3Q52A

Structure of phosphorylated pak1 kinase domain
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
293
structure length
292
Chain Sequence
DEEILEKLRSIVSVGDPKKKYTRFEKIGQGASGTVYTAMDVATGQEVAIRQMNLQQQPKKELIINEILVMRENKNPNIVNYLDSYLVGDELWVVMEYLAGGSLTDVVTETCMDEGQIAAVCRECLQALEFLHSNQVIHRDIKSDNILLGMDGSVKLTDFGFCAQITPEQSKRSMVGTPYWMAPEVVTRKAYGPKVDIWSLGIMAIEMIEGEPPYLNENPLRALYLIATNGTPELQNPEKLSAIFRDFLNRCLEMDVEKRGSAKELIQHQFLKIAKPLSSLTPLIAAAKEATK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Serine/threonine-protein kinase PAK 1
publication title Structural insights into the autoactivation mechanism of p21-activated protein kinase
pubmed doi rcsb
source organism Homo sapiens
total genus 96
structure length 292
sequence length 293
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2010-12-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3q52A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3q52A01
3SRVA 4RFZA 2XYUA 1YVJA 3R30A 4ZJIA 3C4EA 3QBNA 1JSTA 3NGAA 2C6TA 2JKMA 3NPCA 4YO4A 5HLWA 3EH9A 4UWYA 2QKWB 2VWVA 4J8MA 3KGAA 1K9AA 2OJFE 4GEOA 4IAKA 3Q9ZA 2J9MA 4GU9A 5DRBA 3GENA 2OK1A 3ACKA 4UX9A 3QD4A 4U97A 1OKZA 4BC6A 5HE3A 2JAVA 5IQBA 4HNIA 1YI4A 2YDKA 4EBVA 4YTHA 3IW8A 4HGEA 2FSMX 3KXZA 4DEGA 2PUUA 3FYKX 5JT2A 1CSNA 3DQWA 4E5AX 4FKRA 3GT8A 2VD5A 5TF9A 3EL8A 4DTKA 4FIGA 5FM2A 3PG3A 4ZLYA 2CMWA 5M4FA 3GUBA 2YCFA 2VX1A 4B99A 3ACJA 2HZIA 4IB1A 2BRHA 1OUYA 5HI2A 2XCKA 5ANGA 5L8KA 4JOAA 2GNLA 2C6DA 3V6RA 4NJ3A 2OZOA 4H58A 3UIMA 4HVDA 1W7HA 3ZEPA 3QTZA 4ZJVA 2AC5A 2X8EA 3OT3A 4AGDA 4BDKA 2ZM4A 2WTJA 3E8EA 4R78A 4QNAA 4C4IA 4FI1A 3MB6A 4OT6A 4FUXA 4IM0A 2OJ9A 3TACA 3EFJA 4ASEA 4I5HA 2JIUA 3IG7A 4YSMA 4E5WA 4YJQA 4CKJA 3EQGA 2V7AA 4ZLOA 5A6NA 3C5UA 4H3BA 1CDKA 3Q4TA 3R8UA 4O7SA 5EI6A 4YMJA 2Z02A 1H1WA 2C68A 1OB3A 3R04A 3R1NA 4EZ7A 3AQVA 5IUGA 4NYEA 2JIVA 4HCUA 3IONA 3TDVA 3DXNA 3WIKA 2JD5A 2BZKB 4BIEA 2VWWA 3O50A 2UW4A 5I9VA 3CSVA 4E26A 1RDQE 1H0VA 5GIOE 1K3AA 3G2FA 4GVJA 1YKRA 4RWKA 3GU6A 3VULA 2C30A 2ITZA 4FZDB 4Q9SA 2ZMDA 3DKFA 4U8ZA 3ZCLA 5A6OA 1JOWB 1FMOE 2QHMA 4GT4A 4FL2A 3DAEA 4UYAA 3OEZA 5I4NA 4EOOA 3DKCA 3O51A 2QI8A 3QCSA 3W16A 4B6LA 4MVFA 2C47A 3SKCA 5BMMA 4D58A 1L3RE 2WMWA 5C03A 3R1YA 5DPVA 3U9NA 2WMTA 4ALWA 2BMCA 3BKBA 2UW9A 3UGCA 3ELJA 4CT2A 3RWPA 4W9WA 4JDJA 3VUHA 2XMYA 4IDTA 1BI7A 3SXSA 4QYFA 1UU8A 4LI5A 4ERKA 3IDPA 4L44A 4LM5A 1M52A 4FTJA 5AP3A 4IX3A 2HYYA 3ZYAA 5IQHA 5EOLA 5A4CA 4FVPA 2E9OA 4C37A 2BFYA 2JKOA 5AUZA 4QPAA 4U3YA 1ATPE 3UQGA 1OPJA 2A1AB 3DTWA 4K2RA 4E4MA 4KIOA 3NUSA 3Q9YA 4X2KA 2FGIA 4FSRA 4M69A 3HA6A 2VTLA 3E93A 3GGFA 3R2BA 3ZUUA 3KRRA 3B2WA 2QG5A 3O8UA 2O0UA 3V5PA 3VVHA 4TWCA 4QT1A 4FEVA 3FLYA 4P5ZA 1OPKA 2G01A 2WMRA 4WNMA 3O8PA 5CSWA 4MBLA 3WZUA 4A9YA 4AP7A 4DC2A 4Q9ZA 5BX0A 4QMUA 3JY9A 5DRDA 3HUBA 4EH2A 4NL0A 3MPAA 4DGMA 4C36A 4ALUA 5AUYA 5IG1A 5LWMA 4KSQA 2W99B 3G6GA 3H0YA 4YR8A 5A4EA 1OI9A 1U5RA 5FEQA 5C1QB 2QLQA 3KQ7A 1J7UA 2I7QA 4YLKA 4CMTA 4YUQA 3KB7A 4Z55A 2C6MA 5IQCA 3PTGA 3AOXA 3Q60A 3FI3A 4Y5QA 4RIXA 5CVFA 5DVRA 4BDBA 3U6JA 5C8NA 3BZ3A 3UZTA 4K33A 4PY1A 4NCTC 5E8UA 3ZDUA 4I4FA 3IOPA 4RC2A 5LVMA 2XP2A 4P4CA 1YHVA 2O64A 4MXOA 3G6HA 1OVEA 4F9YA 4YU2A 3PG1A 1P2AA 3O96A 4FT7A 4LG4A 4AZVA 2G15A 3SA0A 2J51A 3A7FA 3OCTA 3N4VA 4RJ4A 3ZFYA 4RQKA 3PP0A 2X1NA 1L8TA 1UU7A 2GS6A 4NEUA 4IAYA 5A54A 4AZWA 5ANOA 5CU0A 4QRCA 4XS2A 3C50A 4CLIA 4F7JA 4D2SA 4ONAA 3PUPA 2FB8A 5FDXA 4C4HA 1H01A 3GQIA 5CF5A 3GBZA 2X2LA 3MGYA 3DGKA 4FZ7A 4BWXA 5HX8A 5L2WA 2YAAA 3BYVA 2WAJA 2EB3A 5BQ0A 1XH4A 4KWPA 3U51A 4AN2A 2PMIA 4N57A 3N4TA 4L52A 2WU7A 2P33A 3AD4A 4RIOA 4Z7GA 5I3OA 5CXZA 4TNDA 3ZO2A 2E2BA 4X7QA 3UVRA 1PMEA 3QA0A 4DBXA 2GS2A 1SM2A 2JFLA 5ANJA 2WQOA 3M42A 5JFWA 4XOYA 4AAAA 2VO7A 2WMXA 3PVGA 1GZ8A 4O0RA 5DGZA 3ZFXA 3CLYA 5J9ZA 2OF4A 2QODA 2VTMA 3PXYA 5CU2A 4N4SA 4EWHA 3MI9A 4QPMA 4F4PA 3R8MA 4JX7A 3QC4A 5CT0A 2GCDA 5E8YA 4XV2A 4PL3A 4ZAUA 3RPRA 5CAVA 5DH3A 1V0PA 4JG6A 4JAJA 4K11A 4P5QA 1W8CA 3PPKA 5GZ9A 1LPUA 1QPJA 1ZMVA 3BBTB 5CZIA 4GK4A 4TKSA 5ANDA 2YABA 5I9ZA 4QD6A 1UNLA 5EDQA 5K4JA 4IFGA 3BWFA 2QOQA 3F5XA 3NCGA 1WVWA 2W0JA 2YISA 3BGZA 5AR3A 4CT1A 3BE2A 3HMNA 1GNGA 2O8YA 4M12A 5HCZA 4WNOA 1IAJA 3O2MA 1GY3A 2QOIA 3WE4A 4WRSA 3Q4CA 2CKPA 1ZMWA 3DBCA 3DZQA 4NCTA 3JY0A 5DR6A 4IAAA 1SVGA 4FYNA 2YCRA 2YIRA 2ZV8A 2QOKA 4YJRA 4PQNA 4ZSJA 2LGCA 2OZAB 3PXFA 5HO8A 4FODA 4GH2A 2W9ZB 4C2WA 2Y6MA 5CU6A 3UYSA 1Q8UA 2RFNA 2VV9A 4U42A 3P79A 3V8SA 4CLJA 2BZHB 3RALA 3IDCA 1PYXA 4Y72A 5DT3A 4I41A 1H8FA 2C6IA 4CEGA 4CYIA 4EOIA 2WMUA 2GPHA 4L7SA 4BDGA 2V62A 5IA4A 5FUTA 4FV1A 4RX9A 2WEVA 3OXTA 3QTSA 1P14A 4EK8A 3C1XA 1OKWA 4YC6A 4W4VA 4ANLA 1LEZA 4U41A 4KIQA 3FUPA 4BICA 2WTWA 2C1BA 2XNNA 3VN9A 4IADA 3I5ZA 4D0XA 3BLRA 2QU5A 3R1QA 5BYZA 4FSWA 3W2OA 4EJNA 1MQ4A 2R3PA 3Q9WA 5AP0A 3R7VA 3UO4A 4FTIA 3PSDA 3QD2B 4M15A 2EB2A 3GU7A 3LXNA 4O7VA 2J0JA 2XJ2A 4BCGA 2QO9A 3Q6UA 5AAGA 2XJ0A 4FK3A 5T68A 2X6DA 4FT0A 5AFVA 2A19B 3ETAA 5H8GA 2GNFA 2WXVA 5LVNA 3RAHA 3RZFA 1IEPA 3V5WA 3KXMA 3A62A 4J52A 4OTDA 3MY0A 4CSVA 1PXMA 3WOWA 4AGWA 4X3FC 5AUVA 1H28A 1H08A 3KXXA 5D11A 4GS6A 4Y5HA 4ZZMA 3OROA 5IUIA 4F7NA 4ZSEA 3FZRA 4BYJA 3D2KA 2YFXA 4KABA 5D7AA 3VBYA 4HYSA 3DBFA 4QQJA 1KE9A 3KXHA 2JDTA 3F66A 2PVHA 3PIYA 4MQ1A 4RFMA 5DIAA 2P0CA 3QGYA 3UZRA 2CGWA 2IWIA 1DS5A 4FSZA 4O2PA 3R02A 2BHEA 1SNUA 3ULIA 4FKTA 4OT5A 4ASZA 5CVGA 4AWIA 5CAPA 2H9VA 5CSHA 3VNTA 3MFUA 3II5A 5G6VA 4FG9A 2NPQA 3H3CA 3ZEWA 1JKSA 4R6VA 2UZTA 4WT6A 4D28A 3ORZA 1BL7A 4FBXA 4I5CA 2VTIA 5LMKC 2VTAA 3FC1X 2W4JA 2Z7RA 5K5NA 4NKSA 3QC9A 1ZYLA 4K0YA 3F5PA 4B8LA 4BCHA 2C4GA 5HBHA 3R7GA 4NU1A 2REIA 2ZVAA 4D0WA 4R7HA 4BDJA 3R9DA 2DYLA 2E9PA 5AMNA 1FOTA 4O1PA 4JNWA 4HYHA 5AR4A 3SV0A 3W10A 3IO7A 4FE2A 3F3TA 2I0HA 3TNIA 2JC6A 4RC4A 4EZ3A 4KD1A 4WUAA 1WBOA 4JR3A 1H07A 4M97A 2UZLA 2QOCA 3FJQE 4OBQA 5AEPA 2W1DA 3KF7A 2R2PA 3CGFA 5CYIA 4J98A 4ANSA 5KMLA 4U7ZA 1ZY5A 5FTQA 4HCVA 2VGPA 3NLBA 4P90A 4QTDA 1G5SA 2F49A 2W1HA 3I6WA 4YJUA 5TOZA 4F1TA 1NXKA 3E7VA 4XV9A 4PTCA 4R77A 4OUCA 3LLTA 3EQRA 3NIEA 1DI8A 5KX8A 4CFUA 4IAFA 4ITHA 2J0LA 2E9UA 4X3FA 2IG7A 2VGOA 3PXZA 5F20A 3D7ZA 3EFKA 5CU3A 4IWDA 2BAKA 4EORA 5HU3A 3NUPA 4IQ6A 4KBCA 4USDA 1RQQA 4F63A 3C13A 5BUEA 4TWNA 2Z2WA 4I1ZA 4DH5A 4EHVA 2QR7A 3QCXA 3QHWA 4YZ9A 2V0DA 3WIGA 1MRYA 2I6LA 5CAQA 5L2SA 2YZLA 3K5VA 4OGRA 2AYPA 3ZU7A 2JGZA 2P2IA 3V51A 4CMOA 5HVJA 3I1AA 2IZRA 4O7ZA 3TZ8A 3F2AA 5J9LA 1H25A 3LCKA 4BDEA 5F9EA 1RJBA 2BTRA 5EKOA 3R8LA 5M44A 2WHBA 5IQEA 2IW6A 2J7TA 3TZ9A 3MB7A 4FL3A 3BYMA 3IW5A 2WTIA 3CPBA 3NR9A 3Q52A 3R6XA 4XV1A 4QO9A 1Y6AA 4TZRA 1J3HA 4APPA 1XH6A 1ZY4A 3RCJA 5J5TA 1OIYA 3JR1A 4NK9A 4BZDA 4EYJA 3CE3A 4JBVA 3SXFA 4O7LA 4O7RA 3QQFA 4F08A 4BDFA 3TUBA 2VWXA 4H39A 4BYIA 3T3VA 4IWQA 2ZV9A 2GQGA 1I44A 2H8HA 3CR0A 3RZBA 5HZNA 3KC3A 2IPXA 1ZZLA 1ZYDA 3W18A 3ZM9A 3R01A 4KA3A 3I60A 3A8XA 2HZNA 4ARKA 3I5NA 5HVYA 5EQEA 5DR9A 3DAJA 3NEWA 3KXNA 4I21A 3DZOA 3VS3A 4UMTA 4WG4A 4YHJA 3I7CA 2RFDA 1TQIA 2WMAA 5FRIA 5JRQA 2C5YA 3BV3A 5CI7A 4IANA 3I79A 4UV0A 3GOKA 1JKKA 4FGBA 2VN9A 5HCXA 4C0TA 1YXSA 4QP6A 2ZDTA 3DNEA 2WTKC 3LW0A 3MA6A 5IQDA 2X39A 1R0EA 3OOGA 4OTHA 4U43A 2W5BA 4XHKB 2JDOA 5EM7A 4XV3A 4EOJA 3E87A 2OBJA 4IB5A 1NT2A 4BHZA 3K3JA 4AOIA 4BIBA 4OR5A 4QTCA 4YC3A 1OPLA 2GU8A 4XP2A 2BROA 4PMSA 4MQ2A 4PPBA 4NUSA 4DTBA 1OECA 3R0TA 2X7OA 2BR1A 1VEBA 3MS9A 4M8TA 4RBLA 4QMPA 4O82A 4RIWA 2WKMA 2PSQA 2VU3A 4I6BA 2GHGA 4KS7A 4ZP5A 5FQDC 5AUTA 1FQ1B 3PSCA 3U87A 3PVBA 3CS9A 3IKAA 4WUNA 1PXKA 2B54A 4O84A 4IAZA 3C51A 3K5UA 5L2TA 2WELA 2XM9A 4ZTQA 4BFMA 4O91A 4YTFA 4FVQA 3ZO4A 3RPSA 5TE0A 2E9NA 4FIIA 1YOMA 1E9HA 1OL1A 2J5EA 4JIKA 1XJDA 3CY3A 4E1ZA 4FKIA 2UZEA 5DR2A 4TRLA 3QLFA 3F3WA 3LM0A 2PVNA 3GOPA 1W98A 5GIPE 3V5JA 3V5LA 5ETIA 3ZLWA 4X2NA 4ZXTA 3THBA 4TXCA 4MD8E 3IQ7A 4C3RA 2FUMA 4TPTA 1JSVA 3S2PA 4FV5A 2QLUA 4O0WA 1PJKA 3EZVA 4EQUA 3QCQA 4CMUA 2XNOA 3U55A 3ULZA 4IIRA 2QOHA 2B1PA 4MXAA 4PF4A 1NA7A 1CKIA 1H1PA 2SRCA 3LHJA 1Q41A 4FKWA 3QALE 4EOKA 3UOLA 5BUJA 4YURA 3GI3A 4KRDA 3GU4A 4WO5A 4FSUA 3ZSHA 4CV9A 2B55A 3MW1A 4BF2A 4FV8A 3LVPA 2QKRA 4FV6A 4UYNA 5CT7A 5J87A 4CFFA 2PULA 4E7WA 2CGUA 5IEYA 3E92A 4G6LA 3TV7A 4BTMA 4F1MA 3VS2A 3UQFA 3DV3A 3QTQA 2ZM3A 4TTHB 2ITUA 4BIDA 5HTBA 4DFNA 1QMZA 4FYOA 2B9HA 3F82A 5C27A 3JVSA 3C5IA 4M69B 4BHNA 1IG1A 1ERKA 3DY7A 3LJ0A 4A9SA 2PVFA 2ITVA 3F5UA 2CKEA 3OD6X 4RPVA 5GJGA 3RKBA 5FTGA 1XKKA 3F5GA 3P86A 4IJ9A 2YERA 3KRJA 4DG3E 5KMIA 3ATSA 4AGUA 2C3IB 3ZS5A 4BVUA 1V1KA 1XBAA 4FIHA 3EN6A 4L3LA 4C7TA 2FH9A 4OTWA 4E4LA 5I5ZA 5D7VA 3E88A 4E73A 4I93A 5A14A 3RCDA 4B9DA 4ALVA 3LQ5A 5JKGA 4IWPA 4YLJA 5EM5A 5JFVA 1A48A 4H36A 4IB0A 3P7BA 4F6WA 3GCPA 4DLIA 3BLQA 2WIPA 5GZAA 2V5QA 4Q2AA 5CENA 4K8AA 4B7TA 5EW8A 4WD5A 2X9EA 5FXRA 1QL6A 3CXWA 4LGHA 3OVVA 4RIXB 1LP4A 2ZDUA 2YHVA 2HOGA 4JDHA 1TKIA 2J4ZA 4PX6A 3QX4A 5GHVA 4AZEA 2IW8A 3P4KA 3FSFA 1B38A 3BCEA 4GK2A 3IW4A 4WSYA 5IDNA 4MEDA 3ZTXA 1JAMA 4AZFA 1ND4A 1WBPA 5EW9A 3MFTA 2QU6A 3E63A 5BYYA 4FTUA 4GKIA 4D4VA 4B4LA 2W9FB 4ENXA 5DEYA 4F99A 2WPAA 4JLCA 4IX6A 3R2YA 3DTCA 2ITQA 5DMZA 1NVSA 2CPKE 3OXIA 4LMNA 5HG7A 3T3UA 4FTLA 3FHIA 4CCUA 5CEMA 3D2IA 4QYGA 3PRIA 2OI4X 2VZ6A 3OW3A 1ZARA 4FV9A 4NWMA 4FR4A 2GFCA 5HE1A 4HW7A 5BPYA 4QOXA 2R3QA 4MBJA 1OL6A 5DI1A 3OXZA 4XLVA 5H8EA 3TZMA 4AOJA 5B0XA 4Z3VA 2ITTA 1BKXA 2OXXA 2HXLA 3MH3A 4PMMA 4UWCA 1JVPP 2C1AA 3RP9A 4H05A 4E6QA 2YITA 4QP9A 3KKVA 3UIXA 3MFSA 3FI4A 4O2ZA 3UQCA 3OZ6A 4AS0A 4BKJA 4EZ5A 4GG5A 4FNWA 1YDSE 2H34A 3ENHA 1H4LA 3MYGA 3A61A 3CQUA 4IX5A 3WZKA 3IK3A 4YJOA 4D4YA 2RG6A 5HORA 2G9XA 4FV7A 3KEXA 4IVBA 4IFCA 3ZFMA 3HX4A 2ZMCA 4M14A 4X6QC 2WMVA 5FXQA 1SZMA 2RG5A 2XK4A 5LCKA 4LRMA 3F61A 5ANIA 3VW6A 2CGXA 2C6KA 2IZSA 5M4IA 4D9TA 2IN6A 4FKQA 2VTJA 4YNOA 2V7OA 1J7IA 2YM5A 4R3PA 3MN3A 3AMBA 2EUFB 2YWPA 5IZFA 4N70A 2BRMA 2WD1A 4ERWA 2RGPA 3K3IA 1H26A 4O0SA 4AN3A 5H3QA 4LL5A 3QQLA 4ZTMA 4YBKA 4ANBA 3KL8A 4ASDA 3EKKA 5CU4A 2R0IA 3SW4A 5JEBA 3R7OA 3QHRA 5M51A 3HAVA 4GT3A 4DFZE 2CN5A 2ZB0A 2FSTX 4DH8A 4IZ7A 3DB6A 5F95A 3TEIA 5DN3A 3VHKA 2ZJWA 1LUFA 4ZEGA 5J7HA 1H1QA 3R71A 4QMNA 4Q5EA 4N6ZA 3I0OA 5JMSA 1JLUE 4O1OA 4CRSA 5M4UA 3COIA 4UMPA 2FSOX 3ZONA 5T6KA 3Q5ZA 5M4CA 4U9AA 1GAGA 4ITJA 3NYVA 2VTRA 5JGBA 3PZHA 1T46A 4RIYB 4UBAA 3N51A 4X0MA 3UOKA 4E93A 3T9TA 3UPXA 3VS0A 3LFDA 2OF2A 3NSZA 4W9XA 5AM6A 5BVNA 3FV8A 4BCIA 4NM5A 5IMXA 3O8TA 3NVMB 1ZOGA 3HVCA 5B7VA 5JQ5A 1YI6A 3E64A 4E8AA 4U80A 3EKNA 5CY3A 5ETFA 2HW6A 4IVDA 3U6IA 3KK9A 3PVUA 3ERKA 3MVLA 1RW8A 3U8WA 3UVQA 3QKLA 5D9HA 5CF8A 3UVPA 4M0YA 4W4YA 3W8LA 3AG9A 3LMIA 3NUAA 1OM1A 2AUHA 1IA9A 2C3LA 3PIZA 2C5OA 1V0BA 3P78A 3HECA 3NX8A 4D1XA 4PP7A 1XH8A 3O71A 4GFMA 5TKDA 1Y91A 3FLWA 3BHHA 3AC8A 3PE2A 1ZAOA 2WTVA 3BBWA 3RHKA 2HZ4A 2J5FA 3F88A 1U54A 3I81A 3PA4A 4CV8A 3Q53A 4DT8A 4X21A 3FI2A 4LGDA 3HV4A 4BTFA 1YOJA 5C01A 4IW0A 3TIYA 2RF9A 3PXRA 4H1JA 5KMOA 1WCCA 3FKLA 3R00A 4II5A 4NM7A 5CEPA 4AT3A 4O7TA 4KBKA 3S0OA 1AD5A 2VWIA 4D1SA 1S9IA 3OCBA 4QTBA 5GINE 5FXSA 3MDYA 1PF8A 5IF1A 3JVRA 3D7TB 4FEXA 4O0VA 3R7YA 1F0QA 2XIXA 4LRKA 3EZRA 2GQSA 2BZIB 3VUGA 4AG8A 4IE9A 3KREA 4PDYA 2X8IA 3OY1A 3G9LX 2VTTA 3M11A 5F4NA 5ACBC 3LMHA 4G9CA 5BMSA 4ZMEA 1H1SA 1ZYJA 2R9SA 2R3JA 1HCKA 5LVPA 3R7EA 4QMTA 5HTIA 3CC6A 3UP7A 2Z7LA 3OS3A 4EOQA 4C8BA 2XNGA 2XF0A 2FVDA 3FY2A 4RRVA 4F6SA 3M2WA 3TNHA 3WI6A 2UZWE 2CNQA 5LXMA 2PUIA 5HGIA 4BB4A 3E8CA 2XIRA 5KZIA 1EH4A 2X8DA 2XRUA 3PJ2A 3PY1A 3E7OA 4KKHA 2RL5A 5KZ0A 4BI2A 4DAWA 3W8QA 4IB3A 4B8MA 4YO6A 3KULA 3OF0A 5IMEA 3UNZA 4GUEA 4L3PA 4TT7A 5HVKA 5M53A 5T3QA 2HELA 2EVAA 4CNHA 4DGLC 5AUWA 2QURA 1M2PA 3QLGA 2EXEA 2YEXA 4GRBA 3QX2A 1PW2A 2C0OA 2O65A 3LXKA 4L8MA 3LFCA 1Q24A 3GXLA 4MNFA 2HY81 4I0RA 3TTJA 2WMSA 4DE4A 3OUNB 1UWHA 4DFYA 3BGPA 5JSMA 1TQMA 2LAVA 4J95A 5BVOA 1FGIA 2X4ZA 4WNKA 2Y4IC 1OL5A 3LCDA 4G3GA 3OP5A 5BYLA 3FBVA 5FTOA 4EH7A 1IASA 3HP2A 1MQBA 4DYMA 3AMAA 4L43A 1Q4LA 2GS7A 3VQUA 1S9JA 2I0VA 2PMLX 2WNTA 3IGOA 5IUHA 5A4TA 2EXMA 3I6UA 4G3EA 4JVGA 4X3FB 2UZOA 5EM6A 3ZXZA 3NAXA 2GHLA 2OGVA 3C7QA 3EFWA 3C0GA 1PXNA 2BDFA 4EOMA 4G16A 4EH5A 3MTFA 3AMYA 5CTPA 4YSJA 3PDTA 2QOLA 3EHAA 3Q5IA 4BGHA 1KV2A 3A60A 3Q2MA 4BDHA 5ETCA 5HBJA 3AGMA 2XNEA 3QZFA 4XOZA 5FGKA 3R7UA 3L9NA 5GNKA 1U46A 4J99A 5DOSA 3MVHA 3BHYA 2X4FA 1H1RA 2BIKB 3OW4A 5E8VA 1CM8A 3MA3A 3PA5A 3PE1A 4R8QA 2JKKA 3GCSA 5D12A 5JRSA 4E4XA 5M06A 4EWQA 4MNEA 1MP8A 4XG7A 4YJVA 1J7LA 3BIZA 4QTAA 5E8XA 4NIFA 3GU5A 4C35A 3FMLA 3WYXA 3DBEA 1WAKA 2BAQA 3D83A 4PTGA 3MY5A 4EK6A 4QP1A 4M0ZA 4AN9A 2IW9A 2UZDA 2DQ7X 2VWUA 1W82A 4FF8A 4CZUA 2UZVA 4C3PA 4O0XA 2OFVA 5ACKA 4I3ZA 1Q3WA 2ACXA 3RBWA 4AOTA 3QRUA 3FEGA 1ZLTA 5EI8A 2UW7A 3HMPA 5L4QA 3AC1A 1YXTA 2A4LA 2UV2A 2R64A 5FLFA 3GCQA 4FA2A 3ZM4A 3PZEA 3EN4A 4USEA 3RM7A 3FI8A 3GNIB 2NRUA 3F9NA 4FG7A 4GG7A 4LRJA 4DEEA 4DLJA 5IH5A 3ZZEA 2C6OA 5HICA 4FEQA 3FZTA 4WA9A 3EB0A 3ZH8A 3BU5A 3FC2A 5HTCA 4UZHA 3DJ6A 2C6LA 3RTPA 5CZHA 5AV1A 1T45A 1OIRA 1YDTE 5AWMA 3VRYA 4RLKA 4GIHA 3BELA 3Q9XA 2QOFA 3UC3A 3DK6A 4XEYA 5JZNA 1OIQA 3PRFA 2KTYA 4JG7A 4RIYA 1X8BA 5C9CA 4FTRA 4BZNA 2J50A 5JK3A 4OAUC 3FPQA 4KAOA 3PY3A 1PKGA 4AW2A 4ANOA 3CIKA 4AF3A 3PJCA 5K3YA 1O6KA 2R3FA 2R3IA 3G0EA 3HLLA 5DFPA 4EOSA 3FAAA 5E1EA 3HV7A 4U81A 3NNXA 1UNHA 4EH4A 5IQIA 4FTMA 3UG1A 3R9RA 3HRBA 3HDMA 2QNJA 4V05A 3OG7A 3RPOA 2VTNA 3RMFA 2EWAA 1HOWA 4M3QA 3C0IA 5LCJA 3DJ5A 3I4BA 5AIRA 4RIWB 2VTPA 2Z7QA 5CNNA 5KBRA 2CN8A 3PLAE 3A7HA 1ZMUA 4O83A 4GYGA 5DBXA 2NP8A 3TWJA 2ONLC 4TYIA 4EC8A 4ZTSA 3RINA 3MVMA 4G3FA 2R3KA 3UIBA 3LFAA 5F94A 2WOTA 1DAYA 2WTDA 3PPZA 1OKYA 5KHWA 1UU9A 4QMMA 5TO8A 5L3AA 3LFBA 4FIEA 4XNEA 5CEKA 1PHKA 2Y4PA 5EYKA 5AR5A 3PWDA 5HIDA 4ANQA 3GQLA 1JWHA 2F4JA 5AJQA 5IEXA 2YAKA 3PJ8A 4BKZA 3NUUA 3ROYA 2W1CA 4EC9A 4BWPA 2B4SB 2OW3A 3POOA 5HU9A 2WFYA 5BNJA 3UDBA 3VUMA 3QTRA 4C61A 2C0TA 4AE6A 5J7BA 3WZJA 1BUHA 2ITNA 5FD2A 4AFEA 4ZY4A 3D7TA 2UW6A 4XBUA 2XK7A 4I6HA 3ORPA 1STCE 5AP6A 3S95A 2W5AA 2YCSA 3TUCA 2VNWA 4U6RA 2IZUA 3R9HA 2GNHA 4WBOA 3R8PA 3NW5A 3GB2A 2R7IA 3M1SA 4OBPA 3RPVA 1W0XC 4L53A 4IJPA 1XBBA 3NZ0A 3NCZA 4L01A 4PTEA 4UN0C 1J1BA 3Q04A 4HVIA 3MVJA 1CMKE 3QA8A 1UA2A 3ORNA 3VUKA 4EQMA 4D4SA 4F0FA 2PMOX 2WTKB 2XH5A 4O22A 4DEDA 4QTEA 1YI3A 4BGGA 5FDPA 3FZ1A 2QOOA 4XBRA 3FMMA 3UYTA 4USFA 2VNYA 3DS6A 2BDJA 3OWLA 2YIWA 4RZVA 5EG3A 3UPZA 3R22A 3QKKA 3TN8A 3H9RA 3VS5A 4DGOA 2I0EA 1GOLA 2IZTA 3C4WA 5EK7A 2X6EA 5G1XA 2R4BA 4L7FA 4EH9A 3FKNA 2PZPA 3QXOA 5H8BA 5IPJA 4UXLA 4FICA 4GCJA 4V01A 2NRYA 4IAIA 4O81A 5IKWA 2GDOA 2IVTA 3P08A 4BCQA 4MD7E 4CXAA 4FMQA 4D2TA 3MESA 4QMLA 2GTMA 3HRFA 4FTAA 5BUIA 2ONLA 3WILA 4ENYA 5IQAA 1IRKA 3VHEA 4H3PA 4ZZOA 4RJ7A 1MRUA 5LMBA 2XNPA 1VR2A 2J6MA 3G90X 3ET7A 4RFYA 4ZIMA 5B2MA 5EYCA 5HIBA 4ZS4A 1YWRA 2JITA 2XK9A 2Y7JA 4ITIA 4IXPA 4OTRA 4KKEA 5DWRA 3VIDA 4FT9A 1UNGA 2XJ1A 3RAWA 1IA8A 4PMPA 4GFOA 1OMWA 4HZRA 4EKLA 1Z57A 2HAKA 4IZAA 1APME 4L42A 1B39A 3V8TA 2PVKA 4JX3A 4QPSA 4U40A 3TG1A 4P7EA 5KO1A 1OBGA 4F0IA 5CS6A 2UW5A 2YZAA 3UBDA 4UY9A 4J53A 2NO3A 3S4QA 1R1WA 2XZSA 4XG9A 4X2GA 2X7GA 4MYGA 4EUTA 4AA4A 4CD0A 5CQWA 4D2VA 4JBPA 3QYWA 3NNVA 3AT3A 4DG0E 3CP9A 4O0TA 5AP4A 2XB7A 3R73A 5EQYA 3HP5A 3VF9A 2QG7A 2PL0A 1XH9A 1WVXA 3F2NA 4NW5A 5HG9A 3HV3A 3GC7A 1R3CA 4O96A 3DXQA 2HIWA 3U9CA 3ZC6A 4UZDA 4TNBA 4WG3A 4KUJA 2GNJA 4IC7A 3HMIA 2JIIA 4WBBB 4FEUA 3UG2A 5K0KA 3ZLYA 4KSPA 4KNBA 4A9TA 4AGCA 3S1HA 3EQFA 4PDPA 3CKWA 3R9OA 2O3PA 4YJPA 4K6ZA 3UOJA 1BLXA 3IS5A 3RI1A 5LMKA 1P5EA 4KINA 1U59A 4LOPA 2WU6A 1DI9A 3Q32A 2VWYA 5FP5A 5EHLA 2OLCA 3DPKA 4I22A 2X7FA 3BRBA 1PXIA 3TV6A 4Y8DA 4AE9A 1BI8A 5CAOA 4TYGA 3VWAA 3OWJA 5HKMA 4G6OA 4F09A 4YTIA 4ASXA 5IDPA 4WKQA 4JQ7A 3HEGA 2Y0AA 4F64A 4FIFA 4QMWA 3FY0A 5D41A 2NNWB 3E5AA 3OBGA 4GL9A 3D14A 1SVEA 3QWJA 1R0PA 5LOHA 5J9YA 3Q4UA 3CD3A 2WIHA 5CLPA 3MBLA 3AC5A 5I0BA 3CTQA 4HGSA 1OIUA 4F7SA 5E8ZA 1BL6A 3EYHA 3MH0A 3C0HA 4PDOA 5AX9A 3UTOA 5E8WA 3W32A 4MCVA 2R3RA 4MKCA 3A7JA 4TW9A 4FIJA 4ZY6A 4GMYA 2VWZA 4QQ5A 4B0GA 4EHGA 1Q8WA 4JL9A 2IO6A 4O38A 5TT7A 2VRXA 4LOQA 4AUAA 3FQHA 1MUOA 4U5JA 1ZYCA 2RIOA 4NW6A 3VQHA 1KE5A 4DEIA 5E7RA 1WBSA 4YP8A 5E4HA 3MSSA 5H9BA 4EI4A 1M14A 2YLEA 5AA9A 2QO7A 4F9BA 2PTKA 5A3XA 3W2QA 5HO6A 2BAJA 3MTLA 5AP5A 4H3QA 4P2KA 1XH5A 4QP7A 5K5XA 3GP0A 3FSKA 4ZTLA 4AT4A 5BVFA 4G3CA 3L9PA 3R83A 5IQGA 3U6HA 2W17A 3PVWA 3UOHA 3VJOA 4DCEA 4ANNA 2ITOA 5EM8A 3TNWA 1ZYSA 4DT9A 4IMYA 3ZHPC 3IECA 4ZTHA 3DT1A 3QQUA 2OIDA 2J0KA 2JAMA 1G8SA 3EMGA 5EW3A 1B6CB 3HNGA 4YGAA 5E8TA 4L00A 3COMA 2RFSA 3LFSA 1ZOHA 3LQ8A 1U4DA 3LPBA 4ZSLA 4BWKA 3QZIA 4MH7A 3VBQA 3CD8A 3ZUTA 3UP2A 3K54A 4NTTA 5IEVA 1OZ1A 3UC4A 3CQWA 3V04A 1J1CA 3F3VA 1E1VA 2CSNA 1UWJA 2Z8CA 3D94A 3I7BA 4S2ZA 4ACGA 5JH6A 4YZNA 4C02A 4Y83A 3HRCA 4A4OA 1CKJA 2BALA 1JBPE 1FVRA 4EK4A 4LL0A 5D10A 4EHEA 2ETMA 4DN5A 3PWYA 3SDJA 5JQ8A 3DDPA 4UEUA 4D5KA 4O86A 4CGAA 1PYEA 3NYXA 1KWPA 4TY1A 1FINA 3QF9A 3C4XA 3KA0A 1VYWA 4WG5A 4BCFA 4S34A 2YIQA 1PMVA 2OFUA 1Q8YA 3N9XA 3KVXA 3ZLXA 3KRXA 1F5QA 4KKGA 2C3KA 5FEDA 1M2RA 5ITAA 4FKPA 2YIYA 5IA5A 4CFNA 1XHAA 4MX9A 3ZO1A 5L6PA 1U54B 5ANEA 4CKIA 5K0XA 3SD0A 5KKRC 4BGQA 3ATTA 3BLHA 2UUEA 1R39A 3RK7A 4QYEA 3NWWA 2YM3A 3KRLA 4FTCA 4MXXA 1OL2A 3WF6A 1YWNA 1M7NA 4KB8A 5AX3A 3D9VA 1REJA 4S33A 4GSBA 4BZOA 4R7BA 4JT3A 3CY2A 2P3GX 3GC9A 3NS9A 5KHXA 4R1YA 4OAVB 1TVOA 3EFLA 2PUNA 2PVJA 3LXLA 4UMQA 3ODYX 3IGGA 4FZFB 3GEQA 4ZS0A 4U3ZA 2C5NA 3O7LD 4QMOA 5DEWA 4QP2A 2XVDA 2XS0A 3QXPA 5EDPA 5HCYA 2HCKA 2R3HA 3I0QA 3DFAA 2C6EA 4KIPA 4QMZA 5FP6A 2YCQA 4RLLA 3C4ZA 3CTHA 3FMHA 4WOVA 3QQHA 5HLNA 3SVVA 4KS8A 3P5KA 4IZ5A 3LCOA 4C34A 5HNIX 5IA2A 2R3OA 2YJSA 3DAKA 2ITXA 3EWHA 3KULB 2ITPA 4R5SA 4RVKA 5E9EA 5HOAA 5C4KA 2OIQA 4C4EA 4BKYA 2GQRA 4LV8A 4AW1A 3EIDA 1YXUA 4PP9A 1LEWA 1FGKA 4IHPA 4I0SA 3F6XA 3F69A 2XYNA 4OLIA 2ZM1A 2XIZA 3JXWA 4PRJA 5E1SA 1PRYA 3QQGA 3FXWA 4MWHA 4BBEA 3BYUA 4UALA 2FO0A 2VAGA 2DUVA 3MFRA 2VO3A 3AC3A 3VS1A 4FV3A 2A27A 4CTBA 3VAPA 3U4WA 2BZJA 4JBQA 4X6RA 3ORKA 2ITWA 2ERKA 1Y8YA 4FL1A 3R9NA 4HVGA 3HL7A 3JUHA 3NRMA 4XLIA 1H27A 3U4UA 4NM0A 3OT8A 5M09A 3FXXA 4FTQA 4MD9E 3ANQA 5K4IA 4PV0A 4U45A 3H9OA 5M07A 2QCSA 4J1RA 1G3NA 4ZTRA 4MWIA 4V04A 4YPDA 4NFNA 4EUUA 1W84A 2CDZA 5DLSA 5CANA 3SOAA 1Q8TA 4GT5A 4I6QA 4NH1A 3SHEA 5CAUA 3COKA 4QP3A 5I9XA 1PXPA 4IVCA 3WBLA 3SG9A 4MF0A 4FV0A 4A7CA 4C33A 4UB7A 2XCHA 4HPUE 3LLAA 4TWPA 4D2PA 2YA9A 3COHA 3P7AA 1KOBA 5DYJA 4NM3A 4BDIA 5AADA 4RSSA 3B8RA 3DKOA 5DHJA 3KY2A 1FMKA 3HYHA 3TM0A 3F3UA 2O5KA 4L68A 4RWJA 4D2RA 4DINA 5BVKA 4XUFA 1RE8A 4BDAA 4MNEB 1O6LA 1PXJA 4D4RA 1G8AA 3L9MA 5HQ0A 2YN8A 3AGLA 2OSCA 3FMNA 3QQJA 3QTUA 4NIFB 3VW8A 2F7XE 2G2HA 4TL0A 1WBTA 3QUDA 4DEHA 4FV4A 2XKDA 4ZTNA 2H6DA 5CEOA 2CJMA 2BRBA 4IM3A 4ZOGA 3LQ3A 2Z60A 3TL8A 2A2AA 5A4QA 3G9NA 1QPDA 5HIEA 3ZOSA 5IU2A 4WHZA 5KMKA 4M68A 3TCPA 2GMXA 3FLSA 2WMQA 4FSYA 5HE2A 1Q3DA 3GVUA 4EOLA 4L6QA 3H4JA 1NW1A 3DOGA 3V3VA 1GIIA 4DEAA 3W2PA 4F9CA 1Z9XA 2HWPA 4BL1A 1ZZ2A 4FZAB 4DTAA 2UVZA 2XUUA 5I9WA 2R7BA 3CTJA 4PNIA 4BCJA 5C4LA 3DK7A 5FG8A 5BVEA 5AUUA 1PXLA 2YM7A 4A4XA 5IA1A 3ROCA 1P4OA 2PVMA 1AGWA 3ITZA 4M67A 2XKCA 2PZRA 2Y4IB 3DK3A 4R3CA 5AR8A 5IA3A 2RSVA 4DG2E 4FEWA 3H0ZA 2UVXA 5GJFA 4EBWA 5JGDA 2PYWA 3UE4A 2JDSA 3AT2A 2IJMA 3BYSA 3DBQA 4F65A 4HNFA 4O7WA 3LAUA 3RHXA 3ZRKA 3PIXA 2CNUA 3R21A 5ETAA 3ZLSA 4RGJA 4EONA 3PLSA 4FKLA 3TKHA 5EDRA 3FLZA 4DH1A 1KE6A 4Z9LA 4PPAA 5BVWA 3ALNA 4U0IA 3ZSGA 2WZJA 4QMVA 4I24A 4YJSA 2PVRA 3MPMA 5FWKK 3A7IA 3DKGA 4FTTA 3MV5A 2PE2A 2JBPA 4L3JA 4YZDA 1ZXEA 3SX9A 4LFIA 1IAHA 4KIKB 4BY9E 4C4JA 3GCVA 4FGRA 3NUNA 3D5UA 3NNUA 5HNGA 3BHUA 3BI6A 3MH2A 3QUPA 1J91A 2BUJA 4XG2A 4ACCA 1YXXA 3VRZA 4D2WA 4C62A 4ZZNA 3PXQA 3SLSA 1YOLA 5AR2A 3SAYA 3FWQA 5AA8A 2GFSA 4GK3A 4FOBA 3TKUA 5L2IA 2WMBA 1O9UA 1YHWA 2F9GA 2I40A 3A4OX 3P7CA 5E91A 1WBNA 3E8DA 4MHAA 4FSNA 3REPA 4YJNA 1PMUA 3FMEA 4BI1A 2UW8A 5LQFA 4Z16A 2VTHA 3BYOA 2C5XA 2F7EE 3Q3BA 4IWOA 3TIZA 2HZ0A 3ORTA 3QCYA 4QQTA 4HZSA 3O0GA 3WF8A 1U5QA 4I4EA 2YM6A 3EQIA 3BPRA 4O7YA 3QTXA 2Y6OA 3O23A 5FEEA 5GZ8A 3DCVA 3MH1A 4IEBA 1SVHA 4N6YA 4ZY5A 4AZTA 3RVGA 4Y95A 4RA5A 2R0UA 2BDWA 2C69A 4G34A 3MIAA 1Q5KA 5I9UA 3CPCA 2CCIA 4O7NA 4R1VA 5C26A 3ID6C 2GNGA 2WQBA 3KMUA 3PPJA 4XG6A 5J95A 3TT0A 3VJNA 5HEZA 4AZSA 1K2PA 4GW8A 3D15A 2VX3A 4I5MA 4O21A 2YM8A 3VC4A 4BTJA 4HPTE 2ZOQA 2XK6A 2C5VA 1NY3A 2WO6A 2XKEA 3EN9A 3NUXA 2VTSA 2Q0NA 3OWPA 3QU0A 4XJ0A 4APCA 3MJ2A 4DGGA 3KFAA 4E6AA 2ESMA 4AW5A 4GU6A 4ACDA 4LYNA 2W1FA 2OH0E 3DA6A 5KE0A 3IPHA 2YDIA 2OIBA 1QPEA 3LJ1A 4FTOA 4JDKA 5AM7A 2QC6A 3QTIA 3UMWA 5A9UA 2WOUA 2O2UA 2HW7A 4JRVA 2XK8A 2FSLX 4A07A 3FLNC 3Q6WA 4D55A 4RVTA 4NFMA 2QQ7A 4XCUA 2X2MA 4AQCA 5EHOA 4K9YA 5AP2A 2XRWA 4X2FA 4YHFA 3Q4ZA 5L8LA 4FNXA 2VX0A 3T8OA 3QRTA 1Q97A 2QHNA 4IX4A 4PWNA 4TN6A 3BEGA 2P55A 3TZ7A 3CKXA 2CNVA 3TDWA 3G15A 3DLSA 3QL8A 4C4FA 3MWUA 3VBWA 2PU8A 2PY3A 4FNYA 4RWLA 2RKUA 5TR6A 2YACA 2B7AA 5CSXA 2BHHA 3TV4A 5JFXA 3W2SA 4EH8A 4ZSAA 5EQPA 3LKMA 2X9FA 4G2FA 5CSVA 5JZJA 4FT3A 4RMZA 4GIIA 4LUEA 4FX3A 3W2RA 1KOAA 3PXKA 3P23A 4IC8A 4O0UA 5LWNA 4EH6A 2PHKA 3C9WA 3FLQA 2B9FA 3NAYA 4OW8A 3UNKA 3ORMA 3QKMA 3UO6A 4UMRA 4W4XA 3R7IA 1YXVA 4QMQA 1O6YA 3GCUA 4OTIA 2IVUA 3F7ZA 3G0FA 3V5TA 5E8SA 2YIXA 3V5QA 4BI0A 3GFWA 3ZRLA 4OTPA 2W1EA 4S31A 2YJRA 5LVLA 4GJ3A 3EOCA 3TJCA 2JDRA 3BE9A 3DU8A 1LR4A 3DNDA 2ITYA 3GC0A 4FTKA 2O63A 3KU2A 4S32A 4FKUA 3QFVA 4BDCA 3QQKA 2CKQA 3Q96A 4J96A 3OCGA 3LE6A 2HXQA 3CJGA 3HUCA 4TYHA 4AX8A 4YPSA 2XA4A 2QR8A 5CVHA 3QYZA 4EEVA 3TTIA 4WSQA 1GJOA 3E8NA 3O17A 3GU8A 4I6FA 3E3BX 3PP1A 3QZHA 2HY0A 4MAOA 4BBFA 5BVDA 2FYSA 4JI9A 1YHSA 3CCNA 4YBJA 5EI2A 5EHYA 3HKOA 4G5PA 4F0GA 2AC3A 1KE8A 4YJTA 3VF8A 4JS8A 4QNYA 4E20A 5K9IA 5L6OA 4XYFA 4D9UA 3HV6A 4A06A 4E5BA 2ZAZA 5DT4A 4EH3A 3D0EA 5KMMA 2UVYA 3LM5A 1PY5A 4I92A 4AXAA 4CVAA 3FYJX 1GZOA 2HENA 3EN5A 3KN5A 4R3RA 2F7ZE 5L6WL 5CASA 3W33A 1H00A 4Y46A 3SG8A 5KNJA 4RA4A 4PL5A 4IBMA 4FZ6A 4FT5A 5KBQA 4F6UA 2J0IA 2OXDA 4BTKA 3ZC5A 4BBMA 3HMMA 5IH6A 4XRJA 4QMXA 2JEDA 4RZWA 4ZK5A 5J79A 3BU3A 3HA8A 1ZRZA 2BILB 3R63A 4JG8A 3EYGA 1WBVA 4MXYA 3T9IA 4NKAA 1UV5A 2OH4A 2R3NA 2VTOA 4J7BA 4PL4A 4S30A 5M55A 4AFJA 4C3FA 4DEBA 1M17A 1JKLA 1YRPA 1ZOEA 3BGQA 3D4QA 3DDQA 4DCAA 2F57A 3OTVA 4XG8A 3PA3A 4WIHA 1XQZA 3QZGA 2W7XA 4YHTA 1E1XA 1XO2B 3G51A 4F7LA 5DG5A 3KVWA 1OGUA 3ALOA 4JDIA 2UZNA 3FZOA 5GJDA 4KIKA 1I09A 2VWBA 4QP8A 2I0YA 3OBJA 5IH4A 1CKPA 2I1MA 3L8VA 5AV3A 3KMWA 4BCPA 1ZWSA 4CFVA 5FM3A 2W1GA 5A4LA 1Y8GA 3PY0A 3BHTA 1HCLA 3VS6A 5C8MA 3LOKA 4XG3A 3UJGA 3VS4A 4A4LA 3F2RA 4IDVA 3UIUA 3ZDIA 1MRVA 4IM2A 4DH3A 3NMUF 2WQNA 2VTQA 4V0GB 2R5TA 3B2TA 3RK9A 4W4WA 4LOOA 2GTNA 1W83A 3Q2JA 4YTCA 4CQGA 5AV4A 3HGKA 4RC3A 4MXZA 4AU8A 5CSPA 2W4OA 2WGJA 1JPAA 5AV0A 4XP3A 3KCFA 3BU6A 1WFCA 4MBIA 4M84A 3AD6A 3TJDA 2Q83A 3CGOA 3DLZA 3NDMA 2JLDA 3KK8A 5CF4A 4HOKA 2CLXA 1UKHA 2X2KA 3LCTA 3KMMA 1GIHA 3E62A 4IZYA 1GZNA 4ZSGA 2IVVA 3FPMA 4QQCA 3A99A 2BPMA 3NYOA 4XRLA 3FZPA 1Q62A 4FKGA 2A0CX 2P2HA 4BR3A 4RX8A 5L2QA 4U79A 3A8WA 3LCSA 1SYKA 4O27B 3R8VA 3LFQA 3KN6A 3WE8A 3ZBFA 4QMYA 4MF1A 3PJ3A 2C0IA 2OJIA 3BV2A 3QWKA 4RT7A 4R5YA 3ZRMA 3P0MA 1OL7A 3NYNA 4K77A 4C2VA 3FQSA 1TQPA 4HVSA 4G9RA 3H30A 3VO3A 3UO5A 3F7WA 3MJ1A 5HBEA 4IACA 1REKA 2G2IA 3FL5A 1Q8ZA 3FL4A 3OHTA 1KE7A 3GFEA 3WF5A 2J2IB 2ZB1A 5HHWA 3RAKA 3KXGA 5LARA 3R28A 1M7QA 3VUTA 1JQHA 2BKZA 4N0SA 5J8IA 3PYYA 4IH8A 4JR7A 3SOCA 2WQMA 1AQ1A 2UW3A 3MIYA 2BIYA 4YZBA 5HD7A 5I3RA 3KF4A 1H0WA 1OUKA 2OKRA 4AACA 2PUPA 2RFEA 3TNPC 2W96B 4BDDA 4DFXE 2P4IA 3PFQA 3VUIA 1WMKA 3BQRA 2QVSE 3KRWA 3OEFX 2B9IA 3BEAA 4RJ6A 2YLFA 3EQCA 4RJ3A 1JKTA 3DQXA 2HWOA 4PDSA 4J71A 5DA3A 2XBAA 5HESA 3A2CA 4HYUA 4MK0A 3N4UA 3OWKA 1NVRA 2DS1A 4CCBA 4FUYA 3FE3A 3AD5A 3L1SA 2OICA 4RX5A 4CZTA 5JGAA 5E92A 4EHZA 4DITA 3OOMA 4R7IA 4JRNA 1JNKA 3DB8A 5IISA 4ZJJA 3IDBA 4H1MA 1VZOA 5B2LA 4DFBA 2EXCX 3S3IA 3QRIA 5EYDA 2PZYA 2CHLA 3FMKA 3OMVA 4FKVA 3EQBA 3TUDA 1OKVA 5HO7A 3VS7A 1FVTA 5KMNA 3EQPA 3ZBXA 2VO6A 3UNJA 3ZZWA 1Y6BA 5FBOA 3D5VA 5AAEA 3WF7A 4FK6A 1XBCA 4NT4A 5EFQA 4FKOA 3NUYA 4JXFA 4M7IA 3P9JA 5KKRB 4HJOA 4BN1A 4EYMA 4LGGA 3V6SA 4LQMA 3R1SA 4J8NA 1BMKA 2R3MA 2QONA 3DFCB 5HG5A 3WYYA 3ZO3A 5C8KA 4RVLA 3SXRA 2PE0A 1URWA 1KV1A 4GJ2A 1UVRA 2X81A 4XP0A 5AP7A 5AR7A 5L8JA 3W1FA 4PPCA 4NSTA 4EOPA 2BKKA 3GC8A 5EOBA 2JFMA 3H10A 4I20A 4DFLA 3FMJA 3S00A 1XWSA 2DWBA 3QRKA 5HG8A 4FOCA 3AXWA 4PUZA 4FKSA 3TKIA 1WBWA 3ZSIA 4DBNA 2B0QA 1WVYA 4FNZA 2VUWA 3RNYA 2JKQA 3SRVB 4F9WA 1URCA 2BVAA 3VBXA 4E3CA 3WZEA 4CFMA 5AAFA 2XIYA 3ODZX 2C3JA 5HD4A 4YNEA 3VBTA 3UMXA 1FPUA 4YZCA 3L8PA 4ANMA 4E4NA 1F3MC 4W8DA 5KCVA 5CXHA 5I9YA 3OC1A 4QP4A 2GSFA 1Q61A 3UODA 3EJ1A 3OFMA 4RJ8A 3ZMMA 2XK3A 4XH6A 5DNRA 4C58A 4G31A 5JN2A 5DE2A 3TXOA 4AT5A 2Z7SA 2YDJA 2BTSA 4OTGA 3DBDA 3FKOA 3FDNA 2PZ5A 4FC0A 5F1ZA 4GFGA 3MPTA 4I5PA 2W1ZA 4EKKA 4DFUA 2R3GA 2YWVA 3RK5A 3KCKA 2OZAA 4EK5A 3BQCA 4JJRA 4F1OA 2V22A 2ZV7A 2G2FA 4FG8A 3R8ZA 3AC2A 3LFEA 4HCTA 2WTCA 3TI1A 4DF3A 2OWBA 5CF6A 5HX6A 2WB8A 4HVHA 4CYJA 3ZUVA 2GHMA 2Q0BA 4CZYB 3G33A 3ORLA 4TYEA 4BRXA 4FVRA 1P4FA 1A06A 4D1ZA 2XNBA 5IQFA 2BRGA 1GIJA 3RJCA 4AW0A 2XEZA 2QD9A 2W1IA 3IW6A 5FBNC 5HE0A 4L67A 4F70A 4UMUA 3RPYA 1Y57A 4RJ5A 3WARA 1PMNA 4K1BA 5AUXA 3ZXTA 4XX9A 5CEIA 4CQEA 2BCJA 2VO0A 4V0GA 1FVVA 4A9UA 3NW6A 3AC4A 1SMHA 3W2CA 4ORKA 3QD0A 2ETRA 3VBVA 1V0OA 1YQJA 4C57A 3RGFA 4EQCA 2BRNA 3BHVA 5HLPA 3O7LB 4ACHA 4M66A 4EJ7A 1GZKA 4O6EA 1A9UA 4NZWB 4JQEA 2BFXA 3D5XA 2B9JA 2EU9A 4QYYA 2ERZE 3HV5A 2KULA 3POZA 4KRCA 4GKHA 4X2JA 3QRJA 2XIKA 2R3LA 3EL7A 2H96A 4W8EA 4BCOA 3H9FA 3RWQA 5LVOA 1VYZA 2ZYBA 2XNMA 2XBJA 4AA0A 3LMGA 5KUPA 4G17A 2Y8OA 3EQDA 4RWIA 4G5JA 3VUDA 5CNOA 5ICPA 5KMJA 5CEQA 5AP1A 2OG8A 4L9IA 3SQQA 4C38A 2G1TA 4TYJA 2CCHA 2PE1A 3C4CA 3FXZA 1YW2A 5IA0A 3U54A 2F2CB 3OUKA 3F3ZA 3QTWA 4JAIA 2W5HA 4BCKA 5AV2A 2GNIA 3SGCA 4Q5HA 4CKRA 3ORIA 2ZV2A 4FTNA 1Z5MA 4RQVA 3HDNA 4LUDA 3JPVA 4DHFA 5LMAA 4DA5A 3V01A 3NIZA 5H2UA 3NVKI 4WNPA 4CG8A 2OU7A 4O6LA 1SNXA 4EL9A 3A7GA 3ORXA 4RVMA 2B52A 3LFNA 3ENMA 4NTSA 3IW7A 3P1AA 4UXQA 4E6DA 4DGNA 3DXPA 4I0TA 5CI6A 2QOBA 2PK9A 4G3DA 4JBOA 4YLLA 3RAIA 4YZMA 4FV2A 4X3JA 3TNQB 4NJDA 2WEIA 4EK3A 4O0YA 4I23A 4DH7A 5M08A 3LZBA 2F2UA 4CG9A 1KSWA 1M2QA 2YM4A 4QYHA 5HNBA 4MXCA 4WRGA 5EH0A 4G1WA 4K18A 2W06A 4I94A 3RM6A 4OTFA 2XEYA 1IR3A 1PKDA 4OBOA 1FBNA 3PSBA 3AT4A 3QUEA 4XMOA 5J5SA 4CRLA 5J1VA 2FA2A 2OO8X 3W55A 1OBDA 1CTPE 2W05A 1UKIA 3FQEA 3SW7A 5B2KA 3LFFA 3FMDA 4U44A 4UWBA 4IVAA 3ANRA 2PMNX 4M13A 1BYGA 1DM2A 5CALA 1VJYA 4GV1A 2QO2A 5AIKA 4GUBA 3HZTA 3HAMA 4ZMFA 4LMUA 1QCFA 2PVLA 4C59A 3QD3A 4LV5A 3FHRA 2XM8A 3HMOA 2PPQA 3C4FA 4MTAA 1R78A 3L8SA 4G6NA 5ANKA 5LJJA 3CJFA 2UZUE 2JDVA 3A4PA 1WZYA 2V55A 2J0MB 2OJGA 3FZSA 2J90A 2PVYA 3G5DA 4GYIA 3QAME 4GVAA 4BCMA 4BCNA 4Z7HA 5E90A 1KUTA 5CX9A 4FSQA 5M56A 1JSUA 4HGTA 3NW7A 3UZPA 4QMSA 2JBOA 3E3PA 1PXOA 1Q99A 2UW0A 1QPCA 5D1JA 4KBAA 5CQUA 4CFWA 3K2LA 2Y9QA 4J97A 3DJ7A 3MY1A 4D5HA 3EN7A 3LXPA 4CTCA 2PZIA 2W4KA 3D5WA 2CLQA 3CBLA 4TWOA 5M57A 4HYIA 4L45A 4A9RA 5J1WA 2X0GA 3EQHA 2OXYA 2HK5A 4OTQA 2WQEA 3OTUA 1H24A 1OITA 2E9VA 3RNIA 5EYMA 1DAWA 1XH7A 3L9LA 3LJ2A 5DT0A 2IVSA 3JYAA 3IOKA 3OY3A 3QGWA 4PMTA 4L46A 4AA5A 4E6CA 4PNKA 3SC1A 4ID7A 1XR1A 3JS2A 4YC8A 2UZBA 1NVQA 4Y85A 5A46A 3LIJA 3B8QA 2ETKA 4CFXA 3BX5A 4JIAA 2XKFA 3CQEA 2B53A 3L8XA 3WF9A 4RX7A 2CGVA 1UU3A 3BWJA 3CEKA 4HGLA 4FSTA 4JQ8A 3WZDA 4FKJA 2CKOA 4C4GA 5EKNA 1YDRE 3OCSA 3PJ1A 5JFSA 3NNWA 1YWVA 4F9AA 4RG0A 4XG4A 4Y73A 4ACMA 5CWZA 1BX6A 4TYHB 3V8WA 4FSMA 4ZLZA 2PWLA 2OJJA
chains in the Genus database with same CATH superfamily
3SRVA 4RFZA 2XYUA 1YVJA 3R30A 4ZJIA 3C4EA 3QBNA 1JSTA 3NGAA 2C6TA 2JKMA 3NPCA 4YO4A 5HLWA 3EH9A 4UWYA 2QKWB 2VWVA 4J8MA 3KGAA 1K9AA 2OJFE 4GEOA 4IAKA 3Q9ZA 2J9MA 4GU9A 5DRBA 3GENA 2OK1A 3ACKA 4UX9A 3QD4A 4U97A 1OKZA 4BC6A 5HE3A 2JAVA 5IQBA 4HNIA 1YI4A 2YDKA 4EBVA 4YTHA 3IW8A 4HGEA 2FSMX 3KXZA 4DEGA 2PUUA 3FYKX 4AXDA 5JT2A 1CSNA 3DQWA 4E5AX 4FKRA 3GT8A 2VD5A 5TF9A 3EL8A 4DTKA 4FIGA 5FM2A 3PG3A 4ZLYA 2CMWA 5M4FA 3GUBA 2YCFA 2VX1A 4B99A 3ACJA 2HZIA 4IB1A 2BRHA 1OUYA 5HI2A 2XCKA 5ANGA 5L8KA 3BL9A 4JOAA 2GNLA 2C6DA 3V6RA 4NJ3A 2OZOA 4H58A 3UIMA 4HVDA 1W7HA 3ZEPA 3QTZA 4ZJVA 2AC5A 2X8EA 3OT3A 4AGDA 4BDKA 2ZM4A 2WTJA 3E8EA 2XALA 4R78A 4QNAA 4C4IA 4FI1A 3MB6A 4OT6A 4FUXA 4IM0A 2OJ9A 3TACA 3EFJA 4ASEA 4I5HA 2JIUA 3IG7A 4YSMA 4E5WA 4YJQA 4CKJA 3EQGA 2V7AA 4ZLOA 5A6NA 3C5UA 4H3BA 1CDKA 3Q4TA 3R8UA 4O7SA 5EI6A 4YMJA 2Z02A 1H1WA 2C68A 1OB3A 3R04A 3R1NA 4EZ7A 3AQVA 5IUGA 4QDVA 4NYEA 2JIVA 4HCUA 3IONA 3TDVA 3DXNA 3WIKA 2JD5A 2BZKB 4BIEA 2VWWA 3O50A 2UW4A 5I9VA 3CSVA 4E26A 1RDQE 1H0VA 5GIOE 1K3AA 3G2FA 4GVJA 1YKRA 4RWKA 3GU6A 3VULA 2C30A 2ITZA 4FZDB 4Q9SA 2ZMDA 3DKFA 4U8ZA 3ZCLA 5A6OA 1JOWB 1FMOE 2QHMA 4GT4A 4FL2A 3DAEA 4UYAA 3OEZA 5I4NA 4EOOA 3DKCA 2XANA 3O51A 2QI8A 3QCSA 3W16A 4B6LA 4MVFA 2C47A 3SKCA 5BMMA 4D58A 1L3RE 2WMWA 5C03A 3R1YA 5DPVA 3U9NA 2WMTA 4ALWA 2BMCA 3BKBA 2UW9A 3UGCA 3ELJA 4CT2A 3RWPA 4W9WA 4JDJA 3VUHA 2XMYA 4IDTA 1BI7A 3SXSA 4QYFA 1UU8A 4LI5A 4ERKA 3IDPA 4L44A 4LM5A 1M52A 4FTJA 5AP3A 4IX3A 2HYYA 3ZYAA 5IQHA 5EOLA 5A4CA 4FVPA 2E9OA 4C37A 2BFYA 2JKOA 5AUZA 4QPAA 4U3YA 1ATPE 3UQGA 1OPJA 2A1AB 3DTWA 4K2RA 4E4MA 4KIOA 3NUSA 3Q9YA 4X2KA 2FGIA 4FSRA 4M69A 3HA6A 2VTLA 3E93A 3GGFA 3R2BA 3ZUUA 3KRRA 3B2WA 2QG5A 3O8UA 2O0UA 3V5PA 3VVHA 4TWCA 4QT1A 4FEVA 3FLYA 4P5ZA 1OPKA 2G01A 2WMRA 4WNMA 3O8PA 5CSWA 4MBLA 5BV3A 3WZUA 4A9YA 4AP7A 4DC2A 4Q9ZA 5BX0A 4QMUA 3JY9A 5DRDA 3HUBA 4EH2A 4NL0A 3MPAA 4DGMA 4C36A 4ALUA 5AUYA 5IG1A 5LWMA 4KSQA 2W99B 3G6GA 3H0YA 4YR8A 5A4EA 1OI9A 1U5RA 5FEQA 3PUFC 5C1QB 2QLQA 3KQ7A 1J7UA 2I7QA 4YLKA 4CMTA 4YUQA 3KB7A 4Z55A 2C6MA 5IQCA 3PTGA 3AOXA 3Q60A 3FI3A 4Y5QA 4RIXA 5CVFA 5DVRA 4BDBA 3U6JA 5C8NA 3BZ3A 3UZTA 4K33A 4PY1A 4NCTC 5E8UA 3ZDUA 4I4FA 3IOPA 4RC2A 5LVMA 2XP2A 4P4CA 1YHVA 2O64A 4MXOA 3G6HA 1OVEA 4F9YA 4YU2A 3PG1A 1P2AA 3O96A 4FT7A 4LG4A 4AZVA 2G15A 3SA0A 2J51A 3A7FA 3OCTA 3N4VA 4RJ4A 3ZFYA 4RQKA 3PP0A 2X1NA 1L8TA 1UU7A 2GS6A 4NEUA 4IAYA 5A54A 4AZWA 5ANOA 5CU0A 4QRCA 4XS2A 3C50A 4CLIA 4F7JA 4D2SA 4ONAA 3PUPA 2FB8A 5FDXA 4C4HA 1H01A 3GQIA 5CF5A 3GBZA 2X2LA 3MGYA 3DGKA 4FZ7A 4BWXA 5HX8A 5L2WA 2YAAA 3BYVA 2WAJA 2EB3A 5BQ0A 1XH4A 4KWPA 3U51A 4AN2A 2PMIA 4N57A 3N4TA 4L52A 2WU7A 2P33A 3AD4A 4RIOA 4Z7GA 5I3OA 5CXZA 4TNDA 3ZO2A 2E2BA 4X7QA 3UVRA 1PMEA 3QA0A 4DBXA 2GS2A 1SM2A 2JFLA 5ANJA 2WQOA 3M42A 5JFWA 4XOYA 4AAAA 2VO7A 2WMXA 3PVGA 1GZ8A 4O0RA 5DGZA 3ZFXA 3CLYA 5J9ZA 2OF4A 2QODA 2VTMA 3PXYA 5CU2A 4N4SA 4EWHA 3MI9A 4QPMA 4F4PA 3R8MA 4JX7A 3QC4A 5CT0A 2GCDA 5E8YA 4XV2A 4PL3A 4ZAUA 3RPRA 5CAVA 5DH3A 1V0PA 4JG6A 4JAJA 4K11A 4P5QA 1W8CA 3PPKA 5GZ9A 1LPUA 1QPJA 1ZMVA 3BBTB 5CZIA 4GK4A 4TKSA 5ANDA 2YABA 5I9ZA 3W0MA 4QD6A 1UNLA 3W0QA 5EDQA 5K4JA 4IFGA 3BWFA 2QOQA 3F5XA 3NCGA 1WVWA 2W0JA 2YISA 3BGZA 5AR3A 4CT1A 3BE2A 3HMNA 1GNGA 2O8YA 4M12A 5HCZA 4WNOA 1IAJA 3O2MA 1GY3A 2QOIA 3WE4A 4WRSA 3Q4CA 2CKPA 1ZMWA 3DBCA 3DZQA 4NCTA 3JY0A 5DR6A 4IAAA 1SVGA 4FYNA 2YCRA 2YIRA 2ZV8A 2QOKA 4YJRA 4PQNA 4ZSJA 2LGCA 2OZAB 3PXFA 5HO8A 4FODA 4GH2A 2W9ZB 4C2WA 2Y6MA 5CU6A 3UYSA 1Q8UA 2RFNA 2VV9A 4U42A 3P79A 3V8SA 4CLJA 2BZHB 3RALA 3IDCA 1PYXA 4Y72A 5DT3A 4I41A 1H8FA 2C6IA 4CEGA 4CYIA 4EOIA 2WMUA 2GPHA 4L7SA 4BDGA 2V62A 5IA4A 5FUTA 4FV1A 4RX9A 2WEVA 3OXTA 3QTSA 1P14A 4EK8A 3C1XA 1OKWA 4YC6A 4W4VA 4ANLA 1LEZA 4U41A 4KIQA 3FUPA 4BICA 2WTWA 2C1BA 2XNNA 3VN9A 4IADA 3I5ZA 4D0XA 3BLRA 2QU5A 3R1QA 5BYZA 4FSWA 3W2OA 4EJNA 1MQ4A 2R3PA 3Q9WA 5AP0A 3R7VA 3UO4A 4FTIA 3PSDA 3QD2B 4M15A 2EB2A 3GU7A 3LXNA 4O7VA 2J0JA 2XJ2A 4BCGA 2QO9A 3Q6UA 5AAGA 2XJ0A 4FK3A 5T68A 2X6DA 4FT0A 5AFVA 2A19B 3ETAA 5H8GA 2GNFA 1G8JA 2WXVA 5LVNA 3RAHA 3RZFA 1IEPA 3V5WA 3KXMA 3A62A 4J52A 4OTDA 3MY0A 4CSVA 1PXMA 3WOWA 4AGWA 4X3FC 5AUVA 1H28A 1H08A 3KXXA 5D11A 4GS6A 4Y5HA 4ZZMA 3OROA 5IUIA 4F7NA 4ZSEA 3FZRA 4BYJA 3D2KA 2YFXA 4KABA 5D7AA 3VBYA 4HYSA 3DBFA 3W0OA 4QQJA 1KE9A 3KXHA 2JDTA 3F66A 2PVHA 3PIYA 4MQ1A 4RFMA 5DIAA 2P0CA 3QGYA 3UZRA 2CGWA 2IWIA 1DS5A 4FSZA 4O2PA 3R02A 2BHEA 1SNUA 3ULIA 4FKTA 4OT5A 4ASZA 5CVGA 4AWIA 5CAPA 2H9VA 5CSHA 3VNTA 3MFUA 3II5A 5G6VA 4FG9A 2NPQA 3H3CA 3ZEWA 1JKSA 4R6VA 2UZTA 4WT6A 4D28A 3ORZA 1BL7A 4FBXA 4I5CA 2VTIA 5LMKC 2VTAA 3FC1X 2W4JA 2Z7RA 5K5NA 4NKSA 3QC9A 1ZYLA 4K0YA 3F5PA 4B8LA 4BCHA 2C4GA 5HBHA 3R7GA 4NU1A 2REIA 2ZVAA 4D0WA 4R7HA 2ZFYA 4BDJA 3R9DA 2DYLA 2E9PA 5AMNA 1FOTA 4O1PA 4JNWA 4HYHA 5AR4A 3SV0A 3W10A 3IO7A 4FE2A 3F3TA 2I0HA 3TNIA 2JC6A 4RC4A 4EZ3A 4KD1A 4WUAA 1WBOA 4JR3A 1H07A 4M97A 2UZLA 2QOCA 3FJQE 4OBQA 5AEPA 2W1DA 3KF7A 2R2PA 3CGFA 5CYIA 4J98A 4ANSA 5KMLA 4U7ZA 1ZY5A 5FTQA 4HCVA 2VGPA 3NLBA 4P90A 4QTDA 1G5SA 2F49A 2W1HA 3I6WA 4YJUA 5TOZA 4F1TA 1NXKA 3E7VA 4XV9A 4PTCA 4R77A 4OUCA 3LLTA 3EQRA 3NIEA 1DI8A 5KX8A 4CFUA 4IAFA 4ITHA 2J0LA 2E9UA 4X3FA 2IG7A 2VGOA 3PXZA 5F20A 3D7ZA 3EFKA 5CU3A 4IWDA 2BAKA 4EORA 5HU3A 3NUPA 4IQ6A 4KBCA 4USDA 1RQQA 4F63A 3C13A 5BUEA 4TWNA 2Z2WA 4I1ZA 4DH5A 4EHVA 2QR7A 3QCXA 3QHWA 4YZ9A 2V0DA 3PFYA 3WIGA 1MRYA 2I6LA 5CAQA 5L2SA 2YZLA 3K5VA 4OGRA 2AYPA 3ZU7A 2JGZA 2P2IA 3V51A 4CMOA 5HVJA 3I1AA 2IZRA 4O7ZA 3TZ8A 3F2AA 5J9LA 1H25A 3LCKA 4BDEA 5F9EA 1RJBA 2BTRA 5EKOA 3R8LA 5M44A 2WHBA 5IQEA 2IW6A 2J7TA 3TZ9A 3MB7A 2NYAA 4FL3A 3BYMA 3IW5A 2WTIA 3CPBA 3NR9A 3Q52A 3R6XA 4XV1A 4QO9A 1Y6AA 4TZRA 1J3HA 4APPA 1XH6A 1ZY4A 3RCJA 5J5TA 1OIYA 3JR1A 4NK9A 4BZDA 4EYJA 3CE3A 4JBVA 3SXFA 4O7LA 4O7RA 3QQFA 4F08A 4BDFA 3TUBA 2VWXA 4H39A 4BYIA 3T3VA 4IWQA 2ZV9A 2GQGA 1I44A 2H8HA 3CR0A 3RZBA 5HZNA 3KC3A 2IPXA 1ZZLA 1ZYDA 3W18A 3ZM9A 3R01A 4KA3A 3I60A 3A8XA 2HZNA 4ARKA 3I5NA 5HVYA 5EQEA 5DR9A 3DAJA 3NEWA 3KXNA 4I21A 3DZOA 3VS3A 4UMTA 4WG4A 4YHJA 3I7CA 2RFDA 1TQIA 2WMAA 5FRIA 5JRQA 2C5YA 3BV3A 5CI7A 4IANA 3I79A 4UV0A 3GOKA 1JKKA 4O4FA 4FGBA 2VN9A 5HCXA 4C0TA 1YXSA 4QP6A 2ZDTA 3DNEA 2WTKC 3LW0A 3MA6A 5IQDA 2X39A 1R0EA 3OOGA 4OTHA 4U43A 2W5BA 4XHKB 2JDOA 5EM7A 4XV3A 4EOJA 3E87A 2OBJA 4IB5A 1NT2A 4BHZA 3K3JA 4AOIA 4BIBA 4OR5A 4QTCA 4YC3A 1OPLA 2GU8A 4XP2A 2BROA 4PMSA 4MQ2A 4PPBA 4NUSA 4DTBA 1OECA 3R0TA 2X7OA 2BR1A 1VEBA 3MS9A 4M8TA 4RBLA 4DHJA 4QMPA 4O82A 4RIWA 2WKMA 2PSQA 2VU3A 4I6BA 2GHGA 4KS7A 4ZP5A 5FQDC 5AUTA 1FQ1B 3PSCA 3U87A 3PVBA 3CS9A 3IKAA 4WUNA 1PXKA 2B54A 4O84A 4IAZA 3C51A 3K5UA 5L2TA 2WELA 2XM9A 4ZTQA 4BFMA 4O91A 4YTFA 4FVQA 3ZO4A 3RPSA 5TE0A 2E9NA 4FIIA 1YOMA 1E9HA 1OL1A 2J5EA 4JIKA 1XJDA 3CY3A 4E1ZA 4FKIA 2UZEA 5DR2A 4TRLA 3QLFA 3F3WA 3LM0A 2PVNA 3GOPA 1W98A 5GIPE 3V5JA 3V5LA 5ETIA 3ZLWA 4X2NA 4ZXTA 3THBA 4TXCA 4MD8E 3IQ7A 4C3RA 2FUMA 4TPTA 1JSVA 3S2PA 4FV5A 2QLUA 4O0WA 1PJKA 3EZVA 4EQUA 3QCQA 4CMUA 2XNOA 3U55A 3ULZA 4IIRA 2QOHA 2B1PA 4MXAA 4PF4A 1NA7A 1CKIA 1H1PA 2SRCA 3LHJA 1Q41A 4FKWA 3QALE 4EOKA 3UOLA 5BUJA 4YURA 3GI3A 4DDIA 4KRDA 3GU4A 4WO5A 4FSUA 3ZSHA 4CV9A 2B55A 3MW1A 4BF2A 4FV8A 3LVPA 2QKRA 4FV6A 4UYNA 5CT7A 5J87A 4CFFA 2PULA 4E7WA 2CGUA 5IEYA 3E92A 4G6LA 3TV7A 4BTMA 4F1MA 3VS2A 3UQFA 3DV3A 3QTQA 2ZM3A 4TTHB 2ITUA 4BIDA 5HTBA 4DFNA 1QMZA 4FYOA 1W2CA 2B9HA 3F82A 5C27A 3JVSA 3C5IA 4M69B 4BHNA 1IG1A 1ERKA 3DY7A 3LJ0A 4A9SA 2PVFA 2ITVA 3F5UA 2CKEA 3OD6X 4RPVA 5GJGA 3RKBA 5FTGA 1XKKA 3F5GA 3P86A 4IJ9A 2YERA 3KRJA 4DG3E 5KMIA 3ATSA 4AGUA 2C3IB 3ZS5A 4BVUA 1V1KA 1XBAA 4FIHA 3EN6A 4L3LA 4C7TA 2FH9A 4OTWA 4E4LA 5I5ZA 5D7VA 3E88A 4E73A 4I93A 5A14A 3RCDA 4B9DA 4ALVA 3LQ5A 5JKGA 4IWPA 4YLJA 5EM5A 5JFVA 1A48A 4H36A 4IB0A 3P7BA 4F6WA 3GCPA 4DLIA 3TYKA 3BLQA 2WIPA 5GZAA 2V5QA 4Q2AA 5CENA 4K8AA 4B7TA 5EW8A 4WD5A 2X9EA 5FXRA 1QL6A 3CXWA 4LGHA 3OVVA 3BLAA 4RIXB 1LP4A 2ZDUA 2YHVA 2HOGA 4JDHA 1TKIA 2J4ZA 4PX6A 3QX4A 5GHVA 4AZEA 2IW8A 3P4KA 3FSFA 1B38A 3BCEA 4GK2A 3IW4A 4WSYA 5IDNA 4MEDA 3ZTXA 1JAMA 4AZFA 1ND4A 1WBPA 5EW9A 3MFTA 2QU6A 3E63A 5BYYA 4FTUA 4GKIA 4D4VA 4B4LA 2W9FB 4ENXA 5DEYA 4F99A 2WPAA 4JLCA 4IX6A 3R2YA 3DTCA 2ITQA 5DMZA 1NVSA 2CPKE 3OXIA 4LMNA 5HG7A 3T3UA 4FTLA 3FHIA 4CCUA 5CEMA 3D2IA 4QYGA 3PRIA 2OI4X 2VZ6A 3OW3A 1ZARA 4FV9A 2X0QA 4FR4A 2GFCA 4NWMA 5HE1A 4HW7A 4AAYA 5BPYA 4QOXA 2R3QA 4MBJA 1OL6A 5DI1A 3OXZA 4XLVA 5H8EA 3TZMA 4AOJA 5B0XA 4Z3VA 2ITTA 1BKXA 2OXXA 2HXLA 3MH3A 4PMMA 4UWCA 1JVPP 2C1AA 3RP9A 4H05A 4E6QA 2YITA 4QP9A 3KKVA 3UIXA 3MFSA 3FI4A 4O2ZA 1XMMA 3UQCA 3OZ6A 4AS0A 4BKJA 4EZ5A 4GG5A 4FNWA 1YDSE 2H34A 3ENHA 1H4LA 3MYGA 3A61A 3CQUA 4IX5A 3WZKA 3IK3A 4YJOA 4D4YA 2RG6A 5HORA 2G9XA 4FV7A 3KEXA 4IVBA 4IFCA 3ZFMA 3HX4A 2ZMCA 4M14A 4X6QC 2WMVA 5FXQA 1SZMA 2RG5A 2XK4A 5LCKA 4LRMA 3F61A 5ANIA 3VW6A 2CGXA 2C6KA 2IZSA 5M4IA 4D9TA 2IN6A 4FKQA 2VTJA 4YNOA 2V7OA 1J7IA 2YM5A 4R3PA 3MN3A 3AMBA 2EUFB 2YWPA 5IZFA 4N70A 2BRMA 2WD1A 4ERWA 2RGPA 3K3IA 1H26A 4O0SA 4AN3A 5H3QA 4LL5A 3QQLA 4ZTMA 4YBKA 4ANBA 3KL8A 4ASDA 3EKKA 5CU4A 2R0IA 3SW4A 5JEBA 3R7OA 3QHRA 5M51A 3HAVA 4GT3A 4DFZE 1ST4A 4I6LA 2CN5A 2ZB0A 2FSTX 4DH8A 4IZ7A 3DB6A 5F95A 3TEIA 5DN3A 3VHKA 2ZJWA 1LUFA 4ZEGA 5J7HA 1H1QA 3R71A 4QMNA 4Q5EA 4N6ZA 3I0OA 5JMSA 1JLUE 4O1OA 4CRSA 5M4UA 3COIA 4UMPA 2FSOX 3ZONA 5T6KA 3Q5ZA 5M4CA 4U9AA 1GAGA 4ITJA 3NYVA 2VTRA 5JGBA 3PZHA 1T46A 4RIYB 4UBAA 3N51A 4X0MA 3UOKA 4E93A 3T9TA 3UPXA 3VS0A 3LFDA 1TFFA 2OF2A 3NSZA 4W9XA 5AM6A 5BVNA 3FV8A 4BCIA 4NM5A 5IMXA 3O8TA 3NVMB 1ZOGA 3HVCA 5B7VA 5JQ5A 1OGYA 1YI6A 3E64A 4E8AA 4U80A 3EKNA 5CY3A 5ETFA 2HW6A 4IVDA 3U6IA 3KK9A 3PVUA 3ERKA 3MVLA 1RW8A 3U8WA 3UVQA 3QKLA 5D9HA 5CF8A 3UVPA 4M0YA 4W4YA 3W8LA 3AG9A 3LMIA 3NUAA 1OM1A 2AUHA 1IA9A 2C3LA 3PIZA 2C5OA 1V0BA 3P78A 3HECA 3NX8A 4D1XA 4PP7A 1XH8A 3O71A 4GFMA 5TKDA 1Y91A 3FLWA 3BHHA 3AC8A 3PE2A 1ZAOA 2WTVA 3BBWA 3RHKA 2HZ4A 2J5FA 3F88A 1U54A 3I81A 3PA4A 4CV8A 3Q53A 4DT8A 4X21A 3FI2A 4LGDA 3HV4A 4BTFA 1YOJA 5C01A 4IW0A 3TIYA 2RF9A 3PXRA 4H1JA 5KMOA 1WCCA 3FKLA 3R00A 4II5A 4NM7A 5CEPA 4AT3A 4O7TA 4KBKA 3S0OA 1AD5A 2VWIA 4D1SA 1S9IA 3OCBA 4QTBA 5GINE 5FXSA 3MDYA 1PF8A 5IF1A 3JVRA 3D7TB 4FEXA 4O0VA 3R7YA 1F0QA 2XIXA 4LRKA 3EZRA 2GQSA 2BZIB 3VUGA 4AG8A 4IE9A 3KREA 4PDYA 2X8IA 3OY1A 3G9LX 2VTTA 3M11A 5F4NA 5ACBC 3LMHA 4G9CA 5BMSA 4ZMEA 1H1SA 1ZYJA 2R9SA 2R3JA 1HCKA 5LVPA 3R7EA 4QMTA 5HTIA 3CC6A 3UP7A 2Z7LA 3OS3A 4EOQA 4C8BA 2XNGA 2XF0A 3NFGB 2FVDA 3FY2A 4RRVA 4F6SA 3M2WA 3TNHA 3WI6A 2UZWE 2CNQA 5LXMA 2PUIA 5HGIA 4BB4A 3E8CA 2XIRA 5KZIA 1EH4A 2X8DA 2XRUA 3PJ2A 3PY1A 3E7OA 4KKHA 2RL5A 5KZ0A 4BI2A 4DAWA 3W8QA 4IB3A 4B8MA 4YO6A 3KULA 3OF0A 5IMEA 3UNZA 4GUEA 4L3PA 4TT7A 5HVKA 5M53A 5T3QA 2HELA 2EVAA 4CNHA 4DGLC 2XAMA 4O4CA 5AUWA 2QURA 1M2PA 3QLGA 2EXEA 2YEXA 4GRBA 3QX2A 1PW2A 2C0OA 2O65A 3LXKA 4L8MA 3LFCA 1Q24A 3GXLA 4MNFA 2HY81 4I0RA 3TTJA 2WMSA 4DE4A 3OUNB 1UWHA 4DFYA 4DHIB 3BGPA 5JSMA 1TQMA 2LAVA 4J95A 5BVOA 1FGIA 2X4ZA 4WNKA 2Y4IC 1OL5A 2IF8A 3LCDA 4G3GA 3OP5A 5BYLA 3FBVA 5FTOA 4EH7A 1IASA 3HP2A 1MQBA 4DYMA 3AMAA 4L43A 1Q4LA 2GS7A 3VQUA 1S9JA 2I0VA 2PMLX 2WNTA 3IGOA 5IUHA 5A4TA 2EXMA 3I6UA 4G3EA 4JVGA 4X3FB 2UZOA 5EM6A 3ZXZA 3NAXA 2GHLA 2OGVA 3C7QA 3EFWA 3C0GA 1PXNA 2BDFA 2IEWA 4EOMA 4G16A 4EH5A 3MTFA 3AMYA 5CTPA 4YSJA 3PDTA 2QOLA 3EHAA 3Q5IA 4BGHA 1KV2A 3A60A 3Q2MA 4BDHA 5ETCA 5HBJA 3AGMA 2XNEA 3QZFA 4XOZA 5FGKA 3R7UA 3L9NA 5GNKA 1U46A 4J99A 5DOSA 3MVHA 3BHYA 2X4FA 1H1RA 2BIKB 3OW4A 5E8VA 1CM8A 3MA3A 3PA5A 3PE1A 4R8QA 2JKKA 3GCSA 5D12A 5JRSA 4E4XA 5M06A 4EWQA 1G8KA 4MNEA 3AKKA 1MP8A 4XG7A 4YJVA 1J7LA 3BIZA 4QTAA 5E8XA 4NIFA 3GU5A 4C35A 3FMLA 3WYXA 3DBEA 1WAKA 2BAQA 3D83A 4PTGA 3MY5A 4EK6A 4QP1A 4M0ZA 4AN9A 2IW9A 2UZDA 2DQ7X 2VWUA 1W82A 4FF8A 4CZUA 2UZVA 4C3PA 4O0XA 2OFVA 5ACKA 4I3ZA 1Q3WA 2ACXA 3RBWA 4AOTA 3QRUA 3FEGA 1ZLTA 5EI8A 2UW7A 3HMPA 5L4QA 3AC1A 1YXTA 2A4LA 2UV2A 2R64A 5FLFA 3GCQA 4FA2A 3ZM4A 3PZEA 3EN4A 4USEA 3RM7A 3FI8A 3GNIB 2NRUA 3F9NA 4FG7A 4GG7A 4LRJA 4DEEA 4DLJA 5IH5A 3ZZEA 2C6OA 5HICA 4FEQA 3FZTA 4WA9A 3EB0A 3ZH8A 3BU5A 3FC2A 5HTCA 3BL7A 4UZHA 3DJ6A 2C6LA 3RTPA 1TZDA 5CZHA 5AV1A 1T45A 1OIRA 1YDTE 5AWMA 3VRYA 4RLKA 4GIHA 3BELA 3Q9XA 1ST0A 2QOFA 3UC3A 3DK6A 4XEYA 5JZNA 1OIQA 3PRFA 2KTYA 4JG7A 4RIYA 1X8BA 5C9CA 4FTRA 4BZNA 2J50A 5JK3A 4OAUC 3FPQA 4KAOA 3PY3A 1PKGA 4AW2A 4ANOA 3CIKA 4AF3A 3PJCA 5K3YA 1O6KA 2R3FA 2R3IA 3G0EA 3HLLA 5DFPA 4EOSA 3UDSA 3FAAA 5E1EA 3HV7A 4U81A 3NNXA 1UNHA 4EH4A 5IQIA 4FTMA 3UG1A 3R9RA 3HRBA 3HDMA 2QNJA 4V05A 3OG7A 3RPOA 2VTNA 3RMFA 2EWAA 1HOWA 4M3QA 3C0IA 5LCJA 3DJ5A 3I4BA 5AIRA 4RIWB 2VTPA 2Z7QA 5CNNA 5KBRA 2CN8A 3PLAE 3A7HA 1ZMUA 4O83A 4GYGA 5DBXA 2NP8A 3TWJA 2ONLC 4TYIA 4EC8A 4ZTSA 3RINA 3MVMA 4G3FA 2R3KA 3UIBA 3LFAA 5F94A 2WOTA 1DAYA 2WTDA 3PPZA 1OKYA 5KHWA 1UU9A 4QMMA 5TO8A 5L3AA 3LFBA 4FIEA 4XNEA 5CEKA 1PHKA 2Y4PA 5EYKA 5AR5A 3PWDA 5HIDA 4ANQA 3GQLA 1JWHA 2F4JA 5AJQA 5IEXA 2YAKA 3PJ8A 4BKZA 3NUUA 3ROYA 2W1CA 4EC9A 4BWPA 2B4SB 2OW3A 3POOA 5HU9A 2WFYA 5BNJA 3UDBA 3VUMA 3QTRA 4C61A 2C0TA 4AE6A 5J7BA 3WZJA 1BUHA 2ITNA 5FD2A 4AFEA 4ZY4A 4QDEA 3D7TA 2UW6A 4XBUA 2XK7A 4I6HA 3ORPA 1STCE 5AP6A 3S95A 2W5AA 2YCSA 3TUCA 2VNWA 4U6RA 2IZUA 3R9HA 2GNHA 4WBOA 3R8PA 3NW5A 3GB2A 2R7IA 3M1SA 4OBPA 3RPVA 1W0XC 4L53A 4IJPA 1XBBA 3NZ0A 3NCZA 4L01A 4PTEA 4UN0C 1J1BA 3Q04A 4HVIA 3MVJA 1CMKE 3QA8A 1UA2A 3ORNA 3VUKA 4EQMA 4D4SA 4F0FA 2PMOX 2WTKB 2XH5A 4O22A 4DEDA 4QTEA 1YI3A 4BGGA 5FDPA 3FZ1A 2QOOA 4XBRA 3FMMA 3UYTA 4USFA 2VNYA 3DS6A 2BDJA 3OWLA 2YIWA 4RZVA 5EG3A 3UPZA 3R22A 3QKKA 3TN8A 3H9RA 3VS5A 4DGOA 2I0EA 1GOLA 2IZTA 3C4WA 5EK7A 2X6EA 5G1XA 2R4BA 4L7FA 4EH9A 3FKNA 2PZPA 3QXOA 5H8BA 2AQXA 5IPJA 4UXLA 4FICA 4GCJA 4V01A 2NRYA