2PVKA

Structure-based design of pyrazolo[1,5-a][1,3,5]triazine derivatives as potent inhibitors of protein kinase ck2
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
328
structure length
327
Chain Sequence
MSKARVYADVNVLRPKEYWDYEALTVQWGEQDDYEVVRKVGRGKYSEVFEGINVNNNEKCIIKILKPVKKKKIKREIKILQNLGGPNIVKLLDIVRDQHSKTPSLIFEYVNNTDFKVLYPTLTDYDIRYYIYELLKALDYCHSQGIMHRDVKPHNVMIDHELRKLRLIDWGLAEFYHPGKEYNVRVASRYFKGPELLVDLQDYDYSLDMWSLGCMFAGMIFRKEPFFYGHDNHDQLVKIAKVLGTDGLNAYLNKYRIELDPQLEALVGRHSRKPWLKFMNADNQHLVSPEAIDFLDKLLRYDHQERLTALEAMTHPYFQQVRAAENS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Casein kinase II subunit alpha
publication title Structure-based design, synthesis, and study of pyrazolo[1,5-a][1,3,5]triazine derivatives as potent inhibitors of protein kinase CK2.
pubmed doi rcsb
source organism Zea mays
total genus 114
structure length 327
sequence length 328
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2007-05-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2pvkA01
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2pvkA02
5IA0A 3CXWA 5H3QA 2OFUA 4DFXE 2YA9A 3D14A 4V01A 4QPSA 5JZNA 4HGSA 4ID7A 3OOMA 2J5EA 4DITA 4E4LA 4BF2A 2C6OA 2W96B 2JFMA 2WQNA 2GS6A 3R01A 3W1FA 4FKPA 5L2TA 1PYXA 4KA3A 3MH1A 2ACXA 4U42A 4YPSA 4R77A 3MB7A 4X3FB 3C0HA 4FIJA 5IQFA 4W9XA 4EQMA 4OTQA 3BZ3A 3FY0A 3WILA 4DFNA 2C1BA 4G31A 4G5JA 2WMBA 4RX7A 2R5TA 3UP2A 4OT6A 5JKGA 4UWBA 1Q3DA 4BHZA 2VO3A 4FV1A 4ZLOA 3FSFA 2HIWA 2HELA 3BV3A 5DLSA 3RPYA 2OJIA 4EOOA 3VUKA 4C2WA 3GCQA 2WOTA 3AC2A 3ET7A 5I9VA 4GFOA 3ZLYA 2NRYA 5HNGA 4CLIA 2IO6A 4DEAA 4BDEA 3OCBA 3PVWA 3ZYAA 1PY5A 2XYUA 3ORTA 5IA1A 1R78A 5HGIA 3VRZA 2GU8A 3AMYA 1Q62A 2B52A 2C5OA 2BAQA 4PUZA 2CDZA 1E1VA 4OGRA 4KUJA 1RW8A 3R00A 4JQ7A 2W5HA 3CTHA 4FZDB 3U87A 4APCA 3U4WA 5G1XA 5DMZA 2PE1A 3G33A 5T3QA 3JR1A 3FYKX 4GVAA 4GSBA 3M1SA 2C30A 2WIPA 4TYGA 5FM2A 4C4JA 4OTFA 3E8DA 5DR2A 4C35A 2XZSA 5A4EA 4FEUA 4FICA 4JQEA 4O7LA 3E3BX 4YLJA 2VTOA 4B9DA 4UX9A 3V5WA 2Z60A 4IANA 4X6QC 5E92A 2VNYA 4HYIA 4P4CA 4QQ5A 5LMBA 1OITA 1VYWA 1TKIA 3QTUA 4R5YA 3OEFX 5JZJA 3R8VA 5H8EA 1ZAOA 4CV8A 2P55A 4JNWA 2HAKA 1O9UA 3MFRA 3Q9ZA 5B2KA 5IEVA 5KZIA 2PUUA 1ZY4A 3ODYX 4DT9A 4NIFB 4KIQA 4JRVA 4OAVB 3MW1A 3IK3A 2OFVA 3IS5A 4ALUA 1URWA 1Y6AA 4XYFA 2WTDA 3OCSA 4IFGA 2BHHA 1ZYLA 2P0CA 3NRMA 4X7QA 2ONLC 4E1ZA 4BR3A 3FBVA 3OY3A 3QZGA 3DLSA 2B7AA 5A14A 2QOKA 4O0RA 3LQ5A 4S2ZA 2ITVA 4FEXA 4PPBA 4YJOA 4HZRA 3ACKA 4N4SA 3TV6A 3VS3A 5IEXA 4RIYB 3GBZA 4RIWB 5J7BA 2ZDUA 1IG1A 2PVMA 2RGPA 2ZMDA 4CFNA 1PW2A 3PLAE 2WNTA 4FKVA 5HNIX 3RK9A 3FJQE 3R6XA 5CVHA 4QQCA 4ZSJA 3TM0A 4WUAA 3WE8A 5AR2A 5HHWA 3MFTA 3K5UA 5DIAA 4BB4A 3TXOA 4F9BA 5I4NA 3N4VA 1U46A 3DPKA 3E8CA 2JIIA 4I1ZA 3LXNA 2VTIA 3QCXA 4TL0A 2CGUA 3L9MA 3DDPA 3PA4A 4ASEA 1P14A 4EWQA 3MV5A 4PMTA 1OMWA 1Y6BA 3SXRA 2F7ZE 1XH9A 4JG8A 3VJOA 2I0HA 3R22A 5FXSA 2P4IA 3LJ0A 2HWPA 3RBWA 2X6EA 3DBCA 3EZRA 3F5UA 4O6LA 5IZFA 4GS6A 5KMJA 1YWNA 5AIRA 2Y6OA 4MNEA 3THBA 1UKHA 3AD5A 3TKHA 4ORKA 2JDSA 3W2PA 3QLGA 4R6VA 3GEQA 3ZRLA 1QPDA 1S9JA 3ANQA 2EB2A 4IX5A 3SKCA 4QMTA 3W10A 2X7FA 5J1WA 4K33A 5GZ8A 4O86A 3C50A 4IFCA 4U45A 5DA3A 3A4OX 4O83A 5IQCA 4C33A 4C4EA 5KNJA 5KCVA 3WIKA 2BRGA 4IB5A 3PXZA 5HD4A 3DQXA 3CBLA 3EKNA 2WEIA 3U4UA 3DBFA 3GU8A 2QU6A 5TKDA 1OL2A 3UG1A 3VAPA 3WOWA 2UZBA 2VWWA 4ANLA 4MKCA 5ACKA 3A7GA 4MD8E 4E5AX 4J96A 3TUCA 4FSMA 3WF5A 1Q41A 3KCKA 4PRJA 2PUPA 1KOBA 3GOPA 4I6BA 1W8CA 1SVHA 3HV5A 2C5YA 4EEVA 2UZDA 4H3PA 5ANGA 3UG2A 2QO2A 1W84A 2X81A 2J4ZA 5J1VA 3AMBA 3C4XA 5CVGA 3G0FA 5C27A 5C8MA 4CRSA 3NCZA 4UYAA 3HUBA 3LCKA 1JAMA 4BBFA 1WBPA 4E8AA 4UALA 1XH6A 2LAVA 4L6QA 4RX9A 1JKKA 1H07A 4BKZA 4I6FA 4HPUE 3C5UA 3TG1A 5M4IA 5E8VA 1NVQA 3MH2A 4AE9A 4RVMA 3O8UA 2CCHA 3HKOA 4O96A 1PXIA 5CX9A 1UWHA 3FXZA 2R3OA 2YLEA 4KBAA 2GS7A 4HOKA 3ULIA 4TYEA 4E6AA 3V3VA 3GB2A 3QD4A 2QHMA 4YZBA 4EQUA 5K5NA 3VO3A 3G0EA 5DGZA 5J5TA 3TKIA 3RWPA 4FV5A 1P4FA 3BQCA 3KN6A 2CMWA 4M84A 5AR7A 4D1ZA 3F9NA 3HZTA 4TN6A 3R63A 4EKKA 1YOLA 4ITJA 4M13A 2RIOA 5EM5A 3VBWA 4AA4A 4LMUA 4TPTA 4GH2A 4Y73A 5FLFA 2UZOA 4AU8A 5TO8A 4YJTA 5D12A 4RJ3A 2CN5A 5CSVA 3SV0A 3FXXA 4PY1A 4WBBB 4KD1A 5HVYA 1QMZA 3PXFA 2BKZA 3SW4A 2AUHA 5LMKC 4L52A 3WBLA 4EL9A 5CT7A 3IDPA 3IW5A 4NT4A 4MNEB 2I0VA 2F57A 3FZPA 3DV3A 2WB8A 4RX5A 4JDJA 4AW0A 2QNJA 1APME 3EFLA 5HG7A 4O0XA 2R9SA 2X6DA 3NDMA 3DFAA 3PY0A 5DR9A 5CAOA 4CFMA 5J9YA 5HI2A 1YI3A 4D2RA 2GSFA 4FKQA 1CKPA 2UVZA 1VZOA 1R3CA 2ITQA 2X8DA 2XM8A 4L3PA 4DEGA 2C68A 3UO6A 3F5GA 4YR8A 4YURA 3NUPA 4YSMA 2HZ0A 2WHBA 4QTBA 4IE9A 5HE0A 2VTLA 4D28A 4KSPA 3VW6A 2W1GA 4NFNA 3FQHA 3TCPA 4FKWA 4ACGA 4F1OA 3ORKA 4N0SA 5AR3A 1G8SA 4RLKA 5AP2A 5HO8A 1PHKA 3IW8A 1PXLA 5ETCA 3SG8A 3ZC5A 4FZ7A 2B55A 1OI9A 4O38A 2ERKA 3FSKA 5DT0A 5C26A 5HLNA 2QURA 2YDKA 5L8JA 3GVUA 2R3IA 3QD3A 2JKMA 4WKQA 2Y7JA 3OF0A 3BLHA 4LRJA 5BVEA 2YCFA 3GC7A 3HP5A 4JQ8A 2J0KA 3PRFA 3UQGA 1KSWA 4NM7A 2CNVA 2I6LA 3F3VA 4C61A 5HORA 4NL0A 4EJ7A 1BL6A 4G5PA 4AF3A 1R1WA 2W1DA 1WAKA 3AC8A 4FK6A 1OUYA 3EOCA 4U79A 4IM0A 2I0YA 2YIYA 1Q61A 4O21A 4O7WA 1MRVA 4CZYB 4UXQA 4M8TA 4C3PA 3LJ1A 1M17A 2ZJWA 2RF9A 3OWLA 4O7SA 3EIDA 2J6MA 4FGBA 5E90A 3E62A 4RJ5A 1DAWA 2OIBA 3IOKA 5EI2A 2C6EA 3LFBA 4U8ZA 3ODZX 1JOWB 4E93A 3P86A 2BDJA 4FODA 1UV5A 1JBPE 5AR5A 3RINA 3ZS5A 2OH0E 3G90X 4X0MA 3NS9A 2H96A 2BTSA 3B8RA 1H1PA 3NPCA 3LQ8A 2ZAZA 3ZUTA 3QWKA 3NZ0A 2C69A 2VTHA 3FLQA 3WZJA 3ALOA 1O6KA 5E8UA 2CCIA 3TJDA 2HXLA 4EH7A 5AP7A 5CF6A 3PZHA 3KKVA 4JBPA 4YHJA 3F82A 4U7ZA 1L3RE 3BHVA 4AA0A 5I9XA 3PXQA 5AX9A 5DEWA 4JL9A 2XNMA 3LMIA 3L8PA 3IONA 1EH4A 2R3JA 4BICA 1WBNA 3VBTA 5FM3A 4G16A 4MCVA 3EKKA 4K0YA 3V6SA 4QMWA 4RT7A 4FTLA 4UMRA 3BQRA 2WMAA 4D2SA 5IQGA 4DF3A 4X2NA 5LWNA 5M4FA 2GQGA 2W17A 3GGFA 4GIIA 2G9XA 4XG9A 1H25A 1OKWA 4FSQA 2P2IA 4IX4A 3ZO3A 3ZONA 4WNOA 4ANOA 4IHPA 2VTJA 3HAMA 5C8NA 3BBWA 2IVTA 3OUNB 1HOWA 4BHNA 3JVRA 5EM6A 2UZVA 4QP4A 2XM9A 4QMVA 4KRCA 4RJ8A 2Z7QA 2UZUE 2Z7SA 1J3HA 2R64A 4DG2E 3DXQA 1P4OA 4LOOA 1Z9XA 3MVHA 4XLIA 5AR4A 2BIYA 3Q9XA 4HGLA 5M57A 3FMKA 4RZVA 5IUIA 3A7FA 3ENMA 4JG7A 1E9HA 2XBAA 4IXPA 4WSYA 4XEYA 4Z9LA 4E73A 5EK7A 2C5XA 3RGFA 4TYIA 5FRIA 3QFVA 4BTFA 4FTKA 4CQEA 4D4VA 5DBXA 3JY0A 3MTLA 3LM0A 4I5HA 4QO9A 1XWSA 3TWJA 2WTIA 4J98A 3QX4A 2A4LA 4YO6A 3UJGA 2R3RA 3IO7A 3K2LA 4QTAA 3OT8A 2HYYA 5JFXA 4F64A 4AOTA 3OD6X 2R0UA 4QYYA 5HQ0A 2RFEA 5BPYA 4II5A 3A2CA 4EC8A 1H27A 1IA8A 3R7EA 4APPA 4J97A 1K2PA 4U81A 1Q3WA 3FQEA 5ACBC 4BWXA 3FMDA 3FE3A 2UZTA 2CNUA 4JOAA 4QMZA 3ZSGA 4IVAA 5EDQA 5DHJA 4YHTA 4BIDA 5KMLA 4Y46A 1BI7A 4UXLA 3G9LX 4BGQA 2OBJA 4M97A 2GHLA 3EQGA 3IDCA 1B38A 2DUVA 3WI6A 1PKGA 4ITIA 4MXZA 3Q2MA 2OKRA 3OT3A 4YJNA 2VU3A 3NX8A 2ZV2A 4U43A 3D2IA 4OR5A 2Z02A 3LLAA 1OECA 4ZLYA 3CPCA 4ZY6A 4BKYA 3EHAA 4BZOA 1LPUA 3ZZWA 4F08A 1H8FA 4ZY4A 2O3PA 5M53A 2WPAA 2QG7A 4C3FA 5CSWA 2ITXA 1CM8A 2R3NA 3O51A 3G15A 3UYTA 3RWQA 1JVPP 4MVFA 4USDA 5GJGA 2BAKA 5LJJA 3OY1A 4GYIA 3RALA 2CSNA 3ZDIA 4FL3A 4BTJA 2IPXA 5IH5A 3MIYA 5I3OA 3T8OA 4KINA 4YHFA 4ONAA 5HBHA 5IA5A 3DOGA 5ANIA 3Q60A 3F2NA 2Y8OA 1Q8ZA 4B7TA 4EWHA 3FLSA 5GINE 3PJ2A 2VO6A 3E3PA 5AA8A 1M14A 2C5NA 5K0XA 5HU9A 5CU4A 1NVRA 3V5JA 5E1EA 2OJGA 4E4MA 3KK8A 4RWJA 1XR1A 3PPKA 2WQMA 2F7XE 3P7CA 4FSYA 4L7FA 5H8BA 4IQ6A 4ZJJA 2FA2A 3LLTA 2PVYA 4FC0A 3RAHA 1FVTA 2Y9QA 3R0TA 4QMUA 2Y4IC 3FMJA 3SQQA 5CAVA 3AGLA 5KMIA 3S0OA 3Q4CA 3W18A 5T68A 5ETIA 4FKLA 3UBDA 4ZSGA 2QLUA 5J7HA 2R3MA 4TYJA 4PQNA 4RMZA 4FV9A 5KMOA 1U5QA 2YERA 3FMLA 5EW3A 1DM2A 3TIYA 3FC2A 3UC4A 4AZWA 4DTAA 3R1NA 4NKSA 4LV8A 5KZ0A 3KREA 5KE0A 3VS5A 2WMUA 2R3PA 3Q53A 3ZC6A 5GJFA 3GNIB 3BHYA 4FV7A 2O2UA 4KWPA 3FZRA 4EQCA 5BYYA 2PU8A 2I1MA 2HY81 3UQFA 4A4LA 5CQWA 4FKOA 5IUHA 4UWCA 1SNUA 2OF4A 3QRIA 4JAJA 4ACDA 3EN6A 4GCJA 5A3XA 4TW9A 1REJA 4LYNA 4EKLA 2XNOA 5JQ8A 4JT3A 2CGXA 2WTCA 3TI1A 3UOJA 5HCXA 2QG5A 4E4NA 2O65A 2RFSA 2J51A 3ELJA 3JS2A 5B7VA 5IH6A 5J5SA 2ITWA 4QPAA 3LZBA 4FGRA 2OXDA 3I79A 4GW8A 1JKTA 3N51A 4I0SA 1TQPA 5BUIA 4M0YA 3L8XA 4D0WA 2WTWA 2PHKA 2W4KA 3D5VA 5DH3A 3UIBA 3UIUA 4YSJA 4QPMA 4BTKA 4I5CA 3K5VA 2OJFE 3T9TA 3NW6A 5FEEA 4AXAA 4BFMA 4CV9A 4G2FA 3WARA 5LWMA 2VO7A 1YXTA 3LXPA 3DAJA 4FIEA 4CCBA 2PSQA 4RJ4A 1GIIA 4G3GA 3QRUA 4E5BA 3GOKA 2YM3A 3ZBFA 3WZUA 3QBNA 4MAOA 4C4IA 5CS6A 3VN9A 4L53A 4DH8A 5HKMA 1G3NA 2UZNA 4F4PA 3EH9A 5JRSA 5EYDA 2ITPA 4MBIA 1A48A 4IAAA 3KULA 3POOA 3BGZA 2G2FA 2C1AA 5CANA 1UWJA 2HW6A 2XCHA 3TUDA 5HNBA 2ZV8A 3W55A 5AP4A 2XNBA 3D5XA 4HPTE 1OGUA 1OL6A 1H28A 2CKEA 4A9RA 3EZVA 5EM8A 2BUJA 3TJCA 2NO3A 2JFLA 4M67A 2UVXA 4UY9A 2OZAB 4R1YA 2ZM1A 4EOPA 2IZUA 3PWDA 3QA0A 3DQWA 2ZM4A 4CCUA 5FXRA 4O7VA 5EQPA 2C6TA 3EWHA 2VTMA 4G9CA 4Y83A 5C01A 4GV1A 3DJ6A 3WF7A 2H6DA 3KMWA 4K2RA 4MQ2A 3R8ZA 4GL9A 4QQTA 4GRBA 2QKWB 3BE9A 2X8IA 4A9UA 2QONA 3Q4ZA 5DT4A 2BFXA 4I5PA 5CI7A 3QTWA 4ALWA 5LOHA 4ZMEA 3QL8A 4W4XA 2HZ4A 5EYCA 4BY9E 2IVUA 2OZOA 2Q0BA 1W98A 3BU3A 4FKGA 4XBRA 1H1WA 1AGWA 1PXPA 2B4SB 3Q2JA 4Q9ZA 4X2GA 3NWWA 4E4XA 5J87A 4D5KA 1YQJA 5B0XA 4CRLA 2FSLX 4FV0A 4RRVA 3JVSA 2OLCA 4G3FA 4EYMA 4CYJA 4ZAUA 4QMMA 2XH5A 4UZHA 4X21A 5AV1A 2IZSA 4BDGA 4RFZA 4WIHA 3VWAA 2HWOA 3AC1A 4LRKA 1M52A 3QD0A 4DFUA 2NPQA 3SXSA 3OCGA 3E63A 4PP9A 4WNPA 4EONA 3R7YA 4D9TA 5FTGA 2G01A 3HV7A 2WOUA 4HVGA 5KUPA 2ITUA 4PL3A 3QQFA 4XMOA 2BROA 5LVPA 4P90A 2YIRA 4H05A 2WO6A 4RWIA 1NA7A 1Z57A 3VUHA 1OBGA 3UPZA 3CQEA 5BMSA 1OPKA 4IC7A 2PMNX 4GK2A 4BDIA 2BHEA 1NVSA 3R04A 5IQEA 5LCKA 4K6ZA 5CXHA 4L43A 4CTBA 3F69A 3E7VA 4ZSAA 2C3IB 4GIHA 4ZTMA 1XO2B 3IECA 4KKGA 1YI4A 4E7WA 3BX5A 4I94A 3LPBA 3HA6A 5M4UA 4M15A 4K11A 4G17A 3VS2A 2UW4A 3LOKA 3I7CA 5JGBA 1WVYA 4G6OA 4NIFA 4U40A 5CAPA 3EB0A 3RK7A 3ROYA 5L2IA 4Q2AA 3UO5A 3M2WA 2JIVA 2XKDA 2WKMA 4EOLA 2XS0A 4AN2A 1PF8A 4XG8A 4C02A 1WVWA 2ZOQA 4Z16A 3EL7A 1G8AA 4GG5A 4EH2A 1PXMA 4OBOA 5AX3A 4RBLA 5M08A 2XRWA 2EWAA 4IJPA 4B8LA 4CMTA 1JPAA 1O6YA 2R7BA 1Q24A 4IVBA 4RIYA 2YZAA 3R7IA 4PWNA 4W8EA 2RG6A 1WBWA 2BAJA 3G6HA 4K77A 4ARKA 5IMEA 1CKJA 3A8WA 3NSZA 3DK7A 4EHZA 1LP4A 3CKXA 4M12A 4EOSA 4LM5A 4D4YA 3U51A 2W5AA 4J95A 2IJMA 1J7IA 2ONLA 4GKHA 3RI1A 2A19B 4HJOA 4XG7A 3KRWA 2XK3A 2BDWA 4G9RA 4D55A 4EK4A 4ZS0A 1WZYA 4EH4A 1BX6A 5GHVA 5IA3A 2JAVA 3DCVA 4BCQA 3HMIA 3P79A 5KX8A 3KRLA 1QPJA 4JIAA 3EN7A 3HX4A 3ORPA 3WZDA 4A4XA 5HLWA 4AGCA 5AUXA 3TNPC 1SVEA 1E1XA 1TVOA 3ZUVA 1ZYJA 2WXVA 3VULA 3PE2A 4KNBA 4YU2A 2F9GA 3TKUA 1H0VA 3L9LA 1QL6A 4F63A 3E8NA 1SMHA 4IBMA 1LR4A 2QOQA 4DH7A 3SGCA 4RFMA 3S95A 4QTEA 5CU6A 2IZRA 2FSMX 1RJBA 3D2KA 2HENA 4JI9A 3MA6A 5BYZA 4U97A 3MDYA 4ZIMA 4RJ7A 3QZIA 5BNJA 4LUDA 1P5EA 1PMUA 2VV9A 4WNMA 2PTKA 2Q83A 4M66A 2IWIA 3RTPA 3PXKA 4MBLA 4PTEA 2C6IA 2PZRA 4UYNA 3UYSA 3ZSIA 4AZFA 4DC2A 4PDSA 2UZWE 4MF1A 1M2QA 3ZLWA 1WBTA 4MXXA 3CEKA 2G2HA 2YDJA 3H9RA 4FR4A 3C0GA 1ZMUA 4IWOA 4YNOA 4CT1A 4JS8A 2XF0A 4N6YA 3VBQA 1FPUA 1VEBA 5EM7A 3WE4A 5L8KA 3DKCA 1CTPE 4AW5A 4H36A 4ANNA 4Y5QA 4WUNA 4KS8A 5CNOA 3NEWA 4FNZA 2VWBA 4YC3A 3LFAA 5BX0A 2RFNA 2E9UA 3R8MA 3ZM4A 4EHVA 3C9WA 3D5WA 3RZFA 3WF8A 5HICA 3SHEA 3DT1A 2VO0A 3G51A 3EFJA 2O0UA 5GJDA 4N57A 2YITA 4DGNA 2I0EA 4HZSA 3ULZA 2VUWA 4FG8A 4FK3A 4OT5A 3QX2A 4FNWA 3QZHA 2FSTX 1ZRZA 3BE2A 3MS9A 4F0IA 2QOHA 4EOKA 3V01A 4JDHA 3VQHA 1NT2A 2GNHA 2H8HA 4DBNA 4JX7A 2F2CB 2JKOA 3KGAA 4BBMA 2QVSE 5CEOA 3LJ2A 5HO6A 5KKRC 2QHNA 2EXCX 4PMMA 4H3BA 3LCTA 3R9DA 3ZXTA 3MBLA 3AC4A 2BRHA 2NRUA 4RG0A 4WRSA 3LFCA 4C0TA 5C03A 3QQUA 3LXLA 3P1AA 5ETFA 4ANBA 5K3YA 4B0GA 4O0VA 2PE2A 4AT4A 2E9PA 2VTQA 3OTVA 5D9HA 3AT3A 4FTJA 1I44A 5CZIA 2FSOX 4E6QA 4C2VA 2XVDA 4LV5A 2PVFA 4USEA 4PTCA 3OXTA 3BBTB 1OUKA 4XNEA 1H24A 3TZ9A 3SX9A 3R1YA 5J95A 1SZMA 5M07A 1LEZA 1VR2A 4PDOA 3SOCA 3PVGA 2PY3A 5CU3A 4XRLA 4J8NA 4G1WA 5D7VA 3UC3A 3PSCA 1FVVA 4LGDA 3F3UA 3WIGA 2UW6A 2UW5A 3F2AA 3LFNA 3R2BA 5CEKA 4FV6A 1YWVA 4FVPA 4EK6A 3RPRA 3O17A 2QOCA 1UKIA 3FMEA 4KIPA 3KVXA 4I20A 2W9FB 4J71A 4QNYA 3ZEWA 5K4IA 4OTRA 3FC1X 3FZOA 4F6WA 1ZXEA 3IDBA 4K9YA 3GU4A 3F3WA 4AGWA 3I4BA 4BI0A 4EBVA 4ERKA 5JGDA 4Q9SA 4E6DA 4FTMA 1MP8A 3FLYA 3QRKA 4TWCA 4XV9A 3D7TA 3W2OA 5JMSA 4HYHA 4LOQA 3QCQA 3PZEA 2XKFA 4ANQA 3OROA 3AD4A 3COIA 4KBCA 3TN8A 3UMWA 5AP6A 4AA5A 4FSUA 4KKHA 4DCEA 4U80A 3VHKA 4YJRA 2OU7A 4U0IA 4TRLA 2BKKA 3PDTA 2XCKA 2VTNA 4EOMA 4AG8A 3ZUUA 1J7UA 4FEQA 5FQDC 3PA3A 5AA9A 2VGPA 4L42A 5ETAA 5DFPA 4IZYA 4YTCA 1GZ8A 3ZFXA 4YJQA 1ZY5A 5L6PA 1H26A 1PXKA 4PF4A 3FYJX 3HDNA 3QUPA 1QPCA 4B6LA 4DEHA 5E1SA 5KMNA 5J9LA 1U5RA 1XJDA 3GC9A 2XP2A 4FIHA 3AT2A 2W1EA 2PUIA 3BKBA 2C0TA 3NUSA 4NH1A 4DEEA 2G15A 2C3LA 5HZNA 1FINA 3RCJA 1JSTA 4BDFA 1PRYA 2XUUA 5JN2A 2YIWA 4GT4A 1ZYSA 3DLZA 4AN9A 3VS4A 4BI1A 4DN5A 2F2UA 2HW7A 3GI3A 4F0GA 5AP5A 5AV0A 4D2TA 1LUFA 2NP8A 2C4GA 2QQ7A 3C0IA 4LOPA 4MXCA 1JQHA 3KRRA 1XH8A 2ESMA 3FKNA 1BMKA 2JDTA 1SVGA 3HNGA 4DH3A 3ZFYA 5EW8A 1Q8YA 4BGHA 1PXNA 5IISA 1HCKA 2JBPA 1JKLA 4GYGA 3KF4A 3E87A 1GOLA 2X39A 1SYKA 2BDFA 4AGUA 2XNPA 3AT4A 2CJMA 4XCUA 3K3JA 4AP7A 4BIEA 3W2QA 3H30A 4KBKA 3O50A 4QYEA 5LVMA 4YPDA 3SRVA 4LUEA 4N6ZA 4CSVA 5HX8A 3Q4UA 5BVKA 3Q6WA 2R3LA 5DEYA 5TF9A 3N9XA 3UMXA 5M51A 4IAFA 4YC6A 3BLRA 3OVVA 4F6SA 4L3JA 3KXXA 3SVVA 3P7BA 4A4OA 3TZMA 3H3CA 4CFVA 4D2VA 1BL7A 5E8WA 3VVHA 3MY5A 2UVYA 4I22A 5HBJA 2JEDA 1CMKE 3P9JA 3OXZA 3D7TB 2O8YA 4IAZA 4W4WA 4F9WA 2HY0A 3SDJA 5JQ5A 4FZFB 2X9EA 1DI8A 4TTHB 4AOIA 1JWHA 1OM1A 4HNFA 3LW0A 5FG8A 3ZRMA 3HP2A 2G1TA 4DH5A 4Z7GA 2BZKB 5HE3A 1L8TA 4F1MA 3PVUA 2YFXA 3SA0A 3H0YA 3R02A 2QOIA 2B9IA 3BHUA 3RPVA 4BDKA 4MBJA 3AG9A 5K0KA 4M0ZA 5HBEA 1W7HA 2WMVA 3MPMA 4DLJA 4BCPA 3OZ6A 1I09A 4MX9A 2I7QA 4ZZMA 3ZLXA 1H1QA 4RIXA 5HOAA 5DVRA 4XRJA 1M2RA 3JPVA 4ZSLA 2UW0A 3I5NA 1MRUA 5AAEA 1R39A 4WSQA 4FTIA 3UZRA 3NIEA 2WU7A 5L6WL 2GQRA 3KN5A 4I93A 5HX6A 3R9HA 3FLWA 4OTHA 4DGMA 2W0JA 1ZMWA 4FKJA 3P0MA 4I6HA 3Q5IA 4ZSEA 5C9CA 2C6DA 3IW7A 4E20A 1XH7A 2FH9A 5LMAA 3MGYA 1XBBA 1GAGA 4NW5A 4E5WA 2BPMA 2W99B 5IPJA 2QKRA 4JX3A 3R28A 3FHIA 2OF2A 4BCKA 1TQIA 4F99A 2X0GA 3UOLA 3DAEA 3ITZA 1BI8A 2BILB 3HVCA 3NYXA 3GFWA 4LI5A 2YM5A 3RHXA 2OIQA 3CPBA 3HUCA 2J2IB 1G5SA 2H9VA 5IH4A 4FIFA 3DKOA 2YN8A 3HV6A 5FDXA 3LKMA 4PL5A 5CEIA 4HVDA 4AGDA 5HG8A 3OW4A 3ALNA 4IX3A 5CU2A 3SRVB 4JJRA 3CKWA 3EQFA 3UIXA 4EJNA 4CLJA 1DI9A 3A60A 1OZ1A 4YP8A 5E8TA 3GCSA 4MD7E 3EQPA 3RAKA 3QHRA 3RVGA 5KO1A 1GJOA 3QC4A 4JG6A 1MUOA 4JXFA 4NEUA 3QTQA 2EB3A 2FVDA 3I0QA 3PJCA 5ANJA 5FXQA 4HVSA 3VIDA 1KE6A 5A46A 1M2PA 2WQEA 4UMTA 3COHA 4WO5A 5IUGA 3NNUA 3MA3A 3IPHA 4MXOA 4EUTA 4UMPA 4DFZE 3EQBA 4XJ0A 1OL5A 3MJ1A 4I21A 3VUGA 2GHMA 1Q4LA 2B53A 3D15A 5DR6A 4UZDA 5HESA 3KXGA 1YDTE 4TNBA 1H0WA 4BDJA 2O5KA 4DEBA 3PJ8A 3V51A 4PX6A 1YXSA 5L6OA 4KIOA 4XV1A 3KRXA 4RVKA 4MXAA 2WGJA 1KV2A 5GZ9A 1TQMA 4A9SA 3TZ8A 4O82A 2XEZA 3KK9A 5A6OA 2J0JA 3G5DA 4F1TA 4FA2A 4HCTA 4ZEGA 5IEYA 2YZLA 4JAIA 3O71A 2C47A 4RA5A 3GU5A 3UNJA 3ENHA 3GCUA 3NW7A 2W1ZA 3FPQA 5CALA 4OUCA 2XKEA 3A8XA 3L8VA 3IOPA 3ZU7A 1OKZA 2UZLA 3G9NA 3S2PA 1XQZA 2QODA 3DBEA 4IM2A 4QTCA 4RIXB 5B2MA 4BDBA 4MQ1A 4P7EA 3S4QA 4DG0E 3ORMA 2WTKC 1XBCA 4WRGA 5FBOA 4ANSA 2B9FA 3LIJA 2CNQA 3M11A 1GIJA 3MH0A 4MEDA 5AM7A 1UNLA 3HMNA 4C37A 4DEDA 2UW9A 4WG3A 4FKTA 2BR1A 3LHJA 3A99A 4NK9A 3VJNA 2IW8A 2UV2A 5LCJA 4FT3A 5L3AA 5LQFA 3MB6A 4Q5HA 3JXWA 3DBQA 2ZB1A 3E92A 2YACA 4PV0A 3DTWA 3NUUA 5CWZA 5DYJA 3ZRKA 4BTMA 2ZM3A 2OJJA 3TNQB 2QU5A 4J1RA 2JKKA 3LFEA 3PVBA 4KKEA 4MH7A 4XP2A 5EI8A 3MI9A 3Q5ZA 4O2ZA 4QT1A 3C4ZA 4IW0A 5HG5A 4DAWA 1Q97A 4QRCA 3SLSA 5HLPA 4QMXA 3R9RA 1GZOA 2JLDA 3BU6A 5L8LA 5TE0A 1IA9A 3FDNA 3R7OA 1XH5A 4PMPA 2CPKE 1PMVA 1QCFA 4PMSA 5HCZA 2Z7LA 3BRBA 3QTZA 1H08A 2YDIA 4BGGA 4JBOA 4BC6A 5JGAA 3F3ZA 3IQ7A 3ETAA 1DAYA 2WMSA 3U8WA 3OWKA 2GFCA 3W16A 5ICPA 3KRJA 4C57A 3VBYA 4DE4A 4MD9E 3VHEA 1Z5MA 3MY1A 5CENA 5HG9A 1P2AA 2E9NA 1AD5A 3DAKA 1J91A 4FUXA 3FQSA 3AC5A 4L00A 2IVSA 3TNIA 2VTTA 4NTTA 3HV4A 1Q5KA 3DB8A 2BVAA 5CSHA 4F0FA 3QALE 2QR8A 2YWPA 3D9VA 2GS2A 3E64A 5HIBA 3ROCA 2CKQA 3II5A 4KABA 2XBJA 4FKIA 4GT5A 4RVTA 4ACHA 4CZUA 2OW3A 4GU9A 4IAYA 1YWRA 3BI6A 3VBXA 3EL8A 4L9IA 5ANDA 4GEOA 5L2WA 3QGYA 4FX3A 4QMSA 3IW4A 2ITZA 2F4JA 2V62A 3E5AA 4O0YA 3VUIA 4AW2A 4UN0C 4JRNA 5HTIA 2J50A 3ATTA 4AZVA 3ZO1A 3MN3A 2GNJA 5HVJA 2FO0A 2PZPA 2BZHB 3DJ5A 5AUVA 2OZAA 2XIXA 2Z7RA 3UTOA 4O84A 1OIRA 2RKUA 3LMGA 3R1QA 4YZCA 2Z2WA 3FLZA 4BDDA 3JY9A 3T3VA 3DXNA 4F9AA 4K8AA 5EW9A 3BYOA 3ZBXA 4H1JA 4YTIA 1UVRA 3BEGA 4EZ5A 1ZYCA 1M7QA 4DTKA 2JD5A 3UZTA 5AMNA 4BYJA 4ZZNA 4S33A 4OTWA 3I6WA 4QMYA 5F20A 1R0PA 3QCYA 1ZZLA 3QWJA 4YBKA 5AV2A 4C34A 2GQSA 3ZZEA 3NMUF 3TNHA 4M68A 2Y4IB 3HLLA 3S1HA 4O7ZA 5HIEA 5HU3A 1ATPE 3FMNA 4EUUA 4C4HA 5LARA 2AYPA 3LQ3A 3NLBA 4PNKA 1KUTA 4UV0A 3DA6A 3OFMA 4TWNA 4BZDA 5E8SA 4ACCA 4NCTA 3REPA 2XK9A 2JGZA 3LCOA 3QC9A 5DRBA 3ORZA 2QR7A 3F61A 3KL8A 4FF8A 3R8UA 4Q5EA 3R71A 4AQCA 4QMNA 2VNWA 2FGIA 2JKQA 2WFYA 4L01A 4OTIA 3HMPA 2GNFA 1NXKA 3NUNA 4L44A 4IZ7A 4D2WA 3D4QA 4NKAA 4I6QA 4B4LA 2ITYA 4D0XA 2XIZA 4I41A 5HVKA 3QRJA 4GMYA 3ZM9A 2QLQA 4OTGA 1K9AA 4NU1A 4YTFA 4FL1A 2VWIA 3KC3A 3P23A 4C62A 3ZO2A 3Q9WA 5M4CA 5BVDA 5CEPA 1WMKA 4U3YA 4IAKA 5AEPA 3DK6A 3O23A 4D4RA 3CJGA 4DFBA 3FI3A 4TYHB 4FZ6A 3BWFA 3VS1A 2R3GA 4XV3A 3TZ7A 3PSBA 4CKIA 2YM7A 3P78A 4G34A 4RWKA 4MNFA 1WBSA 4NM0A 4NJ3A 5BVWA 3MY0A 5A54A 3TV7A 3GT8A 4XOZA 4ZTHA 3FKLA 3OCTA 2YJRA 3F2RA 4BN1A 4MF0A 5EHYA 3RHKA 4QNAA 3GU6A 3R2YA 4U41A 2PMIA 3E8EA 3IW6A 4WOVA 4YZNA 4L68A 3RM6A 4R3RA 4W4VA 3QYZA 4FTQA 4EOJA 3HRFA 5LVLA 4MHAA 4PTGA 3PFQA 4FTOA 5H8GA 4AUAA 4EHGA 2YCQA 4U3ZA 4O22A 3COKA 4HVIA 1JSUA 2YLFA 3UO4A 3KCFA 1YHVA 1STCE 4CMUA 5DN3A 2PVHA 1V1KA 4TT7A 3PXYA 4FT7A 1IEPA 1XBAA 4DH1A 4L46A 3ZOSA 4DTBA 3JYAA 4FTNA 5E8XA 2PMOX 4U44A 2OXXA 4ZXTA 5M06A 2VTPA 4XOYA 4TWOA 3CP9A 3CS9A 4G6LA 3CD8A 3RK5A 1KE9A 2KULA 3CJFA 3U6HA 2XKCA 2XK8A 4JLCA 4RC2A 3A4PA 4DFYA 1FGKA 2PL0A 2ITOA 4RC3A 5AIKA 5HD7A 4AZEA 2XK6A 4FI1A 3NAXA 3QXOA 2J0LA 3QKMA 4Y95A 3QQLA 3ZMMA 3MH3A 4PPCA 2DWBA 3PJ3A 2VWUA 3LXKA 4ZTRA 3E7OA 4CFWA 4CMOA 5AUUA 4O81A 4WD5A 3OUKA 5LVOA 5HE2A 3NVMB 4TY1A 4OTPA 2ZDTA 2WIHA 4NM5A 3BWJA 4G3DA 3T9IA 2B9JA 3NR9A 3R30A 4IB3A 4ZJIA 5M55A 4D2PA 4BDHA 4X6RA 2HCKA 3KXHA 3EMGA 3KQ7A 2V7AA 3QU0A 2V7OA 2ITNA 5L4QA 3FZSA 4C7TA 4R5SA 2V0DA 1GNGA 4ASXA 5FEDA 4ASZA 4KS7A 4CD0A 2GTNA 4QYFA 5D11A 4EH9A 5EKNA 3ZLSA 4XLVA 2OWBA 5I3RA 4FSWA 4XG4A 2FUMA 2OICA 1YXXA 1ZOGA 4IIRA 3RAIA 1J1CA 1UU3A 4F65A 3CQWA 3C51A 3LFQA 2ZV7A 3ZO4A 4ZZOA 2WEVA 2XJ1A 1YW2A 2IW6A 2XEYA 3CTQA 3FV8A 5I0BA 3OW3A 3U54A 3OXIA 3Q4TA 1OPLA 1RE8A 3LE6A 2BIKB 1M7NA 4CKJA 2PULA 1WVXA 1J1BA 1REKA 4XP3A 4YJVA 3V5TA 4O0TA 3MFSA 3F7WA 3GC8A 3Q32A 2W1FA 3FI4A 4TXCA 4X2JA 3AMAA 3QRTA 5JFVA 2YIQA 3TIZA 5IG1A 4ZTSA 3E93A 4BCOA 2JITA 2J0IA 4HVHA 3NVKI 2HXQA 4Z7HA 3U6JA 4YJSA 2YAAA 3GU7A 3KVWA 5D1JA 1K3AA 1RQQA 3DNEA 5CU0A 3QQKA 3DKGA 3L8SA 3V5QA 4GK3A 4AS0A 3OHTA 4NYEA 4BDAA 5M09A 2RFDA 3A62A 2VTSA 4KAOA 4IB0A 4CFFA 4DG3E 3NNWA 2E2BA 4HCVA 3H0ZA 3MTFA 2BCJA 3HV3A 2B0QA 4FNYA 4R7IA 3DS6A 2A27A 2VX1A 3SAYA 4X3FC 4BWKA 3OG7A 3MVLA 3AC3A 3S00A 4YGAA 2JIUA 3EQDA 1JNKA 2VX0A 3FZ1A 3I5ZA 4IJ9A 1WBVA 2P3GX 2W4JA 3R83A 4CTCA 5JEBA 4I0RA 1FMKA 2QOBA 2YEXA 2X1NA 5K5XA 3HEGA 3K3IA 3KFAA 3Q9YA 2GHGA 1F5QA 3DNDA 4J53A 3ZDUA 4HYUA 3Q3BA 4FSTA 2XMYA 3PWYA 5KMMA 4S34A 5JRQA 1MQBA 3KXZA 5FP5A 5BYLA 1BYGA 3CD3A 4XP0A 4QP1A 5IA4A 4W9WA 2PMLX 4MTAA 2IW9A 3VRYA 4V05A 2VWXA 5CI6A 1R0EA 4DFLA 2PVRA 4CQGA 3UVRA 4WHZA 3VS0A 5EDPA 4GFMA 3BELA 4ERWA 2YAKA 3ACJA 3LMHA 5JK3A 3QKLA 4A9YA 4C36A 4R1VA 4ZS4A 3CC6A 1O6LA 3ZEPA 2NNWB 2QO9A 4MWIA 2Y6MA 4GJ2A 4RC4A 5HIDA 4HYSA 1FBNA 2XRUA 4QYHA 5HTCA 3CQUA 3FI8A 4Z3VA 2ETKA 1Y8YA 4NUSA 5FGKA 2Q0NA 3FY2A 1LEWA 4GK4A 1A06A 1MQ4A 3A7JA 1UNGA 5EI6A 3R8PA 4O0SA 2XIKA 3GENA 1ZOHA 3A61A 3VNTA 2EVAA 2OIDA 3UGCA 1UU8A 3ERKA 5DI1A 4NZWB 2WMXA 3F66A 4V0GA 3ZH8A 4DLIA 3MPAA 2ETMA 2VTAA 3MFUA 4DEIA 5EQYA 5IKWA 4TNDA 2X2LA 5EDRA 2CHLA 4DGGA 2OG8A 4FT5A 3D83A 5ANKA 3QUEA 4RQKA 4ASDA 3HECA 3PG1A 2X8EA 4FEVA 4CGAA 4CT2A 1Y91A 2ETRA 5CVFA 3PIYA 4YLLA 4OTDA 4IEBA 3F7ZA 5J79A 1SNXA 2ZB0A 3F6XA 4QD6A 4A9TA 2AC3A 1Q8WA 2DYLA 4JR7A 2V55A 2ZV9A 4MWHA 3QQGA 4YLKA 4ALVA 2W1CA 1KE5A 4L45A 4EORA 3O8PA 4AT3A 5GZAA 1F3MC 3PSDA 5D10A 2HK5A 1VYZA 4GUBA 2C0OA 1V0BA 5E7RA 3EQRA 5F1ZA 1X8BA 5HEZA 3DKFA 4NW6A 3QQJA 4M3QA 2JBOA 3C4CA 3BU5A 5E4HA 3V8WA 3FPMA 4F9YA 4EC9A 5F95A 4J99A 5KKRB 2CLXA 2E9VA 3BEAA 4S32A 2A1AB 2R2PA 3SD0A 4BZNA 5KBRA 5C4KA 3UOKA 3KXMA 4EZ3A 3D7ZA 4FVRA 3E88A 4YZ9A 4GFGA 4KB8A 1A9UA 1PMNA 3O7LD 2PPQA 1SM2A 4EH8A 2F49A 1HCLA 5GIOE 4G3EA 1Y8GA 3NAYA 5EQEA 2VN9A 3O7LB 4KSQA 3RPOA 4XG2A 4V04A 2GFSA 5IQBA 2CLQA 5FBNC 4IADA 4IM3A 5LMKA 1GY3A 4OAUC 2WQOA 3W33A 3OBJA 5FWKK 5KMKA 3TTJA 4AZTA 3PYYA 4FV4A 4FNXA 2WAJA 3UIMA 5AADA 5IA2A 4GVJA 4LFIA 5ANEA 5FP6A 2WQBA 4DHFA 4RVLA 3MESA 3W8LA 4BI2A 3TUBA 2OGVA 3K54A 4FTRA 3TNWA 3UNZA 4RGJA 5J8IA 3EN9A 4EZ7A 5L2SA 4ANMA 1URCA 2DQ7X 5CF8A 4N70A 4RSSA 4O0UA 3PJ1A 3PXRA 4YMJA 5AUYA 4K18A 3AD6A 4EK5A 3KY2A 3OWPA 4F70A 4GG7A 3Q96A 3CCNA 3VF8A 4BCNA 4O6EA 1DS5A 3S3IA 4V0GB 4FOCA 4AE6A 3R7GA 4QP8A 4EBWA 4CFUA 1T46A 4EYJA 2VGOA 4AOJA 3QTXA 3M42A 4LGGA 5EOBA 5G6VA 4EH6A 4F6UA 4PPAA 4KIKA 3OS3A 2BALA 5BVNA 5FDPA 3PRIA 3H9OA 3TDVA 1UU9A 1T45A 3COMA 5A4LA 1KOAA 3HL7A 4EOQA 2PWLA 3OEZA 1ZYDA 2X4FA 3ANRA 2YM6A 4FIGA 5I9YA 4JDKA 2C6KA 3HRBA 2GNGA 4LRMA 5IQDA 4R78A 5E91A 3R1SA 3UDBA 5CSPA 1H01A 1YHWA 1YDSE 4JBVA 4OLIA 3RM7A 2IN6A 5I9UA 1UU7A 2PVJA 3KMMA 5LVNA 3DGKA 4FVQA 4HNIA 2V5QA 2I40A 3C4EA 3V6RA 2ITTA 3VBVA 4CEGA 4RFYA 3UP7A 2W4OA 2REIA 5AAGA 3FUPA 3V5LA 4KRDA 3TTIA 2PVNA 3DTCA 3KB7A 4Z55A 3G6GA 4BCJA 3ORXA 4XH6A 4F7SA 4YJPA 1YHSA 5E8YA 3W32A 3RMFA 4AN3A 3ZTXA 2F7EE 3DXPA 4NFMA 4B8MA 1U4DA 3O2MA 1OBDA 4I4EA 4O7YA 3AGMA 2QC6A 4DA5A 3EQIA 3LFSA 4Y8DA 1YDRE 1F0QA 1RDQE 5AUZA 2VD5A 5TR6A 4ITHA 4FSZA 2PVLA 2PZ5A 4IX6A 4XX9A 4H39A 4DGLC 5AFVA 3FEGA 4QQJA 1WCCA 2PE0A 3NYOA 3QLFA 3VS6A 4AACA 4IH8A 5A4QA 1ZZ2A 2HOGA 3LAUA 4XG6A 2YHVA 4QOXA 3TEIA 3FL5A 1OPJA 4I24A 3GUBA 3QTRA 5C1QB 3O8TA 4R3PA 4BBEA 3QKKA 4FG9A 5HCYA 5T6KA 3C1XA 2WMTA 4X2FA 1CKIA 4JR3A 5AAFA 4LMNA 3NW5A 4D58A 5I9WA 2OO8X 3PIZA 4FTCA 2R3HA 4L8MA 4RA4A 4FV3A 1Q8UA 5A9UA 2DS1A 4O7NA 3P7AA 3SG9A 1IR3A 3HYHA 4QMOA 4EOIA 4QMQA 2W1IA 4GUEA 1PXOA 4IACA 3TT0A 4AW1A 3PPZA 3UQCA 3KF7A 2W1HA 2WMQA 2GCDA 3WYYA 5AR8A 1YKRA 4BCMA 3FXWA 3PA5A 3AXWA 4F9CA 2XIYA 4CG8A 5H2UA 3MWUA 5EG3A 4FSRA 4YO4A 5I5ZA 3C4WA 4F09A 4O1OA 4FIIA 4IC8A 4KIKB 4QP9A 5AP3A 4M69A 5FD2A 3BGQA 4CYIA 4ZK5A 5IF1A 3C5IA 3HA8A 4F7NA 4CVAA 4CZTA 4G3CA 3WYXA 2H34A 1YVJA 3MIAA 1PMEA 4C58A 2XIRA 4RJ6A 2W05A 3ORLA 3VUMA 3DU8A 4D9UA 3GCPA 2C5VA 3LVPA 4O1PA 3A7HA 3NIZA 2R3FA 4C38A 3CTJA 1OIYA 2IVVA 4EK8A 5BQ0A 5K9IA 4AT5A 3KA0A 3QYWA 4IWQA 4I4FA 2IG7A 3W2RA 3R8LA 2X4ZA 3DK3A 4U6RA 4JDIA 3RPSA 4B99A 4QP7A 2YIXA 3DBDA 3QCSA 4P5ZA 1XH4A 3UOHA 3FZTA 3W8QA 4PP7A 4XUFA 3ID6C 4S31A 4Y85A 4ZMFA 4IDVA 2JDOA 4FL2A 4R7BA 1Q8TA 4LQMA 2YM4A 5LXMA 2XJ0A 1UA2A 5IQAA 2J7TA 3D94A 2WMRA 3AOXA 4I5MA 2OI4X 1VJYA 2J5FA 2FYSA 2QI8A 3GC0A 3UZPA 5ITAA 4YJUA 4L7SA 4MYGA 1V0OA 4IAIA 4NTSA 1OL1A 2ZMCA 4O7RA 2BRNA 3B2WA 3WZEA 3PY1A 2GNLA 4EI4A 1KV1A 4WBOA 2B1PA 3EN5A 3GP0A 5JFWA 4IZ5A 3HGKA 1UNHA 4K1BA 4BRXA 4WNKA 3CIKA 1YXVA 5DPVA 2WZJA 3QTIA 2X9FA 1CSNA 3Q04A 2BZJA 2C3KA 1FOTA 3F5PA 3L9NA 3OWJA 4BWPA 2GMXA 4M7IA 4FYNA 3PIXA 4GJ3A 1FVRA 2O64A 4AX8A 5AUWA 4JIKA 3Q52A 4QMLA 3R9NA 4A07A 2X2KA 1ZOEA 5EYKA 4F7LA 3WZKA 4BDCA 4I92A 2YABA 2BMCA 3U9NA 4A06A 1J7LA 3OMVA 3FAAA 5I9ZA 2C3JA 2EUFB 2UW8A 1KWPA 4EH5A 3UNKA 4F7JA 4ZTQA 4NM3A 3QTSA 3NUYA 4FG7A 4QP3A 5CEQA 3EYGA 5CEMA 4JBQA 2VWVA 5HTBA 5M56A 4RPVA 2YWVA 2VAGA 2A0CX 4IZAA 1PKDA 4E26A 4BL1A 2QOOA 4O7TA 4QP2A 2B54A 4M14A 3LFDA 3QXPA 5EHLA 5B2LA 4E3CA 4ZY5A 4O2PA 3KMUA 4M69B 4ENXA 3R9OA 3P08A 1JLUE 1ZWSA 3FKOA 4UBAA 1ERKA 3PTGA 5F9EA 5JH6A 2BRBA 2WD1A 3SXFA 4C4GA 2JC6A 4HCUA 3FI2A 4L3LA 4RZWA 1ZMVA 4D1SA 5J9ZA 4W8DA 4ENYA 4PNIA 3R7UA 4O91A 2JDVA 3DDQA 4U5JA 3EN4A 4DBXA 4IWPA 4IVCA 4AFJA 3NNXA 2WTKB 4FV2A 2YM8A 4UWYA 5HO7A 3BYSA 3N4UA 2JDRA 2WTJA 4QTDA 4AWIA 5IMXA 1IRKA 2P2HA 3I60A 5DG5A 4GU6A 5EKOA 2XNNA 3EFWA 2UUEA 4AFEA 3H9FA 3VUTA 3CR0A 3R21A 3C4FA 2UW3A 2RG5A 1OKVA 4NJDA 2J9MA 3BGPA 3R73A 3DZOA 5BVOA 1OB3A 5EH0A 3BPRA 4P5QA 4WA9A 1B6CB 2GNIA 2VZ6A 4LG4A 1JSVA 2X7OA 4IVDA 4QP6A 4O0WA 5DNRA 2SRCA 3BHTA 5AWMA 5GIPE 5IQHA 5C8KA 5CY3A 3DFCB 4DT8A 1WBOA 3LM5A 4PDPA 4QYGA 5CLPA 3UPXA 4FEWA 2HZIA 3I6UA 4U9AA 5IDPA 3U9CA 4OW8A 4DGOA 1OL7A 4TYHA 2A2AA 2VRXA 4AZSA 1QPEA 2YCRA 3FMMA 4FSNA 3BHHA 4XS2A 2R3KA 1XHAA 2CKOA 5DOSA 2CN8A 4DCAA 4LL5A 2YJSA 3POZA 1S9IA 3CGOA 2OXYA 3H4JA 3EQHA 5HE1A 2ERZE 4I3ZA 3N4TA 2P33A 3TDWA 3OC1A 2WMWA 4BCFA 3D0EA 5AM6A 3MPTA 2R7IA 2UW7A 4PL4A 3KU2A 3SOAA 5FTOA 4XV2A 2VX3A 1B39A 4W4YA 3RKBA 2W5BA 4S30A 1WFCA 4BKJA 3C13A 3DZQA 3KEXA 1H1SA 4FV8A 3V04A 3I0OA 5CAUA 3DY7A 3ZXZA 1OIQA 4X3JA 4YBJA 4D5HA 4IDTA 3QD2B 4R7HA 5AV3A 3BYMA 4I23A 1H00A 2KTYA 5ANOA 5F4NA 4GKIA 2UZEA 3O0GA 4YZMA 5CF5A 3P5KA 3IGGA 4D1XA 4RIOA 1OIUA 3CE3A 3W2SA 3H10A 5F94A 2EXEA 4XBUA 3BV2A 3R7VA 4YTHA 3TACA 3EJ1A 2CGWA 5D41A 4FTTA 1KE7A 3EFKA 5EFQA 1Y57A 4ACMA 2V22A 3PLSA 1V0PA 1W83A 3CY2A 4HGTA 4CKRA 2Y0AA 2XNGA 3HMMA 5CZHA 3NUAA 2GPHA 4R8QA 3PP0A 3B2TA 4WG4A 3RNIA 2W9ZB 1Q99A 3QQHA 4BCIA 5CASA 5FEQA 5TOZA 2Z8CA 3CGFA 3FL4A 4Y5HA 1YOJA 4ZP5A 2PZIA 2R4BA 5L2QA 3OTUA 4HGEA 5TT7A 1IAJA 4Y72A 5EHOA 2GDOA 4YZDA 5M44A 4FYOA 3A7IA 4TKSA 3V5PA 5FTQA 5CXZA 4H58A 1FMOE 5IU2A 5CT0A 2WELA 4ZTNA 3TL8A 2R0IA 2OH4A 4GT3A 2PVKA 5DWRA 1FGIA 2AC5A 4BCGA 4FE2A 5IDNA 3VW8A 5KHXA 2RSVA 2G2IA 4YUQA 4YNEA 2XB7A 3VS7A 2PYWA 1OKYA 3G2FA 5JSMA 3L1SA 5A4TA 1W0XC 2QOLA 1PJKA 2VTRA 3F88A 2WTVA 4RWLA 3GFEA 3GCVA 3NUXA 1XKKA 4ZLZA 4FTUA 1BKXA 3B8QA 1W82A 4R3CA 3U55A 2XNEA 3FWQA 4OBPA 2PK9A 4DYMA 3BIZA 4LL0A 2YCSA 4BIBA 2C0IA 1IAHA 1BLXA 3MJ2A 2WU6A 3V8TA 3UVQA 2E9OA 5CQUA 3VC4A 3LFFA 2O63A 5EOLA 5H9BA 4H1MA 4DINA 3UODA 1GZKA 1OVEA 4C8BA 2QD9A 3PG3A 3PPJA 3I81A 2YISA 3BLQA 3HAVA 3F3TA 3RNYA 3GQLA 4ZTLA 3MYGA 5JT2A 1NW1A 5BVFA 3BYUA 4FUYA 5DRDA 4MXYA 4ZOGA 3RJCA 1YRPA 4WT6A 3T3UA 1ZARA 3V8SA 4OBQA 3WF9A 3D5UA 1ZLTA 1BUHA 2OJ9A 3F5XA 5EYMA 3UE4A 3UVPA 4CFXA 4A7CA 1FQ1B 2EXMA 4FT9A 3ZCLA 1CDKA 4J52A 3NYNA 3OBGA 3LCDA 4RQVA 4FKSA 4IB1A 4YC8A 4WG5A 4C3RA 1PYEA 3PUPA 2PUNA 3MVMA 4FKRA 4FZAB 4G6NA 4TWPA 4FBXA 5A6NA 5BUJA 4CNHA 5BUEA 2B9HA 4RLLA 4EK3A 3U6IA 1U54A 3HDMA 1MRYA 3FMHA 3HMOA 3I7BA 4BYIA 2BRMA 2EU9A 2FB8A 3PP1A 2J0MB 4EH3A 4USFA 3EYHA 2BTRA 2XJ2A 3QGWA 2JAMA 1JKSA 2PZYA 5JFSA 3QF9A 4D4SA 3VQUA 1NY3A 3QUDA 5C4LA 3QZFA 3C7QA 2CGVA 4BCHA 2IZTA 5CAQA 2W7XA 4AAAA 3PE1A 4FKUA 4J8MA 1ND4A 5CYIA 2X7GA 3QHWA 4QMPA 2QO7A 3MSSA 3TV4A 3VUDA 4FT0A 3ZSHA 3ORNA 4NCTC 4X3FA 5KBQA 3CY3A 3AQVA 3HRCA 5FUTA 3FHRA 5CF4A 2QCSA 2J90A 1IASA 1U59A 4P2KA 4X2KA 4XG3A 4XHKB 5CTPA 3CLYA 5D7AA 1H1RA 4ZJVA 2VWZA 3NYVA 2XA4A 3NCGA 4LGHA 5GNKA 1GZNA 3ORIA 5AUTA 3DJ7A 2CKPA 3RP9A 4CG9A 2BFYA 5E9EA 5DT3A 3WF6A 4FMQA 3IG7A 2XK7A 3SC1A 3OOGA 3QAME 2VWYA 4FOBA 5E8ZA 1KE8A 5A4CA 3RAWA 5DE2A 5AV4A 2C6LA 2OSCA 2HZNA 3NNVA 4RX8A 3W2CA 3BCEA 4NWMA 2R3QA 3EQCA 1GIHA 1PXJA 4C4FA 3SW7A 4UB7A 2ZYBA 5IQIA 2XYNA 3IKAA 4O27B 4E6CA 5AP0A 4JVGA 3VF9A 3RZBA 1AQ1A 3CSVA 3QA8A 4TZRA 4I0TA 1YXUA 2ZVAA 3GQIA 2XK4A 3L9PA 3FLNC 4HW7A 3DB6A 3ZFMA 3OP5A 4PDYA 1YI6A 4J7BA 4MK0A 5CSXA 3NGAA 5AP1A 4CXAA 5CNNA 3ZHPC 3P4KA 4UMQA 5K4JA 3BYVA 3KXNA 3LCSA 4UMUA 2C6MA 3Q6UA 5AJQA 4EHEA 3O96A 1H4LA 3KULB 3JUHA 4IWDA 2LGCA 3IGOA 2Y4PA 4NSTA 2BZIB 2RL5A 4L67A 3MVJA 3I1AA 3PY3A 4IMYA 3ATSA 2QOFA 5KHWA 1U54B 2X2MA 3RCDA 2W06A 2OK1A 5BMMA 4FTAA 4BVUA 2GTMA 4H3QA 4UEUA 3GXLA 4C59A 4RIWA 1YOMA
chains in the Genus database with same CATH superfamily
5IA0A 3CXWA 5H3QA 2OFUA 4DFXE 2YA9A 3D14A 4V01A 4QPSA 5JZNA 4HGSA 4ID7A 3OOMA 2J5EA 4DITA 4E4LA 4BF2A 2C6OA 2W96B 2JFMA 2WQNA 2GS6A 3R01A 3W1FA 4FKPA 5L2TA 1PYXA 4KA3A 3MH1A 2ACXA 4U42A 4YPSA 4R77A 3MB7A 4X3FB 3C0HA 4FIJA 5IQFA 4W9XA 4EQMA 4OTQA 3BZ3A 3FY0A 3WILA 4DFNA 2C1BA 4G31A 4G5JA 2WMBA 4RX7A 2R5TA 3UP2A 4OT6A 5JKGA 4UWBA 1Q3DA 4BHZA 2VO3A 4FV1A 4ZLOA 3FSFA 2HIWA 2HELA 3BV3A 5DLSA 3RPYA 2OJIA 4EOOA 3VUKA 4C2WA 3GCQA 2WOTA 3AC2A 3ET7A 5I9VA 4GFOA 3ZLYA 2NRYA 5HNGA 4CLIA 2IO6A 4DEAA 4BDEA 3OCBA 3PVWA 3ZYAA 1PY5A 2XYUA 3ORTA 5IA1A 1R78A 5HGIA 3VRZA 2GU8A 3AMYA 1Q62A 2B52A 2C5OA 2BAQA 4PUZA 2CDZA 1E1VA 4OGRA 4KUJA 1RW8A 3R00A 4JQ7A 2W5HA 3CTHA 4FZDB 3U87A 4APCA 4QDVA 3U4WA 5G1XA 5DMZA 2PE1A 3G33A 5T3QA 3JR1A 3FYKX 4GVAA 4GSBA 3M1SA 2C30A 2WIPA 4TYGA 5FM2A 4C4JA 4OTFA 1XMLA 3E8DA 5DR2A 4C35A 2XZSA 5A4EA 4FEUA 4FICA 4JQEA 4O7LA 3E3BX 4YLJA 2VTOA 4B9DA 4UX9A 3V5WA 2Z60A 4IANA 4X6QC 5E92A 2VNYA 4HYIA 4P4CA 4QQ5A 5LMBA 1OITA 1VYWA 1TKIA 3QTUA 4R5YA 3OEFX 5JZJA 3R8VA 5H8EA 1ZAOA 4CV8A 2P55A 4JNWA 2HAKA 1O9UA 3MFRA 3Q9ZA 5B2KA 5IEVA 5KZIA 2PUUA 1ZY4A 3ODYX 4DT9A 4NIFB 4KIQA 4JRVA 4OAVB 3MW1A 3IK3A 2OFVA 3IS5A 4ALUA 1URWA 1Y6AA 4XYFA 2WTDA 3OCSA 4IFGA 2BHHA 1ZYLA 2P0CA 3NRMA 4X7QA 2ONLC 4E1ZA 4BR3A 3FBVA 3OY3A 3QZGA 3DLSA 2B7AA 5A14A 2QOKA 4O0RA 3LQ5A 4S2ZA 2ITVA 4FEXA 4PPBA 4YJOA 4HZRA 3ACKA 4N4SA 3TV6A 3VS3A 5IEXA 4RIYB 3GBZA 4RIWB 5J7BA 2ZDUA 1IG1A 2PVMA 2RGPA 2ZMDA 4CFNA 1PW2A 3PLAE 2WNTA 1XMMA 4FKVA 5HNIX 3RK9A 3FJQE 3R6XA 5CVHA 4QQCA 4ZSJA 3TM0A 4WUAA 3WE8A 5AR2A 5HHWA 3MFTA 3K5UA 5DIAA 4BB4A 3TXOA 4F9BA 5I4NA 3N4VA 1U46A 3DPKA 3E8CA 2JIIA 4I1ZA 3LXNA 2VTIA 3QCXA 4TL0A 2CGUA 3L9MA 3DDPA 3PA4A 4ASEA 1P14A 4EWQA 3MV5A 4PMTA 1OMWA 1Y6BA 3SXRA 2F7ZE 1XH9A 4JG8A 3VJOA 2I0HA 3R22A 5FXSA 2P4IA 3LJ0A 2HWPA 3RBWA 2X6EA 3DBCA 3EZRA 3F5UA 4O6LA 5IZFA 4GS6A 5KMJA 1YWNA 5AIRA 2Y6OA 4MNEA 3THBA 1UKHA 3AD5A 3TKHA 4ORKA 3BL9A 2JDSA 3W2PA 2XANA 3QLGA 4R6VA 3GEQA 3ZRLA 1QPDA 1S9JA 3ANQA 2EB2A 4IX5A 3SKCA 4QMTA 3W10A 2X7FA 5J1WA 4K33A 5GZ8A 4O86A 3C50A 4IFCA 4U45A 5DA3A 3A4OX 4O83A 5IQCA 4C33A 4C4EA 5KNJA 5KCVA 3WIKA 2BRGA 4IB5A 3PXZA 5HD4A 3DQXA 3CBLA 3EKNA 2WEIA 3U4UA 3DBFA 3GU8A 2QU6A 5TKDA 1OL2A 3UG1A 3VAPA 3WOWA 2UZBA 2VWWA 4ANLA 4MKCA 5ACKA 3A7GA 4MD8E 3AKKA 4E5AX 4J96A 3TUCA 4FSMA 3WF5A 1Q41A 3KCKA 4PRJA 3W0SA 2PUPA 1KOBA 3GOPA 4I6BA 1W8CA 1SVHA 3HV5A 2C5YA 4EEVA 2UZDA 4H3PA 5ANGA 3UG2A 2QO2A 1W84A 2X81A 2J4ZA 5J1VA 3AMBA 3C4XA 5CVGA 3G0FA 5C27A 5C8MA 4CRSA 3NCZA 4UYAA 3HUBA 3LCKA 1JAMA 4BBFA 1WBPA 4E8AA 4UALA 1XH6A 2LAVA 4L6QA 4RX9A 1JKKA 1H07A 4BKZA 4I6FA 4HPUE 3C5UA 3TG1A 5M4IA 5E8VA 1NVQA 3MH2A 4AE9A 4RVMA 3O8UA 2CCHA 3HKOA 4O96A 1PXIA 5CX9A 1UWHA 3FXZA 2R3OA 2YLEA 4KBAA 2GS7A 4HOKA 3ULIA 4TYEA 4E6AA 3V3VA 3GB2A 3QD4A 2QHMA 4YZBA 4EQUA 5K5NA 3VO3A 3G0EA 5DGZA 5J5TA 3TKIA 3RWPA 4FV5A 1P4FA 3BQCA 3KN6A 2CMWA 4M84A 5AR7A 4D1ZA 3F9NA 3HZTA 4TN6A 3R63A 4EKKA 4QDEA 1YOLA 4ITJA 4M13A 2RIOA 5EM5A 3VBWA 4AA4A 4LMUA 4TPTA 4GH2A 4Y73A 2AEGA 5FLFA 2UZOA 4AU8A 5TO8A 4YJTA 5D12A 4RJ3A 2CN5A 5CSVA 3SV0A 3FXXA 4PY1A 4WBBB 4KD1A 5HVYA 1QMZA 3PXFA 2BKZA 3SW4A 2AUHA 5LMKC 4L52A 3WBLA 4EL9A 5CT7A 3IDPA 3IW5A 3W0PA 4NT4A 4MNEB 2I0VA 2F57A 3FZPA 3DV3A 2WB8A 4RX5A 4JDJA 4AW0A 2QNJA 1APME 3EFLA 5HG7A 4O0XA 2R9SA 2X6DA 3NDMA 3DFAA 3PY0A 5DR9A 5CAOA 4CFMA 5J9YA 5HI2A 1YI3A 2X0OA 2GSFA 4FKQA 1CKPA 2UVZA 1VZOA 1R3CA 2ITQA 2X8DA 2XM8A 4L3PA 4DEGA 2C68A 3UO6A 3F5GA 4YR8A 4YURA 3NUPA 4YSMA 2HZ0A 2WHBA 4QTBA 4IE9A 5HE0A 2VTLA 4D28A 4KSPA 3VW6A 2W1GA 4NFNA 3FQHA 3TCPA 4FKWA 4ACGA 4F1OA 3ORKA 4N0SA 5AR3A 1G8SA 4RLKA 5AP2A 5HO8A 1PHKA 3IW8A 1PXLA 5ETCA 3SG8A 3ZC5A 4FZ7A 2B55A 1OI9A 4O38A 2ERKA 3FSKA 5DT0A 5C26A 5HLNA 4AXDA 3NFGB 2QURA 2YDKA 5L8JA 3GVUA 2R3IA 3QD3A 2JKMA 1VLRA 4WKQA 2Y7JA 3OF0A 3BLHA 4LRJA 5BVEA 2YCFA 3GC7A 3HP5A 4JQ8A 2J0KA 3PRFA 3UQGA 1KSWA 4NM7A 2CNVA 2I6LA 3F3VA 4C61A 5HORA 4NL0A 4EJ7A 1BL6A 4G5PA 4AF3A 1R1WA 2W1DA 1WAKA 3AC8A 4FK6A 1OUYA 3EOCA 4U79A 4IM0A 2I0YA 2YIYA 1Q61A 4O21A 4O7WA 1MRVA 4CZYB 4UXQA 4FRFA 4M8TA 4C3PA 3LJ1A 1M17A 2ZJWA 2RF9A 3OWLA 4O7SA 3EIDA 2J6MA 4FGBA 5E90A 3E62A 4RJ5A 1DAWA 2OIBA 3IOKA 5EI2A 2C6EA 3LFBA 4U8ZA 3ODZX 1JOWB 4O4FA 3P86A 2BDJA 4FODA 1UV5A 1JBPE 5AR5A 3RINA 3ZS5A 2OH0E 3G90X 4X0MA 3NS9A 2H96A 2BTSA 3B8RA 1H1PA 3NPCA 3LQ8A 2ZAZA 3ZUTA 3QWKA 3NZ0A 2C69A 2VTHA 3FLQA 3WZJA 3ALOA 1O6KA 5E8UA 2CCIA 3TJDA 2HXLA 4EH7A 5AP7A 5CF6A 3PZHA 3KKVA 4JBPA 4DHZA 4YHJA 3F82A 4U7ZA 1L3RE 3BHVA 4AA0A 5I9XA 3PXQA 5AX9A 5DEWA 4JL9A 2XNMA 3LMIA 3L8PA 3IONA 1EH4A 3PFYA 2R3JA 4BICA 1WBNA 3VBTA 5FM3A 4G16A 3W0OA 4MCVA 3EKKA 4K0YA 3V6SA 4QMWA 4RT7A 4FTLA 4UMRA 3BQRA 2WMAA 4D2SA 5IQGA 4DF3A 4X2NA 5LWNA 5M4FA 2GQGA 2W17A 3GGFA 4GIIA 2G9XA 4XG9A 1H25A 1OKWA 4FSQA 2P2IA 4IX4A 3ZO3A 3ZONA 4WNOA 4ANOA 4IHPA 2VTJA 3HAMA 5C8NA 3BBWA 2IVTA 3OUNB 1HOWA 4BHNA 3JVRA 5EM6A 2UZVA 4QP4A 2XM9A 4QMVA 4KRCA 4RJ8A 2Z7QA 2UZUE 2Z7SA 1J3HA 2R64A 4DG2E 3DXQA 1P4OA 4LOOA 4DDIA 1Z9XA 3MVHA 4XLIA 5AR4A 2BIYA 3Q9XA 4HGLA 5M57A 3FMKA 4RZVA 5IUIA 3A7FA 3ENMA 4JG7A 1E9HA 2XBAA 4IXPA 4WSYA 4XEYA 4Z9LA 4E73A 5EK7A 2C5XA 3RGFA 4TYIA 5FRIA 3QFVA 4BTFA 4FTKA 4CQEA 4D4VA 2ZFYA 5DBXA 3JY0A 3MTLA 3LM0A 4I5HA 4QO9A 1XWSA 3TWJA 2WTIA 4J98A 3QX4A 2A4LA 4YO6A 3UJGA 2R3RA 3IO7A 3K2LA 4QTAA 3OT8A 2HYYA 5JFXA 4F64A 4AOTA 3OD6X 2R0UA 4QYYA 5HQ0A 2RFEA 5BPYA 4II5A 3A2CA 4EC8A 3AKLA 1H27A 1IA8A 3R7EA 4APPA 4J97A 1K2PA 4U81A 1Q3WA 3FQEA 5ACBC 4BWXA 3FMDA 3FE3A 2UZTA 2CNUA 4JOAA 4QMZA 3ZSGA 4QEBA 4IVAA 5EDQA 5DHJA 4YHTA 4BIDA 5KMLA 4Y46A 1BI7A 4UXLA 3G9LX 4DHJA 4BGQA 2OBJA 4M97A 2GHLA 3EQGA 3IDCA 1B38A 2DUVA 3WI6A 1PKGA 4ITIA 4MXZA 3Q2MA 2OKRA 3OT3A 4YJNA 2VU3A 3NX8A 2ZV2A 4U43A 3D2IA 4OR5A 2Z02A 3LLAA 1OECA 4ZLYA 3CPCA 4ZY6A 4BKYA 3EHAA 4BZOA 1LPUA 3ZZWA 4F08A 1H8FA 4ZY4A 2O3PA 5M53A 2WPAA 2QG7A 4C3FA 5CSWA 2ITXA 1CM8A 2R3NA 3O51A 3G15A 3UYTA 3RWQA 1JVPP 4MVFA 4USDA 5GJGA 2BAKA 5LJJA 3OY1A 4GYIA 3RALA 2CSNA 3ZDIA 4FL3A 4BTJA 2IPXA 5IH5A 3MIYA 5I3OA 3T8OA 4KINA 4YHFA 4ONAA 5HBHA 5IA5A 3DOGA 5ANIA 3Q60A 3F2NA 2Y8OA 1Q8ZA 4B7TA 4EWHA 3FLSA 5GINE 3PJ2A 2VO6A 3E3PA 5AA8A 1M14A 2C5NA 5K0XA 5HU9A 5CU4A 1NVRA 3V5JA 5E1EA 2OJGA 4E4MA 1TFFA 3KK8A 4RWJA 1XR1A 3PPKA 2WQMA 2F7XE 3P7CA 4FSYA 4L7FA 5H8BA 4IQ6A 4ZJJA 2FA2A 3LLTA 2PVYA 4FC0A 3RAHA 4LV7A 1FVTA 2Y9QA 3R0TA 4QMUA 2Y4IC 3FMJA 3SQQA 5CAVA 3AGLA 5KMIA 3S0OA 3Q4CA 3W18A 5T68A 5ETIA 4FKLA 3UBDA 4ZSGA 2QLUA 5J7HA 2R3MA 4TYJA 4PQNA 4RMZA 4FV9A 5KMOA 1U5QA 2YERA 3FMLA 5EW3A 1DM2A 3TIYA 3FC2A 3UC4A 4AZWA 4DTAA 3R1NA 4NKSA 4LV8A 5KZ0A 3KREA 5KE0A 3NFFB 3VS5A 2WMUA 2R3PA 3Q53A 3ZC6A 5GJFA 3GNIB 3BHYA 4FV7A 2O2UA 4KWPA 3FZRA 4EQCA 5BYYA 2PU8A 2I1MA 2HY81 3UQFA 4A4LA 5CQWA 4FKOA 5IUHA 4UWCA 1SNUA 2OF4A 3QRIA 4JAJA 4ACDA 3EN6A 4GCJA 5A3XA 4TW9A 1REJA 4LYNA 4EKLA 2XNOA 5JQ8A 4JT3A 2CGXA 2WTCA 3TI1A 3UOJA 5HCXA 2QG5A 4E4NA 2O65A 2RFSA 2J51A 3ELJA 3JS2A 5B7VA 3TMOA 5IH6A 5J5SA 2ITWA 4QPAA 3LZBA 1G8KA 4FGRA 2OXDA 3I79A 4GW8A 1JKTA 3N51A 4I0SA 1TQPA 5BUIA 4M0YA 3L8XA 4D0WA 2WTWA 2PHKA 2W4KA 3D5VA 5DH3A 3UIBA 3UIUA 4YSJA 4QPMA 4BTKA 4I5CA 3K5VA 2OJFE 3T9TA 3NW6A 5FEEA 4AXAA 4BFMA 4CV9A 4G2FA 3WARA 5LWMA 2VO7A 1YXTA 3LXPA 3DAJA 4FIEA 4CCBA 2PSQA 4RJ4A 1GIIA 4G3GA 3QRUA 4E5BA 3GOKA 2YM3A 3ZBFA 3WZUA 3QBNA 4MAOA 4C4IA 5CS6A 3VN9A 4L53A 4DH8A 5HKMA 1G3NA 2UZNA 4F4PA 3EH9A 5JRSA 5EYDA 2ITPA 4MBIA 1A48A 4IAAA 3KULA 3POOA 3BGZA 2G2FA 2C1AA 5CANA 1UWJA 2HW6A 2XCHA 3TUDA 5HNBA 2ZV8A 3W55A 5AP4A 2XNBA 3D5XA 4HPTE 1OGUA 1OL6A 1H28A 2CKEA 4A9RA 3EZVA 5EM8A 2BUJA 3TJCA 2NO3A 2JFLA 4M67A 2UVXA 4UY9A 2OZAB 4R1YA 3W0QA 2ZM1A 4EOPA 2IZUA 3PWDA 3QA0A 3DQWA 2ZM4A 4CCUA 5FXRA 4AXEA 4O7VA 5EQPA 2C6TA 3EWHA 2VTMA 4G9CA 4Y83A 5C01A 4GV1A 3DJ6A 3WF7A 2XALA 2H6DA 3KMWA 4K2RA 4MQ2A 3R8ZA 4GL9A 4QQTA 4GRBA 2QKWB 3BE9A 2X8IA 4A9UA 2QONA 3Q4ZA 5DT4A 2BFXA 4I5PA 5CI7A 3QTWA 4ALWA 5LOHA 4ZMEA 3QL8A 4W4XA 2HZ4A 5EYCA 4AAYA 2IVUA 2OZOA 2Q0BA 4BY9E 1W98A 3BU3A 4FKGA 4XBRA 1H1WA 1AGWA 1PXPA 2B4SB 3Q2JA 4Q9ZA 4X2GA 3NWWA 4E4XA 4E93A 3UDTA 5J87A 4D5KA 1YQJA 5B0XA 4CRLA 2FSLX 4FV0A 4RRVA 3JVSA 2OLCA 4G3FA 4EYMA 4CYJA 4ZAUA 4QMMA 2XH5A 4UZHA 2X0PA 4X21A 5AV1A 2IZSA 4BDGA 4RFZA 4WIHA 3VWAA 2HWOA 3AC1A 4LRKA 1M52A 3QD0A 4DFUA 2NPQA 3SXSA 3OCGA 3E63A 4PP9A 4WNPA 4EONA 3R7YA 4D9TA 5FTGA 2G01A 3HV7A 2WOUA 4HVGA 5KUPA 2ITUA 4PL3A 3QQFA 4XMOA 2BROA 5LVPA 4P90A 2YIRA 4H05A 2WO6A 4RWIA 1NA7A 1Z57A 3VUHA 1OBGA 3UPZA 3CQEA 5BMSA 1OPKA 4IC7A 2PMNX 4GK2A 4BDIA 2BHEA 1NVSA 3R04A 5IQEA 5LCKA 4K6ZA 5CXHA 4L43A 4CTBA 3F69A 3E7VA 4ZSAA 2C3IB 4GIHA 4ZTMA 1XO2B 3IECA 4KKGA 4F78A 1YI4A 4E7WA 3BX5A 4I94A 3LPBA 3HA6A 5M4UA 4M15A 4K11A 4G17A 3VS2A 2UW4A 3LOKA 3I7CA 5JGBA 1WVYA 4G6OA 4NIFA 4U40A 5CAPA 4I6LA 3EB0A 3RK7A 3ROYA 5L2IA 4Q2AA 3UO5A 3M2WA 2JIVA 2XKDA 2WKMA 4EOLA 2XS0A 4AN2A 1PF8A 4XG8A 4C02A 1WVWA 2ZOQA 4Z16A 3EL7A 1G8AA 4GG5A 4EH2A 1PXMA 4OBOA 5AX3A 4RBLA 5M08A 2XRWA 2EWAA 4IJPA 4B8LA 4CMTA 1JPAA 1O6YA 2R7BA 1Q24A 4IVBA 4RIYA 2YZAA 3R7IA 4PWNA 4W8EA 2RG6A 1WBWA 2BAJA 3G6HA 4K77A 4ARKA 5IMEA 1ST4A 1CKJA 3A8WA 3NSZA 3DK7A 4EHZA 1LP4A 3CKXA 4M12A 4EOSA 4LM5A 4D4YA 3U51A 2W5AA 4J95A 2IJMA 1J7IA 2ONLA 4GKHA 3RI1A 2A19B 4HJOA 4XG7A 3KRWA 2XK3A 2BDWA 4G9RA 4D55A 4EK4A 4ZS0A 1WZYA 4EH4A 1BX6A 5GHVA 5IA3A 2JAVA 3DCVA 4BCQA 3HMIA 3P79A 5KX8A 3KRLA 1QPJA 4JIAA 3EN7A 3HX4A 3ORPA 3WZDA 4A4XA 5HLWA 4AGCA 5AUXA 3TNPC 1SVEA 1E1XA 1TVOA 3ZUVA 1ZYJA 2WXVA 3VULA 3PE2A 4KNBA 4YU2A 2F9GA 3TKUA 1H0VA 3L9LA 1QL6A 4F63A 3E8NA 1SMHA 4IBMA 1LR4A 2QOQA 4DH7A 3SGCA 4RFMA 3S95A 4QTEA 5CU6A 2IZRA 2FSMX 1RJBA 3D2KA 2HENA 4JI9A 3MA6A 5BYZA 4U97A 3MDYA 4ZIMA 4RJ7A 3QZIA 5BNJA 4LUDA 1P5EA 1PMUA 2VV9A 4WNMA 2PTKA 2Q83A 4M66A 2IWIA 3RTPA 3PXKA 4MBLA 4PTEA 2C6IA 2PZRA 4UYNA 3UYSA 3ZSIA 4AZFA 4DC2A 4PDSA 2UZWE 4MF1A 1M2QA 3ZLWA 1WBTA 4MXXA 3CEKA 2G2HA 2YDJA 3H9RA 4FR4A 3C0GA 1ZMUA 4IWOA 4YNOA 4BJJB 4CT1A 4JS8A 2XF0A 4N6YA 3VBQA 1FPUA 1VEBA 5EM7A 3WE4A 5L8KA 3DKCA 1CTPE 4AW5A 4H36A 4ANNA 4Y5QA 4WUNA 4KS8A 5CNOA 3NEWA 4FNZA 2VWBA 4YC3A 3LFAA 5BX0A 2RFNA 2E9UA 3R8MA 3ZM4A 4EHVA 3C9WA 3D5WA 3RZFA 3WF8A 5HICA 3SHEA 3DT1A 2VO0A 3G51A 3EFJA 2O0UA 5GJDA 4N57A 2YITA 4DGNA 2I0EA 4HZSA 3ULZA 2VUWA 4FG8A 4FK3A 4OT5A 3O5AA 3QX2A 4FNWA 3QZHA 2FSTX 1ZRZA 3BE2A 3MS9A 4F0IA 2QOHA 4EOKA 3V01A 4JDHA 3VQHA 1NT2A 2GNHA 2H8HA 4DBNA 4JX7A 2F2CB 2JKOA 3KGAA 4BBMA 2QVSE 5CEOA 3LJ2A 5HO6A 5KKRC 2QHNA 2EXCX 4PMMA 4H3BA 3LCTA 3R9DA 3ZXTA 3MBLA 3AC4A 2BRHA 2NRUA 4RG0A 4WRSA 3LFCA 4C0TA 5C03A 3QQUA 3LXLA 3P1AA 5ETFA 4ANBA 5K3YA 4B0GA 4O0VA 2PE2A 4AT4A 2E9PA 2VTQA 3OTVA 5D9HA 3AT3A 4FTJA 1I44A 5CZIA 2FSOX 4E6QA 4C2VA 2XVDA 4LV5A 2PVFA 4USEA 4PTCA 3OXTA 3BBTB 1OUKA 4XNEA 1H24A 3TZ9A 3SX9A 3R1YA 5J95A 1SZMA 5M07A 1LEZA 1VR2A 4PDOA 3SOCA 3PVGA 2PY3A 5CU3A 4XRLA 4J8NA 4G1WA 5D7VA 3UC3A 3PSCA 1FVVA 4LGDA 3F3UA 3WIGA 2UW6A 2UW5A 3F2AA 3LFNA 3R2BA 5CEKA 4FV6A 1YWVA 4FVPA 4EK6A 3RPRA 3O17A 2QOCA 1UKIA 3FMEA 4KIPA 3KVXA 4I20A 2W9FB 4J71A 4QNYA 3ZEWA 5K4IA 4OTRA 3FC1X 3FZOA 4F6WA 1ZXEA 3IDBA 4K9YA 3GU4A 3F3WA 4AGWA 3I4BA 4BI0A 4EBVA 4ERKA 5JGDA 4Q9SA 4E6DA 4FTMA 1MP8A 3FLYA 3QRKA 4TWCA 4XV9A 3D7TA 3W2OA 5JMSA 4HYHA 4LOQA 3QCQA 3PZEA 2XKFA 4ANQA 3OROA 3AD4A 3COIA 4KBCA 3TN8A 3UMWA 5AP6A 4AA5A 4FSUA 4KKHA 4DCEA 4U80A 3VHKA 4YJRA 2OU7A 4U0IA 4TRLA 2BKKA 3PDTA 2XCKA 2VTNA 4EOMA 4AG8A 3ZUUA 1J7UA 4FEQA 5FQDC 3PA3A 5AA9A 2VGPA 4L42A 5ETAA 5DFPA 4DDGA 4IZYA 4YTCA 1GZ8A 3ZFXA 4YJQA 1ZY5A 5L6PA 1H26A 1PXKA 4PF4A 3FYJX 3HDNA 3QUPA 1QPCA 4B6LA 4DEHA 5E1SA 5KMNA 5J9LA 1U5RA 1XJDA 3GC9A 2XP2A 4FIHA 3AT2A 2W1EA 2PUIA 3BKBA 2C0TA 3NUSA 4NH1A 4DEEA 2G15A 2C3LA 5HZNA 1FINA 3RCJA 1JSTA 4BDFA 1PRYA 2XUUA 5JN2A 2YIWA 4GT4A 1ZYSA 3DLZA 4AN9A 3VS4A 4BI1A 4DN5A 2F2UA 2HW7A 3GI3A 4F0GA 5AP5A 5AV0A 4D2TA 1LUFA 2NP8A 2C4GA 2QQ7A 3C0IA 4LOPA 4MXCA 1JQHA 3KRRA 1XH8A 2ESMA 3FKNA 1BMKA 2JDTA 1SVGA 3HNGA 4DH3A 3ZFYA 5EW8A 4DHIB 1Q8YA 4BGHA 1PXNA 5IISA 1HCKA 2JBPA 1JKLA 4GYGA 3KF4A 3E87A 1GOLA 2X39A 1SYKA 2BDFA 4AGUA 2XNPA 3AT4A 2CJMA 4XCUA 3K3JA 4AP7A 4BIEA 3W2QA 3H30A 4KBKA 3O50A 4QYEA 5LVMA 4YPDA 3SRVA 4LUEA 4N6ZA 4CSVA 5HX8A 3Q4UA 5BVKA 3Q6WA 2R3LA 5DEYA 5TF9A 3N9XA 3UMXA 5M51A 4IAFA 4YC6A 3BLRA 3OVVA 4F6SA 4L3JA 3KXXA 3SVVA 3P7BA 4A4OA 3TZMA 3H3CA 4CFVA 4D2VA 1BL7A 5E8WA 3VVHA 3MY5A 2UVYA 4I22A 5HBJA 2JEDA 1CMKE 3P9JA 3UDSA 3OXZA 3D7TB 2O8YA 4IAZA 4W4WA 4F9WA 2HY0A 3SDJA 5JQ5A 4FZFB 2X9EA 1DI8A 4TTHB 4AOIA 1JWHA 1OM1A 4HNFA 3LW0A 5FG8A 3ZRMA 3HP2A 2G1TA 4DH5A 4Z7GA 2BZKB 5HE3A 1L8TA 4F1MA 3PVUA 2YFXA 3SA0A 3H0YA 3R02A 2QOIA 2B9IA 3BHUA 3RPVA 4BDKA 4MBJA 3AG9A 5K0KA 2AQXA 4M0ZA 5HBEA 1W7HA 2WMVA 3MPMA 4DLJA 4BCPA 3OZ6A 1I09A 4MX9A 2I7QA 4ZZMA 3ZLXA 1H1QA 4RIXA 5HOAA 5DVRA 4XRJA 1M2RA 3JPVA 4ZSLA 2UW0A 3I5NA 1MRUA 5AAEA 1R39A 4WSQA 4FTIA 3UZRA 3NIEA 2WU7A 5L6WL 2GQRA 3KN5A 4I93A 5HX6A 3R9HA 3FLWA 4OTHA 4DGMA 3UDZA 2W0JA 1ZMWA 4FKJA 3P0MA 4I6HA 3Q5IA 4ZSEA 5C9CA 2C6DA 3IW7A 4E20A 1XH7A 2FH9A 5LMAA 3MGYA 1XBBA 1GAGA 4NW5A 4E5WA 2BPMA 2W99B 5IPJA 2QKRA 4JX3A 3W0RA 3R28A 3FHIA 2OF2A 4BCKA 1TQIA 4F99A 2X0GA 3UOLA 3DAEA 3ITZA 1BI8A 2BILB 3HVCA 3NYXA 3GFWA 4LI5A 2YM5A 3RHXA 2OIQA 3CPBA 3HUCA 2J2IB 1G5SA 2H9VA 5IH4A 4FIFA 3DKOA 2YN8A 3HV6A 4O4DA 5FDXA 3LKMA 4PL5A 5CEIA 4HVDA 4AGDA 5HG8A 3OW4A 3ALNA 4IX3A 5CU2A 3SRVB 4JJRA 3CKWA 3EQFA 3UIXA 4EJNA 4CLJA 1DI9A 3A60A 1OZ1A 4YP8A 5E8TA 3GCSA 4MD7E 3EQPA 3RAKA 3QHRA 3RVGA 5KO1A 1GJOA 3QC4A 4JG6A 1MUOA 4JXFA 4NEUA 3QTQA 2EB3A 2FVDA 3I0QA 3PJCA 5ANJA 5FXQA 4HVSA 3VIDA 1KE6A 5A46A 1M2PA 2WQEA 4UMTA 3COHA 4WO5A 5IUGA 3NNUA 3MA3A 3IPHA 4MXOA 4EUTA 4UMPA 4DFZE 3EQBA 4XJ0A 1OL5A 3MJ1A 4I21A 3VUGA 2GHMA 1Q4LA 2B53A 3D15A 5DR6A 4UZDA 5HESA 3KXGA 1YDTE 2IF8A 4TNBA 1H0WA