06A 3RM7A 2Y0AA 4ZTRA 2OO8X 4QDVA 1NVRA 2R0UA 2VAGA 4X3JA 2XBJA 2XIYA 4XNEA 4C33A 4X7QA 5HO6A 3RM6A 1ZZLA 2BZKB 3HP5A 2YIRA 2J6MA 1JBPE 3L9PA 4NTSA 4YHFA 3NEWA 5LVNA 4EH7A 1GNGA 3TIYA 3FLYA 5EK7A 3FI8A 3T9IA 3VBYA 5KX8A 4QOXA 4GJ3A 3ZDUA 4EZ5A 3W0SA 5DR6A 2J0KA 2Z8CA 3E87A 3IG7A 4R8QA 4RX9A 4V01A 5ACKA 4AUAA 4O84A 2R3OA 4P5ZA 2VTIA 2XNMA 5I9YA 5E1EA 4L45A 3V5QA 1UU9A 1SVEA 3QGWA 4WKQA 3NAXA 3MVHA 2C1AA 1IASA 4L8MA 2E2BA 5L2TA 4MD7E 3G0FA 5AIRA 5F1ZA 5IISA 4YJTA 1PXOA 5AUYA 3GUBA 4CFNA 4YGAA 4N57A 1Q97A 3QRKA 3CBLA 3E8NA 2J90A 3NWWA 5AV1A 5FTQA 3R7IA 4CFMA 4LMUA 5CALA 5L3AA 2I7QA 1Y91A 4GH2A 3BWFA 4RWIA 3ZDIA 3FXWA 4Y5HA 3WYYA 4OGRA 5J9LA 4E5BA 3GI3A 1G8AA 1Q3WA 2J7TA 3RCJA 4FKRA 4YU2A 5D7AA 3AC8A 3CQWA 4HYUA 4TWNA 3UDZA 1RQQA 2WD1A 3KMWA 2UW0A 3FQEA 2C0TA 4KB8A 4FVRA 3PG3A 4NT4A 5FUTA 4C36A 3EFKA 4OTQA 5FDXA 3FKLA 4FTIA 3BGPA 4FODA 2WTDA 4ITJA 3OZ6A 4CV8A 4DH5A 4FVQA 4FNXA 4FIEA 2BR1A 5AUZA 4EWQA 2BTRA 3UP2A 4FTTA 2RSVA 3FDNA 4JAIA 4I5CA 2OFVA 3QZFA 3ZLSA 5A6NA 2QOLA 5J5SA 4EJNA 1TZDA 4Y46A 2ZMDA 5M51A 2VWVA 3SW7A 4A4LA 3ZLWA 2GDOA 3QHRA 3K3IA 2KTYA 4GW8A 4FL1A 2OXYA 4FKUA 1ZY4A 3PY1A 2GFSA 4K0YA 2PMOX 3KRJA 4JX7A 2OWBA 4YTCA 1SYKA 1V1KA 2R3FA 5B0XA 2JIVA 4XRLA 4D1XA 1TFFA 2UW6A 3ZFMA 3C4CA 3AKKA 5E8XA 4PTGA 3A7JA 1OIRA 3LFEA 5BVEA 1VEBA 2Q0BA 4MQ1A 5AA8A 2BDWA 4QMPA 1F0QA 3QC9A 4BHZA 3QRJA 3U4UA 2XKDA 4K2RA 5IA5A 4ZJVA 5F4NA 3QZIA 5C27A 3UBDA 2EVAA 3ATTA 3SG8A 3HEGA 5IU2A 1TQPA 2IVUA 3N4VA 4NM7A 5D12A 1K9AA 5A4CA 3MVJA 1IA9A 5GNKA 1CTPE 2G1TA 2JITA 2QU6A 2IZSA 5EYCA 3FAAA 1V0BA 3CY3A 4JG7A 3W0RA 3B8RA 4JBVA 4J96A 3QU0A 4CD0A 2Z7LA 4MBIA 4GVJA 4CKIA 4AQKA 4H3BA 3O0GA 3KF7A 2GMXA 5IMXA 4I41A 2BAJA 3ZH8A 3KXMA 3EKNA 3G9NA 5IA0A 4PTEA 3KREA 3E88A 2XYNA 3EN5A 2IVSA 1R1WA 3RNYA 4NIFB 4BDGA 2GTNA 3C4EA 3KRLA 4UYAA 2H8HA 5DRDA 2C0IA 2VGPA 4H36A 3KK9A 3FQSA 4H3PA 2WHBA 3N4TA 4KINA 4RJ3A 1JKLA 3IDCA 2KULA 4QNAA 4YMJA 3KVXA 4FF8A 3VUDA 4X2JA 2BRBA 4PDYA 1OGUA 3TL8A 5HTCA 1CKPA 3KULA 3OOMA 1ZARA 4Y73A 3VF8A 3KXGA 4X2KA 4AX8A 3A7GA 2ZM1A 2PK9A 3AC4A 5CEPA 5M4IA 2WIPA 5CXHA 2FSMX 3MVLA 3D7TA 2AC5A 5AP6A 4GYIA 5F95A 2XK4A 5IUGA 3EKKA 3HDNA 2CN8A 5FXSA 1Y57A 2C3IB 1GZKA 3FHRA 4RQKA 2GQGA 3BGZA 2HZ4A 3PP0A 3FKNA 3FI4A 1YWNA 1YXUA 1O6LA 2JGZA 4H1JA 3O2MA 4PRJA 5HG7A 4I0TA 5LWNA 3TUDA 2QU5A 4N6ZA 4I1ZA 4M69A 2BAKA 1YKRA 2XRUA 1LEZA 2C1BA 2F9GA 3MPTA 1P2AA 3SQQA 4BRXA 3R9DA 3FI3A 3EYHA 4AS0A 2R0IA 4KS7A 4CQEA 3RALA 1XQZA 3GENA 5CEIA 2E9PA 4QD6A 4O7WA 2WKMA 2JKMA 2QLUA 1ERKA 5A9UA 2Y6MA 3F5UA 2JBOA 4UWBA 3VO3A 2WMBA 4DN5A 4S2ZA 3CD8A 4ONAA 3KU2A 4D2PA 3EZVA 3BE9A 3C0GA 3EB0A 1YDSE 3I6UA 3QKMA 3D2KA 5DA3A 4YUQA 2ZMCA 3DK6A 4FK3A 4O86A 2VWBA 3OROA 3PSDA 3GXLA 3OW3A 4IXPA 1KSWA 2QOKA 4FKWA 4FZ7A 1CMKE 4BGQA 1UNGA 5AV2A 1A48A 4IH8A 5F20A 2FO0A 5LVMA 3OWJA 1V0OA 4AW5A 3QRUA 2UW9A 3LOKA 5CSHA 2VTRA 2P3GX 4FIFA 3TKIA 3PZHA 4ZSLA 4FA2A 4H05A 4R3PA 2P2HA 2C6MA 4DEGA 2YN8A 3LQ5A 4G2FA 5C1QB 5FD2A 5LVLA 3QTUA 5DIAA 3DFCB 2JAMA 4RGJA 2Q83A 5L8LA 3TV7A 3LCDA 4YZ9A 3O50A 5F94A 5M4FA 5LXMA 3E7VA 4XX9A 3VRZA 4E1ZA 5AX9A 4U0IA 3JR1A 2G2IA 4QMSA 4ZTLA 1H1PA 5ANEA 4FKLA 3VBTA 4M97A 5JH6A 3IW8A 4J1RA 3LMIA 4BDJA 3ERKA 4RX8A 4D5HA 4YJSA 4HZRA 4KKEA 5HU3A 3NR9A 3MFTA 4E5WA 4IE9A 1Y6AA 4BI1A 5TE0A 3CSVA 1H27A 3KCFA 5DE2A 4NEUA 1UU3A 3W0MA 5AMNA 2Y4IB 3T3VA 1JWHA 4FX3A 5A4EA 4BDFA 4FSTA 4WOVA 2BKZA 4A4XA 2C68A 5AUUA 2E9UA 4WBOA 2ZDTA 4ACDA 4IAAA 1M14A 3FI2A 3GEQA 3UO6A 2UW4A 5EM6A 4G6LA 3LFBA 4GVAA 4I93A 1BX6A 4GKHA 3A7FA 4BDCA 1BKXA 4AFJA 2XNNA 4FK6A 4F7NA 2QO9A 3LXNA 4XRJA 3W0OA 2J0MB 3ELJA 2WMWA 4OAVB 3FMMA 4O4DA 3A2CA 1REJA 3MY1A 4RC2A 4W4YA 5I9ZA 4GIHA 4O4FA 4RIYA 1K3AA 3V01A 5AUWA 3UOHA 4D58A 2JKKA 3RTPA 2GQRA 3VJOA 4RRVA 2QURA 3QRIA 4W9XA 2QQ7A 3F82A 3FV8A 2X4FA 2YLFA 4IAIA 4ASXA 4BBFA 3MPMA 2OF2A 1ZMVA 4I6FA 2ITZA 1SVHA 3NYNA 5J7BA 1J3HA 5EKOA 4FSYA 4AOTA 3PE2A 3KRWA 3HA6A 3VHKA 5CU2A 4C7TA 4DINA 4UX9A 5EG3A 4AZWA 3KN5A 4AZTA 4CTCA 3KRXA 2C6KA 2F7XE 4KRCA 4QP3A 5HE2A 3R7UA 4DFXE 5I3OA 2O65A 2V55A 4FKGA 2WTVA 4JT3A 4RPVA 4GIIA 4U44A 4TXCA 4AN3A 3LCTA 5CASA 1NA7A 2ETMA 4BCGA 3RPSA 4OLIA 3F5XA 5IQFA 2BROA 1ATPE 2VTOA 3ID6C 3QWKA 3FUPA 4BZOA 5LQFA 2OBJA 2ITQA 3N51A 3UNJA 4U79A 4I20A 4FYOA 3QKLA 2V7OA 4TYHB 1Z5MA 3OWPA 4ACGA 5JGDA 4G34A 4O21A 1PRYA 5EW3A 5C4LA 4I23A 4DDGA 3R7VA 3HKOA 2VTLA 3F3WA 2Y8OA 3FPMA 2EWAA 5AP1A 4USDA 4DFYA 4DYMA 4E73A 5BNJA 5DYJA 3ZBFA 2XM8A 1OECA 1YWVA 3OP5A 3LJ1A 2X7OA 4G31A 1SNUA 1XH5A 3EQFA 3HRFA 3KQ7A 5DH3A 2YM8A 4AE6A 2QOHA 4FKQA 5A6OA 3WYXA 2IW6A 4KSPA 5C4KA 4M68A 4V04A 4FTJA 5FP5A 4WG3A 4G16A 3BU6A 2CLQA 2XJ2A 2XEZA 4JR3A 4CMUA 2BHEA 3ENMA 2RFNA 3OTUA 3OTVA 1H24A 3OWKA 4YLLA 3ZRLA 2CMWA 2A4LA 4GK4A 2OZOA 4UMRA 3N4UA 1OITA 5JRQA 2JDOA 3TYKA 3ZEPA 4FOCA 1LPUA 3ORZA 2FUMA 3ZTXA 3C4XA 2X6DA 3HV6A 1SZMA 1CKJA 5AP0A 5H8EA 3SA0A 4F65A 3C0HA 3ORTA 3V5WA 3IGOA 4AGCA 2BTSA 4DTKA 1OPKA 4GS6A 3H9RA 4AOJA 4OTDA 4GK3A 4DITA 3IS5A 2IF8A 4EYMA 4IM2A 5KBQA 5CT7A 4F64A 1MQBA 4FKPA 1V0PA 2PTKA 3NYXA 3CD3A 5HVJA 1H08A 1UNLA 3REPA 4F0FA 4QDEA 4OUCA 4K11A 2AYPA 1U5QA 3BYSA 3KXNA 1W83A 5FXRA 1FOTA 2XNPA 3BYUA 2ESMA 4IVAA 4EKLA 3O51A 4FG7A 2RG6A 2J4ZA 3K5VA 4OBQA 3GQLA 4IAYA 3U87A 3GOPA 2JBPA 3SV0A 3EYGA 3SD0A 2VNYA 4FR4A 4OBPA 4IJ9A 3K3JA 1Q99A 4KIPA 5EQPA 2FSOX 2OJ9A 3ACKA 2EU9A 4EL9A 3ORNA 1PYXA 2W05A 1H28A 4CT2A 4MH7A 5I9XA 5HD7A 4C2WA 5JQ5A 4O4EA 4YBJA 3D5XA 5DN3A 2RGPA 3ACJA 5LCKA 1UKIA 3WE8A 4DH1A 5J9ZA 3MA3A 2HY81 5EM7A 2E9NA 4G9RA 3EZRA 3UOJA 2CN5A 4RJ5A 4MEDA 3E8CA 3LAUA 4XP3A 5ETIA 4O83A 2PVRA 3VF9A 4PF4A 4ASEA 2PPQA 4CFXA 4EQUA 4KSQA 4R77A 5B2LA 2XKFA 3DK7A 4NCTC 5AADA 2GQSA 2YIQA 2Z02A 3BLAA 1NW1A 4CZUA 4EH8A 4JG8A 3BLRA 5CQWA 4CZYB 1JSUA 2O0UA 3TWJA 2R3MA 5J1VA 4XEYA 4C4EA 2XALA 2X8IA 4ALWA 4PUZA 4P4CA 2CSNA 3FYJX 5T3QA 5HBHA 1XO2B 1O9UA 1Q5KA 4HOKA 3GP0A 3P23A 3QA8A 5KMIA 5G6VA 4EUUA 2YWVA 2GS6A 1F5QA 2O63A 4F6SA 3TDWA 4E4XA 1JKTA 3MIAA 3F5GA 4IDVA 2OJGA 4KAOA 4YZNA 3RAIA 4PDPA 1PMUA 5L2SA 3AKLA 3QZHA 1OKVA 3FSKA 2YM5A 4FTLA 3IW6A 4FKTA 4ANSA 4X3FB 4C61A 4JMQA 2ONLC 3QA0A 2BIKB 4LGGA 4YTFA 3RNIA 3W2SA 1B38A 2W4KA 2FGIA 3NCGA 3ORPA 3QD2B 4I3ZA 4J52A 4NH1A 3G0EA 3VULA 4R1YA 4FL2A 3QQGA 4YLKA 3RHXA 4TWPA 4K9YA 4AT3A 4IIRA 2XNGA 4IX5A 2B9HA 3FZOA 2A19B 5K9IA 2X2MA 4PMMA 2J0IA 4K77A 4RFMA 3CJGA 3BPRA 3L8VA 4RVKA 4IJPA 4QP7A 1HCLA 3FMEA 2HIWA 3TG1A 4LOOA 1U46A 4E93A 2YIWA 4TZRA 2OXDA 3ZM9A 2VTQA 2WMXA 5CS6A 4ZY5A 2OI4X 5DHJA 5KMNA 1H0WA 4JQEA 3VUKA 4DDIA 3IONA 2A0CX 1OPJA 1H25A 2CKEA 1YXTA 4NYEA 4XP0A 4J8MA 5CZIA 4IZ5A 4IACA 5KZ0A 5DT3A 4AZSA 1JPAA 2QCSA 4W4VA 5EHYA 5K5XA 1URCA 3W55A 3PUFC 3RK7A 4I6LA 5BV3A 4M67A 5BUEA 3BKBA 3QQKA 3VS6A 5JMSA 1BYGA 3G9LX 4FBXA 4JJRA 4U3YA 3VUTA 3TMOA 4KIKA 5LMAA 4FV9A 5CU3A 2ZAZA 3NPCA 4O4BB 4OBOA 3WILA 3LW0A 2P33A 4UWCA 4FT7A 3LKMA 3SXRA 3R9RA 2W99B 1H07A 2WIHA 3LVPA 3JXWA 4FSQA 5HNGA 3UVRA 2CJMA 3BEGA 1R39A 3BQCA 3ZBXA 3VHEA 3E93A 4AW0A 2PUNA 2Y9QA 1VZOA 4NW6A 3PFYA 1W8CA 4RVTA 3Q4CA 3PJ1A 2ITOA 2VUWA 3QD4A 3AKJA 4E4NA 2C5NA 2WMQA 1VYZA 1XKKA 3L8PA 4KKGA 5HORA 3EQPA 4IM3A 1PMVA 2YAAA 3TM0A 3QCQA 2QOOA 3QQLA 3B2WA 4RX5A 3OEZA 4EYJA 4F7JA 2GNFA 4M69B 2UW7A 1CDKA 2HCKA 2IW9A 3R8VA 1YQJA 4F09A 3RWQA 3QTZA 1OL2A 4QP9A 2FVDA 5CEQA 3R9OA 4LYNA 3R01A 4FTRA 1T46A 3R1SA 4O91A 3T8OA 2HELA 3R1NA 3WF9A 2PVMA 3I60A 4L68A 4O7ZA 3MH0A 2PULA 2WGJA 4FG9A 3FLQA 5JEBA 2YABA 5J7HA 3WZEA 4JR7A 4RA5A 2V62A 1PF8A 3C7QA 2ZM4A 4YZBA 4P90A 3IW7A 3FMKA 4EOQA 4YJOA 3JS2A 2VTNA 4RVLA 4Z16A 4XLIA 3LCOA 4AA5A 1KOAA 2B9IA 2ZOQA 3EQCA 2J50A 3KVWA 5M06A 4MBLA 2FSLX 3Q9XA 4L52A 4YJNA 1H00A 2HENA 3GT8A 3IECA 5EI2A 2BDJA 3PDTA 5H2UA 2HYYA 4E6AA 3OBJA 1H1SA 2W1EA 2Z2WA 4FKSA 4J99A 2VWXA 3WBLA 2H96A 2YISA 3PXZA 3PVUA 3U6HA 2BPMA 1I09A 3ANRA 1Q62A 3EH9A 4JOAA 2VZ6A 4YZMA 4R1VA 2O5KA 4ZP5A 4PL5A 5EYMA 4KIQA 5IH6A 4H39A 5CEKA 2ETRA 3ZXZA 4CSVA 4TYEA 4Y83A 5H3QA 3AD5A 4XMOA 3GB2A 3DK3A 4Y72A 4R78A 3C51A 3E8DA 5GIPE 3GNIB 3ZFXA 3MS9A 4MWIA 3JY0A 4Q2AA 3QQUA 4JBQA 2EUFB 4EORA 1G5SA 2CKOA 1IA8A 3ZHPC 5TR6A 5JZJA 5IQHA 4QMXA 4XHKB 3S0OA 4RIOA 4BBEA 1RDQE 4EC9A 2PHKA 4UXQA 4EH2A 2CGVA 4A9TA 4I21A 2WTJA 5IUHA 4MYGA 5EOLA 2B52A 4G3EA 4GJ2A 4Q9SA 3ATSA 3LFNA 4YC6A 2WXVA 3LLTA 4XBUA 2CCIA 5FEEA 4ASDA 3GCPA 3Q6UA 4FNZA 1GIHA 5IEVA 1XWSA 3C4WA 4EOJA 4A9RA 4FIJA 2PU8A 2CNVA 4FGRA 1U4DA 4ALUA 2UZTA 2HK5A 4FV3A 3HRBA 5CF5A 4C58A 1TVOA 3QBNA 3R6XA 3ODZX 3ROYA 4DFBA 3F66A 3AC5A 4O82A 4JRVA 3O71A 2YIXA 1Q8ZA 4O1OA 1MRVA 3DS6A 4CRLA 5B7VA 4M14A 3FBVA 3JUHA 4FEVA 3GU6A 4ACCA 4I4FA 2I0HA 2F57A 4WNPA 3V8TA 4ARKA 1ZOEA 2GPHA 2QLQA 3OG7A 4IC8A 3F5PA 1PKGA 4NTTA 4QQTA 5CU0A 5AAEA 3A7HA 4WD5A 3L8SA 3OBGA 4KA3A 3NYOA 4YTHA 2ERZE 2WQBA 4KS8A 4YBKA 3VS2A 4QYYA 5AUTA 4IQ6A 1KWPA 2Z7RA 2JKOA 4WNOA 3DKOA 3PXRA 5CYIA 2YJRA 3KIOC 3O5AA 2C5VA 3P5JC 4YURA 1OIYA 2UZVA 5KMJA 2X7FA 2NP8A 3F2AA 5DEYA 1H26A 3V6SA 3BRBA 1YWRA 3EL7A 2YACA 2JIUA 3G6GA 5DOSA 3O17A 5E8SA 2XK7A 5FM2A 4MF0A 1JVPP 1YXXA 2V0DA 5CAVA 5KZIA 3UMWA 2VWYA 1KV1A 4E26A 5ETFA 2NRYA 3AMAA 3ODYX 3VN9A 3O7LB 4FSNA 4I94A 5K3YA 2CHLA 3R9NA 3PVGA 3RVGA 2QG7A 4Q5EA 3SVVA 2ITUA 1X8BA 4ZSJA 2GNGA 3ZU7A 2XCKA 2XBAA 2WZJA 2W1DA 4APCA 2EXEA 1ZYDA 3PSBA 4GU6A 1TQMA 4YSMA 4FSMA 4V05A 3ZRKA 3UNKA 4PMSA 4QYHA 4BI0A 5BVDA 4QTCA 4HPTE 1YHVA 4QMZA 1NXKA 2Z7SA 3CE3A 3EJ1A 4S32A 4IZYA 2WOUA 4NW5A 3VAPA 3S2PA 4NKAA 3HA8A 3K5UA 4MXZA 4BCPA 4D9UA 4I24A 3SRVA 4KBKA 4Z3VA 5ETAA 1OM1A 4NM0A 4QTDA 4QMVA 4C62A 5AX3A 3P0MA 2UZBA 4MTAA 4B6LA 5IPJA 4CKRA 3TV4A 3BHVA 2ZV2A 4YJRA 3SHEA 4IB0A 3PXKA 1ND4A 2QOFA 3NNWA 2ZDUA 4R5SA 3ZXTA 4XG6A 4BWKA 4LMNA 4ZZOA 5IH5A 3NUAA 4FSWA 2XIXA 4IBMA 3KY2A 2C3LA 2YCSA 3NIEA 4ZJJA 1B6CB 2GNJA 4O2PA 4USEA 1WBSA 1BI7A 1HOWA 2WAJA 2GS7A 2VWIA 3QTRA 4O7RA 2R3LA 5HIDA 5KMOA 3U8WA 1Q41A 2A98A 4ZTSA 4TYIA 2XARA 5M09A 4EBVA 5AV4A 4EHZA 3CQUA 4A9SA 4D2RA 4FNYA 5FP6A 3FHIA 4U8ZA 2W1GA 5HX6A 5AR2A 4BJJB 4IVDA 3COKA 4C0TA 3BX5A 3QCSA 3K2LA 1ZOGA 2GFCA 2PUUA 3F9NA 4GRBA 5DGZA 5CNNA 1L8TA 4QYGA 2R3GA 5EOBA 4HPUE 3HRCA 4X3FC 3AGLA 1YRPA 4FVPA 3GGFA 3I5NA 3PWDA 4HNIA 4I92A 1JAMA 2QO7A 4QQ5A 3NVMB 3KMUA 1WMKA 2OFUA 4RIXA 5HCXA 1OPLA 5GHVA 1ZZ2A 3NDMA 3TV6A 3F7ZA 3UGCA 5BVFA 5JGAA 4FYNA 4N6YA 4PPBA 3ZO2A 4B99A 2I40A 1KUTA 3D94A 4GT3A 5EH0A 3DAJA 5IKWA 4R7HA 3ZRMA 4BL1A 4CT1A 3NW7A 4L9IA 3MTFA 5IQAA 1SVGA 2W5HA 4RIWA 3L9NA 2XAOA 5HO8A 2G2FA 1XH7A 1AGWA 2QONA 3F3VA 4F0GA 3EFWA 4YO6A 4U81A 3H0YA 4L67A 2BDFA 3LIJA 4PPAA 5IMEA 4D0WA 2UW5A 1M7NA 4CG8A 3CIKA 2CGUA 1QPJA 4G3GA 5ICPA 2ETKA 3VUGA 1SNXA 2BZIB 3TT0A 4JDIA 4HCUA 4PX6A 2WU7A 2PVYA 4R5YA 4DC2A 4U3ZA 5HLNA 5HG9A 4EOKA 2WTCA 4OTHA 3IDBA 4DEAA 2BFYA 2YA9A 3DJ5A 1FVRA 3NUNA 4EHVA 3EWHA 5AJQA 5L8KA 5HX8A 1U5RA 3UG2A 3QQFA 4ZOGA 4QPAA 4U97A 4RWKA 4F1MA 3DKFA 3R2YA 4E8AA 4F78A 4L00A 3NMUF 1JSVA 2OU7A 4N70A 3F2NA 3LCKA 2AQXA 2QC6A 4FL3A 4UBAA 5AR3A 4IAZA 1Q3DA 5HLPA 1J1CA 4FV1A 5KKRC 3OCSA 5CAPA 3OUNB 4YR8A 4O0YA 5AFVA 3VUHA 4Q9ZA 4TN6A 1PXJA 5IDPA 2YHVA 4LRJA 4RWLA 5HOAA 1L3RE 3W0PA 4C4IA 1KE8A 5FM3A 3PP1A 1Q8WA 4BN1A 3C5UA 3FJQE 4F4PA 2B9FA 3OCBA 3P08A 4O0WA 4UZHA 3NZ0A 3BHTA 3FPQA 1H8FA 2OH4A 4ID7A 1I44A 1Q61A 5D9HA 4Q5HA 5IH4A 4ORKA 3S3IA 2OLCA 4UZDA 1WVXA 3DTCA 2QOIA 3LLAA 3P5KA 3PJ3A 2WMUA 4AAYA 3R00A 4AOIA 4DGGA 3DDPA 4J7BA 1XH9A 5AUXA 3BWJA 4L3JA 4GFOA 2W4OA 2Y4IC 2IN6A 4BJJA 4PV0A 3VIDA 1M2RA 3SXSA 3WZKA 2VO6A 4M15A 3TCPA 4EWHA 2JAVA 3RZFA 2VWZA 3DZOA 3OXIA 4BIEA 5BUJA 2YZAA 3EQDA 3DJ7A 4QP8A 3FQHA 4BIBA 3AC2A 5HE1A 4F63A 5I9WA 4OT6A 4DG3E 2PVNA 3PSCA 3ZLYA 3D0EA 4JBOA 4E6CA 5HE0A 4EOOA 2BRGA 3NNVA 4GG7A 3ORXA 3PVWA 5L4QA 4O7VA 2UW3A 1YDRE 3DBDA 4A06A 2LAVA 2I6LA 4FSZA 1XBBA 2BAQA 2OIDA 4BI2A 3DA6A 3D14A 4NCTA 1XMLA 4AWIA 4CXAA 3PJCA 2UZNA 4FKOA 3U9NA 2W06A 5D1JA 4Z7HA 3GU7A 1MRUA 2JFLA 4B8LA 1JKSA 5CF4A 2B55A