4I4FA

Structure of focal adhesion kinase catalytic domain in complex with an allosteric binding pyrazolobenzothiazine compound.
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
272
structure length
255
Chain Sequence
YEIQRERIELGRCIGEGQFGDVHQGIYMSPALAVAIKTCKNCTSDSVREKFLQEALTMRQFDHPHIVKLIGVITENPVWIIMELCTLGELRSFLQVRKYSLDLASLILYAYQLSTALAYLESKRFVHRDIAARNVLVSSNDCVKLGDFGLSKLPIKWMAPESINFRRFTSASDVWMFGVCMWEILMHGVKPFQGVKNNDVIGRIENGERLPMPPNCPPTLYSLMTKCWAYDPSRRPRFTELKAQLSTILEEEKAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Focal adhesion kinase 1
publication title Structure-based discovery of cellular-active allosteric inhibitors of FAK.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 85
structure length 255
sequence length 272
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2012-11-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4i4fA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4i4fA01
2YHVA 1M7QA 2E9VA 3JYAA 3K3JA 3UP7A 3CXWA 3ZC5A 3GOPA 3BU6A 4L9IA 4DEEA 4J71A 2OIBA 3UOJA 3SG8A 4DYMA 1DI8A 3A61A 1UV5A 4J53A 5LQFA 5LMBA 3SGCA 3G33A 3HYHA 3ZXZA 2WNTA 4AUAA 3A7IA 2C6OA 2B9FA 3FSFA 1RQQA 2ZMDA 4NZWB 4ZTLA 2OO8X 2YIXA 4IJPA 2RFNA 5JEBA 2UZUE 2X39A 4KS8A 2UVYA 4RA4A 3S3IA 3VO3A 1H0VA 3OTUA 4QMVA 4UMRA 4MBJA 3FLZA 2C47A 4Y46A 3SRVA 3UOLA 5B7VA 4YC6A 3QD4A 5IUHA 3H0YA 1R39A 4CMUA 3HMMA 3T8OA 3N9XA 4JT3A 4I5HA 4ZS0A 4ZZMA 3MYGA 4DN5A 1H8FA 2CPKE 2DUVA 2RG5A 3EQRA 3KKVA 1ZOGA 3LCTA 3NNUA 4HCUA 4M69A 4P7EA 3ORIA 1Y8YA 2UVXA 4AGCA 1U46A 4AT5A 2R3RA 4YJOA 2WIPA 1Q3WA 4DGOA 2PULA 2BFXA 2UZLA 4W4YA 3UIMA 5EW8A 3C5IA 4XG7A 5JFXA 3R6XA 2FVDA 4M7IA 1ZARA 3QKLA 2OWBA 1JKKA 3R9RA 2B4SB 3BHTA 4TWNA 2PE0A 2R3GA 2UW7A 4EOPA 2IVTA 2WOUA 4ANLA 5K0XA 2H8HA 2JIIA 3NZ0A 3FL5A 4L3PA 4U7ZA 2UVZA 4ONAA 4BBFA 5DA3A 1G8SA 3QRUA 1JKLA 4C4HA 2BTSA 3HECA 4FTCA 3I6WA 3V8WA 4U0IA 3THBA 1BX6A 3LIJA 4NEUA 5EOLA 1OPJA 3BWFA 4CKIA 3D7TB 5KO1A 3CEKA 4EK3A 4RRVA 4ITJA 4ZTRA 5C9CA 4IWPA 5AP5A 5KKRB 4L43A 3BV3A 3ZRLA 2QODA 2C1AA 5CZHA 4EOOA 3DGKA 4OBPA 4XHKB 4BCKA 1CMKE 3RAIA 3UC4A 2OJIA 5CNOA 2B52A 3L8VA 3Q96A 5J7HA 1V0OA 3NW6A 4IACA 2C0IA 2BROA 3H4JA 5JT2A 4RQVA 2GDOA 3AD6A 3PIZA 2EXMA 3Q9XA 1SYKA 2BILB 2WU6A 4U8ZA 3SDJA 4PDYA 4E20A 5GJFA 1DS5A 2OGVA 1QPCA 2F7XE 4FOCA 4WRGA 3VULA 1ERKA 4LMNA 4D0XA 2UV2A 3ZU7A 4Y5QA 3ZRKA 2WTDA 4G34A 3A60A 3OXIA 2JFLA 3AC4A 3KMWA 4HYSA 4JBOA 4M68A 1ZYDA 3IECA 3MWUA 3C0IA 3PP1A 4NTTA 5DI1A 5LARA 4BWXA 4IWOA 3F7WA 2BR1A 4O83A 4IH8A 3FV8A 2JDOA 3QGWA 5KX8A 5AP1A 3M1SA 5EI6A 3Q5IA 5HTIA 3DBEA 2QOFA 5IA3A 2QNJA 5DH3A 5KZIA 4PL3A 4EZ5A 4F4PA 2X0GA 3R73A 4TYJA 4PPCA 2PSQA 2XJ1A 4IVCA 5DGZA 3WF9A 3L9LA 1OIUA 4KIKB 4OTGA 4AZFA 3QZGA 4L68A 1H27A 3R8LA 2UZNA 1R0PA 2C3IB 3TIZA 4G1WA 3C50A 4U40A 1YHSA 2Y7JA 4UXQA 2H34A 2NNWB 1FPUA 4QTBA 4YURA 3ULZA 4O7YA 4G3CA 1YI6A 3RI1A 1L8TA 4MYGA 4O21A 4Z55A 3ID6C 3SXSA 3QQLA 1ZRZA 3OFMA 3Q60A 3QX4A 3UOKA 4XV9A 3UZTA 2ITQA 3TKUA 3UPZA 2OFVA 4LMUA 3RNIA 3GCUA 3VF9A 3IPHA 3W2OA 5EOBA 3DAEA 2WZJA 4UWYA 1PMVA 2YIQA 4HPUE 4WOVA 2Z7QA 3ZFMA 3NS9A 2YM5A 1VR2A 2ITVA 4BDFA 3CQEA 4ACMA 4IX6A 3QRKA 4FEUA 4RJ8A 1BI7A 3O71A 2ZYBA 4FK6A 4EWQA 3COKA 2X81A 1PYEA 4GG5A 4AU8A 1G5SA 2XNNA 4NJ3A 3SHEA 2EB2A 4BDIA 4CYJA 4YPDA 2UW9A 4FKVA 5EHYA 1KE5A 4FVQA 3PJ3A 4MF0A 4W4WA 4JG8A 1STCE 5CENA 2YM6A 2GHGA 4TYGA 4L7SA 2CN5A 2R3NA 5KMNA 4RJ4A 4H39A 4YJTA 2J0IA 5FRIA 1M2QA 4QYHA 4FIHA 5DR6A 5C01A 2J0JA 2O65A 4AAAA 4EQCA 1ZOEA 5E8TA 3U54A 4QP1A 4FX3A 4AFJA 4C3RA 1WBNA 1M52A 3BLRA 3H3CA 3QLGA 1KWPA 3GU6A 3CGOA 4FG7A 1BL7A 2X7GA 5DN3A 3VW6A 4A06A 1J91A 5IEYA 1BMKA 2YITA 3QUDA 4B8MA 4QD6A 4C58A 4EUUA 1F0QA 2W1CA 4X6RA 2CGUA 3NW7A 4D5HA 4PPAA 4R3PA 4Q9SA 1M2RA 5G6VA 3TCPA 5EI8A 3QX2A 1UU3A 5EM8A 4C37A 4UV0A 4O7TA 3FLNC 4ENYA 5EM6A 4XMOA 4A4LA 3PRFA 1SMHA 3I5ZA 3KULB 5L6WL 2H96A 2XK3A 4U5JA 5DIAA 3R7IA 5CEPA 1WZYA 3WE8A 5CEQA 2LAVA 3CTQA 3UDBA 3I1AA 2R2PA 3BHHA 3DNEA 4JIAA 3OT8A 3BELA 5CI6A 3C13A 5C8KA 5ETIA 4P5ZA 4X3JA 4D2SA 2F4JA 5HG8A 5K5NA 3SW7A 1WVXA 2OJ9A 4O7RA 3SVVA 2ZDUA 2DYLA 4JDHA 3GC0A 3QXPA 3ZM9A 1GIHA 3UODA 3UOHA 1H28A 5BVNA 3F5GA 2R3QA 4R78A 2F49A 5CVHA 5E8ZA 4PV0A 3LFDA 3Q52A 3SA0A 4C3PA 2JKQA 4Z7HA 4BCJA 3CQUA 1WVYA 3CLYA 2PVYA 3DNDA 3F2AA 1G8AA 5EKNA 3KREA 3HRFA 1B39A 4BIEA 4G3DA 3OC1A 4YJQA 4EORA 3FQHA 2XKCA 3EFKA 3GC7A 3A99A 3PSBA 3QUPA 5L4QA 5EW9A 2XNOA 3POZA 4FF8A 4ITHA 4YJNA 4I0RA 1ND4A 1WFCA 4LUEA 2WFYA 3C4XA 5F1ZA 3FYJX 3QD3A 5CYIA 4F1MA 3N4UA 3FI4A 2ESMA 3FKLA 3BX5A 3D7ZA 3G9NA 4BDKA 4RIWB 1F5QA 1O9UA 2OXXA 4IW0A 4CLJA 2J0KA 4YO4A 3P7BA 3R22A 4FGRA 3ATSA 5I0BA 2XIXA 5HCYA 1FVVA 2ZM4A 4HJOA 4NT4A 3Q6UA 4OAVB 2JC6A 2OICA 4ZSLA 4GIHA 3W2QA 4RX8A 3ZLSA 1DI9A 2YIYA 3PPJA 5HIEA 3UNKA 4BIBA 3R1SA 3EQCA 3DOGA 3VIDA 4X3FB 4WO5A 2BAJA 2C5XA 2UUEA 3D9VA 3JXWA 4EEVA 3BCEA 4M13A 3E92A 4K11A 4U3ZA 3NYXA 2P55A 4AOJA 3KXNA 3WZEA 4JDJA 5AR3A 3RPYA 4O7VA 1YVJA 3LJ1A 3COHA 3B8RA 5CEMA 4ANOA 4TWPA 3A62A 1YHWA 4R77A 4ACGA 1YKRA 2FGIA 5CQUA 2BCJA 1XR1A 1WVWA 3UP2A 3UVRA 5EH0A 4OAUC 2ETMA 5HVYA 4BCNA 3HX4A 3RK7A 3KRXA 5JQ5A 3NLBA 5BVDA 4FTRA 4K6ZA 3BYOA 5ANEA 3E7OA 3DJ7A 3CKWA 5LVMA 4YC3A 3KN5A 4H1JA 3FHRA 4NM3A 3ZCLA 4F63A 5BNJA 1OL2A 5HKMA 4C4EA 3EL8A 1FGKA 4XH6A 2R3LA 5L2TA 2Y4PA 1H1RA 3RZBA 4KIQA 3ZTXA 2Y8OA 3WF7A 3MB6A 5CSXA 3FYKX 4R1YA 4X6QC 2C6IA 3DA6A 5ETFA 2B53A 3NYNA 1R0EA 3WF8A 3FMJA 4GH2A 1ZZ2A 3QYWA 4NFNA 3QCSA 4AOTA 3BE2A 5EHOA 2FA2A 4FG9A 5J9YA 5DT3A 5AM6A 4C38A 4N6YA 5M51A 4C4JA 3AGMA 1P14A 5AWMA 3D83A 2NRYA 2H9VA 2PVJA 1PF8A 5LVNA 2XJ0A 3DKFA 4PNIA 5F20A 4CRLA 3QRTA 4J95A 4EH3A 5JZJA 2JIUA 2JDSA 3QGYA 1OL5A 3B2TA 3BKBA 5BUIA 2VX3A 4QQCA 3R71A 1OI9A 3CGFA 4PF4A 4AG8A 4YTCA 5DMZA 1OUKA 5GJGA 2ZM3A 4LG4A 2CNVA 2OK1A 2XK7A 4WHZA 4OR5A 4FTQA 5A54A 4LRMA 1GJOA 4DC2A 1H25A 4L45A 2WXVA 3MFTA 3ZS5A 4BKYA 5GZ9A 1UWHA 1URWA 1QPDA 3G90X 4JLCA 4FNYA 4MXAA 5T6KA 5CF6A 3TDVA 4YSJA 4I21A 2OKRA 2FSTX 2QCSA 3PIYA 1Q8YA 4RC2A 4KIOA 5K3YA 3GQLA 4JG7A 4B7TA 4BB4A 4FIFA 2A2AA 2WQNA 2VAGA 2CNUA 2FYSA 3EN7A 3R00A 2OU7A 2J0LA 2YWPA 4MQ2A 2B7AA 2V7AA 2A4LA 4O1PA 4HPTE 5IZFA 5J8IA 5DE2A 2GS2A 4GKIA 3GU7A 5IQHA 3TV6A 2QONA 3KF4A 2JIVA 2W1EA 4TTHB 1V0BA 5DHJA 2VZ6A 4JJRA 3CD3A 2WMAA 2X6EA 2YLEA 3BIZA 4L3LA 1W84A 2PPQA 5BUJA 3AXWA 4IFGA 4FKTA 5D12A 5M57A 2WMQA 3BYVA 4OTHA 2W4JA 4EJNA 5D1JA 4YHJA 4EZ3A 1M2PA 2PZYA 4BCGA 4BHNA 3MPMA 2YDIA 1VJYA 2G2HA 4QMWA 2REIA 2J0MB 2VTHA 4BTKA 2CKPA 4O0XA 4USDA 5FEDA 5AX9A 3ZUVA 5CAOA 3EYGA 4FICA 4BZOA 1W7HA 2EU9A 1IRKA 4GT4A 3L9NA 3PXZA 4EOJA 4FUXA 4GYIA 4CKRA 1OBDA 4ZSEA 3KC3A 1GIIA 1Q8ZA 4UZDA 1UU8A 3DBQA 5M55A 2GSFA 4AGUA 2NP8A 5M06A 3LFAA 2BKKA 5AV3A 3ZEPA 3DCVA 4XG8A 3TNWA 4QP4A 4PTGA 3L8PA 3D15A 4K8AA 5IKWA 4G6NA 5AV2A 3II5A 5HTBA 2Y6OA 3OXZA 3A7FA 4R6VA 4DGNA 3VW8A 3HMNA 4BDAA 5EI2A 4AW5A 3BI6A 5DR2A 2PE2A 3C1XA 2O63A 4HGLA 4EC8A 4XS2A 3R9NA 3ALOA 1YOMA 3D94A 5HESA 5LXMA 2WMWA 4L44A 3TZ9A 4ZY4A 4CMOA 2ERKA 2W06A 4NIFB 4TZRA 4XP0A 4WBBB 4ASZA 3HP5A 5A4CA 3VS6A 5HO7A 4APPA 4HW7A 2BFYA 4XG4A 2OF4A 4A9TA 1JPAA 2JFMA 3OD6X 4ZTSA 3JVRA 3UIUA 5I9YA 3P23A 2YCRA 4D2VA 2P3GX 3ACJA 4XG2A 2CCHA 3AC5A 3FAAA 3R01A 3HLLA 3FLQA 3Q4CA 1M14A 2GS7A 4F9YA 5L2WA 5F9EA 4IDVA 3BV2A 4CFWA 3U87A 3HMIA 1WBVA 4RMZA 3EQGA 1OUYA 3LFFA 5L3AA 4O0YA 4G17A 3VS5A 4YTHA 4B4LA 3LQ8A 5HBHA 5KBQA 2EVAA 4BGQA 4FNWA 1V1KA 4F7LA 4CCBA 3H9RA 3AC2A 3OVVA 1Q62A 2WEVA 4QMZA 3ET7A 1IAJA 4F0IA 2SRCA 4YBJA 2JGZA 3RWPA 1FVTA 4WNKA 4APCA 5HE1A 4MBLA 3UMWA 5A4QA 2HZNA 3LE6A 3FMHA 2HXLA 4L46A 4ZXTA 4FGBA 4Y85A 5HNBA 3L9PA 4CV9A 3FZOA 2X2LA 5KKRC 4WUAA 3MV5A 3IGGA 3ZBXA 5A4TA 5H3QA 5HX6A 5CAQA 3CKXA 2VTAA 1PXIA 3EQHA 1V0PA 5FP5A 3UTOA 4BGGA 3GU4A 3ITZA 2JDTA 5FXRA 4E5WA 4JXFA 4ZSJA 4ERKA 3KK9A 4QTCA 3FWQA 4IAKA 2I7QA 4EH9A 3GXLA 4YR8A 3W8LA 3SG9A 5AUWA 2W05A 1Y91A 4M0ZA 5T68A 3OY3A 5DG5A 4Z3VA 4AOIA 4D5KA 2VO3A 3DTWA 4TT7A 4XUFA 3ZZEA 3MH0A 5AAGA 2B9IA 4H1MA 3V5LA 4USEA 3RINA 4Y72A 1JLUE 4JS8A 5D7AA 3R63A 3IDCA 3QTRA 3GC9A 4JAJA 1H08A 4O7LA 3TUBA 3HAMA 3Q2JA 1OKVA 4MAOA 3V8TA 3C0HA 1U5RA 5C8MA 4GEOA 1ZWSA 3MPTA 2ZV7A 4MF1A 3LMHA 2E9UA 3OP5A 2XCKA 3CIKA 3DKOA 3O96A 5IA5A 4K1BA 1JQHA 2WTJA 3BQRA 3LCSA 4D55A 2KULA 3IDPA 5KMKA 2PZRA 5HO8A 5EM5A 5HBJA 3H0ZA 5HGIA 2P2IA 1GZOA 4K9YA 3VUGA 5J7BA 5M4CA 2R3OA 2WQOA 3QCQA 5A6NA 3LFCA 1DAWA 4ZLOA 5CX9A 5AIRA 2VTRA 4FZAB 5HG7A 2FSOX 3RJCA 4YZDA 3PXFA 3HVCA 2WQBA 5CXHA 5IH6A 2FSLX 5LOHA 4IXPA 4JBQA 4MXCA 5GHVA 5AR2A 4N57A 3MJ1A 2RGPA 2XNEA 4AN9A 4RFYA 1XBBA 3CY2A 2IJMA 4M12A 4A9SA 3NGAA 4JOAA 5HBEA 3FPQA 2YEXA 5CEKA 3NYVA 4WD5A 3A2CA 5H9BA 2IW8A 3RCJA 4BCMA 2OJGA 5DRBA 2HXQA 3K5VA 4XNEA 2EXCX 2ITNA 2WQEA 2PVNA 4OBOA 3EZRA 5CT0A 4M97A 2OXYA 4AZEA 5HTCA 3D2IA 3DXQA 5K9IA 4IM2A 2W5AA 3I0OA 3N4VA 3OCTA 4HGSA 3FMDA 4E5AX 5HIDA 5AV0A 5EQPA 4ZAUA 2WAJA 5TKDA 3PLAE 3T3UA 3PZHA 4FL1A 3V5TA 4F7NA 3RVGA 2CN8A 2HELA 5JRQA 5CASA 1H00A 3HV4A 3K54A 4EJ7A 4YBKA 3VBTA 3MN3A 4MQ1A 4QP9A 4ZTMA 2HY0A 2VTMA 1WBOA 2WMSA 3TKIA 4UZHA 5LMKC 3QQFA 1OL7A 5AR5A 3PXKA 4KKHA 4KAOA 4RZVA 2WTKB 1XH9A 2WMVA 4FVPA 4BI1A 4CXAA 4DFLA 2C4GA 4DFZE 4EHGA 4O6LA 4MXOA 5AP6A 2Z7RA 3CPCA 3VBWA 4J8NA 1YW2A 3A8XA 2QI8A 2HWPA 3GEQA 3W32A 3E3PA 4NCTC 2UW8A 2J90A 1MQ4A 3E8EA 2CLQA 3RAWA 3R28A 4E26A 2PUUA 5LWMA 3QCXA 5EDQA 2OF2A 3QZIA 2NRUA 3KGAA 3NUUA 4RWJA 3QTSA 3PY3A 3DXPA 1APME 4H36A 5T3QA 5G1XA 3TJCA 4AZWA 3CCNA 3ORMA 2IVVA 4WNPA 2IPXA 4DITA 2Q0BA 1FVRA 4M66A 4A4OA 3R9DA 3ORKA 3W55A 5E92A 3UO4A 4RWIA 1JWHA 1OPLA 5D10A 5E7RA 4FTOA 4MX9A 3SXRA 2OJFE 2VWWA 5AUUA 5KMIA 2PZIA 3T9IA 1NVQA 3GP0A 3NUSA 3MW1A 1W82A 3C51A 2PMLX 4OT6A 4U81A 1OB3A 4E4MA 2X9FA 4E6AA 3EB0A 2HW7A 3L1SA 3FMKA 4GK2A 3O0GA 4K77A 4WUNA 1YI3A 3FUPA 3ZFYA 3LMGA 4QQJA 3MTFA 5EDRA 4I23A 3FKOA 5FTOA 5BYLA 3OBGA 2Z02A 4G9RA 4A9RA 4F1TA 1ZMVA 4M14A 3V3VA 5AX3A 3VF8A 2ONLA 4KKGA 3LZBA 4TW9A 3R21A 3CJFA 3KU2A 4HGEA 4WSYA 3WZDA 2JDVA 4M15A 5L2SA 2A0CX 4IM3A 4BI0A 4L01A 4F7JA 4D4VA 5E4HA 3R7YA 4DH3A 4DTKA 3VUMA 3ZO2A 1W0XC 4H3PA 4LI5A 3I60A 2VO0A 2ZDTA 4M0YA 4FT9A 2RIOA 4TKSA 4BF2A 1PJKA 4RVKA 4BR3A 3COMA 3TZMA 4D4SA 3OTVA 3NIEA 4FV5A 4JQ7A 4YLLA 3HUCA 3R8UA 4ERWA 2V0DA 4AW0A 2UW0A 1Q61A 4HCVA 3AG9A 2W9ZB 4B9DA 2J51A 3PZEA 3RCDA 4K33A 4O7NA 4JQEA 5AAEA 1LR4A 1QPEA 2Y4IB 4KBCA 1YXTA 1YDTE 3T9TA 3QTXA 4LOOA 4DBXA 1B38A 3L9MA 3PVUA 5JFVA 4RVMA 4AE6A 4FKSA 2J5EA 3R30A 4L7FA 4DEDA 1MRVA 4F65A 3ODZX 3GCPA 2EXEA 5FEEA 5ANKA 4X3FC 4J1RA 2W0JA 4A4XA 3OHTA 5E1SA 5FG8A 5KNJA 2V22A 4QMNA 4I5MA 4U80A 2PVKA 4JDIA 3IDBA 5AP2A 3CE3A 3ZHPC 4O82A 2XNBA 3ODYX 3DS6A 4XG3A 3U55A 3FJQE 2BIKB 3PY0A 1CM8A 2PHKA 1KE9A 3C4CA 4JBVA 2J50A 2RSVA 4CT2A 4FVRA 4ARKA 1SNUA 5JFSA 4P4CA 3EFLA 4O7SA 2VWBA 3LCOA 5D41A 4F7SA 3PUPA 1YXVA 4CG8A 2JBOA 4BFMA 2XF0A 4IDTA 3DBDA 1CTPE 3AMAA 3RWQA 5DR9A 2W9FB 2XK8A 2QOKA 4EOKA 2BAQA 4F9CA 3CPBA 4XRJA 5E8WA 3TI1A 4O91A 1HCKA 4RFZA 2P4IA 4AGDA 2VV9A 3IO7A 1FGIA 4YHFA 3QRJA 5HIBA 4E6DA 4RIXA 4MBIA 4I24A 2I0EA 5CLPA 3B8QA 5HE2A 4IHPA 4PDSA 3CTHA 3NEWA 4D0WA 4O84A 2YABA 4TY1A 1MRUA 4KS7A 5EYCA 3BE9A 3VS4A 5IPJA 2XIYA 2G15A 3AD4A 4BCFA 3LOKA 4IC7A 2BZHB 2ZV9A 2QOLA 2BTRA 5FDXA 4AN3A 4C62A 5C4LA 1YDSE 3DLSA 3F2NA 2E2BA 3NAXA 4AA5A 4HZSA 4D2TA 5GIPE 2C69A 4KBKA 4O38A 3ANRA 4OTRA 4J7BA 3V5JA 5AUTA 5KMMA 4NW5A 4S30A 1HOWA 3U8WA 4D2PA 4XLIA 4EI4A 5HEZA 2OH0E 5CAVA 4FEQA 3GI3A 4DT9A 3JUHA 3PWYA 4I94A 1RDQE 3BYMA 4GMYA 5C8NA 3R83A 3NNXA 4O22A 4FT5A 3WBLA 4D9TA 5JMSA 2FH9A 2ZB1A 2GFSA 3ZO3A 2YZLA 1KOBA 2G9XA 3D4QA 4PMSA 3O17A 3F7ZA 4KWPA 5AIKA 3F82A 4FTIA 4ZY6A 3RPSA 3RTPA 4LFIA 4CKJA 2GNGA 4X2GA 4E6QA 3I6UA 3F9NA 4DA5A 4C0TA 1CDKA 4G16A 3GC8A 1O6LA 4IB3A 2CCIA 5I9WA 4V01A 2OBJA 3AC8A 4CCUA 3MH3A 5DLSA 2F2CB 1KUTA 1PXPA 4DAWA 1H1SA 4OTPA 4IIRA 4J52A 4Z16A 5AMNA 5AUXA 4E4XA 3FZTA 3BPRA 4QYFA 4EKKA 4KKEA 5CF4A 3ETAA 4OT5A 2AUHA 3LQ5A 4AN2A 5IA4A 3R02A 2C5OA 5IQGA 1BKXA 5DNRA 4FEXA 1Y57A 1Y8GA 4FYOA 5FQDC 2VTJA 3WARA 4QNAA 3VS1A 5IH4A 4I6HA 3AT3A 3EZVA 4RJ5A 2I0HA 4LL5A 4YGAA 5AFVA 3O50A 3MA3A 1KSWA 1JKTA 1P2AA 3P7AA 1Q99A 4RBLA 2O64A 3PG1A 3EQIA 3OZ6A 4EZ7A 4TYHA 2JDRA 1H0WA 3QTUA 4CTCA 3WF5A 3LKMA 4WNMA 4YSMA 3TTIA 3BZ3A 4FUYA 1SNXA 4XOYA 5CF8A 3DZQA 2PVLA 3SRVB 4FSYA 2Z7SA 4S33A 2HY81 3LXPA 4H3QA 2WB8A 5FM3A 1BI8A 4YNEA 4YZ9A 1DM2A 1FMOE 3BYSA 1A48A 4RSSA 1OM1A 3CQWA 3VWAA 2ACXA 2PE1A 4M69B 3GU8A 3R8VA 3AOXA 3MPAA 4ZLYA 2DS1A 3LJ2A 4ALVA 4TL0A 3LXKA 3M42A 5EW3A 1F3MC 3F5UA 1Z9XA 3K3IA 4IX4A 5E8UA 1YWNA 4BCPA 3S00A 3GENA 4XV3A 1CKIA 4G31A 2E9OA 2IZSA 3EL7A 4PY1A 4R3CA 3PSCA 4TPTA 3NNVA 3VBQA 5J5SA 1OIQA 4CG9A 1VYWA 3S2PA 4MTAA 5HO6A 2BDJA 3QC4A 4YTFA 1OBGA 1MRYA 2XK9A 4HYHA 2A19B 3N51A 4O7WA 4DE4A 3QUEA 5CANA 3O8PA 2JITA 3LW0A 4F64A 3P0MA 4HVIA 1OGUA 5AP4A 2QU5A 2XKDA 3ULIA 5DPVA 4O0UA 4ZJIA 2ZV8A 5AP0A 3DK7A 2QO7A 4IWDA 4FKLA 3OOMA 4FIIA 3DQXA 4HZRA 5TO8A 4F0GA 4EOMA 5A46A 2IZUA 1YI4A 1IA8A 4RC4A 4LGHA 1ZMWA 3OUNB 4QPMA 4S31A 4BL1A 4EUTA 3Q3BA 5E8XA 3FLWA 4ANBA 1XKKA 3DPKA 3I4BA 4QMXA 3OT3A 2YAKA 3WZKA 4JR7A 2ITXA 4BZNA 3MVLA 3QTWA 3RAHA 4CFUA 3PWDA 4EC9A 5ITAA 3A7JA 4HOKA 5DYJA 3P79A 4P5QA 3TKHA 4G6OA 2VTTA 2ZJWA 4XLVA 4B99A 4ID7A 4YU2A 4PTEA 3QQKA 5AEPA 3BEAA 4O7ZA 4EOIA 1H1PA 1TKIA 2J7TA 3NMUF 5J9LA 4I5PA 3P5KA 4KBAA 4BKJA 4YJRA 4Q5EA 4EH5A 4C8BA 5CSHA 1S9JA 2J6MA 4C2VA 4RIXB 2WOTA 4GFGA 4AS0A 5CT7A 3I79A 3FZPA 5F94A 4XV2A 1WCCA 1JAMA 4ANNA 5JGDA 3NUPA 4DGMA 3FE3A 4C35A 3QLFA 4MH7A 4AT4A 4FOBA 5CAUA 3UBDA 4J8MA 4X21A 5GINE 3VS0A 4XG6A 2XRWA 3I81A 2R3IA 3MBLA 3RMFA 3G51A 2XP2A 4FTMA 4MNEA 4DF3A 3MY0A 3IK3A 4JRVA 5I9XA 5IQAA 4TNDA 2HAKA 2HZIA 2ERZE 5GJDA 4S2ZA 2JAVA 3R1YA 4AZSA 1GZ8A 2DQ7X 4HNIA 4CZYB 3R7VA 3UQFA 4CNHA 3ZONA 2YA9A 3VUIA 2GQSA 4UEUA 4ANQA 4BC6A 5D11A 4DINA 5M53A 1WBTA 3PA5A 3W8QA 4GK3A 3TN8A 3NR9A 3AT4A 1JOWB 3PPZA 3V5WA 4V04A 3MH2A 3SXFA 4YP8A 5HD7A 2GTMA 4D2WA 4O0RA 4DH8A 4QYYA 5HLWA 2YWVA 4GW8A 4RJ3A 4PP7A 2RF9A 3V6SA 1PKGA 4BZDA 3ATTA 2BKZA 3BGZA 4RIYA 3HRBA 3PTGA 4CYIA 3HL7A 3K5UA 4G5PA 1BL6A 5CAPA 3RPOA 4DTAA 3UE4A 4QMPA 2ZVAA 3VUTA 4MXZA 2VTLA 2WTIA 3KRRA 4D1ZA 4GVAA 4FBXA 4X7QA 4QP6A 4BKZA 3DFCB 4L42A 2XZSA 4U97A 3UG2A 3GFEA 3TNHA 5BVFA 1K9AA 4YZNA 3FSKA 4FL2A 4TYHB 1PXMA 5C26A 2QHNA 5IF1A 5ICPA 3S95A 3G6HA 3UNJA 2NPQA 3UG1A 5AAFA 4YMJA 3H9FA 4BN1A 3UYTA 2C0TA 3O8TA 4ZLZA 1XH6A 4G6LA 2R5TA 4ZK5A 4WG4A 3LM5A 2C6KA 4KSQA 4EHEA 3TDWA 2QKWB 3W2PA 2X9EA 3TWJA 4F6WA 2WELA 3W1FA 3E88A 1QL6A 3JVSA 4TXCA 5C03A 4EOSA 1RE8A 3RPVA 1LEWA 4KSPA 4JR3A 3IOKA 1Q97A 5CVGA 2W1GA 3PSDA 2BRMA 3F3UA 4KNBA 4GRBA 5HD4A 3P08A 4DEGA 2W4KA 4N0SA 1FINA 4FTAA 3S0OA 5IMXA 3VUKA 4M3QA 4DG2E 4EOQA 2BDWA 1ZYJA 4AE9A 2WTKC 3DU8A 3EH9A 5IG1A 2OFUA 3IW5A 1ZZLA 5C4KA 3G0EA 2UZBA 2WTWA 4GIIA 3DDQA 5KMLA 5I3OA 3OG7A 1H24A 3HA6A 3IQ7A 3WIKA 1AQ1A 1CKJA 3ZDUA 3VRZA 3KXHA 2F7EE 2PMOX 2BIYA 3M2WA 4ZSGA 3OWKA 3SKCA 1DAYA 3BQCA 2Z8CA 3DAKA 2XEZA 4PMMA 1MUOA 3KB7A 3KCKA 3U6IA 4ZZOA 4GYGA 3RBWA 5CSPA 3WZJA 1ZMUA 3QKMA 3G0FA 2ETKA 3ZXTA 2R9SA 3CP9A 4RJ7A 4Y83A 3OBJA 3E87A 5M07A 2DWBA 4JRNA 3CD8A 2XM9A 5FUTA 1W8CA 4XG9A 4DH5A 5BVOA 1PHKA 4TWOA 4BICA 5HCXA 4I20A 3SX9A 1QCFA 2XIZA 3LFEA 3SAYA 4MWIA 3DJ5A 1KOAA 2QR8A 4I4FA 4FIEA 4QMTA 1JVPP 2ITUA 2FO0A 2QO9A 3LLAA 3LFQA 3FBVA 4E5BA 3REPA 1R3CA 2WIHA 4Q2AA 4FKUA 1Q4LA 4RX7A 3RK5A 4I92A 3GUBA 2OIQA 2C3KA 4I22A 4IB5A 3A8WA 4J99A 4ITIA 3C0GA 2YIRA 4X0MA 1XH8A 5GIOE 5BQ0A 4AA4A 2XS0A 4IQ6A 4LL0A 5JZNA 3JS2A 5TE0A 5ANDA 5IEXA 4Y73A 4MKCA 3Q4UA 4O27B 5EG3A 3BYUA 4X2NA 3QBNA 3MFRA 3F5PA 3QTQA 4RIOA 2WMBA 3ZBFA 4R5YA 5LWNA 1IR3A 2X1NA 3AC3A 5D9HA 2WTCA 4FTKA 3C4FA 1OMWA 4XP3A 4ZTHA 4IB1A 4GK4A 4IM0A 3MTLA 4CQGA 3FEGA 2IWIA 2X2KA 2Y4IC 3Q53A 2VWVA 1NVRA 1JBPE 1OL1A 2XBJA 3BU3A 4WSQA 5BYZA 3TACA 2BRNA 2IZRA 4LOPA 3JY0A 2UZVA 3PY1A 5LVOA 5ACKA 5GZAA 3ZEWA 4E1ZA 2O5KA 1BYGA 5CZIA 3VHEA 3F3TA 4AZVA 1WBSA 2Q0NA 2W96B 4IZAA 1GY3A 3ZRMA 4PP9A 4QMUA 3I7BA 1OIRA 3LLTA 3QQUA 1PXJA 4ENXA 5A9UA 2W5HA 3FI3A 4GT5A 4DBNA 4PMPA 5L6PA 1LPUA 2XK6A 3DAJA 4OLIA 2B54A 2NO3A 4CFMA 5JN2A 2ITOA 4QQTA 1YXXA 4B0GA 2WQMA 3FXWA 4O2ZA 1PXKA 4ORKA 2VGPA 4FEWA 2BHHA 5IMEA 5E90A 5DT4A 4AQCA 3O2MA 2R3PA 3AD5A 3UGCA 2UW5A 1OKYA 5EM7A 3DQWA 5FWKK 3UIBA 5L8LA 4FIGA 3FZSA 5BMMA 3CBLA 4GUEA 4O96A 4EH8A 1J1BA 5CEIA 3HZTA 2B9HA 4S34A 5IUIA 4FR4A 3U6HA 4IAZA 2GU8A 4WG5A 3F3WA 3PXQA 1J1CA 1UKIA 3SLSA 4E93A 5JQ8A 5K4IA 2JKKA 3DBFA 4FV1A 1XH5A 3FXZA 3T3VA 4QQ5A 4QTDA 4W9WA 5HG9A 1UNGA 4U6RA 4W4XA 1ZYCA 3VJNA 5KE0A 2HENA 4TYEA 2XIRA 2QVSE 5DOSA 1A9UA 4D4YA 3VAPA 2QHMA 4LOQA 5JK3A 3FMMA 2HK5A 3DXNA 3IONA 4YJVA 2VGOA 4WA9A 3AQVA 4FSUA 4NM0A 3RHKA 3KRLA 3P86A 2XB7A 5B2LA 5IDNA 1AD5A 5J79A 1R1WA 4I6BA 5AA8A 2VWUA 4DG0E 4FZFB 4OTIA 4EH6A 4FKJA 1AGWA 2W1HA 4EHVA 2JBPA 2PL0A 3MVHA 3DV3A 2R3FA 2FSMX 4FNXA 4GU6A 4HVSA 4C61A 3MI9A 4JI9A 5DT0A 3RGFA 1BUHA 4IZ7A 1IA9A 3G2FA 3R0TA 1CSNA 4RJ6A 2VX0A 3F61A 3D5XA 4L3JA 4YJUA 5IQFA 2ZM1A 2Y6MA 1UNHA 3KXGA 3Q5ZA 3FC2A 4IAFA 4U43A 4D1SA 3OWLA 3LCKA 4FV4A 2G01A 2AC3A 3GOKA 1E1VA 3OOGA 2YM4A 3WZUA 3BLQA 4DGLC 3N4TA 3C4ZA 3EQPA 3K2LA 1PKDA 1OL6A 2Q83A 4U41A 3Q32A 1NA7A 1OZ1A 4AW2A 2ITWA 4RIWA 2C5VA 2RFSA 1ATPE 5FLFA 3DLZA 3DT1A 1H01A 3D7TA 4Q9ZA 2R3MA 2G2FA 3KQ7A 1E9HA 4DFYA 3ZH8A 2XJ2A 2PZ5A 3GQIA 3PIXA 4IVBA 5CS6A 3R7UA 3RALA 1LEZA 2V7OA 2X8EA 1RJBA 2OW3A 4G5JA 1JNKA 3ROCA 1XO2B 1O6KA 1OIYA 3WI6A 4ACHA 3UVQA 4L53A 4XOZA 4YHTA 3EWHA 5AV4A 4PX6A 4UMPA 4QMMA 5FTGA 3TV4A 2P2HA 2VTPA 3RK9A 4C2WA 3UJGA 2V62A 2QU6A 4ZTNA 4EH4A 2ONLC 2R3JA 4RGJA 5DEYA 5BX0A 3IW6A 3NIZA 2Y9QA 3W33A 2CMWA 3BU5A 2WD1A 4XJ0A 3KF7A 2YERA 2XCHA 2ZOQA 3MDYA 5IISA 4OTQA 4A7CA 5HVJA 2UZWE 3MGYA 1NXKA 4GUBA 2FUMA 1PXNA 4U3YA 2QOCA 3LJ0A 2YM8A 1PRYA 5I9UA 2BVAA 4JG6A 1K3AA 4NL0A 3D5WA 4DCAA 4NWMA 4RG0A 3FLYA 2CGXA 3EOCA 4RFMA 4MNFA 3QXOA 3NWWA 3BBTB 1JSVA 1UVRA 4QMLA 4PTCA 1IG1A 4KINA 2C30A 3A7HA 3FXXA 3OW4A 2YCFA 5L6OA 2C3LA 2XKFA 4AACA 5CVFA 4LGDA 5KBRA 2WMRA 2I0VA 3AGLA 4RPVA 2YDKA 3CY3A 4EL9A 3D0EA 4UX9A 3UQGA 2Z2WA 3DKGA 4FE2A 3FL4A 4ZJVA 3F2RA 2C6EA 1B6CB 4K18A 2YIWA 4KABA 5AP3A 4F70A 1NT2A 2UZTA 3P7CA 4UBAA 3V5QA 2I40A 3OMVA 3ZDIA 3WE4A 4CT1A 1M7NA 3UQCA 3NVMB 4I0SA 3DB6A 4Z7GA 4E3CA 4DT8A 3ORZA 2C6LA 3SOAA 4O1OA 3MSSA 4CZUA 3Q9WA 3R7GA 5KHXA 2UW6A 3VBXA 2HZ0A 1PXLA 1SVEA 4GKHA 5H2UA 3VNTA 2HCKA 3U51A 3KL8A 3EJ1A 4DH1A 4AWIA 4RZWA 3G5DA 4MD8E 5H8GA 2GNFA 3ORLA 4BYJA 3NCZA 5FBNC 1XBCA 5IDPA 2W7XA 3QA8A 4C3FA 2PK9A 1SZMA 3VC4A 3AMYA 3VJOA 5FBOA 2OH4A 4GG7A 4ACDA 4C33A 2QG5A 2WKMA 5HLNA 3B2WA 4EWHA 5FD2A 4FSNA 2GCDA 3ZZWA 1FBNA 3U4WA 5IQCA 1JKSA 4EK6A 3G15A 3E8CA 4CEGA 2B0QA 3C4WA 4EK4A 5M4UA 2WO6A 3O7LD 1I44A 1XHAA 5FXQA 3R1QA 3KN6A 1YWVA 3ORXA 3NYOA 2HOGA 5CU4A 4IVDA 3HEGA 2PMNX 2X7OA 1T45A 3FQSA 3PXRA 1VYZA 4O86A 4L52A 4O81A 4FTUA 4G9CA 3ZO4A 4IAAA 5LMKA 1Q24A 4NKAA 4K0YA 2QOOA 2IW6A 4HVDA 4UB7A 4MEDA 4RLLA 5TOZA 4PQNA 4LYNA 5TR6A 2R0IA 4PPBA 3NSZA 4C36A 1FOTA 3HV7A 4WNOA 2C6TA 3KXZA 5LCJA 2OG8A 4FSTA 3E93A 3D2KA 1MQBA 4NM7A 4RA5A 5CI7A 3HA8A 1Q3DA 3VBVA 1I09A 3QFVA 4ANMA 1OVEA 3E5AA 5CF5A 4NCTA 3NUYA 3V01A 1X8BA 3WILA 4EQUA 5K0KA 3ZSHA 3MFSA 3V51A 3QWJA 5CTPA 3LHJA 3SQQA 3O8UA 4IEBA 4CD0A 3C4EA 2XNPA 3IGOA 3KULA 3MESA 4FV3A 2PUIA 1T46A 1GAGA 2PTKA 3GVUA 2W4OA 5DBXA 2R64A 5ETAA 4FODA 1GZKA 4W8DA 4BCHA 4FTLA 4F09A 4I4EA 4FSZA 4ZY5A 4FKWA 3W16A 5KZ0A 1REKA 4ZZNA 4YO6A 2P0CA 3KXXA 3D5UA 4IX3A 2VTNA 3OW3A 5E8SA 3ZOSA 4J98A 4H58A 4TRLA 4JX3A 4OW8A 3PVBA 5CNNA 3GGFA 4WRSA 5DVRA 3RAKA 4F6UA 3VN9A 4F1OA 4ZEGA 4HYIA 4FA2A 3PE2A 2Z7LA 2CKOA 4L00A 1OECA 4XBRA 4F9BA 1BLXA 5BVWA 2XEYA 2E9NA 2XRUA 3KMMA 3OEFX 5IEVA 3TNPC 2BZKB 1PY5A 2C0OA 3FI2A 3HUBA 5A4LA 3A4PA 4WBOA 3OCSA 4KUJA 2XVDA 4FV0A 2BMCA 4I1ZA 2GNHA 3LCDA 5I5ZA 4AX8A 2QG7A 1SVHA 3MVJA 2C68A 4ZJJA 1PW2A 3BRBA 4CQEA 1YOJA 4QRCA 2VTSA 4NJDA 4KA3A 3QTZA 3HV3A 2EUFB 4D4RA 4RWLA 2XUUA 2YDJA 3BEGA 3O23A 1XBAA 4FT7A 4N70A 3ORNA 4NK9A 4M8TA 3WF6A 2YACA 3Q4TA 4HGTA 3UMXA 2UZEA 3H9OA 5AUZA 4XV1A 3WYYA 1O6YA 4C34A 2XKEA 5F95A 5BVKA 3R9OA 3POOA 5B0XA 2BAKA 3EHAA 5AV1A 3VVHA 1J3HA 3JPVA 4GJ2A 4KIPA 3ZLWA 2XH5A 4ZOGA 4C4IA 3ANQA 5BUEA 4JNWA 4IE9A 3ELJA 4ZS4A 3TV7A 3VHKA 2X4ZA 4J96A 2PVFA 2GQGA 3M11A 3ORTA 4FZ7A 4KRCA 2OSCA 4X3FA 2H6DA 4QTAA 4JL9A 4II5A 4YJSA 3G6GA 4B6LA 4QYGA 4Y8DA 4AGWA 4ANSA 4MXYA 3W2SA 2A27A 5HI2A 1P4FA 4UWBA 5CU2A 2PVRA 4RVTA 2CLXA 4ZMFA 2VWYA 3OCBA 3TEIA 4O0WA 5M44A 1R78A 4FNZA 4V0GA 2KTYA 1OITA 2GTNA 1ZYLA 4X2JA 3IG7A 4FV2A 4DFBA 2AYPA 3HRCA 5HQ0A 1PMNA 4RC3A 4JVGA 4PUZA 4U9AA 3KFAA 3VS3A 2JLDA 4MXXA 1A06A 4E73A 5CALA 5KMJA 4QYEA 3UZPA 4RWKA 4QP7A 4YPSA 4F0FA 4EONA 4CTBA 5JGBA 2GPHA 2R3KA 4HVGA 1J7LA 3HAVA 2C6DA 4BCQA 2IVSA 3EKNA 4EYMA 5M08A 5HZNA 5AR7A 4FIJA 4G3FA 3MH1A 3QQJA 1PMEA 2C6MA 4XBUA 4A07A 1WBWA 4ACCA 5JRSA 4BTFA 2CJMA 4ASEA 3QZHA 1Y6AA 2QC6A 5HX8A 1ZYSA 3P9JA 1NY3A 1S9IA 2O8YA 2IN6A 3R7OA 3V6RA 1PYXA 3DB8A 4BI2A 4MVFA 4CFVA 3QKKA 4M67A 2QLUA 4CRSA 3ZFXA 5AR4A 4FKIA 4Q5HA 3NUXA 4LQMA 2JD5A 4BYIA 3MB7A 3U6JA 2O3PA 4CVAA 4NYEA 4RQKA 1J7UA 4AW1A 4C59A 2BRHA 1Z57A 4QNYA 1ZOHA 4BIDA 4RLKA 3VRYA 5HU9A 5LJJA 1LP4A 3OEZA 2RG6A 2B55A 2VNYA 4FT3A 4RX9A 3ZUTA 1YXSA 4A9YA 2HZ4A 4BDGA 4JX7A 5GZ8A 5EQYA 2I6LA 4EKLA 4F9WA 2XNGA 4UALA 3W10A 1XQZA 3ROYA 2F9GA 4YZCA 3Q9YA 5E91A 3KRWA 4BBMA 4I3ZA 4HVHA 4ZMEA 1ZY4A 3MVMA 2VRXA 4JAIA 4O0SA 5I9ZA 3UO5A 5J1WA 3EQFA 3NDMA 4PWNA 2CHLA 2W1DA 1NW1A 4EBVA 3OWJA 1L3RE 4IBMA 4YLJA 5IQBA 5AM7A 1GZNA 4GFOA 4GVJA 5EFQA 2ITPA 1XH4A 1YWRA 3FC1X 5ANJA 4ZTQA 2PY3A 2UW3A 4FC0A 4FK3A 3FMLA 3OUKA 2ZMCA 3RHXA 4FSQA 4EBWA 1VZOA 3FQEA 3TJDA 4BRXA 5CU0A 4QTEA 1REJA 2J2IB 2J4ZA 3E64A 3PJ1A 3QQGA 4IJ9A 4NM5A 4UYNA 2VN9A 2VUWA 3CTJA 3NVKI 3IS5A 3A7GA 4AXAA 2WPAA 4F9AA 4WT6A 4WG3A 3LFBA 1LUFA 4O0TA 5AADA 1WAKA 3PDTA 4PMTA 4OTDA 3GCVA 2QD9A 4NSTA 1OPKA 1XH7A 1ZY5A 2LGCA 1URCA 4FYNA 5AUYA 4BCIA 4BWPA 2XNMA 1Q5KA 4RT7A 2RFEA 2XK4A 2QOHA 4O2PA 4X2FA 2VTQA 1FQ1B 3QF9A 1G3NA 4BDBA 5CXZA 2E9PA 4UMUA 2CGVA 3DY7A 3GFWA 4E4LA 5HE3A 4CZTA 1Z5MA 2YN8A 4FG8A 4CFFA 5I3RA 3EN4A 1KE7A 2OI4X 4DFUA 4FKGA 4QO9A 3U9NA 4C7TA 2XMYA 3DJ6A 3Q04A 3W2CA 4GV1A 3ORPA 5LVLA 4R7BA 5B2KA 3IW4A 3EYHA 4X2KA 3AC1A 3U4UA 2C5YA 2CSNA 4LM5A 4PRJA 5CU6A 5ETCA 4CFNA 3LXNA 4D58A 3VUHA 3HDMA 1TQMA 2W1IA 3BBWA 4I6QA 3EIDA 4FZ6A 3QALE 4FKPA 5KUPA 5JSMA 3ACKA 2V55A 4MK0A 5E8VA 4G3EA 5FXSA 4PNKA 2B9JA 2VWZA 2R7BA 5GNKA 2BRGA 2YM3A 4QOXA 2V5QA 3VS2A 4BHZA 3TTJA 2QLQA 3C7QA 3KRJA 4JBPA 3LAUA 3LXLA 3UPXA 3OXTA 4NFMA 4GCJA 3WOWA 3A4OX 4BBEA 1YHVA 5IQEA 4NIFA 4D9UA 4FSMA 4FSRA 1W98A 4IB0A 3ZSIA 4DLIA 4DH7A 2VTIA 3DKCA 2X8DA 2PUPA 2X2MA 5ACBC 4D2RA 3D5VA 4IFCA 4MWHA 2VTOA 3QZFA 4C57A 4BDCA 3TM0A 5LMAA 3BHVA 3H30A 5HNGA 5C27A 4NUSA 2R4BA 2PU8A 4AZTA 5L8KA 1JSTA 4PL5A 4V0GB 2HYYA 4BDDA 2OZAA 5LCKA 3FZ1A 5E8YA 1UNLA 3GCSA 2W99B 1JSUA 3R9HA 4IWQA 2W5BA 1Q8UA 2PYWA 3QYZA 3NAYA 3ZC6A 5EHLA 1RW8A 4FTNA 3Q2MA 3QC9A 4ALWA 2G2IA 4R7IA 2WEIA 4IAYA 4FKQA 5FDPA 3QAME 5DEWA 3QHRA 5EKOA 3R7EA 5EYMA 4EYJA 1P4OA 3JY9A 2F57A 4KRDA 5K4JA 3NX8A 5HICA 3TIYA 3CC6A 3MY5A 4YTIA 2BUJA 2XYNA 5JFWA 5L2IA 3F3VA 4ZIMA 5EQEA 2QR7A 1QMZA 1K2PA 3HNGA 4L8MA 2Z60A 4U42A 3E62A 3PA3A 5CY3A 4ALUA 5IA1A 2YJSA 4FT0A 5BYYA 1OKZA 4FSWA 1H1QA 3PJ2A 5AP7A 3R8PA 3ALNA 4DGGA 5AUVA 5D7VA 3AT2A 3PXYA 2B1PA 4JIKA 4DEAA 5TF9A 2ZV2A 4H3BA 3PRIA 2RFDA 3DDPA 3FPMA 3Q6WA 4UY9A 3E3BX 3EFWA 3CR0A 3LM0A 2PMIA 2OXDA 2QOIA 3SOCA 5KMOA 4AA0A 3TZ8A 1U59A 5J9ZA 5AR8A 3BGQA 4Z9LA 3W2RA 5J5TA 4OBQA 1UU7A 5A3XA 2W17A 4GSBA 4NU1A 2WTVA 2IZTA 3PLSA 4NTSA 2O0UA 3Q9ZA 3WYXA 3NUNA 1UU9A 3RZFA 1H4LA 1XJDA 3EN5A 3C5UA 1H07A 3EKKA 3O7LB 4B8LA 4BVUA 4C4FA 1M17A 1W83A 4FKRA 1KV2A 4ASXA 3F66A 4XP2A 2GQRA 1GOLA 3MIYA 4GFMA 3DTCA 2X6DA 4TYIA 4XYFA 5E9EA 3NCGA 4DEHA 2X7FA 5CEOA 5M09A 3EFJA 1UA2A 2AC5A 3GU5A 4JDKA 4UWCA 3OROA 2BALA 2BPMA 3LQ3A 2YLFA 1IASA 2QQ7A 4AFEA 3TNIA 4PDOA 4DCEA 4IZYA 3KCFA 3TUDA 3FI8A 4QP3A 2BZIB 3IKAA 5H8BA 1YQJA 3AMBA 4DEIA 5A6OA 4GJ3A 2A1AB 2PVMA 3EQBA 5F4NA 2GFCA 3Q4ZA 5HORA 3FY2A 4BTJA 1U4DA 3PYYA 4L6QA 2W1ZA 3MY1A 1KV1A 3PP0A 4QP2A 1FMKA 3E8DA 3F3ZA 2QURA 4I6FA 3UC3A 3R8MA 3EQDA 4AT3A 3MA6A 2F7ZE 4K2RA 4USFA 5FM2A 2C5NA 5BVEA 5IQIA 3SC1A 2R3HA 2JKMA 5KCVA 2IVUA 3OF0A 3P1AA 1E1XA 3ENMA 4RX5A 4H05A 4QP8A 4EH2A 3F69A 2GHMA 2VD5A 3G9LX 5J87A 2J5FA 3OCGA 4A9UA 4G3GA 4GS6A 3SD0A 2OLCA 2W1FA 3HMPA 1CKPA 3TT0A 4IZ5A 4E8AA 4R7HA 3RP9A 4FKOA 1KE6A 3UO6A 4FV9A 2PVHA 3L8XA 4MNEB 2VNWA 3MFUA 4CGAA 3CJGA 4P90A 4D28A 3L8SA 5E1EA 3UZRA 4GU9A 1XWSA 2WMUA 3U9CA 2X4FA 4ASDA 3DK6A 2JAMA 3FZRA 3H10A 4WKQA 4IVAA 5IA0A 5M4FA 4KD1A 3P4KA 3UIXA 4DTBA 3I7CA 4Y5HA 1WBPA 5A4EA 5IA2A 3ZLYA 3I0QA 3FHIA 5HLPA 3ZLXA 4C02A 2CKQA 4W8EA 2CDZA 5HOAA 3VBYA 2OIDA 2YISA 3IW7A 4FTJA 5CQWA 4GL9A 1U54A 4IANA 1SM2A 4M84A 2BDFA 2GNJA 3FMEA 2VX1A 5IUGA 4MD7E 4FEVA 3V5PA 2GNIA 3MS9A 2F2UA 3KVWA 4R5SA 1U5QA 3NPCA 5HHWA 3IW8A 3QA0A 4BGHA 2FB8A 4NW6A 2BRBA 4RIYB 4QT1A 2RKUA 4U45A 5EDPA 2OZAB 2R0UA 3ERKA 4XEYA 5CSVA 3BHUA 3CS9A 2HIWA 3TL8A 1H26A 3KVXA 4OUCA 4DHFA 4F99A 3EN9A 4BY9E 4R3RA 5AJQA 2BHEA 4CSVA 1TQIA 2IO6A 3UYSA 1Q8TA 4IC8A 4NKSA 4FV7A 2ITZA 3OS3A 2PZPA 3O51A 3R2YA 5TT7A 4EH7A 1P5EA 4CMTA 5EYKA 2UW4A 2GNLA 4GT3A 5JKGA 1H1WA 3KMUA 3TNQB 4FI1A 2ZB0A 4BDHA 4QMYA 2JEDA 2YCQA 4EK8A 3R1NA 4CFXA 3PVGA 5ANOA 1ZAOA 1IEPA 4EQMA 4QMSA 3PA4A 2WU7A 1Y6BA 4D1XA 4OTFA 3TUCA 4Y95A 3S1HA 4V05A 2I0YA 4FV8A 3ZUUA 5CSWA 3LFSA 3P78A 4IAIA 3HDNA 2VU3A 4NH1A 4QMQA 2ETRA 4WIHA 4I41A 3LVPA 4W9XA 4QPSA 1Q8WA 4FZDB 3HP2A 4EOLA 3ZMMA 4MD9E 2YJRA 3GT8A 4U44A 4ZP5A 1QPJA 3MJ2A 3C9WA 2VWXA 3SV0A 2C1BA 3KEXA 3PVWA 1GNGA 4O6EA 3F5XA 3R2BA 2VO7A 4P2KA 4YZMA 2GS6A 3VQUA 4FV6A 3PFQA 2YFXA 4RVLA 1TQPA 4E4NA 3TXOA 3RKBA 3HV6A 3DK3A 4FMQA 4G2FA 5J1VA 2XYUA 3S4QA 3W18A 2J9MA 3V8SA 1ZXEA 3ZM4A 2GHLA 3VUDA 3R8ZA 4IADA 2QOQA 4BWKA 4XRLA 2WHBA 2OZOA 1YOLA 3NNWA 3KXMA 4LV8A 4R1VA 1HCLA 4TWCA 2IG7A 4N6ZA 3ZYAA 3GBZA 3BGPA 4DLJA 3TZ7A 4LUDA 5HVKA 1NVSA 3QCYA 3D14A 5IH5A 4BDJA 3RPRA 3NRMA 4N4SA 5CWZA 5ANGA 3E8NA 5KHWA 3IOPA 4YC8A 1EH4A 4DG3E 4YUQA 4MCVA 3VS7A 3VQHA 3F6XA 1Q41A 3GNIB 3QD2B 4C4GA 1ZLTA 2WMXA 4YJPA 4EK5A 3GCQA 3KA0A 4W4VA 4DFNA 5M4IA 1KE8A 2QOBA 3QL8A 5HG5A 4IX5A 4UMTA 4XX9A 3RM6A 2CNQA 4TNBA 4HYUA 3E7VA 3QHWA 4OGRA 1TVOA 2VWIA 5EYDA 4CV8A 1MP8A 3PPKA 4S32A 5AA9A 3OWPA 1OKWA 2CKEA 2OJJA 4LV5A 2JKOA 2C3JA 2BZJA 4LRJA 3FY0A 2HW6A 3V04A 2ITYA 2HWOA 4HCTA 5B2MA 4E6CA 3RNYA 4BCOA 1UWJA 3QWKA 3QQHA 3PE1A 4TN6A 3UVPA 4F08A 1YXUA 5I4NA 3TG1A 2RL5A 4QPAA 2PWLA 3NUAA 1SVGA 3DFAA 4KB8A 5JH6A 4I5CA 3QRIA 3KK8A 3ZSGA 3OY1A 5DFPA 4HNFA 4AP7A 4ZSAA 3QTIA 5EK7A 4UYAA 3FMNA 3E63A 3HMOA 3I5NA 2WGJA 3LMIA 5IU2A 4IMYA 5L8JA 4DEBA 2CGWA 4J97A 2YCSA 4U79A 1J7IA 2P33A 2YAAA 2XBAA 4FL3A 4PDPA 4YLKA 2UZDA 3SW4A 1WMKA 3ZO1A 3LFNA 2UZOA 3PJCA 2XA4A 2VO6A 3NW5A 5A14A 3GB2A 1YDRE 3BLHA 3EMGA 3BHYA 1UKHA 4CLIA 3MIAA 4OTWA 3QU0A 5HE0A 4YNOA 5FEQA 3CSVA 1PMUA 3R04A 5DRDA 3UNZA 2WMTA 5BMSA 1YRPA 3DBCA 2G1TA 3WIGA 3FKNA 3FLSA 3DZOA 3ENHA 1PXOA 4MHAA 2YZAA 2XIKA 1VEBA 4JQ8A 5CU3A 5ANIA 4F6SA 1IAHA 3F88A 4KIKA 5L2QA 5I9VA 4UMQA 3PJ8A 2O2UA 2X8IA 4AF3A 5J95A 5HU3A 5FTQA 3EN6A 3RM7A 4QMOA 4E7WA 1U54B 2YM7A 2GMXA 5HNIX 3JR1A 2ITTA 5K5XA 4LGGA 2EB3A 3HGKA 4LRKA 5FP6A 5IQDA 3COIA 3HV5A 4L67A 3KY2A 4XCUA 2R7IA 2PUNA 2QKRA 5HCZA 5DWRA 4BTMA 2I1MA 3FDNA 5C1QB 4O0VA 4R8QA 4PL4A 2XM8A 2QO2A 2ZAZA 3BWJA 4DFXE 4FTTA 4EHZA 2Y0AA 1GIJA 2IW9A 5M56A 4BDEA 5LVPA 5FGKA 3PG3A 4I93A 3HKOA 2EWAA 3QD0A 4I0TA 4YZBA 5H8EA 5BPYA 3LPBA 5JGAA 4UN0C 4UXLA
chains in the Genus database with same CATH superfamily
2YHVA 1M7QA 4F78A 2E9VA 3JYAA 3K3JA 3UP7A 3CXWA 3ZC5A 3GOPA 3BU6A 4L9IA 4DEEA 4J71A 2OIBA 3UOJA 3SG8A 4DYMA 1DI8A 3A61A 1UV5A 4J53A 5LQFA 5LMBA 3SGCA 3G33A 3HYHA 3ZXZA 2WNTA 4AUAA 3A7IA 2C6OA 2B9FA 3FSFA 1RQQA 2ZMDA 4NZWB 4ZTLA 2OO8X 2YIXA 4IJPA 2RFNA 5JEBA 2UZUE 2X39A 3ML1A 4KS8A 2UVYA 4RA4A 3S3IA 3VO3A 1H0VA 3OTUA 4QMVA 4UMRA 4MBJA 3FLZA 2C47A 4Y46A 3SRVA 3UOLA 5B7VA 4YC6A 3QD4A 5IUHA 3H0YA 1R39A 4CMUA 3HMMA 3T8OA 3N9XA 4JT3A 4I5HA 4ZS0A 4ZZMA 3MYGA 4DN5A 1H8FA 2CPKE 2DUVA 2RG5A 3EQRA 3KKVA 1ZOGA 3LCTA 3NNUA 4HCUA 4M69A 4P7EA 3ORIA 1Y8YA 2UVXA 4I6LA 4AGCA 1U46A 4AT5A 2R3RA 4YJOA 2WIPA 1Q3WA 4DGOA 2PULA 2BFXA 2UZLA 4W4YA 3UIMA 5EW8A 3C5IA 4XG7A 5JFXA 3R6XA 2FVDA 4M7IA 1ZARA 4DHJA 3QKLA 2OWBA 1JKKA 3R9RA 2B4SB 3BHTA 4TWNA 2PE0A 2R3GA 2UW7A 4EOPA 2IVTA 2WOUA 4ANLA 5K0XA 2H8HA 1VLRA 3UDTA 2JIIA 3NZ0A 3FL5A 4L3PA 4U7ZA 2UVZA 4ONAA 4BBFA 5DA3A 1G8SA 3QRUA 1JKLA 4C4HA 2BTSA 3HECA 4FTCA 3I6WA 3V8WA 4U0IA 3THBA 1BX6A 3LIJA 4NEUA 5EOLA 1OPJA 3BWFA 4CKIA 3D7TB 5KO1A 3CEKA 4EK3A 4RRVA 4ITJA 4ZTRA 5C9CA 4IWPA 5AP5A 5KKRB 4L43A 3BV3A 3ZRLA 2QODA 2C1AA 5CZHA 4EOOA 3DGKA 4OBPA 4XHKB 4BCKA 1CMKE 3RAIA 3UC4A 2OJIA 5CNOA 2B52A 3L8VA 3Q96A 5J7HA 1V0OA 3NW6A 4IACA 2C0IA 2BROA 3H4JA 5JT2A 4RQVA 2GDOA 3AD6A 3PIZA 1OGYA 2EXMA 3Q9XA 1SYKA 2BILB 2WU6A 4U8ZA 3SDJA 4PDYA 4E20A 5GJFA 1DS5A 2OGVA 1QPCA 2F7XE 4FOCA 4WRGA 3VULA 1ERKA 4LMNA 4D0XA 2UV2A 3ZU7A 4Y5QA 3ZRKA 2WTDA 4G34A 3A60A 3OXIA 2JFLA 3AC4A 3KMWA 4HYSA 4JBOA 4M68A 1ZYDA 3IECA 3MWUA 3C0IA 3PP1A 4NTTA 5DI1A 5LARA 4BWXA 4IWOA 3F7WA 2BR1A 4O83A 4IH8A 3FV8A 2JDOA 3QGWA 5KX8A 5AP1A 3M1SA 5EI6A 3Q5IA 5HTIA 3DBEA 2QOFA 5IA3A 2QNJA 5DH3A 5KZIA 4PL3A 4EZ5A 4F4PA 2X0GA 3R73A 4TYJA 4PPCA 2PSQA 2XJ1A 4IVCA 5DGZA 3WF9A 3L9LA 1OIUA 4KIKB 4OTGA 4AZFA 3QZGA 4L68A 3W0NA 1H27A 3R8LA 2UZNA 1R0PA 2XALA 2C3IB 3TIZA 4G1WA 3C50A 4U40A 1YHSA 2Y7JA 4UXQA 2H34A 2NNWB 3AKLA 1FPUA 4QTBA 4YURA 3ULZA 4O7YA 4G3CA 1YI6A 3RI1A 1L8TA 4MYGA 4O21A 4Z55A 3ID6C 3SXSA 3QQLA 1XMLA 1ZRZA 3OFMA 3Q60A 3QX4A 3UOKA 4XV9A 3UZTA 2ITQA 3TKUA 3UPZA 2OFVA 4LMUA 3RNIA 3GCUA 3VF9A 3IPHA 3W2OA 5EOBA 3DAEA 2WZJA 4UWYA 1PMVA 2YIQA 4HPUE 4WOVA 2Z7QA 3ZFMA 3NS9A 2YM5A 3W0MA 1VR2A 2ITVA 4BDFA 3CQEA 4ACMA 4IX6A 3QRKA 4FEUA 4RJ8A 1BI7A 3O71A 2ZYBA 4FK6A 4EWQA 3COKA 2X81A 1PYEA 4GG5A 4AU8A 1G5SA 2XNNA 4NJ3A 3SHEA 2EB2A 4BDIA 4CYJA 4YPDA 2UW9A 4FKVA 5EHYA 1KE5A 4FVQA 3PJ3A 4MF0A 4W4WA 4JG8A 1STCE 5CENA 2YM6A 2GHGA 4TYGA 4L7SA 2CN5A 2R3NA 5KMNA 4RJ4A 4H39A 4YJTA 2J0IA 5FRIA 1M2QA 4QYHA 4FIHA 5DR6A 5C01A 2J0JA 2O65A 4AAAA 4EQCA 1ZOEA 5E8TA 3U54A 4QP1A 4FX3A 4AFJA 4C3RA 1WBNA 1M52A 3BLRA 3H3CA 3QLGA 1KWPA 3GU6A 3CGOA 4FG7A 1BL7A 2X7GA 5DN3A 3VW6A 4A06A 1J91A 5IEYA 1BMKA 2YITA 3QUDA 4B8MA 4QD6A 4C58A 4EUUA 1F0QA 2W1CA 4X6RA 2CGUA 3NW7A 4D5HA 4PPAA 4R3PA 4Q9SA 1M2RA 5G6VA 3TCPA 5EI8A 3QX2A 1UU3A 5EM8A 4C37A 4UV0A 4O7TA 3FLNC 4ENYA 5EM6A 4XMOA 4A4LA 3PRFA 1SMHA 3I5ZA 3KULB 5L6WL 2H96A 2XK3A 4U5JA 5DIAA 3R7IA 5CEPA 1WZYA 3WE8A 5CEQA 2LAVA 3CTQA 3UDBA 3I1AA 2R2PA 3BHHA 3DNEA 4JIAA 2X0OA 3BELA 3OT8A 5CI6A 3C13A 5C8KA 5ETIA 4P5ZA 4X3JA 4D2SA 2F4JA 5HG8A 5K5NA 3SW7A 1WVXA 2OJ9A 4O7RA 3SVVA 2ZDUA 2DYLA 4JDHA 3GC0A 3QXPA 3ZM9A 1GIHA 3UODA 3UOHA 1H28A 5BVNA 3F5GA 2R3QA 4R78A 2F49A 5CVHA 5E8ZA 4PV0A 3LFDA 3Q52A 3SA0A 4C3PA 2JKQA 4Z7HA 4BCJA 3CQUA 1WVYA 3CLYA 2PVYA 3DNDA 3F2AA 1G8AA 5EKNA 3KREA 3HRFA 1B39A 4BIEA 4G3DA 3OC1A 4YJQA 4EORA 3FQHA 2XKCA 3EFKA 3GC7A 3A99A 3PSBA 4DDIA 3QUPA 5L4QA 5EW9A 2XNOA 3POZA 4FF8A 4ITHA 4YJNA 4I0RA 1ND4A 1WFCA 4LUEA 2WFYA 3C4XA 5F1ZA 3FYJX 3QD3A 5CYIA 4F1MA 3N4UA 3FI4A 2ESMA 3FKLA 3BX5A 3D7ZA 3G9NA 4BDKA 4RIWB 1F5QA 1O9UA 2OXXA 4IW0A 4CLJA 2J0KA 4YO4A 3P7BA 3R22A 4FGRA 3ATSA 5I0BA 2XIXA 5HCYA 1FVVA 2ZM4A 4HJOA 4NT4A 3Q6UA 4OAVB 2JC6A 2OICA 4ZSLA 4GIHA 3W2QA 3UDZA 4RX8A 3ZLSA 1DI9A 2YIYA 3PPJA 5HIEA 3UNKA 4BIBA 3R1SA 3EQCA 3DOGA 3VIDA 4X3FB 4WO5A 2BAJA 2C5XA 2UUEA 3D9VA 3JXWA 4EEVA 3BCEA 4M13A 3E92A 4K11A 4U3ZA 3NYXA 2P55A 4AOJA 3KXNA 3WZEA 4JDJA 5AR3A 3RPYA 4O7VA 1YVJA 3LJ1A 3COHA 3B8RA 5CEMA 4AQKA 4ANOA 4TWPA 3A62A 1YHWA 4R77A 4ACGA 1YKRA 3TYKA 2FGIA 5CQUA 2BCJA 1XR1A 1WVWA 3UP2A 3UVRA 5EH0A 4OAUC 2ETMA 5HVYA 4BCNA 3HX4A 3RK7A 3KRXA 5JQ5A 3NLBA 5BVDA 4FTRA 4K6ZA 3BYOA 5ANEA 3E7OA 3DJ7A 3CKWA 5LVMA 4YC3A 3KN5A 4H1JA 3FHRA 4NM3A 3ZCLA 4F63A 5BNJA 1OL2A 5HKMA 4C4EA 3EL8A 1FGKA 4XH6A 2R3LA 5L2TA 2Y4PA 1H1RA 3RZBA 4KIQA 3ZTXA 2Y8OA 3WF7A 3MB6A 5CSXA 3FYKX 4R1YA 4X6QC 2C6IA 3DA6A 5ETFA 2B53A 3NYNA 1R0EA 3WF8A 3FMJA 4GH2A 1ZZ2A 3QYWA 4NFNA 3QCSA 4AOTA 3BE2A 5EHOA 2FA2A 4FG9A 5J9YA 5DT3A 5AM6A 4C38A 4N6YA 5M51A 4C4JA 2A98A 1P14A 3AGMA 5AWMA 3D83A 2NRYA 2H9VA 2PVJA 1PF8A 5LVNA 2XJ0A 3DKFA 4PNIA 5F20A 4CRLA 3QRTA 4J95A 4EH3A 5JZJA 2JIUA 2JDSA 3QGYA 5BV3A 1OL5A 3B2TA 3BKBA 5BUIA 3BL7A 2VX3A 4QQCA 3R71A 1OI9A 4DDGA 3CGFA 4PF4A 4AG8A 4YTCA 5DMZA 1OUKA 5GJGA 2ZM3A 4LG4A 2CNVA 2OK1A 2XK7A 4WHZA 4OR5A 4FTQA 5A54A 4LRMA 1GJOA 4DC2A 1H25A 4L45A 2WXVA 3MFTA 3ZS5A 4BKYA 3W0QA 5GZ9A 1UWHA 1URWA 1QPDA 3G90X 4JLCA 4FNYA 4MXAA 5T6KA 5CF6A 3TDVA 4YSJA 4I21A 2OKRA 2FSTX 2QCSA 3PIYA 1Q8YA 4RC2A 4KIOA 5K3YA 3GQLA 4JG7A 4B7TA 4BB4A 3NFGB 4FIFA 2A2AA 2WQNA 2VAGA 2CNUA 2FYSA 3EN7A 3R00A 2OU7A 2J0LA 2YWPA 4MQ2A 2B7AA 2V7AA 2A4LA 4O1PA 4HPTE 5IZFA 5J8IA 5DE2A 2GS2A 4GKIA 3GU7A 5IQHA 3TV6A 2QONA 3KF4A 2JIVA 2W1EA 4TTHB 1V0BA 5DHJA 2VZ6A 4JJRA 3CD3A 2WMAA 2X6EA 2YLEA 3BIZA 4L3LA 1W84A 2PPQA 5BUJA 4LV7A 3AXWA 4IFGA 4FKTA 5D12A 5M57A 2XAMA 2WMQA 3BYVA 4OTHA 2W4JA 4EJNA 5D1JA 4YHJA 4EZ3A 1M2PA 2PZYA 4BCGA 4BHNA 3MPMA 2YDIA 1VJYA 2G2HA 4QMWA 2REIA 2J0MB 2VTHA 4BTKA 2CKPA 4O0XA 4USDA 5FEDA 5AX9A 3ZUVA 5CAOA 3EYGA 4FICA 4BZOA 1W7HA 2EU9A 1IRKA 4GT4A 4DHZA 3L9NA 3PXZA 4EOJA 4FUXA 4GYIA 4CKRA 1OBDA 4ZSEA 3KC3A 1GIIA 1Q8ZA 4UZDA 1UU8A 3DBQA 5M55A 2GSFA 4AGUA 2NP8A 5M06A 3LFAA 2BKKA 5AV3A 3ZEPA 3AKKA 3DCVA 4XG8A 3TNWA 4QP4A 4PTGA 3L8PA 3D15A 4K8AA 5IKWA 4G6NA 5AV2A 3II5A 5HTBA 2Y6OA 3OXZA 3A7FA 4R6VA 4DGNA 3VW8A 3HMNA 4BDAA 4JMQA 5EI2A 4AW5A 3BI6A 5DR2A 2PE2A 3C1XA 2O63A 4HGLA 4EC8A 4XS2A 3R9NA 3ALOA 1YOMA 3D94A 5HESA 5LXMA 2WMWA 4L44A 3TZ9A 4ZY4A 4CMOA 2ERKA 2W06A 4NIFB 4TZRA 4XP0A 4WBBB 4ASZA 3HP5A 5A4CA 3VS6A 5HO7A 4APPA 4HW7A 2BFYA 4XG4A 2OF4A 4A9TA 1JPAA 2JFMA 3OD6X 4ZTSA 3JVRA 3UIUA 5I9YA 3P23A 2YCRA 4D2VA 2P3GX 3ACJA 4XG2A 2CCHA 3AC5A 3FAAA 3R01A 3HLLA 3FLQA 3Q4CA 1M14A 2GS7A 4F9YA 5L2WA 5F9EA 4IDVA 3BV2A 4CFWA 3U87A 3HMIA 1WBVA 4RMZA 3EQGA 1OUYA 3LFFA 5L3AA 4O0YA 4G17A 3P5JC 3VS5A 4YTHA 4B4LA 3LQ8A 5HBHA 5KBQA 2EVAA 4BGQA 4FNWA 1V1KA 4F7LA 4CCBA 3H9RA 3AC2A 3OVVA 1Q62A 2WEVA 4QMZA 3ET7A 1IAJA 4F0IA 2SRCA 4YBJA 2JGZA 3RWPA 1FVTA 4WNKA 4APCA 5HE1A 4MBLA 3UMWA 5A4QA 2HZNA 3LE6A 4QDVA 3FMHA 2HXLA 4L46A 4ZXTA 4FGBA 4Y85A 5HNBA 3L9PA 4CV9A 3FZOA 2X2LA 5KKRC 4WUAA 3MV5A 3IGGA 3ZBXA 5A4TA 5H3QA 5HX6A 5CAQA 3CKXA 2VTAA 1PXIA 3EQHA 1V0PA 5FP5A 3UTOA 4BGGA 3GU4A 3ITZA 2JDTA 5FXRA 4E5WA 4JXFA 4ZSJA 4ERKA 3KK9A 4QTCA 3FWQA 4IAKA 2I7QA 4EH9A 3GXLA 4YR8A 3W8LA 3SG9A 2XARA 5AUWA 2W05A 1Y91A 4M0ZA 5T68A 3OY3A 5DG5A 4Z3VA 4AOIA 4D5KA 2VO3A 3DTWA 4TT7A 4XUFA 3ZZEA 3MH0A 5AAGA 2B9IA 4H1MA 3V5LA 4USEA 3RINA 4Y72A 1JLUE 4JS8A 5D7AA 3R63A 3IDCA 3QTRA 3VONA 3GC9A 4JAJA 1H08A 4O7LA 3TUBA 3HAMA 3Q2JA 1OKVA 4MAOA 3V8TA 3C0HA 1U5RA 5C8MA 4GEOA 1ZWSA 3MPTA 2ZV7A 3BL9A 4MF1A 3LMHA 2E9UA 3OP5A 2XCKA 3CIKA 3DKOA 3O96A 5IA5A 4K1BA 1JQHA 2WTJA 3BQRA 3LCSA 4D55A 2KULA 3IDPA 5KMKA 2PZRA 5HO8A 5EM5A 5HBJA 3H0ZA 5HGIA 2P2IA 1GZOA 4K9YA 3VUGA 5J7BA 5M4CA 2R3OA 2WQOA 3QCQA 5A6NA 3LFCA 1DAWA 4ZLOA 5CX9A 5AIRA 2VTRA 4FZAB 5HG7A 2FSOX 3RJCA 4YZDA 3PXFA 3HVCA 2WQBA 5CXHA 5IH6A 2FSLX 5LOHA 4IXPA 4JBQA 4MXCA 5GHVA 5AR2A 4N57A 3MJ1A 2RGPA 2XNEA 4AN9A 4RFYA 1XBBA 3CY2A 2IJMA 4M12A 4A9SA 3NGAA 4JOAA 5HBEA 3FPQA 2YEXA 5CEKA 3NYVA 4WD5A 3A2CA 5H9BA 2IW8A 3RCJA 4BCMA 2OJGA 5DRBA 3W0RA 2HXQA 3K5VA 4XNEA 2EXCX 2ITNA 2WQEA 2PVNA 4OBOA 3EZRA 5CT0A 4M97A 2OXYA 4AZEA 5HTCA 3D2IA 3DXQA 5K9IA 4IM2A 2W5AA 3I0OA 3N4VA 3OCTA 4HGSA 3FMDA 4E5AX 5HIDA 5AV0A 5EQPA 4ZAUA 2WAJA 5TKDA 3PLAE 3T3UA 3PZHA 4FL1A 3V5TA 4F7NA 3RVGA 2CN8A 2HELA 5JRQA 5CASA 1H00A 3HV4A 3K54A 4EJ7A 4YBKA 3VBTA 3MN3A 4MQ1A 4QP9A 4ZTMA 2HY0A 2VTMA 1WBOA 2WMSA 3TKIA 4UZHA 5LMKC 3QQFA 1OL7A 5AR5A 3PXKA 4KKHA 4KAOA 4RZVA 2WTKB 1XH9A 2WMVA 4FVPA 4BI1A 4CXAA 4DFLA 2C4GA 4DFZE 4EHGA 4O6LA 4MXOA 5AP6A 2Z7RA 3CPCA 3VBWA 4J8NA 1YW2A 3A8XA 2QI8A 2HWPA 3GEQA 3W32A 3E3PA 4NCTC 2UW8A 2J90A 1MQ4A 3E8EA 2CLQA 3RAWA 3R28A 4E26A 2PUUA 5LWMA 3QCXA 5EDQA 2OF2A 3QZIA 2NRUA 3KGAA 3NUUA 4RWJA 3QTSA 3PY3A 3DXPA 1APME 4H36A 5T3QA 5G1XA 3TJCA 4AZWA 3CCNA 3ORMA 2IVVA 4WNPA 2IPXA 4DITA 2Q0BA 1FVRA 4M66A 4A4OA 3R9DA 3ORKA 3W55A 5E92A 3UO4A 4RWIA 4DHIB 1JWHA 1OPLA 5D10A 5E7RA 4FTOA 4MX9A 3SXRA 2OJFE 2VWWA 5AUUA 5KMIA 2PZIA 3T9IA 1NVQA 3GP0A 3NUSA 3MW1A 1W82A 3C51A 2PMLX 4OT6A 4U81A 1OB3A 4E4MA 2X9FA 4E6AA 3EB0A 2HW7A 3L1SA 3FMKA 4GK2A 3O0GA 4K77A 4WUNA 1YI3A 3FUPA 3ZFYA 3LMGA 4QQJA 3MTFA 5EDRA 4I23A 3FKOA 5FTOA 5BYLA 3OBGA 2Z02A 4G9RA 4A9RA 4F1TA 1ZMVA 4M14A 3V3VA 5AX3A 3VF8A 2ONLA 4KKGA 3LZBA 4TW9A 3R21A 3CJFA 3KU2A 4HGEA 4WSYA 3WZDA 2JDVA 4M15A 5L2SA 2A0CX 4IM3A 4BI0A 4L01A 4F7JA 4D4VA 5E4HA 3R7YA 4DH3A 4DTKA 3VUMA 3ZO2A 1W0XC 4H3PA 4LI5A 3I60A 2VO0A 2ZDTA 4M0YA 4FT9A 2RIOA 4TKSA 4BF2A 1PJKA 4RVKA 4BR3A 3COMA 3TZMA 4D4SA 3OTVA 3NIEA 4FV5A 4JQ7A 4YLLA 3HUCA 3R8UA 4ERWA 2V0DA 4AW0A 2UW0A 1Q61A 4HCVA 3AG9A 2W9ZB 4B9DA 2J51A 3PZEA 3RCDA 4K33A 4O7NA 4JQEA 5AAEA 1LR4A 1QPEA 2Y4IB 4KBCA 1ST4A 1YXTA 1YDTE 3T9TA 3QTXA 4LOOA 4DBXA 1B38A 3L9MA 3PVUA 5JFVA 4RVMA 4AE6A 4FKSA 2J5EA 3R30A 4L7FA 4DEDA 1MRVA 4F65A 3ODZX 3GCPA 2EXEA 5FEEA 5ANKA 4X3FC 4J1RA 2W0JA 4A4XA 3OHTA 5E1SA 5FG8A 5KNJA 2V22A 4QMNA 4I5MA 4U80A 2PVKA 4JDIA 3IDBA 5AP2A 3CE3A 3ZHPC 4O82A 2XNBA 3ODYX 3DS6A 4XG3A 3U55A 3FJQE 2BIKB 3PY0A 1CM8A 2PHKA 4MUQA 1KE9A 3C4CA 4JBVA 2J50A 2RSVA 4CT2A 4FVRA 4ARKA 1SNUA 5JFSA 4P4CA 3EFLA 4O7SA 2VWBA 3LCOA 5D41A 1XMMA 4F7SA 3PUPA 3W0OA 1YXVA 4CG8A 2JBOA 4BFMA 2XF0A 4IDTA 3DBDA 1CTPE 3AMAA 3RWQA 5DR9A 2W9FB 2XK8A 2QOKA 4EOKA 2BAQA 4F9CA 3CPBA 4XRJA 5E8WA 4QDEA 3TI1A 4O91A 1HCKA 4RFZA 2P4IA 4AGDA 2VV9A 3IO7A 1FGIA 4YHFA 3QRJA 5HIBA 4E6DA 4RIXA 4MBIA 4I24A 2I0EA 5CLPA 3B8QA 5HE2A 4IHPA 4PDSA 3CTHA 3NEWA 4D0WA 4O84A 2YABA 4TY1A 1MRUA 4KS7A 5EYCA 3BE9A 3VS4A 5IPJA 2XIYA 2G15A 3AD4A 4BCFA 3LOKA 4IC7A 2BZHB 2ZV9A 2QOLA 2BTRA 5FDXA 4AN3A 4C62A 5C4LA 1YDSE 3DLSA 3F2NA 2E2BA 3NAXA 4AA5A 4HZSA 4D2TA 5GIPE 2C69A 4KBKA 4O38A 3ANRA 4OTRA 4J7BA 3V5JA 5AUTA 5KMMA 4NW5A 4S30A 1HOWA 3U8WA 4D2PA 4XLIA 4EI4A 5HEZA 2OH0E 5CAVA 4FEQA 3GI3A 4DT9A 3JUHA 3PWYA 4I94A 1RDQE 3BYMA 4GMYA 5C8NA 3R83A 3NNXA 4O22A 4FT5A 3WBLA 4D9TA 5JMSA 2FH9A 2ZB1A 2GFSA 3ZO3A 2AEGA 1KOBA 2G9XA 3D4QA 4PMSA 3O17A 3F7ZA 4KWPA 5AIKA 3F82A 4FTIA 4ZY6A 3RPSA 3RTPA 4LFIA 4CKJA 2GNGA 4X2GA 4E6QA 3I6UA 3F9NA 4DA5A 4C0TA 1CDKA 4G16A 3GC8A 1O6LA 4FRFA 4IB3A 2CCIA 5I9WA 4V01A 1W2DA 2OBJA 3AC8A 4CCUA 3MH3A 5DLSA 2F2CB 1KUTA 1PXPA 4DAWA 1H1SA 4OTPA 4IIRA 4J52A 4Z16A 5AMNA 5AUXA 4E4XA 3FZTA 3BPRA 4QYFA 4EKKA 4KKEA 5CF4A 3ETAA 4OT5A 2AUHA 3LQ5A 4AN2A 5IA4A 3R02A 2C5OA 5IQGA 1BKXA 5DNRA 4FEXA 1Y57A 1Y8GA 4FYOA 5FQDC 2VTJA 3WARA 4QNAA 3VS1A 5IH4A 4I6HA 3AT3A 3EZVA 4RJ5A 2I0HA 4LL5A 4YGAA 5AFVA 3O50A 4QEBA 3MA3A 1KSWA 1JKTA 1P2AA 3P7AA 1Q99A 4RBLA 2O64A 3PG1A 3EQIA 3OZ6A 4EZ7A 4TYHA 2JDRA 1H0WA 3QTUA 4CTCA 3WF5A 3LKMA 4WNMA 4YSMA 3TTIA 3BZ3A 4FUYA 1SNXA 4XOYA 5CF8A 3DZQA 2PVLA 3SRVB 4FSYA 2Z7SA 4S33A 2HY81 3LXPA 4H3QA 2WB8A 5FM3A 1BI8A 4YNEA 4YZ9A 1DM2A 1FMOE 3BYSA 1A48A 4RSSA 1OM1A 3CQWA 3VWAA 2ACXA 2PE1A 4M69B 3GU8A 3R8VA 3AOXA 3MPAA 4ZLYA 2DS1A 3LJ2A 4ALVA 4AXCA 4TL0A 3LXKA 3M42A 5EW3A 1F3MC 3F5UA 1Z9XA 3K3IA 4IX4A 5E8UA 1YWNA 4BCPA 3S00A 3GENA 4XV3A 1CKIA 4G31A 2E9OA 2IZSA 3EL7A 4PY1A 4R3CA 3PSCA 4TPTA 3NNVA 3VBQA 5J5SA 1OIQA 4CG9A 1VYWA 3S2PA 4MTAA 5HO6A 2BDJA 3QC4A 4YTFA 1OBGA 1MRYA 2XK9A 4HYHA 2A19B 3N51A 4O7WA 4DE4A 3QUEA 5CANA 3O8PA 2JITA 3LW0A 4F64A 3P0MA 4HVIA 1OGUA 5AP4A 2QU5A 2XKDA 3ULIA 5DPVA 4O0UA 4ZJIA 2ZV8A 5AP0A 3DK7A 2QO7A 4IWDA 4FKLA 3OOMA 4FIIA 3DQXA 4HZRA 5TO8A 4F0GA 4EOMA 5A46A 2IZUA 1YI4A 1IA8A 4RC4A 4LGHA 1ZMWA 3OUNB 4QPMA 4S31A 4BL1A 4EUTA 3Q3BA 5E8XA 3FLWA 4ANBA 1XKKA 3DPKA 3I4BA 4QMXA 3OT3A 2YAKA 3WZKA 4JR7A 2ITXA 4BZNA 3MVLA 3QTWA 3RAHA 4CFUA 3PWDA 4EC9A 5ITAA 3A7JA 4HOKA 5DYJA 3P79A 4P5QA 3TKHA 4G6OA 2VTTA 2ZJWA 4XLVA 4B99A 4ID7A 4YU2A 4PTEA 3QQKA 5AEPA 3BEAA 4O7ZA 4EOIA 1H1PA 1TKIA 2J7TA 3NMUF 5J9LA 4I5PA 3P5KA 4KBAA 4BKJA 4YJRA 4Q5EA 4EH5A 4C8BA 5CSHA 1S9JA 2J6MA 4C2VA 4RIXB 2WOTA 4GFGA 4AS0A 5CT7A 3I79A 3FZPA 5F94A 4XV2A 1WCCA 1JAMA 4ANNA 5JGDA 3NUPA 4DGMA 3FE3A 4C35A 3W0PA 3QLFA 4MH7A 4AT4A 4FOBA 5CAUA 3O5AA 3UBDA 4J8MA 4X21A 5GINE 3VS0A 4XG6A 2XRWA 3I81A 2R3IA 3MBLA 3RMFA 3G51A 2XP2A 4FTMA 4MNEA 4DF3A 3MY0A 3IK3A 4JRVA 5I9XA 4BJJA 5IQAA 4TNDA 2HAKA 2HZIA 2ERZE 5GJDA 4S2ZA 2JAVA 3R1YA 4AZSA 1GZ8A 2DQ7X 4HNIA 4CZYB 3R7VA 3UQFA 4CNHA 3ZONA 2YA9A 3VUIA 2GQSA 4UEUA 4ANQA 4BC6A 5D11A 4DINA 5M53A 1WBTA 3PA5A 3W8QA 4GK3A 3TN8A 3NR9A 3AT4A 1JOWB 3PPZA 3V5WA 4V04A 3MH2A 3SXFA 4YP8A 5HD7A 2GTMA 3TMOA 4D2WA 4O0RA 4DH8A 4QYYA 5HLWA 2YWVA 4GW8A 4RJ3A 4PP7A 2RF9A 3V6SA 1PKGA 4BZDA 3ATTA 2BKZA 3BGZA 4RIYA 3HRBA 3PTGA 4CYIA 3HL7A 3K5UA 4G5PA 1BL6A 5CAPA 3RPOA 4DTAA 3UE4A 4QMPA 2ZVAA 3VUTA 4MXZA 2VTLA 2WTIA 3KRRA 4D1ZA 4GVAA 4FBXA 4X7QA 4QP6A 4BKZA 3DFCB 4L42A 2XZSA 4U97A 3UG2A 3GFEA 3TNHA 5BVFA 1K9AA 4YZNA 3FSKA 4FL2A 4TYHB 1PXMA 5C26A 2QHNA 5IF1A 5ICPA 3S95A 3G6HA 3UNJA 2NPQA 3UG1A 5AAFA 4YMJA 3H9FA 4BN1A 3UYTA 2C0TA 3O8TA 4ZLZA 1XH6A 4G6LA 2R5TA 4ZK5A 4WG4A 3LM5A 2C6KA 4KSQA 4EHEA 3TDWA 2QKWB 3W2PA 2X9EA 4O4EA 3TWJA 4F6WA 2WELA 3W1FA 3E88A 1QL6A 3JVSA 4TXCA 5C03A 4EOSA 1RE8A 3RPVA 1LEWA 4KSPA 4JR3A 3IOKA 1Q97A 5CVGA