3KXNA

Crystal structure of z. mays ck2 kinase alpha subunit in complex with the inhibitor tetraiodobenzimidazole (k88)
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
327
structure length
327
Chain Sequence
SKARVYADVNVLRPKEYWDYEALTVQWGEQDDYEVVRKVGRGKYSEVFEGINVNNNEKCIIKILKPVKKKKIKREIKILQNLCGGPNIVKLLDIVRDQHSKTPSLIFEYVNNTDFKVLYPTLTDYDIRYYIYELLKALDYCHSQGIMHRDVKPHNVMIDHELRKLRLIDWGLAEFYHPGKEYNVRVASRYFKGPELLVDLQDYDYSLDMWSLGCMFAGMIFRKEPFFYGHDNHDQLVKIAKVLGTDGLNVYLNKYRIELDPQLEALVGRHSRKPWLKFMNADNQHLVSPEAIDFLDKLLRYDHQERLTALEAMTHPYFQQVRAAENS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Casein kinase II subunit alpha
publication title ATP site-directed inhibitors of protein kinase CK2: an update.
pubmed rcsb
source organism Zea mays
molecule tags Transferase/transferase inhibitor
total genus 113
structure length 327
sequence length 327
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2009-12-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3kxnA01
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3kxnA02
2BROA 2YM7A 3L8SA 4UYAA 2XP2A 1FMOE 3VRZA 3C4WA 2DS1A 4GIIA 4OLIA 3VS5A 4DF3A 4PWNA 1RW8A 2XNMA 5L3AA 4ANQA 4FVPA 2CN5A 3HV6A 3RBWA 2PVNA 5T68A 4HNFA 1J1CA 2BRHA 5L2QA 2YA9A 4AU8A 2ZB1A 3FQHA 5FEDA 3G2FA 4X7QA 4EK4A 2PMOX 4ZEGA 3ENMA 4A9TA 4QMPA 4GK2A 4RVMA 1FVTA 3VHKA 2QOIA 3FHIA 5AV0A 5FP5A 4R78A 2C47A 2Q0BA 5ETCA 4DH7A 4E4NA 4HVHA 4AGDA 5C8NA 2X0GA 4YO4A 3MH2A 3COIA 5J9LA 2OFVA 4HYIA 2VO0A 3ALNA 3DBQA 5CAVA 4MCVA 2PPQA 4GUBA 4UY9A 4XX9A 1OITA 4WNKA 3V8SA 4FG9A 5FXRA 2YZAA 4MAOA 2WZJA 3BHHA 2ITNA 5DA3A 3VRYA 3IGOA 5KBRA 2BHHA 5DNRA 3W18A 3N4TA 2PVHA 3A60A 5H3QA 4DTAA 3F3ZA 4FV7A 4JG6A 1Q8WA 3DFAA 4WIHA 3OZ6A 3HV4A 4IX4A 4JL9A 4E5AX 4NH1A 2BRMA 2RG6A 4Z16A 2UZOA 3AG9A 3KF4A 5IEXA 2WXVA 5FTQA 3SAYA 5CASA 5K0KA 5FXQA 5HICA 3U87A 1UWJA 4C62A 3NNWA 5HI2A 2DYLA 3KRRA 1YXXA 4FIEA 3SX9A 3UBDA 4EC9A 3NMUF 4G17A 1U4DA 4D0WA 3Q2MA 4RBLA 4F4PA 4PQNA 4BBMA 4FKOA 4XG3A 5IEVA 3KF7A 4KBAA 5HCYA 4R8QA 5KZIA 2WMSA 3N4VA 5IU2A 2V7AA 5F95A 3NGAA 4C57A 1OUYA 1UU3A 3OD6X 1BL6A 3G9LX 1M14A 5ICPA 3ZDUA 2ZV7A 4IBMA 4TNDA 2NRYA 4OTHA 3LJ0A 5ETAA 5L2SA 1JSUA 3QQHA 3SVVA 2F49A 3MPMA 4I6QA 2GTNA 3CGFA 3O8TA 1A48A 2X9FA 2Z7SA 2EB3A 2RKUA 5DIAA 2ONLC 2V5QA 2W4KA 3PVWA 4AUAA 3Q04A 5A3XA 3S0OA 4AE9A 3LLAA 3PJCA 2CDZA 4AW0A 1YXTA 2IZRA 4KIKB 4PPAA 3ZO3A 4AF3A 1ZYJA 3NUSA 3NIEA 4NW6A 3WZUA 5GZAA 1UKHA 3OWLA 4FEUA 4CQGA 5L6WL 4EOMA 3QC9A 3T3VA 3UC4A 4BDJA 4GYIA 3ZU7A 4CKIA 3ZLYA 3F3TA 1H1WA 2WIPA 3GC7A 5KMIA 4RWLA 4XJ0A 4RZWA 1ZYLA 2YITA 1H00A 4ZTSA 4QTBA 5BUJA 2RG5A 4PNIA 1P4FA 5CXZA 3SOAA 3ZH8A 2OJFE 4YLKA 4D2RA 2P4IA 3R28A 5DN3A 3I5NA 1CMKE 4J97A 2ZJWA 3DY7A 4BI2A 3UQGA 5GNKA 4WD5A 3S2PA 4AGCA 2VD5A 4QMSA 4BI0A 1Z57A 4GT4A 3GB2A 4XV1A 3E3BX 3PE2A 4FT5A 3EN4A 3P9JA 1MUOA 3OC1A 4FTOA 5E1EA 5I4NA 4GVAA 3GU6A 3MBLA 1NY3A 4GW8A 2YFXA 4FEWA 2OGVA 4CZYB 4QNYA 3GP0A 5CEPA 4DITA 1REJA 1YDRE 4RX9A 4EH4A 3EQRA 1W84A 3CCNA 5ANOA 4CMOA 4DEEA 4QMQA 2PZ5A 3D2IA 5EK7A 3U6HA 4MXCA 1XO2B 1LEZA 4NWMA 4WRGA 2KULA 3T8OA 4L6QA 4D4VA 5CU6A 3ZO1A 4DGOA 4ANMA 3AC3A 2WQMA 2UW3A 4CKJA 2A19B 3R1QA 4FKIA 5C03A 3BEAA 4YUQA 4PMMA 5HESA 4AG8A 2B9HA 4FZ6A 2W5AA 4FK3A 3W1FA 5A9UA 3NPCA 4YZBA 5LARA 3A7IA 3E3PA 4LRKA 3K54A 3ZFMA 1G8SA 4EOLA 3UODA 5J9YA 3SW7A 4QD6A 1URWA 1XJDA 3ET7A 3R6XA 4IAZA 4YJQA 3R8PA 4AN2A 3BX5A 1RE8A 4RIOA 1KE5A 4HNIA 3ZXZA 1UWHA 4N6YA 3VS3A 5IF1A 4NIFA 4F9BA 2ITVA 3JUHA 4RX5A 3MIYA 1R1WA 2EU9A 4XH6A 5IZFA 2IVSA 3H4JA 5L8LA 2ZM1A 2WGJA 2YJRA 3EL7A 2B9FA 3O0GA 4JBQA 2J9MA 5EKOA 4F7JA 4RX7A 3VAPA 4P5ZA 3LCDA 4ANNA 1APME 4G9CA 5I9ZA 1BL7A 3HMOA 3FZSA 4DH8A 2X39A 4OTGA 4FKRA 2C6LA 3KB7A 3ZUVA 2W17A 3PIYA 3OY1A 4F1OA 4IWDA 5E8VA 4AOTA 3PLAE 1ZXEA 4MH7A 3UJGA 4ZIMA 1YDTE 1SVEA 3ANRA 3VBTA 4BGGA 5HLWA 4OTIA 4C8BA 5LVLA 3EIDA 4PTCA 2J5FA 5G1XA 1GY3A 3DLSA 4TYHB 4XMOA 4ZSLA 5FDXA 2A27A 4P4CA 4XRJA 3ZUUA 4ANBA 3BHUA 3UDBA 3FLSA 1ND4A 4WNOA 3F2AA 4XLVA 1M2RA 4N4SA 5A46A 4ZY5A 3OTVA 4E1ZA 2BZHB 2XEZA 4OAUC 3CS9A 3DB6A 3ALOA 3FWQA 4FV9A 4XG7A 3DK7A 2Q0NA 2UW0A 3JY9A 3TUDA 2PL0A 4HJOA 4D2VA 4C4IA 3VBYA 3B2TA 2IZUA 5CSWA 5JEBA 1J7IA 5IQEA 4O1OA 1VJYA 3UIXA 1HCKA 1FGKA 4IM3A 1BI7A 4ASZA 5AAGA 2ZMDA 4HZSA 2UZTA 2WQEA 4FSYA 3BHTA 4H3QA 1KV1A 3LFNA 2X2KA 4G6LA 4OTFA 3PPKA 4FV2A 3ZYAA 4MBIA 3A7FA 1XH8A 3P0MA 3FLWA 3MA6A 3LJ2A 3RINA 5CXHA 3UYSA 5DYJA 4FYNA 2G01A 2P2HA 3D5VA 4FG8A 1M2QA 5KKRC 5FRIA 5ANIA 2CGVA 4EONA 4O0WA 4O0VA 3FC2A 4UV0A 2XK7A 2WMXA 3W2QA 3PVUA 1XWSA 1JAMA 4WO5A 5CVFA 3FPQA 5HVJA 4EOSA 3Q2JA 2A2AA 1I09A 2YZLA 3PSDA 4X3FB 4QMOA 5IQCA 3EL8A 3PA4A 4KIKA 5ANJA 4PTEA 3ZS5A 4FSQA 3ORPA 4UYNA 2V55A 4DC2A 4O7LA 4FODA 4QPMA 4X6QC 4NM5A 5CEOA 4R7IA 2R7IA 3KGAA 2BMCA 2W9FB 3UG1A 1OM1A 2F7XE 1K2PA 3ZUTA 5BVFA 2UZNA 4V05A 3E64A 3LHJA 2BTSA 3COKA 3AC2A 1SZMA 3CPBA 3D7TB 3RKBA 4ORKA 3E93A 2ITZA 4C37A 5HCZA 5BUIA 1J7UA 2YEXA 4MVFA 4UEUA 4ENYA 4ZZNA 2CNQA 5AR4A 4FNYA 4RIYB 3L8PA 2C3LA 2J0IA 3F5PA 4L53A 4U44A 4UBAA 1BYGA 4DCEA 3OCSA 4XG6A 3LM5A 1OBDA 3ROCA 3OXIA 2EUFB 1OKYA 3JVSA 2BILB 3WF5A 3KQ7A 4JI9A 3H0YA 4ZTRA 3WIKA 3HX4A 3OBGA 5CTPA 4AGUA 3B2WA 4YPDA 4AT3A 5CEMA 3NYNA 5JFSA 5H8BA 1BLXA 2PK9A 3QA8A 2XK3A 4RA4A 4TYIA 2ITOA 4E4XA 4G3GA 3V8TA 4EQMA 3V6SA 2GS7A 2QCSA 1WCCA 2W5BA 3EJ1A 5FQDC 4GSBA 5HE1A 1G8AA 3TWJA 4QT1A 4R5SA 3R8MA 3W32A 2VO7A 4L00A 5F4NA 4CV9A 3DXNA 3GU4A 4BZOA 2IW8A 3RGFA 4IXPA 1J1BA 3OWPA 4XP3A 5EDRA 3W2OA 1Q8UA 1SM2A 3L9PA 4DBXA 3AQVA 1H1RA 2QU6A 4NL0A 1PW2A 4M66A 3HAMA 4A7CA 5K9IA 3R21A 4U45A 3FI4A 1QCFA 3KREA 3CQWA 4L3PA 5H8EA 4FSUA 2BHEA 4GS6A 4EBWA 3BYMA 2BRNA 5EOLA 2W1CA 4BCPA 3OBJA 5J1VA 5AV1A 3I4BA 4GT3A 4NKSA 4E7WA 3ORLA 1H24A 2E9UA 3A7JA 3QFVA 4NM7A 4RX8A 2OICA 5H2UA 5EQYA 2UZBA 3W2SA 5HG7A 1QPEA 5IDNA 3Q60A 4QQ5A 2OIQA 5HO6A 3IDPA 3UE4A 2I40A 3QKMA 2C1BA 2UW9A 2XJ2A 4DEDA 3R9RA 4IB5A 4E4LA 3AC4A 1TVOA 3DZQA 4RFZA 4KRDA 1U46A 5JN2A 1F0QA 3VULA 2ZB0A 2ZDUA 4NKAA 3P08A 3RPOA 1FQ1B 3F5XA 4JVGA 4CFFA 4DT9A 3DQWA 3PG3A 3PPJA 4WG3A 4RG0A 5BVDA 1QPCA 4C4GA 2X7GA 3AD6A 5HVYA 3H10A 2XYNA 3P4KA 5A54A 3EKKA 5DLSA 4MKCA 1XH9A 2C0IA 4Y5QA 1YOLA 3FQSA 3R63A 2W9ZB 1H08A 1ZLTA 4UXQA 5IMXA 4DEHA 4O0XA 1YDSE 2GHLA 5GZ9A 3FI2A 4LMUA 2W1ZA 2CJMA 4PY1A 2RL5A 4AA0A 3M42A 5E8TA 3BI6A 1LPUA 4FV5A 4PP9A 1XH7A 4ENXA 2Y9QA 2JIIA 3PA5A 4GG7A 1V0OA 5KX8A 2CGXA 3LMHA 4PF4A 4J96A 5E1SA 4X2FA 3LCSA 2P33A 3BQRA 3R1YA 3PXKA 4FKJA 3LCOA 4KAOA 1YOJA 3QCYA 4GUEA 4L67A 4DGLC 2PUPA 3R1NA 4FKGA 3HV7A 4PDPA 4BCNA 2UV2A 4U41A 3R0TA 2ETRA 2VTPA 3WIGA 5IQAA 3AXWA 3EQHA 4FT9A 2DUVA 2QVSE 3AT3A 3BU5A 3SV0A 4YGAA 4K2RA 4O6LA 1IASA 4RA5A 1Q62A 4RGJA 5IH5A 3ORKA 4JIAA 3VVHA 5CF5A 2BZIB 2WMWA 4D1SA 5JSMA 1RQQA 4USDA 1GIHA 5DR6A 3WZDA 4F6SA 4DN5A 4A4OA 5BPYA 3FMMA 1OL2A 4IC7A 2YM6A 3QTIA 2W0JA 5IA5A 4CCBA 4PMPA 4UMUA 1JKTA 2XNPA 3SXRA 4CCUA 2E9OA 4U97A 5D11A 3ORTA 2Y0AA 5HG9A 4Z7HA 5C4KA 5BVOA 4WNMA 3DLZA 3NVKI 3OUKA 3ZDIA 4F9CA 3CJFA 4XP0A 4Z9LA 5ETFA 4IAIA 4MWHA 2ZOQA 1Q5KA 4RJ7A 4RIYA 4V04A 3KRXA 4UZHA 3EQIA 4FA2A 4QYHA 1GZNA 2Y8OA 3AC1A 5F1ZA 3FQEA 5CU4A 3MPAA 4O38A 1X8BA 4J8NA 4BI1A 2YLEA 5JQ8A 3UPXA 3W33A 3HAVA 4RJ3A 3NIZA 2B0QA 3F2NA 2X4FA 1SVHA 2YLFA 1Q61A 3HP2A 4IVCA 3BZ3A 4TYEA 5EYCA 2WFYA 1XBBA 2ZDTA 4EOPA 1GZKA 4C38A 4CRLA 3S4QA 4J99A 2FO0A 3HL7A 1SVGA 2UW7A 4JDKA 4MXXA 2PVKA 2WTWA 4IB1A 3NDMA 5LCKA 3DK6A 3NYOA 4UALA 1OKVA 2NP8A 4OT6A 5HVKA 4RT7A 4W8EA 5FEEA 3SC1A 1J7LA 4QP3A 5CQUA 4FMQA 2JKMA 4P90A 5DVRA 3Q32A 3D7ZA 4PMSA 4DCAA 3U6JA 4BDIA 4AZSA 3QXOA 4IZYA 3RZBA 5L2TA 5DEYA 2G2HA 1GIIA 1WMKA 3B8QA 3COMA 3LMGA 4FBXA 4KIOA 3RPRA 4MXAA 2B1PA 3H0ZA 3R7IA 1PKGA 2OG8A 4ZTLA 2UW4A 5DG5A 1H27A 1YWRA 4IACA 3QZIA 3RHXA 2IZSA 4CFUA 3C4FA 3D5XA 3FMHA 3C4EA 2BFYA 3KMWA 4IQ6A 3QA0A 4G31A 2JITA 4FTTA 1TQMA 4R1VA 5EFQA 3WYYA 2HELA 4C3FA 5HNIX 4AT4A 3TG1A 3MB6A 1NA7A 2P3GX 3UGCA 3CD8A 4FTRA 4CXAA 3O7LB 2CNVA 2QKWB 2Z7LA 3BYVA 1REKA 3E7OA 3SRVA 4E6DA 2RFSA 3DBCA 2J50A 5EG3A 1FBNA 2R4BA 2PMIA 5BYYA 5LVPA 5M4FA 4YJUA 4TN6A 4YTCA 3BRBA 1IRKA 1GJOA 3R9HA 2C0TA 3CQEA 4YR8A 3BWFA 2Y4PA 4BKZA 1MQ4A 3D0EA 4HCTA 3W16A 4ZTNA 3F6XA 3A8WA 4R3PA 4CFNA 4FNZA 4GJ2A 1DM2A 2BR1A 4TPTA 4DEAA 3ATSA 3HYHA 3NAXA 2WTDA 4QRCA 3R01A 4YTHA 1Y6AA 2XA4A 3NRMA 4IAKA 2WEVA 1Y8GA 1Y6BA 2J4ZA 2RFDA 3NW6A 5EYKA 4A4LA 4EH5A 4ASDA 4HZRA 2HY81 5EM6A 3POOA 3MTFA 1B6CB 2C30A 3UO5A 4L8MA 5TO8A 3HMPA 5AP4A 3VWAA 4RIWB 1YVJA 4TL0A 3RTPA 4GL9A 2R3FA 3C0HA 3QD2B 4O0SA 5ACKA 2JKQA 4BDCA 3P7AA 3QKKA 4I6HA 3C9WA 4ZMFA 2C5VA 1K3AA 5DT4A 3QUEA 2R3MA 2XK6A 3Q9XA 5BUEA 3LXKA 2RFNA 5E8XA 5HD7A 4RSSA 3G9NA 4O81A 3WI6A 2YCFA 4X3FC 3OXTA 4FTAA 4CLIA 1WVYA 1OBGA 4RJ8A 5HG8A 1DS5A 1WBTA 1ZMWA 4J98A 5CU0A 5M06A 4RC2A 5AR2A 2WEIA 5TF9A 4C7TA 4U3YA 4M84A 2EB2A 4KRCA 2RIOA 3VO3A 4CVAA 1L3RE 4C4HA 1PXOA 2O65A 4ALWA 4DLJA 2Y6MA 2I1MA 2PUIA 1Q41A 3FLNC 4KD1A 3HRFA 4EH3A 2GS2A 3K5UA 5IA3A 3D15A 5ITAA 5EHYA 2HYYA 4R6VA 4IFGA 1XBAA 4XG4A 1M52A 3PRFA 3SHEA 2UW5A 5CI7A 3ZFXA 3LCTA 3MH3A 3P1AA 2Y7JA 2OF2A 3NUPA 5EI6A 3FL4A 5L6PA 5BYLA 2X2MA 3FZPA 3CPCA 2X2LA 3R9OA 5AFVA 1WBNA 3DOGA 4QP1A 5CALA 3RNYA 5I3RA 5K5XA 5HNGA 3GOPA 1QL6A 2VTSA 3QQKA 4J53A 4YJSA 4C0TA 1H4LA 2E2BA 3HMIA 4FIGA 4EOQA 3TDWA 4ITIA 3A62A 4BWXA 2R64A 3KVWA 4O0RA 1FPUA 5EQPA 4J7BA 4P5QA 5D10A 2LGCA 4P7EA 2J2IB 5KMLA 4IVBA 4QP4A 5E8WA 2XIRA 4ZZMA 1IR3A 4KB8A 3F3VA 2CKOA 3DU8A 3V5TA 3DBDA 4KA3A 3OWJA 4D2WA 2W96B 4AN9A 3C0GA 3ZSGA 4ZZOA 3V5QA 4XCUA 2NO3A 3BLHA 1VYWA 4X6RA 4U40A 2JGZA 1V0PA 4G3EA 3OY3A 4CFVA 2C6KA 3CJGA 4EK8A 1L8TA 4NTTA 1AQ1A 4DFZE 4I6FA 1O6YA 4E73A 4TWPA 2QG7A 3IS5A 1UU7A 4OTDA 4CZUA 3HV5A 3W2PA 5IA4A 3MS9A 3EHAA 2FUMA 3DJ7A 2XJ0A 5AP1A 3KRLA 3MFUA 3TJCA 3TKHA 5FDPA 2WIHA 3BE2A 3LE6A 3QQUA 4FNXA 4FGBA 4HVDA 2PWLA 5CANA 3RK9A 2UVXA 3ZO4A 3CC6A 2QOFA 2XMYA 2XKCA 4J52A 5E92A 3ODZX 4RIXB 5HTBA 3C50A 3KXNA 4MF0A 2OU7A 4JR3A 4X21A 5IISA 4FTUA 1CKPA 3LAUA 3QCXA 1YQJA 5CVGA 1JKKA 2BVAA 4GV1A 3UTOA 4C02A 2EXMA 3LIJA 1M7QA 2GFSA 4OTRA 3HMNA 3ZRKA 3RCJA 4B6LA 5FGKA 4Z3VA 3PXZA 4FEXA 2W1EA 3WILA 4O82A 5GIPE 4QQCA 4ZSAA 3LFFA 4IZ7A 5BYZA 4CTCA 4IJPA 5DT3A 2F7ZE 5EYDA 3F2RA 3PSBA 3G6HA 2B9JA 3ACKA 1FOTA 1M2PA 3HA8A 3IONA 4UXLA 5HU9A 3U6IA 2I7QA 4MQ1A 3FMKA 2QOQA 3TV4A 3A2CA 5CF4A 2WTCA 4GK4A 4BTJA 3SA0A 3DZOA 5C9CA 3DNDA 1Q4LA 4HPTE 3JS2A 5DOSA 2JIVA 4AE6A 2CKPA 2WKMA 5LMKA 3RPSA 2HW6A 3C1XA 4WT6A 3Q5ZA 4IFCA 3VNTA 4C3RA 4RJ4A 2AYPA 2VTJA 3OFMA 3OOMA 4UMQA 5HO8A 2C0OA 2XH5A 2R3KA 4CSVA 2JKOA 3R8UA 5KHWA 4CV8A 3DK3A 4MBLA 4L3LA 4FIJA 1JVPP 5AUYA 1T45A 2RSVA 3O96A 2DWBA 5IH4A 3FKOA 4II5A 4MNEA 3DAEA 3R71A 4DE4A 4H3BA 5JRSA 3NNXA 2GS6A 4LQMA 4M69B 2WQNA 5TT7A 3MY5A 4K33A 3OCBA 3LW0A 4CMTA 4DEBA 5HX8A 1H1SA 5M56A 4GKIA 3EB0A 1RDQE 4HYSA 4KIQA 5C01A 3BIZA 3GCUA 4WUNA 4BIEA 2WMAA 4NU1A 4G1WA 3WF9A 4BDGA 1S9JA 3Q9ZA 4RPVA 2VWUA 2O5KA 2W1IA 3FMNA 2PMNX 4TKSA 4YC6A 5FD2A 1PMNA 5GZ8A 4ZS4A 3TDVA 5TR6A 4KKGA 4D1XA 4FG7A 4NEUA 5AWMA 3POZA 3F7ZA 1NVQA 1CKJA 1QPJA 1Y91A 1O6LA 2OLCA 3NNVA 4E26A 1R39A 3AD5A 1OZ1A 4GG5A 4TT7A 3NW7A 3REPA 2OWBA 1BUHA 4HGEA 4AX8A 2YCQA 1OPJA 3AC8A 3IECA 4JQEA 5EW3A 2WAJA 2WTJA 4QYYA 3FSKA 3V5JA 2CMWA 3EN6A 4Y95A 3QRUA 4EQUA 3I7CA 3IW4A 4QYFA 5FTOA 4EH7A 5IQHA 4XYFA 5D9HA 3V01A 2BUJA 3UNJA 3GU8A 2W1HA 5CNOA 1H07A 2VX0A 2ERKA 3L9NA 3QD0A 5AIRA 2OO8X 1G3NA 4PMTA 4L42A 2BZJA 3Q4UA 3RK5A 5DRDA 1YWVA 3I81A 1KSWA 5CY3A 4CRSA 4BTMA 3I7BA 1XH5A 2VX1A 4F7LA 2C6EA 4O7WA 3QYWA 5K4IA 2XNNA 2X8DA 1PYEA 4H1JA 5E90A 4O84A 2O63A 1Q8TA 3DTCA 3DV3A 4D0XA 1MRUA 4YSJA 4RVTA 2QLQA 5JRQA 3VF9A 4IC8A 3N51A 4Y72A 3ZBFA 4M67A 1F5QA 2EXCX 4ID7A 4O91A 5DEWA 2GCDA 4WBOA 4IAFA 2JBPA 2JBOA 4KSQA 1PJKA 4B8MA 2Z02A 4FOBA 4BWPA 3FYJX 1XKKA 2A0CX 1KE8A 3TZ8A 4F6WA 2WB8A 3IGGA 4ZSEA 3EYHA 4RVKA 2CHLA 4EYJA 3G0EA 3TN8A 3CR0A 5AP6A 3VQUA 4I5PA 4ZTHA 5J1WA 2BDFA 2R0UA 4WA9A 3GQLA 3FY2A 4AQCA 5EHOA 2J5EA 4XG2A 4LV8A 3U8WA 3FMEA 4KNBA 4RIXA 5DFPA 3EMGA 4D2SA 2W1FA 4O96A 1FVVA 5HG5A 4IB0A 4D58A 4FZDB 2QR7A 5IA2A 1YHVA 3V5WA 2XK4A 5AUWA 2B4SB 2RFEA 4H36A 4I41A 2YIQA 1FINA 1KWPA 2YM8A 3DQXA 4JG7A 1OB3A 5AUZA 3TL8A 5AUUA 3RMFA 2FGIA 3ZM4A 3C51A 3A7GA 2F2CB 1U54B 2CKEA 3T9TA 1P5EA 1WBSA 3V5PA 2C5XA 3KK8A 3PA3A 1OL1A 4DFYA 1KE9A 2X7OA 5JGDA 3S00A 5LMKC 2XIXA 3E8DA 4EHEA 3E7VA 4HCUA 3RPYA 5JH6A 3C0IA 3EFLA 3GFEA 5J5TA 2BRGA 4RVLA 3AOXA 3GCSA 3DBFA 2QHNA 2YDJA 2PZRA 2VWYA 3MPTA 4C35A 2Q83A 2QONA 3F69A 4JAIA 3FXZA 3R7UA 4IVDA 5E91A 3WZKA 4O22A 3TTJA 4PL4A 4YZNA 3Q6UA 1H26A 3TI1A 3TIYA 2YAKA 3H9OA 2WMRA 3PTGA 4JQ8A 4D28A 3O2MA 4NFNA 3A8XA 3GQIA 3FAAA 2PVRA 3D9VA 4B99A 4DFUA 3W8LA 4QO9A 5IPJA 3FEGA 5GINE 2C5NA 3NWWA 2PVFA 1OGUA 2EVAA 2KTYA 1P2AA 2C3JA 2IO6A 3PZHA 4L52A 5CT7A 1DI8A 2WTKB 3CBLA 4M69A 4I0SA 3UIUA 4H58A 3MV5A 4AACA 5AUTA 3W8QA 4FGRA 1UNHA 2XCHA 4FUYA 2YCSA 3DCVA 4HGLA 2XBJA 4R1YA 5AR8A 4YTIA 2CCHA 4JDIA 2QNJA 5L8JA 2XNEA 2Y4IB 3PP0A 4GRBA 5BX0A 4CFWA 4IVAA 3LVPA 3MY1A 3OMVA 4X3JA 3KXMA 4H3PA 5AIKA 3QLFA 5IA0A 2W1GA 3HV3A 4HGTA 4AZWA 4C4EA 1J91A 2X4ZA 2PVMA 2XKFA 2CNUA 2C3IB 3BCEA 3CP9A 5AP7A 2R3RA 2WTVA 2C5YA 3E88A 4XG9A 2XBAA 5AR7A 4G5JA 4JQ7A 4XEYA 2WOTA 4NCTC 4ANLA 3Q52A 2VWVA 1CDKA 4Z55A 5CEIA 5HQ0A 2G1TA 3DA6A 1TKIA 1Z9XA 2IJMA 3F5UA 3GCPA 4IAYA 4WSQA 3C13A 3EFWA 3LQ8A 4YBJA 4EZ7A 5A4QA 3BWJA 4FTQA 2F2UA 4BY9E 2OH4A 4O1PA 1R3CA 2W99B 3ZSHA 3ZSIA 5IH6A 3BE9A 3VS2A 1PXPA 3E62A 4F6UA 2XJ1A 3HGKA 4CYIA 4MX9A 2XIYA 4QMWA 2BAKA 3QWKA 3QYZA 4LOOA 4H39A 3I5ZA 3GU5A 2V62A 4B9DA 3WF6A 2F57A 1ZY4A 4BF2A 3LCKA 4OTPA 3R8ZA 3FZ1A 5EW9A 2IVVA 4BDDA 3VS0A 2J6MA 2YIYA 4LV5A 4ASEA 3AC5A 4OTQA 1ZAOA 4UB7A 4FKSA 4RWKA 5CEKA 5HE3A 4U79A 4H1MA 4WG5A 5ANDA 3Q9YA 3O23A 3TM0A 1XR1A 5BVWA 3O7LD 3DKCA 2O2UA 3FLZA 3NYVA 4FOCA 3PDTA 3FV8A 2Z7RA 1Y57A 2OH0E 2YIRA 2YCRA 5CS6A 4A9SA 3O51A 4D2TA 4U43A 3LPBA 4BYIA 3P7BA 3PXQA 4FKQA 3ITZA 3ORMA 2ZVAA 3E5AA 4MXZA 3RI1A 3QD4A 1QPDA 4JOAA 4QTAA 2OJ9A 3NYXA 3BHVA 1Q24A 3LXPA 2CLXA 2QG5A 1W7HA 3GEQA 4G16A 2Z60A 4NUSA 3GXLA 3QQGA 3O17A 4Q5EA 4UMPA 2IZTA 3OT8A 2R5TA 5M4CA 3A61A 3DKFA 4USFA 1A9UA 2A1AB 3IW5A 3NW5A 1KE7A 4HVIA 3HP5A 2BALA 4ZLZA 5FUTA 3NUNA 4OBPA 3T9IA 4BRXA 1MRVA 3DT1A 1LEWA 4YTFA 5IQDA 4G5PA 2OSCA 5CAQA 4E6AA 4PPBA 2GU8A 2WQOA 5JZNA 4PDYA 3TUCA 3LLTA 4B8LA 4EEVA 5A14A 5AA9A 2R3LA 1OPKA 4FV0A 3DTWA 4MQ2A 1VR2A 3HDMA 3CKWA 1XH6A 3PLSA 4BHZA 4DAWA 4ONAA 4EH2A 4S33A 4KKEA 1R78A 4O6EA 5I9WA 3OS3A 4K9YA 4LGDA 2UW8A 4KBKA 3FZOA 2WHBA 2B52A 3L9LA 4O7ZA 2VTTA 2XIZA 3QTRA 4QYEA 2OXXA 1NVRA 4K0YA 3F66A 4NFMA 3I1AA 4EHGA 1YHSA 5DH3A 3TKIA 3RWPA 4IWQA 4NM3A 4XOYA 5FM3A 3PG1A 4L9IA 4D4SA 4PDSA 3R1SA 5AM7A 5FP6A 3UOJA 3R8LA 2HWPA 4IX6A 4MK0A 4U8ZA 3U55A 3ZM9A 3MVLA 4FNWA 4AGWA 3W10A 3ZXTA 2CGUA 2IW6A 4A4XA 3II5A 4U5JA 2AC3A 3E87A 3VUMA 2R3OA 4CNHA 4Y73A 3ULZA 1SNUA 3DJ6A 3P79A 1MP8A 3Q96A 4BZNA 3HDNA 1H01A 3AMBA 2PVJA 2X6EA 5C8MA 1PKDA 4XLIA 2BFXA 4M12A 4QP7A 4ACMA 5KMNA 1OPLA 4ALVA 4EOIA 4TYHA 3EQDA 4YU2A 5BVNA 5HO7A 3E63A 4M0YA 4I0TA 2P2IA 2ACXA 3C4XA 3UG2A 3O8PA 3QTWA 4EYMA 4OUCA 4XBUA 1OIQA 2XRUA 4EK5A 4PX6A 3GENA 3I0QA 4YZCA 2VUWA 4F0GA 2UVZA 3I6UA 4IEBA 5CT0A 3QTXA 1GZ8A 5CSVA 5KCVA 3ULIA 2OF4A 2VRXA 3D83A 4YHTA 2ZV8A 3IG7A 3SW4A 3R04A 4ZS0A 1GAGA 3OT3A 4BDBA 3WF7A 1ZZLA 2IPXA 1JKSA 4I20A 3MSSA 4V0GB 4ERKA 3G15A 2OI4X 2QOLA 4AAAA 3SKCA 3U51A 1WAKA 3F3WA 3MB7A 4I5HA 2JDSA 4BCKA 2OIBA 2VWBA 2W06A 2JEDA 1M17A 4RRVA 3UQCA 4Q5HA 3DDPA 4PP7A 3NUYA 2HXLA 4IW0A 4FTNA 4QTCA 5K4JA 3AT2A 5IDPA 3QCSA 3VUIA 3LKMA 3BGZA 2ZV9A 4EI4A 2BCJA 2QO2A 3MA3A 3QUPA 5CZIA 4JS8A 4MF1A 3KC3A 3KRWA 1B39A 2GNIA 3QQLA 4W4XA 1R0PA 4OR5A 4DLIA 5JQ5A 4Y85A 4TWOA 4GH2A 4X3FA 5DR9A 5B2MA 3PY0A 2JD5A 3QCQA 2CPKE 5GHVA 2YN8A 2XM8A 5CLPA 4UMTA 3QTZA 2W1DA 3Q4TA 4DA5A 5CQWA 5LQFA 4QP8A 2FB8A 4S31A 2XZSA 3DBEA 4XUFA 3IQ7A 1H0WA 4QYGA 3UP7A 4X2NA 2XKEA 2PZIA 1UV5A 4MHAA 2GQRA 3QZFA 2VTAA 3MFTA 3CTJA 1OI9A 3R2YA 3EZRA 3D7TA 3V51A 2FYSA 4NZWB 3MFSA 3GVUA 4NM0A 4MD8E 3OEZA 3CIKA 4X2JA 1DAWA 1ZOHA 4QMXA 1SYKA 4U80A 3VBVA 3LFDA 1OKZA 5FM2A 4AN3A 2X1NA 4BDHA 4RLLA 5M44A 3FI8A 5EM5A 4ACGA 4RJ5A 5A4EA 5FXSA 3TKUA 1Q8ZA 2C4GA 3BLRA 4ACCA 4EZ3A 5HIEA 1PXLA 3AMYA 3D14A 4FR4A 4RWJA 3VF8A 5M53A 2ESMA 2BTRA 4XNEA 4UZDA 3ODYX 3RHKA 4N70A 3JPVA 4W9WA 3HA6A 2VTNA 1ZYSA 3L8VA 5HIBA 4LL5A 5BVKA 3IO7A 3WOWA 1MRYA 2XIKA 2FSTX 5FEQA 2JC6A 3KFAA 4TYGA 2NNWB 4A9YA 4W9XA 3H30A 1Q3DA 2FH9A 3O8UA 2UZLA 4WSYA 4X2GA 3JVRA 5C27A 4BCGA 3MDYA 2XNGA 4XV2A 4BBFA 4MEDA 4ZLOA 3KXZA 4Q2AA 2QURA 4TWCA 3V6RA 2QC6A 2BKKA 4USEA 5KZ0A 2BIKB 1H1PA 5CYIA 3PWDA 4IWOA 4R77A 2YIXA 2YJSA 4M8TA 3UQFA 3NSZA 1ZWSA 5DE2A 4CEGA 3ANQA 5J79A 4RZVA 4TTHB 4QP6A 3QTUA 4IB3A 4J1RA 4EH8A 4QQTA 2VWXA 3MVHA 3RALA 2G9XA 4O7SA 5AMNA 3ROYA 5HBHA 4CZTA 3WZJA 3MGYA 3BGQA 3R00A 4RC4A 4YBKA 5IQIA 4G6NA 5AUXA 5T3QA 2GDOA 4EHZA 4FUXA 5M57A 5FTGA 3N9XA 4JAJA 2XK8A 4JXFA 4NK9A 4GEOA 5CWZA 1NVSA 2W4JA 2WU6A 2X6DA 3OG7A 3B8RA 3CY3A 4PNKA 5FBOA 5CENA 5CAPA 2CCIA 3UPZA 2J0LA 5M4UA 2PUNA 3KMUA 3GGFA 3UOKA 2YDKA 2YWVA 2PU8A 3I6WA 4NTSA 2GNJA 1ZMUA 2WTKC 3G33A 2YABA 4DH5A 4IMYA 4LL0A 5HNBA 3FBVA 5HHWA 3ZTXA 2PSQA 3QGYA 4U6RA 2ITYA 4FVQA 3G6GA 2ITWA 4FSTA 4K6ZA 5EDPA 5GJDA 4ZJIA 2HAKA 4BCIA 4ITJA 1JQHA 3BYSA 5M55A 1FVRA 2OJJA 4FK6A 4IADA 4TXCA 3KN6A 5E7RA 5KE0A 4B0GA 4PDOA 4BCHA 4EWQA 5BMSA 1YKRA 4IDVA 4I22A 5EDQA 4LGHA 5JMSA 4AT5A 3PZEA 2VAGA 3V5LA 3RAKA 2ITTA 3MTLA 1P4OA 5FG8A 1KOAA 3LJ1A 3FHRA 3VUTA 4KBCA 2XCKA 3RNIA 3QZGA 4ANSA 3ZMMA 3DAKA 1YHWA 3VJOA 4IZ5A 2F9GA 3EOCA 2VTLA 2QOBA 4FT3A 3OROA 3A7HA 4QP2A 3O71A 3RCDA 3FKNA 3CTHA 3IOPA 1URCA 1WBPA 3LFSA 2PE0A 3OF0A 5EHLA 1W82A 5HBEA 3ZZWA 3RP9A 2JFLA 1H8FA 2IN6A 4BBEA 3PWYA 2H8HA 5LWMA 5DMZA 4BIDA 5EQEA 2R3GA 2E9NA 2OIDA 4I21A 5ETIA 5KO1A 5J95A 4DGNA 3QRKA 5IQBA 3W55A 3SXFA 3ZCLA 3GU7A 4L3JA 5I5ZA 2XKDA 2H6DA 3VBWA 1JLUE 5EH0A 5BMMA 4R3CA 3BELA 3FLQA 1YI6A 3IW6A 3UVPA 4N57A 1JPAA 3KULB 3ORNA 4BC6A 3U9CA 3FZRA 3OVVA 2R7BA 5E8YA 4DGMA 4FSMA 4O27B 4V01A 2ERZE 4PUZA 1AGWA 4B7TA 4FEQA 5HORA 3PFQA 5CSXA 5ANGA 3JYAA 1JNKA 2I0EA 3EQGA 3LFBA 5F94A 3OOGA 2WMUA 5CZHA 2YWPA 4EH9A 4YNEA 4NW5A 5A4CA 1XQZA 5D7VA 1H25A 5CSHA 5IQGA 4I4FA 2LAVA 5CI6A 3Q6WA 3FXXA 4F65A 3ENHA 2JKKA 4OBOA 1DAYA 4Q9ZA 4WNPA 3ZC5A 4D55A 5ACBC 3OTUA 4HOKA 4O86A 3LMIA 4QTEA 2XVDA 4IANA 5HLNA 4HPUE 4O0UA 4YC8A 3Q53A 2CGWA 4K8AA 3MY0A 4TNBA 4E5WA 5KKRB 3SD0A 4ZSGA 3TNWA 4QPSA 4YSMA 2YM3A 4ZP5A 3VQHA 2CSNA 4O0TA 4E4MA 4Q9SA 3CD3A 3IOKA 4TWNA 3TNQB 3ATTA 2Z2WA 4C61A 2ZMCA 3CY2A 5JFWA 3H9RA 4HVSA 2PZYA 3VS1A 4BDAA 5HIDA 4E6QA 3S1HA 2WNTA 4PL5A 4WBBB 5GJGA 3TTIA 3QHRA 5C4LA 2I0YA 3BV3A 1U59A 4QP9A 5KMMA 5K3YA 3LFQA 4AZVA 3E8EA 1EH4A 4FL3A 2OZOA 3GNIB 2NRUA 4OAVB 4DEGA 3ZRLA 1E9HA 2X7FA 3NR9A 4HVGA 1OIYA 4Y83A 2HW7A 5EOBA 3CXWA 2DQ7X 1HCLA 2C1AA 2GPHA 2GNGA 2OJGA 2VN9A 2WD1A 3KA0A 4N6ZA 5CU3A 5HBJA 4IM2A 1LR4A 3DXQA 1H1QA 4ZTMA 3GCQA 4IAAA 2XRWA 3CKXA 2BDJA 4W4VA 4ALUA 2OJIA 5KHXA 1AD5A 4XOZA 4NJ3A 4LRMA 2EWAA 3Q9WA 4R5YA 1W8CA 3LZBA 2VTQA 3UMWA 4QMUA 1MQBA 4DFBA 1NXKA 2UZEA 4S2ZA 5GIOE 4EJ7A 3W2RA 2J0KA 4D4YA 3ZFYA 5M4IA 4I1ZA 3MVJA 4MXOA 4ARKA 5D7AA 2I6LA 3OXZA 2GHMA 2BRBA 1VZOA 1W0XC 3DPKA 3JY0A 3U4WA 4FX3A 4D9UA 4XP2A 3TACA 3KXXA 3L1SA 2JDTA 4FTJA 4YNOA 3QTSA 4CQEA 2C6TA 3LXNA 3FE3A 3FY0A 4C33A 3CEKA 4HYHA 3S3IA 2QHMA 5HTCA 5JGAA 4L43A 2UZVA 5D41A 3HLLA 4RQKA 2Z7QA 4NIFB 4IE9A 3G0FA 2ZM3A 4K1BA 4EORA 3R2BA 3OEFX 4EJNA 1PXKA 3V8WA 3KVXA 4APCA 4KIPA 2C6IA 2UW6A 4D5KA 3VS6A 2HXQA 1Q8YA 2QKRA 5EI2A 4RIWA 1Z5MA 4ERWA 2P0CA 3CGOA 1LP4A 2VTOA 3QBNA 3KCKA 3IKAA 4AS0A 3U54A 4GU6A 3UOLA 4E8AA 5AP3A 4KS7A 4YZ9A 1I44A 2F4JA 4BCFA 3MH1A 3UVRA 3ZLXA 4DEIA 2RF9A 4LMNA 4Z7GA 1PXMA 1QMZA 5J5SA 2BZKB 3E92A 5DWRA 2VWZA 2XNBA 3VN9A 4DG2E 4XRLA 4UWBA 2VTHA 4F9YA 2PVLA 2C5OA 4BVUA 3HUBA 2UUEA 4YZDA 1P14A 5JZJA 2PULA 3UO6A 4FKPA 2PY3A 4LFIA 3F5GA 2FVDA 3MW1A 5E8ZA 4CG9A 3DGKA 4E6CA 3MWUA 4PL3A 4BTFA 3KULA 4LOPA 1OUKA 4NCTA 1XHAA 4JBOA 3A4PA 5LJJA 5TE0A 4IX3A 4D9TA 2VU3A 3BQCA 4ACHA 5JKGA 2AC5A 5I9XA 4BKYA 3OUNB 5F20A 2IWIA 2O3PA 3IW7A 2GNFA 2B7AA 2JDOA 2BIYA 3NX8A 4FT0A 4FZFB 3DFCB 4TRLA 5I3OA 3PVBA 4LOQA 5DBXA 2UZDA 1IA8A 4PTGA 2OW3A 1OL6A 3GT8A 4QMVA 3HRBA 3G90X 4QMMA 3KEXA 5AV3A 4XV9A 4FSZA 2VTMA 3DAJA 4YHFA 1ZY5A 5AR5A 1W98A 1M7NA 3FUPA 3D5UA 3FMDA 4GYGA 3RPVA 3BLQA 1ZYCA 2EXEA 5EYMA 3EQPA 4WG4A 3LOKA 4GKHA 4BN1A 5J87A 2NPQA 4KKHA 1PRYA 3FPMA 3IPHA 2JIUA 2ITPA 1V1KA 3IK3A 4D1ZA 1NT2A 5A6NA 3KKVA 5IUIA 2PTKA 3RZFA 2YIWA 4FTIA 4WKQA 1YXSA 3WE8A 4MXYA 5KMOA 4BCOA 3H3CA 2WMBA 5KBQA 4HCVA 3UZRA 3RM6A 2QD9A 4CT2A 4FL1A 4JLCA 4L45A 2QOHA 3I79A 2OZAB 4IHPA 3PY1A 4IWPA 4L01A 3KK9A 3I60A 3S95A 3FMLA 3WF8A 5AADA 3NAYA 3BEGA 4CKRA 4KUJA 5AP5A 4RLKA 4EOJA 1F3MC 5BVEA 2I0VA 2J0JA 2HOGA 3PJ3A 4O7RA 3QRJA 4FIFA 5I9YA 4F63A 2PHKA 3QL8A 1JSTA 1STCE 4AOJA 4F1TA 2QO7A 5LVOA 4G6OA 2OXDA 4XG8A 1E1XA 3EQBA 4UWCA 4AFEA 1PHKA 3OHTA 4BL1A 3ZLSA 1PXIA 4EK3A 3HZTA 4JRVA 3U9NA 1YI3A 2E9PA 3T3UA 4QNAA 5L2IA 3LFEA 4JRNA 3WARA 4G2FA 4FV3A 2P55A 2WOUA 4KINA 4A06A 4EK6A 3ELJA 3MJ2A 3SG9A 4DTBA 5ANEA 3KU2A 3NNUA 5C8KA 3OW3A 5BQ0A 3P78A 3MYGA 4JJRA 1CTPE 3R7EA 3ZZEA 4CGAA 3RJCA 4TZRA 2PE1A 1OIRA 3EKNA 3M2WA 1YXVA 2ITXA 4R7BA 2R9SA 1YOMA 2FSLX 3EQFA 2IVUA 5JK3A 2C6MA 4ZK5A 2AUHA 4KSPA 3U4UA 4FV6A 3NVMB 2VO6A 5F9EA 3D94A 3R73A 4K77A 4W8DA 5KMKA 3OP5A 5ANKA 2GMXA 2HY0A 2X8EA 4ITHA 3TUBA 3DDQA 4BCJA 5AV4A 2G15A 2PMLX 2X81A 4DHFA 4L7SA 3EZVA 3M1SA 1PXNA 4FZ7A 2YISA 4C59A 1FGIA 3NEWA 4AZEA 5HD4A 3ZEWA 4MBJA 3Q3BA 4FKTA 4WHZA 5DRBA 5I9VA 5J7HA 3BU3A 4C4JA 1WBOA 4L44A 1H0VA 3GC9A 4O7TA 3DXPA 1WBVA 4HYUA 1ZARA 3ORXA 4TW9A 4I92A 5D12A 4TYJA 3TCPA 3UOHA 5L4QA 3NUAA 3H9FA 1PMEA 3ACJA 5M51A 2YDIA 2HZIA 2V7OA 1GNGA 3V04A 3SG8A 4F64A 3L9MA 2QI8A 4EQCA 2XUUA 4IX5A 2JLDA 3TZMA 4C58A 3F88A 3FKLA 3SDJA 4TY1A 4AFJA 1IAHA 3CSVA 4FT7A 1NW1A 3CLYA 4FE2A 1E1VA 2ZYBA 4U9AA 3QTQA 4JX3A 2B9IA 1BMKA 2GSFA 4YJOA 4QTDA 4ASXA 3A4OX 3IDBA 4YO6A 2VNWA 1TQIA 3WE4A 4D5HA 2O8YA 3QX4A 3KN5A 3F7WA 2VWWA 4U42A 2A4LA 3R7VA 2WMVA 3QX2A 1CM8A 3VW8A 1KE6A 1YW2A 3DKGA 3O50A 4I6BA 2QQ7A 3PIXA 4AOIA 4AWIA 5HCXA 5LMBA 4BCQA 4BGQA 4N0SA 2VO3A 2JAVA 4FV1A 2HIWA 5DHJA 2O64A 3FXWA 5G6VA 3RAWA 2R3NA 5IMEA 4O7VA 4WRSA 3FYKX 4YMJA 3L8XA 2X9EA 3HKOA 1KV2A 5TOZA 1Q99A 4JNWA 3VC4A 4ZOGA 1J3HA 3D4QA 4I5CA 5CX9A 4FV4A 3VBQA 1Q3WA 3P86A 4YC3A 3UC3A 1KUTA 3MFRA 2VV9A 4BDEA 1ZYDA 4LGGA 5LWNA 2B55A 3SLSA 3D2KA 3F9NA 2VTIA 4G3CA 4I93A 4GFOA 2UZUE 4QMZA 3QC4A 4EWHA 2OKRA 5K5NA 4FZAB 4WUAA 1OL7A 4B4LA 3MVMA 4E3CA 4DT8A 3SOCA 4OGRA 3ERKA 2C6DA 4I5MA 3R9DA 2BPMA 2V0DA 4DH1A 2PYWA 1ZMVA 3KRJA 3NZ0A 3ZOSA 1T46A 3QQFA 3R7YA 3FZTA 1YI4A 3RM7A 4R3RA 3R8VA 3EN9A 2IG7A 3BYUA 3DNEA 1WZYA 2YACA 3PPZA 2CN8A 4CT1A 1Y8YA 2R2PA 4GFMA 5C26A 4CLJA 2QOOA 3ZLWA 2HENA 3P7CA 4EC8A 4GVJA 3MESA 1ZOEA 3QU0A 3D5WA 5GJFA 3AMAA 3HMMA 4FSRA 2OZAA 4AZFA 3QD3A 1RJBA 5AP0A 2C68A 1IG1A 4YJVA 5HE0A 2OFUA 4W4YA 4JG8A 4HW7A 3KXHA 3R7OA 2SRCA 5EW8A 4IJ9A 4FTMA 3A99A 3FI3A 3GUBA 4CD0A 3AGMA 5FWKK 2ETKA 4EOKA 2GQSA 3QGWA 4I3ZA 5DT0A 5LOHA 4GT5A 5J8IA 4E93A 5IUGA 4PV0A 1LUFA 5HE2A 3BBWA 5CEQA 2GQGA 3G5DA 3GFWA 3JR1A 4O0YA 4FVRA 3BGPA 4G3FA 1XBCA 5A4TA 2OXYA 4ZTQA 1O6KA 2B54A 3UIBA 5D1JA 4FIHA 4A07A 4M3QA 4X2KA 3BBTB 4NT4A 4FKLA 4M7IA 3PYYA 3MIAA 4H05A 2HZNA 1OL5A 4LUDA 1U54A 4FICA 5IEYA 2OBJA 3TIZA 3Q5IA 1VEBA 4BIBA 3C5UA 1WVXA 4HGSA 5CU2A 4AW5A 2FSOX 4F0FA 2VGPA 5CAUA 4ZJJA 2JDRA 5L6OA 3PUPA 1CSNA 1BX6A 5AM6A 4CYJA 3HUCA 3PXYA 4EL9A 4RJ6A 2VX3A 3LQ3A 4D2PA 3KY2A 3TEIA 4DFXE 2XEYA 3DJ5A 4E20A 4G34A 3GBZA 3CE3A 5KMJA 4DG0E 3K2LA 1PXJA 3UNZA 2YM5A 4EHVA 2FSMX 1A06A 3GCVA 3GC0A 4A9UA 3EN7A 4MD9E 3AT4A 2C6OA 3RAHA 1UA2A 4QMYA 4YJRA 4ZSJA 4AW1A 4LG4A 4YLLA 4F7SA 2WMQA 4EKLA 2UVYA 4OTWA 5C1QB 4KS8A 3TNIA 5AAFA 1UNLA 2IW9A 3VBXA 3QWJA 5IKWA 2ZM4A 2VTRA 4CTBA 4S32A 5JFVA 4GFGA 5I9UA 4M68A 4NSTA 1YWNA 3FL5A 3F3UA 5KNJA 2F7EE 3R30A 4G9RA 1SMHA 3MJ1A 1IEPA 3EWHA 3SRVB 4I23A 2QLUA 1TQPA 4DGGA 5HLPA 2HZ4A 2J0MB 2C3KA 3IDCA 4QMLA 2PVYA 3OWKA 3IW8A 5EKNA 5L8KA 4NJDA 3C4CA 3CQUA 3P23A 4U3ZA 4YJTA 5FBNC 5M08A 4AP7A 4L68A 3TV6A 3K3IA 3ZONA 4I24A 5B0XA 1UNGA 4K18A 2WO6A 5A4LA 4O83A 3I0OA 5TKDA 3RK7A 4BWKA 1ATPE 2QU5A 2ZV2A 3UVQA 4RWIA 5LCJA 2R3IA 2XB7A 1K9AA 2HCKA 4RC3A 4F0IA 4O2ZA 4LUEA 5DPVA 4C2WA 5E8UA 4E5BA 3HNGA 4YPSA 3QKLA 4X0MA 3KL8A 3LXLA 4GMYA 3F61A 5K0XA 1UU9A 2J7TA 3SXSA 3R02A 1FMKA 3C7QA 5J7BA 2ITQA 4AXAA 3PVGA 4O7YA 3EFKA 5B7VA 4IZAA 4RQVA 2Y6OA 2B53A 5A6OA 3VUGA 3R83A 3OW4A 3FMJA 2JFMA 4BCMA 4EUTA 3AGLA 4RMZA 3NS9A 3UYTA 1GZOA 4FIIA 4M14A 3PP1A 4BDFA 2QO9A 4C4FA 4YJPA 2I0HA 3QHWA 5CVHA 4FV8A 3VUDA 1U5RA 4LM5A 2G2FA 5E9EA 3ZC6A 2VWIA 1V0BA 2GHGA 4XHKB 2WELA 4MD7E 4K11A 4APPA 3K5VA 4FYOA 3E8CA 3QZHA 4JBPA 2WU7A 5CF8A 2BAQA 3JXWA 3VW6A 1UKIA 4P2KA 5DGZA 4WOVA 2GTMA 5JFXA 2GFCA 3VUHA 5AX9A 2YERA 5H8GA 2HZ0A 4GU9A 1S9IA 1XH4A 4G3DA 3QRIA 4QMNA 4Y5HA 1ZZ2A 4PRJA 1Q97A 3E8NA 3QUDA 4FSWA 4YZMA 2XF0A 3ZO2A 4YURA 5FLFA 3M11A 4O21A 5EI8A 3GC8A 1YRPA 2XK9A 4FSNA 3HECA 5IUHA 5DI1A 4YJNA 3TNHA 4AA4A 4BB4A 1GOLA 3UP2A 2VZ6A 2ETMA 4J71A 3TV7A 3VHEA 1DI9A 3VS4A 2OK1A 4GK3A 2HWOA 4M0ZA 1B38A 1OIUA 3VS7A 3NUUA 5AEPA 4FTCA 3MN3A 3RAIA 3UZPA 3UZTA 1PMUA 1ERKA 3BU6A 3PSCA 4AW2A 1BKXA 3OCGA 5BNJA 5CF6A 4ANOA 1UU8A 3PXFA 4F7NA 5J9ZA 3Q4CA 2Z8CA 5L2WA 4EUUA 3PY3A 5LXMA 1WFCA 5H9BA 1UVRA 5M07A 3G51A 2W7XA 1YXUA 3QRTA 4JIKA 4LYNA 4MTAA 5JGBA 2BKZA 3F82A 4DBNA 5E4HA 3THBA 4BDKA 2WQBA 1U5QA 2BDWA 5DR2A 4IM0A 3SGCA 4J95A 4S34A 3QAME 2X8IA 5AR3A 4BHNA 2QOCA 1CKIA 4UN0C 2ITUA 2J90A 3PE1A 4C34A 2XNOA 4F99A 5AAEA 4F9AA 3BV2A 5T6KA 3TZ7A 4R7HA 2GNHA 4EH6A 2YM4A 5HOAA 4BYJA 3ID6C 2J51A 2UZWE 2PUUA 4DG3E 1KOBA 2QR8A 4DFNA 2XM9A 1BI8A 4GCJA 5HGIA 4C36A 4JDHA 1JOWB 3DKOA 4F1MA 2O0UA 2HK5A 4OBQA 4YP8A 2WPAA 3RVGA 2PE2A 3KXGA 4IH8A 4IDTA 1PYXA 3R22A 4L7FA 4FEVA 1G5SA 3FLYA 1R0EA 3ORZA 5AV2A 2VNYA 3OCTA 4JX7A 3ZHPC 3MH0A 4F09A 4ACDA 4I4EA 4I94A 2YHVA 2JDVA 3PIZA 3FC1X 2Y4IC 3R9NA 4OT5A 4D4RA 3TNPC 2IVTA 5B2LA 5HTIA 3EYGA 3QQJA 4FKUA 4S30A 4UX9A 4JDJA 3QALE 4DYMA 2H96A 4O7NA 4XV3A 4RFMA 4IIRA 3K3JA 3VUKA 4CMUA 5CSPA 1JBPE 4F9WA 2VGOA 3ZEPA 2YAAA 5LMAA 5AX3A 3KCFA 3EFJA 4ZXTA 3FDNA 5IQFA 3R7GA 3HVCA 2QOKA 5M09A 1OECA 1O9UA 1VYZA 3PRIA 4NYEA 3EN5A 3RWQA 2W5HA 4GIHA 4M15A 4YHJA 3FSFA 2RGPA 1JSVA 2PZPA 4OW8A 4V0GA 4KABA 3WZEA 1GIJA 4Y46A 1H28A 3QF9A 3LFCA 1SNXA 4LI5A 2WMTA 3ETAA 3DS6A 4U7ZA 4XS2A 4EBVA 3C4ZA 3CTQA 3PJ8A 4FKWA 2ZAZA 3BYOA 4LRJA 3TJDA 2WTIA 3AD4A 3LFAA 1OMWA 1HOWA 1OKWA 4MNEB 4C2VA 2C69A 3C5IA 4BGHA 2E9VA 4W4WA 1ZRZA 4CFMA 3SQQA 3UMXA 3BKBA 5HEZA 4AA5A 3EQCA 1IAJA 1IA9A 3QXPA 4FTLA 3W2CA 1WBWA 4ZY4A 5HZNA 5IA1A 3NCGA 3V3VA 2XYUA 4JR7A 2W05A 4ZLYA 2H9VA 2R3QA 3BPRA 1JWHA 1W83A 4KWPA 5HU3A 3WYXA 4O2PA 3LQ5A 4L46A 3TZ9A 4DFLA 4ZAUA 3NCZA 2XS0A 4QOXA 4C3PA 2V22A 3P5KA 4YLJA 3ZRMA 4PPCA 1ZOGA 4U0IA 1OVEA 2R3JA 3ZBXA 4CFXA 4F08A 4GJ3A 1WVWA 3VJNA 2JAMA 2CLQA 4FF8A 4JT3A 2GNLA 5HX6A 3HEGA 4FI1A 2R3PA 4BFMA 5CAOA 3LM0A 2CKQA 5KUPA 4BTKA 3NUXA 2REIA 5AP2A 1PF8A 3NLBA 5CNNA 4UMRA 4FL2A 3EH9A 3GI3A 4Y8DA 3HRCA 4EZ5A 4ZY6A 5HKMA 4AZTA 5AUVA 4J8MA 2ONLA 2R3HA 5JT2A 2BAJA 4FKVA 5B2KA 3WBLA 3BHYA 4BICA 2H34A 4EOOA 3VIDA 3ORIA 4FC0A 2G2IA 3MI9A 4XBRA 5EM8A 4ZMEA 4BKJA 4DH3A 3DB8A 5AA8A 4MYGA 2QODA 5AJQA 5E8SA 3TT0A 4DINA 3FJQE 5I0BA 3Q4ZA 3UO4A 3UIMA 1JKLA 4JBVA 3UNKA 3PJ1A 4BR3A 3PXRA 4U81A 4F70A 5EM7A 3KMMA 4I0RA 4RFYA 3COHA 4M97A 4M13A 4DTKA 4CG8A 4MWIA 3N4UA 4EKKA 1PMVA 5LVNA 4QPAA 3GOKA 3TXOA 4QQJA 4QMTA 4A9RA 2W4OA 2FA2A 4BZDA 1PY5A 4FTKA 4ZJVA 2R0IA 3PJ2A 4MNFA 4UWYA 5IG1A 5LVMA 3QLGA
chains in the Genus database with same CATH superfamily
2BROA 2YM7A 3L8SA 2IEWA 4UYAA 2XP2A 1FMOE 3VRZA 3C4WA 2DS1A 4GIIA 4OLIA 3VS5A 4DF3A 4PWNA 1RW8A 2XNMA 5L3AA 4ANQA 4FVPA 2CN5A 3HV6A 3RBWA 2PVNA 5T68A 4HNFA 1J1CA 2BRHA 5L2QA 2YA9A 4AU8A 2ZB1A 3FQHA 5FEDA 3G2FA 4X7QA 4EK4A 2PMOX 4ZEGA 3ENMA 4A9TA 4QMPA 4GK2A 4RVMA 1FVTA 3VHKA 2QOIA 3FHIA 5AV0A 5FP5A 4R78A 2C47A 2Q0BA 5ETCA 4DH7A 4E4NA 4HVHA 4AGDA 5C8NA 2X0GA 4YO4A 3MH2A 3COIA 5J9LA 2OFVA 4HYIA 2VO0A 3ALNA 3DBQA 5CAVA 4MCVA 2PPQA 4GUBA 4UY9A 4AXFA 4XX9A 1OITA 4WNKA 3V8SA 4FG9A 5FXRA 2YZAA 4MAOA 1XMMA 2WZJA 3BHHA 2ITNA 5DA3A 3VRYA 3IGOA 5KBRA 2BHHA 5DNRA 3W18A 3N4TA 2PVHA 3A60A 5H3QA 3VONA 3F3ZA 4FV7A 4JG6A 4DTAA 1Q8WA 3DFAA 4WIHA 3OZ6A 3HV4A 4IX4A 4JL9A 4E5AX 4NH1A 2BRMA 2RG6A 4Z16A 2UZOA 3AG9A 3KF4A 5IEXA 2WXVA 5FTQA 3SAYA 5CASA 5K0KA 5FXQA 5HICA 3U87A 1UWJA 4C62A 3NNWA 5HI2A 2DYLA 3KRRA 1YXXA 4FIEA 3SX9A 3UBDA 4EC9A 3NMUF 4G17A 1U4DA 4D0WA 3Q2MA 4RBLA 4F4PA 4PQNA 4BBMA 4FKOA 4XG3A 4O4BB 5IEVA 3KF7A 4KBAA 1W2DA 4R8QA 5HCYA 5KZIA 2WMSA 3N4VA 5IU2A 4LV7A 2V7AA 5F95A 3NGAA 4C57A 1OUYA 1UU3A 3OD6X 4LDTA 1BL6A 3G9LX 1M14A 5ICPA 3ZDUA 2ZV7A 4IBMA 4TNDA 2NRYA 4OTHA 3LJ0A 5ETAA 5L2SA 1JSUA 3QQHA 3SVVA 2F49A 3MPMA 4I6QA 2GTNA 3CGFA 3O8TA 1A48A 2X9FA 2Z7SA 2EB3A 2RKUA 5DIAA 2ONLC 2V5QA 2W4KA 3PVWA 4AUAA 3Q04A 5A3XA 3S0OA 3NFGB 4AE9A 3LLAA 3PJCA 2CDZA 4AW0A 1YXTA 2IZRA 4KIKB 4PPAA 3ZO3A 4AF3A 1ZYJA 3NUSA 3NIEA 4NW6A 3WZUA 5GZAA 1UKHA 3OWLA 4FEUA 4CQGA 5L6WL 4EOMA 3QC9A 3T3VA 3UC4A 4BDJA 4GYIA 3ZU7A 4CKIA 3ZLYA 3F3TA 1H1WA 2WIPA 3GC7A 5KMIA 1ST0A 4RWLA 4XJ0A 4RZWA 1ZYLA 2YITA 1H00A 4ZTSA 4QTBA 5BUJA 2RG5A 1OGYA 4PNIA 1P4FA 5CXZA 3SOAA 3ZH8A 2OJFE 4YLKA 4D2RA 2P4IA 3R28A 5DN3A 4QDVA 3BL9A 3I5NA 1CMKE 4J97A 2ZJWA 3DY7A 4BI2A 3UQGA 5GNKA 4WD5A 3S2PA 4AGCA 2VD5A 4QMSA 4BI0A 1Z57A 4GT4A 3GB2A 4XV1A 3E3BX 3PE2A 4FT5A 3EN4A 3P9JA 1MUOA 3OC1A 4FTOA 5E1EA 5I4NA 4GVAA 3GU6A 3MBLA 1NY3A 4GW8A 2YFXA 4FEWA 2OGVA 4CZYB 4QNYA 3GP0A 5CEPA 4DITA 1REJA 1YDRE 4RX9A 4EH4A 3EQRA 1W84A 3CCNA 5ANOA 4CMOA 4DEEA 4QMQA 2PZ5A 3D2IA 5EK7A 3U6HA 4MXCA 1XO2B 1LEZA 4NWMA 4WRGA 2KULA 3T8OA 4L6QA 4D4VA 5CU6A 3ZO1A 4DGOA 4DHJA 4ANMA 3AC3A 2WQMA 2UW3A 4CKJA 2A19B 3R1QA 4FKIA 5C03A 3BEAA 4YUQA 4PMMA 5HESA 4AG8A 2B9HA 4FZ6A 2W5AA 4FK3A 3W1FA 5A9UA 3NPCA 4YZBA 5LARA 5BV3A 3A7IA 3E3PA 4LRKA 3K54A 3ZFMA 1G8SA 4EOLA 3UODA 5J9YA 3SW7A 4QD6A 1URWA 1XJDA 3ET7A 3R6XA 4IAZA 4YJQA 3R8PA 4AN2A 3BX5A 1RE8A 4RIOA 1KE5A 4HNIA 3ZXZA 1UWHA 4N6YA 3VS3A 5IF1A 4NIFA 4F9BA 2IF8A 2ITVA 3JUHA 4RX5A 3MIYA 1R1WA 2EU9A 4XH6A 5IZFA 2IVSA 3H4JA 5L8LA 2ZM1A 2WGJA 2YJRA 3EL7A 2B9FA 3O0GA 4JBQA 2J9MA 5EKOA 4F7JA 4RX7A 3VAPA 4P5ZA 3LCDA 4ANNA 1APME 4G9CA 5I9ZA 1BL7A 3HMOA 3FZSA 4DH8A 2X39A 4OTGA 4FKRA 2C6LA 3KB7A 3ZUVA 2W17A 3PIYA 3OY1A 4F1OA 4IWDA 5E8VA 4AOTA 3PLAE 1ZXEA 4MH7A 4I6LA 3UJGA 4ZIMA 1YDTE 1SVEA 3ANRA 3VBTA 4BGGA 5HLWA 4OTIA 4C8BA 5LVLA 3EIDA 4PTCA 2J5FA 5G1XA 1GY3A 3DLSA 4TYHB 4XMOA 4ZSLA 5FDXA 2A27A 4P4CA 4XRJA 3ZUUA 4ANBA 3BHUA 3UDBA 3FLSA 1ND4A 4WNOA 3F2AA 4XLVA 1M2RA 4N4SA 5A46A 4ZY5A 3OTVA 4E1ZA 2BZHB 2XEZA 4OAUC 3CS9A 3DB6A 3ALOA 3FWQA 4FV9A 4XG7A 3DK7A 2Q0NA 2UW0A 3JY9A 3TUDA 2PL0A 4HJOA 4D2VA 4C4IA 3VBYA 3B2TA 2IZUA 5CSWA 5JEBA 1J7IA 5IQEA 4O1OA 1VJYA 3UIXA 1HCKA 1FGKA 4IM3A 1BI7A 4ASZA 5AAGA 2ZMDA 4HZSA 2UZTA 2WQEA 4FSYA 3BHTA 4H3QA 1KV1A 3LFNA 2XAOA 2X2KA 4G6LA 4OTFA 3PPKA 4FV2A 3ZYAA 4F78A 4MBIA 3A7FA 1XH8A 3P0MA 3FLWA 3MA6A 3LJ2A 4JMQA 3RINA 5CXHA 3UYSA 5DYJA 4FYNA 2G01A 2P2HA 3D5VA 4FG8A 1M2QA 5KKRC 5FRIA 5ANIA 2CGVA 4EONA 4O0WA 4O0VA 3FC2A 4UV0A 2XK7A 2WMXA 3W2QA 3PVUA 1XWSA 1JAMA 4WO5A 5CVFA 3FPQA 5HVJA 4EOSA 3Q2JA 2A2AA 1I09A 2YZLA 3PSDA 4X3FB 4QMOA 5IQCA 3EL8A 3PA4A 4KIKA 5ANJA 4PTEA 3ZS5A 4FSQA 3ORPA 4UYNA 2V55A 4DC2A 4O7LA 4FODA 4QPMA 4X6QC 4NM5A 5CEOA 4R7IA 2R7IA 3KGAA 2BMCA 2W9FB 3UG1A 1OM1A 2F7XE 1K2PA 3ZUTA 5BVFA 2UZNA 3UDSA 4V05A 3E64A 3LHJA 2BTSA 3COKA 3AC2A 1SZMA 3CPBA 3D7TB 3RKBA 4ORKA 3E93A 2ITZA 4C37A 5HCZA 5BUIA 1J7UA 2YEXA 4MVFA 4UEUA 4ENYA 4ZZNA 2CNQA 5AR4A 4FNYA 4RIYB 3L8PA 2C3LA 2J0IA 3F5PA 4L53A 4U44A 4UBAA 1BYGA 4DCEA 3OCSA 4XG6A 3LM5A 1OBDA 3ROCA 3OXIA 2EUFB 1OKYA 3JVSA 2BILB 3WF5A 3KQ7A 4JI9A 3H0YA 4ZTRA 3WIKA 3HX4A 3OBGA 5CTPA 4AGUA 3B2WA 4YPDA 4AT3A 5CEMA 3NYNA 5JFSA 5H8BA 1BLXA 2PK9A 3QA8A 2XK3A 4RA4A 4TYIA 2ITOA 4E4XA 4G3GA 3V8TA 4EQMA 3V6SA 2GS7A 2QCSA 1WCCA 2W5BA 3EJ1A 5FQDC 4GSBA 5HE1A 1G8AA 3TWJA 4QT1A 4R5SA 3R8MA 3W32A 2VO7A 4L00A 5F4NA 4CV9A 3DXNA 3GU4A 4BZOA 2IW8A 3RGFA 4IXPA 1J1BA 3OWPA 4XP3A 5EDRA 3W2OA 1Q8UA 1SM2A 3L9PA 4DBXA 3AQVA 1H1RA 2QU6A 4NL0A 1PW2A 4M66A 3HAMA 4A7CA 5K9IA 3R21A 4U45A 3FI4A 1QCFA 3KREA 3CQWA 4L3PA 5H8EA 4FSUA 2BHEA 4GS6A 4EBWA 3BYMA 1G8JA 2BRNA 5EOLA 2W1CA 4BCPA 3OBJA 5J1VA 5AV1A 3I4BA 4GT3A 4NKSA 4E7WA 3ORLA 1H24A 2E9UA 3A7JA 3QFVA 4NM7A 4RX8A 2OICA 5H2UA 5EQYA 2UZBA 3W2SA 5HG7A 1QPEA 5IDNA 3Q60A 4AAYA 4QQ5A 2OIQA 5HO6A 3IDPA 3UE4A 2I40A 3QKMA 2C1BA 2UW9A 2XJ2A 4DEDA 3R9RA 4IB5A 4E4LA 3AC4A 1TVOA 3DZQA 4RFZA 4KRDA 1U46A 5JN2A 1F0QA 3VULA 2ZB0A 2ZDUA 4NKAA 3P08A 3RPOA 1FQ1B 3F5XA 4JVGA 4CFFA 4DT9A 3DQWA 3PG3A 3PPJA 4WG3A 4RG0A 5BVDA 3O5AA 1QPCA 4C4GA 2X7GA 3AD6A 5HVYA 3H10A 2XYNA 3P4KA 5A54A 3EKKA 4DHZA 5DLSA 4MKCA 1XH9A 2C0IA 4Y5QA 1YOLA 3FQSA 3R63A 2W9ZB 1H08A 1ZLTA 4UXQA 5IMXA 4DEHA 4O0XA 3W0NA 1YDSE 2GHLA 5GZ9A 3FI2A 4LMUA 2W1ZA 2CJMA 4PY1A 2RL5A 4AA0A 3M42A 5E8TA 3BI6A 1LPUA 4FV5A 4PP9A 1XH7A 4ENXA 2Y9QA 2JIIA 3PA5A 4GG7A 1V0OA 5KX8A 2CGXA 3LMHA 4PF4A 4J96A 5E1SA 4X2FA 3LCSA 2P33A 3BQRA 3R1YA 3PXKA 4FKJA 3LCOA 4KAOA 1YOJA 3QCYA 4GUEA 4L67A 4DGLC 2PUPA 3R1NA 4FKGA 3HV7A 4PDPA 4BCNA 2UV2A 4U41A 3R0TA 2ETRA 2VTPA 3WIGA 5IQAA 3AXWA 3EQHA 4FT9A 2DUVA 2QVSE 3AT3A 3BU5A 3SV0A 4YGAA 4K2RA 4O6LA 1IASA 4RA5A 1Q62A 4RGJA 5IH5A 3ORKA 4JIAA 3VVHA 5CF5A 2BZIB 2WMWA 4D1SA 5JSMA 1RQQA 4USDA 1GIHA 5DR6A 3WZDA 4F6SA 4DN5A 4A4OA 5BPYA 3FMMA 1OL2A 4IC7A 2YM6A 3QTIA 2W0JA 5IA5A 4CCBA 4PMPA 4UMUA 1JKTA 2XNPA 3SXRA 4CCUA 2E9OA 4U97A 5D11A 3ORTA 2Y0AA 5HG9A 4Z7HA 5C4KA 5BVOA 4WNMA 3DLZA 3NVKI 3OUKA 3ZDIA 4F9CA 3CJFA 4XP0A 4Z9LA 5ETFA 4IAIA 4MWHA 2ZOQA 1Q5KA 4RJ7A 4RIYA 4V04A 3KRXA 4UZHA 3EQIA 4FA2A 4QYHA 1GZNA 2Y8OA 3AC1A 5F1ZA 3FQEA 5CU4A 3MPAA 4O38A 1X8BA 4J8NA 4BI1A 2YLEA 5JQ8A 3UPXA 3W33A 3HAVA 4RJ3A 3NIZA 2B0QA 3F2NA 2X4FA 1SVHA 2YLFA 1Q61A 3HP2A 4IVCA 3BZ3A 4TYEA 5EYCA 2WFYA 1XBBA 2ZDTA 4EOPA 1GZKA 4C38A 4CRLA 3S4QA 4J99A 2FO0A 3HL7A 1SVGA 2UW7A 4JDKA 4MXXA 2PVKA 2WTWA 4IB1A 3NDMA 5LCKA 3DK6A 3NYOA 4UALA 1OKVA 2NP8A 4OT6A 5HVKA 4RT7A 4W8EA 5FEEA 3SC1A 1J7LA 4QP3A 5CQUA 3W0QA 4FMQA 2JKMA 4P90A 5DVRA 3Q32A 3D7ZA 4PMSA 4DCAA 3U6JA 4BDIA 4AZSA 3QXOA 4IZYA 3RZBA 5L2TA 5DEYA 2G2HA 1GIIA 1WMKA 3B8QA 3COMA 3LMGA 4FBXA 4KIOA 3RPRA 4MXAA 2B1PA 3H0ZA 3R7IA 1PKGA 2OG8A 4ZTLA 2UW4A 5DG5A 1H27A 1YWRA 4IACA 3QZIA 3RHXA 2IZSA 4CFUA 3C4FA 3D5XA 3FMHA 3C4EA 2BFYA 3KMWA 4IQ6A 3QA0A 4G31A 3PFYA 2JITA 4FTTA 1TQMA 4R1VA 5EFQA 3WYYA 2HELA 4C3FA 5HNIX 4AT4A 3TG1A 3BL7A 3MB6A 1NA7A 2P3GX 3UGCA 3CD8A 4FTRA 4CXAA 3O7LB 2CNVA 2QKWB 2Z7LA 3BYVA 1REKA 3E7OA 3SRVA 4E6DA 2RFSA 3DBCA 2J50A 5EG3A 1FBNA 2R4BA 2PMIA 5BYYA 5LVPA 5M4FA 4YJUA 4TN6A 4YTCA 3BRBA 1IRKA 1GJOA 3R9HA 2C0TA 3CQEA 4YR8A 3BWFA 2Y4PA 4BKZA 1MQ4A 3D0EA 4HCTA 3W16A 4ZTNA 3F6XA 3A8WA 4R3PA 4CFNA 4FNZA 4GJ2A 1DM2A 2BR1A 4TPTA 4DEAA 3ATSA 3HYHA 3NAXA 2WTDA 4QRCA 3R01A 4YTHA 1Y6AA 2XA4A 3NRMA 4IAKA 4FJVA 2WEVA 1Y8GA 1Y6BA 2J4ZA 2RFDA 3NW6A 5EYKA 4A4LA 4EH5A 4ASDA 4HZRA 2HY81 5EM6A 3POOA 3MTFA 1B6CB 2C30A 3UO5A 4L8MA 5TO8A 3HMPA 5AP4A 3VWAA 4RIWB 1YVJA 4TL0A 3RTPA 4GL9A 2R3FA 3C0HA 3QD2B 4O0SA 5ACKA 2JKQA 4BDCA 3P7AA 3QKKA 4I6HA 3C9WA 4ZMFA 2C5VA 1K3AA 5DT4A 3QUEA 2R3MA 2XK6A 3Q9XA 5BUEA 3LXKA 2RFNA 5E8XA 5HD7A 4RSSA 3G9NA 4O81A 3WI6A 2YCFA 4X3FC 3AKLA 3OXTA 4FTAA 4CLIA 1WVYA 1OBGA 4RJ8A 5HG8A 1DS5A 1WBTA 1ZMWA 4J98A 5CU0A 5M06A 4FRFA 4RC2A 2WEIA 5AR2A 5TF9A 4U3YA 4M84A 2EB2A 4KRCA 2RIOA 3VO3A 4C7TA 1L3RE 4C4HA 1PXOA 2O65A 4ALWA 4DLJA 2Y6MA 2I1MA 2PUIA 1Q41A 3FLNC 4KD1A 3HRFA 4EH3A 2GS2A 3K5UA 5IA3A 3D15A 5ITAA 5EHYA 2HYYA 4R6VA 4IFGA 1XBAA 4XG4A 1M52A 3PRFA 3SHEA 2UW5A 5CI7A 3ZFXA 3LCTA 3MH3A 3P1AA 2Y7JA 2OF2A 3NUPA 5EI6A 3FL4A 5L6PA 5BYLA 2X2MA 3FZPA 3CPCA 2X2LA 3R9OA 5AFVA 1WBNA 3DOGA 4QP1A 5CALA 3RNYA 5I3RA 5K5XA 5HNGA 3GOPA 1QL6A 2VTSA 3QQKA 4J53A 4YJSA 4C0TA 1H4LA 2E2BA 3HMIA 4FIGA 4EOQA 3TDWA 4ITIA 3A62A 4BWXA 2R64A 3KVWA 4O0RA 1FPUA 5EQPA 4J7BA 4P5QA 5D10A 2LGCA 4P7EA 2J2IB 5KMLA 4IVBA 4QP4A 5E8WA 2XIRA 4ZZMA 1IR3A 4KB8A 3F3VA 2CKOA 3DU8A 3V5TA 3DBDA 4KA3A 3OWJA 4D2WA 2W96B 4AN9A 3C0GA 3ZSGA 4ZZOA 3V5QA 4XCUA 2NO3A 3BLHA 1VYWA 4X6RA 4U40A 2JGZA 1V0PA 4G3EA 3OY3A 4CFVA 2C6KA 3CJGA 4EK8A 1L8TA 4NTTA 1AQ1A 4DFZE 4I6FA 1O6YA 4E73A 4TWPA 2QG7A 3IS5A 1UU7A 4OTDA 4CZUA 3HV5A 3W2PA 5IA4A 3MS9A 3EHAA 2FUMA 3DJ7A 2XJ0A 5AP1A 3KRLA 3MFUA 3TJCA 3TKHA 5FDPA 2WIHA 3BE2A 3LE6A 3QQUA 4FNXA 4FGBA 4HVDA 2PWLA 5CANA 3RK9A 2UVXA 3ZO4A 3CC6A 2QOFA 2XMYA 2XKCA 4J52A 5E92A 3ODZX 4RIXB 5HTBA 4MUQA 3C50A 3KXNA 4MF0A 2OU7A 4JR3A 4X21A 5IISA 4FTUA 1CKPA 3LAUA 3QCXA 1YQJA 5CVGA 1JKKA 2BVAA 4GV1A 3UTOA 4C02A 2EXMA 3LIJA 1M7QA 2GFSA 4OTRA 3HMNA 3ZRKA 3RCJA 4B6LA 5FGKA 4Z3VA 3P5JC 3PXZA 4FEXA 2W1EA 3WILA 4O82A 5GIPE 4QQCA 4ZSAA 3LFFA 4IZ7A 5BYZA 4CTCA 4IJPA 5DT3A 2F7ZE 5EYDA 3F2RA 3PSBA 3G6HA 2B9JA 3ACKA 1FOTA 1M2PA 3HA8A 3IONA 4UXLA 5HU9A 3U6IA 2I7QA 4MQ1A 3FMKA 2QOQA 3TV4A 3A2CA 5CF4A 2WTCA 4GK4A 4BTJA 3SA0A 3DZOA 5C9CA 3DNDA 1Q4LA 4HPTE 3JS2A 5DOSA 2JIVA 4AE6A 2CKPA 2WKMA 5LMKA 3RPSA 3BLAA 2HW6A 3C1XA 4WT6A 3Q5ZA 4IFCA 3VNTA 4C3RA 4RJ4A 2AYPA 2VTJA 3OFMA 3OOMA 4UMQA 5HO8A 2C0OA 2XH5A 2R3KA 4CSVA 2JKOA 3R8UA 5KHWA 4CV8A 3DK3A 4MBLA 4L3LA 4FIJA 1JVPP 5AUYA 1T45A 2RSVA 3O96A 2DWBA 5IH4A 3FKOA 4II5A 4MNEA 3DAEA 3R71A 4DE4A 4H3BA 5JRSA 3NNXA 2XAMA 2GS6A 4LQMA 4M69B 2WQNA 5TT7A 3MY5A 4K33A 3OCBA 3LW0A 4CMTA 4DEBA 5HX8A 1H1SA 5M56A 4GKIA 3EB0A 1RDQE 4HYSA 4KIQA 5C01A 3BIZA 3GCUA 4WUNA 4BIEA 2WMAA 4NU1A 4G1WA 3WF9A 4BDGA 1S9JA 3Q9ZA 4RPVA 2XALA 2VWUA 2O5KA 2W1IA 3FMNA 2PMNX 4TKSA 4YC6A 5FD2A 1PMNA 5GZ8A 4O4FA 4ZS4A 3TDVA 5TR6A 4KKGA 4D1XA 4FG7A 4NEUA 5AWMA 3POZA 3F7ZA 1NVQA 1CKJA 1QPJA 1Y91A 1O6LA 2OLCA 3NNVA 4E26A 1R39A 3AD5A 1OZ1A 4GG5A 4TT7A 3NW7A 3REPA 1XMLA 2OWBA 1BUHA 4HGEA 4AX8A 2YCQA 1OPJA 3AC8A 3IECA 4JQEA 5EW3A 2WAJA 2WTJA 4QYYA 3FSKA 3V5JA 2CMWA 3EN6A 4Y95A 3QRUA 4EQUA 3I7CA 3IW4A 4QYFA 5FTOA 4EH7A 5IQHA 4XYFA 5D9HA 3V01A 2BUJA 3UNJA 3W0PA 3GU8A 2W1HA 5CNOA 1H07A 2VX0A 2ERKA 3L9NA 3QD0A 5AIRA 2OO8X 1G3NA 4PMTA 4L42A 2BZJA 3Q4UA 3RK5A 5DRDA 1YWVA 3I81A 1KSWA 5CY3A 4CRSA 4BTMA 3I7BA 1XH5A 2VX1A 4F7LA 2C6EA 4O7WA 3QYWA 5K4IA 2XNNA 2X8DA 1PYEA 4H1JA 5E90A 4O84A 2O63A 1Q8TA 3DTCA 3DV3A 2X0PA 4D0XA 1MRUA 4YSJA 4RVTA 2QLQA 5JRQA 3VF9A 4IC8A 3N51A 4Y72A 3ZBFA 4M67A 1F5QA 2EXCX 4ID7A 4O91A 5DEWA 2GCDA 4WBOA 4IAFA 2JBPA 2JBOA 4KSQA 1PJKA 4B8MA 2Z02A 4FOBA 4BWPA 3FYJX 1XKKA 2A0CX 1KE8A 3TZ8A 4F6WA 2WB8A 3IGGA 4ZSEA 3EYHA 4RVKA 2CHLA 4EYJA 3G0EA 3TN8A 3CR0A 5AP6A 3VQUA 4I5PA 4ZTHA 5J1WA 2BDFA 2R0UA 4WA9A 3GQLA 3FY2A 4AQCA 5EHOA 2J5EA 4XG2A 4LV8A 3U8WA 3FMEA 4KNBA 4RIXA 5DFPA 3EMGA 4D2SA 1VLRA 2W1FA 4O96A 1FVVA 5HG5A 4IB0A 4D58A 4FZDB 2QR7A 5IA2A 1YHVA 3V5WA 2XK4A 5AUWA 2B4SB 2RFEA 4H36A 4I41A 2YIQA 1FINA 1KWPA 2YM8A 3DQXA 4JG7A 1OB3A 5AUZA 3TL8A 5AUUA 3RMFA 2FGIA 3ZM4A 3C51A 3A7GA 2F2CB 1U54B 2CKEA 3T9TA 1P5EA 1WBSA 3V5PA 2C5XA 3KK8A 3PA3A 1OL1A 4DFYA 1KE9A 2X7OA 4BJJB 5JGDA 3S00A 5LMKC 2XIXA 3E8DA 4EHEA 3E7VA 4HCUA 3RPYA 5JH6A 3C0IA 3EFLA 3GFEA 5J5TA 2BRGA 4RVLA 3AOXA 3GCSA 3DBFA 2QHNA 2YDJA 2PZRA 2VWYA 3MPTA 4C35A 2Q83A 2QONA 3F69A 4JAIA 3FXZA 3R7UA 4IVDA 5E91A 3WZKA 4O22A 3TTJA 4PL4A 4YZNA 3Q6UA 1H26A 3TI1A 3TIYA 2YAKA 3H9OA 2WMRA 3PTGA 4JQ8A 4D28A 3O2MA 4NFNA 3A8XA 3GQIA 3FAAA 2PVRA 3D9VA 4B99A 4DFUA 3W8LA 4QO9A 5IPJA 3FEGA 5GINE 2C5NA 3NWWA 2PVFA 1OGUA 2EVAA 2KTYA 1P2AA 2C3JA 2IO6A 3PZHA 4L52A 5CT7A 1DI8A 2WTKB 3CBLA 4M69A 4I0SA 3UIUA 4H58A 3MV5A 4AACA 5AUTA 3W8QA 4FGRA 1UNHA 2XCHA 4FUYA 2YCSA 3DCVA 4HGLA 2XBJA 4R1YA 5AR8A 4YTIA 2CCHA 4JDIA 2QNJA 5L8JA 2XNEA 2Y4IB 3PP0A 4GRBA 5BX0A 4CFWA 4IVAA 3LVPA 3MY1A 3OMVA 4X3JA 3KXMA 4H3PA 5AIKA 3QLFA 5IA0A 2W1GA 3HV3A 4HGTA 4AZWA 4C4EA 1J91A 2X4ZA 2PVMA 2XKFA 2CNUA 2C3IB 3BCEA 3CP9A 5AP7A 2R3RA 2WTVA 2C5YA 3E88A 4XG9A 2XBAA 5AR7A 4G5JA 4JQ7A 4XEYA 2WOTA 4NCTC 4ANLA 3Q52A 2VWVA 1CDKA 4Z55A 5CEIA 5HQ0A 2G1TA 3DA6A 1TKIA 1Z9XA 2IJMA 3F5UA 3GCPA 4IAYA 4WSQA 4QDEA 3C13A 3EFWA 3LQ8A 4YBJA 4EZ7A 5A4QA 3BWJA 4FTQA 2F2UA 4BY9E 2OH4A 4O1PA 1R3CA 2W99B 3ZSHA 3ZSIA 5IH6A 3BE9A 3VS2A 1PXPA 3E62A 4F6UA 2XJ1A 3HGKA 4CYIA 4MX9A 2XIYA 4QMWA 2BAKA 3QWKA 3QYZA 4LOOA 4H39A 3I5ZA 3GU5A 2V62A 4B9DA 3WF6A 2F57A 1ZY4A 4BF2A 3LCKA 4OTPA 3R8ZA 3FZ1A 5EW9A 2IVVA 4BDDA 3VS0A 2J6MA 2YIYA 4LV5A 4ASEA 3AC5A 4OTQA 1ZAOA 4UB7A 4FKSA 4RWKA 5CEKA 5HE3A 4U79A 4H1MA 4WG5A 5ANDA 3Q9YA 3O23A 3TM0A 1XR1A 5BVWA 3O7LD 3DKCA 2O2UA 3FLZA 3NYVA 4FOCA 3PDTA 3FV8A 2Z7RA 3ML1A 1Y57A 2OH0E 2YIRA 2YCRA 5CS6A 4A9SA 3O51A 4D2TA 3TMOA 4U43A 3LPBA 4BYIA 3P7BA 3PXQA 4FKQA 3ITZA 3ORMA 2ZVAA 3E5AA 4MXZA 3RI1A 3QD4A 1QPDA 4JOAA 4QTAA 2OJ9A 3NYXA 3BHVA 1Q24A 3LXPA 2CLXA 2QG5A 1W7HA 3GEQA 4G16A 2Z60A 4NUSA 3GXLA 3QQGA 3O17A 4Q5EA 4UMPA 2IZTA 3OT8A 2R5TA 5M4CA 3A61A 3DKFA 4USFA 1A9UA 2A1AB 3IW5A 3NW5A 1KE7A 4HVIA 3HP5A 2BALA 4ZLZA 5FUTA 3NUNA 4OBPA 3T9IA 4BRXA 1MRVA 3DT1A 1LEWA 4YTFA 5IQDA 4G5PA 2OSCA 5CAQA 4E6AA 4PPBA 2GU8A 2WQOA 5JZNA 4PDYA 3TUCA 3LLTA 4B8LA 4EEVA 5A14A 5AA9A 2R3LA 1OPKA 4FV0A 3DTWA 4MQ2A 1VR2A 3HDMA 3CKWA 1XH6A 3PLSA 4BHZA 4DAWA 4ONAA 4EH2A 4S33A 4KKEA 1R78A 4O6EA 5I9WA 3OS3A 4K9YA 4LGDA 2UW8A 4KBKA 3FZOA 2WHBA 2B52A 3L9LA 4O7ZA 2VTTA 2XIZA 3QTRA 4QYEA 2OXXA 1NVRA 4K0YA 3F66A 4NFMA 3I1AA 4BJJA 4EHGA 1YHSA 5DH3A 3TKI<