2PVKA

Structure-based design of pyrazolo[1,5-a][1,3,5]triazine derivatives as potent inhibitors of protein kinase ck2
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
328
structure length
327
Chain Sequence
b'MSKARVYADVNVLRPKEYWDYEALTVQWGEQDDYEVVRKVGRGKYSEVFEGINVNNNEKCIIKILKPVKKKKIKREIKILQNLGGPNIVKLLDIVRDQHSKTPSLIFEYVNNTDFKVLYPTLTDYDIRYYIYELLKALDYCHSQGIMHRDVKPHNVMIDHELRKLRLIDWGLAEFYHPGKEYNVRVASRYFKGPELLVDLQDYDYSLDMWSLGCMFAGMIFRKEPFFYGHDNHDQLVKIAKVLGTDGLNAYLNKYRIELDPQLEALVGRHSRKPWLKFMNADNQHLVSPEAIDFLDKLLRYDHQERLTALEAMTHPYFQQVRAAENS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Casein kinase II subunit alpha
publication title Structure-based design, synthesis, and study of pyrazolo[1,5-a][1,3,5]triazine derivatives as potent inhibitors of protein kinase CK2.
pubmed doi rcsb
source organism Zea mays
molecule tags Transferase
total genus 114
structure length 327
sequence length 328
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2007-05-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2pvkA01
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2pvkA02
2A19B 2WU7A 4F08A 3GCSA 3K2LA 3ZO2A 2ETKA 3GU7A 4I24A 4GKIA 4BDEA 3F3WA 1OL5A 2IVUA 3GQLA 2XIKA 4IX4A 3EYGA 5AP0A 2XEZA 4YC6A 4FKJA 1XQZA 3WF7A 4MXCA 4D1ZA 2GS2A 3R2YA 4U97A 3TM0A 3Q4UA 4RFMA 3QHRA 5CX9A 1QPEA 4FTOA 4I0RA 4ZIMA 4WBOA 3Q9ZA 4QMUA 1H27A 3RAWA 3BGQA 4KBAA 3UZPA 1UVRA 3PJ2A 4JAJA 3VQUA 1M7NA 1WCCA 3LFBA 2PSQA 5H8BA 2V7AA 1OBGA 3AD5A 5IA5A 3VUDA 3C5UA 4YO6A 3WBLA 4DBNA 1IA8A 2NPQA 3R9HA 2YCRA 3ZFXA 4BWXA 3SA0A 3ZU7A 2R3RA 4EOKA 3MS9A 4FV8A 2JDSA 4QPAA 1XO2B 4ZSEA 3TV7A 4EHEA 3V8SA 2OZAB 3S1HA 2GMXA 2WIPA 4XG7A 3ORPA 4IWPA 4AUAA 5HTCA 4CFNA 1PYEA 4ZMEA 5FLFA 4CZUA 5AUZA 3UE4A 3RP9A 2PYWA 3QAME 3VIDA 2JDOA 2OH4A 5GJFA 4B8MA 5A6OA 2JBOA 3U6HA 3P08A 2WFYA 1BMKA 3RK7A 4RJ4A 1MRYA 3BZ3A 3PZHA 1VR2A 4IM2A 5M06A 5DR2A 2ZAZA 4RQVA 4ERKA 3QC4A 4RX8A 4F7LA 3MPAA 2QG5A 1ATPE 1JKTA 1RW8A 2XKDA 3A7FA 3DQWA 2EUFB 4M0YA 4TZRA 3NVKI 3UVRA 2HXQA 2R7BA 1IA9A 4LGDA 1X8BA 2C6KA 2J0IA 3PWDA 2C5NA 2PU8A 3EFWA 2R3LA 4FKSA 2B53A 5ANOA 3FBVA 5HIBA 5BPYA 2C0IA 5DR9A 3CQUA 5J9ZA 1JKSA 4DG0E 4DG2E 5HO7A 2OF2A 3OY3A 2XUUA 4DGNA 1XR1A 3OG7A 3LFCA 4H1JA 4KRDA 4QT1A 2GS7A 2W1EA 4IAAA 1QL6A 4QYEA 1Q5KA 2PHKA 2W99B 4RIWB 1S9JA 4U9AA 3GC7A 3M2WA 4WNOA 5CVFA 5J5SA 5JGAA 3MVMA 2WTKC 4JIKA 4X3FA 4LMNA 4ZLOA 2CGUA 2JLDA 1HOWA 4M14A 4TYEA 2VTAA 5EK7A 4BCKA 4D2TA 3S3IA 1PRYA 1GY3A 4UXLA 1ZOGA 5HG5A 3FL5A 4BCJA 2VX3A 4MF0A 2XNEA 4E1ZA 2C69A 3VHKA 2G1TA 4XG8A 5HX8A 4G3EA 5DBXA 4BCPA 4FKVA 3C0GA 3R00A 1CKIA 4ZOGA 3JYAA 3KK9A 4NT4A 3BU6A 4MBLA 3H9RA 2E2BA 4YPDA 2X7OA 3BHUA 4MD9E 5BVNA 3LZBA 5EM8A 3SW4A 3OBJA 2ONLA 4GUEA 3QQGA 2AUHA 3EIDA 3NW5A 4R3CA 3E62A 5CAPA 3V5WA 3R0TA 1T46A 5J87A 3IW4A 3Q32A 4LRMA 3E93A 1Z9XA 2OBJA 1CSNA 4C37A 4PMSA 3LFAA 4C57A 3LMHA 2W4KA 4RJ5A 2OICA 5LXMA 4IAFA 3PTGA 1APME 3LXNA 1TVOA 4IZAA 3BKBA 1MQBA 2VTHA 4NEUA 3KA0A 4NH1A 3N4VA 1RQQA 2DQ7X 4DTAA 3MTLA 1IG1A 2VZ6A 2YM3A 2HENA 3WZKA 3UOJA 4J1RA 2C6TA 4IDTA 4BRXA 3D0EA 2Y6OA 5GNKA 4FIHA 5C8NA 1SMHA 3GEQA 3F5XA 3R7YA 2RFEA 3LCTA 3QKKA 1UNHA 3LM5A 3B8QA 3UIUA 4ZSAA 1SZMA 3SXRA 5LVNA 4G5JA 4DT9A 5EM5A 3NMUF 1ZAOA 3JVRA 4GFGA 2B9FA 1JSTA 3UMXA 4CV8A 2OJFE 2PK9A 5EI6A 1VEBA 4R7IA 3TJCA 1A9UA 2VWZA 2ERZE 3R1YA 2X2KA 3FC2A 2Q83A 2PZPA 5F20A 2DWBA 3DKGA 4RMZA 1PXPA 5D1JA 2VUWA 4DT8A 1XHAA 3V5LA 3MGYA 1O6KA 5CSWA 5KUPA 3UIXA 4JR7A 2IO6A 2FSTX 4EH6A 5C9CA 5KBQA 5KKRB 2OSCA 5A4QA 2G2FA 3OCTA 3UBDA 4P4CA 3S4QA 2C3IB 1W8CA 4BDDA 4AGDA 3S2PA 5L8LA 4J71A 3HAMA 2VO3A 1OZ1A 4EOLA 5H3QA 3U9CA 3DFCB 4FL1A 4CKRA 3DFAA 1F3MC 3BE9A 3R73A 4GYIA 4L46A 4N6YA 3NUXA 2XCHA 3IOPA 4YZBA 5IQCA 2FB8A 3AT4A 3BE2A 4PWNA 2QU5A 4RA4A 5TE0A 3QCXA 5EM7A 3SQQA 1YI6A 4D4VA 3WIKA 2QKRA 5HKMA 3ZRMA 3MVHA 3Q52A 2YJSA 3EMGA 4EH2A 5E8SA 3C4XA 4YSMA 3ZFMA 4FYOA 4FZ6A 4BC6A 3NNUA 3F2RA 4JBVA 4GH2A 5BMMA 4D9UA 5FG8A 3QTWA 3QD0A 4FIFA 4FEXA 2H8HA 4FG7A 2WAJA 3BIZA 3M42A 3VW8A 3PLSA 1Y6AA 5AUXA 4GIIA 2BRBA 3CPCA 3PY1A 3K3JA 2CMWA 4FG9A 4IDVA 4MD7E 4C0TA 4S34A 4D58A 1KUTA 5E1EA 1DI8A 3FXXA 5ETIA 4ANMA 5AR7A 1XH4A 3BEGA 3GU5A 4FSZA 3PXQA 4RA5A 3FZPA 4YJPA 5LVPA 4F6SA 3LMIA 1PMUA 2CGVA 2JDTA 1PF8A 2XCKA 4UYAA 3OWPA 2Y6MA 3ZSIA 4RIXB 4YC3A 3P86A 5LCJA 2GHLA 3ET7A 1ND4A 5GIOE 1JAMA 4C4HA 5M09A 2BCJA 2QLQA 3R8LA 2VU3A 2VO0A 5AV0A 3BYVA 3NNVA 3KCKA 3O7LB 3Q5ZA 3L9PA 2HWOA 4RC2A 2C6LA 3AG9A 4TWOA 4A9TA 2O63A 4YNOA 3I7BA 1KOBA 3HV4A 3AC2A 3KRRA 3QQHA 3F3VA 2YCFA 3GC9A 3QCQA 3UVQA 3ZUTA 4AW1A 2RFNA 4EKKA 2X1NA 3PXFA 4IIRA 4TYHA 5KMKA 4FL3A 2PULA 4MH7A 2OKRA 2VAGA 3FE3A 2QLUA 3PVWA 4FTJA 4HZSA 4W8DA 4AZWA 4L52A 5IQAA 3DNEA 3WZJA 1ZYSA 3MFUA 3TEIA 5AP6A 3SG9A 4CGAA 5LWNA 3EQHA 5HCYA 5JMSA 5E8VA 4KS8A 4EOMA 3EN6A 3RK5A 5DYJA 3Q9YA 4O7NA 3D83A 1L3RE 3ZSHA 5KMLA 4II5A 2VWBA 4L3JA 3SX9A 1STCE 4QYFA 3W2SA 3IDPA 4QMQA 4F6WA 4DHFA 4ZTHA 3SLSA 5ANDA 4KBKA 4KIKA 4YSJA 5B2LA 1NXKA 4K18A 3TKUA 4AGWA 5C8KA 4FR4A 3TV4A 4HVGA 4IB3A 4CQGA 3SW7A 4WG4A 2B55A 2CCHA 1ZYLA 3O96A 2RFDA 4W4YA 4D4RA 3Q9XA 3EQDA 1UKIA 5IA4A 4G5PA 5GZ9A 2QKWB 4YLKA 3NNWA 3E8NA 3BGPA 5ANEA 3CY3A 3C51A 4GFOA 1JSUA 2NRUA 4WBBB 4DH3A 4R3PA 3AGLA 3QGWA 4BDAA 2C6OA 1IRKA 2J50A 5CASA 4ZJIA 4C7TA 3U54A 3KF7A 3G2FA 5BNJA 4FMQA 1GNGA 4X2FA 4DH7A 1J3HA 3ZLWA 3RCJA 4MXXA 3P78A 4GV1A 5ACKA 1H1WA 4AOTA 4UZDA 4H1MA 5HG7A 5AP7A 3RAIA 4GVAA 3U6IA 2W4OA 1TQMA 3DCVA 2B9JA 5BYZA 3I5ZA 3LIJA 5DMZA 5KBRA 4EEVA 1PXMA 3OTVA 2PMOX 4JBQA 4LUDA 2OJGA 3I5NA 3DK7A 4D1XA 1OB3A 3C7QA 3CP9A 3IW6A 5K4IA 1FBNA 3EB0A 5IPJA 4EOQA 4AG8A 3RPSA 3BHTA 1W98A 5JT2A 2JIUA 2YDKA 1DAWA 3ZYAA 4CTCA 2R3HA 3LVPA 2UZNA 3HV5A 4GS6A 3UYTA 3DBCA 2R3NA 2X8EA 3CBLA 3IECA 4RJ6A 2WMTA 4L68A 3QQLA 5EOLA 4AF3A 3EZVA 4ZAUA 3QYZA 4XCUA 5EW3A 1OL7A 2J6MA 5HICA 4TWCA 4FA2A 2C1BA 4C62A 4FEVA 4BFMA 5GJDA 3IW5A 3KXMA 2YDJA 4RVTA 1Y8GA 4W4VA 4YJTA 4PNIA 3TJDA 4BN1A 5HLPA 4CRLA 1GAGA 2CKEA 1OPKA 3I1AA 1TKIA 4WD5A 4NUSA 4YJSA 4L6QA 5J79A 1GZOA 3VRZA 2E9OA 3Q2JA 1F5QA 2R3FA 3UQCA 3V5TA 3QFVA 3GU6A 1H4LA 3PIYA 4GU9A 3PRFA 4ZTQA 1M7QA 4GRBA 3QTUA 4G16A 3AOXA 4FNYA 4QTBA 3FZ1A 3FMKA 3R8VA 3RCDA 4E4MA 4X3JA 1QPJA 3UO4A 4APPA 2VX1A 4LI5A 2RGPA 3NNXA 4QMWA 2A2AA 4MQ1A 3CJFA 3I81A 4V0GB 3TTJA 4UMUA 3VUGA 4QYYA 4F1OA 4F63A 2WOTA 5M53A 2UV2A 4HGSA 4YJOA 3C4FA 3FXWA 4D9TA 1YW2A 4BY9E 3TNPC 1F0QA 2E9UA 4C3PA 2EVAA 3V04A 4D4YA 4YTCA 4J8MA 3QLGA 4YTFA 2Z7RA 3C0IA 4K1BA 5ETCA 5FD2A 5EQPA 4EH3A 3EQIA 1DS5A 2H34A 2WQEA 3QALE 4BBFA 5M56A 1M2RA 2CKOA 3O8PA 4DA5A 5HX6A 4AT3A 2OF4A 4FKQA 5TO8A 1WVWA 3AT2A 1ZRZA 4J95A 3R9NA 3PVGA 4RVLA 4O7SA 4FZ7A 2QURA 1JQHA 2VN9A 5CAUA 5I4NA 2UZEA 4M13A 2J0JA 4OGRA 4YJUA 5C27A 5BVFA 5IUHA 3HUCA 4G34A 4AT5A 3H0ZA 5HORA 5CF5A 5J1WA 4R3RA 4QYGA 2GQRA 3R9DA 1PY5A 4JX7A 2O8YA 4CFUA 1HCLA 2Y7JA 3MN3A 4RQKA 1URWA 4PPCA 4MCVA 3QHWA 1JOWB 5ANKA 2QD9A 4HYHA 4LL0A 4QTDA 2FSOX 3MPMA 4MXZA 4YJQA 3EQFA 4K0YA 2Z7LA 4DLJA 5K5XA 2C6IA 1Q61A 4LQMA 3NUAA 5EH0A 2QOQA 3AMAA 1XBBA 5CNNA 4DEGA 3F7ZA 3FAAA 3PE2A 2WQNA 3O50A 1CTPE 3P0MA 1M2PA 4O1OA 2WTKB 4ZY6A 2O3PA 4Z7GA 3DLSA 2PVYA 4FODA 3COHA 3UZTA 3ULIA 2ITYA 4I5CA 4X7QA 5HI2A 2VWUA 4FOCA 4FTUA 3PIZA 4Q5HA 2XNBA 4KSPA 1LPUA 2V62A 3V01A 3UDBA 2IPXA 5KZIA 4PY1A 4UMPA 4JX3A 5CWZA 5H8EA 3ZSGA 4G6LA 3R28A 4FKIA 2EXMA 2C1AA 1U54A 2ZDTA 4RLKA 1ZARA 2C5XA 3HP5A 3PY0A 4MX9A 4USDA 3ZC6A 4EZ3A 3SXSA 2P2IA 3EWHA 5KZ0A 4C59A 4EH7A 1XWSA 2OW3A 2JFLA 4KAOA 3RINA 2BZJA 3SKCA 3TNQB 4LFIA 4D4SA 3AQVA 3P7BA 1XBCA 1PKGA 3BX5A 3LE6A 1RJBA 3GB2A 4KIOA 2F9GA 4CFMA 4CG9A 4AS0A 1H1RA 3PZEA 4MXYA 2BKKA 1KE6A 3OD6X 3BHHA 2AC3A 4Z3VA 3W18A 2B9HA 5FM3A 3TZMA 1H26A 2VTOA 2BMCA 4O1PA 3WZEA 4EH5A 3A99A 4EI4A 3E3BX 3VUKA 3MH0A 1OBDA 3NZ0A 3FMMA 3C13A 1UWJA 2B7AA 3VO3A 5EHYA 4AT4A 4O7RA 5DEWA 3U4WA 2ZV7A 5BUEA 4TKSA 4LL5A 2FGIA 1Q62A 2GFSA 5TF9A 4FTAA 1PXJA 3PA5A 5EKOA 5C26A 5AUUA 3PLAE 3MFSA 5EKNA 3KY2A 4RPVA 4XBUA 3PDTA 4EH9A 5ETAA 5IMXA 2R9SA 2EWAA 4QD6A 2RFSA 5HO8A 3I60A 3O8TA 3OOGA 3DXPA 2XIZA 2YAKA 3ODZX 3GQIA 2YZAA 3CS9A 3KULB 4IVDA 1R3CA 4G17A 5JH6A 1YRPA 2XJ1A 2OG8A 2YJRA 3D4QA 5BVEA 3EL8A 5TKDA 1GJOA 3PP1A 2FSMX 4NM7A 5FRIA 5B7VA 4EKLA 3BU3A 4RG0A 5KHXA 1QMZA 3FMEA 2F7EE 4V01A 3VS4A 2OFUA 3REPA 5I9WA 5E7RA 4BI2A 4F65A 2BHHA 3W1FA 1XH6A 2YIYA 3UMWA 5HQ0A 5FTGA 3ZM4A 4WSYA 2X6DA 4GK3A 2XK4A 2JAVA 2PZ5A 4QMPA 4FK6A 4EOSA 4AN9A 2X8IA 3E5AA 3QKLA 1BYGA 1GZKA 4G6NA 4HCTA 4PDSA 4KABA 5JFXA 4D0WA 3EQRA 4TNBA 3ZEWA 4ARKA 4B8LA 4IZ5A 2WTVA 3HRCA 5IEYA 2P0CA 2QVSE 3TNWA 2Z02A 2RKUA 2ITUA 1EH4A 4FF8A 3GI3A 2C5OA 2QCSA 3G6GA 3MH3A 4RIWA 4D1SA 3EQPA 3NCZA 1PXLA 2RF9A 4X3FC 4I94A 1Q3DA 3R7GA 2W1CA 3KRJA 4MF1A 3D5VA 3UODA 4FEUA 5H2UA 3CCNA 2E9PA 2XH5A 3V8WA 1BLXA 3JS2A 5JRSA 3GBZA 3HECA 2WMBA 4HGLA 3RZBA 3VUTA 2HCKA 4YBJA 2ESMA 3RNYA 3KREA 4GKHA 2Y4IC 1UU7A 2ZV9A 2YIRA 1P14A 3TDVA 1CM8A 3C9WA 4UYNA 2A27A 4CTBA 1U59A 4BCFA 4ANQA 4EBVA 4RWJA 1G5SA 4JOAA 1YXVA 5IDNA 2I0YA 4QP1A 5AV2A 2YZLA 3ELJA 2ONLC 3VBYA 1M52A 4MK0A 3G90X 3NIEA 4LM5A 4ZZNA 4ZTSA 3MIYA 5E8XA 5GHVA 4QRCA 3MIAA 3E3PA 2JEDA 3WZUA 1P5EA 4U0IA 5CF4A 3IGOA 2BTSA 3UZRA 3FZOA 4YZCA 5ANJA 4ACHA 4CD0A 5C4LA 4XV1A 4J7BA 2XMYA 3KVWA 1BKXA 3FSKA 4QP4A 5IA3A 4LG4A 3E8EA 3U4UA 2QOCA 3ZM9A 1XBAA 2XYNA 2R2PA 4EJNA 2OH0E 1PW2A 3LJ0A 1ZMVA 3TIYA 3ZLXA 3CEKA 1W0XC 2PMIA 1KOAA 4EK8A 2QOLA 2JKOA 2UW7A 1YDSE 3CD3A 3PVUA 4IAYA 5FBNC 2JGZA 4CMTA 4M8TA 2R7IA 3FKOA 3DXNA 3E8CA 4FZAB 5L8JA 2O2UA 4FKTA 3CKWA 2W1ZA 4FKLA 2QG7A 4RSSA 1Y91A 3EH9A 1OECA 4K11A 5E9EA 4O84A 2X2LA 5AIKA 4QP9A 4DFXE 3OMVA 1KE9A 3ZOSA 4M12A 4IZYA 4E5BA 1J91A 1RDQE 2PZYA 3H10A 4ZK5A 4ITJA 4YO4A 3PYYA 4GK2A 5LQFA 3G15A 3D14A 3F69A 3NEWA 4FTNA 3QXPA 3HMPA 4FYNA 2HK5A 4ZZMA 3R01A 2BR1A 4E4LA 2YACA 2ITXA 3QQJA 5FTOA 3KXNA 2JKKA 3DJ6A 4FNZA 4O6LA 4G9RA 4CNHA 4PL5A 4TYIA 5IA2A 5I9VA 5JFVA 4CLIA 3SV0A 2WHBA 4F9WA 5GZAA 4M84A 2WU6A 3TKIA 4J8NA 3KU2A 4UZHA 5J9LA 5IA0A 2PZRA 3LXLA 2WTCA 3FYJX 4Y5QA 4BDIA 3OTUA 5JQ5A 4KIQA 4RC3A 4DH1A 4BBMA 1I44A 1LEWA 3MV5A 5DHJA 3B8RA 2BTRA 4CG8A 4KA3A 4U81A 3RTPA 4I5PA 4YTIA 2WTJA 3SC1A 5D11A 2NO3A 2UW9A 4PDPA 4ANSA 5JK3A 3HRBA 1O6LA 4L01A 3ORTA 4OTGA 3RWPA 4CZYB 5BVWA 1YKRA 2B52A 4MNEB 3AC4A 2I1MA 4G3GA 5HD7A 3WE4A 5CEMA 4O38A 2BPMA 4OT5A 2OJIA 3LFNA 2VTQA 4QO9A 2GNIA 2HY0A 2VTMA 3NGAA 3KKVA 5C8MA 2IW9A 5A14A 5CSVA 3F82A 5CNOA 1KV2A 3BGZA 4LV8A 5LWMA 3KN6A 3VUIA 2IZUA 4JRNA 3DBQA 2OZOA 4NM3A 5EHLA 2BVAA 2CSNA 2JKMA 4Y83A 5IQHA 3PPJA 3QCSA 4AN2A 3MB7A 4BL1A 4ID7A 4GEOA 1JNKA 2W5AA 2X9EA 4J52A 3GP0A 2C3LA 3QTXA 3VBXA 5EYCA 4AW2A 2YM5A 1FVTA 1OIYA 3HMMA 4CXAA 2YLFA 3V3VA 1Q8UA 3F61A 3NR9A 1MUOA 2PVRA 3ORIA 4FSRA 4NFMA 2XYUA 4MYGA 3DB6A 4RIXA 3PIXA 2JFMA 4L44A 5L6WL 3GC8A 1OVEA 3QWKA 2W9FB 4HYSA 4JG8A 4R6VA 5JZJA 5HU3A 4C4JA 4EYJA 2ZV8A 1R0EA 1ZYJA 4NTSA 2B4SB 4NU1A 4XG3A 4M15A 5E8ZA 4FV1A 4N6ZA 3KF4A 4HPUE 3VC4A 4B7TA 1UWHA 5BVKA 4M0ZA 1PJKA 4F09A 4F9CA 1G8SA 3HV6A 2HOGA 2W05A 5HNBA 4EK3A 4CT2A 3ZZEA 4O7TA 5IQIA 2W96B 3MVJA 4DINA 5CF8A 2W5HA 3QF9A 3QZGA 1Y8YA 3BI6A 3QUDA 3RBWA 4I5MA 3W55A 1SVHA 2PZIA 3G0FA 2UW5A 1I09A 3LJ2A 4IFGA 4QYHA 2IW6A 4R7BA 2XRWA 1ZZ2A 2UW4A 3NIZA 4UMTA 3U9NA 4OLIA 4AA0A 4PF4A 1YOJA 4RGJA 1Q8YA 2CLQA 2I0EA 3LMGA 5ANGA 4RX5A 2J4ZA 4RX7A 3K5VA 3UC4A 5J7BA 4U79A 4FSNA 3W32A 4IX6A 4Z16A 4CKJA 4F7JA 2GTMA 5K0KA 4JR3A 4U44A 3ORZA 4FVPA 4IE9A 3VF9A 4EOIA 4BGGA 3A60A 3TL8A 5AM6A 1PXOA 2CN8A 3C50A 3QRUA 4OBQA 1VYWA 4R7HA 1J1BA 4GL9A 4BIEA 3ZRKA 5HCZA 1AQ1A 5I5ZA 2GNGA 3SVVA 2UVXA 3O71A 5CLPA 4OR5A 4C36A 5HU9A 3O2MA 2XK9A 4TRLA 3OUKA 4BDHA 2ITZA 5DG5A 5AWMA 3BBTB 2JDRA 2R64A 2YN8A 2ZM1A 2Y9QA 2IG7A 2HYYA 4WUNA 1YHVA 5TOZA 2C0TA 3UP7A 3VQHA 3OW3A 4RIOA 2HXLA 3NUNA 3U51A 2VTNA 4YZMA 2BDWA 4D2RA 1ZOHA 2CDZA 3MB6A 4JXFA 3V6SA 1OL2A 3GVUA 4PMPA 2IWIA 2OO8X 4RIYB 3FMNA 4NJ3A 5GINE 2BZKB 3DZOA 5L2QA 1NVQA 3ZC5A 4C4GA 5HE1A 4JNWA 4E5WA 3W8QA 2NRYA 3KXXA 4S32A 2UZWE 4XBRA 3Q4ZA 4X6RA 4O81A 5IQFA 4PP7A 4FL2A 4Y72A 3HP2A 3UO5A 5AR5A 5FDXA 4G2FA 2C5VA 3E8DA 3UNJA 3OEFX 3DPKA 4K2RA 4XOZA 4I3ZA 1H08A 2R3IA 3LQ5A 5EW8A 2WGJA 4EH8A 4KNBA 3PE1A 2XKFA 2Z7SA 5DT4A 2G9XA 3P79A 3ZFYA 4C2VA 4E73A 4AZEA 3OW4A 2QOHA 3KFAA 4HGEA 1J7IA 3A7HA 5K5NA 4WNMA 1MRVA 4BCMA 2PE1A 4FV6A 5ANIA 5FP6A 4ORKA 1ZLTA 4R5SA 4H3PA 3UNKA 5M57A 2QOFA 4C35A 2QU6A 4XG9A 2VV9A 1U5QA 3QRJA 1Y6BA 3R6XA 4HJOA 4ACMA 4XLIA 1H07A 2PVMA 3Q2MA 4FGBA 4BCHA 4BKYA 5JSMA 4N57A 1R0PA 3QD4A 5HTBA 3COKA 2X81A 3LCOA 4YJRA 2GQSA 4S30A 2E9VA 5DRDA 3NUYA 4AU8A 5BQ0A 4DEDA 5CT0A 5FWKK 3O7LD 4JQEA 4JDKA 2XIYA 1NT2A 4X2GA 4CFVA 4HGTA 2XF0A 1ZY5A 2I0VA 3SOCA 1YI3A 4IXPA 3EN4A 5CALA 4O7VA 2FO0A 2OWBA 3EKNA 4F0GA 5JRQA 3RKBA 2R0UA 2R3OA 3OROA 1JVPP 4JDJA 4X0MA 4OAUC 2ACXA 5LARA 3C0HA 3AC1A 4WO5A 3L8PA 4AE9A 3HGKA 4L42A 3GU8A 4M68A 1H8FA 4V0GA 4IW0A 1UU9A 3RAKA 4ZLYA 3A8WA 5KMIA 1B38A 3FC1X 5J1VA 3QL8A 2VX0A 4DTBA 4BBEA 3SG8A 3PY3A 4V05A 4FBXA 3UO6A 4AZSA 2YM4A 4U8ZA 2VGOA 4XRLA 5CU2A 3SRVB 1KV1A 2X7GA 5ETFA 3HMIA 3TZ7A 3ZDIA 4Q5EA 3GOKA 3QD2B 2YISA 4O2PA 5HVKA 1UU3A 2ITTA 5T68A 2I6LA 5CEKA 2RSVA 3P1AA 4B9DA 2JKQA 4G31A 1VZOA 3OZ6A 3TXOA 2F2CB 3MDYA 3EN9A 1NVRA 4BYIA 4S2ZA 3SD0A 2LGCA 2FVDA 4B6LA 4XG4A 2HW7A 5L2SA 3RZFA 4ZXTA 4BTMA 4QMXA 3UG1A 2YHVA 3C4WA 5AA9A 5G1XA 4BTKA 3FJQE 2J7TA 4NM0A 4BZOA 3DQXA 3GCVA 4RWKA 1ZY4A 4FNWA 4DTKA 4BZDA 4HOKA 4DF3A 3R8PA 2BDFA 3PXYA 4NKAA 3RWQA 2F49A 2EB3A 1H0VA 2PMLX 3AC5A 4LRJA 1MP8A 5F4NA 2EXEA 3R7IA 5CANA 4UX9A 4PV0A 3G33A 1PKDA 2ITNA 3EZRA 4JLCA 4TWPA 3FI4A 4OTPA 3W2OA 4FTCA 4C61A 1URCA 3TT0A 2WPAA 2Z7QA 4JQ7A 2BFXA 4IM0A 5EQYA 3H4JA 3IK3A 2C30A 3CD8A 4X3FB 3GUBA 4CRSA 1YDTE 2E9NA 4ACDA 1OUYA 2OK1A 3IOKA 4FSUA 4FK3A 1FMOE 3RPVA 4O0SA 5DRBA 2QC6A 4PQNA 3NW7A 5LMAA 5KCVA 2BDJA 2X7FA 3BYUA 2JIIA 3FZTA 1BUHA 1A06A 2QO2A 2R3QA 2YWPA 3R04A 3SXFA 3D94A 5IH6A 4K6ZA 3PJ3A 4QMSA 5HOAA 4BDJA 4BCNA 2VNWA 4FT9A 1OMWA 3Q9WA 3ZCLA 4ZTNA 1ZYCA 3FLNC 4HNIA 4A4LA 2CNUA 3ATTA 2HZNA 4DFUA 4J98A 4J99A 4YR8A 4OUCA 5BYYA 3QC9A 1M17A 3QLFA 3QZFA 3FPMA 5HBEA 3JY9A 3TDWA 3LLTA 1SM2A 3OCGA 3OUNB 4BDBA 2Y0AA 4YHFA 3PA3A 2GU8A 3FQSA 3ULZA 4JBOA 5FP5A 1Y57A 4Z7HA 5K4JA 5AAGA 4V04A 5L3AA 3VW6A 3FXZA 2YIWA 3S0OA 5FEQA 3BWFA 4YUQA 4G3FA 3UQFA 2O64A 5JFWA 4RJ7A 5AV1A 1H01A 5FXSA 3BLQA 2Q0BA 2ITPA 3V5JA 3F5GA 4H3BA 3CKXA 4JL9A 2GNJA 4U40A 3QD3A 3BWJA 3UG2A 2WNTA 3CGFA 5DPVA 2R5TA 1H1PA 3QU0A 4Y95A 1SNUA 4IZ7A 5HG8A 4UMRA 4JG6A 3ALOA 3C1XA 4CFWA 2F4JA 3G9LX 5I9ZA 4LOPA 4GT3A 5IEXA 4XEYA 3PSBA 4HVHA 4O7LA 4EQMA 3MTFA 4U6RA 2ZVAA 3ORLA 3JVSA 4WRGA 1QPCA 5IZFA 5CF6A 3N4UA 3E7VA 3HZTA 5CZHA 3VVHA 3A8XA 3FQHA 5I9UA 4U41A 5AIRA 5IMEA 5AP5A 4PPAA 2XNOA 3KULA 4ERWA 5KMMA 5BX0A 4MWHA 4IADA 4O0YA 3ZLYA 3OEZA 3FPQA 4X2NA 4FV9A 3Q04A 3PG1A 2GQGA 4J96A 4NTTA 4YHTA 1FQ1B 4FVRA 4GFMA 4O96A 3UIMA 3DDPA 4AW5A 2YIQA 2F57A 2RG5A 4E6CA 4DBXA 3TUDA 4EHGA 3KRXA 4IEBA 4WT6A 4E8AA 4OBOA 5CAQA 3FKLA 3QTIA 1OKWA 4YLLA 3AC8A 5HLWA 4PX6A 3RI1A 2R3PA 2CPKE 4U5JA 5KMNA 2GFCA 3DBFA 3WF8A 3EOCA 3N9XA 4BIDA 4F9AA 1MQ4A 4TYGA 3WF6A 2Q0NA 2YERA 2ZB1A 5KHWA 2WEVA 3KGAA 4R1YA 2O5KA 4P5QA 2Y4PA 2QOBA 2XIRA 3KCFA 4L9IA 4XRJA 3QX2A 4A9SA 4D2WA 3COIA 2RIOA 3NWWA 3B2TA 4GT5A 5A3XA 3AXWA 4XS2A 4OTHA 2WIHA 4O91A 2HIWA 4IH8A 3OXIA 2PVFA 4OTQA 4QMLA 3OBGA 1BI8A 4I1ZA 4NKSA 5I9YA 4GT4A 3LFDA 4PL4A 1BX6A 1R1WA 1OL1A 4FGRA 5BUJA 5D10A 3UOHA 5AAEA 3QYWA 3BV2A 1JPAA 2ZDUA 3F7WA 4NK9A 4CT1A 2IN6A 4I6QA 2QNJA 3ZO1A 3DA6A 3BQRA 3ENHA 3HA6A 3ODYX 5AMNA 5C4KA 4E4XA 5E8TA 1OM1A 2XA4A 1JKKA 2IW8A 4QOXA 5DA3A 4UWCA 4NW6A 5IISA 1OITA 3UQGA 3R8ZA 5HNIX 3NYXA 4TPTA 4Y46A 4CFFA 3GXLA 4QMNA 2UZBA 3AMBA 3DAEA 4KD1A 3ID6C 4L43A 2OXDA 4F0IA 4I0SA 1Q99A 2BZIB 4APCA 2EB2A 4UWYA 4IBMA 3Q5IA 1SNXA 1U4DA 2JAMA 2QHMA 3CIKA 3EYHA 3L9LA 4FSMA 5DVRA 5HVJA 5D7AA 3NAXA 4EYMA 4JT3A 5BUIA 3MI9A 4EK6A 3FDNA 3Q96A 1J7UA 4BGHA 2R3JA 3ORKA 4U80A 1OKZA 1V1KA 2WMUA 4QTCA 2UVYA 5JKGA 5DWRA 3O0GA 3V51A 5FDPA 4TYHB 4IAZA 5HLNA 3CPBA 3POOA 4BCGA 3F2AA 1J1CA 4Y73A 4XV9A 4IFCA 4RFYA 5IF1A 5AFVA 4KBCA 3ORXA 4PPBA 2WB8A 4A4OA 4FE2A 4AA4A 4CLJA 4S33A 4L7FA 1XH7A 4DFNA 3FV8A 3MFTA 5CENA 3KMUA 3T9IA 4NIFB 4UN0C 1GZNA 2VTLA 3R7EA 4DC2A 3U8WA 4QTAA 4I6FA 4KIPA 3W16A 1YI4A 2UZTA 3FLWA 4FZDB 4HVIA 1KSWA 5I9XA 4NSTA 1TQPA 3RPRA 3R1SA 4X21A 4FV0A 5EM6A 1SVEA 3IKAA 4BIBA 2IZRA 4JRVA 4CMOA 5EDQA 4UMQA 4DCAA 3P5KA 3BBWA 4RZVA 5LJJA 3LFEA 4IQ6A 5AA8A 3FHIA 3NUPA 4RC4A 2FYSA 5KKRC 4BB4A 3GCQA 1A48A 3T9TA 4FT5A 1OKYA 2W5BA 4O83A 3PSDA 2Z2WA 1IAHA 5JFSA 3OT8A 3TCPA 3WI6A 2J90A 4C8BA 3EFJA 3R7OA 2BRGA 2BKZA 4AOIA 2C6MA 4WNKA 2WELA 4R1VA 4EH4A 4PNKA 3UOKA 4BHZA 3UC3A 2ITWA 1V0BA 5G6VA 3EN5A 3LQ8A 4PP9A 3VS6A 4XP3A 2UUEA 4WSQA 4I22A 5DI1A 4EOPA 4AP7A 2ZYBA 1NY3A 3MVLA 4EL9A 3OFMA 2G2HA 4FKUA 2PUIA 3ZO3A 2OZAA 3D5UA 3LCKA 3O8UA 4UB7A 4XP2A 2P55A 3D7TB 4PMTA 1OIRA 3NRMA 2WOUA 3C4CA 1GIHA 4W9XA 2P2HA 3HYHA 4MNEA 2BIYA 2GSFA 2W1HA 4FKGA 4R5YA 5DGZA 3C5IA 3HAVA 5AAFA 3AC3A 3L8VA 3F5PA 1YXUA 3F3TA 4QMTA 4FZFB 5IQBA 2C47A 1W7HA 5BYLA 3F88A 4BTJA 2G2IA 2JBPA 2JIVA 3QA0A 2X4ZA 3ZLSA 4IAKA 1Q8TA 3EN7A 2UW3A 3OHTA 3ORNA 2VTRA 5CVGA 3FHRA 2OIQA 5IUIA 3VBWA 3NUUA 2BRMA 5CAOA 4ASDA 4E6AA 4ZSJA 3I6UA 2QO9A 4I4FA 4ZJVA 3R9RA 4BZNA 4PDOA 4USEA 3N51A 1OPJA 3DAKA 4ANNA 2GDOA 4CKIA 2XNNA 1IEPA 4PMMA 2XM9A 4EOJA 2FSLX 5L4QA 5FEEA 1GOLA 2HZ0A 5LMBA 1VJYA 1JSVA 4YU2A 2WQMA 3GU4A 2WMXA 1FPUA 3RM6A 3SOAA 2OLCA 2PY3A 1GZ8A 5LVOA 1Q41A 3MA6A 1KE7A 1PYXA 3IO7A 4YJVA 5C1QB 4FTQA 3GENA 4ACCA 5IDPA 3WIGA 3DS6A 4CCUA 2VTPA 2FUMA 3HL7A 5HIDA 4E93A 3QQUA 4IJPA 3VBTA 2I7QA 4DGMA 4F1MA 4JG7A 3CR0A 2BAKA 2I40A 3CQEA 3MSSA 3D5WA 5B2MA 4KWPA 2PTKA 4ZJJA 3K3IA 2OIDA 4BDFA 4FV2A 4UY9A 4TXCA 3ALNA 4FEQA 3A4OX 3A4PA 4U3YA 3LFQA 4JI9A 4Q2AA 5J8IA 2PUPA 1OI9A 2ZOQA 4BCQA 3FMHA 2BIKB 5EOBA 4NYEA 4FSTA 2H96A 3CC6A 5FGKA 5HE2A 4DEAA 1CKPA 2WD1A 3P9JA 3HRFA 4FC0A 4IHPA 4U42A 3BCEA 1WBVA 3OCBA 2VGPA 4ZSGA 1WVYA 3RPYA 3DT1A 4UBAA 1YWVA 1P2AA 3KN5A 2JD5A 5KMOA 2GS6A 3MY5A 4MBJA 3VWAA 4O86A 2ITQA 3KXZA 3R8MA 4ANOA 4IB1A 3HDNA 3IS5A 4F6UA 1KE5A 3IW8A 5B2KA 2IZTA 2C5YA 2G01A 1LR4A 5D7VA 5D9HA 3ZH8A 4P2KA 4AQCA 3TKHA 5FUTA 3KXHA 4LV5A 4O6EA 3VJNA 5DR6A 5A6NA 3VUMA 4PTGA 2XBJA 5CI7A 3BHVA 4YMJA 4TNDA 4HNFA 4BHNA 1CKJA 4LRKA 3NDMA 3ZBXA 2BUJA 1FMKA 1UKHA 1J7LA 2RL5A 3PSCA 4ZP5A 5C03A 3GC0A 5HD4A 4QQ5A 4P5ZA 3QWJA 3I0QA 3CJGA 4H36A 4J53A 3ZEPA 1YHWA 2R3MA 5AX3A 4LUEA 3PFQA 5FQDC 3CTJA 3D9VA 3WOWA 5M08A 4GW8A 3RGFA 5J9YA 5E91A 4KKGA 4OT6A 4P7EA 4PL3A 2YM8A 5CXHA 3FZSA 3WF9A 2WMAA 3FI3A 1G3NA 4D5KA 5CY3A 1VYZA 1E9HA 2W1GA 2QO7A 2YLEA 3AD4A 4F99A 5L2TA 2KULA 4E4NA 1H24A 1IR3A 5HCXA 4XH6A 3R71A 4AE6A 4EWQA 1R39A 4H58A 1UV5A 4HCUA 4HCVA 2YWVA 2XJ0A 3I7CA 4F64A 5E8UA 4ZEGA 2VRXA 4JDIA 5E92A 3FY2A 3U55A 3WILA 1FINA 3GFWA 4BI0A 4CSVA 4EK5A 2C3KA 4QMOA 2J51A 4QQCA 2V22A 4ASEA 3LM0A 4NL0A 3NYVA 3QX4A 3LFSA 4O0VA 3RHXA 4GYGA 3HKOA 4LYNA 3F3UA 2IVTA 3KMWA 4JBPA 3GCPA 4W4XA 5HNGA 4ITIA 3V5QA 4W9WA 3BEAA 1XJDA 2P4IA 4Y5HA 2W1FA 2VWIA 4C38A 2J5EA 2X6EA 4GMYA 5L6PA 2RG6A 5AR4A 4GG5A 2F7XE 3EQBA 5AP1A 3DY7A 5I3OA 4ZS0A 4AXAA 3K5UA 4M69B 2ETRA 4DEEA 3ZUVA 4C02A 4E6DA 4G9CA 3A7GA 3R63A 3ZRLA 5EYKA 3HNGA 2H6DA 3DDQA 5CQUA 2CNQA 3ERKA 4LGHA 2XRUA 4IVCA 3H9FA 4O0TA 3RAHA 4WRSA 4IC8A 5A4EA 4CVAA 4BWKA 5A4TA 4CZTA 3R1QA 3R02A 2Y8OA 3ROCA 3PUPA 3ZXZA 4F4PA 4EWHA 2C68A 4TT7A 2AC5A 2ZMCA 4O82A 4OW8A 3VNTA 4CV9A 5E8WA 2CLXA 2J0LA 3U87A 3G0EA 2W1IA 3IDBA 4GJ2A 2PVJA 1FOTA 3CQWA 3BLHA 4C4FA 5AUVA 2QODA 1WVXA 3JY0A 2YA9A 5CSXA 4FV3A 5A46A 3ACJA 2A0CX 3OWKA 4DGOA 2CNVA 4Z9LA 3SRVA 3FEGA 4U43A 5JN2A 4NCTA 4H3QA 4D28A 4F7NA 4MWIA 4O0XA 3T3VA 4O7ZA 4FEWA 1H1QA 3LCSA 3QQKA 4QP6A 2VWXA 2HY81 4XNEA 5CVHA 5AJQA 4TWNA 5AV3A 5GZ8A 2G15A 4IB0A 4WOVA 5FBOA 2UW6A 1BL7A 2WO6A 2QR8A 4DH8A 4EONA 5I3RA 3QTRA 3W33A 3UP2A 3UVPA 3FLYA 5CAVA 3ETAA 4FTRA 4E7WA 1SVGA 5JGDA 3TUBA 3RPOA 3QTZA 2W7XA 4UXQA 4MEDA 1REKA 4IANA 2V0DA 4XX9A 4DG3E 3JXWA 4O21A 4YPSA 5JZNA 2OJ9A 4USFA 2BAQA 3UNZA 3H3CA 4ZS4A 1TQIA 4QP2A 4TTHB 3ZBFA 1WBNA 2XS0A 5EHOA 1LEZA 5K0XA 2ERKA 3F5UA 1MRUA 1Z5MA 3MWUA 5KMJA 1FVRA 3FUPA 4JQ8A 2PUUA 4FIEA 5D41A 2PPQA 3HLLA 3PWYA 3TTIA 3FYKX 4FKRA 4Y8DA 4FIIA 4HYIA 1H1SA 3II5A 4YZNA 4EHVA 2C3JA 3OXTA 4MQ2A 3H9OA 4K33A 3DU8A 5AUWA 4C3FA 4D2VA 3MA3A 4FUXA 3MH2A 3BHYA 3E87A 4QNAA 1AGWA 4BWPA 4OBPA 3QKMA 3NX8A 4C3RA 2UW8A 3LPBA 1FGIA 4MHAA 4DEHA 3UYSA 2YEXA 1PXNA 5CEQA 4FSWA 5TT7A 3THBA 5IQDA 4L45A 1YXTA 3P4KA 2X4FA 4MTAA 5A9UA 4PDYA 3DJ5A 2JC6A 4E5AX 1W82A 2BFYA 4MXAA 1IAJA 4BICA 4CMUA 4FT0A 4CFXA 3RJCA 3R21A 2H9VA 2XP2A 3PPZA 2JITA 3E92A 4M7IA 2BILB 5F94A 3TIZA 2PMNX 3R9OA 4AZTA 2GNLA 1Q24A 2PL0A 5GJGA 2PUNA 3PJ8A 3F6XA 2VNYA 4BDKA 4DEIA 5A4CA 2OI4X 2WKMA 1WBSA 2UZVA 2B1PA 2C4GA 3E64A 3GNIB 4A9RA 2Z8CA 1YWRA 4FT7A 3F3ZA 3VS3A 1FVVA 3WYXA 2VTIA 3ATSA 3DAJA 3EFKA 4AGUA 3UPZA 2YABA 2QR7A 4L67A 1H28A 4XYFA 3TUCA 3QRIA 3KK8A 3QUPA 4BCOA 1NA7A 4RVMA 3DJ7A 4ENYA 3PPKA 3V5PA 5DIAA 1OPLA 3DBEA 5IG1A 4L3PA 4Q9SA 5HEZA 3DKFA 1UNLA 2PVNA 3U6JA 2XNGA 4QMMA 2QHNA 4F9BA 3CTHA 4C34A 5IA1A 4IX3A 5H9BA 1M2QA 5B0XA 4IM3A 4BI1A 3S00A 2J0MB 1OUKA 4FTLA 4G3CA 4DYMA 3IPHA 1OIQA 3Q53A 2GHMA 4I23A 1OKVA 4XUFA 5FM2A 5LMKA 4O0UA 3KC3A 3FI2A 4AA5A 4BTFA 4FIJA 3EKKA 4IC7A 4DGLC 2F7ZE 2XIXA 4A7CA 3CLYA 4QPSA 1ZMWA 4I93A 3VS2A 3FI8A 3NPCA 5FTQA 4B0GA 5HESA 3C4EA 2J5FA 4M67A 1FGKA 1Q8WA 4G3DA 3L9MA 5IKWA 5AR2A 3UOLA 5HZNA 1HCKA 1H25A 1BL6A 1UNGA 4DFBA 4XLVA 2O65A 3PXZA 5IEVA 5CZIA 2OXXA 3HDMA 5FXRA 3KVXA 4TYJA 4RX9A 4ZLZA 1WMKA 2A4LA 5IU2A 3BV3A 3IONA 4D2PA 4C58A 4DAWA 5K9IA 3W2RA 5AUTA 4BF2A 2I0HA 4RJ8A 4ONAA 3AMYA 3OY1A 2W06A 5EQEA 1GIJA 4M3QA 2C0OA 4NZWB 3KRLA 1K2PA 4XG6A 2WTDA 3T3UA 1NW1A 4A06A 3FMJA 4MNFA 1XKKA 3P7AA 4QTEA 4ZSLA 2ZJWA 5EYDA 1UU8A 2YDIA 3DLZA 3QCYA 1Q4LA 3FY0A 4YNEA 4EBWA 4O7WA 2WMVA 4AACA 4QQJA 3DV3A 3F9NA 2CN5A 4O0RA 4D5HA 2YCSA 3ORMA 2PWLA 3B2WA 5CU6A 4OTWA 3D7ZA 4KKHA 4MBIA 4NFNA 5AP2A 4NWMA 3UTOA 5HHWA 3VS5A 5A4LA 1YOLA 1ZWSA 3RM7A 4QP7A 5BVOA 2X39A 3WYYA 5LCKA 3M11A 2YAAA 2PE0A 4FSQA 4F0FA 2XEYA 3E63A 4F1TA 3IG7A 1Q97A 4Y85A 1WZYA 3D15A 1W84A 3F66A 3LAUA 4XOYA 3VBQA 4FX3A 3BQCA 4YTHA 4ENXA 5JQ8A 4FIGA 2QOOA 3EQCA 3F2NA 3ENMA 3QA8A 4QP8A 2IJMA 1XH5A 3QTQA 4W8EA 4FV4A 4D55A 4EHZA 4EZ7A 4U3ZA 4AZFA 5M55A 4UEUA 2QQ7A 2AYPA 1QPDA 3ZMMA 5JGBA 3JR1A 4O27B 2UZLA 4I21A 4I6HA 3AT3A 3GCUA 2OGVA 4EUUA 4YP8A 3PA4A 4DGGA 5EDRA 3MYGA 4L3LA 5DOSA 5HBHA 4DH5A 4C4IA 2GPHA 4QQTA 3ACKA 5EW9A 2QOKA 4MKCA 2IVSA 4IMYA 4WA9A 5I0BA 1WFCA 2P33A 1JWHA 4DE4A 3VAPA 2Y4IB 4YJNA 3KRWA 3DXQA 3L8XA 1DM2A 3A61A 4YZ9A 1WBOA 4DN5A 3I4BA 5M07A 4NIFA 5F1ZA 4ACGA 1L8TA 1JKLA 2V5QA 3GFEA 3FMDA 1H00A 2Z60A 3OS3A 3V6RA 2NNWB 3DZQA 5BMSA 1LP4A 3L9NA 3DB8A 5E4HA 4B4LA 5CXZA 1H0WA 1RE8A 4GUBA 2VTTA 4L8MA 4RLLA 1V0OA 1P4FA 2B54A 2DYLA 3BYMA 3EQGA 3FWQA 4BGQA 1KWPA 2WMWA 4IWOA 4TW9A 4XV2A 3DOGA 4UV0A 3IQ7A 4I6BA 4WUAA 5E8YA 1XH9A 4E26A 3Q6WA 4OTRA 4TL0A 5M51A 5HO6A 4IB5A 4RBLA 3RVGA 1JBPE 5AP3A 3LKMA 3LQ3A 2CJMA 3UPXA 5FXQA 3KL8A 3CTQA 3MFRA 5T6KA 4ASZA 2W17A 3VS7A 3A7IA 3MBLA 2GHGA 3PXRA 1SYKA 2OIBA 4I92A 2VTJA 3WARA 2OJJA 5GIPE 3VS1A 1OIUA 1PMNA 4HW7A 2ZV2A 3OOMA 3A7JA 2VWWA 1B39A 2F2UA 3OF0A 2WQBA 3M1SA 4MXOA 4B99A 4AAAA 2ZM3A 1B6CB 4I4EA 4YC8A 2CHLA 3BLRA 3OCSA 4IJ9A 4NM5A 4FI1A 3D7TA 3I79A 2CGXA 5J95A 1ZMUA 3LOKA 2WTIA 4BYJA 2GTNA 4FTMA 3LLAA 5EI8A 3HEGA 3KQ7A 4CQEA 4EJ7A 4PTEA 2LAVA 4MD8E 2XKCA 4OAVB 1CDKA 4GCJA 1KE8A 4HPTE 4DLIA 5AV4A 4FVQA 5DE2A 4PUZA 3R22A 4I20A 4DFYA 3MJ2A 2BALA 4EQUA 4CYIA 2FH9A 3PXKA 3Q4CA 4ZY5A 2X8DA 3FLQA 4E20A 3R7VA 2DUVA 2DS1A 4TY1A 4IVAA 4X2JA 2FA2A 4RRVA 3DGKA 2ITOA 4JJRA 3ZHPC 2ZB0A 4S31A 3HX4A 3TN8A 3MPTA 4CEGA 3LW0A 5LVMA 4DFZE 4ZZOA 1PHKA 2V7OA 2QONA 3E88A 4EORA 3AGMA 1S9IA 2UZDA 3SAYA 1YHSA 2R3GA 4ASXA 5DEYA 5EFQA 2XZSA 2BHEA 2XM8A 4GJ3A 5DH3A 4AZVA 2J0KA 2WXVA 3QRTA 4GVJA 4RWLA 5L8KA 2X2MA 3R30A 4XV3A 5F9EA 3ANRA 4FUYA 5CTPA 2R4BA 4ZY4A 3SDJA 3VULA 3VBVA 1M14A 5AM7A 4A07A 3D2IA 4RWIA 3BU5A 4L00A 4ZTLA 4E6QA 3ZDUA 4XG2A 3OC1A 3CXWA 4A9YA 3CGOA 2P3GX 2CGWA 3Q60A 3UIBA 3TZ9A 3ZUUA 1ZYDA 4OTFA 3P7CA 4H39A 2CKPA 3SGCA 3MY0A 1DAYA 3FLSA 4KB8A 4MVFA 3R7UA 4ALUA 3C4ZA 2UW0A 1BI7A 3EL7A 3TZ8A 3QRKA 3MY1A 5M44A 5HGIA 2OFVA 4MAOA 4UALA 4H05A 3NYNA 2UZOA 1YWNA 3DTWA 3IGGA 3W2PA 2YITA 4GSBA 4ALVA 3RK9A 4XJ0A 4C2WA 3UGCA 3QGYA 2EU9A 2WQOA 3OXZA 4ITHA 2XK3A 2XNMA 2QI8A 3CSVA 4NW5A 3QUEA 4FG8A 5EYMA 4EUTA 4IWQA 4EC8A 1ZXEA 3BRBA 5DLSA 4F9YA 3H30A 3LXKA 5IUGA 4UWBA 4WIHA 4I0TA 3VUHA 2WEIA 3LFFA 4YLJA 5IH4A 3JUHA 4GIHA 2XVDA 5C01A 2VO6A 4N0SA 2WMRA 3H0YA 1W83A 3LHJA 3O17A 4U45A 4C33A 1U46A 3QQFA 4M66A 5M4FA 2OXYA 4BCIA 3VN9A 1OL6A 5CU3A 2BRNA 3FKNA 3VRYA 2CKQA 4BR3A 4E3CA 1YQJA 2NP8A 4YURA 5CU0A 1IASA 4AFJA 3RHKA 3TNIA 3GGFA 1YOMA 5CU4A 5CS6A 4R8QA 4AWIA 4FV7A 4GG7A 2VD5A 5E1SA 3BELA 5AR8A 3BYSA 3N4TA 4AFEA 4AOJA 5DFPA 3MESA 3P23A 3OWJA 3MJ1A 5CYIA 2V55A 3LXPA 4FKWA 1E1XA 1REJA 2VTSA 3NAYA 5A54A 5KNJA 4P90A 5M4UA 4FNXA 3TV6A 2J9MA 2SRCA 2ZM4A 3I0OA 1O9UA 1V0PA 2OU7A 4KRCA 4QPMA 3UJGA 3E7OA 3W2QA 4EOOA 1Z57A 3O51A 3G51A 3AD6A 3NVMB 4KIKB 2BAJA 4QMZA 3DKOA 5L2WA 3LJ1A 4L7SA 4RT7A 4QMYA 4O22A 1PMEA 3ITZA 4M97A 1WAKA 1YXSA 5HE0A 3DK6A 3W8LA 5T3QA 1QCFA 2PVLA 4DITA 4JDHA 2PVHA 4LOOA 4BVUA 1OGUA 3COMA 3G9NA 3DK3A 4Q9ZA 2O0UA 3QZIA 3WZDA 5AX9A 5HTIA 1K9AA 3PG3A 3QTSA 2HWPA 3EFLA 4A9UA 5IQGA 1K3AA 3OWLA 4O2ZA 4RFZA 3TI1A 3KEXA 5CI6A 4BKJA 4ZTMA 4LMUA 1GIIA 2JDVA 3HA8A 3ZTXA 5AR3A 4HZRA 4M69A 3ANQA 3MH1A 5AUYA 3HUBA 3PJ1A 2XKEA 5EDPA 2WMQA 3NS9A 4ANBA 4EQCA 4FKOA 4KS7A 1P4OA 3MW1A 3FL4A 2XBAA 4J97A 4O7YA 4EK4A 2YM6A 2X9FA 2HELA 4JS8A 4LGGA 3POZA 4QP3A 4EC9A 3TACA 3NSZA 5L2IA 5CEOA 3FQEA 1E1VA 2PE2A 3W2CA 4I41A 3ZS5A 4BDCA 3RMFA 4U7ZA 5CEIA 5AEPA 3CE3A 5IQEA 2WTWA 3R83A 3G6HA 3QBNA 4W4WA 5CQWA 1CMKE 5JEBA 3BYOA 5HVYA 3LCDA 1T45A 3FLZA 1O6YA 2XB7A 4NCTC 1YXXA 3T8OA 2BZHB 3PRIA 4WG5A 2BROA 3KB7A 3V8TA 4EZ5A 4X6QC 4F7SA 3L8SA 5H8GA 3S95A 1WBWA 3GT8A 4IVBA 5EI2A 3GOPA 3Q6UA 3A2CA 3FZRA 4BDGA 2VWVA 4G1WA 5HBJA 5LOHA 4I5HA 3ZZWA 5DT0A 4KUJA 2YCQA 3R2BA 3KMMA 3VJOA 2HAKA 4WNPA 1YVJA 4GU6A 3ZXTA 2W9ZB 5J5TA 2KTYA 3OVVA 4NJDA 2R0IA 4IACA 4WHZA 5AADA 5LVLA 1ERKA 2UVZA 3DNDA 4TN6A 1JLUE 2VO7A 5FEDA 4OTDA 3R1NA 4FTKA 5L6OA 3O23A 4YZDA 2GNHA 3D5XA 1Q8ZA 5EG3A 2BRHA 3DKCA 3WE8A 2YIXA 5KO1A 5BVDA 2GNFA 4JVGA 4DEBA 1PMVA 4FTTA 5IH5A 4WG3A 4D2SA 5KX8A 3KXGA 3IW7A 2IZSA 3HV7A 4QNYA 3TG1A 4BKZA 3DTCA 4CCBA 4ZMFA 1ZZLA 3NUSA 4RVKA 3I6WA 3NLBA 3DBDA 3IDCA 2B9IA 4PTCA 2X0GA 1Q3WA 4CYJA 3RALA 1XH8A 4ZTRA 4FOBA 2HW6A 5D12A 3BPRA 2IVVA 4G6OA 4ALWA 2B0QA 5KE0A 3VS0A 4IAIA 3QXOA 5ICPA 5ITAA 3WF5A 2GCDA 2W1DA 2XK7A 4N70A 4OTIA 4WKQA 3NW6A 4XP0A 3L1SA 3TWJA 3RNIA 2WZJA 4XHKB 4R78A 3A62A 5HIEA 4D0XA 4DCEA 4YHJA 2R3KA 4QMVA 5AP4A 4FKPA 4KKEA 4RZWA 4XMOA 4IX5A 3W10A 4IWDA 1PXIA 2XK8A 2YM7A 1PXKA 2CCIA 2PVKA 3PJCA 2ETMA 2ZMDA 4PRJA 3R8UA 3VHEA 4F70A 4FICA 1G8AA 4K9YA 2YFXA 3ROYA 3D2KA 4AN3A 4N4SA 5CEPA 1NVSA 3PVBA 2J2IB 5CT7A 2HZIA 3G5DA 1U5RA 3K54A 4O0WA 3ZO4A 4HYUA 3HMOA 4C4EA 4AGCA 5DNRA 2EXCX 3JPVA 3QZHA 2W4JA 5F95A 4JAIA 5HE3A 3SHEA 5TR6A 4AW0A 1ZOEA 2XNPA 5ACBC 2UZUE 4RIYA 3ZONA 4AX8A 2ITVA 3VF8A 5DN3A 4KINA 3CY2A 4DFLA 5DT3A 4HVSA 1R78A 3NYOA 4YBKA 1YDRE 4X2KA 5M4CA 4FT3A 1DI9A 2WMSA 5CSHA 3HVCA 5J7HA 4A4XA 3EJ1A 4K8AA 4YGAA 5M4IA 4LOQA 4R77A 2QOIA 4L53A 4Z55A 3OP5A 4FTIA 3Q4TA 5CSPA 1WBTA 2XJ2A 1UA2A 3EHAA 2HZ4A 2C6DA 1WBPA 2VWYA 3FMLA 3FSFA 2A1AB 3Q3BA 4K77A 4KSQA 4ANLA 2C6EA 1LUFA 1AD5A 3NCGA 5E90A 3HV3A 3HMNA 3OT3A 2REIA 4FSYA 3TNHA 4GK4A 5K3YA 4RJ3A 2XK6A 4HVDA 4FV5A 1U54B 4JIAA 2W0JA 3PP0A 5HG9A 5LMKC
chains in the Genus database with same CATH superfamily
2A19B 2WU7A 4F08A 3GCSA 3K2LA 3ZO2A 2ETKA 3GU7A 4I24A 4GKIA 2XARA 4BDEA 3F3WA 1OL5A 2IVUA 3GQLA 2XIKA 4IX4A 3EYGA 5AP0A 3W0RA 2XEZA 4YC6A 4FKJA 1XQZA 3WF7A 4MXCA 4D1ZA 2GS2A 3R2YA 4U97A 3TM0A 3Q4UA 4RFMA 3QHRA 5CX9A 1QPEA 4FTOA 4I0RA 4ZIMA 4WBOA 3Q9ZA 4QMUA 1H27A 3RAWA 3BGQA 4KBAA 3UZPA 1UVRA 3PJ2A 4JAJA 3VQUA 2AEGA 4O4FA 1M7NA 1WCCA 3LFBA 2PSQA 5H8BA 2V7AA 1OBGA 3AD5A 5IA5A 3VUDA 3C5UA 4YO6A 3WBLA 4DBNA 1IA8A 2NPQA 3R9HA 2YCRA 3ZFXA 4BWXA 3SA0A 3ZU7A 2R3RA 4EOKA 3MS9A 4FV8A 2JDSA 4QPAA 1XO2B 4ZSEA 3TV7A 4EHEA 3V8SA 2OZAB 3UDSA 3S1HA 2GMXA 2WIPA 4XG7A 3ORPA 4IWPA 4AUAA 5HTCA 4CFNA 1PYEA 4ZMEA 5FLFA 4CZUA 5AUZA 3UE4A 3RP9A 2PYWA 3QAME 3VIDA 2JDOA 2OH4A 5GJFA 4B8MA 5A6OA 2JBOA 3U6HA 3P08A 2WFYA 1BMKA 3RK7A 4RJ4A 1MRYA 3BZ3A 3PZHA 1VR2A 4IM2A 5M06A 5DR2A 2ZAZA 4RQVA 4ERKA 3QC4A 4RX8A 4F7LA 3MPAA 2QG5A 1ATPE 1JKTA 1RW8A 2XKDA 3A7FA 3DQWA 2EUFB 4M0YA 4TZRA 3NVKI 3UVRA 2HXQA 2R7BA 1IA9A 4LGDA 1X8BA 2C6KA 2J0IA 3PWDA 2C5NA 2PU8A 3EFWA 2R3LA 4FKSA 2B53A 5ANOA 3FBVA 5HIBA 5BPYA 2C0IA 5DR9A 3CQUA 5J9ZA 1JKSA 4DG0E 4DG2E 5HO7A 2OF2A 3OY3A 2XUUA 4DGNA 1XR1A 3OG7A 3LFCA 4H1JA 4KRDA 4QT1A 2GS7A 2W1EA 4IAAA 1QL6A 4QYEA 1ST4A 1Q5KA 2PHKA 2W99B 4RIWB 4LDTA 1S9JA 4U9AA 3GC7A 3M2WA 4WNOA 5CVFA 5J5SA 5JGAA 3MVMA 2WTKC 4JIKA 4X3FA 4LMNA 4ZLOA 2CGUA 2JLDA 1HOWA 4M14A 4TYEA 2VTAA 5EK7A 4BCKA 4D2TA 3S3IA 1PRYA 1GY3A 4UXLA 1ZOGA 5HG5A 3FL5A 4BCJA 2VX3A 4MF0A 2XNEA 4E1ZA 2C69A 3VHKA 3BL7A 2G1TA 4XG8A 5HX8A 4G3EA 5DBXA 4BCPA 4FKVA 3C0GA 3R00A 1CKIA 4ZOGA 3JYAA 3KK9A 4NT4A 3BU6A 4MBLA 3H9RA 2E2BA 4YPDA 2X7OA 3BHUA 4MD9E 5BVNA 3LZBA 5EM8A 3SW4A 3OBJA 2ONLA 4GUEA 3QQGA 2AUHA 3EIDA 3NW5A 4R3CA 3E62A 5CAPA 3V5WA 3R0TA 1T46A 5J87A 3IW4A 3Q32A 4LRMA 3E93A 1Z9XA 2OBJA 1CSNA 3NFFB 4C37A 4PMSA 3LFAA 4C57A 3LMHA 2W4KA 4RJ5A 2OICA 5LXMA 4IAFA 3PTGA 1APME 3LXNA 1TVOA 4IZAA 3BKBA 1MQBA 2VTHA 4NEUA 3KA0A 4NH1A 3N4VA 1RQQA 2DQ7X 4DTAA 3MTLA 1IG1A 2VZ6A 2YM3A 2HENA 3WZKA 3UOJA 4J1RA 2C6TA 4IDTA 4BRXA 3D0EA 2Y6OA 5GNKA 4FIHA 5C8NA 1SMHA 3GEQA 3F5XA 3R7YA 2RFEA 3LCTA 3QKKA 1UNHA 3LM5A 3B8QA 3UIUA 4ZSAA 1SZMA 3SXRA 5LVNA 4G5JA 4AAYA 5EM5A 4DT9A 1ZAOA 3NMUF 3JVRA 4GFGA 2B9FA 1JSTA 3UMXA 4CV8A 2OJFE 2PK9A 5EI6A 1VEBA 4R7IA 3TJCA 1A9UA 2VWZA 2ERZE 3R1YA 2X2KA 3FC2A 2Q83A 2PZPA 5F20A 2DWBA 3DKGA 4RMZA 1PXPA 5D1JA 2VUWA 4DT8A 1XHAA 3V5LA 3MGYA 1O6KA 5CSWA 5KUPA 3UIXA 4JR7A 2IO6A 2FSTX 4EH6A 5C9CA 5KBQA 5KKRB 2OSCA 5A4QA 2G2FA 3OCTA 3UBDA 4P4CA 3S4QA 2C3IB 1W8CA 4BDDA 4AGDA 3S2PA 5L8LA 4J71A 3HAMA 2VO3A 1OZ1A 4DDIA 2XALA 4EOLA 5H3QA 3U9CA 3DFCB 4FL1A 4CKRA 3DFAA 1F3MC 3BE9A 3R73A 4GYIA 4L46A 4N6YA 3NUXA 2XCHA 3IOPA 4YZBA 5IQCA 2FB8A 3AT4A 3BE2A 4PWNA 2QU5A 4RA4A 5TE0A 3QCXA 5EM7A 3SQQA 1YI6A 4D4VA 3WIKA 2QKRA 5HKMA 3ZRMA 3MVHA 3Q52A 2YJSA 3EMGA 4EH2A 5E8SA 3C4XA 4YSMA 3ZFMA 4FYOA 4FZ6A 4BC6A 3NNUA 3F2RA 4JBVA 4GH2A 5BMMA 4D9UA 5FG8A 3QTWA 3QD0A 4FIFA 4FEXA 2H8HA 2IEWA 4FG7A 2WAJA 3BIZA 3M42A 3VW8A 3PLSA 1Y6AA 5AUXA 4GIIA 2BRBA 3CPCA 3PY1A 3K3JA 2CMWA 4FG9A 4IDVA 4MD7E 4C0TA 4S34A 4D58A 1KUTA 5E1EA 1DI8A 3FXXA 5ETIA 4ANMA 5AR7A 1XH4A 3BEGA 3GU5A 4FSZA 3PXQA 4RA5A 3FZPA 4YJPA 5LVPA 4F6SA 3LMIA 1PMUA 2CGVA 2JDTA 1PF8A 2XCKA 4UYAA 3OWPA 2Y6MA 3ZSIA 4RIXB 4YC3A 3P86A 5LCJA 2GHLA 3ET7A 1ND4A 5GIOE 1JAMA 4C4HA 5M09A 2BCJA 2QLQA 3R8LA 2VU3A 2VO0A 5AV0A 3BYVA 3NNVA 3KCKA 3O7LB 3Q5ZA 3L9PA 2HWOA 4RC2A 2C6LA 3AG9A 4TWOA 4A9TA 2O63A 4YNOA 3I7BA 1KOBA 3HV4A 3AC2A 3KRRA 3QQHA 3F3VA 2YCFA 3GC9A 3QCQA 3UVQA 3ZUTA 4AW1A 4DHZA 2RFNA 4EKKA 2X1NA 3PXFA 4IIRA 4TYHA 5KMKA 4FL3A 2PULA 4MH7A 2OKRA 2VAGA 3FE3A 2QLUA 3PVWA 4FTJA 4HZSA 4W8DA 4AZWA 4L52A 5IQAA 3DNEA 3WZJA 1ZYSA 3MFUA 3TEIA 5AP6A 3SG9A 4CGAA 5LWNA 3EQHA 5HCYA 5JMSA 5E8VA 4KS8A 4EOMA 3EN6A 3RK5A 5DYJA 3Q9YA 4O7NA 3D83A 1L3RE 3ZSHA 5KMLA 4II5A 2VWBA 4L3JA 3SX9A 1STCE 4QYFA 3W2SA 3IDPA 4QMQA 4F6WA 4DHFA 4ZTHA 3SLSA 5ANDA 4KBKA 4KIKA 4YSJA 5B2LA 1NXKA 4K18A 3TKUA 4AGWA 5C8KA 4FR4A 3TV4A 4HVGA 4JMQA 4IB3A 4CQGA 3SW7A 4WG4A 2B55A 2CCHA 1ZYLA 3O96A 2RFDA 4W4YA 4D4RA 3Q9XA 3EQDA 1UKIA 5IA4A 4G5PA 5GZ9A 2QKWB 4YLKA 3NNWA 3E8NA 3BGPA 5ANEA 3CY3A 3C51A 4GFOA 1JSUA 2NRUA 4WBBB 4DH3A 4R3PA 3P5JC 3AGLA 3QGWA 4BDAA 2C6OA 1IRKA 2J50A 5CASA 4ZJIA 4C7TA 3U54A 3KF7A 3G2FA 5BNJA 4FMQA 1GNGA 4X2FA 4DH7A 1J3HA 3ZLWA 3RCJA 4MXXA 3P78A 4GV1A 5ACKA 1H1WA 4AOTA 4UZDA 4H1MA 5HG7A 5AP7A 3RAIA 4GVAA 3U6IA 2W4OA 1TQMA 3DCVA 2B9JA 5BYZA 3I5ZA 3LIJA 5DMZA 5KBRA 4EEVA 1PXMA 3OTVA 2PMOX 4JBQA 4LUDA 2OJGA 3I5NA 3DK7A 4D1XA 1OB3A 3C7QA 3CP9A 3IW6A 5K4IA 1FBNA 2XAMA 3EB0A 5IPJA 4EOQA 4AG8A 3RPSA 3BHTA 1W98A 5JT2A 2JIUA 2YDKA 1DAWA 3ZYAA 4CTCA 2R3HA 3LVPA 2UZNA 3HV5A 4GS6A 3UYTA 3DBCA 2R3NA 2X8EA 3CBLA 3IECA 4RJ6A 3UDZA 2WMTA 4L68A 3QQLA 5EOLA 4AF3A 3EZVA 4ZAUA 3QYZA 4XCUA 5EW3A 1OL7A 2J6MA 5HICA 4TWCA 4FA2A 2C1BA 4C62A 4FEVA 4BFMA 5GJDA 3IW5A 3KXMA 2YDJA 4RVTA 1Y8GA 4W4VA 4YJTA 4PNIA 3TJDA 4BN1A 5HLPA 4CRLA 1GAGA 2CKEA 1OPKA 3I1AA 1TKIA 4WD5A 4NUSA 4YJSA 4L6QA 5J79A 1GZOA 3VRZA 2E9OA 3Q2JA 1F5QA 2R3FA 3UQCA 3V5TA 3QFVA 3GU6A 1H4LA 3PIYA 4GU9A 3PRFA 4ZTQA 1M7QA 4GRBA 3QTUA 4G16A 3AOXA 4FNYA 4QTBA 3FZ1A 3FMKA 3R8VA 3RCDA 4E4MA 4X3JA 1QPJA 3UO4A 4APPA 3W0SA 2VX1A 4LI5A 2RGPA 3NNXA 4QMWA 2A2AA 4MQ1A 3CJFA 3I81A 4V0GB 3TTJA 4UMUA 3VUGA 4QYYA 4F1OA 4F63A 2WOTA 5M53A 2UV2A 4HGSA 4YJOA 3C4FA 3FXWA 4D9TA 1YW2A 4BY9E 3TNPC 1F0QA 2E9UA 4C3PA 2EVAA 3V04A 4D4YA 4YTCA 4J8MA 3QLGA 4YTFA 2Z7RA 3C0IA 4K1BA 5ETCA 5FD2A 5EQPA 4EH3A 3EQIA 1DS5A 2H34A 2WQEA 3QALE 4BBFA 5M56A 1M2RA 2CKOA 3O8PA 4DA5A 5HX6A 4AT3A 2OF4A 4FKQA 5TO8A 1WVWA 3AT2A 4F78A 1ZRZA 4J95A 3R9NA 3PVGA 4RVLA 4O7SA 4FZ7A 2QURA 1JQHA 2VN9A 5CAUA 5I4NA 2UZEA 4O4DA 4M13A 2J0JA 4OGRA 4YJUA 5C27A 5BVFA 5IUHA 3HUCA 4G34A 4AT5A 3H0ZA 5HORA 5CF5A 5J1WA 4R3RA 4QYGA 2GQRA 3R9DA 1PY5A 4JX7A 2O8YA 4CFUA 1HCLA 2Y7JA 3MN3A 4RQKA 1URWA 4PPCA 4MCVA 3QHWA 1JOWB 5ANKA 2QD9A 4HYHA 4LL0A 4QTDA 2FSOX 3MPMA 4MXZA 4YJQA 3EQFA 4K0YA 2Z7LA 4DLJA 5K5XA 2C6IA 1Q61A 4LQMA 3NUAA 5EH0A 2QOQA 3AMAA 1XBBA 5CNNA 4DEGA 3F7ZA 3FAAA 3PE2A 2WQNA 3O50A 1CTPE 3P0MA 1M2PA 4O1OA 2WTKB 4ZY6A 2O3PA 4Z7GA 3DLSA 2PVYA 4FODA 3COHA 3UZTA 3ULIA 2ITYA 4I5CA 4X7QA 5HI2A 2VWUA 4FOCA 4FTUA 3PIZA 4Q5HA 2XNBA 4KSPA 1LPUA 2V62A 3V01A 3UDBA 2IPXA 5KZIA 4PY1A 4UMPA 4JX3A 5CWZA 5H8EA 3ZSGA 4G6LA 3R28A 4FKIA 2EXMA 2C1AA 1U54A 2ZDTA 4RLKA 1ZARA 2C5XA 3HP5A 3PY0A 4MX9A 4USDA 3ZC6A 4EZ3A 3SXSA 2P2IA 3EWHA 5KZ0A 4C59A 4EH7A 1XWSA 2OW3A 2JFLA 4KAOA 3RINA 2BZJA 3SKCA 3TNQB 4LFIA 4D4SA 3AQVA 3P7BA 1XBCA 1PKGA 3BX5A 3LE6A 1RJBA 3GB2A 4KIOA 2F9GA 4CFMA 4CG9A 4AS0A 1H1RA 3PZEA 4MXYA 4AXFA 2BKKA 1KE6A 3OD6X 3BHHA 2AC3A 4Z3VA 3W18A 2B9HA 5FM3A 3TZMA 1H26A 2VTOA 2BMCA 4O1PA 3WZEA 4EH5A 3A99A 4EI4A 3E3BX 3VUKA 3MH0A 1OBDA 3NZ0A 3FMMA 3C13A 1UWJA 2B7AA 3VO3A 5EHYA 4AT4A 4O7RA 5DEWA 3U4WA 2ZV7A 5BUEA 4TKSA 4LL5A 2FGIA 1Q62A 2GFSA 5TF9A 4FTAA 1PXJA 3PA5A 1G8JA 5EKOA 5C26A 5AUUA 3PLAE 3MFSA 5EKNA 3KY2A 4RPVA 4XBUA 3PDTA 4EH9A 5ETAA 5IMXA 2R9SA 2EWAA 4QD6A 2RFSA 5HO8A 3I60A 3O8TA 3OOGA 3DXPA 2XIZA 2YAKA 3ODZX 3GQIA 2YZAA 3CS9A 3KULB 4IVDA 1R3CA 4G17A 5JH6A 1YRPA 2XJ1A 2OG8A 2YJRA 3D4QA 5BVEA 3EL8A 5TKDA 1GJOA 3PP1A 2FSMX 4NM7A 5FRIA 5B7VA 4EKLA 3BU3A 4RG0A 5KHXA 1QMZA 3FMEA 2F7EE 4V01A 3VS4A 2OFUA 3REPA 5I9WA 5E7RA 4BI2A 4F65A 2BHHA 3W1FA 1XH6A 2YIYA 3UMWA 5HQ0A 5FTGA 3ZM4A 3W0PA 4WSYA 2X6DA 4GK3A 2XK4A 1G8KA 2JAVA 2PZ5A 4QMPA 4FK6A 4EOSA 4AN9A 2X8IA 3E5AA 3QKLA 1BYGA 1GZKA 4G6NA 4HCTA 4PDSA 4KABA 5JFXA 4D0WA 3EQRA 4TNBA 3ZEWA 4ARKA 4B8LA 4IZ5A 2WTVA 3HRCA 5IEYA 2P0CA 2QVSE 3TNWA 2Z02A 2RKUA 2ITUA 1EH4A 4FF8A 3GI3A 2C5OA 2QCSA 3G6GA 3MH3A 4RIWA 4D1SA 3EQPA 3NCZA 1PXLA 2RF9A 4X3FC 4I94A 1Q3DA 3R7GA 2W1CA 3KRJA 4MF1A 3D5VA 3UODA 4FEUA 5H2UA 3CCNA 2E9PA 2XH5A 3V8WA 1BLXA 3JS2A 5JRSA 3GBZA 3HECA 2WMBA 4HGLA 3RZBA 3VUTA 2HCKA 4YBJA 2ESMA 3RNYA 3KREA 4GKHA 2Y4IC 1UU7A 2ZV9A 2YIRA 1P14A 3TDVA 1CM8A 3C9WA 4UYNA 2A27A 4CTBA 1U59A 4BCFA 4ANQA 4EBVA 1ST0A 4RWJA 1G5SA 4JOAA 1YXVA 5IDNA 2I0YA 4QP1A 5AV2A 2YZLA 3ELJA 2ONLC 3VBYA 1M52A 4MK0A 3G90X 2X0QA 3NIEA 4LM5A 4ZZNA 4ZTSA 3MIYA 5E8XA 5GHVA 4QRCA 3MIAA 3E3PA 2JEDA 3WZUA 1P5EA 4U0IA 5CF4A 3IGOA 2BTSA 3UZRA 3FZOA 4YZCA 5ANJA 4ACHA 4CD0A 5C4LA 4XV1A 4J7BA 2XMYA 3KVWA 1BKXA 3FSKA 4QP4A 5IA3A 4LG4A 3E8EA 3U4UA 2QOCA 3ZM9A 1XBAA 2XYNA 2R2PA 3BL9A 4EJNA 2OH0E 1PW2A 3LJ0A 1ZMVA 3TIYA 3ZLXA 3CEKA 1W0XC 2PMIA 1KOAA 4EK8A 2QOLA 2JKOA 2UW7A 1YDSE 3CD3A 3PVUA 4IAYA 5FBNC 2JGZA 4CMTA 4M8TA 2R7IA 3FKOA 3DXNA 3E8CA 4FZAB 3UDTA 5L8JA 2O2UA 4FKTA 3CKWA 2W1ZA 4FKLA 2QG7A 4RSSA 1Y91A 3EH9A 1OECA 4K11A 5E9EA 4O84A 2X2LA 5AIKA 4QP9A 4DFXE 3OMVA 1KE9A 3ZOSA 4M12A 4IZYA 4E5BA 1J91A 1RDQE 2PZYA 3H10A 4ZK5A 4ITJA 4YO4A 3PYYA 4GK2A 5LQFA 3G15A 3D14A 3F69A 3NEWA 4FTNA 3QXPA 3HMPA 4FYNA 2HK5A 4ZZMA 3R01A 2BR1A 4E4LA 2YACA 2ITXA 3QQJA 5FTOA 3KXNA 2JKKA 3DJ6A 4FNZA 4O6LA 4G9RA 4CNHA 4PL5A 4TYIA 5IA2A 5I9VA 5JFVA 4CLIA 3SV0A 2WHBA 4F9WA 5GZAA 4AXCA 4M84A 2WU6A 3TKIA 4J8NA 3KU2A 4UZHA 5J9LA 5IA0A 2PZRA 3LXLA 2WTCA 3FYJX 4Y5QA 4BDIA 3OTUA 5JQ5A 4KIQA 4RC3A 4DH1A 4BBMA 1I44A 1LEWA 3MV5A 5DHJA 3B8RA 2BTRA 4CG8A 4KA3A 4U81A 3RTPA 4I5PA 4YTIA 2WTJA 3SC1A 5D11A 2NO3A 2UW9A 4PDPA 4ANSA 5JK3A 3HRBA 1O6LA 4L01A 3ORTA 4OTGA 3RWPA 4CZYB 5BVWA 1YKRA 2B52A 4MNEB 3AC4A 2I1MA 4G3GA 5HD7A 3WE4A 5CEMA 4O38A 2BPMA 4OT5A 2OJIA 3LFNA 2VTQA 4QO9A 2GNIA 2HY0A 2VTMA 3NGAA 3KKVA 5C8MA 2IW9A 5A14A 5CSVA 3F82A 5CNOA 1KV2A 3BGZA 4LV8A 5LWMA 3KN6A 3VUIA 2IZUA 4JRNA 3DBQA 2OZOA 4NM3A 5EHLA 2BVAA 2CSNA 2JKMA 4Y83A 5IQHA 3PPJA 3QCSA 4AN2A 3W0MA 1TFFA 3MB7A 4BL1A 4ID7A 4GEOA 1JNKA 2W5AA 2X9EA 4J52A 3GP0A 2C3LA 3QTXA 3VBXA 5EYCA 4AW2A 2YM5A 1FVTA 1OIYA 3HMMA 4CXAA 2YLFA 3V3VA 1Q8UA 3F61A 3NR9A 1MUOA 2PVRA 3ORIA 4FSRA 4NFMA 2XYUA 4MYGA 3DB6A 4RIXA 3PIXA 2JFMA 4L44A 5L6WL 3GC8A 1OVEA 3QWKA 2W9FB 4HYSA 4JG8A 4R6VA 5JZJA 5HU3A 4C4JA 4EYJA 2ZV8A 1R0EA 1ZYJA 4NTSA 2B4SB 4NU1A 4XG3A 4M15A 5E8ZA 4FV1A 4N6ZA 3KF4A 4HPUE 3VC4A 4B7TA 1UWHA 5BVKA 4M0ZA 1PJKA 4F09A 4F9CA 1VLRA 1G8SA 3HV6A 2HOGA 2W05A 5HNBA 4EK3A 4CT2A 3ZZEA 4O7TA 5IQIA 2W96B 3MVJA 4DINA 5CF8A 2W5HA 3QF9A 3QZGA 1Y8YA 3BI6A 3QUDA 3RBWA 4I5MA 3W55A 1SVHA 2PZIA 3G0FA 2UW5A 1I09A 3LJ2A 4IFGA 4QYHA 2IW6A 4R7BA 2XRWA 1ZZ2A 2UW4A 3NIZA 4UMTA 3U9NA 4OLIA 4AA0A 4PF4A 1YOJA 4RGJA 1Q8YA 2CLQA 2I0EA 3LMGA 5ANGA 4RX5A 2J4ZA 4RX7A 3K5VA 3UC4A 5J7BA 4U79A 4FSNA 3W32A 4IX6A 4Z16A 4CKJA 4F7JA 2GTMA 5K0KA 3KIOC 4JR3A 4U44A 3ORZA 4FVPA 4IE9A 3VF9A 4EOIA 4BGGA 3A60A 3TL8A 5AM6A 1PXOA 2CN8A 3C50A 3QRUA 4OBQA 1VYWA 4R7HA 1J1BA 4GL9A 4BIEA 3ZRKA 5HCZA 1AQ1A 5I5ZA 2GNGA 3SVVA 2UVXA 3O71A 5CLPA 4OR5A 4C36A 5HU9A 3O2MA 2XK9A 4TRLA 3OUKA 4BDHA 2ITZA 5DG5A 5AWMA 3BBTB 2JDRA 2R64A 2YN8A 2ZM1A 2Y9QA 2IG7A 2HYYA 4WUNA 1YHVA 5TOZA 2C0TA 3UP7A 3VQHA 3OW3A 4I6LA 4RIOA 2HXLA 3NUNA 4DHJA 3U51A 2VTNA 4YZMA 2BDWA 4D2RA 1ZOHA 2CDZA 3MB6A 4JXFA 3V6SA 1OL2A 3GVUA 4PMPA 2IWIA 2OO8X 4RIYB 3FMNA 4NJ3A 5GINE 2BZKB 3DZOA 5L2QA 1NVQA 3ZC5A 4C4GA 5HE1A 4JNWA 4E5WA 3W8QA 2NRYA 3KXXA 4S32A 2UZWE 4XBRA 3Q4ZA 4X6RA 4O81A 3TYKA 5IQFA 4PP7A 4FL2A 4Y72A 3HP2A 3UO5A 5AR5A 5FDXA 4G2FA 2C5VA 3E8DA 3UNJA 3OEFX 3DPKA 4K2RA 4XOZA 4I3ZA 1H08A 2R3IA 3LQ5A 5EW8A 2WGJA 4EH8A 4KNBA 3PE1A 2XKFA 2Z7SA 5DT4A 2G9XA 3P79A 3ZFYA 4C2VA 4E73A 4AZEA 3OW4A 2QOHA 3KFAA 4HGEA 1J7IA 3A7HA 5K5NA 4WNMA 1MRVA 4BCMA 2PE1A 4FV6A 5ANIA 5FP6A 4ORKA 1ZLTA 4R5SA 4H3PA 3UNKA 5M57A 2QOFA 4C35A 4QEBA 2QU6A 4XG9A 2VV9A 1U5QA 3QRJA 1Y6BA 3PUFC 3R6XA 4HJOA 4ACMA 4XLIA 1H07A 2PVMA 3Q2MA 4FGBA 4BCHA 4BKYA 5JSMA 4N57A 4DDGA 1R0PA 3QD4A 5HTBA 3COKA 2X81A 3LCOA 4YJRA 2GQSA 4S30A 2E9VA 5DRDA 2AQXA 3NUYA 4AU8A 5BQ0A 4DEDA 5CT0A 5FWKK 3O7LD 4JQEA 4JDKA 2XIYA 1NT2A 4X2GA 4CFVA 4HGTA 2XF0A 1ZY5A 2I0VA 3SOCA 1YI3A 4IXPA 3EN4A 5CALA 4O7VA 2FO0A 2OWBA 3EKNA 4F0GA 5JRQA 3RKBA 2R0UA 2R3OA 3OROA 1JVPP 4JDJA 4X0MA 4OAUC 2ACXA 5LARA 3NFGB 3C0HA 3AC1A 4WO5A 3L8PA 4AE9A 3HGKA 4L42A 3GU8A 4M68A 1H8FA 4V0GA 4IW0A 1UU9A 3RAKA 4ZLYA 3A8WA 5KMIA 1B38A 3FC1X 5J1VA 3QL8A 2VX0A 4DTBA 4BBEA 3SG8A 3PY3A 4V05A 4FBXA 3UO6A 4AZSA 2YM4A 4U8ZA 2VGOA 4XRLA 5CU2A 3SRVB 1KV1A 2X7GA 5ETFA 3HMIA 3TZ7A 3ZDIA 4Q5EA 3GOKA 3QD2B 2YISA 4O2PA 5HVKA 1UU3A 2ITTA 5T68A 2I6LA 5CEKA 2RSVA 3P1AA 4B9DA 2JKQA 4G31A 1VZOA 3OZ6A 3TXOA 2F2CB 3MDYA 3EN9A 1NVRA 4BYIA 4S2ZA 3SD0A 2LGCA 2FVDA 4B6LA 4XG4A 2HW7A 5L2SA 3RZFA 4ZXTA 4BTMA 4QMXA 3UG1A 2YHVA 3C4WA 5AA9A 5G1XA 4BTKA 3FJQE 2J7TA 4NM0A 4BZOA 3DQXA 3GCVA 4RWKA 1ZY4A 4FNWA 4DTKA 4BZDA 4HOKA 4DF3A 3R8PA 2BDFA 3PXYA 4NKAA 3RWQA 2F49A 2EB3A 1H0VA 2PMLX 3AC5A 4LRJA 1MP8A 5F4NA 2EXEA 3R7IA 5CANA 4UX9A 4PV0A 3G33A 1PKDA 2ITNA 3EZRA 4JLCA 4TWPA 3FI4A 4OTPA 3W2OA 4FTCA 4C61A 1URCA 3TT0A 2WPAA 2Z7QA 4JQ7A 2BFXA 4IM0A 5EQYA 3H4JA 3IK3A 2C30A 3CD8A 4X3FB 3GUBA 4CRSA 1YDTE 2E9NA 4ACDA 1OUYA 2OK1A 3IOKA 4FSUA 4FK3A 1FMOE 3RPVA 4O0SA 5DRBA 2QC6A 4PQNA 3NW7A 5LMAA 5KCVA 2BDJA 2X7FA 3BYUA 2JIIA 3FZTA 1BUHA 1A06A 2QO2A 2R3QA 2YWPA 3R04A 3SXFA 3D94A 5IH6A 4K6ZA 3PJ3A 4QMSA 5HOAA 4BDJA 4BCNA 2VNWA 4FT9A 1OMWA 3Q9WA 3ZCLA 4ZTNA 1ZYCA 3FLNC 4HNIA 4A4LA 2CNUA 3ATTA 2HZNA 4DFUA 4J98A 4J99A 4YR8A 4OUCA 5BYYA 3QC9A 1M17A 3QLFA 3QZFA 3FPMA 5HBEA 3JY9A 3TDWA 3LLTA 1SM2A 3OCGA 3OUNB 4BDBA 2Y0AA 4YHFA 3PA3A 2GU8A 3FQSA 3ULZA 4JBOA 5FP5A 1Y57A 4Z7HA 5K4JA 5AAGA 4V04A 5L3AA 3VW6A 3FXZA 2YIWA 3S0OA 5FEQA 3BWFA 4YUQA 4G3FA 3UQFA 2O64A 5JFWA 4RJ7A 5AV1A 1H01A 5FXSA 3BLQA 2Q0BA 2ITPA 3V5JA 3F5GA 4H3BA 3CKXA 4JL9A 2GNJA 4U40A 3QD3A 3BWJA 3UG2A 2WNTA 3CGFA 5DPVA 2R5TA 1H1PA 3QU0A 4Y95A 1SNUA 4IZ7A 5HG8A 4UMRA 4JG6A 3ALOA 3C1XA 4CFWA 2F4JA 3G9LX 5I9ZA 4LOPA 4GT3A 5IEXA 4XEYA 3PSBA 4HVHA 4O7LA 4EQMA 3MTFA 4U6RA 2ZVAA 3ORLA 3JVSA 4WRGA 1QPCA 5IZFA 5CF6A 3N4UA 3E7VA 3HZTA 5CZHA 3VVHA 3A8XA 3FQHA