2PVKA

Structure-based design of pyrazolo[1,5-a][1,3,5]triazine derivatives as potent inhibitors of protein kinase ck2
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
328
structure length
327
Chain Sequence
MSKARVYADVNVLRPKEYWDYEALTVQWGEQDDYEVVRKVGRGKYSEVFEGINVNNNEKCIIKILKPVKKKKIKREIKILQNLGGPNIVKLLDIVRDQHSKTPSLIFEYVNNTDFKVLYPTLTDYDIRYYIYELLKALDYCHSQGIMHRDVKPHNVMIDHELRKLRLIDWGLAEFYHPGKEYNVRVASRYFKGPELLVDLQDYDYSLDMWSLGCMFAGMIFRKEPFFYGHDNHDQLVKIAKVLGTDGLNAYLNKYRIELDPQLEALVGRHSRKPWLKFMNADNQHLVSPEAIDFLDKLLRYDHQERLTALEAMTHPYFQQVRAAENS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Casein kinase II subunit alpha
publication title Structure-based design, synthesis, and study of pyrazolo[1,5-a][1,3,5]triazine derivatives as potent inhibitors of protein kinase CK2.
pubmed doi rcsb
source organism Zea mays
molecule tags Transferase
total genus 114
structure length 327
sequence length 328
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2007-05-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2pvkA01
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2pvkA02
3QUPA 5H2UA 3M1SA 4XBUA 4DFLA 4ZMFA 2YJSA 3PG3A 3B2WA 3DPKA 4FTLA 3D14A 2E9VA 4MK0A 1L3RE 4BVUA 4RX7A 3BZ3A 3HRCA 4NK9A 2UW5A 5KNJA 4GU6A 4WNKA 2F9GA 3ZCLA 4XG6A 5IQHA 2C47A 3ZHPC 3IW5A 1KV2A 4F63A 5BMSA 3E3PA 4EQMA 3REPA 2YISA 2CSNA 3ZH8A 3Q32A 4F6WA 2YAKA 2J9MA 5HVKA 1YXXA 3HDMA 3UBDA 4F0GA 2C6LA 5BVEA 4CV8A 4GT5A 3HAMA 4C33A 3DB6A 3TV4A 2FH9A 5CS6A 3LE6A 5HU9A 4GFGA 4I92A 3BU3A 4MX9A 4NM5A 5HTIA 5BVWA 2B55A 3CP9A 4F7NA 3L1SA 3BGPA 2OJGA 2B9JA 1JSUA 4L68A 4FV8A 4QMOA 4DA5A 1BL7A 3WZKA 5AJQA 4QTCA 2C4GA 1G8AA 4JS8A 4LRJA 4XS2A 2YZAA 4NZWB 3CIKA 3KXMA 3PJ8A 1Q41A 4XG8A 5HIDA 4IX3A 1FVVA 3OEZA 3CTQA 3EN7A 5AMNA 5AP6A 4KB8A 5KHWA 5L6PA 4BHNA 4BDJA 3LIJA 5GJGA 3RMFA 2Q0NA 1RQQA 4AFEA 1M52A 1UNLA 4FTRA 3LJ2A 4FEQA 4IZYA 4G1WA 4UB7A 4BHZA 2ZM4A 4RJ5A 4H58A 4C0TA 4RQKA 3VIDA 5DR2A 4R7BA 3I60A 3SLSA 1CDKA 2UZTA 3K3IA 4YSMA 4EWHA 2X8IA 4XHKB 4O86A 5KZIA 3TKIA 3TZ8A 1H28A 5IQEA 2OXYA 4QYGA 5I9YA 3DJ5A 5D9HA 3EN5A 4OTQA 3MPMA 4MEDA 5CASA 2G2HA 2YIQA 2PMLX 2ZV7A 4OBOA 4D2SA 2IZUA 1W0XC 4M69A 3ZM9A 3V04A 4XOZA 1H0VA 3GC8A 5IF1A 4FOBA 1YRPA 3G6GA 4AW5A 5JK3A 3SRVA 3F5XA 3FY2A 3G9NA 3BHTA 5DEYA 4OTIA 3UGCA 2FUMA 4IC8A 5JFWA 3F66A 1OIYA 3GT8A 3NUXA 2PU8A 4XG9A 5M55A 5A6NA 4JDKA 3ROCA 2NRYA 2I0VA 4Z7HA 3O51A 2VN9A 2J50A 3MVMA 4BTMA 3A2CA 2VX0A 4NSTA 5CNOA 3D0EA 4L43A 4U5JA 5HKMA 4YTIA 3U87A 4ZLZA 5EKNA 3W8QA 4PX6A 4A9TA 4AN2A 3LXKA 5DBXA 4EHZA 3ZBFA 3Q9YA 3VUKA 1UKHA 2IVUA 1OBDA 4ZS4A 4ZSEA 1G5SA 2CKQA 4ANQA 3G51A 4TT7A 2C5OA 2Y0AA 1OL1A 4G5JA 4QP9A 2W05A 3QTQA 5K0KA 4ACMA 4EYMA 5LVOA 3LOKA 2P0CA 3LXNA 1Q8WA 4EOQA 4XG4A 3U6HA 4WO5A 4X2NA 4RIXA 3IK3A 4FZAB 3E63A 3O71A 3ORPA 3U51A 5BNJA 4YU2A 2WTIA 3ALNA 2OZOA 2JKQA 5L6OA 4KRCA 2QVSE 2GS2A 2WTDA 1ZOEA 3R22A 4FZ6A 2CNQA 3QF9A 4YTHA 4IB0A 3SC1A 2JDOA 4JAIA 3E64A 3KRRA 4OBQA 4O38A 4GUBA 1PMEA 5DHJA 3UQCA 1CM8A 3W32A 2X6DA 3U54A 3BWFA 4MBIA 4JG7A 4WKQA 2BKKA 4FKWA 3RHKA 4QPAA 3KF4A 2HXQA 4TYHA 5E8ZA 3FI8A 1BLXA 4JQ8A 4KSPA 3IDBA 4QYFA 3JVRA 4TXCA 5AX3A 3TTIA 5AV4A 3FYKX 2YIYA 1P5EA 3VS1A 4XNEA 4O7WA 4R78A 3WF9A 4GU9A 3R30A 4FKRA 4PTCA 5M4IA 5DI1A 2C6MA 3QKLA 1F5QA 3TCPA 4BDFA 3ZFXA 4E1ZA 3F5UA 4ZIMA 2XNOA 3PPJA 3F5GA 3LFQA 3OG7A 3QXPA 4FKQA 1KSWA 4YZDA 2ZDTA 4TYHB 3WF7A 1KE8A 1U4DA 3D5UA 4I22A 4W9WA 1XJDA 5D41A 3LCTA 3CE3A 4FT5A 5LVPA 3E93A 4V05A 4RMZA 3UDBA 4BB4A 4BIEA 3QKMA 4C02A 5L4QA 4IC7A 1GAGA 3II5A 2C1AA 2IO6A 3MI9A 1FQ1B 4C3PA 3ANRA 3FKNA 4FSZA 2GCDA 2QI8A 4TYEA 3DJ6A 4FF8A 3VS6A 2XIYA 5CF5A 3NAXA 4PL3A 4RJ8A 4OUCA 3M11A 3POZA 2YM7A 4BGQA 5ANEA 3GI3A 4AOJA 1YHVA 3KRJA 3RVGA 5K9IA 2Z8CA 4QQTA 1ZYLA 2BFXA 2ITWA 4C2WA 4L00A 4PMPA 4GG5A 5ICPA 3POOA 3FAAA 3TNPC 1XH8A 4AZTA 4E6QA 5LVMA 2OICA 3NSZA 4CZUA 3TNQB 2YCRA 4K8AA 2RFDA 2CCHA 3NNUA 5HCXA 2WMTA 3RHXA 2PULA 3FMMA 3O0GA 3C4XA 1CKPA 5ANIA 4YP8A 1GIIA 5AR3A 3R7OA 2O5KA 4IEBA 3F2NA 3HDNA 4UZHA 5EDQA 4DH8A 4ANNA 2XK6A 3OW4A 4BDIA 2RG5A 3D2KA 2XRWA 4C34A 2WTJA 3HUCA 3ZU7A 5FP5A 3R8MA 4AE6A 3TUBA 4KIKB 3CQEA 4ANMA 2AUHA 3DS6A 5DN3A 5HVYA 1JPAA 4IANA 1ZZLA 3B8RA 2ITTA 1H1RA 3MN3A 4UMRA 4U7ZA 4YHFA 5EM8A 4FUYA 4CRLA 4RZWA 5G1XA 5LARA 3RWPA 5IQGA 2WO6A 3GENA 4I93A 4IM2A 4Z7GA 4DEBA 5EI8A 2X7OA 4BKZA 2OXXA 4RIOA 2C3KA 4UX9A 3QLFA 3LJ0A 4E4NA 5LCJA 4DFUA 4S30A 4XV3A 5AV1A 3CQUA 4K9YA 5HEZA 2QLUA 1WBNA 4E6DA 2Z7LA 4X6QC 4G3DA 5BVNA 4J99A 3EQCA 4ZTMA 3ZUVA 4D4RA 4HJOA 4WBBB 4TL0A 3U4WA 4NTTA 1KE7A 5HBEA 2PWLA 4JDHA 4EH2A 4FTTA 3IGGA 2XIXA 5B2KA 5E8VA 2HY81 3UO6A 4WUNA 3WI6A 1QPJA 3P9JA 5AA9A 2GNGA 3BKBA 5HNIX 2VTLA 4YMJA 2Y7JA 2C68A 5HOAA 2W0JA 3PP0A 4QQ5A 2YWPA 3HUBA 4MNEA 3D7TA 5FXSA 4CFUA 1GZ8A 2ONLC 4M68A 4F6SA 4U81A 3BU6A 3KU2A 4QMVA 1M17A 1UWJA 4TPTA 1OKVA 4FV7A 4CT1A 2DQ7X 3TUCA 3C4EA 3OWLA 1FMKA 3NS9A 4MCVA 4EOIA 4D2RA 1E1XA 4GSBA 1NXKA 3NUYA 3OMVA 2IW9A 4H05A 4MNEB 3D7TB 3SXRA 2X4FA 1STCE 2BKZA 3DQWA 3TV6A 5IKWA 2HZNA 4RIWA 4JRVA 5TO8A 2GQRA 3WE4A 3COKA 2WQEA 1MRUA 4ZK5A 4F64A 1H1QA 3R7EA 4ID7A 2HWPA 1UV5A 5HTCA 2ZOQA 4CKIA 4AZEA 4D5KA 2CKPA 1JKKA 2G1TA 2RFSA 2W99B 3ACKA 2BILB 4DFBA 5B2MA 4EUTA 4QNAA 3V5LA 2EU9A 2E9PA 3DKFA 3QCYA 4P2KA 4S31A 3FLQA 4JOAA 3CSVA 3QQHA 5LCKA 4DEAA 2WGJA 2VNYA 3MFRA 1UNGA 2YIXA 4Z3VA 4YLJA 3BEAA 2IW8A 3L8XA 2BRNA 5EW3A 1XBCA 4ZTHA 5KHXA 3PDTA 1YOJA 2QKWB 3S2PA 3QWKA 4EEVA 3I7CA 1Y6AA 2B52A 3IONA 1YI4A 3I5ZA 3O8UA 3QTZA 3R00A 2XKCA 3FSFA 1E1VA 2UW8A 3G5DA 4BCJA 3R73A 3OWPA 2YZLA 5M07A 4NUSA 2ETRA 4DT9A 3CC6A 5LWNA 4BZDA 2G2FA 3OCBA 4RJ4A 5CSHA 4O2ZA 3DKGA 4ZZOA 1ZRZA 4TWOA 4D1ZA 3K5VA 4B0GA 2GS6A 4J98A 4EC8A 4LOQA 3ZYAA 1OUYA 5EW8A 5BYLA 1PXNA 1U54B 3ET7A 4BCIA 3SG8A 3GU5A 1UKIA 3RJCA 5CXZA 4F9YA 2HXLA 2JDRA 3NPCA 3VS4A 3HZTA 2YACA 3FLZA 5EYCA 2PMNX 3RZBA 3NYOA 5IA3A 1NT2A 2I7QA 4MF0A 3NYNA 5EM6A 4UN0C 4AW2A 4APCA 5CI7A 4QP8A 4ZTSA 1ZMUA 3GQIA 3ZM4A 5E8YA 3C4WA 4E73A 2W1ZA 2WQOA 4R8QA 4YTFA 3VUDA 3TZ9A 4O7NA 4DTKA 1CTPE 5FWKK 4E4MA 2OZAA 1R3CA 3FE3A 4DGLC 5TF9A 2PZPA 2YM8A 3NW5A 4BZNA 4WNMA 3VF8A 2OW3A 3C5UA 3F82A 1ZYCA 3ETAA 3QCXA 4B99A 4DTAA 4RWKA 3DK6A 2QU6A 5DPVA 2QO2A 3SA0A 4CCUA 4IMYA 5A14A 5AFVA 2QHNA 5JGAA 3UODA 4YGAA 4ASXA 5LMBA 1S9JA 1YWRA 4EOOA 4G9CA 4FKVA 4Q5EA 4N6YA 3A99A 1V0PA 1Q97A 1G8SA 4KUJA 4OBPA 4O0RA 4XV2A 3A4PA 3KN5A 1VYZA 3CTJA 2VO0A 2HYYA 4EZ7A 2QLQA 4FTMA 3OP5A 1MQBA 4BCOA 4FE2A 1YWVA 4X7QA 2EWAA 4DEDA 3KCKA 2R3PA 4J53A 4UMTA 5HI2A 4F7LA 3P08A 5F9EA 3R21A 4O0XA 2B7AA 4EK6A 1YQJA 3TTJA 2GNFA 3Q60A 3MJ2A 3DBEA 3HP2A 3FKLA 5DWRA 5JH6A 4FSMA 3ALOA 5ANKA 3IW6A 2XBAA 4AE9A 4EH5A 4O7VA 1XR1A 5LMAA 4RJ6A 1IEPA 1VYWA 3IKAA 3QTSA 4XP3A 3Q5IA 5I3OA 2WD1A 4QTEA 3NW7A 2Z7QA 4ONAA 4PDYA 4GG7A 5E9EA 3U6IA 1SZMA 5IA0A 4FSWA 5M44A 4D4SA 5CAPA 2BRHA 4U9AA 5IEYA 5JFSA 1XQZA 4M15A 5L8JA 3QA0A 3JVSA 1Q5KA 2IVVA 5FRIA 4CT2A 1LEZA 4O7ZA 5JGDA 2UZNA 4RJ3A 4YO4A 2YCFA 3H0ZA 4IHPA 1WFCA 4JR3A 3NNXA 4DFYA 3QD4A 4FL3A 4EH8A 4ZTLA 5AA8A 1BI8A 3EQGA 3OTVA 4Z16A 4BZOA 3DLSA 5C01A 3RCJA 1Y8GA 4QMNA 4WUAA 1IA9A 3R1YA 5IEXA 5T3QA 4AZVA 2X0GA 4YPSA 2NO3A 3R7IA 2IWIA 1M7NA 4PP7A 2JBPA 4C4JA 3HV7A 4FL2A 4I5PA 2E9NA 3T3UA 4AGDA 4D9TA 3ZDUA 2QOOA 2W5AA 4EC9A 2JAVA 4YO6A 4YJNA 5EM7A 5FEDA 2UW9A 4I0TA 2PUIA 4HGEA 4J97A 4ENXA 2CJMA 5I9UA 4BBMA 3COMA 5E8WA 5A4QA 2X2MA 4I1ZA 3KRWA 4MTAA 5E8XA 1SYKA 5G6VA 2QURA 1ATPE 5CXHA 1ZARA 5C9CA 4DGMA 1REKA 3IECA 4JX7A 3HV5A 3LCOA 2JFMA 3L9NA 4OAVB 5HLWA 4ZY4A 4O0TA 4AW0A 4IM0A 1VZOA 5CVHA 3VJOA 5C26A 3W33A 4PL5A 5JMSA 4PTGA 1IR3A 3EWHA 5CEOA 4AT3A 4IWQA 5JFXA 5GHVA 1FOTA 2BIKB 2O8YA 4L9IA 3EQDA 4LRMA 4UYAA 4JDIA 4BKJA 5I0BA 4O82A 4MWIA 4YHJA 5HO7A 3A7HA 3PRFA 4NCTA 3MY0A 3RTPA 4D28A 3DU8A 2B54A 3FXXA 3PY0A 4LL0A 3F88A 3LQ5A 4M7IA 2Y6OA 5FD2A 1FGIA 1KE6A 2CLXA 2WMWA 3D15A 3U8WA 4C4HA 4R1YA 2JGZA 2YDJA 4FSRA 1Q99A 4QP6A 3GC0A 4E20A 4GVAA 2J6MA 4NM0A 3HGKA 5I4NA 4I21A 4FVPA 1H08A 4M97A 3RPSA 3R01A 3RALA 2LGCA 5HNGA 4BN1A 4FK6A 4ORKA 4HZRA 1VEBA 4O1OA 5E1SA 5E7RA 5IMEA 4RLKA 5DT0A 3GC7A 3AOXA 1Q4LA 4IWDA 4J95A 5CQUA 5DEWA 4QMWA 3UG2A 4BDDA 5AWMA 4HPTE 3QRIA 1R0PA 3CXWA 4MXYA 5K4JA 4BY9E 3DFCB 5GJDA 2CLQA 4TYIA 4YJOA 4YC3A 5DLSA 2YCSA 3KB7A 4FR4A 4F09A 3L8SA 3ZRKA 5KCVA 5IDNA 2CN5A 3UTOA 4I23A 3ZO3A 4QTDA 4N57A 3MTLA 4FG9A 3OZ6A 3LFEA 3UVRA 5AR4A 5BYZA 3PPKA 1CMKE 3GUBA 5ETCA 4M67A 2ETMA 1BMKA 5I9ZA 4XLIA 1YDSE 2VWVA 4MXZA 2UW4A 3CGOA 2ITOA 1NVSA 3JPVA 3IOKA 1ZMVA 4F9BA 3HA6A 4AU8A 3GBZA 3Q4TA 2W1IA 3DAEA 4OTHA 5TKDA 3DKOA 2LAVA 2F49A 3FXZA 2CMWA 2XNMA 1TQMA 3DDPA 3H9RA 1O6YA 4TW9A 2JC6A 2GHLA 4C4GA 3TI1A 1CKJA 2XIKA 3QBNA 4TY1A 4C7TA 4F1MA 2VV9A 4EOLA 5CEMA 3W10A 4DTBA 1OIUA 2WAJA 4X0MA 3UIMA 1SVGA 1YOLA 5L2QA 4FT7A 2G01A 5A6OA 4JDJA 2ITUA 4E5BA 4NCTC 3BI6A 2BHHA 5CT0A 4XCUA 4BI2A 2IZRA 4CMUA 5FP6A 3I6UA 5J9ZA 4J52A 3NCGA 3LPBA 2JLDA 4WSQA 3FC2A 2GPHA 4FKOA 2PMOX 1JNKA 3EN6A 4G3CA 5FDXA 4BTJA 3Q9XA 1OBGA 4JQ7A 4JXFA 1QCFA 4XRJA 4FSUA 5JGBA 4D9UA 4GYIA 2ERKA 1Z9XA 2FB8A 2WMUA 3MPTA 4GFMA 5E8UA 4EL9A 4O21A 4C58A 4AN9A 3IDPA 5CI6A 4BCMA 3HP5A 5FTGA 4X3FA 2GTMA 3OUKA 1QPEA 1WVXA 2JD5A 4W4YA 5AP0A 3QC4A 1Q24A 2WMAA 3JY0A 3VS2A 4BDGA 3QGWA 5B7VA 5M4UA 4K18A 2C5NA 4QT1A 1AD5A 3F6XA 3VO3A 3LXLA 3ID6C 1Q62A 3BHVA 5F20A 5DT4A 2QU5A 4RX8A 4I6HA 1KOAA 3A60A 5TT7A 2VO3A 4X3FB 4G6NA 2RSVA 1PMNA 4TYGA 3ZZEA 4IVBA 3F7WA 2XNNA 5HE2A 1OIQA 4PRJA 1OM1A 4QMLA 4ERWA 3BBTB 4DHFA 2OJ9A 1P2AA 3RPYA 4AOTA 3V6RA 4IH8A 4RRVA 2PVJA 4D1XA 3HMMA 4FC0A 5KKRB 3BGQA 5ANDA 5EM5A 3P7CA 3NVKI 3WOWA 4ITJA 3PLAE 4B6LA 2XEZA 4CZTA 3T9IA 3PVWA 5IQCA 2VTIA 4DEHA 3W18A 2PUUA 2R3OA 4QP1A 4RFZA 3EFLA 3BLRA 4YJUA 4QYHA 3R83A 1CKIA 3D4QA 2C69A 4BDCA 4BCGA 3W2QA 4EOKA 2ETKA 3OCSA 2C0OA 2X7GA 2X2LA 2PVYA 4YURA 5AUZA 4ALWA 3F5PA 5LXMA 3BELA 5ETFA 4FGRA 5ACKA 5CEIA 4RGJA 4G9RA 1SM2A 3V01A 4A9YA 2XA4A 4Y72A 5DRBA 1REJA 3AMBA 3FMNA 4O6EA 3RAIA 1ERKA 3PA4A 4LYNA 3FL4A 2Z7RA 4K1BA 3ORLA 5LJJA 1URWA 2X81A 3AC1A 2Y6MA 4DH3A 3VC4A 5ACBC 3C4ZA 4GRBA 2ITVA 2J2IB 4BTFA 4QMPA 5IA5A 3P23A 2QG5A 4LUEA 3EN4A 3PE1A 5HBJA 3V8TA 3DB8A 4FKIA 5CU0A 2AC3A 3Q4ZA 2R0IA 3DBDA 2YAAA 3BWJA 4O2PA 4QTAA 4ACGA 4AUAA 4EJNA 4IDTA 3HRBA 4QMMA 3ORIA 2GS7A 1H07A 3EKNA 4YZ9A 5HU3A 2ESMA 3QHRA 1ZXEA 2RGPA 2V0DA 2ITPA 4O1PA 4OTPA 3GQLA 4X3FC 2WMXA 1Q61A 2IW6A 2Z60A 3CR0A 4FTNA 4R3PA 1YKRA 4DGGA 2W1CA 4KS7A 3PY3A 2X7FA 5AP2A 4IB1A 2C3LA 3ZS5A 3F3WA 2OFUA 2FSMX 4U6RA 4HVHA 2ZV8A 5FEEA 3DV3A 3Q96A 5KKRC 4P5QA 3HKOA 3HA8A 3GNIB 4RZVA 4HZSA 2QONA 3GXLA 3LMGA 1WVWA 2H96A 1UVRA 5AV0A 2QR8A 4D2VA 3FPMA 1NW1A 5EW9A 4F70A 4QMZA 5IUHA 2W9FB 1UU3A 3FQEA 4QRCA 2YA9A 4R1VA 5KZ0A 5IH6A 4CQEA 4U3YA 5AEPA 4IZAA 2QOQA 3PXFA 2XCHA 4WA9A 4FT0A 4X3JA 2XNPA 4DAWA 1KUTA 2FA2A 4HCVA 4YLKA 4M12A 4U0IA 2R3FA 5AIKA 4RX5A 3DAJA 2WTCA 1U5RA 2OLCA 3IW8A 1WBTA 1GZNA 3FMDA 4CZYB 1BUHA 5CF4A 4YBJA 5CX9A 4XG7A 2WMQA 2ZDUA 2CDZA 3EYGA 3I6WA 4UEUA 5HG8A 4EH4A 2OI4X 5J1VA 3KXXA 1DAWA 4AZWA 2C5XA 2UVZA 2JIIA 5AIRA 4BGGA 3TNWA 4KINA 4EHVA 2WU7A 3AQVA 3LLAA 2Z7SA 3FMJA 3T3VA 3S3IA 4II5A 4JVGA 3F69A 5KBQA 1K2PA 2JDSA 2YM4A 3OROA 2B9FA 4IACA 2WZJA 3ZZWA 2QO7A 1JWHA 4H3PA 4FOCA 5CAOA 1O9UA 1ZYJA 4ZXTA 5GIOE 4DG3E 4K77A 4Y73A 1H01A 4BIDA 3CS9A 5FTQA 3VS5A 2HWOA 4ANOA 5J5TA 4OTFA 2VO7A 3V5WA 3M2WA 1GY3A 2UUEA 2PSQA 5A4CA 5HO6A 5JN2A 1PKGA 1H1PA 1JLUE 4JX3A 5KO1A 2PY3A 4A4OA 3SOAA 3VBXA 3DBQA 4FI1A 1GIJA 4WRGA 2CHLA 3PVUA 3LZBA 4FV0A 4TYJA 4K0YA 2WMRA 4IDVA 2OJFE 2WMSA 2XIZA 4B7TA 4BKYA 2R3NA 3R04A 3TJCA 2E9OA 2VTOA 5GNKA 4X2FA 2XS0A 3HEGA 3TT0A 2PE2A 4YJPA 2VTRA 2WELA 4D2TA 5FUTA 5HNBA 3QX4A 1ZY5A 3DCVA 3I4BA 3FJQE 3PPZA 3E5AA 2UV2A 3OOGA 3HRFA 4O0WA 3SHEA 4E4XA 2XIRA 3QQKA 5DFPA 2R3QA 5IUGA 4XLVA 1FPUA 4L42A 2QKRA 5D10A 2OJJA 4N70A 5HIBA 1ZLTA 2ITQA 3FXWA 3QLGA 4Q5HA 4FV1A 4HGTA 2HZIA 4E93A 4AACA 4D58A 3ZLSA 4FZ7A 1DI8A 2X4ZA 3OCTA 5AX9A 4YZMA 4D0XA 4HVIA 5E91A 4O6LA 2VTQA 1YW2A 4OTRA 2WMVA 4MYGA 4WOVA 3WARA 2HELA 3DJ7A 2QQ7A 2Z02A 3G90X 2J5EA 4FV3A 4MF1A 4TWNA 5HICA 3TNHA 4C38A 2Z2WA 4C36A 3LM0A 3PJ1A 1ND4A 3I5NA 1XH4A 4JBVA 3GU8A 4F9WA 3A7GA 3R2YA 1HCLA 3SD0A 4L01A 2QOLA 4RPVA 4MQ2A 4QO9A 3EQRA 4MXCA 3EHAA 3FKOA 3DZQA 2YABA 4UBAA 1OL7A 5BUJA 4FODA 3UIUA 1ZOHA 3SAYA 5GZ9A 4LOPA 2R4BA 4FSNA 3A8WA 4ZSJA 3SG9A 5C8KA 3ZFYA 3PVGA 1BKXA 5EHLA 4Z55A 3VHKA 1Q3DA 4NT4A 4B8MA 1J7LA 4JG8A 3HMIA 4GW8A 2ONLA 3V3VA 2QR7A 3QQGA 3G33A 2I0HA 2G15A 4QMXA 4QMSA 1Y8YA 4E5AX 5BVFA 2OWBA 4ARKA 5ITAA 4YJRA 4RC3A 3UMXA 3TEIA 4KIKA 4X2JA 2OF2A 2UVXA 4P4CA 5BUIA 3KMMA 3ATSA 4DITA 1J7UA 4C62A 1WBWA 2W4OA 4JG6A 2I1MA 3EQHA 5EH0A 4XMOA 3ERKA 4FTOA 2ZM3A 4IBMA 3KK9A 3BLHA 4O7LA 1XH5A 3D5VA 5TOZA 4DFNA 4ZMEA 1PXMA 4DCAA 5F1ZA 4W4WA 4JNWA 3H9OA 3DZOA 4AA0A 2GMXA 4NU1A 3H0YA 4GYGA 4EKLA 4GFOA 4GJ2A 3FQSA 4I0SA 5H9BA 5C27A 5JEBA 4UV0A 4KKGA 2UZVA 5AP5A 3MB6A 4QNYA 3VUGA 1Z5MA 1A48A 3DXQA 3D5XA 3CPCA 4F7SA 3RWQA 4G17A 4DG2E 1W7HA 2XM8A 3IW4A 3KRLA 4XUFA 3R7VA 3UIBA 4MD8E 3ZTXA 3TZ7A 2C3IB 3RPVA 3ZSIA 3VHEA 5AM7A 3N9XA 3PXQA 3ULIA 1Q8ZA 4Q9SA 3BYUA 4F9CA 2W5HA 2E2BA 4PNIA 5AR5A 1H26A 3FLWA 4AX8A 4S33A 5FDPA 3PWYA 3W55A 4W8DA 5IU2A 2PE0A 2OF4A 3LQ3A 4F9AA 4TRLA 4DLIA 3I1AA 3PSCA 1FGKA 3LMIA 4ZJIA 5EK7A 2PE1A 3CQWA 3R9RA 3NAYA 4GV1A 5DOSA 3P1AA 4AZSA 1OECA 3GEQA 3HV4A 4HCUA 4NW5A 3OXZA 4RVKA 4WRSA 5J7BA 2BRGA 4ACHA 4P7EA 3VBQA 2BHEA 3PJ2A 3ZO1A 4U42A 5FEQA 2W5BA 3CBLA 1XH6A 3QZIA 5EFQA 5A54A 4E8AA 5L2IA 1GZOA 4RWIA 1M2QA 3OT8A 3IO7A 2YM5A 1VR2A 4BWKA 4I5MA 3RNYA 5AAGA 2ZB1A 2BDWA 3PJCA 2PHKA 3FPQA 2HZ4A 2J0LA 4FTKA 3FLNC 2PVKA 4M14A 3Q52A 4EQCA 3MPAA 1OKZA 4ANLA 2WEVA 3LAUA 1F3MC 3TJDA 5FQDC 2W1GA 3NIEA 4RWLA 3DTCA 4J8MA 3P7BA 3QX2A 4IB3A 2ZV9A 4XRLA 3ROYA 2VTSA 4FYNA 5JQ5A 4GUEA 1BX6A 3D7ZA 3DNEA 3R7YA 4I24A 3R7UA 5CAUA 2XCKA 3UVPA 5HX6A 2VTMA 3FY0A 4UWBA 5DNRA 4HW7A 4AT5A 4OTWA 3G9LX 3RBWA 3PG1A 2UZOA 3G0FA 4CMTA 3KVWA 3R9OA 4P90A 5B2LA 4HCTA 1FVRA 4UXLA 3FMKA 5HBHA 1YDRE 3GC9A 3V51A 2ERZE 5EQPA 1NY3A 1APME 4MAOA 3DOGA 4RJ7A 2WIHA 3FSKA 1XWSA 4ERKA 3MH2A 2PTKA 4GMYA 3ZRMA 3G2FA 4L45A 3E87A 4DINA 3KMWA 2QOCA 4APPA 3L9LA 2HIWA 2R3MA 1PHKA 3JY9A 1XKKA 5D7AA 4AWIA 4E7WA 4ZZNA 2C30A 3V5TA 4LMUA 4FNYA 2PL0A 1U54A 2R7BA 2YDKA 1IG1A 4AF3A 4QTBA 5KMOA 3E8EA 3V5QA 3R71A 3UZTA 4IAYA 4FTJA 4PDSA 3IGOA 1K3AA 2RL5A 1TVOA 1WBSA 3NNVA 4ASDA 3QAME 3TUDA 3GCSA 4O83A 4H1JA 1W83A 2B9HA 2HOGA 4LGHA 3LCDA 4YC6A 1OPJA 1XBAA 4FUXA 1GIHA 5ETIA 2W1HA 4W9XA 4ZLOA 2VGPA 4EK3A 1OPLA 5IQIA 3AT2A 3H4JA 4DFXE 4EOPA 4ZTNA 3WYYA 5H8GA 2J0KA 2PZ5A 4IAKA 3BV2A 4F4PA 4Y8DA 2Q83A 3GCVA 3OY1A 2XJ2A 3UPZA 3ZC5A 2EXEA 3MH3A 1AQ1A 5AM6A 1IAJA 4KS8A 2CGWA 3CY3A 4L7SA 4MBJA 4AG8A 3SXFA 3F3UA 3KGAA 1V1KA 3BGZA 3HLLA 3P86A 1IASA 5HZNA 3E7VA 2VWYA 2R7IA 1KOBA 4KABA 4FYOA 2HCKA 5JSMA 1PXKA 2VWWA 5BVKA 5HTBA 2OXDA 3GU6A 3AD4A 4EUUA 2R3RA 5HCYA 1UNHA 3AD6A 3NLBA 1OKWA 4ZSAA 3E8CA 1U59A 3IQ7A 1IRKA 4IVDA 3RNIA 2JBOA 4BI1A 5A4EA 1QPDA 3KXNA 1Y91A 3OS3A 3N4VA 5BVDA 5BYYA 2QC6A 2J0MB 3Q3BA 4ITHA 4LUDA 4PQNA 5FXQA 3QRKA 3R9NA 2GFSA 4YJTA 3BCEA 3W2PA 1XH7A 4EQUA 2Y8OA 3PY1A 4ACCA 4U45A 2YM3A 4Y5QA 3K3JA 5KMIA 4FKUA 4L67A 4CYIA 4EH9A 3EN9A 2A27A 4L8MA 4YPDA 2GNJA 3MDYA 2NPQA 5CU6A 3ZBXA 2RF9A 4NYEA 3HMPA 4G5PA 2ZV2A 3L8VA 2GNHA 1I44A 5EHOA 1H27A 3QRUA 5TR6A 4L7FA 3I81A 2PVMA 3TM0A 4RC4A 4AXAA 4BDAA 2C6IA 4BYJA 5IH5A 3L8PA 3OOMA 5F95A 3LJ1A 4GT3A 2UVYA 2VRXA 5EYDA 4AN3A 3P0MA 3UYSA 4ASZA 3CKXA 3LCKA 4XG3A 3MFTA 4H1MA 4DYMA 3MIAA 5IG1A 3HX4A 1SVEA 4QQCA 2XZSA 3VVHA 3N51A 1H00A 4FG8A 5CYIA 1PYEA 2GHGA 3NGAA 3NR9A 3FLSA 2NNWB 3DDQA 2X1NA 3PWDA 2BDJA 4EH7A 2V55A 5KMMA 4DEIA 4E6AA 2WKMA 2W1DA 4GK3A 3GOPA 3ODZX 4UMQA 2HAKA 2BAKA 3O8PA 3R02A 4KA3A 4R3RA 4C37A 3WZUA 4ZZMA 2O65A 3SV0A 1MUOA 4GK2A 2PZIA 2HZ0A 3FWQA 5AV3A 3RAKA 3ZSGA 4RVTA 2Y4IB 3SKCA 3LFAA 5IA2A 3AMYA 2B53A 3GB2A 1LR4A 3OC1A 4BDBA 4DE4A 4FSYA 3TG1A 2J51A 2JFLA 5T68A 3ZXZA 3MVJA 3C0IA 4R7IA 5EG3A 2WNTA 1YXVA 4ENYA 4AZFA 4ACDA 3M42A 2BRMA 4L6QA 4TN6A 3NDMA 4CNHA 5BUEA 4O7TA 1FINA 3UNZA 5EDPA 4NL0A 3DLZA 3DK7A 3DY7A 5EI2A 3MH0A 3NMUF 4AA4A 1YI3A 3ORNA 2O63A 4NWMA 5FG8A 4BWXA 3FZRA 3FI4A 5DR6A 4PP9A 2PUNA 3NCZA 3QKKA 1IA8A 3ZO4A 3NW6A 1TQIA 4JL9A 4RQVA 3HAVA 1RJBA 3TKUA 1DI9A 2EXMA 5LVNA 3OTUA 4LV8A 2VTNA 4FV5A 4FNZA 3UIXA 2BDFA 3Q5ZA 4IJ9A 4FG7A 3TL8A 5CF8A 2V5QA 5IQBA 1U46A 3UC4A 3UMWA 4LQMA 3D94A 2PVNA 3WF6A 5FM2A 2C0IA 3DK3A 3EQBA 2XUUA 4Y95A 3UYTA 4CLJA 4EJ7A 4MBLA 4BFMA 4YNOA 3F2AA 4G16A 4IIRA 2UW7A 3KQ7A 4IWOA 3OCGA 4J71A 3MW1A 4Y85A 5IEVA 5GINE 2DWBA 4WNPA 3O17A 3QGYA 3WILA 4A9RA 2CKOA 3O50A 3FMEA 5J79A 1I09A 3ITZA 4G3EA 4DGNA 3UQGA 1KE5A 3DXNA 5M51A 2XMYA 3F9NA 4YJSA 4DH5A 1ZWSA 3LMHA 2Y4IC 3GVUA 3L9MA 3ZDIA 3QTXA 3QQLA 3KULA 4ITIA 4D4YA 4F0FA 2XK4A 3QCSA 4RT7A 5LVLA 4YR8A 4W4VA 3VF9A 3ATTA 2BRBA 4MHAA 4DH1A 3OBJA 3CPBA 3R2BA 4ZTRA 3A61A 4HGLA 5AUXA 4IAZA 4DLJA 3ZONA 2XEYA 5AP1A 3UOHA 3UJGA 4FIGA 2XK7A 3BQCA 4OW8A 2HK5A 1DM2A 1NA7A 2UW6A 3G6HA 5BX0A 1V0OA 3OVVA 5ANOA 3KULB 4CFVA 3BX5A 2QCSA 3D83A 4AA5A 4CKRA 1GZKA 3PE2A 2Q0BA 1WBVA 5DE2A 5IDPA 5EOLA 4EBWA 4DBXA 1YXSA 4FT9A 4X21A 2OU7A 3CD8A 4HYHA 3O2MA 3I0OA 4JBQA 3UVQA 5L2TA 1H8FA 1W82A 4S2ZA 4C4IA 4EH3A 5M56A 3C50A 3ORZA 4JLCA 4CMOA 4D2WA 5HLNA 3H3CA 3W2RA 3L9PA 3CY2A 4MH7A 1P14A 4WG5A 2CNVA 3R9HA 4WG3A 1W84A 4FEWA 4QP4A 2GSFA 4USDA 3IS5A 3FHRA 1XO2B 2WTVA 3F3TA 4F1OA 5L3AA 3NVMB 4CTBA 3IDCA 5DA3A 5FLFA 1AGWA 3NIZA 4FKTA 4O22A 2QOIA 4MXXA 5K3YA 4WG4A 4WIHA 5FXRA 4H36A 2BZJA 4GS6A 3DNDA 4O0UA 4XBRA 3UO5A 2F7XE 3AC5A 3CTHA 3HMNA 2WHBA 3G0EA 4CTCA 4K6ZA 3SQQA 4EZ5A 5CSPA 3FUPA 3R7GA 2WOTA 3DTWA 2WTKB 5C8NA 1KWPA 3BYVA 4WBOA 1PXOA 2XM9A 2GFCA 5HE1A 2C3JA 4HVSA 3OBGA 1NVRA 2IZTA 3DBCA 4DGOA 3MY5A 2UZBA 2IVTA 2W1FA 3HECA 4QPMA 2R9SA 2UW3A 5J1WA 4OTDA 1OKYA 4O7SA 2ITXA 5H3QA 5CT7A 3ENHA 4IJPA 1NVQA 4TZRA 2OGVA 3ORXA 3ULZA 5J7HA 4X2GA 3FMLA 1R39A 4PPBA 5ANGA 5AP4A 4DEGA 4IM3A 1BYGA 1J7IA 3R63A 1ZAOA 4D1SA 5KX8A 5A4LA 4BC6A 4MWHA 5D12A 2RKUA 3SXSA 5I9VA 5A46A 4HPUE 4V04A 3QZGA 3K54A 1B39A 3Q9WA 5D7VA 2W1EA 5IPJA 4TNBA 4RC2A 2W4KA 2CPKE 5F94A 5CU2A 3WF8A 4FTQA 2PVFA 3LFCA 2NP8A 3LHJA 4JJRA 2XJ1A 3NX8A 1PF8A 5CNNA 5AV2A 4EOJA 2W7XA 2F2UA 2P3GX 4U43A 4S32A 4NEUA 4N6ZA 3U6JA 3GU7A 5T6KA 3AGLA 3VBVA 5LMKA 2A4LA 3BU5A 4CFWA 5EYKA 5KBRA 5EQYA 2BCJA 1UU7A 4S34A 5AP3A 4IAFA 4YZNA 3WF5A 4HVDA 2HY0A 1SVHA 4U3ZA 2WTWA 3BYOA 1WBOA 3OXIA 2AC5A 3PTGA 3QRTA 4M13A 4NJDA 4V01A 3V5JA 5M4FA 2IZSA 3WIKA 3FEGA 2WTKC 1J3HA 2R64A 1OMWA 5J9LA 5FBOA 1YVJA 2V62A 1QMZA 4FV9A 2VWZA 3UZPA 4BDHA 2VO6A 3VBWA 5IA1A 5J5SA 3EH9A 3FYJX 1OGUA 5CSXA 1XHAA 3Q2JA 1JSVA 4DF3A 4AAAA 4HOKA 4PPAA 2J90A 1RW8A 3C51A 3ZUTA 4BCFA 2R3GA 1J91A 2P2HA 3C9WA 4I6FA 3AC4A 1DAYA 3V5PA 2PZRA 4KIQA 4PDPA 4FIEA 3DGKA 3ZRLA 2IJMA 4U44A 4KKEA 1BL6A 1FVTA 5DIAA 5AUTA 3EMGA 3QRJA 4A4LA 2B9IA 4O0VA 4YJQA 4RA4A 4CV9A 2E9UA 4NTSA 3LXPA 2WU6A 4L44A 5CU4A 1YXTA 3RPRA 3E3BX 4GIIA 4PV0A 3UOJA 1F0QA 4FIHA 4OR5A 1PKDA 5AADA 1Q8YA 2YERA 4GJ3A 3UO4A 1LUFA 2WFYA 2P4IA 3BE9A 1M7QA 4FVQA 4EHGA 2VWBA 2XB7A 3MH1A 4Y5HA 3VBYA 2R0UA 3KREA 4DCEA 4O7YA 3PJ3A 4USFA 5AUWA 1P4FA 4DBNA 4K11A 3HYHA 3W2CA 4FKPA 4KIOA 3R8UA 2ITNA 4ALVA 2VD5A 4XV1A 3NYXA 4FIJA 5IZFA 4I6QA 2H6DA 5I3RA 4J1RA 3MESA 3QTRA 3DXPA 1OI9A 5L6WL 2QOFA 2IPXA 1PJKA 4A4XA 1Q8UA 3R8PA 3U9NA 3VBTA 3S0OA 2O64A 4NFNA 3WIGA 1YI6A 2R3JA 3EYHA 2OIDA 1O6LA 4OTGA 5LMKC 4OAUC 3IOPA 3KXGA 4O84A 4AFJA 4F65A 2G2IA 1YOMA 3PSBA 4R7HA 3V6SA 4GCJA 1GJOA 2XF0A 2C6EA 3QTIA 5HD7A 4F7JA 5GZ8A 1PMVA 1YWNA 3CGFA 2XKDA 3KK8A 4RSSA 3KRXA 4I20A 5EYMA 4AS0A 4EK4A 2P55A 4BR3A 2SRCA 1J1CA 4XOYA 5IA4A 5E92A 4IX4A 4KBKA 5HLPA 5DMZA 3BPRA 5CWZA 2DYLA 4XX9A 5HX8A 3VQHA 3ODYX 5CEPA 3PIYA 3THBA 3JXWA 3GOKA 3RKBA 2BROA 2PUPA 4G3GA 3GP0A 4FL1A 4MKCA 2BZHB 2YEXA 3CKWA 4IZ7A 4PMSA 2XKFA 4XYFA 4YZBA 4E3CA 1FMOE 3MIYA 4IAAA 4C4EA 3LFFA 5L8KA 1YDTE 2FSLX 3C0GA 3QD0A 3S4QA 3VUMA 3C1XA 3HVCA 2W4JA 3O7LD 1A9UA 4N4SA 3MTFA 2EUFB 3R9DA 4PTEA 4HYUA 3EB0A 2PMIA 3PLSA 4JI9A 4GT4A 4M69B 4QP2A 5AR8A 4XEYA 4AP7A 5IQAA 3ZC6A 3NUUA 2GQSA 1JKLA 3FDNA 5DH3A 2OJIA 5M4CA 4BICA 4TTHB 4NJ3A 3SRVB 5L8LA 4O91A 4I6BA 1YHSA 4F1TA 3R1NA 3VS7A 1VJYA 3QHWA 3N4TA 4FICA 1ZMWA 2A0CX 3F61A 3KEXA 3QL8A 3DBFA 5J95A 3UG1A 4IE9A 3RM6A 4B4LA 5JZNA 4BWPA 3A7IA 3QTUA 3R8ZA 1WVYA 3OW3A 4DT8A 3MV5A 4C61A 2XNEA 2H34A 3RK9A 1FBNA 3OT3A 1G3NA 4YLLA 1XH9A 4C57A 4UMUA 2CGVA 4EOSA 4RWJA 3ZLXA 5HORA 2NRUA 4NFMA 2UZUE 3EQPA 4B8LA 5GIPE 2I6LA 1T46A 2IN6A 4ZLYA 2VGOA 2F7EE 4U8ZA 3PRIA 3QQUA 3TDVA 1TQPA 3P79A 1WAKA 2XYNA 2BZKB 3VJNA 3I7BA 2EB2A 3RI1A 4RVLA 5HIEA 4G3FA 4HNFA 4F0IA 3N4UA 2OIQA 4ZTQA 3KVXA 4RIXB 3AC8A 2GDOA 3EZVA 5HG5A 4ZY5A 4ZSGA 3GCUA 4UXQA 1R1WA 3KXHA 3R8LA 4IB5A 3DA6A 1PXIA 1MP8A 4IFGA 4M66A 4I4FA 4R77A 4FV6A 3VNTA 2XKEA 3VWAA 5I9WA 4E5WA 2F4JA 3S95A 3BEGA 5CEKA 2BTRA 3ACJA 4A7CA 5DYJA 2ZAZA 2ZYBA 2GNIA 2XBJA 5KMKA 4KAOA 2YITA 2JIVA 3LFSA 5E1EA 4UWYA 4MQ1A 3PSDA 4C35A 1MQ4A 2IG7A 4YNEA 3WE8A 5FM3A 3VUHA 3JYAA 5KUPA 4U40A 3EJ1A 1JOWB 1UU8A 4RLLA 2UZLA 3NUPA 4FMQA 2XNGA 4UYNA 3TKHA 4IX5A 4D55A 2JKMA 4LL5A 2YWVA 1LEWA 4CQGA 3ANQA 1U5QA 4RG0A 1L8TA 2CNUA 4XJ0A 4V0GA 2A2AA 5H8EA 3MVLA 3LW0A 3UE4A 3VW6A 3Q53A 5CANA 5HO8A 4FKGA 1PRYA 3ORKA 4E26A 2WPAA 1M2RA 2X8EA 4G6LA 5H8BA 4DC2A 4YUQA 4DN5A 2C5VA 2I0EA 2JEDA 5BPYA 3KKVA 3RGFA 4U80A 2BZIB 3W2OA 2BIYA 4FZDB 4R5SA 3EOCA 4V0GB 4I3ZA 3ZO2A 4RA5A 2C5YA 3EFJA 4PWNA 4TWPA 2R3KA 4CG9A 3IPHA 2QOHA 2RIOA 3DQXA 4BCHA 2J4ZA 4FNWA 4BCKA 4FA2A 1BI7A 3DKCA 3PIZA 4FTCA 3UOLA 4CSVA 5M09A 1JBPE 1ZZ2A 5AR7A 4A07A 5CEQA 3C4CA 3BYSA 3MS9A 3QUDA 5EI6A 1QL6A 3MFSA 3RK5A 4FV2A 3OWJA 4FGBA 4BF2A 3TIYA 2B1PA 4FIFA 2UZWE 4LI5A 2BALA 5GJFA 5C4LA 1A06A 5F4NA 5J8IA 3NWWA 1PXLA 2OK1A 3AC3A 5K5XA 3QD2B 4MXAA 2YDIA 3O23A 5M08A 3QFVA 4YBKA 4JQEA 1X8BA 4YSJA 1PMUA 2C6DA 5B0XA 3H30A 5CU3A 3BLQA 4TKSA 5IQFA 5BQ0A 3HL7A 4G31A 3DFAA 1W8CA 4BYIA 5FGKA 4KWPA 5AUYA 2X39A 4AQCA 1B38A 1KV1A 5K0XA 2VAGA 3PYYA 3R0TA 3PXRA 3TN8A 2W96B 3AG9A 4IQ6A 3C0HA 4O0SA 1URCA 4Q2AA 3FI2A 4LM5A 5KMNA 2YCQA 3LFBA 3AT3A 1ZYDA 1LPUA 2J5FA 4NW6A 4PY1A 3EL8A 2EVAA 3IG7A 4QD6A 3TDWA 1KE9A 4C3FA 3F3ZA 4LGGA 4LGDA 4PMMA 5CSVA 4BDKA 3KA0A 3OUNB 1OB3A 3KFAA 4WNOA 4BTKA 4CYJA 2JIUA 4IW0A 4IFCA 2VNWA 3UNJA 3PZHA 3VQUA 2P33A 3CJFA 2VWXA 2JKKA 3QYZA 4FKJA 2A1AB 4W4XA 4HYIA 5BMMA 4O0YA 3SW7A 1V0BA 3FI3A 3SX9A 2YIWA 3TV7A 2C0TA 2O2UA 4WT6A 5CZIA 4OLIA 4FZFB 3T8OA 4EONA 1JQHA 3NUAA 2W9ZB 3OXTA 4LV5A 4UMPA 4FEXA 2ACXA 3QZHA 2JDVA 1PW2A 4JBPA 4U79A 4WHZA 3TIZA 3TNIA 3U9CA 1O6KA 1M14A 3ZEWA 4QMQA 1PY5A 3W8LA 4I4EA 1YHWA 4ZAUA 3VAPA 3NUNA 4JIAA 2HW7A 4PMTA 4F6UA 3MA6A 4J7BA 2FGIA 5HESA 4BBEA 3E7OA 4L46A 1Q3WA 4USEA 3B2TA 3IW7A 3GFWA 3RAWA 2XVDA 5JKGA 2CN8A 4FTIA 5CALA 3FV8A 3LKMA 3GCQA 4NM7A 2ITZA 3MA3A 2OFVA 4LG4A 3Q9ZA 3KF7A 2R5TA 3FZ1A 4B9DA 5L2SA 3Q2MA 3QYWA 5CQWA 4JBOA 1Q8TA 4LOOA 2CGUA 2YJRA 2VTHA 3NNWA 4HNIA 4ASEA 4E6CA 4FNXA 5IH4A 3UQFA 2OKRA 1WMKA 3F7ZA 4GL9A 3WZJA 4H3QA 3AD5A 4O7RA 2DS1A 3AGMA 2OSCA 3CLYA 3EQFA 2V22A 5A4TA 3KN6A 3A8XA 3ZXTA 2XYUA 2VUWA 3R1QA 1K9AA 5D1JA 2EB3A 4G2FA 1H4LA 5K5NA 4EWQA 2P2IA 1S9IA 3BE2A 2BMCA 2JDTA 2F57A 3HMOA 4I41A 4C3RA 2PVLA 4OT6A 4JT3A 4UWCA 3ZUUA 4RIWB 4D0WA 3RPOA 4CFNA 3K2LA 4MD9E 2F7ZE 4H39A 4J8NA 4ZP5A 3I0QA 2QODA 5A9UA 3PXKA 4O81A 5M57A 3VUTA 1Y57A 3PVBA 3VS0A 5M06A 1R78A 2HW6A 2KULA 4YTCA 1T45A 2VX1A 3MGYA 3RAHA 4EK8A 3BQRA 3C5IA 3UZRA 4PPCA 2X2KA 3MBLA 4AGUA 3NRMA 3QALE 2XK3A 3ORMA 2J7TA 2QNJA 3OFMA 3OHTA 3Q4CA 4FBXA 2W17A 2QOKA 4FVRA 4HYSA 5CY3A 2WXVA 3KMUA 4AGWA 3D9VA 4O96A 2W06A 3RM7A 5HGIA 4HGSA 2IVSA 5I9XA 4L3JA 4A06A 4GKIA 1PXJA 2KTYA 4A9UA 2BAQA 3ENMA 3QQJA 4BL1A 2AYPA 4C4FA 3FZSA 3U4UA 2GU8A 2C6KA 3CEKA 1XBBA 1QPCA 2OO8X 4UY9A 3RP9A 5AR2A 4F99A 3UNKA 5CTPA 3OEFX 1LP4A 1GNGA 2DUVA 3EFWA 1OIRA 1M2PA 2XK8A 3LFNA 4GK4A 4JAJA 4L53A 1HOWA 2VU3A 5HQ0A 2GQGA 3QQFA 2A19B 4L3LA 4ZOGA 4KD1A 2VWIA 4NM3A 4CCBA 4D4VA 4KKHA 4ZEGA 2QOBA 2OIBA 4XH6A 3BRBA 5LWMA 3G15A 4XP0A 3MSSA 3O7LB 3NZ0A 4RIYA 5AAEA 5CLPA 1J1BA 3Q4UA 4EORA 5IISA 2R3HA 4PL4A 2REIA 2J0JA 5C8MA 3PFQA 4FKSA 1H25A 2CKEA 5JRQA 3R28A 2ZM1A 3BHYA 3UP7A 2Y9QA 3P4KA 3TZMA 3LFDA 3FC1X 4KSQA 3QTWA 5EDRA 5FBNC 2OZAB 5FTOA 4RIYB 4IAIA 2BVAA 4UZDA 4JR7A 2XK9A 1OVEA 3F2RA 1UWHA 3BHHA 2O0UA 3FHIA 4AW1A 3SDJA 4EH6A 5HE3A 3COIA 3KC3A 4M84A 4BI0A 3QD3A 4QQJA 5EQEA 3LVPA 2YN8A 3PUPA 4X6RA 4XV9A 1H24A 2C6OA 3GCPA 3OF0A 2WQNA 3BHUA 3C7QA 4RVMA 5HCZA 3FLYA 3P78A 2VTPA 1IAHA 2WOUA 3RZFA 1OITA 2C6TA 2UZDA 3Q6WA 4KRDA 3R6XA 2YLEA 3E92A 2C1BA 5DT3A 4JIKA 3VULA 3S00A 4WD5A 2R2PA 3S1HA 4DG0E 4LMNA 4YHTA 3JUHA 2J0IA 2VTJA 2ZB0A 4RBLA 4RX9A 4UALA 4EYJA 3NEWA 3WYXA 3MYGA 2WB8A 4M0ZA 3OY3A 3TWJA 4CG8A 4YZCA 3RCDA 1B6CB 1P4OA 4NKSA 4DH7A 2X9FA 3D2IA 3ZLYA 3EL7A 4ZSLA 2FO0A 1TKIA 1RE8A 3HV3A 2WEIA 4QYYA 1JKTA 4QMYA 4EK5A 5DVRA 5CSWA 3LQ8A 3A62A 4QYEA 3VRYA 2PVHA 2FSTX 3EKKA 4DEEA 3OD6X 3PXZA 3OWKA 4ZS0A 4ALUA 5LQFA 1GOLA 5JFVA 3FL5A 2GHMA 3MB7A 4R5YA 3VRZA 3FQHA 3FZTA 4FT3A 4RFMA 5JT2A 5BVOA 4I5HA 5DG5A 4IVCA 3W16A 4M8TA 1OZ1A 1WCCA 3T9TA 4BCPA 4DFZE 1RDQE 2JITA 2O3PA 1ZY4A 3EFKA 4GEOA 4U41A 3BYMA 3QU0A 4EKKA 4O27B 2V7AA 4N0SA 4XP2A 5E8SA 3NYVA 5D11A 5JRSA 2Y4PA 3K5UA 3ZSHA 4EBVA 4GKHA 3PXYA 3I79A 3JS2A 4H3BA 4U97A 5CAQA 4X2KA 5DGZA 4LRKA 3RK7A 5HD4A 2CGXA 4P5ZA 1YXUA 4Y83A 2VZ6A 4CFMA 1R0EA 4QOXA 4PDOA 4R6VA 1SMHA 2GNLA 5A3XA 3QWJA 3UPXA 4AGCA 5E90A 2YFXA 5HG7A 1Y6BA 4JRNA 2CCIA 2QD9A 1UA2A 4IVAA 4FIIA 3JR1A 4FSQA 3QC9A 2I0YA 4ANSA 3H10A 1MRYA 1OL5A 3DT1A 3GU4A 4KBAA 3QUEA 3WBLA 2JKOA 5L2WA 5CZHA 2FVDA 4I94A 4IWPA 4BCNA 5C1QB 5DRDA 4CFXA 1WBPA 3C13A 4C2VA 2F2CB 4CFFA 2V7OA 2OH0E 4KIPA 3VS3A 5KMJA 4TWCA 4A9SA 3Q6UA 3VW8A 4PNKA 3SVVA 3PA5A 1H0WA 3MY1A 4BRXA 2H9VA 4CKJA 5E4HA 1HCKA 2FYSA 4BIBA 4GH2A 5TE0A 3ZFMA 5M53A 3FZPA 5AP7A 2OG8A 2ZVAA 3KY2A 2UZEA 4KNBA 4YJVA 4C59A 5ANJA 5JZJA 3FZOA 3H9FA 5E8TA 4FEVA 4EHEA 3QZFA 4ZY6A 4CRSA 4ZJVA 1W98A 4FV4A 4K33A 3O8TA 4KBCA 2ZMDA 4G6OA 3GFEA 1DS5A 4YC8A 2YM6A 5KMLA 5C03A 3R1SA 4CD0A 3ZMMA 2VWUA 2FSOX 2YLFA 5HVJA 5K4IA 1OPKA 3QA8A 5J87A 1MRVA 2WQBA 1SNUA 3BIZA 2RFEA 4NIFA 5CENA 4D2PA 2RFNA 4BBFA 3LM5A 4PF4A 4IADA 3CJGA 4R3CA 4BDEA 3FBVA 3AMAA 4NH1A 3VUIA 4Q9ZA 3EQIA 4QMTA 4EOMA 3ORTA 3VN9A 4F08A 3TACA 4L52A 3W2SA 3U55A 2RG6A 3UP2A 2OBJA 2B4SB 4E4LA 4BCQA 2BFYA 3TXOA 3RINA 5IQDA 4CXAA 2H8HA 4AT4A 4CEGA 2QO9A 4AOIA 3AXWA 1ZOGA 5J9YA 4NIFB 4FSTA 5HG9A 4I0RA 3QXOA 3ZOSA 4GIHA 4QP7A 5C4KA 2PYWA 3MVHA 2WIPA 1WZYA 5DR9A 3D5WA 2XNBA 3C4FA 3KCFA 3O96A 2X6EA 1OL2A 4HVGA 3PP1A 2R3IA 4EI4A 5IUIA 2BAJA 3MWUA 2PZYA 3WZDA 3CCNA 2QHMA 3MJ1A 5HHWA 3P7AA 4FEUA 2X9EA 4IZ5A 4TNDA 3HV6A 4G34A 3E88A 3KL8A 3V8WA 4CLIA 3HNGA 4NKAA 3AT4A 3SW4A 1CSNA 3B8QA 5HE0A 4ANBA 3NUSA 5KE0A 5AUUA 1OL6A 1EH4A 2XRUA 2HENA 4M3QA 5GZAA 3LCSA 4M0YA 2PPQA 3BV3A 3R8VA 4I5CA 2YIRA 3E8DA 3GGFA 2X8DA 3P5KA 4OGRA 3LLTA 5ETAA 4BGHA 2ZJWA 4MNFA 2WQMA 1ZYSA 4IXPA 1JVPP 4K2RA 5CAVA 1Z57A 3PIXA 2QG7A 4EZ3A 3KXZA 2PK9A 2I40A 2UW0A 3CD3A 3PA3A 4FX3A 4ZJJA 5EKOA 4CGAA 2YHVA 5LOHA 3DAKA 4FTUA 2GTNA 2XJ0A 3F3VA 3A7JA 3EIDA 4RFYA 4QMUA 5EHYA 4L3PA 2VTTA 2G9XA 2BR1A 2WMBA 4QP3A 3A4OX 4WSYA 3UOKA 4W8EA 3E8NA 4OT5A 4FTAA 2EXCX 2ZMCA 4PUZA 4XG2A 3V8SA 3A7FA 3BBWA 4QPSA 2B0QA 3W1FA 1JKSA 4LFIA 1OUKA 1JAMA 2BUJA 3AC2A 4IX6A 3EZRA 4GVJA 5EOBA 2BPMA 1E9HA 4C8BA 3E62A 4CVAA 2OH4A 4MVFA 1H1SA 3ZLWA 5CVGA 4FK3A 1JSTA 2VTAA 3QCQA 1H1WA 2ITYA 2VX3A 5AAFA 3COHA 4MXOA 3ELJA 3FMHA 3UC3A 5I5ZA 5CF6A 1PXPA 3WZEA 1PYXA 4MD7E 2R3LA 3MFUA 4D5HA 3SOCA 2JAMA 2XP2A 3Q04A 4FKLA 4J96A 4Y46A 3SGCA 2BTSA 2XH5A 5IMXA 3PZEA 5JQ8A 5AUVA 3ZEPA 1SNXA 2PVRA 4Z9LA 1UU9A 5CVFA
chains in the Genus database with same CATH superfamily
3QUPA 5H2UA 3M1SA 4XBUA 4DFLA 4ZMFA 2YJSA 3PG3A 3B2WA 3DPKA 4FTLA 3D14A 2E9VA 4MK0A 1L3RE 4BVUA 4RX7A 3BZ3A 3HRCA 4NK9A 2UW5A 5KNJA 1W2DA 4GU6A 4WNKA 2F9GA 3ZCLA 4XG6A 5IQHA 2C47A 3ZHPC 1G8JA 3IW5A 1KV2A 4F63A 5BMSA 3E3PA 4EQMA 3REPA 2YISA 2CSNA 3ZH8A 3Q32A 4F6WA 2YAKA 2J9MA 5HVKA 1YXXA 3HDMA 3UBDA 4F0GA 2C6LA 5BVEA 4CV8A 4GT5A 3HAMA 4C33A 3DB6A 3TV4A 2FH9A 5CS6A 3LE6A 5HU9A 4GFGA 4I92A 3BU3A 4MX9A 4NM5A 5HTIA 5BVWA 2B55A 3CP9A 4F7NA 3L1SA 3BGPA 2OJGA 2B9JA 1JSUA 4L68A 4FV8A 4QMOA 4DA5A 1BL7A 3WZKA 5AJQA 4QTCA 2C4GA 1G8AA 4JS8A 4LRJA 4XS2A 2YZAA 4NZWB 3CIKA 3KXMA 3PJ8A 1Q41A 4XG8A 5HIDA 4IX3A 1FVVA 3OEZA 3CTQA 3EN7A 5AMNA 5AP6A 4KB8A 5KHWA 5L6PA 4BHNA 4BDJA 3LIJA 5GJGA 3RMFA 2Q0NA 1RQQA 4AFEA 1M52A 1UNLA 4FTRA 3LJ2A 4FEQA 4IZYA 4G1WA 4UB7A 4BHZA 2ZM4A 4RJ5A 4H58A 4C0TA 4RQKA 3VIDA 5DR2A 4R7BA 3I60A 3SLSA 1CDKA 2UZTA 3K3IA 4YSMA 4EWHA 2X8IA 4XHKB 4O86A 5KZIA 3TKIA 3TZ8A 1H28A 5IQEA 2OXYA 4QYGA 5I9YA 3DJ5A 5D9HA 3EN5A 4OTQA 3MPMA 4MEDA 5CASA 2G2HA 2YIQA 2PMLX 2ZV7A 4OBOA 4D2SA 2IZUA 1W0XC 4O4EA 4M69A 3ZM9A 3V04A 4XOZA 1H0VA 3GC8A 5IF1A 4FOBA 1YRPA 3G6GA 4AW5A 5JK3A 3SRVA 3F5XA 3FY2A 3G9NA 3BHTA 3UDZA 5DEYA 4OTIA 3UGCA 2FUMA 4IC8A 5JFWA 3F66A 1OIYA 3GT8A 3NUXA 2PU8A 4XG9A 5M55A 5A6NA 4JDKA 3ROCA 2NRYA 2I0VA 4Z7HA 4LDTA 3O51A 2VN9A 2J50A 3MVMA 4BTMA 3A2CA 2VX0A 4NSTA 5CNOA 3D0EA 4L43A 4U5JA 5HKMA 4YTIA 3U87A 4ZLZA 5EKNA 3W8QA 3W0QA 4PX6A 4A9TA 4AN2A 3LXKA 5DBXA 4EHZA 3ZBFA 3Q9YA 3VUKA 1UKHA 2IVUA 1OBDA 4ZS4A 4ZSEA 1G5SA 2CKQA 4ANQA 3G51A 4TT7A 2C5OA 2Y0AA 1OL1A 4G5JA 4QP9A 2W05A 3QTQA 5K0KA 4ACMA 4EYMA 5LVOA 3LOKA 2P0CA 3LXNA 1Q8WA 4EOQA 4XG4A 3U6HA 4WO5A 4X2NA 4RIXA 3IK3A 4FZAB 3E63A 3O71A 3ORPA 3U51A 5BNJA 4YU2A 2WTIA 3ALNA 2OZOA 2JKQA 5L6OA 4KRCA 2A98A 2QVSE 2GS2A 2WTDA 1ZOEA 3R22A 4FZ6A 2CNQA 3QF9A 4YTHA 4IB0A 3SC1A 2JDOA 4JAIA 3E64A 3KRRA 4OBQA 4O38A 4GUBA 1PMEA 5DHJA 3UQCA 1CM8A 3W32A 2X6DA 3U54A 3BWFA 4MBIA 4JG7A 4WKQA 2BKKA 4FKWA 3RHKA 4QPAA 3KF4A 2HXQA 4TYHA 5E8ZA 3FI8A 1BLXA 4JQ8A 4KSPA 3IDBA 4QYFA 3JVRA 4TXCA 5AX3A 3TTIA 5AV4A 3FYKX 2YIYA 1P5EA 3VS1A 4XNEA 4O7WA 4R78A 3WF9A 4GU9A 3R30A 4FKRA 4PTCA 5M4IA 5DI1A 2C6MA 3QKLA 1F5QA 3TCPA 4BDFA 3ZFXA 4E1ZA 3F5UA 4ZIMA 2XNOA 3PPJA 3F5GA 3LFQA 3OG7A 3QXPA 4FKQA 1KSWA 4YZDA 2ZDTA 4TYHB 3WF7A 1KE8A 1U4DA 3D5UA 4I22A 4W9WA 1XJDA 5D41A 3LCTA 3CE3A 4FT5A 5LVPA 3E93A 4V05A 4RMZA 3UDBA 4BB4A 4BIEA 3QKMA 4C02A 5L4QA 4IC7A 1GAGA 3II5A 2C1AA 2IO6A 3MI9A 1FQ1B 4C3PA 3ANRA 3FKNA 4FSZA 2GCDA 2QI8A 4TYEA 3DJ6A 4FF8A 3VS6A 2XIYA 5CF5A 3NAXA 4PL3A 4RJ8A 4OUCA 3M11A 3POZA 2YM7A 4BGQA 5ANEA 3GI3A 4AOJA 1YHVA 3KRJA 3RVGA 5K9IA 2Z8CA 4QQTA 1ZYLA 2BFXA 2ITWA 4C2WA 4L00A 4PMPA 4GG5A 5ICPA 3POOA 3FAAA 3TNPC 1XH8A 4AZTA 4E6QA 5LVMA 2OICA 3NSZA 4CZUA 3TNQB 2YCRA 4K8AA 2RFDA 2CCHA 3NNUA 5HCXA 2WMTA 3RHXA 2PULA 3FMMA 5BV3A 4AXCA 3O0GA 3C4XA 1CKPA 5ANIA 4YP8A 1GIIA 5AR3A 3R7OA 2O5KA 4IEBA 3F2NA 3HDNA 4UZHA 5EDQA 4DH8A 4ANNA 2XK6A 3OW4A 4BDIA 2RG5A 3D2KA 2XRWA 4C34A 2WTJA 3HUCA 3ZU7A 5FP5A 3R8MA 4AE6A 3TUBA 4KIKB 3CQEA 4ANMA 2AUHA 3DS6A 5DN3A 5HVYA 1JPAA 4IANA 1ZZLA 3B8RA 2ITTA 1H1RA 3MN3A 4UMRA 4U7ZA 4YHFA 5EM8A 4FUYA 4CRLA 4RZWA 5G1XA 5LARA 3RWPA 5IQGA 2WO6A 3GENA 4I93A 4IM2A 4Z7GA 4DEBA 5EI8A 2X7OA 4BKZA 2OXXA 4RIOA 2C3KA 4UX9A 3QLFA 3LJ0A 4E4NA 5LCJA 4DFUA 4S30A 4XV3A 5AV1A 3CQUA 4K9YA 5HEZA 2QLUA 1WBNA 4E6DA 2Z7LA 4X6QC 4G3DA 5BVNA 2IF8A 2AQXA 3EQCA 4J99A 4ZTMA 3ZUVA 4D4RA 4HJOA 4WBBB 4TL0A 3U4WA 4NTTA 1KE7A 3ML1A 5HBEA 2PWLA 4JDHA 4EH2A 4FTTA 3IGGA 2XIXA 5B2KA 5E8VA 2HY81 3UO6A 4WUNA 3WI6A 1QPJA 3P9JA 5AA9A 2GNGA 3BKBA 5HNIX 2VTLA 4YMJA 2Y7JA 2C68A 5HOAA 1VLRA 2W0JA 3PP0A 4QQ5A 2YWPA 3HUBA 4MNEA 4O4BB 3D7TA 5FXSA 4CFUA 1GZ8A 2ONLC 4M68A 4F6SA 4U81A 3BU6A 3KU2A 4QMVA 1M17A 1UWJA 4TPTA 1OKVA 4FV7A 4CT1A 2DQ7X 3TUCA 3C4EA 3OWLA 1FMKA 3NS9A 4MCVA 2IEWA 4EOIA 4D2RA 1E1XA 4GSBA 1NXKA 3NUYA 3OMVA 2IW9A 4H05A 4MNEB 3D7TB 3SXRA 2X4FA 1STCE 2BKZA 3DQWA 3TV6A 5IKWA 2HZNA 4RIWA 4JRVA 5TO8A 2GQRA 2NYAA 3WE4A 3COKA 2WQEA 1MRUA 4ZK5A 4F64A 1H1QA 3R7EA 4ID7A 2HWPA 1UV5A 5HTCA 2ZOQA 4CKIA 4AZEA 4D5KA 2CKPA 1JKKA 2G1TA 2RFSA 2W99B 3ACKA 2BILB 4DFBA 5B2MA 4EUTA 4QNAA 3V5LA 2EU9A 2E9PA 3DKFA 3QCYA 4P2KA 4S31A 3FLQA 4JOAA 3CSVA 3QQHA 5LCKA 4DEAA 2WGJA 2VNYA 3MFRA 1UNGA 2YIXA 4Z3VA 4YLJA 3BEAA 2IW8A 3L8XA 2BRNA 5EW3A 1XBCA 4ZTHA 5KHXA 3PDTA 1YOJA 2QKWB 3S2PA 3QWKA 4EEVA 3I7CA 1Y6AA 2B52A 3IONA 1YI4A 3I5ZA 3O8UA 3QTZA 3R00A 2XKCA 3FSFA 1E1VA 2UW8A 3G5DA 4BCJA 3R73A 3OWPA 2YZLA 5M07A 4NUSA 2ETRA 4DT9A 3CC6A 5LWNA 4BZDA 2G2FA 3OCBA 3P5JC 4RJ4A 5CSHA 4O2ZA 3DKGA 4ZZOA 1ZRZA 4TWOA 4D1ZA 3K5VA 4B0GA 2GS6A 4J98A 4EC8A 4LOQA 3ZYAA 1OUYA 5EW8A 5BYLA 1PXNA 1U54B 3ET7A 4BCIA 3SG8A 3GU5A 1UKIA 3RJCA 5CXZA 4F9YA 2HXLA 2JDRA 3NPCA 3VS4A 3HZTA 2YACA 3FLZA 5EYCA 2PMNX 3RZBA 3NYOA 5IA3A 1NT2A 2I7QA 4MF0A 3NYNA 5EM6A 4UN0C 4AW2A 4APCA 5CI7A 4QP8A 4ZTSA 1ZMUA 3GQIA 3ZM4A 5E8YA 3C4WA 4E73A 2W1ZA 2WQOA 4R8QA 4YTFA 3VUDA 3TZ9A 4O7NA 4DTKA 1CTPE 5FWKK 4E4MA 2OZAA 1R3CA 3FE3A 4DGLC 5TF9A 2PZPA 2YM8A 3NW5A 4BZNA 4WNMA 3VF8A 2OW3A 3C5UA 3F82A 1ZYCA 3ETAA 3QCXA 4B99A 4DTAA 4RWKA 3DK6A 2QU6A 5DPVA 2QO2A 3SA0A 4CCUA 4IMYA 5A14A 5AFVA 2QHNA 5JGAA 3UODA 4YGAA 4ASXA 5LMBA 1S9JA 1YWRA 4EOOA 4G9CA 4FKVA 4Q5EA 4N6YA 3A99A 1V0PA 1Q97A 1G8SA 4KUJA 4OBPA 4O0RA 4XV2A 3A4PA 3KN5A 1VYZA 3CTJA 2VO0A 2HYYA 4EZ7A 2QLQA 4FTMA 3OP5A 1MQBA 4BCOA 4FE2A 1YWVA 4X7QA 2EWAA 4DEDA 3KCKA 2R3PA 4J53A 4UMTA 5HI2A 4F7LA 3P08A 5F9EA 3R21A 4O0XA 2B7AA 4EK6A 1YQJA 3TTJA 2GNFA 3Q60A 3MJ2A 3DBEA 3HP2A 3FKLA 5DWRA 5JH6A 4FSMA 3ALOA 5ANKA 3IW6A 2XBAA 4AE9A 4EH5A 4O7VA 1XR1A 5LMAA 4RJ6A 1IEPA 1VYWA 3IKAA 3QTSA 4XP3A 3Q5IA 5I3OA 2WD1A 4QTEA 3NW7A 2Z7QA 4ONAA 4PDYA 4GG7A 5E9EA 3U6IA 1SZMA 5IA0A 4FSWA 5M44A 4D4SA 5CAPA 2BRHA 4U9AA 5IEYA 5JFSA 1XQZA 4M15A 5L8JA 3QA0A 3JVSA 1Q5KA 2IVVA 5FRIA 4CT2A 1LEZA 4O7ZA 5JGDA 2UZNA 4RJ3A 4YO4A 2YCFA 3H0ZA 4IHPA 1WFCA 4JR3A 3NNXA 4DFYA 3QD4A 4FL3A 4EH8A 4ZTLA 5AA8A 1BI8A 3EQGA 3OTVA 4Z16A 4BZOA 3DLSA 5C01A 3RCJA 1Y8GA 4QMNA 4WUAA 1IA9A 3R1YA 5IEXA 5T3QA 4AZVA 2X0GA 4YPSA 2NO3A 3R7IA 2IWIA 1M7NA 4PP7A 2JBPA 4C4JA 3HV7A 4FL2A 4I5PA 2E9NA 3T3UA 4AGDA 4D9TA 3ZDUA 2QOOA 2W5AA 4EC9A 2JAVA 4YO6A 4YJNA 5EM7A 5FEDA 2UW9A 4I0TA 2PUIA 4HGEA 4J97A 4ENXA 2CJMA 5I9UA 4BBMA 3COMA 5E8WA 5A4QA 2X2MA 4I1ZA 3KRWA 4MTAA 5E8XA 1SYKA 5G6VA 2QURA 1ATPE 5CXHA 1ZARA 5C9CA 4DGMA 1REKA 3IECA 4JX7A 3HV5A 2ZFYA 3LCOA 2JFMA 3L9NA 4OAVB 5HLWA 4ZY4A 4O0TA 4AW0A 4IM0A 1VZOA 5CVHA 3VJOA 5C26A 3W33A 4PL5A 5JMSA 4PTGA 1IR3A 3EWHA 5CEOA 4AT3A 4IWQA 5JFXA 5GHVA 1FOTA 2BIKB 2O8YA 4L9IA 3EQDA 4LRMA 4UYAA 4JDIA 4BKJA 5I0BA 4O82A 4MWIA 4YHJA 5HO7A 3A7HA 3PRFA 4NCTA 3MY0A 3RTPA 4D28A 3DU8A 2B54A 3FXXA 3PY0A 3VONA 4LL0A 3F88A 3LQ5A 4M7IA 2Y6OA 5FD2A 1FGIA 1KE6A 2CLXA 2WMWA 3D15A 3U8WA 4C4HA 4R1YA 2JGZA 2YDJA 4FSRA 1Q99A 4QP6A 3GC0A 4E20A 4GVAA 2J6MA 4NM0A 3HGKA 5I4NA 4I21A 4FVPA 1H08A 4M97A 3RPSA 3R01A 3RALA 2LGCA 5HNGA 4BN1A 4FK6A 4ORKA 4HZRA 1VEBA 4O1OA 5E1SA 5E7RA 5IMEA 4RLKA 5DT0A 3GC7A 3AOXA 1Q4LA 4IWDA 4J95A 5CQUA 5DEWA 4QMWA 3UG2A 4BDDA 5AWMA 4HPTE 3QRIA 1R0PA 3CXWA 4MXYA 5K4JA 4BY9E 3DFCB 5GJDA 2CLQA 4TYIA 4YJOA 4YC3A 5DLSA 4AAYA 2YCSA 3KB7A 4FR4A 4F09A 3L8SA 3ZRKA 5KCVA 5IDNA 2CN5A 3UTOA 4I23A 3ZO3A 4QTDA 4N57A 3MTLA 4FG9A 3OZ6A 3LFEA 3UVRA 5AR4A 5BYZA 3PPKA 1CMKE 3GUBA 5ETCA 4M67A 2ETMA 1BMKA 5I9ZA 4AXFA 4XLIA 1YDSE 2VWVA 4MXZA 2UW4A 3CGOA 2ITOA 1NVSA 3JPVA 3IOKA 1ZMVA 4F9BA 3HA6A 4AU8A 3BLAA 3GBZA 3Q4TA 2W1IA 3DAEA 4OTHA 5TKDA 3DKOA 2LAVA 2F49A 3FXZA 2CMWA 2XNMA 1TQMA 3DDPA 3H9RA 1O6YA 4TW9A 2JC6A 2GHLA 4C4GA 3TI1A 1CKJA 2XIKA 3QBNA 4TY1A 4C7TA 4F1MA 2VV9A 4EOLA 5CEMA 3W10A 4DTBA 1OIUA 2WAJA 4X0MA 3UIMA 1SVGA 1YOLA 5L2QA 4FT7A 2G01A 5A6OA 4JDJA 2ITUA 3W0PA 4E5BA 4NCTC 3BI6A 2BHHA 5CT0A 2AEGA 4XCUA 4BI2A 2IZRA 4CMUA 5FP6A 3I6UA 5J9ZA 4J52A 3NCGA 3LPBA 2JLDA 4WSQA 3FC2A 2GPHA 4FKOA 2PMOX 1JNKA 3EN6A 4G3CA 5FDXA 4BTJA 3Q9XA 1OBGA 4JQ7A 4JXFA 1QCFA 4XRJA 4FSUA 5JGBA 4D9UA 4GYIA 2ERKA 1Z9XA 2FB8A 2WMUA 3MPTA 4GFMA 5E8UA 4EL9A 4O21A 4C58A 4AN9A 3IDPA 5CI6A 4BCMA 3HP5A 5FTGA 4X3FA 2GTMA 1XMLA 3OUKA 1QPEA 1WVXA 2JD5A 4W4YA 5AP0A 3QC4A 1Q24A 2WMAA 3JY0A 3VS2A 4BDGA 3QGWA 5B7VA 5M4UA 4K18A 2C5NA 4QT1A 1AD5A 3F6XA 3VO3A 3LXLA 3ID6C 1Q62A 3BHVA 5F20A 5DT4A 2QU5A 4RX8A 4I6HA 1KOAA 3A60A 5TT7A 2VO3A 4X3FB 4G6NA 2RSVA 1PMNA 4TYGA 3ZZEA 4IVBA 3F7WA 2XNNA 5HE2A 1OIQA 4PRJA 1OM1A 4QMLA 4ERWA 3BBTB 4DHFA 2OJ9A 1P2AA 3RPYA 4AOTA 3V6RA 4IH8A 4RRVA 2PVJA 4D1XA 3HMMA 4FC0A 5KKRB 3BGQA 5ANDA 5EM5A 3P7CA 3NVKI 3WOWA 4ITJA 3PLAE 4B6LA 2XEZA 4CZTA 3T9IA 3PVWA 5IQCA 2VTIA 4DEHA 3W18A 2PUUA 2R3OA 4QP1A 4RFZA 3EFLA 3BLRA 4YJUA 4QYHA 3R83A 1CKIA 3D4QA 2C69A 4BDCA 4BCGA 3W2QA 4EOKA 2ETKA 3OCSA 2C0OA 2X7GA 2X2LA 2PVYA 4YURA 5AUZA 4ALWA 3F5PA 5LXMA 3BELA 5ETFA 4FGRA 5ACKA 5CEIA 4RGJA 4G9RA 1SM2A 3V01A 4A9YA 2XA4A 4Y72A 5DRBA 1REJA 3AMBA 3FMNA 4O6EA 3RAIA 1ERKA 3PA4A 4LYNA 3FL4A 2Z7RA 4K1BA 3ORLA 5LJJA 1URWA 2X81A 3AC1A 2Y6MA 4DH3A 3VC4A 5ACBC 3C4ZA 4GRBA 2ITVA 2J2IB 4BTFA 4QMPA 5IA5A 3P23A 2QG5A 4LUEA 3EN4A 3PE1A 5HBJA 3V8TA 3DB8A 4FKIA 5CU0A 2AC3A 3Q4ZA 2R0IA 3DBDA 2YAAA 3BWJA 4O2PA 4QTAA 4ACGA 4AUAA 4EJNA 4IDTA 3HRBA 4QMMA 3ORIA 2GS7A 1H07A 3EKNA 4YZ9A 5HU3A 2ESMA 3QHRA 1ZXEA 2RGPA 2V0DA 2ITPA 4O1PA 4OTPA 3GQLA 4X3FC 2WMXA 1Q61A 2IW6A 2Z60A 3CR0A 4FTNA 4R3PA 1YKRA 4DGGA 2W1CA 4KS7A 3PY3A 2X7FA 5AP2A 4IB1A 2C3LA 3ZS5A 3F3WA 2OFUA 2FSMX 4U6RA 4HVHA 2ZV8A 5FEEA 3DV3A 3Q96A 5KKRC 4P5QA 3HKOA 3HA8A 3GNIB 4RZVA 4HZSA 2QONA 3GXLA 3LMGA 1WVWA 2H96A 1UVRA 5AV0A 2QR8A 4D2VA 3FPMA 1NW1A 5EW9A 4F70A 4QMZA 5IUHA 2W9FB 1UU3A 3FQEA 4QRCA 2YA9A 4R1VA 5KZ0A 5IH6A 4CQEA 4JMQA 4U3YA 5AEPA 4IZAA 2QOQA 3PXFA 2XCHA 4WA9A 4FT0A 4X3JA 2XNPA 4DAWA 1KUTA 2FA2A 4HCVA 4YLKA 4M12A 4U0IA 2R3FA 5AIKA 4RX5A 3DAJA 2WTCA 1U5RA 2OLCA 3IW8A 1WBTA 1GZNA 3FMDA 4CZYB 1BUHA 5CF4A 4YBJA 5CX9A 4XG7A 2WMQA 2ZDUA 2CDZA 3EYGA 3I6WA 4UEUA 5HG8A 4EH4A 2OI4X 5J1VA 3KXXA 1DAWA 4AZWA 2C5XA 2UVZA 2JIIA 5AIRA 4BGGA 3TNWA 4KINA 4EHVA 2WU7A 3AQVA 3LLAA 2Z7SA 3FMJA 3T3VA 3S3IA 4II5A 4JVGA 3F69A 5KBQA 1K2PA 2JDSA 2YM4A 3OROA 2B9FA 4IACA 2WZJA 3ZZWA 2QO7A 1JWHA 4H3PA 4FOCA 5CAOA 1O9UA 1ZYJA 4ZXTA 5GIOE 4DG3E 4K77A 4Y73A 1H01A 4BIDA 3CS9A 5FTQA 3VS5A 2HWOA 4ANOA 5J5TA 4OTFA 2VO7A 3V5WA 3M2WA 1GY3A 2UUEA 2PSQA 5A4CA 5HO6A 5JN2A 1PKGA 1H1PA 1JLUE 4JX3A 5KO1A 2PY3A 4A4OA 3SOAA 3VBXA 3DBQA 4FI1A 1GIJA 4WRGA 2CHLA 3PVUA 3LZBA 4FV0A 4TYJA 4K0YA 4AXDA 2WMRA 4IDVA 2OJFE 2WMSA 2XIZA 4B7TA 4BKYA 2R3NA 3R04A 3TJCA 2E9OA 2VTOA 5GNKA 4X2FA 2XS0A 3HEGA 3TT0A 2PE2A 4YJPA 2VTRA 2WELA 4D2TA 5FUTA 5HNBA 3QX4A 1ZY5A 3DCVA 3I4BA 3FJQE 3PPZA 3E5AA 2UV2A 3OOGA 3HRFA 4O0WA 3SHEA 4E4XA 2XIRA 3QQKA 5DFPA 2R3QA 5IUGA 4XLVA 1FPUA 4L42A 2QKRA 5D10A 2OJJA 4N70A 5HIBA 1ZLTA 2ITQA 3FXWA 3QLGA 4Q5HA 4FV1A 4HGTA 2HZIA 4E93A 4AACA 4D58A 3ZLSA 4FZ7A 1DI8A 2X4ZA 3OCTA 5AX9A 4YZMA 4D0XA 4HVIA 5E91A 3BL9A 4O6LA 2VTQA 1YW2A 4OTRA 2WMVA 4MYGA 4WOVA 3WARA 2HELA 3DJ7A 2QQ7A 2Z02A 3G90X 2J5EA 4FV3A 4MF1A 4TWNA 5HICA 3TNHA 4C38A 2Z2WA 4C36A 3LM0A 3PJ1A 1ND4A 3I5NA 1XH4A 4JBVA 3GU8A 4F9WA 3A7GA 3R2YA 1HCLA 3SD0A 4L01A 2QOLA 4RPVA 4MQ2A 4QO9A 3EQRA 4MXCA 3EHAA 3FKOA 3AKJA 3DZQA 2YABA 4UBAA 1OL7A 5BUJA 4FODA 3UIUA 1ZOHA 4O4DA 3SAYA 5GZ9A 4LOPA 2R4BA 4FSNA 3A8WA 4ZSJA 3SG9A 5C8KA 3ZFYA 3PVGA 1BKXA 5EHLA 4Z55A 3VHKA 1Q3DA 4NT4A 4B8MA 1J7LA 4JG8A 3HMIA 4GW8A 2ONLA 3V3VA 3KIOC 2QR7A 3QQGA 3G33A 2I0HA 2G15A 4QMXA 4QMSA 1Y8YA 4E5AX 5BVFA 2OWBA 4ARKA 5ITAA 4YJRA 4RC3A 3UMXA 3TEIA 4KIKA 4X2JA 2OF2A 2UVXA 4DDGA 4P4CA 5BUIA 3KMMA 3ATSA 4DITA 1J7UA 4C62A 1WBWA 2W4OA 4JG6A 2I1MA 3EQHA 5EH0A 4XMOA 3ERKA 4FTOA 2ZM3A 4IBMA 3KK9A 3BLHA 4O7LA 1XH5A 3D5VA 5TOZA 4DFNA 4ZMEA 1PXMA 4DCAA 5F1ZA 4W4WA 4JNWA 3H9OA 3DZOA 4AA0A 2GMXA 4NU1A 3H0YA 1W2FA 4GYGA 4EKLA 4GFOA 4GJ2A 3FQSA 4I0SA 5H9BA 5C27A 5JEBA 4UV0A 4KKGA 2UZVA 5AP5A 3MB6A 4QNYA 3VUGA 1Z5MA 1A48A 3DXQA 3D5XA 3CPCA 4F7SA 3RWQA 4G17A 4DG2E 1W7HA 2XM8A 3IW4A 3KRLA 4XUFA 3R7VA 3UIBA 4MD8E 3ZTXA 4DHIB 3TZ7A 2C3IB 3RPVA 3ZSIA 3VHEA 5AM7A 3N9XA 3NFGB 3PXQA 3ULIA 1Q8ZA 4Q9SA 3BYUA 4F9CA 2W5HA 2E2BA 4PNIA 5AR5A 1H26A 3FLWA 4AX8A 4S33A 5FDPA 3PWYA 3W55A 4W8DA 5IU2A 2PE0A 3TYKA 1XMMA 2OF4A 3LQ3A 4F9AA 4TRLA 4DLIA 3I1AA 3PSCA 1FGKA 3LMIA 4ZJIA 5EK7A 2PE1A 3CQWA 3R9RA 3NAYA 4GV1A 5DOSA 3P1AA 4AZSA 1OECA 3GEQA 3HV4A 4HCUA 4NW5A 3OXZA 4RVKA 4WRSA 5J7BA 2BRGA 4ACHA 4P7EA 3VBQA 2BHEA 3PJ2A 3ZO1A 4U42A 5FEQA 2W5BA 3CBLA 1XH6A 3QZIA 5EFQA 5A54A 4E8AA 5L2IA 1GZOA 4RWIA 1M2QA 3OT8A 3IO7A 2YM5A 1VR2A 4BWKA 4I5MA 3RNYA 5AAGA 2ZB1A 2BDWA 3PJCA 2PHKA 3FPQA 2HZ4A 2J0LA 4FTKA 3FLNC 2PVKA 4M14A 3Q52A 4EQCA 3MPAA 1OKZA 4MUQA 4ANLA 2WEVA 3LAUA 1F3MC 3TJDA 5FQDC 2W1GA 3NIEA 4RWLA 3DTCA 4J8MA 3P7BA 3QX2A 4IB3A 2ZV9A 4XRLA 3ROYA 2VTSA 4FYNA 5JQ5A 4GUEA 1BX6A 3D7ZA 3DNEA 3R7YA 4I24A 3R7UA 5CAUA 2XCKA 3UVPA 5HX6A 2VTMA 3FY0A 4UWBA 5DNRA 4HW7A 4AT5A 4OTWA 3G9LX 3RBWA 3PG1A 2UZOA 3G0FA 4CMTA 3KVWA 3R9OA 4P90A 5B2LA 4HCTA 1FVRA 4UXLA 3FMKA 5HBHA 1YDRE 3GC9A 3V51A 2ERZE 5EQPA 1NY3A 1APME 4MAOA 3DOGA 4RJ7A 2WIHA 3FSKA 1XWSA 4ERKA 3MH2A 2PTKA 4GMYA 3ZRMA 3G2FA 4L45A 3E87A 4DINA 3KMWA 2QOCA 4APPA 3L9LA 2HIWA 2R3MA 1PHKA 3JY9A 1XKKA 5D7AA 4AWIA 4E7WA 4ZZNA 2C30A 3V5TA 4LMUA 4FNYA 2PL0A 1U54A 2R7BA 4QDEA 2YDKA 1IG1A 4AF3A 4QTBA 5KMOA 3E8EA 3V5QA 3R71A 3UZTA 4IAYA 4FTJA 4PDSA 3IGOA 1K3AA 2RL5A 1TVOA 1WBSA 3NNVA 4ASDA 3QAME 3TUDA 3GCSA 4O83A 4H1JA 1W83A 2B9HA 2HOGA 4LGHA 3LCDA 4YC6A 1OPJA 1XBAA 4FUXA 1GIHA 5ETIA 2W1HA 4W9XA 4ZLOA 2VGPA 4EK3A 1OPLA 5IQIA 3AT2A 3H4JA 4DFXE 4EOPA 4ZTNA 3WYYA 5H8GA 2J0KA 2PZ5A 4IAKA 3BV2A 4F4PA 4Y8DA 2Q83A 3GCVA 3OY1A 2XJ2A 3UPZA 3ZC5A 2EXEA 3MH3A 1AQ1A 5AM6A 1IAJA 4KS8A 2CGWA