1BI7A

Mechanism of g1 cyclin dependent kinase inhibition from the structure of the cdk6-p16ink4a tumor suppressor complex
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
292
structure length
269
Chain Sequence
DQQYECVAEIGEGAYGKVFKARDLKNGGRFVALKRVRVQEHPNVVRLFDVCTVSRTDRETKLTLVFEHVDQDLTTYLDKVPEPGVPTETIKDMMFQLLRGLDFLHSHRVVHRDLKPQNILVTSSGQIKLADFGLARIYSFQMALTSVVVTLWYRAPEVLLQSSYATPVDLWSVGCIFAEMFRRKPLFRGSSDVDQLGKILDVIGLPGEEDWPRDVALPRQAFHSKSAQPIEKFVTDIDELGKDLLLKCLTFNPAKRISAYSALSHPYFQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CYCLIN-DEPENDENT KINASE 6
publication title Structural basis for inhibition of the cyclin-dependent kinase Cdk6 by the tumour suppressor p16INK4a.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Complex (kinase/anti-oncogene)
total genus 67
structure length 269
sequence length 292
ec nomenclature ec 2.7.11.22: Cyclin-dependent kinase.
pdb deposition date 1998-06-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 1bi7A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 1bi7A01
3DS6A 4O2PA 3GBZA 4CQEA 5IEYA 3JY0A 3HMOA 2JD5A 3R0TA 4G6OA 3CP9A 3IO7A 5TR6A 2V0DA 1YXSA 3SW7A 2RFNA 3IK3A 4X2FA 1KE6A 3OTUA 4EC9A 4DFBA 3TZ8A 4Z3VA 4HYSA 4OTPA 5HIDA 2CDZA 1H28A 2C6LA 4JQ8A 5EYCA 2IW9A 3WYYA 2ZM3A 5LVOA 3ZC5A 3ANQA 1PXLA 3CY3A 4X3FC 5CNOA 3DQXA 3C4XA 4JDHA 1HCKA 2WTJA 4MYGA 3LJ0A 4GSBA 4YPSA 2YJSA 5H8GA 5FDPA 4WNMA 3KB7A 4FL3A 2WMVA 4RVTA 4G5JA 4TZRA 5H2UA 2XJ0A 2F2UA 4AGWA 5IQHA 2WD1A 5C27A 3QD3A 3DKFA 4IJPA 3C13A 3IW8A 3IW4A 3GQLA 4IAYA 4TWPA 3GENA 4CZUA 2ITQA 2KULA 5F95A 4EHVA 3PIXA 4KWPA 1Q8UA 2YIWA 3VWAA 2EXMA 2PVLA 4FNYA 3KRRA 2VO0A 1V0BA 2XP2A 4FEQA 4QP9A 1MUOA 2UZTA 2R64A 4QMUA 2VTNA 4MWIA 3ROYA 4QMVA 2XRWA 4FG7A 4JIKA 4XOYA 4UXQA 3ZHPC 1K2PA 5HTBA 2UW6A 5BUIA 4JBQA 3G15A 2FUMA 1LPUA 3DBDA 5E7RA 3FC1X 4BBEA 4BR3A 3RCDA 3UG2A 3RALA 4EWQA 3L8VA 5AA9A 2BIKB 3QUDA 1A48A 4I6HA 3IQ7A 4K18A 4KABA 5FD2A 3ZU7A 3UYSA 2WQBA 4KKGA 1O6KA 3GC0A 4L6QA 4R7IA 2J0IA 3BLRA 4FKJA 2CNUA 4BCPA 4CFMA 3WF9A 2BZIB 4I6QA 4DG0E 5I9WA 4IANA 4IX5A 5JMSA 4IM0A 3LXLA 2ERKA 4FC0A 4ASXA 3FLYA 2P2HA 4JRVA 4BCHA 3MVMA 3LFFA 2QOOA 5KNJA 2XF0A 1YKRA 3A99A 3MH0A 4HGEA 5KKRC 4R7HA 4P2KA 4KIQA 3LM0A 4QYHA 5AAGA 2JDVA 3KULB 4FKUA 2OFVA 3PXFA 4L9IA 4CKIA 3I1AA 5CI6A 3OCSA 4RFZA 4PPCA 4FIHA 2VWXA 3TACA 5M08A 3L8XA 2XYNA 4OGRA 4XG2A 3F2AA 4YJPA 4G3EA 5IQCA 1ZZ2A 2BFXA 2GQGA 3AMBA 3V8WA 1OECA 4QQCA 1QPCA 3EL7A 4EOQA 3OUKA 2JBPA 3Q9WA 4QMMA 3DKGA 4PUZA 3FUPA 3LXKA 2UZVA 5J95A 4UXLA 4TYHA 4CFWA 4XUFA 3UNKA 3ORIA 4FIJA 4D9UA 1J91A 1PYXA 1R78A 4FYNA 4MWHA 1YW2A 2ETKA 2B0QA 4QYGA 4FKQA 3RPYA 4AOIA 4PMPA 3KQ7A 1R39A 2EVAA 4GH2A 3OP5A 4BKYA 5IQIA 2CHLA 3A7FA 2W1HA 3IW7A 4YLJA 4J1RA 2C5NA 3QQHA 5GIPE 3TNQB 4O0XA 4D0XA 3E62A 4ENYA 4BCQA 2BDWA 2R3HA 2B53A 1JPAA 4OBOA 4DGLC 3LLAA 3QKMA 2Y4PA 2WTWA 4S30A 4AU8A 1GZ8A 2YAKA 3ETAA 1H1PA 3AMAA 3QRTA 4LRJA 2J9MA 4M15A 4NU1A 1XH8A 4PX6A 5HG7A 4DTAA 3VQHA 5A4EA 5BVKA 1Y8YA 1R0PA 3LXPA 3UZRA 4O6EA 3CSVA 3UGCA 4FZ7A 3MB6A 3C4ZA 4PPBA 4IAZA 3OCGA 4GU6A 4IZYA 3BBWA 4DFZE 2RGPA 4TXCA 1VYZA 3FI3A 1PMEA 3UNJA 1H8FA 5CF8A 5LJJA 2AC3A 3FE3A 4EBVA 2VO6A 1URWA 1J7LA 4UEUA 4AZSA 2R3LA 2PZYA 3NDMA 5CZIA 3IKAA 3P7AA 4IH8A 3A62A 3CD3A 5GJFA 5LMBA 4TYIA 5KCVA 4RPVA 4PNKA 1A9UA 4FTNA 4IAFA 4RWKA 3UP7A 4HVIA 4NM3A 5I9XA 4O1OA 1WBWA 5DE2A 4BDAA 4TW9A 4WBOA 3TNPC 4PF4A 4CNHA 3R8PA 5LXMA 1WAKA 1YI3A 3PJCA 2JFLA 4IM3A 3UDBA 4FSNA 5ETCA 1WBSA 2VRXA 2IW6A 2UW4A 3E3BX 4IVAA 2BRMA 4OUCA 5DR2A 4ZSGA 3SV0A 3RWPA 2OZOA 2PZ5A 4LL5A 4UMQA 1RQQA 3NVKI 3WZEA 3L8PA 1WZYA 4U6RA 4EH5A 4IVCA 2OO8X 1G8SA 1OPJA 3D4QA 3FDNA 3OWJA 4GUEA 4BIEA 3PUPA 4LMUA 2GU8A 2PUUA 2PVYA 5CS6A 5A6OA 3TDVA 1OM1A 4R3CA 4H3BA 3A4PA 4RSSA 4CKRA 5CEMA 4ARKA 4C59A 2XM8A 2ZOQA 3H0YA 3FI2A 4QTBA 2QOFA 3VNTA 2RG6A 3ZM4A 1VYWA 4LGHA 3OWLA 2VTPA 3BV3A 2UZNA 5J87A 4O0SA 4B6LA 5JGAA 3NUSA 2PK9A 2OJJA 4NJDA 4BL1A 4LV8A 2H8HA 2WEIA 1GJOA 3QLFA 4FK3A 4U8ZA 4O21A 4H3PA 5C26A 4BTFA 4ZTQA 2WB8A 3UP2A 4EOPA 2CPKE 3FXWA 4A9RA 1B38A 4TYJA 3DKOA 3ORPA 4GIHA 2O5KA 4G6NA 4JAIA 2JAVA 1SYKA 3QLGA 4YZNA 4QYFA 3E7OA 5AJQA 1XJDA 2ZV2A 2PULA 5DT3A 2OIBA 4D2PA 3CCNA 3O71A 3HRCA 3BYVA 4IB0A 2QG5A 4G3CA 2PZRA 2PUPA 1BMKA 3COHA 4PDOA 2ZAZA 2XNEA 3ZO4A 4AOJA 4QP1A 1LUFA 3GUBA 5F20A 3W33A 3BGQA 4ZLOA 5JKGA 4B0GA 3MVLA 2JFMA 3QZFA 4YJNA 2J5FA 5L6WL 4U80A 4EOLA 1XKKA 4S31A 1H4LA 2VV9A 4A4XA 5AAEA 5M4UA 5GNKA 2X6EA 4IB3A 3VJNA 4Q9ZA 5CAPA 5C01A 3VULA 3E87A 2UZWE 2XUUA 4N57A 5JN2A 3SXRA 5A4LA 3A7JA 1XBAA 1L8TA 3TG1A 2C5YA 5AP5A 3HLLA 2X6DA 5DBXA 2B52A 3LCOA 3UNZA 3CXWA 5D11A 3N4TA 2VTSA 2R2PA 5I9VA 5CAVA 3U6HA 1DI9A 2X2KA 4G3FA 4FGBA 4BI1A 4L3LA 4H39A 3PA5A 3QZHA 5DMZA 3C1XA 5KMKA 1W84A 3BIZA 3D0EA 4XJ0A 2HZ4A 4M3QA 1YQJA 3QRKA 4I94A 2RFEA 3N4UA 4I5CA 2PVHA 5HU3A 4U9AA 5FGKA 2QCSA 3VC4A 5IISA 5JQ5A 2C69A 5DHJA 4GJ3A 3DA6A 2PE0A 2F4JA 3LQ5A 5CI7A 5E8SA 3ZFYA 2OIQA 5L2SA 2YIQA 3DJ7A 5TF9A 3GEQA 2IVTA 2BHEA 3M42A 3U55A 1BL6A 4M7IA 5HG8A 4D2WA 4BHNA 4LL0A 1P2AA 1E1VA 2C3LA 4BDHA 5BVNA 4HYUA 2ERZE 4E93A 5HE2A 1Q3DA 1ZYSA 4MF1A 2OIDA 1MRUA 3W1FA 3Q4UA 1UU3A 2A19B 3WF6A 4K11A 4IWQA 5TOZA 1PJKA 3B8QA 5HLNA 3PSBA 2NPQA 3PFQA 4F63A 4KA3A 2HENA 4NM0A 5HTCA 1ZZLA 3RK9A 3ZXZA 3OHTA 5A46A 4O82A 4N6ZA 3RM7A 4YURA 4B8MA 2QURA 4FT9A 3PY3A 4R7BA 4Y73A 3D5WA 5TO8A 5IMEA 4X0MA 4PTEA 3HP2A 5KE0A 3BWFA 5ETFA 4CLIA 5CF5A 4CKJA 5AR4A 4KD1A 4PRJA 1FBNA 4F7SA 3S00A 2X9FA 5EDPA 2ZV8A 4I0SA 2C3JA 4IE9A 4NT4A 4YSJA 2OLCA 4H1MA 4I1ZA 1JWHA 4CRSA 3JR1A 4XEYA 3DAKA 3W16A 3PY1A 5DOSA 4M66A 4UYNA 2OZAA 4L7FA 3TIYA 1Z5MA 2VUWA 3GU7A 3WE8A 3ZEWA 2C68A 4YZBA 3W2CA 5IDNA 4FZ6A 3ATSA 5AP0A 4PL4A 1Q61A 2UZUE 2Y0AA 5EYMA 4Z16A 4L44A 5IQAA 3VAPA 2J4ZA 4X7QA 3R9HA 3DBCA 4LV5A 3GCUA 3ZM9A 3LMIA 2V22A 4U44A 4NW6A 4Q5HA 4L52A 2P55A 3UC4A 1DAWA 3OG7A 3IECA 2JDSA 4FNWA 4NIFA 4CD0A 4E6DA 1ZOGA 1KUTA 4RMZA 1ZMVA 5L2WA 4FOCA 4QTDA 4ASDA 5C8NA 3DNEA 4QP7A 4ZTSA 3HA6A 3NX8A 5F9EA 4IC7A 4YLLA 4DH7A 5E90A 3R9RA 4F7LA 4ALVA 3FKLA 2BILB 1BI8A 3GCPA 1KE9A 3MH1A 5CWZA 2PPQA 2XEZA 4Y46A 3KMUA 4ZS0A 4DEIA 2Z7LA 4FTMA 4D4SA 4C3RA 3ZH8A 2WMBA 2OJGA 3VBYA 3LFNA 4MXXA 3FSFA 2HXLA 1JSVA 4FTAA 3NRMA 4O38A 3AD5A 4FIGA 2GNIA 4L53A 1JBPE 1PXJA 3C4FA 4QP2A 4YPDA 3CKWA 3FZTA 4FSTA 3ZSGA 3VS7A 3H9OA 3R7IA 3MBLA 4YJVA 4O0TA 2WHBA 2PMNX 5M44A 3PZEA 3QUEA 4E6CA 1PMVA 3PPJA 3ZZWA 3TUBA 4ORKA 1DI8A 4WD5A 4FTJA 3JPVA 1O9UA 4FZDB 3EZVA 4MAOA 5AUTA 4BB4A 3LKMA 3A7IA 4MF0A 3SQQA 2XYUA 5M06A 4LOPA 4S33A 2W9ZB 3UQCA 4DFXE 1PXPA 4EEVA 5I0BA 1SVEA 4P4CA 4O1PA 3JYAA 2GHLA 2OK1A 3R1YA 3R28A 2JKOA 3MJ1A 3PVBA 4TT7A 5AM7A 1YOLA 2YCRA 2WTDA 2YDKA 4RFYA 1I09A 3Q4TA 3F69A 2YM7A 3HAVA 4L7SA 2WKMA 2XIYA 1ATPE 3MDYA 2E9OA 3U54A 1CSNA 1UU8A 2GMXA 1OUKA 3VW8A 3VUTA 2XKCA 4EOJA 4F1OA 3VS4A 5JZNA 5J9ZA 3C50A 3VS0A 3ZONA 5FLFA 5HVKA 1KOAA 2WQNA 1BX6A 4QPSA 2E2BA 5HX8A 3VJOA 2C6KA 2UV2A 5AAFA 1DS5A 1SMHA 3R7GA 4RQVA 4BY9E 3BX5A 1FPUA 3W2RA 4DFLA 3UQFA 3VUHA 3EFWA 4A9TA 3TNHA 4EOSA 4B8LA 2H9VA 3NIZA 4I6BA 3PP1A 4USDA 4CV9A 5ANDA 4AA5A 5HD4A 4ITIA 4YNEA 1NVSA 2YDJA 3WF5A 3QFVA 4JS8A 3IOPA 5IQDA 3DB8A 4RIYB 1APME 3ODYX 4RIYA 3TNIA 2VU3A 3ATTA 4I93A 4DH1A 2BDJA 1W98A 1XQZA 4ANLA 2R0IA 4WG3A 3V5TA 4AE9A 2IG7A 2R3GA 3KXNA 3QQGA 3O8TA 3LMGA 4TL0A 2XKFA 2IVVA 3KRWA 3EZRA 5CSXA 2O64A 5J5TA 3NW5A 3PSCA 2G2IA 1GIIA 5B0XA 4MNEA 4NFNA 2C6EA 4CXAA 3BGPA 3R7VA 2HWOA 4W8DA 4QTAA 3I0OA 3ITZA 4D55A 4QO9A 2OI4X 4A7CA 4V04A 4RA4A 3T9TA 4HCUA 2UVXA 3V51A 2HY0A 5A4TA 5EQEA 1Z57A 3KA0A 3Q5IA 2I0HA 2ZB0A 5DNRA 4YC6A 2QOHA 1FOTA 2ZDUA 3JUHA 4AT5A 3F88A 4FMQA 5IZFA 3GOKA 4XLVA 3TL8A 4BCIA 1WCCA 4DINA 3ZUUA 5KZIA 4AW0A 2G2HA 5CX9A 5J1WA 3FV8A 3HUBA 4EH2A 5HX6A 4U45A 2XNPA 2YERA 5JRSA 3TM0A 2CSNA 2YM8A 4RC3A 3FI4A 4GVJA 2ITWA 4J53A 4FZAB 3ZEPA 2OH0E 4HJOA 2ITVA 1YXXA 3K5UA 4YJRA 4OBPA 1K3AA 3MFSA 4D9TA 4XX9A 5J7HA 2R3OA 3UMXA 2XIRA 4XLIA 3F82A 2HYYA 3I4BA 3OT8A 4E26A 2XIZA 2OGVA 3OXTA 4EONA 1IAHA 3V5LA 4YC8A 4IWDA 1R0EA 1F3MC 2JIIA 1M7QA 2GCDA 5AMNA 3V8TA 2CCHA 4DYMA 4RBLA 1REJA 2PHKA 3JY9A 1GIJA 3U6IA 5AFVA 2ONLC 3NR9A 3LQ3A 5CSWA 3OXIA 5E4HA 1MP8A 2YHVA 2C30A 5G6VA 2Q0NA 2B9FA 4DH3A 5BNJA 2NNWB 3PYYA 3TJDA 3MPMA 1PMNA 3NUYA 4BCKA 3S3IA 5GJGA 4BTMA 1ZAOA 2B9JA 3Q2MA 3D14A 4O6LA 5HZNA 4WHZA 4BHZA 4HVGA 5BYZA 5EDRA 4I3ZA 3ENMA 5IKWA 1DM2A 1M52A 1XWSA 3FLNC 3VBTA 5CAOA 2VWBA 4RZWA 4WBBB 3AQVA 3W8LA 4CGAA 1WBPA 3DV3A 3WARA 2VGPA 2W1FA 2AC5A 4APCA 1AD5A 5EW8A 5JFSA 2BRGA 4FV7A 2CJMA 1JKSA 3G6GA 3C4CA 5C9CA 4I24A 4E1ZA 3NYNA 1MQBA 4OTRA 1OKYA 1CM8A 4F9BA 5DA3A 2Y8OA 2PL0A 3UODA 4D5KA 3DGKA 1BI7A 5KMNA 4TNDA 5ANIA 2NP8A 3V3VA 4AW2A 4FV1A 2W0JA 4BFMA 3AOXA 2QONA 2OWBA 1XH7A 3ZBFA 5GINE 4IX6A 3QTXA 2WTIA 4LG4A 3PIZA 3R8LA 3ROCA 2IWIA 2W9FB 5I5ZA 5JEBA 1EH4A 1WMKA 4EJNA 3QD0A 5EYKA 3S95A 3KRJA 3QU0A 3PXKA 3EWHA 3JVSA 2PVNA 3CY2A 3ORZA 4JI9A 4BI0A 2YWVA 3LHJA 4MEDA 3IDCA 2B54A 5IG1A 3ZDUA 2NRUA 5EM5A 3AC1A 4F09A 3N4VA 1H1SA 3L9PA 5EFQA 3NAXA 3QCSA 1YHWA 4FTCA 4KUJA 3MVJA 3FLSA 2GTNA 1ZYCA 5C1QB 3DU8A 2BPMA 4WA9A 1WBTA 3NW6A 4EH7A 3QTSA 4O0YA 3G9LX 3RNYA 4QMSA 1Y8GA 4FSYA 1IRKA 1OIYA 2UVZA 4CV8A 4MNFA 4A4LA 5IEXA 4GT4A 3BRBA 4W9XA 1BKXA 5AP7A 1E9HA 3EJ1A 4JT3A 5HCZA 2ETRA 3SKCA 4O84A 1U59A 4AAAA 5JH6A 2CGVA 2V7OA 2ZVAA 4ANMA 2BKKA 4L42A 5CT7A 3ZLWA 4C33A 1R1WA 3A7GA 3EOCA 3EYHA 1TQIA 3DLZA 2GS7A 3QWKA 4R1VA 5CSVA 5CENA 4JL9A 2X0GA 4WUAA 3VS3A 5JRQA 1W83A 4AFJA 4E4LA 4KKEA 4NW5A 4PV0A 4TYEA 4KIPA 3EFJA 5EG3A 5JSMA 3NLBA 3FPQA 4I5PA 3IS5A 3FY0A 4H36A 1H25A 1MQ4A 3CEKA 1OMWA 4XV9A 2F57A 4YSMA 3KRLA 4K77A 4EHZA 4J95A 4USFA 4PMSA 4FEXA 3SW4A 5BX0A 5CEPA 2R3IA 1PRYA 5HQ0A 3ZXTA 4G3GA 1Y57A 3AC2A 3QX4A 2GQRA 2FSTX 2YABA 1L3RE 3NCGA 4XP2A 2BTRA 4NUSA 4MBLA 5KMLA 3FC2A 5CYIA 3RINA 2JKKA 1OL1A 2UZLA 2HZ0A 4NZWB 4DGGA 3MVHA 5HOAA 3P0MA 3BU5A 4RX5A 3ID6C 5TT7A 3ZO3A 4F64A 5FM3A 4YR8A 2X7OA 4IWOA 4ZTMA 4QTCA 3LMHA 2QHNA 1PKDA 2VWZA 3II5A 4E20A 4ZMEA 4E8AA 1KOBA 3R22A 2XCHA 2X2MA 4HGTA 4IX3A 3SG9A 3MGYA 4XV3A 3TV6A 3MY0A 4NTSA 3COMA 2PY3A 4RVKA 5AUWA 1ZOHA 4PL5A 4NCTC 5I9UA 4FTQA 2O3PA 4FIFA 2XH5A 3QXOA 4JJRA 5CZHA 4ZOGA 4E4NA 3MH2A 2QD9A 2VGOA 4Y8DA 4K33A 4C4GA 2J2IB 4DT8A 4OAUC 5L2TA 3EN4A 4IMYA 2YWPA 4GT3A 3TTIA 2REIA 5CEOA 4QP3A 3VUIA 4K9YA 3ORTA 4TYGA 3SXSA 3RBWA 2X1NA 4HYIA 5AP6A 4DLJA 4ACCA 3MH3A 4F6UA 4QMZA 3KXMA 2W5AA 4CTCA 2QOLA 3UO6A 4BDGA 1IG1A 5EM8A 1UKHA 2CLXA 5CQWA 2UZEA 5ANJA 1IA9A 2YLFA 4XG7A 1S9IA 1VZOA 5EHOA 2J0LA 4NM5A 4DITA 3QTZA 5F4NA 3R2YA 4F7JA 4CZYB 3MPTA 5G1XA 2A2AA 3BHHA 4ZLYA 2G1TA 3DXQA 2WOUA 2F7XE 2ITYA 2VZ6A 5A14A 5E8VA 3QHRA 2GHGA 4AN9A 4YNOA 3K2LA 1QPDA 3UC3A 4BICA 4TKSA 5DLSA 2V5QA 5EK7A 4BDIA 1YDSE 4R1YA 4GW8A 4F0IA 3QTQA 4QMOA 5FUTA 5HE0A 3Q53A 4AFEA 1GOLA 4GIIA 2J90A 4RGJA 1STCE 2C5VA 4FICA 3SHEA 4BVUA 3KK9A 4P7EA 5L8JA 2WTKB 3BBTB 2XK7A 2WU6A 4RLLA 2EXCX 5FEQA 1CMKE 5C4LA 1YWNA 2ZM1A 3PXZA 2H6DA 4ENXA 3GI3A 5T3QA 5FTQA 5KBQA 2XNBA 3GCVA 3F66A 3O2MA 1NVRA 5C8KA 2WPAA 1GZOA 5B7VA 3TUCA 3ALNA 3CIKA 4L01A 3C0GA 1HOWA 2I0EA 4BGGA 2ITTA 1ZMUA 2WMXA 5HIBA 3UO5A 4I5MA 5JT2A 3EQFA 3CQUA 4RIXB 1U5QA 3BYOA 4RIXA 5CANA 3ELJA 2C1BA 3VUMA 4I20A 4IFCA 2QU6A 5IF1A 4KRCA 1KV2A 4QMQA 5HO6A 3RNIA 3C5IA 3LZBA 2VX3A 4QP6A 5D7VA 4F1MA 4W4YA 1HCLA 3P08A 3BHYA 1WVWA 4Q9SA 4X2JA 2VNWA 5IA5A 2OXDA 3R83A 3HMMA 1OZ1A 4JDIA 2JGZA 4TYHB 5J1VA 4G3DA 4XG4A 1PKGA 1KE7A 4O7WA 5EKNA 2V62A 2W1EA 2GTMA 3O17A 5JZJA 5M4CA 4JVGA 4PMMA 4U81A 3VBQA 3VN9A 4CMOA 3KF4A 4EKKA 5IA2A 1JVPP 2XVDA 3CGOA 3TEIA 4CYJA 5KBRA 4CFNA 4FT7A 3D7TA 5EKOA 4YTCA 3OCTA 4N0SA 3RVGA 1Q8YA 4BYJA 4PTGA 1AQ1A 2VD5A 2VN9A 1JKLA 1Y6BA 3GP0A 3GT8A 4IAIA 3NIEA 2J51A 2PVJA 4FTLA 4MQ1A 2J0JA 3V5PA 3U9NA 5D41A 5GZ9A 4KAOA 4S2ZA 4EK3A 3EH9A 5J9YA 2C1AA 4O7SA 4XV1A 4XBRA 3AT2A 3SX9A 4APPA 3W8QA 1G8AA 3AXWA 2H34A 3LCSA 4L3PA 3W32A 4IEBA 5HIEA 5KMIA 2AYPA 2GNHA 4OT5A 3D7ZA 4WSQA 5HNBA 3W2QA 3LCDA 4QYYA 4F9AA 5M07A 3VUKA 4A06A 2H96A 3KMMA 3LW0A 4C35A 4EYMA 5FP6A 3TKIA 3QXPA 3V6SA 3W18A 3TKHA 2C6TA 3IDPA 5IU2A 5DH3A 3R8MA 2R3QA 2XS0A 3QCQA 4FTOA 2ZV9A 3F3WA 4FNXA 4FTTA 4AT4A 4YUQA 3F3TA 2FYSA 2WQEA 3DJ5A 4JRNA 3Q96A 1OIQA 2YAAA 2BAJA 3BI6A 4FKRA 2ITOA 4U79A 3AD6A 4MX9A 4V01A 3WF7A 5AR5A 2EB2A 3EQCA 3A60A 5EYDA 3QTUA 2JDTA 3I79A 5AX9A 4BKZA 1RDQE 3GCQA 2BFYA 2QI8A 4FKGA 3UG1A 3MFUA 4M68A 1CKIA 5DPVA 4QD6A 5HG9A 4AZVA 4FA2A 3W2OA 1OIUA 5LWNA 4IFGA 5FBNC 4Y83A 3TT0A 3KKVA 2PMOX 5E8ZA 4Z7HA 4ZXTA 4ANQA 4F9WA 4QQTA 2CCIA 3B2TA 1JLUE 3BHVA 5L6PA 3FHRA 1ZY5A 3BPRA 4AZWA 4ACGA 5ANKA 2RFDA 3OW3A 4OBQA 2WELA 5M09A 3CQEA 4GKHA 3F61A 3PIYA 2ITXA 4PNIA 1P14A 5ACKA 1O6LA 3DJ6A 4KBKA 3ALOA 3TV7A 5E8YA 2W4KA 3UIXA 3HGKA 1IR3A 4U42A 2W06A 2C5OA 4FL2A 4KBCA 4ZSJA 3WF8A 2ZB1A 4K6ZA 3L8SA 2C6MA 2B7AA 3WIKA 4BDFA 3MIAA 5DYJA 2VWYA 3AC5A 2B4SB 5L3AA 3RGFA 4QQ5A 5DWRA 5CF6A 4U7ZA 5EQPA 4HVSA 4NL0A 2W4OA 4ZTHA 2HCKA 4EHEA 4O91A 3DT1A 3M11A 3ZMMA 2HAKA 5T6KA 4JG6A 1NXKA 1MRYA 1H0WA 4FSQA 1XO2B 4ZEGA 4EOIA 4GCJA 4AE6A 4BDBA 4BDCA 3PWDA 3S2PA 4J98A 3K3IA 5HBEA 4F6SA 4CVAA 4IW0A 4MXCA 4D1XA 2IZSA 3K54A 3PJ8A 4HZRA 3RMFA 3EQPA 1NT2A 5HLPA 3UOJA 1T45A 3H9RA 4IZAA 4F65A 1KE5A 3ZRMA 1G3NA 2RKUA 2XK3A 4W4WA 2UW5A 4UZHA 5E1SA 4IB1A 4ZY5A 5EQYA 4MBIA 4FF8A 4AP7A 3NGAA 2YM5A 5FTOA 3TZ9A 3P4KA 5BUEA 4RJ7A 4L00A 5LMKC 4GMYA 4BYIA 4C4HA 4NTTA 1PXIA 4XH6A 5DN3A 5JFXA 2CGUA 3OBGA 4OTDA 4AACA 4RIWB 4RIWA 3GC7A 3VBWA 3LIJA 4DCEA 1YOJA 3D5VA 2RF9A 4O96A 3UOHA 5ETAA 3NMUF 3HV5A 5FRIA 3LFBA 4FOBA 5CVGA 5AV1A 1YDRE 2G9XA 1OBGA 5FXSA 5E9EA 4MTAA 3TDWA 2HWPA 4H3QA 4WSYA 4GFMA 2VX0A 4QRCA 5AV2A 4DAWA 5EI2A 3QQFA 4KIKA 4C4EA 2VTQA 4OLIA 3K3JA 4GK4A 3BZ3A 1OITA 5IH5A 5A6NA 2ITUA 1MRVA 5K0KA 2PSQA 3U51A 4HPUE 4ZP5A 2RSVA 4HCTA 4F4PA 4QTEA 4EQUA 4GK2A 3WBLA 5FBOA 2QO7A 3R6XA 4XP3A 4C61A 1CKJA 2OJ9A 2GNLA 5CSHA 1YDTE 3BGZA 1Q4LA 4RT7A 5HCXA 2JITA 2FSOX 1BL7A 3HMNA 4EK5A 3BEAA 3LXNA 3QYWA 4X6RA 5D12A 3EYGA 2YDIA 3QC9A 4OTQA 2QOQA 3FWQA 4RFMA 4AZTA 3FMNA 4C2VA 2EU9A 3TWJA 5LVPA 5AV0A 4MBJA 4MXYA 5HHWA 4D58A 3V5JA 1P5EA 3R21A 5AUVA 4GV1A 5L2QA 5LARA 2Z7SA 3AC8A 5AP3A 2C3KA 5K9IA 2OF2A 4MXZA 3KC3A 4GT5A 4A07A 4FEVA 4FEUA 3VVHA 3R2BA 4FKSA 4FV2A 2BMCA 1UWHA 2Y4IB 4BZOA 4KKHA 3NS9A 4IVBA 1FVTA 3G51A 4HNFA 4KBAA 2QC6A 5CU6A 1UNHA 5TE0A 3SD0A 4ZMFA 3QCXA 1H00A 3MTFA 2IVUA 5K5NA 3VS1A 4UBAA 3R1NA 4UY9A 4C62A 4YJOA 1JKTA 3ZS5A 3RAKA 3QKLA 4PMTA 3MS9A 4XRJA 4C0TA 4FGRA 1XH9A 4LM5A 1RJBA 2QOBA 2QOCA 1JQHA 3F9NA 2EXEA 4FKVA 1GZNA 4HGLA 3F2NA 4UB7A 3CTJA 5HO7A 2Z7QA 4CT1A 3NPCA 4YJQA 2VNYA 3P5KA 3R04A 2OU7A 4FUYA 3FL4A 5DEYA 3H4JA 4M84A 2WIHA 4O7LA 4BCMA 1XBBA 1RE8A 3ORXA 2WXVA 4R6VA 4D2TA 3R8ZA 3UPXA 3PY0A 2QLUA 4O7RA 4M69A 2WQOA 4FVPA 3RJCA 3CE3A 1H01A 4XG8A 1H1RA 1XH4A 4I0TA 2HOGA 2OZAB 4NEUA 4NH1A 2PWLA 4C58A 3CKXA 5B2KA 3E93A 4AGCA 5IQFA 4YTHA 3PRFA 2FA2A 4C7TA 5AR2A 4ZSAA 3CLYA 5BYYA 3UVQA 3UZTA 4FNZA 5CLPA 3QZGA 2PVMA 5D1JA 3QQKA 4DH5A 2QOKA 5CEQA 4E6QA 4DEBA 3Q4CA 4I5HA 3REPA 2WMTA 4NIFB 3OWPA 4U41A 5K5XA 5IH4A 1M2QA 2R3NA 3OBJA 4Z7GA 2ZMCA 3C0IA 4PDPA 2R3MA 5KHWA 4G2FA 4J8MA 2C5XA 5EHLA 3A4OX 5LCKA 5HBHA 4HVHA 5IH6A 2I7QA 3NNXA 3OVVA 1UA2A 5FEEA 3LFQA 4FTIA 3T3VA 5JK3A 4FODA 3QTIA 2BHHA 4YO6A 3GXLA 3PPKA 3LFSA 4O0VA 3BQCA 4YJUA 3GGFA 3PG1A 3FZPA 3H3CA 3E8CA 4BDKA 5J7BA 3KXHA 4FTUA 1YXTA 3HX4A 4YTIA 1Q24A 2J6MA 3KXZA 4RJ5A 3G90X 5AA8A 5IA4A 4H05A 1UKIA 4FSRA 1OKZA 4LQMA 5CNNA 5HE3A 3PRIA 1Q5KA 1UVRA 4IQ6A 3LQ8A 3RPVA 4WRGA 3OT3A 4RX7A 3DDPA 2R3KA 2ZYBA 3TZ7A 1PXKA 3EB0A 4J52A 4XG6A 4D5HA 4AUAA 2VWUA 3FPMA 4M14A 1Q97A 3LOKA 3MIYA 3HP5A 1T46A 5I4NA 4WRSA 4DCAA 4CCBA 4TWOA 4TN6A 4EQCA 4BF2A 1UU7A 1QCFA 2X2LA 3Q9YA 1RW8A 3OTVA 3L9NA 4FSZA 3RK5A 4EOOA 5D10A 5IMXA 5DT0A 4YZCA 4XP0A 2QKRA 1PF8A 4RC2A 1LEZA 3NNVA 4EH8A 1QMZA 4HVDA 4V05A 1ND4A 1QPJA 3PPZA 4FG8A 4R77A 4EH9A 1FMOE 4UYAA 1UNGA 3QHWA 4YJSA 4ZK5A 4UX9A 3HMIA 5FWKK 3VHEA 3QBNA 2IZUA 4X3FA 4YC3A 4E4XA 2YJRA 2X7GA 4JBPA 4AA0A 4QPMA 3OC1A 3QWJA 1H07A 4IM2A 3NYOA 3DZQA 5J8IA 1Y91A 2JAMA 3R00A 1FQ1B 2F7EE 3NZ0A 2V55A 3Q32A 3QZIA 4G9CA 4EBWA 2ACXA 5ITAA 3POOA 4ITHA 3Q3BA 3TKUA 5BPYA 5BVFA 4CZTA 4LI5A 4YZ9A 4JQ7A 4X6QC 2CNVA 1JSUA 3KVXA 1GY3A 4A9SA 3FYKX 3HV4A 2C6DA 3ZYAA 1VEBA 3FEGA 2A27A 4Q2AA 4PPAA 2WMUA 4IVDA 4QP8A 4D0WA 5K4JA 3G9NA 3ZDIA 3FLWA 2GHMA 2HELA 5LWMA 1K9AA 1J1CA 2BIYA 3PXQA 5AP2A 3VRYA 2XZSA 3FMJA 3HA8A 3F5XA 4O7ZA 4QMPA 2X8DA 3OD6X 4J8NA 4EI4A 3S1HA 2WNTA 2WTVA 4NFMA 1H0VA 5HE1A 3E7VA 3HKOA 3LPBA 4I4FA 2GS6A 1YRPA 3EN6A 2GNJA 2WMRA 3F5GA 3NEWA 4FX3A 4JLCA 4MNEB 3I7CA 1OI9A 1H1WA 4A4OA 3MYGA 1BYGA 2HXQA 3M2WA 3HYHA 3PXRA 4IBMA 5HICA 4ACHA 3VRZA 1Q3WA 4E3CA 4RZVA 3MWUA 4QMXA 3QQUA 5FXQA 1JAMA 3ORLA 3UZPA 4CMUA 4O83A 5HESA 4HYHA 4QP4A 4ZJJA 3CPBA 3UYTA 3BV2A 3CR0A 2X39A 3Q04A 1SM2A 3BHTA 1YI6A 2W5HA 2IJMA 1G5SA 3V6RA 4LRMA 5DT4A 2HY81 3PSDA 3HL7A 3BHUA 4FSWA 1YWRA 3SVVA 3D2KA 2EB3A 3N51A 4WNKA 4G9RA 3PLSA 5AWMA 2BAKA 4JQEA 4ASEA 1UWJA 2Q0BA 3KXXA 5ANGA 4UWYA 4ZLZA 4RIOA 3ULIA 3GFWA 3KN5A 4ONAA 3HDMA 4EOMA 5CU2A 4ZTLA 4ZY4A 4ANNA 4RG0A 2E9UA 2I0YA 5AP1A 4CFUA 3CPCA 4DEEA 4WT6A 1NA7A 5HI2A 2G2FA 5AUUA 1J7UA 5FM2A 2DWBA 2XJ2A 3MB7A 2F49A 4W4XA 5FEDA 4LYNA 1OKWA 3EN5A 3R7OA 3A8XA 5FXRA 2OH4A 4EOKA 1OPLA 4O7YA 3Q5ZA 4XG9A 1M2PA 4PY1A 3R8VA 2Y7JA 4DN5A 3NUAA 4U3ZA 4ZZMA 5AR8A 2WTCA 3UMWA 3PJ1A 4JBOA 3O96A 4FI1A 3C0HA 2WMSA 3F2RA 2NRYA 5A4QA 4DFUA 2JDRA 2JIUA 5LVNA 5CU4A 4GL9A 2WU7A 3UIUA 3RM6A 5M51A 4EQMA 3FMHA 1ZY4A 2IO6A 1OKVA 1OL6A 1TVOA 2SRCA 4XHKB 2A1AB 3SRVB 3SRVA 3VBXA 3GCSA 1ERKA 4FKWA 1ZMWA 3MESA 4KRDA 5CU0A 4ZY6A 4TPTA 4BKJA 2FO0A 5AM6A 5EM6A 2VTJA 1PXMA 5FTGA 2PMIA 3JVRA 5EHYA 4FUXA 2WMAA 4M12A 1NVQA 3TJCA 5I9YA 2R3RA 4A9YA 4I41A 4HPTE 3VHKA 1Q41A 5E91A 5HGIA 4AG8A 2YZLA 3LM5A 4BIDA 1X8BA 3LAUA 4L46A 2FB8A 2XJ1A 4J71A 4DT9A 2GNFA 4Z9LA 3FXXA 3O7LB 2GSFA 4UMRA 2X8IA 2QQ7A 3IDBA 3MPAA 4K8AA 1XH6A 2VTAA 3H10A 3POZA 3QA8A 4LRKA 2Y4IC 4PQNA 4C34A 4EUUA 2IPXA 3ODZX 1OUYA 1XR1A 2GFCA 3KREA 3R8UA 2LGCA 4XCUA 5HCYA 2J0KA 4U97A 4GFGA 5H8BA 3CS9A 1LP4A 4F70A 3VIDA 4KS7A 4O0UA 4RJ4A 3LFDA 4DFNA 4RLKA 2R9SA 4ERKA 4FT3A 4LGDA 4CFXA 3I6WA 3C4WA 5AIKA 1YWVA 4QNYA 5AX3A 4BI2A 4G6LA 3UIMA 2CGWA 4XRLA 2OFUA 5EH0A 4C4JA 2QO2A 3SDJA 2FGIA 2O65A 4MH7A 3O50A 3DAEA 4AW5A 5I3RA 3KF7A 4F6WA 2PYWA 5AR3A 4MD7E 4JIAA 3H30A 2OXXA 4G5PA 4DG2E 5KO1A 1ZYJA 3U4WA 4O81A 3U4UA 3D5UA 4J99A 3HNGA 1VJYA 3BQRA 5E1EA 3R63A 1YHSA 5IPJA 2OKRA 5AV3A 3Q9ZA 4R3PA 3GU8A 2O63A 1H27A 3NCZA 2I0VA 4JOAA 4QYEA 4WOVA 3DK3A 3GOPA 3KL8A 4FTRA 4QMNA 3BLHA 3QUPA 4AN2A 2C4GA 3BWJA 1YXVA 2OJIA 5JFVA 5J9LA 3U6JA 3QRUA 3V01A 3SGCA 4KS8A 5CU3A 4ANBA 1GIHA 3QAME 4JDKA 5CTPA 3COKA 4KINA 4W4VA 2W96B 2PE2A 4IAKA 1YXUA 3Q52A 2HZNA 2UW8A 3NYXA 3UE4A 2C6IA 2BR1A 3FY2A 3BE2A 5CASA 2VTRA 3Q4ZA 5F94A 5DEWA 2IN6A 4OTWA 5D7AA 5DI1A 2WEVA 4AGDA 3E8DA 4BCGA 3QQJA 4LFIA 4E4MA 2XEYA 2YITA 3FMEA 5L8KA 3P7CA 2PE1A 3ZCLA 2ZV7A 2BZJA 3DKCA 4FVQA 4UMTA 2Q83A 1Q62A 4EORA 4NSTA 4FVRA 4D28A 4OT6A 4EK6A 4K0YA 1ZYDA 3AC4A 4D1ZA 3BU6A 2ZJWA 1W82A 4LUEA 4N70A 4RJ6A 4H58A 4DEAA 4ZJVA 5LMKA 3ZLXA 2R7IA 5GIOE 5BVOA 4LGGA 4P5QA 2OW3A 2PVRA 4GG5A 4FTKA 4U43A 2E9NA 3WIGA 3RP9A 3FQSA 2FH9A 4F99A 4EYJA 4E5WA 1TQMA 3TNWA 3DDQA 3GVUA 3VQUA 3TI1A 4L45A 4AT3A 4D2SA 3WYXA 4EH4A 3KVWA 2JBOA 4BCOA 3B8RA 5DGZA 4UMPA 4HOKA 3WILA 3DLSA 4IZ7A 4U5JA 3ZSIA 4X2KA 3QD2B 2X4FA 4L68A 4M0YA 3ORMA 4KB8A 4WO5A 3TUDA 2OICA 5CALA 3R7YA 5HG5A 3FZ1A 3CTQA 3IW6A 3O23A 3QTRA 4O7NA 4NJ3A 3NNWA 4D2VA 1LEWA 4R5YA 1BUHA 3MSSA 2IW8A 5T68A 5H8EA 2RIOA 3RHXA 5CVFA 3M1SA 3T8OA 4RVLA 3UQGA 5A3XA 4EC8A 1FINA 3W10A 4MXAA 4NM7A 3RWQA 3HRBA 5FG8A 3VW6A 4DEGA 5A54A 3KN6A 5AUYA 2VTOA 2Y6MA 3FKNA 3F5PA 3G2FA 2YLEA 3HEGA 5DVRA 3R9DA 3PA4A 3ZLSA 4BGHA 2JIVA 3BLQA 1CDKA 4F08A 3IW5A 5KHXA 5HVJA 2QODA 2IZRA 3GU4A 3GQIA 5EOBA 4Z55A 2VO7A 3D9VA 2EUFB 4OTIA 3FBVA 3R73A 3QQLA 4MQ2A 4Y72A 3RAIA 3W2PA 5M53A 4FKLA 3TZMA 4RWJA 3S0OA 3ENHA 2XNNA 4I92A 3BU3A 3K5VA 1B39A 4CEGA 1TQPA 4GKIA 2A4LA 2EWAA 3TXOA 4L3JA 4L8MA 4DGMA 3QC4A 4JR7A 3ZO1A 4FEWA 4C36A 5LOHA 4EK4A 4BWPA 3V04A 3EQBA 4RRVA 3DPKA 3D2IA 3MN3A 4IC8A 4JG7A 3KULA 3RPOA 1PMUA 2GPHA 5BMMA 5HBJA 1WVYA 5IQGA 5HNIX 4EZ5A 4FKPA 5CF4A 2PMLX 1IAJA 2WZJA 3EHAA 2G15A 2WIPA 2OSCA 4I0RA 2X9EA 2PTKA 3OXZA 3D7TB 4TWNA 4E7WA 2WO6A 3WOWA 4BDDA 4XYFA 2YCFA 4IHPA 3PVWA 2RFSA 2XK9A 3KFAA 4JXFA 4JNWA 1GZKA 2I6LA 1M14A 3EQDA 2GS2A 2QNJA 4ALWA 3FI8A 3NUUA 2BALA 3DOGA 3DB6A 3QL8A 4FIIA 4L67A 5JGBA 2BRBA 1XBCA 3Q2JA 4MK0A 3I5NA 3NUXA 1F0QA 1UU9A 3DBEA 4F9CA 4ACDA 3SG8A 1AGWA 2UW3A 2WAJA 3O0GA 2DYLA 2W05A 2XBAA 3JS2A 2QKWB 3LJ2A 4DHFA 1CKPA 3DBQA 3PE2A 1CTPE 4UZDA 4DGOA 2DS1A 2X4ZA 3RAHA 4FE2A 2B9IA 3R7UA 5I9ZA 3R02A 3O8PA 3RZFA 1FVRA 2ZMDA 4M97A 5IUGA 3IONA 4G17A 4F1TA 3MTLA 4UWCA 1YVJA 3LCKA 2ITNA 1Q8ZA 3FZRA 4M13A 5CVHA 1P4OA 3THBA 4DEHA 4EHGA 2F2CB 3MFRA 3NVMB 3A8WA 1YOMA 1S9JA 3E3PA 5EW9A 3Q60A 4GYIA 4M0ZA 5IQEA 2RG5A 3VUDA 3GC9A 3OFMA 5KMJA 2OG8A 1OL5A 5EDQA 1BLXA 5CXHA 5AP4A 3VO3A 2BROA 5JFWA 4BGQA 2I1MA 3HDNA 2YEXA 3GU6A 2PUIA 1Q99A 4G16A 5K0XA 4OW8A 3TN8A 2OF4A 3ZFXA 3V5QA 3ZC6A 2YIRA 2W1GA 3BKBA 3P86A 1U4DA 3KXGA 3KEXA 4FR4A 4ID7A 4MD8E 1SVHA 3QRJA 4AWIA 1KSWA 4OTGA 4MHAA 3SC1A 3NSZA 5ACBC 1R3CA 1ZARA 2PVFA 5L2IA 5K4IA 4ACMA 2BZKB 3EQRA 2O8YA 3PJ3A 3RTPA 3LE6A 2PUNA 4O0RA 3C5UA 3FJQE 2QO9A 3P78A 2YA9A 3F7WA 2O0UA 3DCVA 3ET7A 2UW9A 3P1AA 3KCFA 3RI1A 5EM7A 2E9PA 2PVKA 1WFCA 3QRIA 1O6YA 3ZLYA 3HMPA 3UOKA 4BWXA 4CYIA 3QTWA 4C2WA 1Z9XA 3KK8A 4CFFA 1IASA 2YM3A 3OS3A 5IUHA 4G34A 3VS2A 3E8NA 3DFCB 4FV9A 5GJDA 4WNOA 3MY5A 5FDXA 2QR8A 4CMTA 2OXYA 1JSTA 3F6XA 3I7BA 5M56A 2QHMA 3FMDA 4MXOA 5LCJA 3EKKA 4LOQA 3VBVA 3F3ZA 4K2RA 4FKIA 2KTYA 2J5EA 4DE4A 3UO4A 3B2WA 1FGKA 4J7BA 4X3JA 2QU5A 4BBMA 2BAQA 4WG4A 2F9GA 2VWVA 3OEZA 4E6AA 3E63A 5TKDA 4LUDA 5JQ8A 5DG5A 3COIA 3CBLA 2BVAA 3I60A 2W7XA 4I4EA 4JBVA 2PZIA 5HO8A 3LJ1A 2W1CA 3LFAA 3O7LD 1SVGA 4FL1A 5I3OA 3ZOSA 2UZDA 3L9LA 2DUVA 3EQIA 2R3PA 4RJ8A 2UW0A 3GC8A 3CD8A 2BCJA 3GB2A 3VF8A 4DGNA 5A9UA 2IZTA 2W1DA 2UVYA 4E5AX 3DNDA 2R5TA 3R7EA 3EN9A 2B9HA 2Y6OA 4GS6A 4UMUA 2XNGA 3D5XA 2X7FA 1A06A 2WOTA 1B6CB 3O51A 3OY1A 3PVUA 5BMSA 2G01A 5HNGA 3P9JA 4XS2A 4YZDA 5J5SA 3AGMA 1GNGA 2QLQA 2PZPA 1PY5A 2R3FA 2JLDA 2YIYA 4U3YA 2CNQA 3OW4A 4ZTNA 2YM4A 3S4QA 4ANOA 1Q8WA 1ZYLA 4KIKB 5CAQA 4FKOA 1M7NA 4QQJA 3WI6A 2VTLA 2XK4A 5DFPA 4S32A 2ONLA 4BN1A 1VR2A 4Y5QA 1QPEA 4I22A 5E8TA 3FL5A 1OPKA 4NKSA 1ZLTA 3E64A 4H1JA 5AUZA 4D4RA 3NAYA 5CQUA 2X8EA 1Y6AA 3ORNA 3Q6WA 3RZBA 2C0OA 2C6OA 4YHFA 2HW7A 4B7TA 5EI6A 3PZHA 1J7IA 3U9CA 3FKOA 3A2CA 4R8QA 5BYLA 4IADA 1H08A 1JNKA 2F7ZE 2VTHA 1KV1A 5EI8A 5CT0A 2Z8CA 2BKZA 4WUNA 4NYEA 1J1BA 3QYZA 4USEA 4YBJA 4V0GA 4V0GB 4OTHA 3VUGA 4QT1A 4B99A 4TWCA 2UUEA 3U8WA 2YIXA 5IA0A 5LQFA 3ORKA 3PTGA 1W8CA 4BC6A 4F9YA 3FMKA 5IA3A 3MA6A 4R78A 2QR7A 4BDEA 3RK7A 3DY7A 4BZNA 2BDFA 4DG3E 3HUCA 4TY1A 3A61A 5GHVA 3QKKA 1PW2A 4RWIA 2HW6A 4AS0A 1KE8A 2FSLX 3CQWA 3C4EA 1U46A 1U5RA 3RKBA 3PJ2A 4DBNA 5IUIA 1WBVA 2W1ZA 2WTKC 4HCVA 4QMTA 5LVMA 4CQGA 3EFLA 2GFSA 4FV4A 3E88A 2I40A 5DRBA 3OCBA 3R1QA 4DEDA 5BUJA 5B2LA 3V8SA 4HW7A 2CKQA 5LVLA 2FVDA 5BVDA 3FLZA 4LOOA 2WFYA 3V5WA 4M69B 3DK6A 3W55A 1ZXEA 4ZAUA 4YU2A 3RAWA 4GFOA 2VTIA 1OGUA 3EL8A 2UZBA 3P79A 2P2IA 4Y5HA 2Z02A 4TTHB 2R0UA 3LVPA 1FMKA 4DH8A 4KSQA 4PL3A 4YLKA 2UZOA 2E9VA 4RQKA 3HV7A 4K1BA 1H1QA 4ZZOA 2XRUA 3KCKA 2DQ7X 4YHTA 3AD4A 5HKMA 4A9UA 4ZZNA 3ZTXA 2GDOA 3DK7A 1IEPA 3QX2A 4FSUA 4RWLA 4EL9A 4ZIMA 3BCEA 4PP9A 4RJ3A 2J50A 4GK3A 4KIOA 5CXZA 1V0PA 2XMYA 3F7ZA 4NK9A 5ETIA 5HLWA 1GAGA 3ZRKA 4QMLA 4JG8A 2VWIA 2VO3A 3OMVA 3FZOA 1XHAA 4OTFA 4QNAA 4JR3A 3SAYA 3H0ZA 3FAAA 3I0QA 5AEPA 1SNXA 3TV4A 3U87A 3OY3A 5HU9A 4CG8A 4ERWA 2NO3A 4BTKA 3LFEA 2P3GX 3SOAA 2VTMA 5DRDA 3AMYA 4ZJIA 3SA0A 4WNPA 3G6HA 4AF3A 3O8UA 1W0XC 2Z7RA 2C0IA 3KRXA 1OL2A 3T9IA 3FMLA 3VF9A 5J79A 4FT0A 3DQWA 3VS6A 3SXFA 4CSVA 4YGAA 1DAYA 3E92A 3Q9XA 3PE1A 4FV5A 4N6YA 3OWKA 4EZ7A 2JKQA 4JDJA 2JKMA 1ZWSA 4W8EA 4DLIA 2PU8A 3PA3A 2BRHA 4HZSA 1PXNA 3CTHA 3DXNA 3PG3A 2Y9QA 4J96A 4NKAA 3ULZA 4M8TA 4BCFA 4AZFA 4EZ3A 5KMOA 4GJ2A 5HVYA 4D4YA 4UV0A 2YN8A 4G1WA 3ZSHA 4DFYA 2VX1A 3VS5A 4O0WA 4QMYA 4FV3A 4XMOA 2A0CX 5FQDC 4R3RA 3QA0A 4X3FB 4PTCA 4RC4A 3BYSA 4P90A 4NCTA 4XNEA 4IJ9A 2C0TA 1I44A 3DZOA 4RA5A 4DTKA 4EK8A 4EWHA 3HAMA 4M67A 3UJGA 3DXPA 3G5DA 2C3IB 5L6OA 4S34A 4CG9A 4I21A 4IACA 4JAJA 3TIZA 1NW1A 4RVMA 2W4JA 3EFKA 1J3HA 2UW7A 2RL5A 3DFAA 2JEDA 4FV6A 3AGLA 2YCSA 1OVEA 1U54A 1U54B 1F5QA 2XNMA 1OBDA 4MCVA 4UALA 3HECA 1OB3A 4G31A 4ASZA 5AIRA 5EW3A 3ANRA 4GG7A 3PDTA 5CAUA 4ZSEA 5DR6A 3SLSA 2CGXA 3BYMA 3IPHA 3CC6A 2CKOA 3EKNA 3QCYA 4D1SA 3OOGA 4DF3A 3NYVA 3F5UA 3QGYA 3QALE 2CN5A 2XKDA 2YFXA 4FZFB 5E92A 3DTWA 4E5BA 4XG3A 1YHVA 3FHIA 3HRFA 2XNOA 4BBFA 4EKLA 4WKQA 2WQMA 3AT4A 2XBJA 1KWPA 4BRXA 4DC2A 3RHKA 3RCJA 5DIAA 1SZMA 1UNLA 2YISA 4C38A 3BYUA 3R71A 4O2ZA 3P23A 4GEOA 4I23A 5C8MA 4YTFA 2HIWA 2FSMX 2YCQA 4W9WA 5CEIA 3I81A 5HEZA 2CN8A 1ZRZA 3C51A 5LMAA 5AV4A 5L4QA 5KKRB 4IX4A 4F0GA 4DTBA 2WGJA 4WIHA 3IGGA 4AW1A 4OAVB 2X81A 1JOWB 3AG9A 4GU9A 4YZMA 4BTJA 3WZDA 3G33A 3GFEA 4IZ5A 2CMWA 2CLQA 3HZTA 5M55A 4C4IA 2V7AA 2VAGA 4F7NA 3G0EA 2ITZA 2JDOA 3OUNB 3EIDA 2YM6A 3R9OA 2VWWA 2W1IA 1QL6A 1E1XA 1YI4A 2XM9A 4FT5A 5F1ZA 3OZ6A 3UVRA 3CGFA 3KU2A 5GZ8A 4IDTA 3E8EA 5AR7A 4O7VA 2AUHA 2ZDTA 1REKA 1OIRA 1WBNA 3LLTA 3EMGA 3G0FA 3ZZEA 2O2UA 3BEGA 4IXPA 2CKPA 4GRBA 1Q8TA 5HORA 5KMMA 5AUXA 5BVWA 1H24A 3DBFA 4Q5EA 5M4IA 5KX8A 2VTTA 2W5BA 3R1SA 4ALUA 5BQ0A 2XIKA 3QGWA 1IA8A 3I6UA 4Y85A 3JXWA 2XKEA 3FZSA 4KNBA 4FG9A 4XBUA 3R01A 1LR4A 2WMQA 3FQEA 4TRLA 4U0IA 4YHJA 2WMWA 3ZUTA 4C02A 4X2GA 5CEKA 3L1SA 4WG5A 5M4FA 3BELA 4IAAA 3LFCA 3Q6UA 4MVFA 4QMWA 4FIEA 3CJGA 1JKKA 4GUBA 4UWBA 4DA5A 2Z60A 1OL7A 3FQHA 4U40A 5H9BA 4Y95A 4C8BA 5B2MA 4E73A 2XK6A 4AA4A 4UN0C 4GVAA 5H3QA 4RX9A 3T3UA 2J0MB 4FKTA 2W99B 4FSMA 4C57A 3FLQA 3CJFA 3D83A 4II5A 5IA1A 1FGIA 4N4SA 3IGOA 4NWMA 4AX8A 3WZUA 4BCNA 4CRLA 3RPRA 3KGAA 5ANEA 5L8LA 3H9FA 4YJTA 4B9DA 4GYGA 4O86A 4PWNA 1FVVA 3ZUVA 3PXYA 5FP5A 3EN7A 5A4CA 3HV6A 3UPZA 4YO4A 4MKCA 5K3YA 4OR5A 3NW7A 2XCKA 5BVEA 3SOCA 3A7HA 3I5ZA 3MI9A 4X2NA 3EQGA 4AOTA 5HTIA 2BZHB 2OBJA 2R7BA 1WBOA 4JX3A 3GNIB 4PDSA 3HVCA 5C4KA 3D94A 2LAVA 4FV8A 3MFTA 3ZFMA 3RPSA 2XB7A 3BE9A 3TTJA 3MV5A 2C47A 3MY1A 4ZTRA 3NUPA 3UBDA 3WE4A 4IB5A 1V1KA 3MW1A 3WZKA 3HV3A 1M17A 2HK5A 2YACA 2ZM4A 4X21A 4CCUA 4CFVA 2Z2WA 3ZBXA 3TCPA 3PP0A 4EJ7A 4L43A 4O22A 1P4FA 2P0CA 3KY2A 3FXZA 4CLJA 4IDVA 4YBKA 5E8XA 3F3UA 4C3PA 1XH5A 2HZIA 2BTSA 2OJFE 3WZJA 3UTOA 3D15A 4HNIA 3AT3A 3IOKA 4JX7A 4RX8A 4C3FA 4O27B 4YMJA 4ZS4A 5E8WA 2QG7A 1TKIA 2B1PA 3AC3A 3MA3A 2J7TA 3OOMA 5IQBA 3GU5A 2W17A 3C9WA 4R5SA 1W7HA 5HD7A 4BIBA 2ETMA 3FYJX 4EH6A 3OEFX 4XV2A 4AZEA 4CTBA 2ITPA 2P33A 3PLAE 3L9MA 5DR9A 1SNUA 3IG7A 4P5ZA 3UVPA 4B4LA 3ZRLA 4ITJA 2R3JA 4BZDA 3NUNA 4FV0A 4F0FA 4BWKA 4HGSA 2QVSE 4DBXA 3FMMA 5CY3A 2XK8A 5GZAA 4MD9E 5CSPA 5ICPA 2R4BA 3W2SA 4O7TA 1ZOEA 3P7BA 4KSPA 2IVSA 4FYOA 5KZ0A 3UIBA 1PYEA 3OF0A 1URCA 5ANOA 5JGDA 5C03A 3ACJA 3F3VA 3OROA 2QOIA 3LCTA 3QD4A 4IIRA 4AGUA 2GNGA 4C37A 5M57A 2CKEA 1PHKA 4FBXA 4AN3A 4XOZA 2BRNA 3ERKA 4ANSA 5IEVA 3NNUA 3KMWA 4TNBA 4YP8A 3MJ2A 3QF9A 3C7QA 4PDYA 1V0OA 4PP7A 1M2RA 2JC6A 4BDJA 5AADA 5EOLA 4QPAA 4IWPA 5E8UA 1UV5A 3FSKA 3PWYA 2GQSA 4D2RA 3UOLA 4ZSLA 2XIXA 3ZO2A 3EQHA 2P4IA 3ACKA 3E5AA 3N9XA 2BUJA 2ESMA 3PVGA 4LMNA 4CT2A 4J97A 4EUTA 2B55A 4I6FA 2XA4A 5D9HA 3R9NA 4AXAA 4AQCA 3DAJA 4C4FA 4FK6A 5IDPA 4QOXA 1WVXA 4BCJA 1H26A 5KUPA 2YZAA 1NY3A 3DTCA 3R30A 1PXOA 4EH3A 3NWWA 4D4VA
chains in the Genus database with same CATH superfamily
3DS6A 4O2PA 3GBZA 4CQEA 5IEYA 3JY0A 3HMOA 2JD5A 3R0TA 4G6OA 3CP9A 3IO7A 5TR6A 2V0DA 1YXSA 3SW7A 2RFNA 3IK3A 4X2FA 1KE6A 3OTUA 4EC9A 4DFBA 3TZ8A 4Z3VA 4HYSA 4OTPA 5HIDA 2CDZA 1H28A 2C6LA 4JQ8A 5EYCA 2IW9A 3WYYA 2ZM3A 5LVOA 3ZC5A 3ANQA 1PXLA 3CY3A 4X3FC 5CNOA 3DQXA 3C4XA 4JDHA 1HCKA 2WTJA 4MYGA 3LJ0A 4GSBA 4YPSA 2YJSA 5H8GA 5FDPA 4WNMA 3KB7A 4FL3A 2WMVA 4RVTA 4G5JA 4TZRA 5H2UA 2XJ0A 2F2UA 4AGWA 5IQHA 2WD1A 5C27A 3QD3A 3DKFA 4IJPA 3C13A 3IW8A 3IW4A 3GQLA 4IAYA 4TWPA 3GENA 4CZUA 2ITQA 2KULA 5F95A 4EHVA 3PIXA 4KWPA 1Q8UA 2YIWA 3VWAA 2EXMA 2PVLA 4FNYA 4AXDA 3KRRA 2VO0A 1V0BA 2XP2A 4FEQA 4QP9A 1MUOA 2UZTA 2R64A 4QMUA 2VTNA 4MWIA 3ROYA 4QMVA 2XRWA 4FG7A 4JIKA 4XOYA 4UXQA 3ZHPC 1K2PA 5HTBA 2UW6A 5BUIA 4JBQA 3G15A 2FUMA 1LPUA 3DBDA 5E7RA 3FC1X 4BBEA 4BR3A 3RCDA 3UG2A 3RALA 4EWQA 3L8VA 5AA9A 2BIKB 3QUDA 1A48A 4I6HA 3IQ7A 4K18A 4KABA 5FD2A 3ZU7A 4O4EA 3UYSA 2WQBA 4KKGA 1O6KA 3GC0A 4L6QA 4R7IA 2J0IA 3BLRA 4FKJA 2CNUA 4BCPA 4CFMA 3WF9A 2BZIB 4I6QA 4DG0E 5I9WA 4IANA 4IX5A 5JMSA 4IM0A 3LXLA 2ERKA 4FC0A 4ASXA 3FLYA 2P2HA 4JRVA 4BCHA 3MVMA 3LFFA 2QOOA 5KNJA 2XF0A 1YKRA 3A99A 3MH0A 4HGEA 5KKRC 4R7HA 4P2KA 4KIQA 3LM0A 4QYHA 5AAGA 2JDVA 3KULB 4FKUA 2OFVA 3PXFA 4L9IA 4CKIA 3I1AA 5CI6A 3OCSA 4RFZA 4PPCA 4BJJB 4FIHA 2VWXA 3TACA 5M08A 3L8XA 2XYNA 4OGRA 4XG2A 3F2AA 4YJPA 4G3EA 5IQCA 1ZZ2A 2BFXA 2GQGA 3AMBA 3V8WA 1OECA 4QQCA 1QPCA 3EL7A 4EOQA 3OUKA 2JBPA 3Q9WA 4QMMA 3DKGA 4PUZA 3FUPA 3LXKA 2UZVA 5J95A 4UXLA 4TYHA 4CFWA 4XUFA 3UNKA 3ORIA 4FIJA 4D9UA 1J91A 1PYXA 1R78A 4FYNA 4MWHA 1YW2A 2ETKA 2B0QA 4QYGA 4FKQA 3RPYA 4AOIA 4PMPA 3KQ7A 1R39A 3AKJA 2EVAA 4GH2A 3OP5A 4BKYA 5IQIA 2CHLA 3A7FA 2W1HA 3IW7A 1ST4A 4YLJA 4J1RA 2C5NA 3QQHA 5GIPE 3TNQB 4O0XA 4D0XA 4LV7A 3E62A 4ENYA 4BCQA 2BDWA 2R3HA 2B53A 1JPAA 4OBOA 4DGLC 3LLAA 3QKMA 2Y4PA 2WTWA 4S30A 1W2CA 4AU8A 1GZ8A 2YAKA 3ETAA 1H1PA 3AMAA 3QRTA 4LRJA 2J9MA 4M15A 4NU1A 1XH8A 4PX6A 5HG7A 4DTAA 3VQHA 5A4EA 5BVKA 1Y8YA 1R0PA 3LXPA 3UZRA 4O6EA 3CSVA 3UGCA 4FZ7A 3MB6A 3C4ZA 4PPBA 4IAZA 3OCGA 4GU6A 4IZYA 3BBWA 4DFZE 2RGPA 4TXCA 1VYZA 3FI3A 1PMEA 3UNJA 1H8FA 5CF8A 5LJJA 2AC3A 3FE3A 4EBVA 2VO6A 1URWA 1J7LA 4UEUA 4AZSA 2R3LA 2PZYA 3NDMA 5CZIA 3IKAA 3P7AA 4IH8A 3A62A 3CD3A 5GJFA 5LMBA 4TYIA 5KCVA 4RPVA 4PNKA 1A9UA 4FTNA 4IAFA 4RWKA 3UP7A 4HVIA 4NM3A 5I9XA 4O1OA 1WBWA 5DE2A 4BDAA 4TW9A 4WBOA 3TNPC 4PF4A 4CNHA 3R8PA 5LXMA 1WAKA 1YI3A 3PJCA 2JFLA 4IM3A 3UDBA 4FSNA 5ETCA 1WBSA 2VRXA 2IW6A 2UW4A 3E3BX 4IVAA 2BRMA 4OUCA 5DR2A 4ZSGA 3SV0A 3RWPA 4DHIB 2OZOA 2PZ5A 4LL5A 4UMQA 1RQQA 3NVKI 3WZEA 3L8PA 1WZYA 4U6RA 4EH5A 4IVCA 2OO8X 1G8SA 1OPJA 3D4QA 3FDNA 3OWJA 4GUEA 4BIEA 3PUPA 4LMUA 2GU8A 2PUUA 2PVYA 5CS6A 5A6OA 3TDVA 1OM1A 4R3CA 4H3BA 3A4PA 4RSSA 4CKRA 5CEMA 4ARKA 4C59A 2XM8A 2ZOQA 3H0YA 3FI2A 4QTBA 2QOFA 3VNTA 2RG6A 3ZM4A 1VYWA 4LGHA 3OWLA 2VTPA 3BV3A 2UZNA 5J87A 4AXFA 4O0SA 4B6LA 5JGAA 3NUSA 2PK9A 2OJJA 4NJDA 4AXEA 4BL1A 4LV8A 2H8HA 2WEIA 1GJOA 3QLFA 4FK3A 4U8ZA 4O21A 4H3PA 5C26A 4BTFA 4ZTQA 2WB8A 3UP2A 4EOPA 2CPKE 3FXWA 4A9RA 1B38A 4TYJA 3DKOA 3ORPA 4GIHA 3P5JC 2O5KA 4G6NA 4JAIA 2JAVA 1SYKA 3QLGA 4YZNA 4QYFA 3E7OA 5AJQA 1XJDA 2ZV2A 2PULA 5DT3A 2OIBA 4D2PA 3CCNA 3O71A 3HRCA 3BYVA 4IB0A 2QG5A 4G3CA 2PZRA 2PUPA 1BMKA 3COHA 4PDOA 2ZAZA 2XNEA 3ZO4A 4AOJA 4QP1A 1LUFA 3GUBA 5F20A 3W33A 3BGQA 4ZLOA 5JKGA 4B0GA 3MVLA 2JFMA 3QZFA 4YJNA 2J5FA 5L6WL 4U80A 4EOLA 1XKKA 4S31A 1H4LA 2VV9A 4A4XA 5AAEA 5M4UA 5GNKA 2X6EA 4IB3A 3VJNA 4Q9ZA 5CAPA 5C01A 3VULA 3E87A 2UZWE 2XUUA 4N57A 5JN2A 3SXRA 5A4LA 3A7JA 1XBAA 1L8TA 3TG1A 2C5YA 5AP5A 3HLLA 2X6DA 5DBXA 2B52A 3LCOA 3UNZA 3CXWA 5D11A 3N4TA 2VTSA 2R2PA 5I9VA 5CAVA 3U6HA 1DI9A 2X2KA 4LDTA 4G3FA 4FGBA 4BI1A 4L3LA 4H39A 3PA5A 3QZHA 5DMZA 3C1XA 5KMKA 1W84A 3BIZA 1G8KA 3D0EA 4XJ0A 2HZ4A 4M3QA 1YQJA 3QRKA 4I94A 2RFEA 3N4UA 4I5CA 2PVHA 5HU3A 4U9AA 5FGKA 2QCSA 3VC4A 5IISA 5JQ5A 2C69A 5DHJA 4GJ3A 3DA6A 2PE0A 2F4JA 3LQ5A 5CI7A 5E8SA 3ZFYA 2OIQA 5L2SA 2YIQA 3DJ7A 5TF9A 3GEQA 2IVTA 2BHEA 3M42A 3U55A 1BL6A 4M7IA 5HG8A 4D2WA 4BHNA 4LL0A 1P2AA 1E1VA 2C3LA 4BDHA 5BVNA 4HYUA 2ERZE 4E93A 5HE2A 1Q3DA 1ZYSA 4MF1A 2OIDA 1MRUA 3W1FA 3Q4UA 1UU3A 2A19B 3WF6A 4K11A 4IWQA 5TOZA 1PJKA 3B8QA 5HLNA 3PSBA 2NPQA 3PFQA 4F63A 4KA3A 2HENA 4NM0A 5HTCA 1ZZLA 3RK9A 3ZXZA 3OHTA 5A46A 4O82A 4N6ZA 3RM7A 4YURA 4B8MA 2QURA 4FT9A 3PY3A 3BL7A 4R7BA 4Y73A 3D5WA 5TO8A 5IMEA 4X0MA 4PTEA 3HP2A 5KE0A 3BWFA 5ETFA 4CLIA 5CF5A 4CKJA 5AR4A 4KD1A 4PRJA 1FBNA 4F7SA 3S00A 2X9FA 5EDPA 2ZV8A 2XAOA 4I0SA 2C3JA 4IE9A 4NT4A 4YSJA 2OLCA 4H1MA 4I1ZA 1JWHA 4CRSA 3UDSA 3JR1A 4XEYA 3DAKA 3W16A 3PY1A 5DOSA 4M66A 4UYNA 2OZAA 4L7FA 3TIYA 1Z5MA 2VUWA 3GU7A 3WE8A 3ZEWA 2C68A 1ST0A 4YZBA 3W2CA 5IDNA 4FZ6A 3ATSA 5AP0A 4PL4A 1Q61A 2UZUE 2Y0AA 5EYMA 4Z16A 4L44A 5IQAA 3VAPA 2J4ZA 4X7QA 3R9HA 3DBCA 4LV5A 3GCUA 3ZM9A 3LMIA 2V22A 4U44A 4NW6A 4Q5HA 4L52A 2P55A 3UC4A 1DAWA 3OG7A 3IECA 2JDSA 4FNWA 4NIFA 4CD0A 4E6DA 1ZOGA 1KUTA 4RMZA 1ZMVA 5L2WA 3TMOA 4FOCA 4QTDA 4ASDA 5C8NA 3DNEA 4QP7A 4ZTSA 3HA6A 3NX8A 5F9EA 4IC7A 4YLLA 4DH7A 5E90A 3R9RA 4F7LA 4ALVA 3FKLA 2BILB 1BI8A 3GCPA 1KE9A 3MH1A 5CWZA 2PPQA 2XEZA 4Y46A 3KMUA 4ZS0A 4DEIA 2Z7LA 4FTMA 4D4SA 4C3RA 3ZH8A 2WMBA 2OJGA 3VBYA 3LFNA 4MXXA 4DDGA 1W2DA 3FSFA 2HXLA 1JSVA 4FTAA 3NRMA 4O38A 3AD5A 4FIGA 2GNIA 4L53A 1JBPE 1PXJA 3C4FA 4QP2A 4YPDA 4QDEA 3CKWA 3FZTA 4FSTA 4FRFA 3VS7A 3H9OA 3ZSGA 3R7IA 3MBLA 4YJVA 4O0TA 2WHBA 2PMNX 5M44A 3PZEA 3QUEA 4E6CA 1PMVA 3PPJA 3ZZWA 3TUBA 4ORKA 1DI8A 4WD5A 4FTJA 3JPVA 1O9UA 4FZDB 3EZVA 4MAOA 5AUTA 4BB4A 3LKMA 3A7IA 4MF0A 3SQQA 2XYUA 5M06A 4LOPA 4S33A 2W9ZB 3UQCA 4DFXE 1PXPA 4EEVA 5I0BA 4MUQA 1SVEA 4P4CA 4O1PA 3JYAA 2GHLA 2OK1A 3R1YA 3R28A 2JKOA 3MJ1A 3PVBA 4TT7A 5AM7A 1YOLA 2YCRA 2WTDA 2YDKA 4RFYA 1I09A 3Q4TA 3F69A 2YM7A 3HAVA 4L7SA 2WKMA 2XIYA 1ATPE 3MDYA 2E9OA 3U54A 1CSNA 1UU8A 2GMXA 1OUKA 3VW8A 3VUTA 2XKCA 4EOJA 4F1OA 3VS4A 5JZNA 5J9ZA 3C50A 3VS0A 3ZONA 5FLFA 5HVKA 1KOAA 2WQNA 1BX6A 4QPSA 2E2BA 5HX8A 3VJOA 2C6KA 2UV2A 5AAFA 1DS5A 1SMHA 3R7GA 4RQVA 4BY9E 3BX5A 1FPUA 3W2RA 4DFLA 3UQFA 3VUHA 3EFWA 4A9TA 3TNHA 4EOSA 4B8LA 2H9VA 3NIZA 4I6BA 3PP1A 4USDA 4CV9A 5ANDA 4AA5A 5HD4A 4ITIA 4YNEA 1NVSA 2YDJA 3WF5A 3QFVA 4JS8A 3IOPA 5IQDA 3DB8A 4RIYB 1APME 3ODYX 4RIYA 3TNIA 2VU3A 3ATTA 4I93A 4DH1A 2BDJA 1W98A 1XQZA 4ANLA 2R0IA 4WG3A 3V5TA 4AE9A 2IG7A 2R3GA 3KXNA 3QQGA 3O8TA 3LMGA 4TL0A 2XKFA 2IVVA 3KRWA 3EZRA 5CSXA 2O64A 5J5TA 3NW5A 3PSCA 2G2IA 1GIIA 5B0XA 4MNEA 4NFNA 2C6EA 4CXAA 3BGPA 3R7VA 2HWOA 4W8DA 4QTAA 3I0OA 3ITZA 4D55A 4QO9A 2OI4X 4A7CA 4V04A 4RA4A 3T9TA 4HCUA 2UVXA 3V51A 2HY0A 5A4TA 5EQEA 1Z57A 3W0PA 3KA0A 3Q5IA 2I0HA 2ZB0A 5DNRA 4YC6A 2QOHA 1FOTA 2ZDUA 3JUHA 4AT5A 3F88A 4FMQA 5IZFA 3GOKA 4XLVA 3TL8A 4BCIA 1WCCA 4DINA 3ZUUA 5KZIA 4AW0A 2G2HA 5CX9A 5J1WA 3FV8A 3HUBA 4EH2A 5HX6A 4U45A 2XNPA 2YERA 5JRSA 3TM0A 2CSNA 2YM8A 4RC3A 3FI4A 4GVJA 2ITWA 4J53A 4FZAB 3ZEPA 2OH0E 4HJOA 2ITVA 1YXXA 3K5UA 4YJRA 4OBPA 1K3AA 3MFSA 4D9TA 4XX9A 5J7HA 2R3OA 3UMXA 2XIRA 4XLIA 3BL9A 3F82A 2HYYA 3I4BA 3OT8A 4E26A 2XIZA 2OGVA 3OXTA 4EONA 1IAHA 3V5LA 4YC8A 4IWDA 1R0EA 1F3MC 2JIIA 1M7QA 2GCDA 5AMNA 3V8TA 2CCHA 4DYMA 4RBLA 1REJA 2PHKA 3JY9A 3ML1A 1GIJA 3U6IA 5AFVA 2ONLC 3NR9A 3LQ3A 5CSWA 3OXIA 5E4HA 1MP8A 2YHVA 2C30A 5G6VA 2Q0NA 2B9FA 4DH3A 5BNJA 2NNWB 3PYYA 3TJDA 3MPMA 1PMNA 3NUYA 4BCKA 3S3IA 5GJGA 4BTMA 1ZAOA 2B9JA 3Q2MA 3D14A 4O6LA 5HZNA 4WHZA 4BHZA 4HVGA 5BYZA 5EDRA 4I3ZA 3ENMA 5IKWA 1DM2A 1M52A 1XWSA 3FLNC 3VBTA 5CAOA 2VWBA 4RZWA 4WBBB 3AQVA 3W8LA 4CGAA 1WBPA 3DV3A 3WARA 2VGPA 2W1FA 2AC5A 4APCA 1AD5A 5EW8A 5JFSA 2BRGA 4FV7A 2CJMA 1JKSA 3G6GA 3C4CA 5C9CA 4I24A 4E1ZA 3NYNA 1MQBA 4OTRA 1OKYA 1CM8A 4F9BA 5DA3A 2Y8OA 2PL0A 3UODA 4D5KA 3DGKA 1BI7A 5KMNA 4TNDA 5ANIA 2NP8A 3V3VA 4AW2A 4FV1A 2W0JA 4BFMA 3AOXA 2QONA 2OWBA 1XH7A 3ZBFA 5GINE 4IX6A 3QTXA 2WTIA 4LG4A 3PIZA 3R8LA 3ROCA 2IWIA 2W9FB 5I5ZA 5JEBA 1EH4A 1WMKA 4EJNA 3QD0A 5EYKA 3S95A 3KRJA 3QU0A 3PXKA 3EWHA 3JVSA 2PVNA 3CY2A 3ORZA 4JI9A 4BI0A 2YWVA 3LHJA 4MEDA 3IDCA 2B54A 5IG1A 3ZDUA 2NRUA 5EM5A 3AC1A 4F09A 3N4VA 1H1SA 3L9PA 5EFQA 3NAXA 3QCSA 1YHWA 4FTCA 4KUJA 3MVJA 3FLSA 2GTNA 1ZYCA 5C1QB 3DU8A 2BPMA 4WA9A 1WBTA 3NW6A 4EH7A 3QTSA 4O0YA 3G9LX 3RNYA 4QMSA 3W0OA 1Y8GA 4FSYA 1IRKA 1OIYA 2UVZA 4CV8A 4MNFA 3W0MA 4A4LA 5IEXA 4GT4A 3BRBA 4W9XA 1BKXA 5AP7A 1E9HA 3EJ1A 4JT3A 5HCZA 2ETRA 3SKCA 4O84A 1U59A 4AAAA 5JH6A 2CGVA 2V7OA 2ZVAA 4ANMA 2BKKA 4L42A 5CT7A 3ZLWA 4C33A 1R1WA 3A7GA 3EOCA 3EYHA 1TQIA 3DLZA 2GS7A 3QWKA 4O4FA 4R1VA 5CSVA 5CENA 4JL9A 2X0GA 4WUAA 3VS3A 5JRQA 1W83A 4AFJA 4E4LA 4KKEA 4NW5A 4PV0A 4TYEA 4KIPA 3EFJA 5EG3A 5JSMA 3NLBA 3FPQA 4I5PA 3IS5A 3FY0A 4H36A 1H25A 1MQ4A 3CEKA 1OMWA 4XV9A 2F57A 4YSMA 3KRLA 4K77A 4EHZA 4J95A 4USFA 4PMSA 4FEXA 3SW4A 5BX0A 5CEPA 2R3IA 1PRYA 5HQ0A 3ZXTA 4G3GA 1Y57A 3AC2A 3QX4A 2GQRA 2FSTX 2YABA 1L3RE 3NCGA 4XP2A 2BTRA 4NUSA 4MBLA 5KMLA 3FC2A 5CYIA 3RINA 2JKKA 1OL1A 2UZLA 2NYAA 2HZ0A 4NZWB 4DGGA 3MVHA 5HOAA 3P0MA 3BU5A 4RX5A 3ID6C 5TT7A 3ZO3A 4F64A 5FM3A 4YR8A 2X7OA 4IWOA 4ZTMA 4QTCA 3LMHA 2QHNA 1PKDA 2VWZA 3II5A 4E20A 4ZMEA 4E8AA 1KOBA 3R22A 2XCHA 2X2MA 4HGTA 4IX3A 3SG9A 3MGYA 4XV3A 3TV6A 3MY0A 4NTSA 3COMA 2PY3A 4RVKA 5AUWA 1ZOHA 4AXCA 4PL5A 4NCTC 5I9UA 4FTQA 2O3PA 4FIFA 2XH5A 3QXOA 4JJRA 5CZHA 4ZOGA 4E4NA 3O5AA 3MH2A 2QD9A 2VGOA 4Y8DA 4K33A 4C4GA 2J2IB 4DT8A 4OAUC 5L2TA 3EN4A 4IMYA 2YWPA 4GT3A 3TTIA 2REIA 5CEOA 4QP3A 3VUIA 4K9YA 3ORTA 4TYGA 3SXSA 2IF8A 3RBWA 2X1NA 4HYIA 5AP6A 4DLJA 4ACCA 3MH3A 4F6UA 4QMZA 3KXMA 2W5AA 2A98A 2QOLA 4CTCA 3UO6A 4BDGA 1IG1A 5EM8A 1UKHA 2CLXA 5CQWA 2UZEA 5ANJA 1IA9A 2YLFA 4XG7A 3NFFB 1S9IA 1VZOA 5EHOA 2J0LA 4NM5A 4DITA 3QTZA 5F4NA 3R2YA 4F7JA 4CZYB 3MPTA 5G1XA 2A2AA 3BHHA 4ZLYA 2G1TA 3DXQA 2WOUA 2F7XE 2ITYA 2VZ6A 5A14A 5E8VA 3QHRA 2GHGA 4AN9A 4YNOA 3K2LA 1QPDA 3UC3A 4BICA 4TKSA 5DLSA 3PUFC 2V5QA 5EK7A 4BDIA 1YDSE 4R1YA 4GW8A 4F0IA 3QTQA 4QMOA 5FUTA 5HE0A 3Q53A 4AFEA 1GOLA 4GIIA 2J90A 4RGJA 1STCE 2C5VA 4FICA 3SHEA 3W0RA 4BVUA 3KK9A 4P7EA 5L8JA 2WTKB 3BBTB 2XK7A 2WU6A 4RLLA 2EXCX 5FEQA 1CMKE 5C4LA 1YWNA 2ZM1A 3PXZA 2H6DA 4ENXA 3GI3A 5T3QA 5FTQA 5KBQA 2XNBA 3GCVA 3F66A 3O2MA 1NVRA 5C8KA 2WPAA 1GZOA 5B7VA 3TUCA 3ALNA 3CIKA 4L01A 3C0GA 1HOWA 2I0EA 4BGGA 2ITTA 1ZMUA 2WMXA 5HIBA 3UO5A 4I5MA 5JT2A 3EQFA 3CQUA 4RIXB 1U5QA 3BYOA 4RIXA 5CANA 3ELJA 2C1BA 3VUMA 4I20A 4IFCA 2QU6A 5IF1A 4KRCA 1KV2A 4QMQA 5HO6A 3RNIA 3C5IA 3LZBA 2VX3A 4QP6A 5D7VA 4F1MA 4W4YA 1HCLA 3P08A 3BHYA 1WVWA 4Q9SA 4X2JA 2VNWA 5IA5A 2OXDA 3R83A 3HMMA 1OZ1A 4JDIA 2JGZA 4TYHB 5J1VA 4G3DA 4XG4A 1PKGA 1KE7A 4O7WA 5EKNA 4O4DA 2V62A 2W1EA 2GTMA 3O17A 5JZJA 5M4CA 4JVGA 4PMMA 4U81A 3VBQA 3VN9A 4CMOA 3KF4A 4EKKA 5IA2A 1JVPP 2XVDA 3CGOA 3TEIA 4CYJA 5KBRA 4CFNA 4FT7A 3D7TA 5EKOA 4YTCA 4I6LA 3OCTA 4N0SA 3RVGA 1Q8YA 4BYJA 4PTGA 1AQ1A 2VD5A 2VN9A 1JKLA 1Y6BA 3GP0A 3GT8A 4IAIA 3NIEA 2J51A 2PVJA 4FTLA 4MQ1A 2J0JA 3V5PA 3U9NA 5D41A 5GZ9A 4KAOA 4S2ZA 4EK3A 3EH9A 5J9YA 2C1AA 4O7SA 4XV1A 4XBRA 3AT2A 3SX9A 4APPA 3W8QA 1G8AA 3AXWA 2H34A 3LCSA 4L3PA 3W32A 4IEBA 5HIEA 5KMIA 2AYPA 2GNHA 4OT5A 3D7ZA 4WSQA 5HNBA 3AKKA 3W2QA 3LCDA 4QYYA 4F9AA 5M07A 3VUKA 4A06A 2H96A 3KMMA 3LW0A 4C35A 4EYMA 5FP6A 3TKIA 3QXPA 3V6SA 3W18A 3TKHA 2C6TA 3IDPA 5IU2A 5DH3A 3R8MA 2R3QA 2XS0A 3QCQA 4FTOA 2ZV9A 3F3WA 4FNXA 4FTTA 4AT4A 4YUQA 3F3TA 2FYSA 2WQEA 3DJ5A 4JRNA 3Q96A 1OIQA 2YAAA 2BAJA 3BI6A 4FKRA 2X0PA 2ITOA 4U79A 3AD6A 4MX9A 4V01A 3WF7A 4FJVA 5AR5A 2EB2A 3EQCA 3A60A 5EYDA 3QTUA 2JDTA 3I79A 5AX9A 4BKZA 1RDQE 3GCQA 2BFYA 2QI8A 4FKGA 3UG1A 3MFUA 4M68A 1CKIA 5DPVA 4QD6A 5HG9A 4AZVA 4FA2A 3W2OA 1OIUA 5LWNA 4IFGA 5FBNC 4Y83A 3TT0A 3KKVA 2PMOX 5E8ZA 4Z7HA 4ZXTA 4ANQA 4F9WA 4QQTA 2CCIA 3B2TA 1JLUE 3BHVA 5L6PA 3FHRA 1ZY5A 3BPRA 4AZWA 4ACGA 5ANKA 2RFDA 3OW3A 4OBQA 2WELA 5M09A 3CQEA 4GKHA 3F61A 3PIYA 2ITXA 4PNIA 1P14A 5ACKA 1O6LA 3DJ6A 4KBKA 3ALOA 3TV7A 5E8YA 2W4KA 3UIXA 3HGKA 1IR3A 4U42A 2W06A 2C5OA 4FL2A 4KBCA 4ZSJA 3WF8A 2ZB1A 4K6ZA 3L8SA 2C6MA 2B7AA 3WIKA 4BDFA 3MIAA 5DYJA 2VWYA 3AC5A 2B4SB 5L3AA 3RGFA 4QQ5A 5DWRA 5CF6A 4U7ZA 5EQPA 4HVSA 4NL0A 2W4OA 4ZTHA 2HCKA 4EHEA 4O91A 3DT1A 3M11A 3ZMMA 1TFFA 2HAKA 5T6KA 4JG6A 1NXKA 1MRYA 1W2FA 1H0WA 4FSQA 1XO2B 4ZEGA 4EOIA 4GCJA 4AE6A 4BDBA 4BDCA 3PWDA 3S2PA 4J98A 3K3IA 5HBEA 4F6SA 4CVAA 4IW0A 4MXCA 4D1XA 2IZSA 3K54A 3PJ8A 4HZRA 3RMFA 3EQPA 1NT2A 5HLPA 3UOJA 1T45A 3H9RA 4IZAA 4F65A 3UDTA 1KE5A 3ZRMA 1G3NA 2RKUA 2XK3A 4W4WA 2UW5A 4UZHA 5E1SA 4IB1A 4ZY5A 5EQYA 4MBIA 3KIOC 4FF8A 4AP7A 3NGAA 2YM5A 5FTOA 3TZ9A 3P4KA 5BUEA 4RJ7A 4L00A 5LMKC 4GMYA 4BYIA 4C4HA 4NTTA 1PXIA 4XH6A 5DN3A 5JFXA 2CGUA 3OBGA 4OTDA 4AACA 4RIWB 4RIWA 3GC7A 3VBWA 3LIJA 4DCEA 1YOJA 3D5VA 2RF9A 4O96A 3UOHA 5ETAA 3NMUF 3HV5A 5FRIA 3LFBA 4FOBA 5CVGA 5AV1A 1YDRE 2G9XA 1OBGA 5FXSA 5E9EA 4MTAA 3TDWA 2HWPA 4H3QA 4WSYA 2XARA 4GFMA 2VX0A 4QRCA 5AV2A 4DAWA 5EI2A 3QQFA 4KIKA 4C4EA 2VTQA 4OLIA 3K3JA 4GK4A 3BZ3A 1OITA 5IH5A 5A6NA 2ITUA 1MRVA 5K0KA 2PSQA 3U51A 4HPUE 4ZP5A 2RSVA 4HCTA 4F4PA 4QTEA 4EQUA 4GK2A 3WBLA 5FBOA 2QO7A 3R6XA 4XP3A 4C61A 1CKJA 2OJ9A 2GNLA 5CSHA 1YDTE 3BGZA 1Q4LA 4RT7A 5HCXA 2JITA 2FSOX 1BL7A 3HMNA 4EK5A 3BEAA 3LXNA 3QYWA 4X6RA 5D12A 3EYGA 2YDIA 3QC9A 4OTQA 2QOQA 3FWQA 4RFMA 4AZTA 3FMNA 4C2VA 2EU9A 3TWJA 5LVPA 5AV0A 4MBJA 4MXYA 5HHWA 4D58A 3V5JA 1P5EA 3R21A 5AUVA 4GV1A 5L2QA 5LARA 2Z7SA 3AC8A 5AP3A 2C3KA 5K9IA 2OF2A 4MXZA 3KC3A 4GT5A 4A07A 4FEVA 4FEUA 3VVHA 3R2BA 4FKSA 4FV2A 2BMCA 1UWHA 2Y4IB 4BZOA 4KKHA 3NS9A 4IVBA 1FVTA 3G51A 4HNFA 4KBAA 2QC6A 5CU6A 1UNHA 5TE0A 3SD0A 4ZMFA 3QCXA 1H00A 3MTFA 2IVUA 5K5NA 3VS1A 4UBAA 3R1NA 4UY9A 4C62A 4YJOA 1JKTA 3ZS5A 3RAKA 3QKLA 4PMTA 3MS9A 4XRJA 4C0TA 4FGRA 1XH9A 4LM5A 1RJBA 2QOBA 2QOCA 1JQHA 3F9NA 2EXEA 4FKVA 1GZNA 4HGLA 3F2NA 4UB7A 3CTJA 3BLAA 5HO7A 2Z7QA 4CT1