2PVKA

Structure-based design of pyrazolo[1,5-a][1,3,5]triazine derivatives as potent inhibitors of protein kinase ck2
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
328
structure length
327
Chain Sequence
MSKARVYADVNVLRPKEYWDYEALTVQWGEQDDYEVVRKVGRGKYSEVFEGINVNNNEKCIIKILKPVKKKKIKREIKILQNLGGPNIVKLLDIVRDQHSKTPSLIFEYVNNTDFKVLYPTLTDYDIRYYIYELLKALDYCHSQGIMHRDVKPHNVMIDHELRKLRLIDWGLAEFYHPGKEYNVRVASRYFKGPELLVDLQDYDYSLDMWSLGCMFAGMIFRKEPFFYGHDNHDQLVKIAKVLGTDGLNAYLNKYRIELDPQLEALVGRHSRKPWLKFMNADNQHLVSPEAIDFLDKLLRYDHQERLTALEAMTHPYFQQVRAAENS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Casein kinase II subunit alpha
publication title Structure-based design, synthesis, and study of pyrazolo[1,5-a][1,3,5]triazine derivatives as potent inhibitors of protein kinase CK2.
pubmed doi rcsb
source organism Zea mays
molecule tags Transferase
total genus 114
structure length 327
sequence length 328
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2007-05-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2pvkA01
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2pvkA02
1IG1A 3E3PA 2BZKB 3H0YA 3MB6A 2NO3A 4IWQA 3Q5ZA 2WPAA 3R7YA 2WU6A 4O82A 1RQQA 5LVMA 4YU2A 2IVVA 5G6VA 2R3HA 2VNWA 2R3NA 2C0TA 4FSRA 4C7TA 3OTVA 3ORIA 4XG8A 3QXPA 4C3RA 1CDKA 4D1ZA 2C4GA 2C5OA 4F9BA 3F82A 1J3HA 4FG8A 4C4HA 3FYKX 1ND4A 1ZZ2A 3G6HA 3H0ZA 4IFGA 5FEQA 5BVOA 4RGJA 5JKGA 2A0CX 3D7ZA 3AD6A 4RIYA 1XH9A 2UW9A 4KIKA 3PJ2A 4FZFB 5BQ0A 3Q2MA 2YM8A 5BVFA 2W5HA 2XNBA 4S31A 5E92A 4L67A 2OLCA 5C4LA 4PMMA 5HGIA 3A4OX 4IHPA 3PXFA 1UNHA 4J98A 1PXIA 1OUYA 3PA4A 4XG6A 4RWLA 5FXSA 3ZMMA 4EH7A 3SVVA 1NY3A 4JBVA 5K0KA 2B7AA 3NUUA 3SOAA 4XJ0A 3UP2A 4AA4A 4BICA 2OW3A 4EK4A 4ZTSA 4YTFA 2GQGA 3DU8A 3SA0A 2IPXA 2W96B 3F7ZA 3HMOA 3NGAA 3POOA 4IWDA 5DEYA 4RQVA 4AZTA 1M2QA 3SW4A 4FL1A 4HJOA 4PPCA 3U9NA 5EW3A 5D9HA 3GCQA 3ZXTA 3VS2A 3O7LD 3R28A 4ZSJA 2BIKB 3PVBA 4G3CA 2PMOX 3VUHA 4BDBA 3TM0A 3VUDA 1MRVA 2BROA 3GNIB 2VWUA 3P7BA 3SQQA 3I5NA 4A06A 4ZAUA 3UVRA 5CSXA 1YOJA 3WE4A 1OL5A 5AP6A 3UP7A 4F70A 3AD5A 3RTPA 2VTNA 4X2FA 1FQ1B 2YCQA 4UBAA 3RBWA 4O91A 4F0GA 2BTRA 4FL2A 4K2RA 5E8UA 4DFBA 1JSVA 4TRLA 3VS4A 3F3VA 3V5QA 1BUHA 3FMMA 3KA0A 4NM0A 3ZDIA 2P2HA 4L6QA 2GHGA 2XNNA 4EZ7A 1W98A 4QMSA 4DH7A 2VGOA 5J95A 5IDPA 5JK3A 3BE2A 4CV8A 3ZM9A 2CJMA 4J1RA 3MVMA 3TUCA 3AC2A 4W4VA 4BKZA 4JBQA 4X3FA 4Z9LA 4WIHA 3UZRA 4C3FA 5AV4A 5KMLA 3CXWA 4LL5A 2XB7A 4BGGA 2PZRA 3QBNA 3BYSA 4GYIA 3MVLA 4IB3A 4YJVA 5LCJA 3QZGA 2FYSA 4MD8E 5LWNA 4JVGA 4A9RA 2XA4A 3BRBA 4NTTA 4PDPA 4ZLZA 3DB6A 4TKSA 2FA2A 5CZIA 5ANIA 3O8TA 5T6KA 3LJ1A 1SMHA 4QP1A 3C4WA 4RX7A 5HBHA 3IW5A 4BVUA 5K4JA 2G1TA 1WBSA 3EHAA 2OH0E 3EN6A 4OBOA 3BCEA 5HE0A 4G5PA 5GJDA 4BDIA 5CF6A 4EJNA 3UQFA 4E4LA 2QQ7A 2HW6A 3V5TA 3OROA 5BVDA 4FKTA 4FSMA 3DB8A 2XJ0A 4FX3A 3UNZA 1H26A 3OS3A 3ORXA 4XG2A 2KULA 3MH0A 4XOYA 5F20A 5FUTA 5L6OA 4FT9A 5A4LA 3PXKA 4G5JA 2UV2A 5K3YA 3IW8A 2PZYA 4NUSA 3VS7A 4X6QC 3NSZA 5BVWA 1GAGA 1RDQE 3GU8A 4C57A 3C5UA 5HG5A 4ZZNA 2QOCA 5C03A 4OLIA 2UUEA 3BQRA 4Z7HA 5JRSA 2B52A 3CGOA 3QGWA 4O7YA 3P08A 4GEOA 5BYYA 4XRLA 2XNOA 2C6OA 4O7TA 3ITZA 1KE9A 2EUFB 4C2VA 4BDEA 3ZEWA 5A4EA 1Y8YA 2BAQA 4JQ8A 3ZSHA 4U42A 5L8LA 4WBOA 3C5IA 3QD4A 4DHFA 5JQ5A 1OBDA 5DFPA 2JDVA 5IQBA 1FGKA 5AUUA 5HNIX 4K1BA 1FMKA 4F1OA 3A99A 4DH8A 5IA3A 1JAMA 1LEWA 3CKXA 5JFVA 3UJGA 4X0MA 1JWHA 1W82A 3RCJA 1DM2A 4GIHA 4QOXA 5KX8A 3FPMA 4ARKA 4M3QA 3K3IA 3VUTA 5DNRA 2G2HA 3BU5A 4WHZA 2Q0BA 2WQBA 5LCKA 4BIDA 4EHZA 1OM1A 3I7CA 2G15A 2XK4A 2YHVA 1XBCA 5KMOA 3VC4A 4R7HA 4O86A 5CEKA 4N70A 3PY0A 3KXMA 2PVMA 4F7LA 3QUPA 4BDDA 4BDFA 1OITA 3F5XA 2SRCA 2QR7A 2XM8A 2PE1A 4YJRA 4JAIA 2VAGA 5J7HA 2IVTA 2Z7RA 2YAAA 3HA6A 2B1PA 1YXTA 4XLIA 4PTEA 2Y4IB 4ANQA 2VTHA 4OT5A 5CXHA 4L7FA 5L6WL 1H0VA 2WOTA 1PMVA 3DJ5A 1MRUA 1P4FA 3KK9A 1OPLA 3CJGA 3PSDA 4O0SA 5AV2A 3TZ8A 2QODA 4YJQA 5KHXA 1GZ8A 1UWJA 2RFDA 4UXQA 3D83A 5M57A 3FZPA 4PTGA 5AADA 4PQNA 3PZEA 3P86A 3RINA 3R01A 3WF8A 4AQCA 4OGRA 2QVSE 4EORA 2VTAA 1UU8A 2X7GA 3GCVA 4M12A 5E8SA 4DEBA 3W32A 4IZ5A 3WF9A 1Q97A 3LFBA 3Q6WA 4FTUA 4GFMA 3U6JA 4YHJA 4A07A 3IONA 3DDPA 4ITHA 4ZTQA 5B2KA 4AT3A 1XH7A 3DDQA 3JUHA 5EDRA 2R9SA 3RAHA 3W33A 4ERKA 3D5UA 2ZV9A 3VS1A 1KWPA 5AP2A 3ORKA 4PPBA 4U6RA 2X8DA 5KCVA 4XG9A 2JIIA 3RCDA 1V1KA 3TT0A 4AT5A 3GOPA 4FVQA 4PMPA 2WQNA 4L3JA 4M66A 5KNJA 3PPZA 1Q41A 3MWUA 1PXPA 4O0RA 5DBXA 4RIOA 2ITQA 3MFRA 3OCGA 3VBTA 3EB0A 3RALA 4CCBA 3JYAA 1PKDA 3E62A 1OL1A 2DUVA 3OTUA 2ITNA 4U0IA 2ITYA 4C4IA 4YR8A 2QO2A 4UMTA 2BKKA 3FI2A 2WQMA 4HYIA 3VRZA 3EFWA 3PUPA 4FSTA 3TI1A 3W10A 1YI3A 2R3FA 4DC2A 3QRUA 4AW0A 4FKJA 4CKRA 2W17A 3KK8A 3CJFA 3OF0A 3Q4CA 3F5UA 3IW6A 4AX8A 4ZLOA 3LXNA 4Y73A 4DEIA 5IPJA 2I7QA 4R77A 2ZJWA 4JG6A 3N51A 5HKMA 4WG4A 2XUUA 5IKWA 4F0FA 4BTFA 2R0UA 1BL7A 4BDKA 1M2PA 4NWMA 4ALWA 3IGGA 5EHYA 4K6ZA 3IOPA 3UC4A 4D2SA 4DGGA 1B38A 1OPKA 3EQRA 3NW5A 2BFYA 3E8DA 4AN9A 5IF1A 2UVXA 3Q9YA 5C8KA 3PXYA 3OWJA 4BKJA 4AF3A 4JIAA 2PWLA 5KMKA 3TN8A 3LXLA 1QPDA 4BTKA 4UZHA 2XMYA 5EM8A 4GFOA 5AJQA 5HG8A 3QQHA 4AW1A 2WGJA 3I7BA 4FIHA 4Z3VA 5IEXA 5KBQA 5CAPA 3WF6A 3TWJA 4TZRA 4G17A 3CSVA 5J1WA 1WCCA 2DWBA 3DV3A 1SNUA 3CEKA 1U59A 1YVJA 2HWOA 3MPMA 3OWPA 4HOKA 4U9AA 5CU3A 4I21A 4UMUA 3TZ7A 5BPYA 1APME 3U6IA 4X7QA 3CY3A 3PE1A 3QLGA 4EWQA 2X8EA 4O21A 2YITA 4FT7A 3QGYA 4DN5A 3QLFA 3A4PA 4HW7A 2B55A 4ITJA 4IWPA 5ACKA 3RJCA 5TOZA 2R4BA 3FLWA 5BUIA 2BRMA 4FYNA 4FT5A 1R0EA 4U41A 2VO7A 4HNFA 4EUTA 2R5TA 4XOZA 2PUPA 3CTJA 2JDOA 4IIRA 5HO8A 4KNBA 1KE8A 5AR8A 3AC5A 4JI9A 4X3FC 2BDJA 1GZKA 1M2RA 2YIXA 3K5VA 5F1ZA 2QOHA 4HZRA 4RVKA 3QL8A 4HVHA 3ZDUA 1XQZA 4UMPA 3FKLA 3L8SA 1Q8WA 4QO9A 2R64A 1HCKA 3NYOA 3TIYA 2J4ZA 3D0EA 3VWAA 3IKAA 3PSCA 3G9NA 1V0BA 1Q3DA 2WQOA 3HX4A 2BZHB 4QTDA 4ZJJA 2QOBA 4YHTA 4BFMA 4MWHA 4E3CA 3R7EA 2VO0A 3O7LB 5J5SA 4KSQA 2JAMA 4MXXA 3O2MA 2OSCA 3GCSA 5GZAA 2BHHA 4TNBA 4D2VA 3O51A 5FD2A 1XWSA 4ZSAA 4W4YA 2Z60A 4G9CA 3SC1A 2CPKE 1WVYA 3IK3A 4BDHA 3R1QA 2XJ1A 3Q60A 3QRIA 2B0QA 3Q9WA 3SXSA 4P7EA 5AX9A 5DE2A 3RK7A 4FTIA 5IEYA 3C51A 1FVRA 1G5SA 2O3PA 4I4FA 3IDBA 3Q04A 2QU6A 4U8ZA 1WAKA 2CGXA 2CMWA 3QYZA 3QTUA 3QZFA 4FV9A 5ETFA 5A3XA 5JQ8A 2YCFA 1Y57A 1YHSA 4FV7A 3ULIA 4OTRA 4WNPA 3LLAA 2ZB0A 4KBAA 4S34A 2OI4X 2V0DA 5L2IA 3SW7A 3D5WA 3I6UA 1XKKA 4O0XA 4ONAA 5AUYA 5IH5A 2OZAA 5DGZA 4M0ZA 4DITA 3R8VA 3DFAA 1ATPE 5DEWA 3C4ZA 2YM3A 4BCJA 2Z7QA 4AW2A 4EH2A 4BI0A 4XX9A 4F1MA 3KL8A 4DTKA 1REJA 2UW8A 3HNGA 1B39A 1PJKA 5F4NA 4PPAA 2WEVA 3I4BA 5AAFA 1PXOA 2E2BA 5AP4A 4O1OA 3NYVA 4F99A 4BB4A 4W8EA 3FKNA 4CZYB 3HEGA 4FTTA 1TQMA 2Z2WA 3WZJA 1URWA 4BGHA 3ZRKA 4NW6A 2JKMA 4YTHA 4ZLYA 5EQPA 4D4VA 3KXNA 2YIWA 1YI4A 4UYNA 3AQVA 3TUBA 2VTTA 4ZEGA 4K9YA 2F2CB 3ANQA 4UYAA 1ZRZA 3BV2A 2J6MA 1IASA 3KCKA 3U8WA 3R7GA 5GINE 4L53A 4UWBA 2DYLA 2PVNA 4S33A 1YWNA 5EG3A 3ZZEA 4C4FA 4CT1A 3HYHA 3U55A 5DOSA 3WZKA 3ZUTA 4JRVA 4F9WA 4QYEA 3FLYA 3V5JA 3EQPA 3REPA 4EQUA 5CAUA 5IQIA 3C1XA 3DK3A 5C1QB 5GNKA 5L6PA 3ZSGA 1H28A 4IVDA 4CV9A 5H3QA 4G34A 2GNFA 1R0PA 4FKLA 4BRXA 2QOFA 5FQDC 4XV1A 4J52A 4BCFA 3IECA 5EH0A 3OCTA 4UN0C 3LZBA 3QFVA 3G15A 4O96A 5GIPE 4NIFB 4LQMA 4FVRA 2WEIA 4DG3E 4CD0A 5M4IA 3NUSA 3MFSA 1ZARA 4EJ7A 3JS2A 4HZSA 4UWCA 4F08A 1NA7A 5GZ9A 3N9XA 4WOVA 4PF4A 5DR9A 4FTRA 4B4LA 1JQHA 3AMYA 3NCZA 1NVQA 1WBVA 2R3QA 4OTFA 4DEGA 2B54A 2Y7JA 3GC0A 4BYJA 3LMHA 3MFTA 3QD3A 2FO0A 3KULB 4IDTA 3SRVA 3UVPA 5KMMA 2V5QA 3E3BX 1VZOA 1JOWB 2J5FA 4CZUA 3PVWA 4MF0A 2W9FB 3G5DA 2JKOA 3NR9A 3WOWA 5CVFA 4C58A 1QPCA 2QURA 4QYGA 2UZUE 1WBOA 3UPZA 4E26A 4EI4A 4CLIA 2RFSA 3DGKA 4ACCA 2XBJA 3ZEPA 3QTXA 4HGTA 4B8LA 5LMBA 4DFZE 3TJCA 4QMXA 3KU2A 4QP9A 5IH4A 1H0WA 2B9FA 4GT4A 5BYZA 1OB3A 3DA6A 3C4CA 2E9NA 4NCTC 4EBVA 1H24A 2BCJA 4HVDA 5BUJA 3PTGA 3LFDA 3RP9A 2WMAA 1H07A 3KFAA 4GYGA 1U46A 4FKVA 4HPUE 4M68A 5ANGA 2YDJA 2RGPA 2YJRA 4RT7A 4DH3A 4CXAA 3TKUA 1UVRA 1PHKA 4IAFA 1OIRA 5BMMA 3GBZA 2HYYA 3WBLA 5AAGA 2QOKA 5JGAA 2WELA 2YZLA 3QWJA 3NW6A 5D12A 4ZY4A 1JKSA 4JQ7A 2BRGA 2EXEA 4UV0A 3HZTA 4DBNA 2E9PA 5JGBA 5H9BA 5ANEA 4Z55A 4BCPA 3MY1A 4CMTA 4EOPA 1ZYCA 3JY9A 5KMIA 4HVGA 3KGAA 5EQYA 3BBTB 5J9YA 4TT7A 4WT6A 3L9NA 3ZBFA 5JSMA 3ZOSA 4EK5A 4YJNA 5HU9A 3NUNA 4I6BA 3OXTA 3EZVA 3FMLA 4BDJA 4EH9A 5HG7A 3TNHA 5JGDA 3E8NA 4FBXA 3LE6A 4BCGA 4E20A 3QXOA 5AR7A 4NM5A 1PRYA 3KRLA 3ZBXA 2BFXA 4P5ZA 4TWPA 4CNHA 4E5WA 1T46A 1MQBA 4UALA 4YTIA 3FC1X 1PY5A 4II5A 1NXKA 3UMWA 4KWPA 4WSQA 4QMYA 2QR8A 3OEFX 5E8YA 5J5TA 2X39A 4U81A 4WG5A 4UWYA 3C0GA 3UVQA 2GFCA 3II5A 4AAAA 3ANRA 2ZV8A 3WF7A 4CGAA 4PWNA 1ZOEA 4UB7A 4GUBA 4XV3A 4AA5A 3AT2A 4BN1A 2PVRA 1KOAA 5AIRA 1ZMVA 3IW7A 4R5YA 2XNEA 3OWLA 3TG1A 1Q5KA 3ZHPC 3QA8A 3W2CA 3DK7A 5HCZA 3W2OA 5AP7A 2VX1A 2ZM1A 4DEDA 2WTJA 2XJ2A 3F88A 5M56A 4MD7E 3DKFA 3ROYA 3OY1A 3UYSA 4C4EA 5JFWA 2PULA 5ETAA 4LMNA 4YLKA 5K0XA 1Q24A 4TYIA 4YJOA 4FV6A 3QQJA 3LIJA 4ZJVA 3TIZA 4XBUA 4OTDA 2GS7A 5CT0A 2YA9A 4TL0A 4RX5A 2OKRA 5I4NA 2Y6OA 5CEQA 3QX4A 2JEDA 2EB2A 3PA5A 3MW1A 5FDXA 4U5JA 4KIOA 4XP0A 3FY0A 4OR5A 5EM5A 1QL6A 2QO7A 5CT7A 1FMOE 3SHEA 3DNDA 4CZTA 4YSMA 3QCXA 2I1MA 5E9EA 4IW0A 4DFXE 4QPSA 4JX3A 5E1EA 3OY3A 3NVKI 5JFSA 3EQGA 4NJDA 2YCRA 3LLTA 4X2JA 3A62A 2XYNA 4I1ZA 5AR3A 4J95A 3CGFA 5AM6A 5IG1A 3ERKA 2C6DA 2W4OA 2CCIA 4NEUA 4PL5A 1CTPE 3FXZA 4CFVA 1ZWSA 3FLNC 2ZV2A 4BBEA 4XP3A 1H1SA 3FLSA 2BTSA 2OXXA 4XG7A 3UE4A 2XIKA 4APPA 5B7VA 4AN3A 4B9DA 3EQIA 3ATTA 4EOMA 3MH1A 4FV5A 1JVPP 4FYOA 3BGPA 1Z9XA 1UWHA 5AWMA 4EZ5A 4K8AA 4AE9A 4EKLA 5C4KA 1H1WA 2C1AA 4I5CA 4A9SA 1HOWA 5CI6A 4P5QA 3DKCA 3AMAA 4GT5A 2WZJA 4YHFA 5AUVA 2VGPA 3FY2A 4KIQA 4RA4A 4F6SA 4V0GB 3FXWA 5CSHA 4YC6A 2X2LA 3GQIA 4G3EA 5CU0A 5I9YA 3DZOA 5DRBA 4RFYA 4QNYA 5E1SA 3WI6A 3HV5A 2V7AA 4DLIA 1YKRA 4MVFA 3K5UA 1YQJA 3S00A 4O0YA 3O8PA 3MB7A 3LFQA 4LI5A 2PZPA 3FQSA 4F9CA 1V0OA 5HI2A 3LJ0A 4BBFA 4AW5A 1UA2A 4MBIA 1PXLA 4OBPA 5M55A 3DTWA 3P1AA 4A9UA 4DCAA 4B99A 3K54A 1ZMUA 2HY81 3S3IA 2XS0A 4G2FA 4X3JA 4LRKA 4S30A 3V01A 4FEWA 4IAYA 1W0XC 2GNIA 5I3OA 4YPSA 1V0PA 4V0GA 3AMBA 1DI9A 4IAIA 3W8LA 3W2RA 1DAWA 4IWOA 2WTKB 4MX9A 4H1MA 1OBGA 4DH1A 4FC0A 3UIMA 3ZLWA 4FZ6A 4NFMA 1FOTA 3GC9A 4FL3A 4MKCA 4R3PA 1OIYA 2WMWA 5A14A 3KCFA 5CVHA 5HD7A 4HVIA 4CLJA 2ITZA 2I6LA 3HRFA 4QTBA 3ZXZA 4AS0A 3FPQA 1OKWA 2R3MA 4ANSA 5EDPA 2W1EA 1OL7A 4M0YA 4G6LA 2ZM4A 4DYMA 2GU8A 3LQ5A 3WE8A 3MY5A 4EK8A 5HX6A 2OF2A 5HTIA 1LEZA 2YLEA 4FF8A 4RG0A 3RMFA 3BHTA 2QLQA 3UO4A 4O6EA 5CTPA 4ANOA 1ZLTA 2G01A 3VF9A 2CN5A 5EW8A 4PDYA 4XUFA 4E6CA 5I9UA 4JX7A 3UIBA 1IR3A 3EKNA 5GZ8A 5BUEA 4V04A 2C1BA 2O64A 5EKOA 4GVAA 4IQ6A 5FXQA 4MAOA 2QCSA 3EFJA 3VQHA 1E1VA 4HNIA 3O8UA 4Y8DA 3EH9A 2QLUA 5L2QA 4BIEA 5HLNA 4J97A 3GI3A 5AP0A 4KABA 2OIBA 5E8TA 3QHWA 5EK7A 3BHVA 2WU7A 4O2ZA 5AUWA 2XK9A 5JEBA 4JDJA 4YUQA 3EN4A 3EYHA 5DPVA 1IA8A 4QTCA 4DGNA 3VBQA 5CEIA 4QMPA 4U40A 3UOHA 3BGZA 3F2RA 4FOCA 2W7XA 2GNJA 4CCUA 5KZIA 3NYNA 5KMJA 5A6NA 4DAWA 4UMQA 4GIIA 4PX6A 4ACDA 4FI1A 4EC9A 2QKRA 5CEMA 1Q8TA 2JIUA 2W1ZA 4L3PA 5FTQA 2W4KA 1G8SA 3EQCA 3QCQA 3NEWA 4UX9A 4C35A 3VHKA 3A8WA 3AOXA 4BIBA 4YBJA 2B4SB 2R3KA 5DT0A 4FIGA 2RKUA 4OTIA 3W1FA 4RLLA 1NW1A 1Y8GA 4O22A 3W2PA 3R8UA 3UOJA 4IJPA 3O0GA 5LXMA 1GOLA 4MNEB 4YNEA 5ETIA 5EYKA 3UG2A 2ETRA 3POZA 4AA0A 3SG9A 2J0IA 4GFGA 3GFEA 2CGVA 2YABA 3MY0A 4ITIA 2FGIA 2RG6A 4BWPA 1MRYA 2QKWB 2UZTA 2YWPA 4J53A 5M09A 4NYEA 1XBAA 5CF4A 5M44A 4QMWA 2YISA 3CLYA 2H9VA 4EOSA 1W83A 3EKKA 4USDA 5KMNA 5AV3A 3TTIA 4PP9A 3DKGA 3OW3A 3NNXA 3DQWA 1ZYLA 4E5AX 3TV7A 5FM3A 3IOKA 4DH5A 4TYGA 4XH6A 3LCOA 4YMJA 3EL7A 3DK6A 4FKGA 4LYNA 4JG7A 4O7SA 2UW7A 2HWPA 5EI2A 4MNEA 4YO6A 3V3VA 4N6ZA 5CU6A 3FMDA 3F61A 3PJ1A 3OW4A 3TV4A 1L3RE 3NDMA 4G6NA 5IMEA 4YZCA 4ASXA 1YDRE 2WIHA 1Q61A 4U43A 4IAKA 4Q5HA 2RFEA 5CAQA 1Q8UA 3ZS5A 4EYJA 2Y8OA 4FOBA 4ZTMA 4RQKA 3VBYA 2VRXA 5FP6A 3LCKA 4R78A 5D7VA 2PMIA 1MP8A 2WTWA 5E4HA 1GNGA 3H9OA 2HXLA 4BCNA 1E1XA 4ID7A 4YPDA 3PXZA 3ZFYA 5IUGA 4C2WA 2G2FA 4EK3A 3O50A 4ANBA 5K9IA 4BI1A 2C47A 4EH3A 3RHKA 2JGZA 5D11A 3UO5A 3A7IA 2R3PA 2RL5A 4MH7A 3OXZA 2W05A 2XM9A 4M15A 5K5NA 2C68A 4XYFA 3DZQA 4KBKA 3BGQA 3HMPA 4D2RA 4O7ZA 3S95A 3QKKA 4HPTE 2XIXA 4Q2AA 3ULZA 1M17A 4GG5A 4ACGA 3R8MA 3VVHA 1BI8A 3VQUA 3KMMA 5IQCA 1DI8A 2W5AA 5HE3A 4FV8A 4KRCA 1YDTE 2QG7A 1PXNA 3PYYA 4ZP5A 4KA3A 1YOMA 2PE0A 2JD5A 3PXRA 4NM3A 2JBOA 4F63A 5L2SA 3CD3A 4Y95A 5G1XA 4GT3A 1JLUE 2C5VA 3GC7A 4ZIMA 4CFNA 3ZO1A 3LQ3A 2OF4A 2HENA 2HXQA 4I0RA 2XEYA 1PXJA 3BV3A 2CSNA 4FICA 4CEGA 5A9UA 1FGIA 5CI7A 2WAJA 1OUKA 5CYIA 2BHEA 2PPQA 3NCGA 5AUXA 4E1ZA 2OFVA 3C13A 4EH4A 5K4IA 3VAPA 4CFWA 4N57A 4BCKA 4A4LA 3P23A 2WD1A 2ZMCA 3GVUA 4KRDA 3FAAA 4TWCA 5AIKA 3QQFA 1UNLA 2HW7A 4ZSEA 5HLPA 2XKEA 4RLKA 2JDRA 3EQFA 4WUNA 4MF1A 3V51A 3R04A 3V5PA 4HCUA 3GCUA 3DT1A 3UNJA 3MESA 5IH6A 4IEBA 3LKMA 5HVYA 4U45A 5C9CA 2VTQA 4ACMA 1ZAOA 4RJ4A 3LJ2A 4BI2A 2CN8A 2UZEA 3MA6A 1M7QA 3DAEA 3EN7A 3LXPA 4WNOA 1RW8A 3DPKA 4I20A 5ANJA 3AGMA 3VBXA 1JSTA 4BBMA 3BX5A 2HZNA 1P5EA 4OTPA 3ZH8A 3MH3A 4D4RA 2C6KA 3FUPA 1KV2A 3FMNA 3NNVA 3PXQA 5LMKA 2CLXA 3MIYA 4MWIA 3BU3A 3SAYA 3SLSA 3WIGA 5HTBA 4MXYA 4FNWA 1WBWA 3QTWA 4W4WA 5FBNC 2J0LA 3VW8A 5CNNA 2XVDA 4H3QA 4LV8A 4P2KA 4ALVA 2CDZA 2VZ6A 3OXIA 2W1GA 4UZDA 3AC1A 2YDIA 4XP2A 3EL8A 4D4YA 1H8FA 2GNLA 1CMKE 3MJ1A 3PJCA 4ASZA 4E6AA 5KO1A 4FT0A 3UBDA 2I0YA 4ZJIA 3GXLA 4AGWA 4EHVA 2YEXA 3HAMA 4TXCA 5BX0A 3QTQA 3VBWA 3GUBA 4EZ3A 3KC3A 4FGRA 5M51A 4R7BA 4FKIA 2AYPA 5ANKA 3FZOA 3BYUA 4JDHA 4IX5A 4NFNA 3UQCA 4ZTNA 4EQCA 3TKIA 3R8ZA 5DH3A 4UY9A 4RMZA 2EXCX 4L44A 3N4UA 1ZY5A 3WZUA 1H01A 2P0CA 3DBFA 3Q9ZA 3NX8A 5B0XA 3FHIA 1AGWA 3FL4A 5DR6A 3SKCA 3VULA 3KMWA 4H3BA 4S32A 5JN2A 4YSJA 5FEDA 4IB5A 5L4QA 3D9VA 4JG8A 4FTKA 4L3LA 4LUEA 4EONA 4YO4A 4U97A 3LCDA 4CFXA 4C38A 1WZYA 3GCPA 3MN3A 5HBJA 2WMXA 4BHNA 4M14A 3ZFMA 5B2MA 2YFXA 4FIEA 4O2PA 4OT6A 5M08A 5L3AA 3HVCA 5CLPA 3R9DA 2I0HA 4LMUA 5CY3A 5LMAA 1GZOA 2I0EA 2WB8A 3PIZA 3VUGA 4KD1A 4AACA 2ZB1A 2PMNX 3CKWA 3G0FA 4WNMA 2FSMX 3QTZA 2V62A 4AU8A 4JQEA 3A7JA 3HV6A 3OHTA 4CG8A 3D94A 2BZJA 2BR1A 2YJSA 1YHWA 3QU0A 2XK8A 3LM0A 4ZS4A 3JXWA 2C0OA 3CPBA 4QMLA 3FXXA 4GSBA 4UXLA 4U7ZA 4I92A 2BUJA 3RZBA 4EOJA 5E8WA 1L8TA 3PRIA 1VEBA 5M07A 3R9NA 3D2IA 1YRPA 3GU4A 4TWOA 4M13A 1JKKA 4O7WA 3DJ7A 3FLZA 2IW9A 4DEEA 5KKRB 3WILA 4I5HA 5IU2A 1I09A 2OXDA 3IDPA 3JPVA 1ZYJA 4FSWA 2C3JA 2GFSA 3HUCA 3KN5A 5CALA 2WTCA 4DG2E 3OWKA 5M4UA 5IA1A 2E9VA 1QPEA 2J90A 2A2AA 3MGYA 2CGWA 2UW0A 3UTOA 3P4KA 2J0MB 2BRNA 4EC8A 3CR0A 3Q6UA 5F9EA 3BWFA 3MFUA 4KUJA 4O81A 4IDVA 2C6TA 2XK3A 4FTOA 3NLBA 4FUXA 2A19B 4TYHB 4FTLA 5AR5A 1LP4A 4BC6A 2BRHA 3HRBA 4NK9A 5IISA 3PP1A 4J96A 1BLXA 3R7UA 5ICPA 2Y9QA 2ZAZA 4HYSA 4M97A 4JXFA 3EYGA 3KVXA 3QALE 3D5XA 5A4TA 3CQUA 5EHOA 1X8BA 4B7TA 3G51A 3MIAA 4V05A 4IX3A 4J7BA 4CRLA 3JR1A 3R9RA 3OBJA 2GTNA 5DYJA 5CSVA 3G0EA 4YC3A 3TNWA 1R3CA 2UVYA 3I1AA 3R9HA 3PPJA 3E7VA 1AQ1A 1GIIA 5AA9A 4TYHA 3PFQA 3M42A 5CWZA 1REKA 3PP0A 2GS6A 5HORA 5CQUA 5CQWA 3NPCA 3WF5A 2FB8A 3E7OA 4FTJA 3FHRA 1OKVA 2AC3A 2C6IA 2Q0NA 1M52A 4JNWA 4EH8A 4EWHA 3P5KA 3N4TA 4AN2A 4FKWA 5LVNA 5A6OA 2CKPA 4P90A 4NL0A 3Q4TA 1H27A 4USFA 3HDMA 3L8VA 4ALUA 4ZXTA 4E93A 3AC4A 1JKLA 4FK6A 4MQ1A 4QYHA 2W1CA 2R2PA 2J0JA 4AT4A 4B0GA 5CF8A 3FZRA 5AFVA 3HV7A 3MI9A 4GK4A 4Y72A 3ZSIA 1FVTA 2OJFE 2NP8A 2A1AB 4MD9E 5TE0A 1U54B 4FZAB 2B9IA 4LM5A 5E8XA 1U5QA 3RHXA 5FBOA 4EOOA 3S1HA 5J8IA 5I9VA 1Z57A 2YERA 2O5KA 4DEAA 5AP3A 3FE3A 4FUYA 3ZM4A 4F0IA 4A7CA 2QONA 4HYUA 5E8ZA 3F6XA 4EH5A 3DQXA 5EYDA 2UZOA 4QQTA 4IM2A 3NNWA 4JJRA 4NKAA 3RZFA 3GU6A 4RIXB 2CCHA 4IM0A 3TTJA 3KY2A 3UPXA 4JBPA 2BKZA 3UMXA 4D0XA 3EWHA 5AM7A 1J1BA 3PIXA 4QP7A 4TY1A 3ROCA 4KBCA 4E4XA 5FDPA 4PDOA 3QA0A 2C6LA 3O17A 3GP0A 2PUUA 4RX9A 1DS5A 4E5BA 4FV3A 2HIWA 2OK1A 4FZDB 4RZVA 4AFEA 4R8QA 5HBEA 4W8DA 4X6RA 4ZTRA 5EM7A 3ZCLA 5FG8A 2YCSA 3QD0A 4FIFA 1WVWA 4D9UA 4ZMEA 2X81A 4ENXA 4RIXA 4ENYA 3A7HA 5F94A 1JBPE 3F3WA 4FZ7A 4I5PA 2QG5A 4EUUA 1BKXA 1KSWA 3TZ9A 3KEXA 4TNDA 3BYVA 4BDGA 4JIKA 3S4QA 2UZBA 2J5EA 2J7TA 4BYIA 3SXRA 2ONLA 3UDBA 3CQWA 4TN6A 2YZAA 5E91A 4KB8A 2YIYA 5FTOA 2UZDA 5CAVA 3W55A 3FI3A 1PXKA 3V8WA 1OGUA 4FIJA 4NIFA 1BMKA 2QNJA 3JVSA 4I3ZA 5D7AA 4LL0A 4F64A 3ZC5A 3HMNA 4NZWB 1TQPA 1WMKA 4QYFA 4YZNA 3FZTA 2X9FA 4MK0A 3NNUA 4MHAA 3EQDA 2RFNA 4JAJA 2R3RA 3QKMA 2F57A 3PSBA 4B8MA 4ZSGA 1AD5A 3AC8A 4EOLA 1UU9A 4GU6A 3KULA 3QAME 4RJ7A 4AOIA 4BL1A 4JOAA 1CKIA 3ODZX 2J50A 2PVYA 4H1JA 2GHMA 1PW2A 3MTFA 3RPVA 3NAXA 4YZMA 5FLFA 5IA0A 3U87A 3E5AA 4IX6A 4LGHA 2XNMA 3UQGA 2HELA 1OECA 2BAJA 3ID6C 5TO8A 4BCMA 3C4EA 4LGGA 3C4XA 1FBNA 1JSUA 4QPAA 4GW8A 2JIVA 3Q4ZA 4MBJA 4EOQA 3FSKA 5DMZA 1GY3A 1WBNA 2IZTA 3F2AA 3FSFA 4FSYA 4F4PA 1K9AA 2VTOA 3I5ZA 4PL4A 3H10A 2CGUA 2A27A 3GU5A 2R7IA 4WSYA 4YZBA 5HICA 4HCTA 4IVBA 2VWZA 1OIUA 3VUIA 4IH8A 4L52A 2BDWA 2ZYBA 4RC3A 2R3OA 4GS6A 4RVMA 3ET7A 4I41A 4E4MA 1XO2B 4O83A 2QHMA 4YNOA 4C33A 3OBGA 5AP1A 5KUPA 1DAYA 3A2CA 3LMIA 5BVEA 3RAWA 3BKBA 2FVDA 4AGDA 4EEVA 2XK7A 5LARA 3E63A 3GQLA 4IVCA 1YI6A 5J7BA 2O2UA 2P55A 3PG3A 2VO3A 4K11A 4OAUC 5AV0A 2EU9A 2YM5A 4O38A 4YLJA 4DGLC 1RJBA 3QQKA 4GL9A 1XH8A 3MSSA 3KF4A 5DT3A 5LVOA 2CLQA 3P78A 5EFQA 1YXVA 4L68A 4WNKA 3ORLA 1SZMA 3F69A 3RM7A 3LFSA 2F7XE 1JNKA 3R7VA 1ZYDA 3GOKA 3CPCA 3E8EA 4D2TA 3V8SA 3ZZWA 3R21A 2F49A 4LUDA 4Y85A 3LM5A 4KKGA 2GDOA 3NWWA 4L9IA 2G2IA 1P14A 3KMUA 4KINA 1RE8A 3A8XA 2HZ0A 2ITTA 3GFWA 3MTLA 3L8XA 3OG7A 2UZVA 4FSQA 4RWIA 3WARA 2ERZE 4ACHA 4F6WA 5BNJA 5LWMA 5CAOA 3BWJA 4QMOA 1PXMA 1YXXA 4R1VA 5AEPA 4M69B 2XCKA 2F9GA 3MDYA 4FK3A 4JS8A 4CYIA 5HLWA 3BU6A 2ITVA 2OGVA 3ALOA 1HCLA 2VU3A 2WMBA 4C0TA 2R7BA 1PMNA 3FLQA 4A9YA 5L8JA 3RNIA 3R73A 3EN9A 2NPQA 1XBBA 4D1XA 4TTHB 2O8YA 4CG9A 3R2YA 2OJ9A 1F0QA 4RSSA 4WG3A 3DCVA 5IUIA 4FKUA 2WTDA 3R7IA 3VW6A 2XK6A 3MVJA 4CMUA 4LRJA 4E4NA 5HE1A 3SG8A 1VJYA 2QC6A 2HZIA 3F2NA 3V8TA 3FI8A 4QYYA 2VX3A 2Z7SA 5DG5A 4CFUA 4L42A 4R3CA 2PK9A 2XRWA 4GRBA 4Q5EA 3VNTA 1A9UA 5I5ZA 4BTJA 2VWYA 4KKEA 2JDTA 3C7QA 4EHEA 3KREA 3QCYA 5GJFA 3RAKA 3NZ0A 4DFYA 1E9HA 2IVSA 4O84A 4QMVA 5I9XA 4H3PA 3SD0A 3H4JA 2W9ZB 5CASA 3OVVA 2A4LA 2OO8X 4RBLA 3QQLA 3T9IA 3TL8A 4PUZA 2BIYA 3TJDA 4DFLA 1YXSA 2GSFA 4JT3A 2OG8A 3BEAA 4U80A 3UGCA 1TVOA 2QI8A 4XS2A 4AUAA 4AXAA 2GS2A 1P2AA 2QO9A 3Q9XA 4X2GA 5J9LA 3BIZA 2C3LA 4I93A 4FTQA 4RJ8A 4CYJA 4O0UA 4IAAA 3L9LA 2C3IB 5C8MA 3C50A 3RAIA 4BDAA 4FGBA 4Y5QA 4DEHA 5CENA 2YM4A 4I24A 2YIQA 1Y6AA 3KQ7A 4AFJA 4YLLA 1YXUA 2IZRA 3LFAA 4D4SA 4ORKA 3DY7A 3VJNA 5HTCA 4X2NA 3AT3A 3V5LA 3T8OA 2AUHA 3QTSA 3GC8A 2BPMA 1Q3WA 4FKQA 3GB2A 5IDNA 4AOJA 1F5QA 5CSWA 5AR2A 2WOUA 3SXFA 2OIQA 5L8KA 1OL6A 2VWVA 2ZDTA 3NUXA 2Y4PA 5D1JA 4CKIA 2WMRA 2ETMA 2ETKA 4MTAA 3R8PA 4K18A 1LR4A 1YW2A 1ZOGA 2FSTX 2H8HA 2UVZA 2WIPA 3VS6A 3ZONA 4DFNA 2WHBA 4O7VA 2XEZA 3OC1A 1CKJA 4WD5A 2GNGA 3FMJA 4I6FA 5F95A 5JRQA 5M53A 3UZTA 3MA3A 5KHWA 2JFLA 2W1FA 5HQ0A 3PPKA 4KIKB 5L2TA 2V55A 4M8TA 5FXRA 5AP5A 4NKSA 3I79A 4ZY6A 3LOKA 2Q83A 2W4JA 1FPUA 3MS9A 3QKLA 2YDKA 5EYCA 4OBQA 2BRBA 3R22A 2F7ZE 5JT2A 4CRSA 4F9AA 5DLSA 4NW5A 2UW4A 5EI8A 2ITPA 1B6CB 4BKYA 2W99B 4M7IA 3S0OA 3W18A 2XIYA 3UIXA 3UODA 4CFMA 1PMUA 4A4XA 1LPUA 4ZOGA 2P2IA 3IS5A 1WBPA 2OXYA 4D55A 1W8CA 4HYHA 1NT2A 3QWKA 4PDSA 2GQSA 3EOCA 3ZLYA 2WMTA 3QHRA 3V6SA 3R7OA 5JMSA 3MYGA 3Q53A 2XIRA 4LOQA 4DGMA 3AGLA 1Q99A 4IB0A 4NJ3A 4O0TA 3ZLXA 4ASDA 4CKJA 5IQFA 3W2QA 2BALA 4GK2A 4NM7A 3IDCA 4FEVA 1UNGA 2LAVA 2RSVA 1Q62A 3PDTA 3NVMB 5A46A 3W8QA 4OTWA 4D5HA 1PYXA 5I9ZA 4QTAA 4BCIA 1XH6A 1Q8YA 3COHA 3VO3A 5T3QA 1UKIA 1BL6A 1O9UA 4IBMA 4WKQA 4FIIA 3P9JA 4XNEA 4MXCA 5HCXA 4IM3A 4K0YA 2GHLA 2F4JA 4IJ9A 2HY0A 4XHKB 2Z7LA 3FQEA 3MJ2A 5IQHA 3D2KA 4X3FB 3LMGA 4KSPA 2JBPA 4O7RA 2OJIA 5FWKK 4AOTA 2B53A 2X2MA 1OMWA 2X6EA 2CNVA 1J7UA 4GUEA 4IX4A 3FWQA 4FTMA 4EBWA 4GKHA 3NW7A 2JKQA 3WZDA 3F66A 2ZOQA 1M14A 5LVPA 2OZOA 5CXZA 2HCKA 5DRDA 5LOHA 4I23A 3Q52A 5AR4A 1J7LA 5TR6A 5ITAA 3MVHA 1Y6BA 2R3GA 4AG8A 4ZTLA 2VTJA 4IE9A 5CNOA 4L46A 4EK6A 2W06A 4DE4A 4JDIA 3VHEA 4GCJA 4LGDA 4JL9A 4BWKA 4IB1A 4CSVA 3QRTA 5C26A 5HE2A 5DT4A 1OIQA 3R0TA 5HCYA 2IW8A 2QU5A 2X7FA 2ZM3A 4PL3A 2VWWA 3TXOA 3M2WA 4LRMA 3R1SA 4AP7A 4QMUA 1UKHA 3DBQA 1O6LA 3FYJX 1Q4LA 3O23A 4HGSA 4L45A 5HESA 4UEUA 3HECA 3LCSA 4FT3A 4PY1A 3I0QA 4AZFA 2C5YA 4GJ2A 3R1NA 2QOLA 4GK3A 4MCVA 3CTHA 2DS1A 4RJ6A 4U79A 4DA5A 2JFMA 3TZMA 5M06A 3OOGA 5BVKA 1KE5A 3B8QA 2Z02A 4HGEA 1SVGA 3BPRA 3DLSA 3DS6A 3G2FA 3ALNA 4FR4A 1ERKA 5J1VA 2VD5A 5ANOA 4GJ3A 4I0SA 4O6LA 2C5XA 2RF9A 2WMQA 5BVNA 4PP7A 1Z5MA 1IAJA 3DXNA 3ETAA 1PMEA 1UV5A 4QT1A 4RVTA 2C3KA 4QPMA 4MQ2A 3VN9A 5H8GA 2IWIA 2KTYA 4XBRA 4GKIA 3FJQE 2VWBA 3NIZA 2XRUA 1YWVA 5GHVA 3QRKA 4FV2A 3QUEA 3D5VA 3H9FA 4FVPA 4Y83A 1EH4A 4DLJA 2P33A 3PIYA 5CX9A 3RPOA 4D1SA 2ERKA 5CU2A 2CKOA 3F5PA 3PE2A 2EWAA 3NYXA 3ZLSA 4BCQA 5H8BA 2QOIA 4V01A 4C59A 3ORTA 5JZJA 2ITOA 3C9WA 4JR7A 1ZZLA 4BY9E 2Y6MA 1QCFA 5TF9A 1CKPA 4FTCA 5FM2A 4HCVA 2RG5A 3RPYA 4YZDA 1H08A 1JPAA 4PRJA 3LW0A 5HNBA 5HX8A 4RX8A 5HO7A 3TACA 4PV0A 4AWIA 2W1DA 4N6YA 5CZHA 4FMQA 5C8NA 4QNAA 2J9MA 3DKOA 3R8LA 1FINA 4W9XA 4UMRA 1MUOA 4AZVA 1H00A 3CTQA 3MH2A 5AV1A 5HHWA 3VJOA 2VWIA 1SVHA 2PVLA 4MBLA 3ORNA 3OEZA 2YM6A 4QP4A 3TNIA 3EN5A 3F3ZA 5AUTA 3OT8A 2PTKA 3H3CA 2OFUA 2OU7A 4O1PA 2CKEA 3RWQA 3LVPA 3BI6A 3MPAA 3B2TA 4DINA 3ENHA 2BMCA 4TYEA 5DHJA 4QRCA 4DFUA 3TV6A 3G33A 2V7OA 3P7CA 4QQ5A 5DI1A 1YHVA 3COIA 3OUNB 3F3UA 2PVFA 1J1CA 3QC9A 4IZAA 3ZU7A 4QMMA 3AD4A 2P3GX 2HAKA 2XF0A 3UOLA 4NSTA 3E93A 4AZSA 2ITXA 5AUZA 3BQCA 4G3DA 3I0OA 4USEA 3L8PA 1IRKA 2BAKA 2YWVA 2B9JA 4XV2A 3BLRA 1R39A 3ORPA 4FSUA 4TWNA 3TCPA 5TT7A 3IPHA 4JDKA 5E90A 2REIA 3F9NA 3LFFA 3NRMA 4IAZA 3R1YA 4IC7A 2VTPA 5DN3A 3U4UA 1OL2A 3NUYA 2VTRA 4IMYA 4D5KA 3D14A 4FNYA 2OIDA 4FEQA 2PU8A 1KOBA 4D58A 3R00A 4AE6A 1O6YA 3A7FA 3HMMA 1BX6A 3QF9A 5CVGA 3H9RA 3M1SA 3RPRA 2ITUA 4F7JA 3F3TA 4FSZA 1J91A 5DWRA 4F65A 3N4VA 3BLQA 4J8NA 4FKOA 4ZS0A 1WFCA 4K33A 2WTKC 4FG7A 4P4CA 3QZHA 4FODA 2HZ4A 4ASEA 1OI9A 2J0KA 1TQIA 2WNTA 1KE7A 3MBLA 5AA8A 4MYGA 3R9OA 5IA2A 2XH5A 1OKYA 5C01A 4L01A 5HEZA 3I81A 4IXPA 5FTGA 3KXGA 3OUKA 4D0WA 5HIDA 4IZYA 5LVLA 3R2BA 4QD6A 3QQUA 3RK5A 3UIUA 4N0SA 4PNIA 4EKKA 2XP2A 3OFMA 3R02A 4EL9A 3NIEA 3HP2A 5EM6A 5HVKA 4C61A 2VWXA 1I44A 3H30A 1O6KA 2PSQA 2XKFA 4NCTA 1ZYSA 1T45A 4QP8A 5HIBA 4BZDA 3SDJA 1K2PA 3CY2A 5M4CA 2W1IA 4FA2A 5L2WA 1BYGA 5HOAA 1R1WA 3VRYA 3U51A 4ZZMA 4WO5A 4KS7A 3TEIA 4QTEA 4DBXA 3DAKA 4RFMA 3QRJA 2FSOX 4QP2A 5AX3A 4DF3A 3EFKA 3P79A 5LJJA 4WBBB 1M7NA 2GMXA 2CNQA 2ZVAA 2C5NA 4FSNA 4ZZOA 3IG7A 3W2SA 4RWKA 5D10A 5D41A 4R3RA 2GQRA 4NTSA 2XBAA 4GH2A 5CF5A 2IZSA 1H1RA 4B6LA 4JBOA 4G3FA 2E9UA 4HVSA 3CBLA 3BYOA 1PF8A 3EMGA 3TUDA 1IA9A 3RK9A 3PJ8A 4NT4A 4W4XA 4AZEA 5J9ZA 2BZIB 5EKNA 2B9HA 3BEGA 4ANMA 2ACXA 1KE6A 4E6QA 3A61A 2IG7A 4HGLA 5I0BA 3ZRLA 5HZNA 2W5BA 1OZ1A 4I6QA 2YAKA 5IQGA 3W16A 4FKSA 4OAVB 5AMNA 4M67A 3ATSA 4YZ9A 2JDSA 2H34A 3IQ7A 3QC4A 4N4SA 3ZC6A 3CQEA 3HMIA 4E73A 5TKDA 4XG4A 3D7TB 3HP5A 3DFCB 2PL0A 5KZ0A 3ZYAA 2IZUA 3QD2B 3PG1A 1OKZA 3HV4A 1GJOA 4RWJA 3UYTA 3V5WA 4BF2A 3Q2JA 2WO6A 3ELJA 5KE0A 4NU1A 1PKGA 3COKA 3OMVA 5FRIA 4TYJA 4XV9A 3ODYX 4FNZA 3KN6A 4QP3A 2XCHA 2WFYA 4ZMFA 4DTAA 4RVLA 4H58A 4J71A 1H1PA 1K3AA 3SOCA 4GV1A 3FBVA 4F6UA 2X2KA 3JVRA 4I5MA 4XG3A 4RIWB 4U3ZA 3VF8A 3SGCA 3T3VA 3C0HA 3FMEA 3QQGA 2PMLX 4BCOA 2QOOA 2PVJA 2PY3A 4PMSA 2CHLA 2VV9A 3D7TA 1TKIA 4XCUA 1FVVA 3L1SA 4G1WA 4LV5A 5HG9A 4DCEA 2GNHA 2VTSA 4I6HA 3KRJA 4MXOA 4FE2A 4FEUA 1QPJA 2R0IA 3VS0A 4CVAA 2XKDA 5EYMA 2O0UA 2OZAB 3LFNA 4FTNA 2HOGA 1MQ4A 3PVGA 4LG4A 3EQBA 5GJGA 2WKMA 3BLHA 3FC2A 3LCTA 4K77A 3HAVA 2DQ7X 4FV4A 5CEPA 4L43A 4YTCA 2ITWA 4IADA 4C34A 3QCSA 4H39A 1QMZA 4L7SA 1OVEA 3GENA 4E7WA 5I3RA 3HRCA 4DGOA 1YWRA 2VTMA 3BYMA 3QX2A 4RIWA 4DT9A 2ZDUA 3LXKA 4X21A 4X2KA 4CFFA 5HIEA 3SX9A 4BGQA 2UZNA 3U9CA 3TKHA 5A4CA 3F5GA 3ZUUA 3HDNA 5FP5A 2JLDA 4O27B 4QQCA 2HK5A 2P4IA 3C0IA 4GU9A 2EVAA 3AC3A 5M4FA 2ESMA 2E9OA 2EXMA 3FI4A 2WMUA 2PZIA 5IA5A 3NUAA 2C6EA 1Q8ZA 3CCNA 1XH4A 5IUHA 3FL5A 3ZRMA 2G9XA 2CKQA 2QHNA 2VTIA 1LUFA 2CNUA 3GT8A 2UZLA 2UW3A 3UOKA 3R6XA 4CQEA 2VUWA 3D15A 1H1QA 5A54A 2PUNA 4Q9ZA 3PWYA 3DBCA 3HUBA 4F1TA 2I0VA 4G31A 2J51A 4QMNA 1NVSA 2LGCA 2VTLA 3QUDA 1VYZA 2GPHA 3C4FA 5CSPA 1ZY4A 3P0MA 3PA3A 4G3GA 3QYWA 3I6WA 4CT2A 4R1YA 2VNYA 1GZNA 1J7IA 4C02A 3CP9A 3PLAE 4FNXA 4RJ5A 5C27A 4CTBA 3AT4A 3ZFXA 3FEGA 1U54A 4TPTA 5DIAA 5ETCA 5J79A 1H25A 3G6GA 5JFXA 2OBJA 1WVXA 1XR1A 2W0JA 3R63A 2ZMDA 4YGAA 5EOLA 1YDSE 3VUMA 5JH6A 5EOBA 4H05A 4I0TA 1R78A 5ANDA 3RVGA 2Y0AA 3EFLA 4O0VA 4OUCA 5CS6A 1KUTA 4YBKA 4LOPA 2IN6A 2OWBA 1VYWA 4JRNA 4EQMA 4Z7GA 3O96A 3CS9A 4YJSA 3OP5A 4RA5A 2ZV7A 4A4OA 4EH6A 5CANA 2YACA 3WYYA 4C4JA 1BI7A 1NVRA 3T3UA 4ERWA 5LMKC 3E64A 2Y4IC 3SRVB 3LQ8A 4MEDA 3VS5A 5IQDA 5DVRA 1UU3A 4GVJA 3EQHA 3FMHA 2NRUA 4YJPA 2X7OA 3QTRA 3QTIA 3BE9A 4AGUA 4PNKA 2C0IA 3OOMA 4RZWA 4CMOA 3CD8A 4KKHA 4S2ZA 2FUMA 4XMOA 3UC3A 5K5XA 3E88A 2BVAA 3OZ6A 2X9EA 3IGOA 3L9PA 3LFCA 3FDNA 4H36A 3TNPC 5AAEA 4WRGA 1WBTA 2H6DA 2XNGA 4Y46A 4C37A 3KKVA 2C69A 3PY1A 4LOOA 4D2PA 3OCSA 4RPVA 4E6DA 2R3IA 3A7GA 5I9WA 2R3JA 4WA9A 4IVAA 4G6OA 1CSNA 1SNXA 2H96A 4FG9A 3PLSA 4YC8A 4DTBA 2IJMA 4D28A 5KBRA 4FV1A 3DAJA 4ANLA 3E92A 3CIKA 1W84A 5HO6A 2V22A 3KRWA 4IANA 2X0GA 4LFIA 2RIOA 3BHYA 2PVHA 3DNEA 2VO6A 1A06A 4XRJA 2OICA 1URCA 3PRFA 2QD9A 1A48A 3ZTXA 1GIJA 3ACJA 3CC6A 2O65A 3D4QA 5IA4A 2X8IA 4U44A 2VX0A 4O7NA 4C62A 3F7WA 3FMKA 5FEEA 4EOKA 1OPJA 2I40A 5EI6A 2X4ZA 3ZO3A 5HNGA 3FZ1A 1UU7A 3FV8A 2C30A 4GMYA 1VR2A 3VIDA 1YOLA 3HKOA 1S9JA 4C36A 5EQEA 5IQEA 2PYWA 5T68A 2XZSA 3NS9A 5DA3A 5IZFA 3Q5IA 2XKCA 2X1NA 4YP8A 2IW6A 3ZO4A 5EW9A 3NMUF 4OTHA 3OD6X 4XLVA 4BR3A 2YIRA 3KXZA 3ORZA 2GCDA 2R3LA 1F3MC 4BDCA 5LQFA 3PVUA 4BZNA 3U6HA 4RFZA 3IW4A 4PMTA 3KB7A 2OJGA 3DBDA 3P7AA 3Q3BA 3PY3A 3KVWA 1P4OA 4F09A 1PYEA 1SM2A 5J87A 2BILB 4L00A 4BTMA 3GGFA 4DT8A 4YURA 4OTQA 2WQEA 1XJDA 2UW6A 3PWDA 4AGCA 2JC6A 3DTCA 3RKBA 3UNKA 2XYUA 4R6VA 3V6RA 4BZOA 3HA8A 4A9TA 3GU7A 3ZO2A 2FSLX 3E87A 1XHAA 3BBWA 5JZNA 5HVJA 4EHGA 5EHLA 4EYMA 4JLCA 4ZK5A 3UZPA 4WRSA 3RPSA 4Y5HA 1H4LA 3EZRA 4R5SA 4KIPA 3LPBA 3VS3A 5ACBC 4FKPA 4J99A 3IO7A 4FEXA 2WXVA 4FTAA 3FQHA 4I94A 1KV1A 3E8CA 2VN9A 5IQAA 2FH9A 3JY0A 4MNFA 2JAVA 2X6DA 3ENMA 4APCA 3EIDA 2PVKA 3QZIA 4TW9A 3HLLA 3BHUA 4JR3A 3HGKA 3RNYA 5KKRC 5B2LA 2XNPA 4QMZA 4CQGA 3UG1A 4M84A 1ZOHA 4C8BA 3EJ1A 3LFEA 4E8AA 5H8EA 4QQJA 4I22A 3HV3A 3V04A 4YJUA 3R83A 4PTCA 5H2UA 3NUPA 4NH1A 5FGKA 3Q96A 4CTCA 2F7EE 2NNWB 2UW5A 3ACKA 3HL7A 5E7RA 4BCHA 4KAOA 2YM7A 4W9WA 2YLFA 1STCE 1IEPA 4Z16A 2OH4A 3M11A 5DR2A 4KS8A 4D9TA 2WTVA 4O0WA 2XIZA 4C4GA 2PUIA 4EOIA 4IACA 3WZEA 2QOQA 4FKRA 4QP6A 4M69A 3RI1A 5IEVA 3DXPA 3RGFA 4OTGA 3DLZA 1Y91A 1XH5A 1SVEA 2F2UA 2Z8CA 3KF7A 3L9MA 3B8RA 3R71A 4IFCA 5EDQA 3I60A 3SV0A 5CU4A 2PHKA 2X4FA 3FZSA 3U54A 2WMVA 4J8MA 4DG0E 1SYKA 4G16A 3AXWA 2JKKA 1U4DA 4YJTA 3TNQB 3VUKA 5BMSA 3CE3A 4IZ7A 5CEOA 3KRXA 2UZWE 4FV0A 4I4EA 4ANNA 3LAUA 3G9LX 3KRRA 2IVUA 3WIKA 3MV5A 4MXAA 4QMQA 3COMA 4ZY5A 3TDVA 2YN8A 2EB3A 3DJ6A 3R30A 3PJ3A 2JITA 3AG9A 2PZ5A 4R7IA 3VBVA 4BHZA 5A4QA 3WYXA 1W7HA 3RWPA 4RC4A 3U4WA 4QMTA 4D2WA 1CM8A 3Q4UA 4F7SA 3G90X 2PE2A 3FKOA 4BWXA 2OJJA 5E8VA 5HU3A 1IAHA 5IMXA 3UO6A 4F7NA 2C6MA 1G3NA 4L8MA 4AZWA 4U3YA 3PZHA 3O71A 2AC5A 3NAYA 4C3PA 5GIOE 3B2WA 2NRYA 1ZMWA 4G9RA 4IC8A 4ZSLA 3S2PA 3THBA 2W1HA 5BYLA 3BHHA 3MPTA 4MXZA 3ORMA 5HD4A 3BELA 2GTMA 3Q32A 2O63A 4F9YA 4ZTHA 3BZ3A 1G8AA 3GEQA 4O7LA 3A60A 3LHJA 3OT3A 1GIHA 2J2IB 3KXHA 4RRVA 3OCBA 4RC2A 2IO6A 1JKTA 4WUAA 3K3JA 3KXXA 3TDWA 2BDFA 4GG7A 4Q9SA 3ZUVA 4RIYB 4XEYA 4OW8A 2ONLC 3DBEA 3RM6A 4RJ3A 3DOGA 3T9TA 1U5RA 3DXQA 1S9IA 1ZXEA 2WMSA 2WTIA 3K2LA
chains in the Genus database with same CATH superfamily
1IG1A 3E3PA 2BZKB 3H0YA 3MB6A 2IEWA 2NO3A 4IWQA 3Q5ZA 2WPAA 3R7YA 2WU6A 4O82A 1RQQA 5LVMA 4YU2A 2IVVA 5G6VA 2R3HA 2VNWA 2R3NA 2C0TA 4FSRA 4C7TA 3OTVA 3ORIA 4XG8A 3QXPA 4C3RA 1CDKA 4D1ZA 2C4GA 2C5OA 4F9BA 3F82A 3PUFC 1J3HA 4FG8A 4C4HA 3FYKX 1ND4A 1ZZ2A 3G6HA 3H0ZA 4IFGA 5FEQA 5BVOA 4RGJA 5JKGA 2A0CX 3D7ZA 3AD6A 4RIYA 1XH9A 2UW9A 4KIKA 3PJ2A 4FZFB 5BQ0A 3Q2MA 2YM8A 5BVFA 2W5HA 2XNBA 4S31A 5E92A 4L67A 2OLCA 5C4LA 4PMMA 5HGIA 3A4OX 4IHPA 3PXFA 1UNHA 4J98A 1PXIA 1OUYA 3PA4A 4XG6A 4RWLA 5FXSA 3ZMMA 4EH7A 3SVVA 1NY3A 4JBVA 5K0KA 2B7AA 3NUUA 3SOAA 4XJ0A 3UP2A 4AA4A 4BICA 2OW3A 4EK4A 4ZTSA 4YTFA 2GQGA 3DU8A 3SA0A 2IPXA 2W96B 3F7ZA 2AQXA 3HMOA 3NGAA 3POOA 4IWDA 5DEYA 4RQVA 4AZTA 1M2QA 3SW4A 4FL1A 4HJOA 4PPCA 3U9NA 5EW3A 5D9HA 3GCQA 3ZXTA 3VS2A 3O7LD 3R28A 4ZSJA 2BIKB 3PVBA 4G3CA 2PMOX 3VUHA 4BDBA 3KIOC 3TM0A 3VUDA 1MRVA 2BROA 3GNIB 2VWUA 3P7BA 3SQQA 3I5NA 4A06A 4ZAUA 3AKLA 3UVRA 5CSXA 1YOJA 3WE4A 1OL5A 5AP6A 3UP7A 4F70A 3AD5A 3RTPA 2VTNA 4X2FA 1FQ1B 2YCQA 4UBAA 3RBWA 4O91A 4F0GA 2BTRA 4FL2A 4K2RA 5E8UA 4DFBA 1JSVA 4TRLA 3VS4A 3F3VA 3V5QA 1BUHA 3FMMA 3KA0A 4NM0A 3ZDIA 2P2HA 4L6QA 2GHGA 2XNNA 4EZ7A 1W98A 4QMSA 4DH7A 2VGOA 5J95A 5IDPA 5JK3A 3BE2A 4CV8A 3ZM9A 2CJMA 4J1RA 3MVMA 3TUCA 3AC2A 4W4VA 4BKZA 4JBQA 4X3FA 4Z9LA 4WIHA 3UZRA 4C3FA 5AV4A 5KMLA 3CXWA 4LL5A 2XB7A 4BGGA 2PZRA 3QBNA 3BYSA 4GYIA 3MVLA 4IB3A 4YJVA 5LCJA 3QZGA 2FYSA 4MD8E 5LWNA 4JVGA 4A9RA 2XA4A 3BRBA 4NTTA 4PDPA 4ZLZA 3DB6A 4TKSA 2FA2A 5CZIA 5ANIA 3O8TA 5T6KA 3LJ1A 1SMHA 4QP1A 3C4WA 4RX7A 5HBHA 3IW5A 4BVUA 5K4JA 2G1TA 1WBSA 3EHAA 2OH0E 3EN6A 4OBOA 3BCEA 5HE0A 4G5PA 5GJDA 4BDIA 5CF6A 4EJNA 3UQFA 4E4LA 2QQ7A 2HW6A 3V5TA 3OROA 5BVDA 2XALA 4FKTA 4FSMA 3DB8A 2XJ0A 4FX3A 3UNZA 1H26A 3OS3A 3ORXA 4XG2A 2KULA 3MH0A 4XOYA 5F20A 5FUTA 5L6OA 4FT9A 5A4LA 3PXKA 4G5JA 2UV2A 5K3YA 3IW8A 2PZYA 4NUSA 3VS7A 4X6QC 3NSZA 5BVWA 1GAGA 1RDQE 3GU8A 4C57A 3C5UA 5HG5A 4ZZNA 2QOCA 5C03A 4OLIA 2UUEA 3BQRA 4Z7HA 5JRSA 2B52A 3CGOA 3QGWA 4O7YA 3P08A 4GEOA 5BYYA 4XRLA 2XNOA 2C6OA 4O7TA 3ITZA 1KE9A 2EUFB 4C2VA 4BDEA 3ZEWA 5A4EA 1Y8YA 2BAQA 4JQ8A 3ZSHA 4U42A 5L8LA 4WBOA 3C5IA 3QD4A 4DHFA 5JQ5A 1OBDA 5DFPA 2JDVA 5IQBA 1FGKA 5AUUA 5HNIX 4K1BA 1FMKA 4O4BB 4F1OA 3A99A 4DH8A 5IA3A 1JAMA 1LEWA 3CKXA 5JFVA 3UJGA 4X0MA 1JWHA 1W82A 4QDVA 3RCJA 1DM2A 4GIHA 4QOXA 5KX8A 3FPMA 4ARKA 4M3QA 3K3IA 3VUTA 5DNRA 2G2HA 3BU5A 4WHZA 2Q0BA 2WQBA 5LCKA 4BIDA 4EHZA 1OM1A 3I7CA 2G15A 2XK4A 2YHVA 1XBCA 5KMOA 3VC4A 4R7HA 4O86A 5CEKA 4N70A 3PY0A 3KXMA 2PVMA 4F7LA 3QUPA 4BDDA 4BDFA 1OITA 3F5XA 2SRCA 2QR7A 2XM8A 2PE1A 4YJRA 4JAIA 2VAGA 5J7HA 4AXDA 2IVTA 2Z7RA 2YAAA 3HA6A 1W2CA 2B1PA 1YXTA 4XLIA 4PTEA 2Y4IB 4ANQA 2VTHA 4OT5A 5CXHA 4AXFA 4L7FA 5L6WL 1H0VA 2WOTA 1PMVA 3DJ5A 1MRUA 1P4FA 3KK9A 1OPLA 3CJGA 3PSDA 4O0SA 5AV2A 3TZ8A 2QODA 4YJQA 5KHXA 1GZ8A 1UWJA 2RFDA 4UXQA 1W2DA 3D83A 3FZPA 4PTGA 5M57A 5AADA 4PQNA 3PZEA 3P86A 3RINA 3R01A 3WF8A 4AQCA 4OGRA 2QVSE 4EORA 2VTAA 1UU8A 2X7GA 3GCVA 4M12A 5E8SA 4DEBA 3W32A 4IZ5A 3WF9A 1Q97A 3LFBA 3Q6WA 4FTUA 4GFMA 3U6JA 4YHJA 4A07A 3IONA 3DDPA 4ITHA 4ZTQA 5B2KA 4AT3A 1XH7A 3DDQA 3JUHA 5EDRA 2R9SA 3RAHA 3W33A 4ERKA 3D5UA 2ZV9A 3VS1A 1KWPA 5AP2A 3ORKA 4PPBA 4U6RA 2X8DA 5KCVA 4XG9A 2JIIA 3RCDA 1V1KA 3TT0A 4AT5A 3GOPA 4FVQA 4PMPA 2WQNA 4L3JA 4M66A 5KNJA 3PPZA 1Q41A 3MWUA 1PXPA 4O0RA 5DBXA 4RIOA 2ITQA 3MFRA 3OCGA 3VBTA 1ST4A 3EB0A 3RALA 4CCBA 3JYAA 1PKDA 3E62A 1OL1A 2DUVA 3OTUA 2ITNA 4U0IA 2ITYA 4C4IA 4YR8A 2QO2A 4UMTA 2BKKA 3FI2A 2WQMA 4HYIA 3VRZA 3EFWA 3PUPA 4FSTA 3TI1A 3W10A 1YI3A 2R3FA 4DC2A 3QRUA 4AW0A 4FKJA 4CKRA 2W17A 3KK8A 3CJFA 3OF0A 3Q4CA 3F5UA 3IW6A 4AX8A 4ZLOA 3LXNA 4Y73A 4DEIA 5IPJA 2I7QA 4R77A 2ZJWA 4JG6A 3N51A 3AKKA 5HKMA 4WG4A 2XUUA 5IKWA 4F0FA 4BTFA 2R0UA 1BL7A 4BDKA 1M2PA 4NWMA 4ALWA 3IGGA 5EHYA 4K6ZA 3IOPA 3UC4A 4D2SA 4DGGA 1B38A 1OPKA 3EQRA 3NW5A 2BFYA 3E8DA 4AN9A 5IF1A 2UVXA 3Q9YA 5C8KA 3PXYA 3OWJA 4BKJA 4AF3A 4JIAA 2PWLA 4O4FA 5KMKA 3TN8A 3LXLA 1QPDA 4BTKA 4UZHA 2XMYA 5EM8A 4GFOA 5AJQA 5HG8A 3QQHA 4AW1A 2WGJA 3I7BA 4FIHA 4Z3VA 5IEXA 3BL7A 5KBQA 5CAPA 3WF6A 3TWJA 4TZRA 4G17A 3CSVA 5J1WA 1WCCA 2DWBA 3DV3A 1SNUA 3CEKA 1U59A 1YVJA 2HWOA 3MPMA 3OWPA 4HOKA 4U9AA 5CU3A 4I21A 4UMUA 3TZ7A 5BPYA 1APME 3U6IA 4X7QA 3CY3A 3PE1A 3QLGA 4EWQA 2X8EA 4O21A 2YITA 4FT7A 3QGYA 4DN5A 3QLFA 3A4PA 4HW7A 2B55A 4ITJA 4IWPA 5ACKA 3RJCA 5TOZA 2R4BA 3FLWA 5BUIA 2BRMA 2XAOA 4FYNA 4FT5A 1R0EA 4U41A 2VO7A 4HNFA 4EUTA 2R5TA 4XOZA 2PUPA 3CTJA 2JDOA 4IIRA 5HO8A 4KNBA 1KE8A 5AR8A 3AC5A 4JI9A 4X3FC 2BDJA 1GZKA 1M2RA 2YIXA 3K5VA 5F1ZA 2QOHA 4HZRA 4RVKA 3QL8A 4HVHA 3ZDUA 1XQZA 4UMPA 3FKLA 3L8SA 1Q8WA 4QO9A 2R64A 1HCKA 3NYOA 3TIYA 2J4ZA 3D0EA 3VWAA 3IKAA 3PSCA 3G9NA 1V0BA 1Q3DA 2WQOA 3HX4A 2BZHB 4QTDA 4ZJJA 2QOBA 4YHTA 4BFMA 4MWHA 4E3CA 3ML1A 3R7EA 3W0QA 2VO0A 3O7LB 5J5SA 4KSQA 2JAMA 4MXXA 3O2MA 2OSCA 3GCSA 5GZAA 2BHHA 4TNBA 4D2VA 3O51A 5FD2A 1XWSA 4ZSAA 4W4YA 2Z60A 4G9CA 3SC1A 2CPKE 1WVYA 3IK3A 4BDHA 3R1QA 2XJ1A 3Q60A 3QRIA 2B0QA 3Q9WA 3SXSA 4P7EA 5AX9A 5DE2A 3RK7A 4FTIA 5IEYA 3C51A 1FVRA 1G5SA 2O3PA 4I4FA 3IDBA 3Q04A 2QU6A 4U8ZA 1WAKA 2CGXA 2CMWA 3QYZA 3QTUA 3QZFA 4FV9A 5ETFA 5A3XA 5JQ8A 2YCFA 1Y57A 1YHSA 4FV7A 3ULIA 4OTRA 4WNPA 3LLAA 2ZB0A 4KBAA 4S34A 2OI4X 2V0DA 5L2IA 3SW7A 3D5WA 3I6UA 1XKKA 4O0XA 4ONAA 5AUYA 5IH5A 2OZAA 5DGZA 4F78A 4M0ZA 4DITA 3R8VA 3DFAA 1ATPE 5DEWA 3C4ZA 2YM3A 4BCJA 2Z7QA 4AW2A 4EH2A 4BI0A 4XX9A 4F1MA 3KL8A 4DTKA 1REJA 2UW8A 3HNGA 1B39A 1PJKA 5F4NA 4PPAA 2WEVA 3I4BA 5AAFA 1PXOA 2E2BA 5AP4A 4O1OA 3NYVA 4F99A 4BB4A 4W8EA 3FKNA 4CZYB 3HEGA 4FTTA 1TQMA 2Z2WA 3WZJA 1URWA 4BGHA 3ZRKA 4NW6A 2JKMA 4YTHA 4ZLYA 5EQPA 4D4VA 3KXNA 2YIWA 1YI4A 4UYNA 3AQVA 3TUBA 2VTTA 4ZEGA 4K9YA 2F2CB 3ANQA 4UYAA 1ZRZA 3BV2A 2J6MA 1IASA 3KCKA 3U8WA 3R7GA 5GINE 4L53A 4UWBA 2DYLA 2PVNA 4S33A 1YWNA 5EG3A 3ZZEA 4C4FA 4CT1A 3HYHA 3NFGB 5DOSA 3WZKA 3U55A 3ZUTA 4JRVA 4F9WA 4QYEA 3FLYA 3V5JA 3EQPA 3REPA 4EQUA 5CAUA 5IQIA 3C1XA 3DK3A 5C1QB 5GNKA 5L6PA 3ZSGA 1H28A 4IVDA 4CV9A 5H3QA 4G34A 2GNFA 1R0PA 3UDSA 4FKLA 4BRXA 2QOFA 5FQDC 4XV1A 4J52A 4BCFA 3IECA 5EH0A 3OCTA 4UN0C 3LZBA 3QFVA 3G15A 4O96A 5GIPE 4NIFB 4LQMA 4FVRA 2WEIA 4DG3E 4CD0A 5M4IA 3NUSA 3MFSA 1ZARA 4EJ7A 3JS2A 4HZSA 4UWCA 4F08A 1NA7A 5GZ9A 3N9XA 4WOVA 4PF4A 5DR9A 4FTRA 4B4LA 1JQHA 3AMYA 3NCZA 1NVQA 1WBVA 2R3QA 4OTFA 4DEGA 2B54A 2Y7JA 3GC0A 4BYJA 3LMHA 3W0RA 3MFTA 3QD3A 2FO0A 3KULB 4IDTA 3SRVA 3UVPA 5KMMA 2V5QA 3E3BX 1VZOA 1JOWB 2J5FA 4CZUA 3PVWA 4MF0A 2W9FB 3G5DA 2JKOA 3NR9A 3WOWA 5CVFA 4C58A 1QPCA 2QURA 4QYGA 2UZUE 1WBOA 3UPZA 4FJVA 4E26A 4EI4A 4CLIA 2RFSA 3DGKA 4ACCA 2XBJA 3ZEPA 3QTXA 4HGTA 4B8LA 5LMBA 4DFZE 3TJCA 4QMXA 3VONA 3KU2A 4QP9A 5IH4A 1H0WA 2B9FA 4GT4A 5BYZA 1OB3A 3DA6A 3C4CA 2E9NA 4NCTC 4EBVA 1H24A 2BCJA 4HVDA 5BUJA 3PTGA 3LFDA 3RP9A 2WMAA 1H07A 3KFAA 4GYGA 1U46A 4FKVA 4HPUE 4M68A 5ANGA 2YDJA 2RGPA 2YJRA 4RT7A 4DH3A 4CXAA 3TKUA 1UVRA 1PHKA 4IAFA 1OIRA 5BMMA 3GBZA 2HYYA 3WBLA 5AAGA 2QOKA 5JGAA 2WELA 2YZLA 3QWJA 3NW6A 5D12A 4ZY4A 1JKSA 4JQ7A 2BRGA 2EXEA 4UV0A 3HZTA 4DBNA 2E9PA 5JGBA 5H9BA 5ANEA 4Z55A 4BCPA 3MY1A 4CMTA 4EOPA 1ZYCA 3JY9A 5KMIA 4HVGA 3KGAA 5EQYA 3BBTB 5J9YA 4TT7A 4WT6A 3L9NA 3ZBFA 5JSMA 3ZOSA 4EK5A 4YJNA 5HU9A 3NUNA 4I6BA 3OXTA 3EZVA 3FMLA 4BDJA 4EH9A 5HG7A 4O4DA 3TNHA 5JGDA 3E8NA 4FBXA 3LE6A 4BCGA 4E20A 3QXOA 5AR7A 4NM5A 1PRYA 3KRLA 3ZBXA 2BFXA 4P5ZA 4TWPA 4CNHA 4E5WA 1T46A 1MQBA 4UALA 4YTIA 3FC1X 1PY5A 4II5A 1NXKA 3UMWA 4KWPA 4WSQA 4QMYA 2QR8A 3OEFX 5E8YA 5J5TA 2X39A 4U81A 4WG5A 4UWYA 3C0GA 3UVQA 2GFCA 3II5A 4AAAA 3ANRA 2ZV8A 3WF7A 4CGAA 4PWNA 1ZOEA 4UB7A 4GUBA 4XV3A 4AA5A 3AT2A 4BN1A 2PVRA 1KOAA 5AIRA 1ZMVA 3IW7A 4R5YA 2XNEA 3OWLA 3TG1A 1Q5KA 3ZHPC 3QA8A 3W2CA 3DK7A 5HCZA 3W2OA 5AP7A 2VX1A 2ZM1A 4DEDA 2WTJA 2XJ2A 3F88A 5M56A 4MD7E 3DKFA 3ROYA 3OY1A 3UYSA 4C4EA 5JFWA 2PULA 5ETAA 4LMNA 4YLKA 5K0XA 1Q24A 4TYIA 4YJOA 4FV6A 3QQJA 3LIJA 4ZJVA 3TIZA 4XBUA 4OTDA 2GS7A 5CT0A 2YA9A 4TL0A 4RX5A 2OKRA 5I4NA 2Y6OA 4QDEA 5CEQA 3QX4A 2JEDA 2EB2A 3PA5A 3MW1A 5FDXA 4U5JA 4KIOA 4XP0A 3FY0A 4OR5A 5EM5A 1QL6A 2QO7A 5CT7A 1FMOE 3SHEA 3DNDA 4CZTA 4YSMA 3QCXA 2I1MA 5E9EA 4IW0A 4DFXE 4QPSA 4JX3A 5E1EA 3OY3A 3NVKI 5JFSA 3EQGA 4NJDA 2YCRA 3LLTA 4DHIB 4X2JA 3A62A 2XYNA 4I1ZA 5AR3A 4J95A 3CGFA 5AM6A 5IG1A 3ERKA 2C6DA 2W4OA 2CCIA 4NEUA 4PL5A 1CTPE 3FXZA 4CFVA 1ZWSA 3FLNC 2ZV2A 4BBEA 4XP3A 1H1SA 3FLSA 2BTSA 2OXXA 4XG7A 3UE4A 2XIKA 4APPA 5B7VA 4AN3A 4B9DA 3EQIA 3ATTA 4EOMA 3MH1A 4FV5A 1JVPP 4FYOA 3BGPA 1Z9XA 1UWHA 5AWMA 4EZ5A 4K8AA 4AE9A 4AAYA 4EKLA 5C4KA 1H1WA 2C1AA 4I5CA 4A9SA 1HOWA 5CI6A 4P5QA 3DKCA 3AMAA 4GT5A 2WZJA 4YHFA 5AUVA 2VGPA 3FY2A 4KIQA 4RA4A 4F6SA 4V0GB 3FXWA 5CSHA 4YC6A 2X2LA 3GQIA 4G3EA 5CU0A 5I9YA 3DZOA 5DRBA 4RFYA 4QNYA 5E1SA 3WI6A 3HV5A 2V7AA 4DLIA 1YKRA 4MVFA 3K5UA 1YQJA 3S00A 4O0YA 3O8PA 3AKJA 3MB7A 3LFQA 4LI5A 2PZPA 3FQSA 4F9CA 1V0OA 5HI2A 3LJ0A 4BBFA 4AW5A 4LDTA 1UA2A 4MBIA 1PXLA 3UDTA 4OBPA 5M55A 3DTWA 3P1AA 4A9UA 4DCAA 4B99A 3K54A 1ZMUA 2HY81 3S3IA 2XS0A 4G2FA 4X3JA 4LRKA 4S30A 3V01A 4FEWA 4IAYA 1W0XC 2GNIA 5I3OA 4YPSA 1V0PA 4V0GA 3AMBA 1DI9A 4IAIA 3W8LA 3W2RA 4JMQA 1DAWA 4IWOA 2WTKB 4MX9A 4H1MA 1OBGA 4DH1A 4FC0A 3PFYA 3UIMA 3ZLWA 4FZ6A 4NFMA 1FOTA 3GC9A 4FL3A 4MKCA 4R3PA 1OIYA 2WMWA 5A14A 3KCFA 5CVHA 5HD7A 4HVIA 4CLJA 2ITZA 2I6LA 3HRFA 4QTBA 3ZXZA 4AS0A 3FPQA 1OKWA 2R3MA 4ANSA 5EDPA 2W1EA 1OL7A 4M0YA 4G6LA 2ZM4A 2ZFYA 3W0SA 4DYMA 2GU8A 3LQ5A 3WE8A 3MY5A 4EK8A 5HX6A 2OF2A 5HTIA 1LEZA 2YLEA 4FF8A 4RG0A 3RMFA 3BHTA 2QLQA 3UO4A 4O6EA 5CTPA 4ANOA 1ZLTA 2G01A 3VF9A 2CN5A 5EW8A 4PDYA 4XUFA 4E6CA 5I9UA 4JX7A 3UIBA 1IR3A 3EKNA 5GZ8A 5BUEA 4V04A 2C1BA 2O64A 5EKOA 4GVAA 4IQ6A 5FXQA 4MAOA 2QCSA 3EFJA 3VQHA 1E1VA 4HNIA 3O8UA 4Y8DA 3EH9A 2QLUA 5L2QA 4BIEA 5HLNA 4J97A 3GI3A 5AP0A 4KABA 2OIBA 5E8TA 3QHWA 5EK7A 3BHVA 2WU7A 4O2ZA 5AUWA 2XK9A 5JEBA 4JDJA 4YUQA 3EN4A 3EYHA 5DPVA 1IA8A 4QTCA 4DGNA 3VBQA 5CEIA 4QMPA 4U40A 3UOHA 3BGZA 3F2RA 4FOCA 2W7XA 2GNJA 4CCUA 5KZIA 3NYNA 5KMJA 5A6NA 4DAWA 4UMQA 4GIIA 4PX6A 4ACDA 4FI1A 4EC9A 2QKRA 5CEMA 1Q8TA 2JIUA 2W1ZA 4L3PA 5FTQA 2W4KA 1G8SA 3EQCA 3QCQA 3NEWA 4UX9A 4C35A 3VHKA 3A8WA 3AOXA 4BIBA 4YBJA 2B4SB 2R3KA 5DT0A 4FIGA 2RKUA 4OTIA 3W1FA 4RLLA 1NW1A 1Y8GA 4O22A 3W2PA 3R8UA 3UOJA 4IJPA 3O0GA 5LXMA 1GOLA 4MNEB 4YNEA 5ETIA 5EYKA 3UG2A 2ETRA 3POZA 4AA0A 3SG9A 2J0IA 4GFGA 3GFEA 2CGVA 2YABA 3MY0A 4ITIA 2FGIA 2RG6A 4BWPA 1MRYA 2QKWB 2UZTA 2YWPA 4J53A 5M09A 4NYEA 1XBAA 5CF4A 5M44A 4QMWA 2YISA 3CLYA 2H9VA 4EOSA 1W83A 3EKKA 4USDA 5KMNA 5AV3A 3TTIA 4PP9A 3DKGA 3OW3A 3NNXA 3DQWA 1ZYLA 4E5AX 3TV7A 5FM3A 3IOKA 4DH5A 4TYGA 4XH6A 3LCOA 4YMJA 3EL7A 3DK6A 4FKGA 4LYNA 4JG7A 4O7SA 2UW7A 2HWPA 5EI2A 4MNEA 4YO6A 3V3VA 4N6ZA 5CU6A 3FMDA 3F61A 3PJ1A 3OW4A 3TV4A 1L3RE 3NDMA 4G6NA 5IMEA 4YZCA 4AXCA 4ASXA 1YDRE 2WIHA 1Q61A 4U43A 4IAKA 4Q5HA 2RFEA 5CAQA 1Q8UA 3ZS5A 4EYJA 2Y8OA 4FOBA 4ZTMA 4RQKA 3VBYA 2VRXA 5FP6A 3LCKA 4R78A 5D7VA 2PMIA 1MP8A 2WTWA 5E4HA 1GNGA 3H9OA 2HXLA 4BCNA 1E1XA 4ID7A 4YPDA 3PXZA 3ZFYA 5IUGA 4C2WA 2G2FA 2NYAA 4EK3A 3O50A 4ANBA 5K9IA 4BI1A 2C47A 4EH3A 3RHKA 2JGZA 5D11A 3UO5A 3A7IA 2R3PA 2RL5A 4MH7A 3OXZA 2W05A 2XM9A 4M15A 5K5NA 2C68A 4XYFA 3DZQA 4KBKA 3BGQA 3HMPA 4D2RA 4O7ZA 3S95A 3QKKA 4HPTE 2XIXA 4Q2AA 3ULZA 1M17A 4GG5A 4ACGA 3R8MA 3VVHA 1BI8A 3VQUA 3KMMA 5IQCA 1DI8A 2W5AA 5HE3A 4FV8A 4KRCA 1YDTE 2QG7A 1PXNA 3PYYA 4ZP5A 4KA3A 1YOMA 2PE0A 2JD5A 3PXRA 4NM3A 2JBOA 4F63A 5L2SA 3CD3A 4Y95A 5G1XA 4GT3A 1JLUE 2C5VA 3GC7A 4ZIMA 4CFNA 3ZO1A 3LQ3A 2OF4A 2HENA 2HXQA 4I0RA 2XEYA 1PXJA 3BV3A 2CSNA 4FICA 4CEGA 5A9UA 1FGIA 5CI7A 2WAJA 1OUKA 5CYIA 2BHEA 2PPQA 3NCGA 5AUXA 4E1ZA 2OFVA 3C13A 4EH4A 5K4IA 3VAPA 4CFWA 4N57A 4BCKA 4A4LA 3P23A 4DDGA 2WD1A 2ZMCA 3GVUA 4KRDA 3FAAA 4TWCA 5AIKA 3QQFA 1UNLA 2HW7A 4ZSEA 5HLPA 2XKEA 4RLKA 2JDRA 3EQFA 4WUNA 4MF1A 3V51A 3R04A 3V5PA 4HCUA 3GCUA 3DT1A 3UNJA 3MESA 1ST0A 5IH6A 4IEBA 3LKMA 5HVYA 4U45A 5C9CA 2VTQA 4ACMA 1ZAOA 4RJ4A 3LJ2A 4BI2A 2CN8A 2UZEA 3MA6A 1M7QA 3DAEA 3EN7A 3LXPA 4WNOA 1RW8A 3DPKA 4I20A 5ANJA 3AGMA 3VBXA 1JSTA 4BBMA 1W2FA 2HZNA 1P5EA 3BX5A 4OTPA 3MH3A 3ZH8A 2C6KA 3FUPA 1KV2A 3FMNA 3NNVA 3PXQA 5LMKA 2CLXA 3MIYA 4MWIA 3BU3A 3SAYA 3SLSA 3WIGA 5HTBA 4MXYA 4FNWA 1WBWA 3QTWA 4W4WA 5FBNC 2J0LA 3VW8A 5CNNA 2XVDA 4H3QA 4LV8A 4P2KA 4ALVA 2CDZA 2VZ6A 3OXIA 2W1GA 4UZDA 3AC1A 2YDIA 4XP2A 3EL8A 4D4YA 1H8FA 2GNLA 1CMKE 3MJ1A 3PJCA 4ASZA 4E6AA 5KO1A 4FT0A 3UBDA 2I0YA 4ZJIA 3GXLA 4AGWA 4EHVA 2YEXA 3HAMA 4TXCA 5BX0A 3QTQA 3VBWA 3GUBA 4EZ3A 3KC3A 4FGRA 5M51A 4R7BA 4FKIA 2AYPA 5ANKA 3FZOA 3BYUA 4JDHA 4IX5A 4NFNA 3UQCA 4ZTNA 4EQCA 3TKIA 3R8ZA 5DH3A 4UY9A 4RMZA 2EXCX 4L44A 3N4UA 1ZY5A 3WZUA 1H01A 2P0CA 3DBFA 3Q9ZA 3NX8A 5B0XA 3FHIA 1AGWA 3FL4A 5DR6A 3SKCA 3VULA 3KMWA 4H3BA 4S32A 5JN2A 4YSJA 5FEDA 4IB5A 5L4QA 3D9VA 4JG8A 4FTKA 4L3LA 4LUEA 4EONA 4YO4A 4U97A 3LCDA 4CFXA 3W0MA 4C38A 1WZYA 3GCPA 3MN3A 5HBJA 2WMXA 4BHNA 4M14A 3ZFMA 5B2MA 2YFXA 4FIEA 4O2PA 4OT6A 5M08A 5L3AA 3HVCA 5CLPA 3R9DA 2I0HA 4LMUA 5CY3A 5LMAA 1GZOA 2I0EA 2WB8A 3PIZA 3VUGA 4KD1A 4AACA 2ZB1A 2PMNX 3CKWA 3G0FA 4WNMA 2FSMX 3QTZA 2V62A 4AU8A 3BLAA 4JQEA 3A7JA 3HV6A 3OHTA 4CG8A 3D94A 2BZJA 2BR1A 2YJSA 1YHWA 3QU0A 2X0OA 2XK8A 3LM0A 4ZS4A 3JXWA 2C0OA 3CPBA 4QMLA 3FXXA 4GSBA 4UXLA 4U7ZA 4I92A 2BUJA 3RZBA 4EOJA 5E8WA 1L8TA 3PRIA 1VEBA 5M07A 3R9NA 3D2IA 1YRPA 3GU4A 4TWOA 4M13A 1JKKA 4O7WA 3DJ7A 3FLZA 2IW9A 4DEEA 5KKRB 3WILA 4I5HA 5IU2A 1I09A 2OXDA 3IDPA 3JPVA 1ZYJA 4FSWA 2C3JA 2GFSA 3HUCA 3KN5A 5CALA 2WTCA 4DG2E 3OWKA 5M4UA 5IA1A 2E9VA 1QPEA 2J90A 2A2AA 3MGYA 2CGWA 2UW0A 3UTOA 3P4KA 2J0MB 2BRNA 4EC8A 3CR0A 3Q6UA 5F9EA 3BWFA 3MFUA 4KUJA 4O81A 4IDVA 2C6TA 2XK3A 4FTOA 3NLBA 4FUXA 2A19B 4TYHB 4FTLA 5AR5A 1LP4A 4BC6A 2BRHA 3HRBA 4NK9A 5IISA 3PP1A 4J96A 1BLXA 3R7UA