3KXNA

Crystal structure of z. mays ck2 kinase alpha subunit in complex with the inhibitor tetraiodobenzimidazole (k88)
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
327
structure length
327
Chain Sequence
SKARVYADVNVLRPKEYWDYEALTVQWGEQDDYEVVRKVGRGKYSEVFEGINVNNNEKCIIKILKPVKKKKIKREIKILQNLCGGPNIVKLLDIVRDQHSKTPSLIFEYVNNTDFKVLYPTLTDYDIRYYIYELLKALDYCHSQGIMHRDVKPHNVMIDHELRKLRLIDWGLAEFYHPGKEYNVRVASRYFKGPELLVDLQDYDYSLDMWSLGCMFAGMIFRKEPFFYGHDNHDQLVKIAKVLGTDGLNVYLNKYRIELDPQLEALVGRHSRKPWLKFMNADNQHLVSPEAIDFLDKLLRYDHQERLTALEAMTHPYFQQVRAAENS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/transferase inhibitor
molecule keywords Casein kinase II subunit alpha
publication title ATP site-directed inhibitors of protein kinase CK2: an update.
pubmed rcsb
source organism Zea mays
total genus 113
structure length 327
sequence length 327
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2009-12-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3kxnA01
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3kxnA02
4LOOA 5IKWA 1WBNA 4NTTA 1FMOE 4I24A 3U87A 4KIOA 3HMPA 1P2AA 1ZYDA 5C8KA 1H07A 4YLLA 5IISA 4QTCA 4FEWA 4DBXA 1PJKA 4NM3A 4BF2A 4H1MA 2W1FA 3OTVA 4EOIA 3EQRA 3ZZEA 4GIIA 3LKMA 3FMEA 2DWBA 4YJTA 2O65A 3OCSA 2BALA 3PXRA 5GNKA 1JLUE 4G5JA 3U6IA 5FUTA 4FNXA 3UIBA 1OMWA 2R3MA 3PPZA 3EB0A 2RIOA 2XK3A 4FSZA 4E6AA 2PYWA 3OW4A 3UNZA 3D5UA 4O83A 2W99B 3QUEA 3EFJA 5HNGA 3NYOA 4XG2A 3F66A 5GZAA 1M2RA 5KHWA 4E20A 3G15A 2OF4A 1LEZA 3O8TA 2W1CA 4FIIA 2CNQA 3C4FA 3OHTA 3M1SA 2R3IA 1Q62A 3WYXA 3R7GA 3QD0A 3QRJA 4A4LA 1PYXA 4LMUA 3UOHA 3QTIA 2X81A 3R8ZA 5IQIA 3LCTA 2QLQA 3MH0A 2XKDA 4FL3A 4PL3A 2O0UA 1CMKE 2JKMA 4XP3A 3IPHA 2R2PA 2X9EA 4MEDA 1KV1A 4MD9E 4APCA 4ZMEA 3PWYA 3EQPA 4FZ6A 2OI4X 4JDHA 3EN5A 2JBOA 3II5A 4S32A 3COHA 2RGPA 1OL7A 2QU5A 4ZIMA 3NUUA 2RKUA 1IR3A 4EWHA 3P79A 2P0CA 2E9NA 4O38A 3P08A 4QP9A 2RG6A 4OTDA 2WMUA 5LVPA 3MVMA 3A7IA 5I4NA 1UNGA 3H4JA 3LZBA 3PPJA 5ANDA 4M68A 3V5WA 2DYLA 3TT0A 2G2IA 4O82A 1WMKA 3JVSA 4YMJA 5DR9A 3PXYA 3ANQA 4GS6A 5K4IA 3E8DA 3CEKA 2UZLA 3LAUA 5CVGA 4HGEA 3KFAA 2A2AA 2BZJA 1OL6A 2AC3A 3KMUA 4X2NA 3DFAA 4PL5A 4GVJA 1ZY4A 4DINA 2BZHB 4F63A 4IZYA 3R71A 5JGBA 4ANBA 3FY2A 4RWLA 4ASXA 2ESMA 5JQ5A 2VNWA 3U6HA 2UZWE 2IVSA 1R39A 5ANOA 3EN4A 1GZOA 3N4VA 2RFEA 2WMRA 2YISA 4NW5A 4TY1A 2RL5A 2KTYA 5HVKA 5JK3A 5AAEA 5B2MA 2CDZA 3H9OA 2RF9A 1IA9A 2JFLA 4FA2A 3AGMA 2X4FA 1WBOA 2QOQA 3WF9A 4ZTQA 5LJJA 5CSXA 4DFYA 3SAYA 3UOJA 5HG5A 3ZM4A 5EHOA 2XRUA 1Y8YA 3FQHA 4QPSA 5J1WA 4A7CA 5ANGA 3RK7A 4WSQA 1YVJA 3GCQA 3QYWA 3ZLWA 2P33A 5GJDA 2JKOA 3ZSHA 4RLKA 1W98A 1XO2B 3F3TA 3GU6A 2CJMA 3KKVA 4IHPA 5CSVA 3OCBA 5AIKA 3SW4A 3GGFA 2QHMA 3QD2B 4BKZA 5AUVA 1OUYA 2ONLC 4B0GA 1PMUA 4OBOA 3NW5A 4TWNA 5D1JA 1KOAA 4YJUA 4AT4A 4QQ5A 5BYLA 2PMOX 5FP6A 3QRTA 3S4QA 4CKRA 4BI2A 4AWIA 3AC3A 4EORA 3U9CA 3P78A 5IA1A 4NW6A 1IG1A 3BU6A 3C4CA 4AZVA 1ZLTA 2UVZA 1M7QA 1J91A 3GI3A 4FV9A 3QKMA 3DU8A 4JVGA 4BCOA 3DY7A 4MX9A 1WBVA 5KZIA 2JDOA 3UZPA 4D2VA 3VW8A 4E1ZA 3JYAA 3TEIA 5H8EA 4CFUA 3NUXA 2OICA 5DN3A 2WPAA 4CT1A 3CD3A 4UMPA 3EYHA 3C13A 4D4YA 3F3UA 4Z16A 3TZ9A 4LUEA 3D7TB 5E8VA 5FTQA 3THBA 5DR6A 4W8DA 2R5TA 2WZJA 2DQ7X 3V3VA 4ANQA 4F70A 2OXXA 2HZIA 2HWPA 4M66A 1HOWA 3WZUA 3VJOA 5AX9A 4CRSA 3PZHA 5E8TA 4JG7A 3EH9A 5J9YA 3KGAA 3PRFA 5AA8A 5HU3A 5LXMA 3R7IA 4OTQA 1XJDA 5IQCA 4MK0A 3P4KA 3OWJA 5EW9A 4BC6A 2IVTA 4FIEA 4FT5A 3C4EA 4NM7A 3CKXA 4BIBA 2ZDUA 2ERZE 1H25A 3FJQE 5J79A 1JWHA 4GFGA 3UBDA 3OBGA 4Z55A 5ETCA 3AC4A 4C2WA 5JGDA 5IUIA 1IASA 3ZCLA 4O1OA 1OPKA 3LCOA 4FTAA 4QYFA 1KOBA 3K3IA 4IX5A 4N6YA 4H58A 4FV3A 1LEWA 2X7FA 4YZCA 4CTBA 3CS9A 2BVAA 2GQGA 3H3CA 4JJRA 3VW6A 2AC5A 4Q5EA 2XNBA 2BDFA 4PWNA 1Q8UA 3PP1A 4EQCA 3TIZA 2J0IA 1OB3A 4W8EA 4XNEA 3REPA 2ZB0A 3W16A 4IVAA 2FB8A 2WELA 4O7YA 3R8UA 2HENA 2JFMA 1X8BA 3OXTA 4LM5A 4IX3A 3FPQA 4IDVA 5LOHA 1K2PA 3QZHA 3QWKA 4H3PA 5AFVA 4MVFA 2VU3A 3VS6A 3WBLA 2XP2A 3D15A 4J1RA 4IBMA 2Q83A 3UOKA 3IW5A 1FOTA 1OPJA 2C6MA 2E9UA 3IW6A 5HNBA 4E8AA 4EC9A 3PG1A 4QMMA 4RC2A 3FEGA 5DGZA 2OH0E 2WIPA 3HV6A 4KBAA 2OJ9A 4LI5A 4CFVA 3SVVA 4IWQA 4YJQA 1J7LA 3VIDA 4O96A 2GCDA 4F6SA 5EM8A 2WEVA 5CX9A 3ORMA 3MI9A 4NK9A 4YUQA 2WO6A 3CC6A 4D2WA 2CGXA 4YLJA 4XYFA 5CEIA 2E9VA 2QKWB 2G9XA 4IWPA 3PSBA 3DBEA 4ZTLA 3SXFA 3A60A 3I6WA 2B9HA 1O6YA 4AE6A 4FEXA 4AZEA 2YIXA 2OJGA 3HGKA 1H27A 4K1BA 5M4UA 4EK3A 1HCKA 2ZJWA 3LCSA 3WF8A 3MJ2A 4FZDB 4YZBA 4H05A 3A61A 3KEXA 4QYEA 2WIHA 1OIQA 3DPKA 3TNQB 5TT7A 4UWYA 1V0PA 4MWIA 3FKOA 2E2BA 3MJ1A 3NUYA 4X0MA 3NCGA 4NIFB 4W4XA 5L2IA 5AUTA 3NAXA 3QU0A 3Q9WA 4AT5A 4FSQA 3HL7A 2G15A 3TJDA 3Q32A 4AZFA 2XKCA 5KNJA 1FVTA 3I7CA 3QTSA 4RIYB 3ZONA 4C62A 2B54A 1O6KA 1U4DA 2ETKA 3HDMA 3ZFMA 3PPKA 4KIKB 4ZP5A 4G1WA 2BCJA 4D4SA 5IU2A 4JX7A 4JDJA 4C7TA 1WZYA 4EWQA 5HBJA 1URCA 2IJMA 2NRUA 2YWPA 1PYEA 4ID7A 3BEGA 1NT2A 3BHTA 3LCDA 3A8XA 5HGIA 4NYEA 3G0EA 4FV8A 3TDWA 4E5AX 4WRGA 3VS5A 5KBRA 2Y6MA 2PVJA 2PZRA 3A7GA 2Z8CA 3AD5A 1XH8A 3DV3A 4BTKA 5JFSA 4Y85A 5EYMA 3AMAA 3DXNA 2EB3A 4J53A 1S9JA 2BAJA 5LMAA 2CKPA 2NP8A 3NLBA 1M2PA 4UY9A 5ITAA 4RWKA 3UIXA 4BBFA 4I22A 2XRWA 4ZZOA 1REJA 3ZSGA 2P2HA 4WSYA 3FMNA 3ZEWA 3BYUA 2QR7A 2HZNA 3G9NA 4YGAA 3S2PA 5DMZA 1M17A 3OOMA 4QT1A 5BX0A 3LLTA 5CXZA 1GIHA 2UZEA 4XH6A 5GJGA 3UJGA 4GRBA 3NGAA 2R3KA 3GXLA 3QQJA 2BR1A 4LUDA 1OPLA 3W55A 2WQOA 5IEYA 4PUZA 5CEQA 2JDRA 3BQCA 3R9RA 3EMGA 3RAKA 4BDBA 5HESA 2PVKA 4AS0A 2HYYA 2VTAA 2VNYA 3EFKA 3HRBA 4CFXA 3IG7A 4E7WA 3R9HA 2XNMA 4MBJA 5LVMA 5AP5A 4I6BA 2PUUA 5DT0A 5E8YA 5AR3A 2BKKA 4HOKA 1QPJA 5DFPA 5BVWA 5CF4A 3R01A 5HCZA 5HIBA 2YDJA 4ZTSA 1KE9A 4I41A 5GZ8A 2WEIA 3W10A 1Q99A 3DB6A 2IVVA 4OTPA 4V0GA 1IEPA 3C5IA 3ORIA 1I44A 3QQFA 4O21A 5FXSA 2KULA 2R64A 3G2FA 3BQRA 4FKJA 4NT4A 4IVDA 4EUUA 5JFXA 4EHVA 4UEUA 5HE2A 3WI6A 5AAGA 5L2TA 4L3PA 1U46A 3SW7A 4C34A 1PMVA 3ZYAA 3KQ7A 2I6LA 2ZAZA 1LUFA 1SVGA 4ACMA 3COMA 4I5PA 5IQBA 4I6FA 2ITVA 3V5JA 4YZ9A 2W9ZB 3CIKA 2UW3A 4ERKA 5B2KA 3BYOA 2YABA 3KULB 4CFNA 3O2MA 1CSNA 3DDPA 3Q04A 4E73A 2WMQA 2CLQA 4U80A 3I5ZA 3DJ5A 4U43A 3FMHA 5AA9A 5IA4A 2I0YA 4F08A 5DE2A 2CGVA 4QMWA 1IA8A 4ZSAA 4G9CA 4TW9A 3ORNA 4NCTA 4RJ3A 3EHAA 3R83A 4RWJA 2JAVA 2P2IA 3HAMA 1XHAA 3QKLA 3QTQA 2GHGA 4K33A 2PZIA 3CTHA 2OFUA 4QMXA 3TWJA 3W33A 4IIRA 2C5OA 2Y4IB 3FI3A 3Q5IA 3NYNA 2OH4A 3VBYA 4D0WA 3ULZA 4USEA 2ITTA 4U5JA 4KB8A 4K18A 5ANIA 4DTKA 4ZLYA 3BI6A 3R9DA 4IDTA 3DK7A 3ORZA 2C1AA 3MDYA 5BPYA 5GZ9A 3OMVA 5DT4A 2V22A 3FMKA 4I92A 3EKNA 4FK3A 2JAMA 3AQVA 3PA3A 4GT3A 1OKYA 3VUHA 3D2KA 2ITUA 4RX9A 4CEGA 1W8CA 2VWWA 5HE1A 5IEXA 4ZLOA 1Q97A 3BZ3A 3HMMA 2OIBA 4OTHA 1QCFA 2Z7SA 2VWUA 3C4WA 3VUGA 3E8EA 2YACA 4XS2A 4D55A 3KXXA 4OTFA 5FBNC 4KD1A 4BDIA 4O0TA 1RDQE 4KS7A 4NZWB 4ZTMA 3TL8A 2C47A 5CF5A 5LWMA 3LXLA 4WUAA 2OBJA 4F65A 3FZOA 2PZPA 3FHIA 3GU7A 3GC7A 3PIYA 5C4KA 1F3MC 4C8BA 5EQYA 4HZRA 2JLDA 2FYSA 4JXFA 3ORKA 2W05A 3QLFA 3RK5A 2CCIA 2X7GA 5JT2A 2B53A 4YZMA 3DCVA 5LMBA 3EWHA 4NEUA 3GBZA 3R0TA 2ETMA 2HOGA 3NNUA 3PJ8A 4QD6A 4GKHA 5T6KA 4ZTNA 3RBWA 3QZFA 2ITWA 2GDOA 5BMSA 5I3RA 2OKRA 3P5KA 5A3XA 2R0UA 2ITYA 4RVKA 2FSTX 4KKHA 3RGFA 2XNEA 4FEQA 3UVRA 2PE2A 2XIZA 2JIUA 4QTAA 4I5CA 5CS6A 1Z9XA 4QMNA 4J97A 4WOVA 1MP8A 2BROA 3UGCA 4U81A 3PRIA 4Y73A 1RQQA 5JFWA 1J3HA 2ERKA 4Y46A 1SNXA 3M11A 4M97A 3F2RA 3NS9A 4TWOA 5CU6A 2CCHA 3KU2A 2WOUA 4ENYA 2O63A 1XQZA 1YXTA 4FG9A 5ANKA 5D7VA 4ZOGA 4FT0A 1CKPA 3LW0A 3U8WA 3I5NA 5CSPA 4IM3A 3OROA 4PF4A 2UZUE 5FTOA 5FLFA 4TYHB 4MHAA 3LFQA 3DFCB 4FV4A 4IC7A 5M55A 3RPRA 5GINE 2C3JA 4O7TA 2QU6A 1K9AA 3COIA 4O7WA 2VWZA 3Q9ZA 5F95A 4O0YA 1VZOA 4GUEA 1KV2A 4HYUA 1UU9A 5HG7A 3SQQA 4UXLA 4X6RA 2X2KA 3ZTXA 2XIXA 3O7LB 3DNEA 4ZAUA 3BU5A 1Y8GA 3UC3A 2ZV9A 2J90A 1GZ8A 3QX4A 3E3PA 1OIRA 2WMTA 3L9LA 4MD8E 5DHJA 2YCFA 3DOGA 5HIDA 3DDQA 2R4BA 4JQ7A 4KIPA 2XB7A 4OTGA 3RAIA 3TKHA 1U54A 2AYPA 2WMAA 4G3DA 2JKKA 3FDNA 1PKDA 1YI3A 5J7HA 3HDNA 2HELA 3GUBA 3QKKA 4MBIA 3DJ7A 3ITZA 3VUMA 3R02A 4YLKA 3FL5A 3POOA 2ZMDA 1SNUA 4FIGA 3R8PA 4D1XA 4YURA 2PK9A 5E8SA 3BGPA 4QTDA 2HZ0A 4IFGA 2J5EA 4NWMA 3BHYA 3UG1A 3A62A 3W2OA 1YKRA 3TJCA 4FE2A 3BLQA 3DAKA 4YTIA 3FSFA 3QCQA 4BIDA 3DKOA 2UW9A 2BFXA 3DTWA 4JDIA 2X8IA 2C5YA 3VUIA 3VHEA 3H0YA 1IRKA 5D9HA 5CQWA 2R7IA 4LRMA 4NCTC 4PPCA 3TV7A 3W2PA 3ZO4A 4JQ8A 5HQ0A 4UBAA 3Q9YA 2VWVA 2YM4A 5FQDC 3SXSA 4D0XA 3OCTA 3GU8A 3TZMA 5BVFA 5IPJA 1KE8A 4FNZA 2O8YA 3CXWA 3TI1A 4BZOA 4DEHA 2VTSA 4OTIA 3A8WA 3UZRA 1GIJA 2ZM1A 3T9IA 4EOMA 4HVDA 3MA6A 1NXKA 4B99A 3F3ZA 3P86A 3RK9A 3W2QA 3NUAA 1WVYA 3C50A 5D10A 2QG5A 3R04A 4U44A 4UB7A 2OLCA 4W4VA 3HAVA 3HP2A 5BUJA 5D11A 4AFEA 3TV6A 3GFWA 4JG8A 4Y5HA 5LQFA 3UNJA 4W4WA 2VTJA 1MRUA 5A4TA 1IAJA 3CPBA 2V62A 3DK6A 2XS0A 2B4SB 5AP6A 3ZXZA 3T9TA 4AW0A 4I94A 1DI9A 3RWPA 1ZZ2A 2CNUA 4USDA 2Y7JA 3I1AA 5DT3A 4EI4A 4A9YA 3BRBA 4FKWA 4FNWA 3H10A 2ONLA 4YR8A 5HVJA 3V8SA 5HBHA 4CXAA 2GSFA 4DEGA 1ATPE 4A9SA 3VVHA 5M07A 1XBBA 4W9XA 1DAYA 2O2UA 4GFOA 5AP0A 4FTRA 4ZXTA 2RG5A 5FEDA 5C03A 2GQRA 5M09A 2X4ZA 4L6QA 3BELA 3PVUA 4HPTE 4LG4A 4TWPA 4EYMA 4O84A 3HMNA 5L8JA 1UWJA 2PMIA 3HEGA 4AUAA 3MBLA 4U40A 1P14A 3N4UA 2QCSA 3FSKA 3KCFA 4WG3A 2QOFA 4L67A 2C3IB 2YDKA 1XBAA 5CI6A 3BLHA 3PXZA 2BPMA 4AU8A 4EHGA 3UO6A 4G3FA 1WBWA 5BUEA 4YO4A 5KMLA 3ZUUA 4ALWA 3KXMA 2UZOA 2NPQA 3QTUA 1UU3A 4X2GA 4BDGA 5HTIA 5M56A 2WTDA 1FQ1B 3HYHA 5AMNA 3QRUA 2WU6A 1OECA 3IQ7A 2PHKA 2VX1A 3V51A 4QMSA 3P1AA 2R3FA 3GNIB 4X21A 3G90X 4FVRA 3ID6C 3PSCA 4D9UA 4MBLA 2HIWA 4OGRA 2F2CB 3GFEA 3OT3A 2SRCA 3NUSA 3Q4TA 3R1QA 4L43A 4BRXA 3UZTA 2W4KA 4DFBA 4DA5A 3S3IA 1W83A 3QD4A 4RIOA 4A07A 5M4CA 5CU0A 3IOKA 3UP2A 3U55A 4I1ZA 4PV0A 3QX2A 4FV7A 2G01A 4H39A 4QO9A 3RALA 4IZ5A 3RJCA 1OI9A 5CAQA 5TOZA 1ZZLA 4W4YA 4XV2A 2ZYBA 2QVSE 4GL9A 3MW1A 4FR4A 4GT4A 3IW7A 5FEQA 2GNIA 2UZBA 3AC8A 3BGQA 3IDBA 4KKGA 3R2BA 4OLIA 3ANRA 3F2NA 5KE0A 3TN8A 3ZEPA 4BCGA 5BYZA 3UO5A 2WTKB 4GK2A 3K5VA 5CNOA 3OY1A 4D5HA 1WBTA 3D94A 4ZSEA 4D4VA 2R9SA 3B2WA 3ZC5A 5BUIA 2CKOA 1VJYA 2F7ZE 1JVPP 5B2LA 3IW8A 5CZIA 4UMTA 3DBCA 5DI1A 4BCHA 3E3BX 5M57A 3JR1A 3ULIA 5KUPA 2VO0A 4AP7A 5AUUA 3O7LD 1ZOEA 2C6OA 3QA0A 4IVBA 5AUYA 3HV7A 2W17A 4CZYB 1ZWSA 1YXVA 2HK5A 3Q53A 4V0GB 3R9NA 3RWQA 2XNGA 2QOOA 5C8NA 4YC8A 1YOLA 5JQ8A 2V7AA 3UE4A 1OL5A 3U4WA 2VAGA 2BRGA 4BN1A 3ZSIA 2QQ7A 2C5XA 3GC0A 3AG9A 4RVLA 2QO2A 2HZ4A 2ZV8A 4FGBA 4EOQA 3LE6A 2W5AA 1H26A 3KF4A 4TTHB 2VRXA 4M13A 3LFBA 4EH2A 3WIKA 2WHBA 5DLSA 1W0XC 4NM0A 4O1PA 4D1SA 3O8PA 2XK8A 4WIHA 3CE3A 2WQNA 2W4JA 3I4BA 4QQTA 2V5QA 2YFXA 3G0FA 4RMZA 4IJ9A 5CNNA 1YWNA 4FTJA 3LJ0A 3UYTA 4JIKA 3V8WA 4CQGA 1OGUA 4QMZA 2R3PA 4JBPA 4TNBA 3TUCA 3FZTA 3VS7A 4YC3A 4GIHA 3QHRA 4J99A 4BL1A 5L8KA 4RIWA 2FO0A 3C1XA 3LFDA 3HVCA 4UYNA 4JBVA 4CZTA 5EKNA 5I9YA 3QGWA 1RJBA 2PMLX 1OL1A 2B55A 2VTIA 4M14A 3FC2A 1GOLA 4AA4A 3TZ7A 1M2QA 4RFMA 4GH2A 2W06A 4HYSA 3I60A 2OU7A 4MXZA 1PKGA 4IB5A 1G8AA 3DBDA 4TZRA 2OJJA 5J7BA 3WF6A 3EN6A 5CVFA 2F4JA 1NA7A 4O0RA 2PE1A 3PA4A 5DIAA 1SM2A 4B8MA 1CTPE 3QZGA 3QXOA 1STCE 3KVXA 3TNPC 5IQEA 1BX6A 4RRVA 5HNIX 3IDCA 2XIRA 4C33A 2CSNA 4NJ3A 3QL8A 3ODZX 4RJ5A 4U9AA 2X39A 4BDFA 5HG9A 1BL7A 1T45A 1VR2A 3MWUA 4IEBA 2BRNA 5I9ZA 5HORA 4I20A 4WD5A 2R3NA 2QOHA 1RW8A 3FC1X 5A46A 5F94A 2J4ZA 2ZB1A 4X3FA 3SXRA 4L53A 5TF9A 2XBJA 3AGLA 3EQDA 1PXMA 2UVXA 4DGMA 1YHWA 1APME 2ZDTA 4FV1A 2X2MA 4LOPA 5DRBA 5EQEA 2NNWB 3FZPA 3PTGA 2XYNA 2YJSA 2PY3A 5CASA 4AGDA 4AW1A 1OL2A 3FZ1A 4PL4A 4PX6A 3PDTA 5G1XA 1KE7A 2QG7A 4R78A 4BDHA 1JAMA 4HJOA 4B4LA 5BVKA 4UALA 4CGAA 4KSPA 4BTFA 5IMXA 1MQBA 3ACJA 4R7BA 1VEBA 1ZOGA 4WNKA 3RHXA 3LHJA 3AXWA 3ZUTA 3QUDA 4LGGA 3HA8A 4U45A 1FVRA 2QD9A 5K0XA 5IMEA 2RFDA 5HLPA 1YWRA 1L8TA 3FZRA 5CU2A 4A4OA 4QP8A 4XV1A 2IG7A 3D7ZA 2C5VA 1Q8TA 3MIAA 3FV8A 4QP2A 2VGPA 5IUHA 2QC6A 4R7HA 1PXIA 4Q9SA 4MCVA 4MKCA 4NJDA 4DFZE 4F6UA 3FI2A 1ZYLA 5E8UA 3SD0A 4KS8A 4UYAA 3EOCA 1NVQA 3F88A 3V5PA 3W32A 4AZSA 1PMNA 3PJ3A 3R22A 5J8IA 4LQMA 2OG8A 1WCCA 2IZTA 3HMIA 2B52A 4HVSA 4R6VA 3PIXA 5CANA 1OIYA 2VTMA 2QONA 2Z7LA 1RE8A 1YHSA 3H0ZA 3LJ2A 2XKFA 4IWOA 2O5KA 5EYCA 5CEMA 5AV2A 4OTRA 1U5QA 1A9UA 3LOKA 3QC9A 4FICA 3LMHA 5A9UA 1ERKA 5E7RA 2F49A 2UZNA 4RPVA 3QXPA 3UVQA 5FXRA 3G5DA 1GZKA 3W18A 5KHXA 1OKWA 3SA0A 3QQHA 5K3YA 3BGZA 2GNGA 5J9ZA 4ALVA 4I6QA 5E8XA 4CMUA 4O0XA 4CLJA 4AW2A 4QMTA 4A9RA 3Q3BA 3E64A 5FEEA 2PMNX 2R3GA 3VAPA 3UPZA 4RJ6A 5E1EA 5M06A 4DH8A 3R9OA 4U0IA 4FOBA 3VBXA 3FLSA 2B7AA 3FLQA 4NL0A 1XH9A 2W4OA 4GUBA 2AUHA 1E9HA 4JNWA 4Y8DA 4FKIA 4IJPA 4C37A 3MTLA 3OZ6A 4ORKA 3A7FA 4P2KA 2BRBA 3BYMA 4F1TA 4IB0A 4MF0A 4YTHA 4RZWA 3IK3A 3G6HA 5M44A 3P7CA 2G2FA 5DBXA 3S0OA 3EQIA 2GTMA 4FOCA 1PRYA 2BDJA 3ZRLA 4MF1A 1KWPA 4I6HA 2J0LA 4AGWA 5A54A 1Q3DA 1YXSA 2HXLA 1VYWA 1GNGA 3QQUA 4MWHA 5DNRA 2YWVA 2JBPA 4ANOA 3C5UA 5AV0A 3KXGA 3CP9A 1JSVA 3Q4UA 4NH1A 2WMXA 2B1PA 4UWCA 3COKA 3OUKA 3QTWA 3H9FA 2GHLA 4PTEA 4XG3A 2B9IA 4ZZMA 2NRYA 3VQUA 2VN9A 3G33A 3NZ0A 4FSNA 5EOBA 4EOLA 3ENHA 5I5ZA 3NNVA 5L2SA 4KNBA 5LVNA 2A27A 3LFSA 3MIYA 3PLSA 4O22A 4XG8A 1JSTA 3QQLA 4F9WA 3E92A 4U3YA 5J1VA 5KX8A 5J95A 4F9BA 3UMXA 5C26A 5L3AA 5L8LA 3SLSA 4JRNA 2YM3A 4QP6A 3OUNB 5EHLA 3DKFA 3WILA 4FTIA 3TKUA 5E91A 3ERKA 4XLVA 3LJ1A 4C4HA 1W82A 3KXHA 5A4EA 4C4JA 4JBQA 5HBEA 3ZH8A 3I0OA 3ETAA 1TQPA 2EU9A 3UTOA 5ANEA 4C61A 4YTCA 4FKPA 3SDJA 3WZDA 1TQMA 5KMOA 3NVMB 1URWA 2GS7A 1ZMWA 3DKGA 3IO7A 3UQCA 4WG4A 2WB8A 3RNIA 1TKIA 3QQKA 4FG7A 4RSSA 4QYHA 3OFMA 3ZOSA 5AV4A 4BY9E 4HCVA 4FC0A 3CTJA 4FF8A 3GENA 4X3FC 4Y95A 3Q6WA 1REKA 5AR8A 2UW5A 3UOLA 2GS6A 4G17A 2Y0AA 4ZLZA 4O7ZA 3QTZA 5AM7A 4DF3A 4QMLA 2CKEA 4XX9A 2E9PA 3AC2A 4WNMA 5DR2A 4YSJA 3PUPA 2F7EE 3LFNA 1H08A 5E92A 4YJSA 4JLCA 3A2CA 3A4PA 2WKMA 4WNOA 2UZTA 3SHEA 5CSWA 4PTCA 3UQGA 4DGNA 4IADA 5M4FA 2YA9A 1KUTA 5EI8A 2GU8A 2LGCA 3VNTA 2UW8A 4AE9A 4CCBA 4JOAA 3GQIA 3JUHA 3OW3A 4IAKA 4L00A 4LV5A 4XG6A 4OUCA 4CKIA 4E4XA 5LMKC 4R1VA 3E7VA 5EW3A 4YP8A 4DTAA 2UVYA 5CSHA 4IH8A 1YOMA 4V04A 4U97A 4EH5A 3F2AA 2YIQA 5KO1A 4L7FA 2YIRA 4BI1A 3WE4A 4EH6A 1PXNA 4EH7A 3KRWA 3R8LA 3V5TA 2YM8A 2PTKA 5CALA 3W2SA 3RTPA 4BCIA 5CF8A 4BR3A 1H28A 2GNHA 4UXQA 5EG3A 4OT6A 3EQGA 3W8LA 2YIWA 3U54A 3MESA 4BDCA 4EJ7A 1ZY5A 1DI8A 1JKLA 3NRMA 5T68A 3ZLYA 1AGWA 2A0CX 3Q52A 4JRVA 4RFZA 5HO6A 5JSMA 2JDSA 4CFWA 3KCKA 2C6EA 3EQHA 4GKIA 3LVPA 4FTLA 4GFMA 2PPQA 2XCKA 4CKJA 4PTGA 5AR7A 1QPCA 4GU9A 2HCKA 1GZNA 4RX7A 4XRLA 2DS1A 2C6KA 2J6MA 4YJPA 3IW4A 4YHJA 3TDVA 5CZHA 2LAVA 4DG2E 1AD5A 3KRXA 4ANNA 2UW4A 4XG9A 3D5WA 4FV0A 3V6RA 4E4NA 3OF0A 5EW8A 5AR2A 4DGGA 4CVAA 3IS5A 4BDDA 5KKRC 5C9CA 4UX9A 2GFCA 4GG7A 4BDEA 3ZO2A 3FLNC 5HI2A 5IA3A 3NNWA 4KIQA 2I0HA 3QA8A 4IXPA 3LPBA 2A19B 3PJCA 4O2ZA 2VTRA 4CFMA 1OUKA 2EXCX 4AA0A 1R1WA 3P9JA 2G1TA 4HNFA 3DT1A 4PRJA 2IW9A 4HZSA 5J9LA 2FVDA 4I0SA 2ZVAA 4BWPA 2QLUA 4QRCA 2VWXA 4EOOA 4DFNA 4CG8A 2X7OA 4AGCA 4C3RA 3VC4A 3D5VA 4ACDA 2XNNA 5LCJA 3DJ6A 4AZTA 5FDPA 2YLFA 3WF5A 4TRLA 2VWYA 3EJ1A 3SGCA 5EYDA 5IH6A 5HHWA 1QL6A 4DHFA 5BNJA 3E8CA 1UVRA 4GU6A 4AOIA 4ENXA 4EZ5A 3R30A 4E26A 5KMNA 3IOPA 4OBQA 5BQ0A 5ETAA 3I81A 3N9XA 3PXFA 4U42A 1K3AA 5AUWA 4R5SA 1JQHA 2C6LA 4D2PA 3NMUF 4M12A 2XZSA 2IZUA 3ORPA 4MNFA 3FBVA 2PVLA 4IAFA 2YAKA 3SOAA 4XRJA 4FTTA 3D14A 3F82A 4Z9LA 2OZAA 3WARA 2XEYA 2BRHA 3MPMA 4DITA 3QF9A 5FD2A 4ITIA 3EIDA 4G6LA 3QWJA 4XHKB 2Q0BA 3OP5A 2W96B 4KABA 3HUCA 4I5MA 3W2RA 3KREA 1YXXA 2QHNA 5L4QA 3R1SA 4QMUA 5CEKA 4C36A 3TCPA 1P4FA 1H1PA 3EKKA 2BKZA 3BE9A 3FLYA 4CMOA 4PMSA 1YOJA 3BE2A 1BUHA 2C6IA 4X2JA 3RPYA 4BCPA 2GFSA 3T8OA 2WTJA 3DTCA 5JRSA 3EZRA 4OR5A 4XG4A 5IEVA 5DEYA 4XV9A 4LMNA 4BGHA 4AX8A 5L6PA 2VGOA 5DG5A 3KXNA 4FL2A 5JRQA 3EQFA 2UW6A 3EN7A 1XKKA 1KE5A 1ZMUA 2R3RA 4LV8A 4DC2A 2PL0A 3BEAA 2WTCA 3SOCA 3VRYA 4UZHA 4FVPA 4DG3E 4FT9A 4IANA 2XJ1A 2QOIA 2Q0NA 3C9WA 4G9RA 3TV4A 3NUPA 3OWPA 3MVJA 2VO7A 3BYVA 3R7EA 4AN2A 4S34A 4P7EA 1E1XA 1FVVA 2C1BA 3OTUA 5ETFA 5L2QA 1SVEA 5CENA 3V6SA 2YJRA 3PIZA 2WQEA 3F9NA 2IZRA 5HOAA 2YM5A 5CU4A 5K9IA 2Z02A 1BKXA 3PJ1A 5D7AA 5A4CA 2XH5A 2OO8X 5KMJA 1A48A 1XH7A 3FUPA 1UWHA 1OVEA 3PXKA 4OTWA 1FGIA 2OIQA 4FZ7A 3S00A 3CQUA 1P5EA 3WOWA 4RX5A 2QOBA 4U41A 4JX3A 4R3RA 4NM5A 4JG6A 4F6WA 1CKJA 2XK6A 4WKQA 5KMMA 2OF2A 4IACA 4ACGA 3AC1A 1F0QA 2HW7A 2QOLA 3CGFA 3OCGA 3OC1A 1UKIA 3PE1A 2ITOA 4G2FA 3QGYA 3R6XA 4I4EA 1SZMA 2J9MA 3QCXA 4O0VA 3D7TA 4RIXA 3QQGA 4YNOA 4QNYA 4DFLA 3KK9A 3NIEA 3MFUA 4FTQA 3U9NA 2W5BA 2WNTA 3BCEA 3IKAA 3NCZA 3RP9A 1G8SA 3MYGA 2BIYA 3JPVA 4TKSA 4AT3A 2X2LA 3DGKA 4ITHA 4L68A 4FVQA 3EN9A 3HUBA 4FV5A 4HYIA 4DEBA 4E6CA 4FI1A 1Y6AA 4X6QC 4R3PA 4U3ZA 3HV4A 4BGGA 3G9LX 1V0BA 3TUBA 2UUEA 3FYKX 5CT7A 5EDRA 5C27A 5FBOA 2PVYA 2FGIA 2YCSA 4GYIA 4BCKA 5BMMA 2GS2A 3DAJA 5JGAA 3OY3A 3LQ8A 3LCKA 3LM5A 3POZA 3LXNA 4YZDA 4LRKA 4FEVA 3FKLA 4EQUA 4RVMA 5HX8A 3C4XA 2QO7A 3RPSA 2X9FA 4ASDA 2VV9A 5CYIA 3K2LA 4AZWA 3BX5A 3P23A 3ZZWA 2YDIA 3O17A 1U5RA 3DQWA 3TIYA 1CKIA 1J1BA 3KB7A 5M08A 4FKOA 2GQSA 3KN5A 1JKTA 5EH0A 3LQ3A 1BI7A 1XH4A 4GYGA 3UO4A 4JBOA 4EHZA 3FXZA 2WOTA 5TO8A 4I4FA 3OG7A 2BAKA 5BVEA 5CAOA 3RNYA 3UQFA 2PVNA 3A4OX 2X8EA 4PPBA 4PP7A 4NFNA 4GVAA 2GNFA 2WMBA 4KA3A 3QHWA 4YTFA 4ZJJA 4K6ZA 4O6LA 4TYEA 5CU3A 3PYYA 2BHHA 2W0JA 4ACCA 2WD1A 4KSQA 3ALNA 5C4LA 2HY81 1GAGA 1H4LA 1XBCA 4APPA 3VS4A 4NTSA 1R78A 5GIPE 2ZOQA 3EQBA 3ENMA 2OJIA 4EK5A 5FP5A 4PNIA 3CSVA 4N4SA 4M15A 3JVRA 5TE0A 2JC6A 5CF6A 2CN5A 5IA5A 3JXWA 4K11A 5I3OA 3SKCA 1PMEA 2VTPA 5AUXA 1H1SA 4IM0A 4ZMFA 3AMBA 3QRKA 4M0ZA 2XUUA 4AXAA 4UMUA 5FM2A 5AM6A 4QMQA 4BCNA 4CT2A 5AEPA 4M3QA 4NU1A 1SYKA 4PDOA 4S33A 4FK6A 2EWAA 5AV3A 3C4ZA 4D1ZA 4C4GA 2V7OA 2X6EA 3L8VA 1IAHA 2B0QA 4QQCA 1CDKA 3KL8A 3V5LA 4AAAA 3ZRMA 4RC3A 2NO3A 4DT9A 5FGKA 1PF8A 4NIFA 4GW8A 4O7VA 4D2RA 4FMQA 3EFLA 1Q41A 2EXMA 1KE6A 2Z7RA 3PXQA 4R5YA 4RQVA 3E63A 4E5BA 3KA0A 3UIUA 4G6OA 2C6TA 3CJFA 4RQKA 2YCRA 2EB2A 4UN0C 4ACHA 3QLGA 1JNKA 2JDTA 2QR8A 4YJVA 4I0TA 3MFRA 2YHVA 4PMPA 4F7NA 2I0EA 4DH5A 2X8DA 4BCFA 2UZVA 2IN6A 3MVLA 4DYMA 5K5NA 3HV5A 4F4PA 4JR7A 4EJNA 1WFCA 1CM8A 2W1EA 3G6GA 3LFAA 3PVWA 4QPAA 3TM0A 2WQMA 4BYIA 2REIA 1Z57A 2VTLA 3FMJA 3NNXA 4J95A 3RZFA 4EOKA 1LPUA 2C6DA 4XP0A 3DNDA 3C0GA 4C3FA 1BLXA 2BMCA 3CKWA 1Q5KA 4WA9A 3ORLA 2XNPA 3GOPA 3AMYA 4HNIA 4F0FA 3E7OA 1YI6A 2P4IA 4ZTRA 2HW6A 2PU8A 4EYJA 4BDAA 4YZNA 4AW5A 3OBJA 4JR3A 5CI7A 4EH3A 3ZDUA 4WUNA 4TYIA 3KY2A 2ZM3A 4J98A 4EKLA 5A4QA 1XWSA 1T46A 1DS5A 3ZS5A 5I9WA 5CEPA 4N0SA 2A1AB 3FXXA 2F57A 4J7BA 1H24A 4JDKA 5GJFA 5GIOE 3I6UA 5K4JA 4ZS4A 4M69A 4F7LA 4FT3A 4M67A 3UODA 3DA6A 2I1MA 1OBGA 2IVUA 5KZ0A 2JIVA 3MFTA 2H34A 3NAYA 1Q8WA 4ZSJA 2WGJA 2YITA 4ZSGA 2IW8A 5IF1A 2PVFA 1B6CB 3MPTA 4MXXA 4Q5HA 4YJOA 4L7SA 4B8LA 5AIRA 1Q8ZA 4IFCA 4RA4A 4RFYA 4DFXE 4TPTA 2EXEA 3F6XA 4CSVA 2W1IA 4BTMA 3L1SA 2BHEA 2YERA 3ZLXA 4EH8A 4RGJA 5HU9A 1JBPE 4BGQA 5FRIA 4FSTA 4Z7HA 4EC8A 3LMGA 3F5UA 4KINA 4Y72A 1YI4A 3O8UA 3OWLA 5H8GA 1PXOA 2IPXA 2YZLA 3GVUA 4MH7A 4D2TA 2YLEA 4F0IA 1G3NA 4O81A 3HZTA 3FQEA 3HKOA 3LIJA 5LARA 4ERWA 4IW0A 2WU7A 4XBRA 3VS1A 5KMIA 2VD5A 1UKHA 2WMSA 4TWCA 3GEQA 3DB8A 4BBMA 4ANMA 5IQHA 2PZ5A 4ZSLA 4F7SA 2W5HA 3FKNA 4L44A 4PDSA 4PQNA 4Y83A 4DBNA 5KBQA 3LLAA 3FLZA 1JSUA 3ROCA 3F61A 1ZMVA 4FZFB 2ITPA 1WVWA 5HLWA 4E4LA 3R21A 1LP4A 2IWIA 3BWJA 4HCUA 4R7IA 5A4LA 3R2YA 4FKUA 4V05A 5FG8A 3ZFYA 4O91A 3UNKA 3MH1A 1JKKA 4KKEA 3GOKA 4QYYA 3MY1A 2YM6A 2JEDA 2XM9A 4L3JA 2QKRA 3F5GA 4IX4A 1KSWA 4H3QA 4R8QA 2OGVA 5CT0A 3TACA 4AN9A 3FY0A 3KK8A 3DBQA 2P3GX 3KN6A 3KULA 4O86A 4ZJVA 4TT7A 3DZOA 2H6DA 2OJFE 4KBCA 3SV0A 2ITZA 4X3JA 3TTIA 4F99A 5HVYA 4IM2A 3PVGA 3D5XA 1QMZA 4DEDA 4EEVA 3OEFX 3FAAA 5AJQA 4RX8A 5EI6A 5I9XA 4G3CA 3A99A 3MY0A 3TUDA 5AWMA 4J71A 4D4RA 3JY0A 5IDNA 2WMVA 3LM0A 4BDJA 1H1RA 5DH3A 2WTVA 4BI0A 3VS3A 3UG2A 3SRVA 3QRIA 4F1OA 4ZY4A 4B7TA 1QPEA 2GPHA 2OZAB 4E5WA 1Y6BA 4EUTA 4F09A 1ZXEA 5EM5A 3CPCA 3HNGA 3ODYX 4KAOA 4RJ4A 1FBNA 4X2KA 2W7XA 4F9CA 4C02A 3E88A 1EH4A 1Q4LA 4QOXA 5L6WL 2YEXA 4YHTA 4AQCA 4P5QA 5F1ZA 4LOQA 2IO6A 5M53A 2B9FA 2W1ZA 4XJ0A 4DGLC 2C5NA 3WYYA 3BPRA 3O50A 4CYIA 4O7LA 4X7QA 4MQ1A 3KRJA 2QODA 3R73A 4IB1A 1B39A 2R3HA 3L9NA 4A4XA 1H00A 5AP3A 4CLIA 1WBPA 4C2VA 2VO6A 2Y4PA 2C69A 4O0SA 4LYNA 2VTQA 4EOPA 4FIFA 4G6NA 2YIYA 4FG8A 4FSUA 3DZQA 4RZVA 2VX0A 2YAAA 3FE3A 3VJNA 4CV9A 5A6OA 1YDSE 2PE0A 3SG9A 4N57A 2XCHA 5BVNA 1YRPA 4G3GA 2R7BA 4WT6A 5AP2A 5LMKA 4K9YA 4X2FA 3IONA 4IX6A 3ZRKA 2C0OA 1H1QA 3LXPA 2J51A 4L9IA 2GTNA 2VTOA 2XK9A 4AA5A 3W8QA 3NSZA 4RBLA 5HCYA 2VTHA 1OITA 3NW7A 4AOJA 2XF0A 2J0MB 3C0HA 3BYSA 4FT7A 5CVHA 5LVOA 3C0IA 4JAJA 1H1WA 3CJGA 4L45A 1MQ4A 2RFNA 5EDQA 5IUGA 5HO7A 5AUZA 2YM7A 4FODA 2VX3A 2EUFB 2FSLX 2XIYA 4IAAA 4LL5A 5LWNA 3HP5A 2CNVA 4GJ2A 3CBLA 5EDPA 5IQAA 2XJ2A 3O71A 1YXUA 4AN3A 4CV8A 2FUMA 4YHFA 4Q9ZA 4ZEGA 2CMWA 4GEOA 4UMQA 5FXQA 2CGUA 3NPCA 5IG1A 3AD4A 3ET7A 2QURA 4DEEA 3PZEA 1R3CA 3MTFA 3QD3A 4ARKA 5HO8A 4L42A 4YU2A 2PUNA 3EL8A 4O2PA 3IGOA 1UA2A 4PY1A 4JQEA 4IE9A 5AAFA 4RIXB 3L8XA 3VBQA 4L01A 5EFQA 4BDKA 4BFMA 1UV5A 2R3LA 3FI8A 4HPUE 4PDPA 2GNJA 4DH1A 2BTSA 4EZ7A 5HD7A 4FKTA 3GC9A 5HTBA 3AT3A 3C7QA 2C0IA 3F3WA 3OVVA 4K8AA 4R77A 3MY5A 4MYGA 4QNAA 4TYHA 3F3VA 4MNEA 3MB6A 4S31A 4YPSA 4DAWA 4EONA 4DFUA 3OT8A 4XG7A 3S1HA 1ZYJA 3VO3A 5M4IA 2J0KA 4FTNA 3L9MA 4U7ZA 2R0IA 4DTBA 5D41A 4XEYA 4Z3VA 4K0YA 3R63A 4KBKA 4YSMA 5E90A 4TL0A 3OS3A 1JOWB 5CLPA 2GMXA 1PW2A 5DRDA 3RAHA 3AC5A 3BKBA 5AV1A 4RWIA 2J50A 3SX9A 4XCUA 3PWDA 3TTJA 2JD5A 3NYXA 2W1DA 4E6QA 4GK3A 4FSMA 2C3LA 3MN3A 3V8TA 5ICPA 1ZYSA 3P0MA 3ZBXA 4FTKA 1U54B 2VWIA 4Y5QA 3VQHA 4EKKA 4RG0A 3FWQA 2VTNA 1M14A 2HAKA 1YHVA 4I0RA 1SMHA 5K0KA 2JGZA 4IMYA 5HEZA 5JN2A 4II5A 2OXYA 3CLYA 4ASZA 3VULA 1TQIA 4BCJA 3A7HA 4AGUA 3Q6UA 3PY1A 3QALE 4N6ZA 3R7YA 4CMTA 3PVBA 4G3EA 4FZAB 4J96A 2A4LA 3OWKA 5AP4A 2BZIB 4A9UA 3MPAA 5K5XA 3NX8A 3F7WA 3DXPA 2I40A 3BHUA 3RINA 1I09A 3U4UA 4HVIA 2C68A 5FTGA 2CN8A 3CCNA 3BV3A 2YZAA 3R8VA 5HG8A 3D0EA 3I0QA 4PNKA 2FA2A 5E4HA 4IZ7A 2J5FA 3QZIA 4KRDA 3T3UA 5IA2A 5BVDA 5IH4A 5IH5A 4GT5A 5AR4A 3BHVA 5BVOA 2WXVA 3Q60A 5HICA 1H01A 3B2TA 4BTJA 2IW6A 4PDYA 3R8MA 2Y4IC 2QNJA 2YCQA 3AT2A 3MB7A 1PXPA 3GT8A 4DN5A 3DK3A 5IQGA 2CGWA 3QTRA 4ANLA 4JAIA 4DH7A 1R0EA 4C59A 3LFEA 1B38A 4XMOA 1MUOA 4C3PA 4F7JA 5EM7A 1PXKA 4YJRA 1NVRA 3DS6A 3PY3A 3IDPA 2CPKE 4PP9A 3QTXA 4EOJA 4FKSA 3ATTA 2UW7A 2UV2A 4QP4A 2CKQA 3E5AA 4ZS0A 2ZV7A 3IGGA 4BHZA 2BFYA 5CXHA 4RLLA 5KCVA 5CWZA 5IQFA 2Z60A 4S2ZA 3OOGA 4U79A 4BIEA 3DXQA 4DEIA 3BIZA 3R00A 4JIAA 4EK4A 4CTCA 4C38A 2HWOA 4QYGA 3DQXA 5J87A 3OXIA 3QUPA 4ZZNA 3UDBA 5HZNA 1W84A 4R3CA 2UW0A 3I7BA 2J0JA 4FSYA 1WAKA 3WF7A 3VRZA 2I0VA 3GCUA 2R3OA 4H3BA 5JH6A 5M51A 3EFWA 4EK8A 4IAYA 2XMYA 3BBTB 3F5XA 4ZJIA 3U6JA 1R0PA 3GP0A 4KWPA 3R28A 5D12A 4KUJA 3W1FA 3H30A 5JMSA 3RCDA 4GK4A 3FLWA 1SVHA 3HV3A 4HCTA 2F9GA 2X6DA 3B8RA 5DA3A 5DPVA 4DT8A 4G31A 4MQ2A 3JS2A 2FSMX 3DBFA 5JKGA 4IVCA 4YO6A 4B9DA 3ZBFA 4WBOA 3TG1A 2JIIA 1PXLA 5DVRA 3UC4A 4L46A 4L52A 3L8SA 4O7NA 5E1SA 2PULA 1G5SA 1LR4A 2O3PA 1YQJA 5EKOA 5IZFA 5J5SA 5H2UA 4P5ZA 1OKZA 4QMVA 4F9AA 5EI2A 4O6EA 4IZAA 3ZXTA 3EQCA 3HMOA 3Q9XA 5CEOA 2WFYA 4J8NA 3MS9A 3UYSA 3ZO3A 1BYGA 4JI9A 3FMMA 5ANJA 3GQLA 2JITA 4C35A 2F7XE 4UV0A 2BTRA 2VWBA 3VS2A 2IZSA 5CAUA 2VTTA 5AX3A 4M69B 3FZSA 4O7SA 3PJ2A 3ZLSA 5HE3A 1UU8A 2HY0A 3ELJA 3DKCA 4BICA 4CD0A 4D2SA 3N4TA 3ZHPC 2B9JA 3EL7A 5FM3A 4GJ3A 2WTWA 4QPMA 3NIZA 4G34A 4D28A 3R1NA 3ZO1A 4WHZA 4YNEA 1GIIA 4QMYA 3Q4ZA 4C57A 5FWKK 4FTCA 4CYJA 3RHKA 3O96A 3O23A 3VF8A 4EH9A 1ND4A 2P55A 4BBEA 1L3RE 2PSQA 3TKIA 4C0TA 3E87A 4CG9A 3FMLA 3PE2A 2W1HA 5ETIA 3QAME 4QTEA 4M84A 4XLIA 2BILB 2VZ6A 3H9RA 1OZ1A 4J8MA 1JPAA 2W1GA 4DLJA 4QP3A 4FKLA 2Z7QA 2QOKA 2OFVA 3EYGA 1Q8YA 4TYJA 5JZNA 4AOTA 1DAWA 3KMWA 4FUXA 2H9VA 4YBKA 3RAWA 5L2WA 4RJ8A 3TNIA 1W7HA 3QC4A 4BCMA 3G51A 3OD6X 4MXOA 1OM1A 4ITJA 2CLXA 2QI8A 3P7AA 4DG0E 5L6OA 4AFJA 4M7IA 1BI8A 3CTQA 3L9PA 1XH6A 3GU5A 4FL1A 3TNHA 5CY3A 2V55A 4NFMA 4C4EA 3VUDA 4MTAA 3HX4A 2O64A 5HCXA 3VF9A 3WZEA 3AOXA 4FSWA 1ZARA 3C51A 4PMTA 2PZYA 3KMMA 1PHKA 1PXJA 3M2WA 1E1VA 3FQSA 3GCPA 2OXDA 3NYVA 3ORXA 3Q2MA 3VBTA 1WBSA 1O6LA 2UZDA 2JKQA 3PP0A 2PVRA 3DAEA 3HRCA 5CQUA 2ITNA 5EK7A 4BKYA 4XOZA 4CFFA 5IA0A 5JEBA 4LGDA 4U6RA 4ZK5A 4MXYA 5ACBC 4E93A 5F20A 4FEUA 5IQDA 1WVXA 1OBDA 4LFIA 1F5QA 3W2CA 3RKBA 4MD7E 2VO3A 4E3CA 4L3LA 2ETRA 4M8TA 4O27B 5HTCA 1Q3WA 4E6DA 5H9BA 4NSTA 1M52A 4HVHA 2PUIA 4JL9A 2X0GA 4RIWB 5B7VA 5J5TA 3Q96A 1Y91A 3Q4CA 4LL0A 4ZY6A 3EZVA 3VWAA 3AT4A 3K54A 3KRRA 3UVPA 2WQBA 3GCSA 3L8PA 4HVGA 1VYZA 3NR9A 4O0WA 2XJ0A 3RMFA 5DWRA 1XR1A 3F5PA 3SRVB 1AQ1A 3PSDA 3CY3A 5I9VA 3R7UA 1YDRE 4FIJA 4GMYA 4XV3A 1Q61A 3TXOA 3MFSA 3ZC6A 4GG5A 1V1KA 4D5KA 2BIKB 4GV1A 3BU3A 4WG5A 3RI1A 3NWWA 4YBJA 4DE4A 3ZUVA 2JDVA 5EHYA 4OW8A 2PVHA 3FXWA 4OBPA 1J7IA 1S9IA 4S30A 4EHEA 2Y9QA 3BV2A 4OAVB 1A06A 2C4GA 1FGKA 3FI4A 3OEZA 4G16A 2ITXA 4AACA 4PPAA 4BWKA 4BZDA 5IDPA 4FGRA 4X3FB 5E8ZA 3QCSA 2OWBA 3FHRA 2G2HA 4RA5A 4FKRA 5B0XA 4IB3A 3BWFA 5E9EA 3P7BA 4NUSA 5HE0A 4F1MA 4OAUC 4MXCA 1FINA 4P90A 3LFCA 4BWXA 4LGHA 3ALOA 3F7ZA 2RFSA 3GC8A 3M42A 2I7QA 4BYJA 4FUYA 4IWDA 3MA3A 5JFVA 4TN6A 1O9UA 4EOSA 3Q5ZA 3UIMA 4V01A 4J52A 3AD6A 5I0BA 1QPDA 5G6VA 3WZKA 1YW2A 4EZ3A 1FPUA 4FIHA 1BMKA 4FYNA 1H0WA 3I79A 3RVGA 4DCEA 4LRJA 4I3ZA 3R7VA 4ZTHA 2H8HA 4BB4A 4YC6A 5A6NA 3JY9A 4AF3A 4IAIA 3VBWA 4RVTA 5CTPA 3Q2JA 2XM8A 1OIUA 5HD4A 3O0GA 4TXCA 1J1CA 5AP1A 3TNWA 2FSOX 2OW3A 3V01A 3SC1A 4CQEA 2ZV2A 3V04A 4C4FA 4EL9A 4HYHA 4QP1A 2OK1A 4FNYA 2PVMA 3PA5A 4FV6A 2XBAA 2J7TA 4B6LA 3D83A 4D9TA 1MRYA 4DCAA 4FTOA 2YN8A 5LVLA 4AG8A 4A06A 4FYOA 1NY3A 4EQMA 5CAVA 4USFA 2XVDA 2XIKA 3BLRA 4WNPA 5DOSA 3VUTA 5C1QB 1Z5MA 4CZUA 4DEAA 3KVWA 2OIDA 4MXAA 5ACKA 2QOCA 4BKJA 3KXZA 3HLLA 3CQEA 4EBVA 4WRSA 2WMWA 1H0VA 2WTKC 4IC8A 4RJ7A 4HW7A 4MNEB 1ZRZA 2XKEA 3VUKA 3CY2A 3ATSA 1U59A 2OZOA 2XK7A 5KKRB 5EM6A 4FKQA 3VHKA 2C30A 3DLSA 4OT5A 2Y6OA 3KRLA 3K5UA 5EYKA 3ROYA 4ZY5A 4U8ZA 1BL6A 3LQ5A 3N51A 4JS8A 4C58A 1GJOA 4KRCA 3FPMA 2W9FB 4FKVA 4FKGA 3VN9A 2BAQA 3ZM9A 1FMKA 4C4IA 4UMRA 2Z2WA 4XUFA 3U51A 4GSBA 5HX6A 5DEWA 2QO9A 3FMDA 2F2UA 2XYUA 3RM7A 4E4MA 3VBVA 2RSVA 4EK6A 4FTUA 4UWBA 3QCYA 1J7UA 3MVHA 3ZMMA 3MH2A 3ACKA 4Z7GA 1XH5A 3MH3A 4PMMA 2X1NA 5F4NA 5F9EA 2PUPA 1NW1A 5AP7A 4H1JA 3E62A 5AADA 3BBWA 4FV2A 4ALUA 3CR0A 1TVOA 2BRMA 1ZYCA 3D9VA 3NEWA 1JKSA 1UNHA 3GCVA 4FTMA 4I5HA 2GHMA 4K77A 4FSRA 4I93A 3CGOA 5KMKA 3VS0A 4TNDA 5HIEA 4F64A 4CNHA 4O7RA 3IECA 3E8NA 1V0OA 3GU4A 4QTBA 5C8MA 4CRLA 5A14A 3MV5A 4ANSA 1MRVA 3RZBA 2HXQA 3RPOA 4W9WA 1UU7A 3UPXA 3O51A 5HKMA 3WIGA 3LMIA 1Y57A 1NVSA 3A7JA 2J2IB 4HGTA 2VUWA 4A9TA 4MAOA 4UZDA 5TR6A 1DM2A 3PLAE 4HGSA 4IAZA 3BHHA 3NUNA 4QP7A 3RM6A 3QBNA 3LFFA 3HA6A 4BVUA 5CAPA 5C01A 2ACXA 3NVKI 2XNOA 4EBWA 3CQWA 1OKVA 1Q24A 2V0DA 4GCJA 4XP2A 5FDXA 4EH4A 2XEZA 3GB2A 2WAJA 3NW6A 3WE8A 1UNLA 4WO5A 4N70A 2E9OA 2ZM4A 2CHLA 3KC3A 4ASEA 2WTIA 4RIYA 4QMPA 4JT3A 5GHVA 5HLNA 3LXKA 4YPDA 4BZNA 4WBBB 2C0TA 2R3QA 4YJNA 5AR5A 4FX3A 4KIKA 4RT7A 2BZKB 3RCJA 1HCLA 2OSCA 1YWVA 3FYJX 3QFVA 4R1YA 3R1YA 1M7NA 4XOYA 3TZ8A 4HGLA 3WZJA 4BHNA 1GY3A 4IQ6A 4TYGA 4XBUA 3RPVA 5JZJA 4Q2AA 3OXZA 4M0YA 3UMWA 5LCKA 4L8MA 3R7OA 3KF7A 2XA4A 4F9YA 2FH9A 4BCQA 2ITQA 3MSSA 4O0UA 5T3QA 5EQPA 4K2RA 3MGYA 4NKAA 3ZU7A 4F0GA 2PWLA 3T3VA 5E8WA 2BUJA 3CD8A 3PY0A 4D58A 3UP7A 3F69A 4DH3A 2H96A 4H36A 4FBXA 3NDMA 3PFQA 1PY5A 2C3KA 3D4QA 4ONAA 5DYJA 4CCUA 5TKDA 4QMOA 2ZMCA 4P4CA 1ZAOA 3FL4A 3SG8A 3ZFXA 3D2IA 5H3QA 4I23A 4RC4A 5I9UA 2EVAA 3S95A 2R3JA 3ORTA 3K3JA 5EOLA 1H8FA 3HRFA 4DGOA 5BYYA 4G5PA 3B8QA 2BDWA 1ZOHA 3DLZA 2XK4A 4I21A 2Y8OA 4NKSA 2DUVA 1YDTE 4QQJA 3V5QA 1P4OA 5H8BA 3E93A 2GNLA 4DLIA 3PG3A 3QYZA 3ZDIA 3HECA
chains in the Genus database with same CATH superfamily
4LOOA 5IKWA 1WBNA 4NTTA 1FMOE 4I24A 3U87A 4KIOA 3HMPA 1P2AA 1ZYDA 5C8KA 1H07A 4YLLA 5IISA 4QTCA 4FEWA 4DBXA 1PJKA 4NM3A 4BF2A 4H1MA 2W1FA 3OTVA 4EOIA 3EQRA 3ZZEA 4GIIA 3LKMA 3FMEA 2DWBA 4YJTA 2O65A 3OCSA 2BALA 3PXRA 5GNKA 1JLUE 4G5JA 3U6IA 5FUTA 4AXDA 4FNXA 3UIBA 1OMWA 2R3MA 3PPZA 3EB0A 2RIOA 2XK3A 4FSZA 4E6AA 2PYWA 3OW4A 3UNZA 3D5UA 4O83A 2W99B 3QUEA 3EFJA 5HNGA 3NYOA 4XG2A 3F66A 5GZAA 1M2RA 5KHWA 4E20A 3G15A 2OF4A 1LEZA 3O8TA 2W1CA 4FIIA 2CNQA 3C4FA 3OHTA 3M1SA 2R3IA 1Q62A 3WYXA 3R7GA 3QD0A 3QRJA 4A4LA 1PYXA 4LMUA 3UOHA 3QTIA 2X81A 3R8ZA 5IQIA 3LCTA 2QLQA 3MH0A 2XKDA 4FL3A 4PL3A 2O0UA 1CMKE 2JKMA 4XP3A 3IPHA 2R2PA 2X9EA 4MEDA 1KV1A 4MD9E 4APCA 4ZMEA 3PWYA 3EQPA 4FZ6A 2OI4X 4JDHA 3EN5A 2JBOA 3II5A 4S32A 3COHA 2RGPA 1OL7A 2QU5A 4ZIMA 3NUUA 2RKUA 1IR3A 4EWHA 3P79A 2P0CA 2E9NA 4O38A 3P08A 4QP9A 2RG6A 4OTDA 2WMUA 5LVPA 3MVMA 3A7IA 5I4NA 1UNGA 3H4JA 3LZBA 3PPJA 5ANDA 4M68A 3V5WA 2DYLA 3TT0A 2G2IA 4O82A 1WMKA 3JVSA 4YMJA 5DR9A 3PXYA 3ANQA 4GS6A 5K4IA 3E8DA 3CEKA 4O4BB 2UZLA 3LAUA 5CVGA 4HGEA 4AXEA 3KFAA 2A2AA 2BZJA 1OL6A 2AC3A 3KMUA 4X2NA 3DFAA 4PL5A 4GVJA 1ZY4A 4DINA 2BZHB 4F63A 4IZYA 3R71A 5JGBA 4ANBA 3FY2A 4RWLA 4ASXA 2ESMA 5JQ5A 2VNWA 3U6HA 2UZWE 2IVSA 1R39A 5ANOA 3EN4A 1GZOA 3N4VA 2RFEA 2WMRA 2YISA 4NW5A 4TY1A 2RL5A 2KTYA 5HVKA 5JK3A 5AAEA 5B2MA 2CDZA 3H9OA 2RF9A 1IA9A 2JFLA 4FA2A 3AGMA 2X4FA 1WBOA 2QOQA 3WF9A 4ZTQA 5LJJA 5CSXA 4DFYA 3SAYA 3UOJA 5HG5A 3ZM4A 5EHOA 2XRUA 1Y8YA 3FQHA 4QPSA 5J1WA 4A7CA 5ANGA 3RK7A 4WSQA 1YVJA 3GCQA 3QYWA 3ZLWA 2P33A 5GJDA 2JKOA 3ZSHA 4RLKA 1W98A 1XO2B 3F3TA 3GU6A 2CJMA 3KKVA 4IHPA 5CSVA 3OCBA 5AIKA 3SW4A 3GGFA 2QHMA 3QD2B 4BKZA 5AUVA 1OUYA 2ONLC 4B0GA 1PMUA 3PFYA 4OBOA 3NW5A 4TWNA 5D1JA 1KOAA 4YJUA 4AT4A 4QQ5A 5BYLA 2PMOX 5FP6A 3QRTA 3S4QA 4CKRA 4BI2A 4AWIA 3AC3A 4EORA 3U9CA 3P78A 5IA1A 4NW6A 1IG1A 3BU6A 3C4CA 4AZVA 1ZLTA 2UVZA 1M7QA 1J91A 3GI3A 4FV9A 3QKMA 3DU8A 4JVGA 4BCOA 3DY7A 4MX9A 1WBVA 5KZIA 2JDOA 3UZPA 4D2VA 3VW8A 4E1ZA 3JYAA 3TEIA 5H8EA 4CFUA 3NUXA 2OICA 5DN3A 2WPAA 4CT1A 3CD3A 4UMPA 3EYHA 3C13A 4D4YA 3F3UA 4Z16A 3TZ9A 4LUEA 3D7TB 5E8VA 5FTQA 3THBA 5DR6A 4W8DA 2R5TA 2WZJA 2DQ7X 3V3VA 4ANQA 4F70A 2OXXA 2HZIA 2HWPA 4M66A 1HOWA 3WZUA 3VJOA 5AX9A 4CRSA 3PZHA 5E8TA 4JG7A 3EH9A 5J9YA 3KGAA 3PRFA 5AA8A 5HU3A 3W0OA 5LXMA 3R7IA 4OTQA 1XJDA 4FJVA 5IQCA 4MK0A 3P4KA 3OWJA 5EW9A 4BC6A 2IVTA 4FIEA 4FT5A 3C4EA 4NM7A 3CKXA 4BIBA 4MUQA 2ZDUA 2ERZE 1H25A 3FJQE 5J79A 1JWHA 4GFGA 3UBDA 3OBGA 4Z55A 5ETCA 3AC4A 4C2WA 5JGDA 5IUIA 1IASA 3ZCLA 4O1OA 1OPKA 3LCOA 4FTAA 4QYFA 1KOBA 3K3IA 4IX5A 4N6YA 4H58A 4FV3A 1LEWA 2X7FA 4YZCA 4CTBA 3CS9A 2BVAA 2GQGA 3H3CA 4JJRA 3VW6A 2AC5A 4Q5EA 2XNBA 2BDFA 4PWNA 1Q8UA 3PP1A 4EQCA 3TIZA 2J0IA 1OB3A 4W8EA 4XNEA 3REPA 2ZB0A 3W16A 4IVAA 2FB8A 2WELA 4O7YA 3R8UA 2HENA 2JFMA 1X8BA 3OXTA 4LM5A 4IX3A 3FPQA 4IDVA 5LOHA 1K2PA 3QZHA 3QWKA 4H3PA 5AFVA 4MVFA 2VU3A 3VS6A 3WBLA 2XP2A 3D15A 4J1RA 4IBMA 2Q83A 3UOKA 3IW5A 1FOTA 1OPJA 2C6MA 2E9UA 3IW6A 5HNBA 4E8AA 4EC9A 3PG1A 4QMMA 4RC2A 3FEGA 5DGZA 2OH0E 2WIPA 3HV6A 4KBAA 2OJ9A 4LI5A 4CFVA 3SVVA 4IWQA 4YJQA 1J7LA 3VIDA 4O96A 2GCDA 4F6SA 5EM8A 2WEVA 1VLRA 5CX9A 3ORMA 3MI9A 4NK9A 4YUQA 2WO6A 3CC6A 4D2WA 2CGXA 4YLJA 4XYFA 5CEIA 2E9VA 2QKWB 2G9XA 4IWPA 3PSBA 3DBEA 4ZTLA 3SXFA 3A60A 3I6WA 2B9HA 1O6YA 4AE6A 4FEXA 4AZEA 2YIXA 2OJGA 3HGKA 1H27A 4K1BA 5M4UA 4EK3A 1HCKA 2ZJWA 3LCSA 3WF8A 3MJ2A 4FZDB 4YZBA 4H05A 3A61A 3KEXA 4QYEA 2WIHA 1OIQA 3DPKA 3AKJA 3TNQB 5TT7A 4UWYA 1V0PA 4MWIA 3FKOA 2X0QA 2E2BA 3MJ1A 3NUYA 4X0MA 3NCGA 4NIFB 4W4XA 5L2IA 5AUTA 3NAXA 3QU0A 3Q9WA 4AT5A 4FSQA 3HL7A 2G15A 3TJDA 3Q32A 4AZFA 2XKCA 5KNJA 1FVTA 3I7CA 3QTSA 4RIYB 3ZONA 4C62A 2B54A 1O6KA 1U4DA 2ETKA 3HDMA 3ZFMA 3PPKA 4KIKB 4ZP5A 4G1WA 2BCJA 4D4SA 5IU2A 4JX7A 4JDJA 4C7TA 1WZYA 4EWQA 5HBJA 1URCA 2IJMA 2NRUA 2YWPA 1PYEA 4ID7A 3BEGA 1NT2A 3BHTA 3LCDA 3A8XA 5HGIA 4NYEA 3G0EA 4FV8A 3TDWA 4E5AX 4WRGA 3VS5A 5KBRA 2Y6MA 2PVJA 2PZRA 3A7GA 2Z8CA 3AD5A 1XH8A 3DV3A 2AQXA 4BTKA 5JFSA 4Y85A 5EYMA 3AMAA 3DXNA 2EB3A 4J53A 1S9JA 2BAJA 5LMAA 2CKPA 2NP8A 3NLBA 1M2PA 4UY9A 5ITAA 4RWKA 3UIXA 4BBFA 4I22A 2XRWA 4ZZOA 1REJA 3ZSGA 2P2HA 4WSYA 3FMNA 3ZEWA 3BYUA 2QR7A 2HZNA 3G9NA 4YGAA 3S2PA 5DMZA 3NFGB 1M17A 3OOMA 4QT1A 5BX0A 3LLTA 5CXZA 1GIHA 2UZEA 4XH6A 5GJGA 3UJGA 4GRBA 3NGAA 2R3KA 3GXLA 3QQJA 2BR1A 4LUDA 1OPLA 3W55A 2WQOA 5IEYA 4PUZA 5CEQA 2JDRA 4QDEA 3BQCA 3R9RA 3EMGA 3RAKA 4BDBA 5HESA 2PVKA 4AS0A 2HYYA 2VTAA 2VNYA 3EFKA 3HRBA 4CFXA 3IG7A 4E7WA 3R9HA 2XNMA 4MBJA 5LVMA 5AP5A 4I6BA 2PUUA 5DT0A 5E8YA 5AR3A 2BKKA 4HOKA 1QPJA 5DFPA 5BVWA 5CF4A 3R01A 5HCZA 5HIBA 2YDJA 4ZTSA 1KE9A 4I41A 5GZ8A 2WEIA 3W10A 1Q99A 3DB6A 2IVVA 4OTPA 4V0GA 1IEPA 3C5IA 3ORIA 1I44A 3QQFA 4O21A 5FXSA 2KULA 2R64A 3G2FA 3BQRA 4FKJA 4NT4A 4IVDA 4EUUA 5JFXA 4EHVA 4UEUA 5HE2A 3WI6A 5AAGA 5L2TA 4L3PA 1U46A 3SW7A 4C34A 1PMVA 3ZYAA 3KQ7A 2I6LA 2ZAZA 1LUFA 1SVGA 1XMLA 4ACMA 3COMA 4I5PA 5IQBA 4I6FA 2ITVA 3V5JA 2AEGA 4YZ9A 2W9ZB 3CIKA 2UW3A 4ERKA 5B2KA 3BYOA 2YABA 3KULB 4CFNA 3O2MA 1CSNA 3DDPA 3Q04A 4E73A 2WMQA 2CLQA 4U80A 3I5ZA 3DJ5A 4U43A 3FMHA 5AA9A 5IA4A 2I0YA 4F08A 5DE2A 2XARA 2CGVA 4QMWA 1IA8A 4ZSAA 4G9CA 4TW9A 3ORNA 4NCTA 4RJ3A 3EHAA 3R83A 4RWJA 2JAVA 2P2IA 3HAMA 1XHAA 3QKLA 3QTQA 2GHGA 4K33A 2PZIA 3CTHA 2OFUA 4QMXA 3TWJA 3W33A 4IIRA 2C5OA 2Y4IB 3FI3A 3Q5IA 3NYNA 2OH4A 3VBYA 4D0WA 3ULZA 4USEA 2ITTA 4U5JA 4KB8A 4K18A 5ANIA 4DTKA 4ZLYA 3BI6A 3R9DA 4IDTA 3DK7A 3ORZA 2C1AA 3MDYA 5BPYA 5GZ9A 3OMVA 5DT4A 2V22A 3FMKA 4I92A 3EKNA 4FK3A 2JAMA 3AQVA 3PA3A 4GT3A 1OKYA 3VUHA 3D2KA 2ITUA 4LV7A 4RX9A 4CEGA 1W8CA 2VWWA 5HE1A 5IEXA 4ZLOA 1Q97A 3BZ3A 3HMMA 2OIBA 4OTHA 1QCFA 2Z7SA 2VWUA 4JMQA 3C4WA 3VUGA 3E8EA 2YACA 4XS2A 4D55A 3KXXA 4OTFA 5FBNC 4KD1A 4BDIA 4O0TA 1RDQE 4KS7A 4NZWB 4ZTMA 3TL8A 2C47A 5CF5A 5LWMA 3LXLA 4WUAA 2OBJA 4F65A 3FZOA 2PZPA 3FHIA 3GU7A 3GC7A 3PIYA 5C4KA 1F3MC 4C8BA 5EQYA 4HZRA 2JLDA 2FYSA 4JXFA 3ORKA 2W05A 3QLFA 3RK5A 2CCIA 2X7GA 5JT2A 2B53A 4YZMA 3DCVA 5LMBA 3EWHA 4NEUA 3GBZA 3R0TA 2ETMA 2HOGA 3NNUA 3PJ8A 4QD6A 4GKHA 5T6KA 4ZTNA 3RBWA 3QZFA 2ITWA 2GDOA 5BMSA 5I3RA 2OKRA 2NYAA 3P5KA 5A3XA 2R0UA 2ITYA 4RVKA 2FSTX 4KKHA 3RGFA 2XNEA 4FEQA 3UVRA 2PE2A 2XIZA 2JIUA 4QTAA 4I5CA 5CS6A 1Z9XA 4QMNA 4J97A 4WOVA 1MP8A 2BROA 3UGCA 4U81A 3PRIA 4Y73A 1RQQA 5JFWA 1J3HA 2ERKA 4Y46A 1SNXA 3M11A 4M97A 3F2RA 3NS9A 4TWOA 5CU6A 2CCHA 3KU2A 2WOUA 4ENYA 2O63A 1XQZA 1YXTA 4FG9A 5ANKA 5D7VA 4ZOGA 4FT0A 1CKPA 3LW0A 3U8WA 3I5NA 5CSPA 4IM3A 3OROA 4PF4A 2UZUE 5FTOA 5FLFA 4TYHB 4MHAA 3LFQA 3DFCB 4FV4A 4IC7A 5M55A 3RPRA 5GINE 2C3JA 4O7TA 2QU6A 1K9AA 2X0OA 3COIA 4O7WA 2VWZA 3Q9ZA 5F95A 4O0YA 1VZOA 4GUEA 1KV2A 4HYUA 1UU9A 5HG7A 3SQQA 4UXLA 4X6RA 2X2KA 3ZTXA 2XIXA 3O7LB 3DNEA 4ZAUA 3BU5A 1Y8GA 3UC3A 2ZV9A 2J90A 1GZ8A 3QX4A 3E3PA 1OIRA 2WMTA 3L9LA 4MD8E 5DHJA 2YCFA 3DOGA 5HIDA 3DDQA 2R4BA 4JQ7A 4KIPA 2XB7A 4OTGA 3RAIA 3TKHA 1U54A 2AYPA 2WMAA 4G3DA 2JKKA 3FDNA 1PKDA 1YI3A 5J7HA 3HDNA 2HELA 3GUBA 3QKKA 4MBIA 3DJ7A 3ITZA 3VUMA 3R02A 4YLKA 3UDSA 3FL5A 3POOA 2ZMDA 1SNUA 4FIGA 3R8PA 4D1XA 4YURA 2PK9A 5E8SA 3BGPA 4QTDA 2HZ0A 4IFGA 2J5EA 4NWMA 3BHYA 3UG1A 3A62A 3W2OA 1YKRA 3TJCA 4FE2A 3BLQA 3DAKA 4YTIA 3FSFA 3QCQA 4BIDA 4AQKA 3DKOA 2UW9A 2BFXA 3DTWA 4JDIA 2X8IA 2C5YA 3VUIA 3VHEA 3H0YA 1IRKA 5D9HA 5CQWA 2R7IA 4LRMA 4NCTC 4PPCA 3TV7A 3W2PA 3ZO4A 4JQ8A 5HQ0A 4UBAA 3Q9YA 2VWVA 2YM4A 5FQDC 3SXSA 4D0XA 3OCTA 3GU8A 3TZMA 5BVFA 5IPJA 1KE8A 4FNZA 2O8YA 3CXWA 3TI1A 4BZOA 4DEHA 2VTSA 1W2CA 4OTIA 3P5JC 3A8WA 3UZRA 1GIJA 2ZM1A 3T9IA 4EOMA 4HVDA 3MA6A 1NXKA 4B99A 3F3ZA 3P86A 3RK9A 3W2QA 3NUAA 1WVYA 3C50A 5D10A 2QG5A 3R04A 4U44A 4UB7A 2OLCA 4W4VA 3HAVA 3HP2A 5BUJA 5D11A 4AFEA 3TV6A 3GFWA 4JG8A 4Y5HA 5LQFA 3UNJA 4W4WA 2VTJA 1MRUA 5A4TA 1IAJA 3CPBA 2V62A 3DK6A 2XS0A 2B4SB 5AP6A 3ZXZA 3T9TA 4AW0A 4I94A 1DI9A 3RWPA 1ZZ2A 2CNUA 4USDA 2Y7JA 3I1AA 5DT3A 4EI4A 4A9YA 3BRBA 4FKWA 4FNWA 3H10A 2ONLA 4YR8A 5HVJA 3V8SA 5HBHA 4CXAA 2GSFA 4DEGA 1ATPE 4A9SA 3VVHA 5M07A 1XBBA 4W9XA 1DAYA 2IEWA 2O2UA 4GFOA 5AP0A 4FTRA 4ZXTA 2RG5A 5FEDA 5C03A 2GQRA 5M09A 2X4ZA 4L6QA 3BELA 3PVUA 4HPTE 4LG4A 4TWPA 4EYMA 4O84A 3HMNA 5L8JA 1UWJA 2PMIA 3HEGA 4AUAA 3MBLA 4U40A 1P14A 3N4UA 2QCSA 3FSKA 3KCFA 4WG3A 2QOFA 4L67A 2C3IB 2YDKA 1XBAA 5CI6A 3BLHA 3PXZA 2BPMA 4AU8A 4EHGA 3UO6A 4G3FA 1WBWA 5BUEA 4YO4A 5KMLA 3ZUUA 4ALWA 3KXMA 2UZOA 2NPQA 3QTUA 1UU3A 4X2GA 4BDGA 5HTIA 5M56A 2WTDA 1FQ1B 3HYHA 5AMNA 3QRUA 2WU6A 1OECA 3IQ7A 2PHKA 2VX1A 3V51A 4QMSA 3P1AA 2R3FA 3GNIB 4X21A 3G90X 4FVRA 3TMOA 3ID6C 3PSCA 4D9UA 4MBLA 2HIWA 4OGRA 2F2CB 3GFEA 3OT3A 2SRCA 3NUSA 3Q4TA 3R1QA 4L43A 4BRXA 3UZTA 2W4KA 4DFBA 4DA5A 3S3IA 1W83A 3QD4A 4RIOA 4A07A 5M4CA 5CU0A 3IOKA 3UP2A 3U55A 4I1ZA 4PV0A 3QX2A 4FV7A 2G01A 4H39A 4QO9A 3RALA 4IZ5A 3RJCA 1OI9A 5CAQA 5TOZA 1ZZLA 4W4YA 4XV2A 2ZYBA 4DHIB 2QVSE 4GL9A 3MW1A 4FR4A 4GT4A 3IW7A 2X0PA 2GNIA 2UZBA 3AC8A 3BGQA 3IDBA 4KKGA 3R2BA 4FRFA 3ANRA 3F2NA 4OLIA 5KE0A 3TN8A 3ZEPA 4BCGA 5BYZA 3UO5A 2WTKB 4GK2A 3K5VA 5CNOA 3OY1A 4D5HA 1WBTA 3D94A 4ZSEA 4D4VA 2R9SA 3B2WA 3ZC5A 5BUIA 2CKOA 1VJYA 2F7ZE 1JVPP 5B2LA 3IW8A 5CZIA 4UMTA 3DBCA 5DI1A 4BCHA 3E3BX 5M57A 3JR1A 3ULIA 5KUPA 2VO0A 4AP7A 5AUUA 3O7LD 1ZOEA 2C6OA 3QA0A 4IVBA 5AUYA 3HV7A 2W17A 4CZYB 1ZWSA 1YXVA 2HK5A 3Q53A 4V0GB 3R9NA 3RWQA 2XNGA 2QOOA 5C8NA 4YC8A 1YOLA 5JQ8A 2V7AA 3UE4A 1OL5A 3U4WA 2VAGA 2BRGA 4BN1A 3ZSIA 2QQ7A 2C5XA 3GC0A 3AG9A 4RVLA 2QO2A 2HZ4A 2ZV8A 4FGBA 4EOQA 3LE6A 2W5AA 1H26A 3KF4A 4TTHB 2VRXA 4M13A 3LFBA 4EH2A 3WIKA 2WHBA 5DLSA 1W0XC 4NM0A 4O1PA 4D1SA 3O8PA 2XK8A 4WIHA 3CE3A 2WQNA 2W4JA 3I4BA 4QQTA 2V5QA 2YFXA 3G0FA 4RMZA 4IJ9A 5CNNA 1YWNA 4FTJA 3LJ0A 3UYTA 4JIKA 3V8WA 4CQGA 1OGUA 4QMZA 2R3PA 4JBPA 4TNBA 3TUCA 3FZTA 3VS7A 4YC3A 4GIHA 3QHRA 4J99A 4BL1A 5L8KA 4RIWA 2FO0A 3C1XA 3LFDA 3HVCA 4UYNA 4JBVA 4CZTA 5EKNA 5I9YA 3QGWA 1RJBA 2PMLX 1OL1A 2B55A 2VTIA 4M14A 3FC2A 1GOLA 4AA4A 3TZ7A 1M2QA 4RFMA 4GH2A 2W06A 4HYSA 3I60A 2OU7A 4MXZA 1PKGA 4IB5A 1G8AA 3DBDA 4TZRA 2OJJA 5J7BA 3WF6A 3EN6A 5CVFA 2F4JA 1NA7A 4O0RA 2PE1A 3PA4A 5DIAA 1SM2A 4B8MA 1CTPE 3QZGA 3QXOA 1STCE 3KVXA 3TNPC 5IQEA 1BX6A 4RRVA 5HNIX 3IDCA 2XIRA 4C33A 2CSNA 4NJ3A 3QL8A 3ODZX 4RJ5A 4U9AA 2X39A 4BDFA 5HG9A 1BL7A 1T45A 1VR2A 3MWUA 4IEBA 2BRNA 5I9ZA 5HORA 4I20A 4WD5A 2R3NA 2QOHA 1RW8A 3FC1X 5A46A 5F94A 2J4ZA 2ZB1A 4X3FA 3SXRA 4L53A 5TF9A 2XBJA 3AGLA 3EQDA 1PXMA 2UVXA 4DGMA 1YHWA 1APME 2ZDTA 4FV1A 2X2MA 4LOPA 5DRBA 5EQEA 2NNWB 3FZPA 3PTGA 2XYNA 2YJSA 2PY3A 5CASA 4AGDA 4AW1A 1OL2A 3FZ1A 4PL4A 4PX6A 3PDTA 5G1XA 1KE7A 2QG7A 4R78A 4BDHA 1JAMA 4HJOA 4B4LA 5BVKA 4UALA 4CGAA 4KSPA 4BTFA 5IMXA 1MQBA 3ACJA 4R7BA 1VEBA 1ZOGA 4WNKA 3RHXA 3W0SA 3LHJA 3AXWA 3ZUTA 3QUDA 4LGGA 3HA8A 4U45A 1FVRA 2QD9A 5K0XA 5IMEA 2RFDA 5HLPA 1YWRA 1L8TA 3FZRA 5CU2A 4A4OA 4QP8A 4XV1A 2IG7A 3D7ZA 2C5VA 1Q8TA 3MIAA 3FV8A 4QP2A 2VGPA 5IUHA 2QC6A 4R7HA 1PXIA 4Q9SA 4MCVA 4MKCA 4NJDA 4DFZE 4F6UA 3FI2A 1ZYLA 5E8UA 3SD0A 4KS8A 4UYAA 3EOCA 1NVQA 3F88A 3V5PA 3W32A 4AZSA 1PMNA 3PJ3A 3BL7A 3R22A 5J8IA 4LQMA 2OG8A 1WCCA 2IZTA 3HMIA 2B52A 4HVSA 4R6VA 3PIXA 5CANA 1OIYA 2VTMA 2QONA 2Z7LA 1RE8A 1YHSA 3H0ZA 3LJ2A 2XKFA 4IWOA 2O5KA 5EYCA 5CEMA 5AV2A 4OTRA 1OGYA 1U5QA 1A9UA 3LOKA 3QC9A 4FICA 3W0NA 3LMHA 5A9UA 1ERKA 5E7RA 2F49A 2UZNA 4RPVA 3QXPA 3UVQA 5FXRA 3G5DA 1GZKA 3W18A 5KHXA 1OKWA 3SA0A 3QQHA 5K3YA 3W0QA 3BGZA 2GNGA 5J9ZA 4ALVA 4I6QA 5E8XA 4CMUA 4QDVA 4O0XA 4CLJA 4AW2A 4QMTA 4A9RA 3Q3BA 3E64A 5FEEA 2PMNX 2R3GA 3VAPA 3UPZA 4RJ6A 5E1EA 5M06A 4DH8A 3R9OA 4U0IA 4FOBA 3VBXA 3FLSA 2B7AA 3FLQA 4NL0A 1XH9A 2W4OA 4GUBA 2AUHA 1E9HA 4JNWA 4Y8DA 4FKIA 4IJPA 4C37A 3MTLA 3OZ6A 4ORKA 3A7FA 4P2KA 2BRBA 3BYMA 4F1TA 4IB0A 4MF0A 4YTHA 4RZWA 3IK3A 3G6HA 5M44A 3P7CA 2G2FA 5DBXA 3S0OA 3EQIA 2GTMA 4FOCA 1PRYA 2BDJA 3ZRLA 4MF1A 1KWPA 4I6HA 2J0LA 4AGWA 5A54A 1Q3DA 1YXSA 2HXLA 1VYWA 1GNGA 3QQUA 4MWHA 5DNRA 2YWVA 2JBPA 4ANOA 3C5UA 5AV0A 3KXGA 3CP9A 1JSVA 3Q4UA 4NH1A 2WMXA 2B1PA 4UWCA 1W2FA 3COKA 3OUKA 3QTWA 3H9FA 2GHLA 4PTEA 4XG3A 2B9IA 4ZZMA 2NRYA 3VQUA 2VN9A 3G33A 3NZ0A 4FSNA 5EOBA 4EOLA 3ENHA 5I5ZA 3NNVA 5L2SA 4KNBA 5LVNA 2A27A 3LFSA 3MIYA 3PLSA 4O22A 4XG8A 1JSTA 3QQLA 4F9WA 3E92A 4U3YA 5J1VA 5KX8A 5J95A 4F9BA 3UMXA 5C26A 5L3AA 5L8LA 3SLSA 4JRNA 2XANA 2YM3A 4QP6A 3OUNB 5EHLA 3DKFA 3WILA 4FTIA 3TKUA 5E91A 3ERKA 4XLVA 3LJ1A 4C4HA 1W82A 3KXHA 5A4EA 4C4JA 4JBQA 5HBEA 3ZH8A 3I0OA 3ETAA 1TQPA 2EU9A 3UTOA 5ANEA 4C61A 4YTCA 4FKPA 3SDJA 3WZDA 1TQMA 5KMOA 3NVMB 1URWA 2GS7A 1ZMWA 3DKGA 3IO7A 3UQCA 4WG4A 2WB8A 3RNIA 1TKIA 3QQKA 4FG7A 4RSSA 4QYHA 3OFMA 3ZOSA 5AV4A 4BY9E 4HCVA 4O4EA 4FC0A 3CTJA 4FF8A 3GENA 4X3FC 4Y95A 3W0MA 3Q6WA 1REKA 5AR8A 2UW5A 3UOLA 2GS6A 4G17A 2Y0AA 4ZLZA 4O7ZA 3QTZA 5AM7A 4DF3A 4QMLA 2CKEA 4XX9A 2E9PA 3AC2A 4WNMA 5DR2A 4YSJA 3PUPA 2F7EE 3LFNA 1H08A 5E92A 4YJSA 4DHJA 4JLCA 3A2CA 3A4PA 2WKMA 4WNOA 2UZTA 3SHEA 5CSWA 4PTCA 3UQGA 4DGNA 4IADA 5M4FA 2YA9A 1KUTA 5EI8A 2GU8A 2LGCA 3VNTA 2UW8A 4AE9A 4CCBA 4JOAA 3GQIA 3JUHA 3OW3A 4IAKA 4L00A 4LV5A 4XG6A 4OUCA 4CKIA 4E4XA 5LMKC 4R1VA 3E7VA 5EW3A 4YP8A 4DTAA 2UVYA 5CSHA 4IH8A 1YOMA 4V04A 4U97A 4EH5A 3UDZA 3F2AA 2YIQA 5KO1A 4L7FA 2YIRA 4BI1A 3WE4A 4EH6A 1PXNA 4EH7A 3KRWA 3R8LA 3V5TA 2YM8A 2PTKA 5CALA 3W2SA 3RTPA 4BCIA 5CF8A 4BR3A 1H28A 2GNHA 4UXQA 5EG3A 4OT6A 3EQGA 3W8LA 2YIWA 3U54A 3MESA 4BDCA 4EJ7A 1ZY5A 1DI8A 1JKLA 3NRMA 5T68A 3ZLYA 1AGWA 2A0CX 3Q52A 4JRVA 4RFZA 5HO6A 5JSMA 2JDSA 4CFWA 3KCKA 2C6EA 3EQHA 4GKIA 3LVPA 4FTLA 3ML1A 4GFMA 2PPQA 2XCKA 4CKJA 4PTGA 5AR7A 1QPCA 4GU9A 2HCKA 1GZNA 4RX7A 4XRLA 2DS1A 2C6KA 2J6MA 4YJPA 3IW4A 4YHJA 3TDVA 5CZHA 2LAVA 4DG2E 1AD5A 3KRXA 4ANNA 2UW4A 2XAMA 4XG9A 3D5WA 4FV0A 3V6RA 4E4NA 3OF0A 5EW8A 5AR2A 4DGGA 4CVAA 3IS5A 4BDDA 5KKRC 5C9CA 4UX9A 2GFCA 4GG7A 4BDEA 3ZO2A 3FLNC 5HI2A