1BI7A

Mechanism of g1 cyclin dependent kinase inhibition from the structure of the cdk6-p16ink4a tumor suppressor complex
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
292
structure length
269
Chain Sequence
DQQYECVAEIGEGAYGKVFKARDLKNGGRFVALKRVRVQEHPNVVRLFDVCTVSRTDRETKLTLVFEHVDQDLTTYLDKVPEPGVPTETIKDMMFQLLRGLDFLHSHRVVHRDLKPQNILVTSSGQIKLADFGLARIYSFQMALTSVVVTLWYRAPEVLLQSSYATPVDLWSVGCIFAEMFRRKPLFRGSSDVDQLGKILDVIGLPGEEDWPRDVALPRQAFHSKSAQPIEKFVTDIDELGKDLLLKCLTFNPAKRISAYSALSHPYFQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Complex (kinase/anti-oncogene)
molecule keywords CYCLIN-DEPENDENT KINASE 6
publication title Structural basis for inhibition of the cyclin-dependent kinase Cdk6 by the tumour suppressor p16INK4a.
pubmed doi rcsb
source organism Homo sapiens
total genus 67
structure length 269
sequence length 292
ec nomenclature ec 2.7.11.22: Cyclin-dependent kinase.
pdb deposition date 1998-06-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 1bi7A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 1bi7A01
1HCKA 5CT0A 2IVTA 4QQ5A 3V5JA 4K1BA 2VTQA 3G90X 5CSWA 1OIUA 3DTCA 1SM2A 4NIFB 3DXPA 3KXHA 4ZS0A 2WGJA 3ZMMA 3L9MA 4FIHA 5L2WA 3E7OA 3BGQA 3QTQA 3DAJA 4N70A 1H27A 2F7EE 2UZWE 4FG8A 3OUKA 3ET7A 2WELA 3F88A 2I0YA 2XIXA 3LFFA 3VULA 4BCIA 4JDJA 3DGKA 4ZEGA 3TNPC 2FVDA 2R2PA 1UU9A 3ZTXA 5DR2A 1CDKA 1TKIA 2QODA 4RA5A 3LFEA 2JFLA 3V01A 3C0GA 3IDBA 3OTVA 4LL0A 4E4XA 2VTLA 2Y4IB 3DQWA 3ACJA 1M14A 3DS6A 5HE3A 1MQBA 3LFQA 4AUAA 2GPHA 4EZ3A 1P2AA 2CKEA 2F7ZE 3OD6X 3PE2A 4TZRA 4YO6A 3V3VA 3H0YA 5DRBA 1U54B 3DJ7A 3IOPA 3MGYA 2C5OA 4L00A 4ZTHA 5CLPA 5L6WL 2PZPA 2RIOA 3FI2A 4JI9A 5AUZA 3U6JA 3NW7A 2YZLA 2ESMA 4O22A 2W5AA 2XJ2A 5A4TA 1ZZLA 3EWHA 3N4VA 3TNWA 3VS0A 3PA5A 4YJRA 2JGZA 2ZB0A 3EQCA 4PP9A 4C3PA 4BCKA 2BIKB 3TNIA 3G33A 4O2PA 4D9TA 4R77A 3WZEA 3NW6A 3R0TA 4WRSA 4A9TA 2X9FA 4QMNA 3ODZX 4C61A 2YFXA 4PDOA 3GENA 3UIUA 2J51A 4RVKA 3R9HA 3NAYA 3U55A 3LFBA 3K5VA 5AUVA 3VRYA 4RIYA 3H4JA 2WPAA 3NYVA 5D7AA 3ORZA 4FIEA 5D7VA 4ZMFA 3MB7A 1T46A 4BC6A 1F0QA 2R3KA 4D1SA 2Y8OA 4PRJA 3FV8A 3JYAA 1WZYA 1JAMA 2REIA 3C5UA 4YTFA 3LJ2A 4AGDA 4GKIA 2BVAA 3PDTA 1LEWA 2XRUA 4FT7A 3NNVA 5FBNC 2HXLA 4Z7HA 2EB2A 3R22A 5CU0A 5EKNA 2YCSA 4FTOA 4E5BA 3JVSA 5E90A 4BB4A 2ETRA 2IVVA 3ROCA 2GQSA 3W18A 4GU6A 4ZSLA 3SC1A 2FSOX 3FZOA 4RA4A 2ZB1A 2WMXA 4FTQA 4X3FB 4DGOA 1MRUA 4NM0A 3VRZA 4ZS4A 2GDOA 5DR6A 2QOCA 1YOMA 2FSMX 4G3GA 5ANJA 2F9GA 2OZAA 2VTMA 3GCPA 1UVRA 5AP0A 4L68A 4I0TA 5LVNA 3ORTA 4AACA 4IIRA 5ANGA 3AC4A 4KSQA 4ALUA 4AN9A 5KMJA 5M07A 4BIBA 3W2QA 4PPAA 3COKA 1SNXA 2C5YA 4QMSA 5GJDA 2F49A 4WA9A 5JZJA 1Q24A 4EK6A 4PPCA 2G2IA 4QMXA 5CEKA 4BCJA 5I9WA 2GNFA 4BCMA 2ZM1A 4FV2A 5AWMA 5K0KA 3RBWA 4E1ZA 4JS8A 4JRNA 5BNJA 4YC3A 3PA4A 3C4EA 4G34A 3KXNA 2BZIB 4U43A 3UIXA 1WMKA 4O7WA 5CY3A 5F20A 3QXOA 2LAVA 3T9TA 4W4WA 3UYSA 4DH1A 4F99A 3ZLYA 2ITPA 4AZVA 4BCGA 1BL7A 3LQ8A 4ASEA 5GZAA 1VEBA 3PXZA 3R83A 2GTMA 2KULA 5LWNA 2AUHA 4L6QA 5BVDA 1JLUE 2B7AA 1GIIA 2BAKA 2Y0AA 2Y9QA 5DOSA 3Q32A 5CASA 3P86A 3G15A 5AV0A 4EUUA 2HXQA 5CZHA 4FNXA 3CPCA 3GB2A 4TWCA 1UA2A 3D2IA 2WU6A 3EZRA 4FKIA 2XKEA 3RK7A 3UE4A 4XYFA 2VU3A 3R73A 4QP2A 3RAHA 3PE1A 4FV8A 4GYIA 1M7NA 2VO3A 4QYYA 4M97A 3K3JA 1OBDA 1DM2A 4BVUA 4R1VA 4NCTC 4NFNA 3LZBA 2HZ4A 4TKSA 4U8ZA 2W0JA 4LM5A 5GZ9A 3QZGA 4UXLA 4AF3A 1Y8YA 4ITIA 4YLLA 5IEXA 2WMWA 3SGCA 3HGKA 4O6LA 3EOCA 4YHJA 3UIMA 2VWBA 2VTPA 5I9ZA 5E1SA 4NM7A 5K0XA 3AMYA 4S32A 4YTHA 4J97A 2YCQA 2BRHA 4I6QA 3KB7A 3AD4A 4OTDA 1QPJA 2GNLA 4FV5A 3F5XA 4H36A 4TRLA 1H00A 3Q96A 4Y73A 4TYEA 5BMMA 4E7WA 3UC3A 5J9ZA 4C8BA 3GC9A 4LOOA 5CWZA 4G3EA 5F94A 4EQUA 3R8LA 4DG3E 4XOZA 3UOKA 3MH3A 2H6DA 1KE7A 1YI6A 5AV2A 2VO7A 4GJ2A 2XRWA 4AW0A 5BVOA 5GIPE 5EW3A 2A27A 4QMMA 3Q9YA 4B7TA 5L2IA 3UODA 4C4FA 5EYKA 3HECA 4DGGA 4OBQA 1IEPA 1OIRA 4RC2A 4TTHB 5FLFA 5KHWA 3EN7A 4MH7A 2OGVA 5HO6A 4ZZMA 3V5LA 4D2RA 4ERKA 2ITWA 2XIRA 3GCUA 3F82A 2WMQA 1K9AA 2UVXA 4FSMA 4S33A 4YSJA 5JN2A 4JQ8A 3HMPA 4JR3A 3PVGA 2BILB 4NT4A 4XNEA 2PULA 4AE9A 4H3PA 5DEWA 1XWSA 5AP1A 1O9UA 1ZMWA 4CYJA 2XIZA 3GOKA 3DK6A 3F5UA 4RIOA 4YZDA 3T9IA 5A4EA 4M66A 4BI2A 4F7LA 4YJSA 1YI4A 4Y83A 2OFVA 2CGUA 5CVHA 5I3RA 4MF1A 2PY3A 4EHZA 4HW7A 4FK6A 1YOLA 1MQ4A 4WSYA 3NZ0A 4JX3A 3BBTB 1J1CA 5CF4A 4XJ0A 4ZLZA 5C1QB 3BHUA 3OWKA 4AFEA 4HVDA 4PMMA 3NWWA 4RWIA 3Q9WA 4C4IA 2BRBA 3S3IA 4DTKA 2P33A 5AV1A 3SVVA 5CTPA 3TUDA 4WG5A 5AP2A 5H8BA 2QG5A 2WIPA 5CU4A 2G9XA 4D1XA 1CKPA 1BX6A 5IH6A 3NIEA 3UO4A 3GU5A 4I4EA 5HVYA 2WEIA 4UYAA 2J90A 2C4GA 3H30A 2GNHA 2HY81 1U5RA 3WIGA 3GC8A 2EB3A 2VX1A 2C5VA 2OXDA 3EN6A 1FVVA 3EN9A 3PA3A 4II5A 5IA2A 5FTGA 2X7OA 5H8EA 4DFXE 3HUCA 3GNIB 1JSTA 1YXSA 3RTPA 1KOBA 3R7EA 5LOHA 4J71A 3HKOA 5JKGA 5HCZA 5A4CA 3FC2A 4L46A 5CX9A 5AP3A 4G2FA 4G16A 3TIZA 4A06A 4YR8A 2XA4A 4BR3A 3QLGA 3NVKI 3VC4A 4MHAA 2QU5A 5L2TA 3GCQA 3A4PA 3RK5A 3E3PA 3IPHA 2A0CX 4K33A 4AFJA 3UO6A 3FL5A 2WTCA 3GUBA 4FNYA 4QP3A 4XG7A 3Q3BA 4AN3A 5A9UA 2CKOA 3OXIA 4A9UA 3Q2JA 2I0VA 3OBJA 2JAVA 4I21A 4C36A 1B38A 3PIZA 3R00A 4PUZA 4DN5A 2J4ZA 3DT1A 3FE3A 4NTSA 2UVZA 5ANEA 1PJKA 5CEMA 5IH5A 1PHKA 3MVHA 5TF9A 4LYNA 4YNEA 4FTLA 4ALVA 4BDAA 5HU9A 2QOKA 3TT0A 5AUXA 3ATSA 4PPBA 5BVFA 2R3NA 2QHMA 5CAUA 4R7BA 4MXYA 4YNOA 2UW7A 2VTNA 1R0PA 3RPOA 5IA4A 2E2BA 4Q9SA 3Q4ZA 2CNVA 2BHEA 3WI6A 3DXQA 4FL3A 4EH6A 3BE2A 2DUVA 4NZWB 4WHZA 5KX8A 4I6HA 2WB8A 3OVVA 4GG7A 2XK4A 2IW8A 4BTFA 2NPQA 5I9VA 1BL6A 5JH6A 2C0IA 5C4LA 3KF7A 3GU6A 3VQUA 3DK7A 1XHAA 2QU6A 3KRLA 4P4CA 4CD0A 3OXTA 1HOWA 4I41A 3NUAA 4B8MA 4KIKB 3M2WA 2X39A 3DK3A 4B99A 3D0EA 3H10A 4FX3A 2GCDA 3CCNA 4RJ3A 4EHEA 3THBA 3TNHA 3NS9A 3ZUUA 4KINA 5HD4A 4JL9A 2VGPA 4IB5A 1PXIA 4U3ZA 2WMBA 5T6KA 4F9BA 4DGLC 4E3CA 3MESA 2OFUA 2BALA 1KSWA 4QTEA 4FOCA 3P79A 3VQHA 1JVPP 4O81A 2BFXA 3U51A 5IU2A 5C26A 4DBXA 2G1TA 3HV4A 3A60A 4EJNA 1YXTA 3KU2A 3NUYA 5CXHA 2J0IA 4LRJA 2W7XA 4FKOA 4EONA 5GZ8A 2VWZA 3L8VA 3FHRA 1SVHA 3VWAA 5K4JA 5EFQA 3RWQA 1G3NA 5KE0A 2QCSA 3GQIA 3QX2A 3FZTA 4USEA 4BIEA 3DDPA 5ANKA 3EZVA 2H9VA 4GW8A 2XBAA 3CPBA 4I4FA 2IJMA 2CGWA 3T3UA 3ZU7A 2JKMA 4EOQA 2QO7A 3W2OA 4O27B 1H0WA 4TPTA 4DLIA 2Y4IC 3QGYA 1M2PA 1Y6BA 2Z2WA 4EH7A 4QMQA 3O7LD 2QOOA 3D83A 3O50A 4WG4A 4F0FA 4XCUA 3HA6A 4MXCA 4DFZE 3BQCA 3QCQA 4FSQA 3TN8A 1YHVA 4OTPA 4D28A 3R02A 3Q4UA 4ANQA 4YURA 2YWVA 4TWNA 3IW7A 4MAOA 5CI6A 3F6XA 3VN9A 2X6EA 3W33A 2UZLA 5BVNA 4O82A 4KUJA 3FY0A 4RT7A 5HG7A 4IZAA 3A8WA 1ZXEA 5LVPA 1Q8WA 3DXNA 3MPMA 4CV8A 3BGZA 3L8XA 3FYKX 4DINA 5K5NA 3ZO4A 4C7TA 3DZQA 3JPVA 4C38A 1PXJA 3NIZA 5I5ZA 2QOHA 5CEOA 1YOJA 2QR7A 2XZSA 4IAFA 4WO5A 5M09A 4HGEA 3UZRA 2E9PA 3C7QA 4UWYA 4O0VA 4IBMA 3ACKA 4OGRA 3VUHA 3E93A 1TQIA 2WZJA 3ZYAA 3WIKA 4RIXB 3IOKA 3AXWA 2Z7RA 3UOJA 4GV1A 4ASDA 4ORKA 1CKJA 3BLHA 3PIYA 5CSVA 4DEAA 4EH3A 5DN3A 1OITA 5KO1A 2RFNA 3SG9A 1H25A 2GNJA 3DNDA 3AGLA 5CNOA 3PIXA 3ZZWA 2XNEA 3ZEWA 4U6RA 2G01A 3NSZA 3OEFX 2C0TA 5HLPA 1A48A 3PPJA 5KCVA 3V04A 4MXAA 4DTAA 4I5HA 5L6OA 3DBFA 2ITNA 3EQHA 4NM3A 3VS5A 4JIKA 3UP7A 4IAIA 2ZV9A 3DBDA 3NYXA 3UQCA 1PYXA 4QMVA 1Y57A 4FNZA 4XV9A 2FO0A 2VN9A 3EFLA 1V0OA 4NL0A 5CS6A 4X3FC 2BIYA 3GI3A 4BIDA 3P5KA 4XLIA 3I81A 3QKLA 3ORMA 3OBGA 2PE2A 2XK8A 2JITA 3UYTA 3U9CA 4NCTA 5ANDA 3W2CA 3ETAA 5JQ8A 5IA1A 1H8FA 2RL5A 3PJCA 2VTAA 1P14A 4JDIA 4P5QA 3EKNA 3I5ZA 4QTAA 5EW8A 2WMSA 5I3OA 4EOIA 2X2MA 4HZSA 2UZVA 3MJ2A 4CSVA 3V8TA 3FI4A 3MWUA 4X7QA 4C02A 4GKHA 1O6LA 2XJ0A 4AP7A 4NJDA 3VBQA 5DYJA 1UNHA 3LAUA 5EDQA 2OU7A 2BZHB 5M55A 1URCA 3SX9A 3KXXA 4DCAA 2PMLX 5I9UA 2XMYA 3UNJA 3ZOSA 4BCOA 2R4BA 2B52A 2XKCA 2HW7A 4FKWA 3T3VA 4QMZA 5AR7A 5HZNA 4XG9A 4FVRA 1Q3WA 4BZNA 4BCFA 1L8TA 3TKHA 4I5CA 3QHRA 4E4LA 3OTUA 2WQEA 5LQFA 2X4ZA 4D58A 3QQKA 5BYYA 3KRWA 5AP6A 3MH2A 4RG0A 2WQNA 1Q62A 3TUBA 3R1NA 4FKRA 4C2WA 5J9LA 4RBLA 2VD5A 5M53A 4FTNA 4TYJA 5C8KA 4IE9A 4BDKA 5D11A 3SOAA 3E7VA 3AT3A 2G2FA 2PVJA 2YM8A 1GNGA 3VUKA 3A61A 2NRYA 4CT2A 4BDDA 5FXQA 3WYXA 4B0GA 4EHVA 5JFWA 4GIHA 4P7EA 4YBKA 3Q4CA 4O7LA 4FL2A 5H2UA 4G3CA 1UKHA 4I92A 3KFAA 1JKKA 4GFMA 1OKVA 3AQVA 5E1EA 5CSPA 3GFEA 4L42A 3GC7A 4RWKA 1I09A 3R1SA 2IPXA 3PZEA 4X0MA 4O1PA 4U40A 5JGAA 3QALE 4ZTLA 1IRKA 3A62A 3ELJA 3F61A 3KVXA 3NNWA 3QZIA 1FINA 2WD1A 3QTXA 4G5JA 5E8WA 4Y95A 3LJ1A 1IAJA 2PE1A 5K3YA 3D5UA 1KUTA 2JBPA 4QOXA 3V5QA 4U41A 4LI5A 3COHA 4QP8A 4F08A 2VTOA 2IG7A 4TT7A 3ZFXA 3GP0A 4GK3A 3WF9A 2H34A 5EM5A 5FGKA 4FIJA 4KB8A 2YDIA 4O91A 5EM7A 2YM6A 4FKLA 2X9EA 2C6OA 2VWWA 4C0TA 3W16A 3QD4A 1XH9A 4USDA 3HX4A 3PY1A 5IQBA 5L8LA 3OWPA 3BZ3A 2RF9A 5DLSA 5AA9A 3ZRMA 2W9ZB 4HCVA 3ID6C 5KBRA 1P5EA 2B9FA 3FKLA 2WFYA 4HJOA 1OUYA 4YZBA 1R78A 1YWVA 3P7AA 3QUDA 1ZRZA 4FTJA 2RFDA 3QD0A 3V5TA 1YKRA 1OECA 4DH5A 4EI4A 5BPYA 4DLJA 2WTJA 2OLCA 3CD3A 3DTWA 1FMKA 1VR2A 3EB0A 3KVWA 4L8MA 4PTGA 4UZHA 4Y8DA 1OL6A 5ETAA 4BDGA 3OCGA 4Q2AA 3QTUA 5JSMA 4O7YA 1U5QA 2BDWA 1H1PA 4YHFA 5EHYA 4R3RA 1ZOGA 4C62A 4FTKA 4BDIA 5JMSA 3O8PA 3Q04A 4C57A 1Y91A 5IMEA 4Q5EA 4HYHA 3LFAA 4K77A 3NAXA 4H39A 4RJ6A 2XKDA 3C0IA 4ACDA 1J3HA 5B2LA 3DKFA 3M11A 1YHSA 3RJCA 3NUUA 3BU5A 3PJ8A 3TDWA 4XP3A 4FTUA 4A4LA 4DHFA 5IPJA 3VAPA 3TJCA 4TNDA 3TG1A 3KRRA 4RJ7A 1WVXA 4BDFA 4EBVA 2B1PA 3RHKA 4EH9A 5AV4A 1OL7A 2HW6A 4XS2A 3WZKA 4CFVA 3ITZA 1CSNA 3EQDA 4K11A 3ZBXA 3OG7A 4MTAA 4BDHA 4IB3A 4J96A 4ZSJA 4YTIA 4Y85A 2IW6A 4V0GA 1PXLA 2ZMCA 4HVGA 3D7TB 5EYMA 4RLKA 5LVLA 2XCHA 5KZIA 3MA3A 3R7VA 3SRVB 4DE4A 4LMNA 4IFGA 4USFA 3IGOA 1O6YA 4G1WA 4CMOA 4JIAA 4PL3A 2PUNA 4ZTMA 5F95A 3DLSA 4F9CA 3GVUA 1XH4A 3VS6A 4E8AA 5KMIA 2CN5A 4PTEA 2P55A 1GZKA 3RM6A 4CYIA 3WZJA 5J9YA 2O65A 3LXKA 4QQJA 3U8WA 2B55A 4J7BA 4EOJA 1OBGA 2OIQA 3E62A 3L9PA 4JG7A 4D2WA 4JDKA 1LR4A 2GSFA 3LCOA 3FZPA 3HAVA 2GNIA 2EVAA 3NUXA 3P9JA 4OBPA 4XG4A 4EH8A 3ZBFA 3DA6A 5J7BA 5AV3A 5IA3A 2OSCA 1FGKA 4AG8A 4I5MA 4J99A 3KREA 3R7YA 4BTMA 2GHGA 2ERZE 2PUUA 5EDRA 1W8CA 4RRVA 3UTOA 1OKZA 3IW6A 3FJQE 2J0LA 3O71A 3HMMA 4WUNA 4F7SA 5D12A 4FTRA 4WRGA 3FEGA 3MFTA 3I6WA 4MD8E 2F2CB 4NIFA 5HU3A 5LVOA 4N57A 1V0PA 3NEWA 4ZY5A 3CGFA 1PXKA 2W99B 3N9XA 2IW9A 4WBOA 2BHHA 4F0GA 4KS8A 3OY3A 4O7RA 1Q5KA 4IANA 1GZ8A 3PTGA 4R3PA 3ZC6A 3P1AA 3NUPA 3PY0A 4G6OA 4JOAA 4K0YA 4LFIA 3SAYA 5D9HA 3PLSA 4K9YA 4YU2A 1PYEA 3GQLA 4E73A 3CD8A 4ZY4A 4O7NA 3PJ1A 3MSSA 3A7IA 5DWRA 3ZO1A 4ZLYA 5F9EA 5CSHA 3DU8A 3BLRA 4W4VA 1M7QA 3DBEA 4UWCA 1JOWB 1U54A 3IGGA 3LCTA 1PY5A 3UBDA 4KIPA 2OH0E 3PXYA 2UV2A 4GK4A 5DG5A 3UO5A 3MN3A 4YUQA 4CT1A 5HIEA 2DS1A 2WU7A 3BHTA 2IZSA 4EOSA 5FDPA 2JDOA 3ZDUA 3HEGA 4TYHB 4N4SA 2UZNA 2HIWA 4QTCA 2OG8A 4U80A 2GS2A 4J8MA 4ACMA 3R1QA 2EXCX 4U97A 4H05A 2BMCA 4ID7A 2RFSA 2FH9A 3HV3A 2VTJA 3Q52A 1AD5A 4HPTE 2XNPA 4O0UA 3WE4A 4F1TA 2B9HA 3OROA 5JT2A 1JKSA 3FZ1A 4DEIA 5FD2A 4BCQA 4BCPA 5IQCA 3ZRKA 3JXWA 3TV6A 4ACCA 3PPZA 1K2PA 3UOLA 5BX0A 3NMUF 2YAKA 3FLZA 4BDJA 3KN5A 5HHWA 3R9DA 4CQGA 4EH2A 4GT4A 3SOCA 4D4SA 5J1VA 3VJNA 2XNNA 1OIQA 3L9LA 3JUHA 1IG1A 5E8SA 3E5AA 2AC3A 2J5FA 3FQHA 1JSVA 4U3YA 3GBZA 5ANOA 2YJRA 3MFRA 4OBOA 3V5PA 4X3FA 4YC6A 2FB8A 3R8ZA 2VWXA 3TTJA 1YDSE 2UW6A 3NUNA 4JLCA 4NSTA 3FQEA 4P2KA 4EHGA 4EK8A 4FA2A 4MX9A 1KE6A 1XBAA 1QMZA 2O5KA 3LCKA 1SMHA 2RG5A 2NP8A 3KY2A 2OJ9A 4WNMA 5AR2A 4CG8A 1UKIA 5J7HA 4PP7A 3RWPA 4I5PA 1GY3A 2XVDA 2C3LA 4XRLA 1ZYJA 3R21A 1E9HA 4XG3A 5FEDA 5BYZA 4IJPA 2OICA 3WYYA 2OXXA 4JT3A 5I9YA 4RC3A 4GT3A 3VS2A 1QCFA 3QUPA 4OTHA 1WVYA 5FTQA 3NRMA 4AXAA 1VJYA 3GEQA 2OWBA 3CS9A 3LFNA 3MI9A 3LFCA 3MS9A 1XQZA 1B39A 4HGTA 4LOQA 3RP9A 3I6UA 4U79A 4U45A 3R7UA 3BV3A 3OXZA 5L8JA 2XH5A 4GYGA 3RM7A 1W82A 5C8NA 4IDTA 1YXUA 3UVPA 3QBNA 5IH4A 4IZ5A 4WT6A 4CFXA 3C4WA 2CNUA 5KMOA 4TYIA 4G3DA 2JBOA 4XG2A 4U44A 2GS6A 4PY1A 4PQNA 3C4FA 3NYOA 4N6ZA 5IQAA 2GNGA 4OTWA 4MYGA 4WBBB 3P4KA 3TKUA 5E8TA 4HGLA 4YJNA 3QD3A 3FXZA 4AZSA 3KN6A 2HWPA 3TZ8A 2B54A 5D1JA 1NXKA 5IUHA 3K3IA 3B2WA 3ZXZA 5ICPA 4XLVA 4KS7A 1O6KA 5A54A 3LVPA 4H3BA 3MVJA 4O7TA 3RALA 4AZTA 3BU6A 3ERKA 3KA0A 2CN8A 4YJUA 2W9FB 3DKGA 4EORA 4QMYA 4CFMA 4HVSA 4DT8A 3WBLA 1LPUA 4LGDA 3OCBA 3EQGA 3CJFA 3CQUA 2PU8A 4ANBA 1GAGA 1M2QA 4QMPA 4BGGA 3ATTA 1DI8A 3BV2A 3HZTA 3WF6A 3E8NA 3IS5A 5M56A 5M4IA 4M84A 5KHXA 4O7SA 5KNJA 2GS7A 4OTGA 5CU2A 4AW2A 3LFDA 3UQFA 4XG8A 1J7LA 1QPEA 1KV2A 4EL9A 5HGIA 3RPSA 5HVKA 5IA5A 1YXXA 4EUTA 2YN8A 1PMVA 4QP9A 3R8VA 2R9SA 3CKWA 1OMWA 3QWJA 4TN6A 3RMFA 4A7CA 4BI1A 4FGBA 5FDXA 5H9BA 4TW9A 4Q5HA 3CBLA 4D1ZA 4YJTA 3OOGA 3FMLA 4LQMA 4JG8A 5IQGA 2OH4A 4L45A 2P2IA 3LLTA 4MXZA 2WTIA 5E8YA 3TIYA 1I44A 2B9JA 3HRFA 4KKHA 2BZKB 2Q0BA 2A2AA 2PZRA 2XK7A 2Q0NA 4EK5A 4DYMA 2NNWB 2BFYA 1NVRA 2VZ6A 3OOMA 4RVTA 4KBKA 4AS0A 4JG6A 2WKMA 1ERKA 4CKRA 5IISA 4M67A 3EL7A 2BKZA 4BZDA 2VUWA 4DEBA 5FTOA 4AQCA 3O8UA 4L43A 3MDYA 5JZNA 4XV1A 1WBWA 3VHKA 4EQCA 3MTFA 1H0VA 1AGWA 1Q3DA 1GZOA 3N51A 1Z9XA 3ANRA 3HMNA 3QA0A 1Q61A 3P23A 4QO9A 4EKLA 4ZJVA 3ZFYA 1ZYSA 4ZLOA 2HOGA 4NK9A 4R5SA 3FPQA 2UZUE 3D94A 1PXNA 3FL4A 4KRDA 3V8SA 2W5BA 3F9NA 1A9UA 2GU8A 2BAQA 3NDMA 5HO8A 4DT9A 4OT5A 3H9FA 3UMXA 3MIYA 4KA3A 4MVFA 4D5KA 4ZZOA 2X6DA 4PL4A 4QT1A 2PUIA 5HX6A 4FEVA 2VGOA 2E9NA 3ODYX 4U7ZA 4YGAA 4XH6A 3QD2B 1QPCA 3AT2A 3N4UA 3EH9A 3VBVA 4JJRA 4CCBA 5AM6A 4D5HA 3DV3A 4FTTA 4ZTNA 1PXOA 3O0GA 4O2ZA 2PMIA 1FGIA 4IZ7A 1OB3A 3Q9XA 3UOHA 4GEOA 3I5NA 4F1OA 2I7QA 4G6LA 2ONLC 2W4KA 1E1VA 3O8TA 5HD7A 5M06A 3ZSGA 3D5WA 3TKIA 4B6LA 3OHTA 1KWPA 3ENHA 4FV7A 3BEGA 2QOIA 5GJGA 3ZHPC 5LXMA 1APME 2OJJA 3PXRA 3PY3A 3R7GA 4MWHA 5EOBA 3R63A 3FLYA 4BDBA 4Y5QA 2HK5A 3HDNA 4GVJA 4IQ6A 4JQEA 3FXXA 4I3ZA 1YWRA 3FMJA 4I6BA 5GINE 2Z8CA 3G9LX 3ORKA 5EYCA 4FI1A 1JNKA 5AIKA 5DGZA 3TXOA 4E93A 4F64A 5K9IA 2B0QA 4BBFA 3IDCA 5CNNA 5B2KA 4LRKA 4IVAA 1UU3A 4D55A 2EU9A 4F1MA 5AUYA 4UBAA 3HP2A 4O0WA 1PKDA 2WMRA 1H1RA 3FAAA 3I7BA 3OS3A 5ETFA 5HI2A 2HZIA 4G17A 4O7VA 2BZJA 3NCGA 3QWKA 3MH0A 4KKEA 1WVWA 2JLDA 4L7SA 5FM3A 3TL8A 5CAOA 3PWDA 1BYGA 2QURA 3BYSA 4BKJA 3PYYA 4MD9E 2ZM3A 3TZ7A 2OW3A 2OXYA 3QUEA 5B7VA 4KBCA 2NRUA 3I1AA 4NUSA 4IZYA 4YZCA 5CALA 3C5IA 3EL8A 5M57A 3RPVA 4M69B 4C4GA 5IQEA 1ZARA 4YZMA 3E8EA 3R9OA 3F3ZA 4D4VA 5E8XA 1URWA 4QPAA 4EK4A 4CFWA 1GIJA 4IVDA 1WAKA 4PV0A 5EK7A 2V7OA 3QQJA 4FIFA 5EDPA 3W2RA 3UPZA 4FEXA 3QRIA 3RCJA 2PPQA 4AA0A 4D2PA 5AR3A 2G15A 5HTCA 4I0RA 2KTYA 3QQGA 4KIOA 3FWQA 3R6XA 5HVJA 5IDNA 4MNEB 2E9VA 3BI6A 4RVLA 5BVEA 4DEEA 2EXMA 3QFVA 5AMNA 2C3IB 4FKVA 3WZUA 1H1WA 3H9RA 3NX8A 3FYJX 4WSQA 2CKQA 4EC9A 5HE0A 4MNEA 1ZLTA 5DR9A 3O2MA 4NKSA 4K6ZA 3RVGA 3LXLA 2I40A 1A06A 1R39A 1W7HA 2GFCA 3BELA 5C4KA 3BRBA 4BCNA 3Q6UA 1BI7A 2ACXA 4XP0A 4FUXA 1FVTA 1RE8A 5CEIA 2GHLA 4ITHA 3BHVA 3PVWA 3PG1A 4FV1A 2A19B 2C3KA 4K8AA 4EOPA 4QMTA 3V8WA 3VIDA 4L53A 4C4HA 2GQGA 4KIKA 4AGCA 4GSBA 4ARKA 5M4CA 5M51A 4FSZA 3KXGA 5JGBA 3QC9A 4DGNA 1IR3A 4J98A 1SYKA 5L6PA 4XRJA 5K4IA 1WBVA 4FV0A 1SVEA 5CU6A 5JRQA 2IZRA 2BKKA 4XBUA 4L01A 1R1WA 4UMTA 5JFSA 2CDZA 3K5UA 3A7HA 5L4QA 4WNKA 4AX8A 1LUFA 4WNPA 4N6YA 3FSFA 5BVWA 3D14A 3QRKA 4JBOA 4DEGA 3FMNA 2OZOA 2VNYA 2OIDA 5HBJA 3KCKA 2YHVA 1BUHA 4L3LA 4X2FA 1IASA 3RKBA 5KUPA 4BICA 2OF2A 3S4QA 4F09A 2JEDA 3Q53A 3Q5ZA 4UMQA 2C1BA 3MBLA 3MJ1A 4CMUA 5GHVA 2F4JA 2PVYA 2ITYA 3NW5A 2JD5A 1PXPA 2QOBA 3A4OX 4FZAB 4YSMA 3ULIA 5DMZA 5FXSA 1SZMA 2YEXA 3BHYA 2BDFA 2HWOA 3JS2A 5FG8A 4OUCA 2R3IA 2IZUA 2W4OA 3HV5A 5AAGA 3G9NA 1FVRA 4K18A 3DB8A 4RWJA 3F3UA 2C6LA 4RIWB 4GG5A 5A4LA 4V04A 3WF8A 4PNIA 3CLYA 2PMNX 3AMAA 4EOLA 3AC8A 5C27A 4R7HA 1EH4A 2QHNA 3QF9A 4FSUA 3ZLSA 2PK9A 2YITA 3C9WA 4E4MA 3EHAA 3R30A 3KK8A 5HBEA 2WTKB 3S0OA 1Q8UA 4XEYA 4DG2E 4Z3VA 3VHEA 4GMYA 5KKRB 1RDQE 3Q5IA 4DBNA 2O64A 4QTBA 1TVOA 5CSXA 3II5A 3VUMA 4F65A 3ZZEA 1KE5A 3UQGA 1XH5A 2IZTA 3N4TA 1B6CB 4JXFA 2JKKA 2XF0A 2Z02A 1ATPE 4ASZA 3L1SA 1V1KA 2P0CA 4M14A 4DAWA 5IDPA 5KZ0A 3VBYA 4AW5A 2PL0A 5J5SA 2CGXA 3TM0A 5JRSA 4O7ZA 1E1XA 4G9RA 2XKFA 4MNFA 1ZMVA 3CEKA 4LGHA 4RIXA 2UW5A 4U0IA 2OF4A 2OO8X 3UVQA 3PSDA 4A9YA 3RINA 4UXQA 4GFGA 3W8QA 4X6QC 3I79A 2W1DA 4LRMA 4APCA 1XKKA 5AR5A 3DCVA 3RAIA 4ANSA 1PXMA 3GFWA 1H1SA 2CLXA 4CKIA 4YLKA 2ERKA 2OK1A 1PMNA 2UW4A 4RQVA 4QD6A 5DHJA 3E8CA 5FP5A 4EC8A 3VUIA 4I94A 4EOKA 4F6SA 1Q97A 2XP2A 5AX3A 5C01A 3U4WA 3DAEA 3K54A 5KMKA 3D2KA 2Y7JA 3W8LA 1RJBA 5FEQA 4J95A 2BUJA 3QYZA 3TACA 1MUOA 3F7WA 3O51A 3MYGA 1ZYLA 2QKWB 1GIHA 3COMA 2YABA 4GFOA 2J2IB 2V0DA 3U6HA 2R3LA 4DFYA 2IVUA 5BMSA 3EYGA 2C69A 2RG6A 4F9AA 4X2JA 4CXAA 4CZTA 5T3QA 3QQLA 2XUUA 3TI1A 3NGAA 3V6SA 3E88A 3MB6A 3AC3A 3SD0A 3VUGA 4GVAA 4QPSA 1K3AA 4X2GA 4IJ9A 2X8IA 3W10A 1CMKE 5EQEA 4ANOA 2P4IA 3L9NA 4CCUA 4JBPA 3IQ7A 2W4JA 3MW1A 1XBBA 4XOYA 3CIKA 3MY1A 5A46A 4GUBA 1JWHA 3IDPA 4DEHA 3ROYA 5AIRA 3RNYA 4BN1A 3ZXTA 4XHKB 1ZYCA 2R3MA 3NR9A 1BLXA 2PZIA 3F69A 4WUAA 5TO8A 4ALWA 1UV5A 4GUEA 4ZSAA 3ZM9A 4E5AX 2SRCA 2OJIA 4M12A 1DAWA 3UIBA 1UWJA 4FR4A 2LGCA 4D2TA 4HPUE 3PLAE 4FKPA 3PJ2A 4MK0A 1W83A 4L67A 4KABA 4E6CA 4RVMA 1IAHA 3LW0A 4G5PA 2JC6A 5DIAA 4F9WA 1H1QA 4CLJA 4W8EA 4ZSGA 1BI8A 4S31A 2YLEA 3FBVA 5B2MA 4L3JA 1GJOA 5B0XA 4MQ1A 4D4YA 4IX3A 1OGUA 2VRXA 3HVCA 5D10A 4ZZNA 5DH3A 1QL6A 4PWNA 4RJ5A 4CG9A 4UV0A 1LP4A 3DQXA 4CVAA 3D5XA 3O23A 5A14A 4FEWA 5CQWA 2O3PA 4DGMA 2X4FA 4ANNA 4KBAA 2YACA 1OPLA 2C6IA 3DNEA 4M13A 3AD5A 4JQ7A 4RLLA 5DFPA 3ORLA 4BBMA 2GHMA 2XCKA 2F57A 1FMOE 3MIAA 3F3WA 2XNOA 2RKUA 2CHLA 2UW0A 1P4OA 3CJGA 3PZHA 4IDVA 4IM2A 1Y6AA 4UEUA 4QP7A 3ZDIA 5BUJA 4NFMA 4FT0A 4W4YA 2J5EA 4LOPA 2JKOA 2XEYA 4MWIA 2PZYA 2X8EA 3KMUA 3EFWA 3O17A 3LQ5A 2CJMA 2PVRA 2VTRA 2W96B 2ONLA 3KK9A 1JPAA 3FI8A 5EQYA 5IQDA 5KMNA 4BWPA 4FV6A 2YISA 2ITVA 3OCSA 4WD5A 3ANQA 5L2SA 2W1GA 3O7LB 5IEYA 2BRNA 5IF1A 2XK9A 5BVKA 4HNFA 2QI8A 4CFFA 1WBNA 3UP2A 1OKWA 2J0KA 3GU4A 4W4XA 3BYVA 3OT8A 5JGDA 3EFKA 2J50A 2QR8A 3F7ZA 1NW1A 2C3JA 3V51A 1Q99A 4O0RA 4CZYB 4BDCA 1G8SA 4CGAA 3R7IA 4I24A 4A9RA 1SNUA 5A3XA 3M1SA 4JAJA 3GU7A 5AUUA 3KRJA 4BFMA 4DFUA 1JKTA 2QQ7A 5A6OA 2YM5A 4IX5A 3EFJA 4M3QA 1RQQA 3QTZA 4C59A 1MRVA 2QG7A 3SQQA 3HDMA 3AMBA 4BWKA 4AA5A 1F5QA 4QMLA 5AFVA 3TZMA 2UZOA 3VJOA 5DI1A 2EXEA 3KULB 4XBRA 2X7FA 3U6IA 1ZOHA 3W2SA 3RHXA 3I4BA 4N0SA 2I0EA 1LEZA 4R7IA 3P7CA 2NO3A 3PXFA 3R8MA 4BWXA 5E9EA 2R3FA 4OAUC 2H96A 2XM9A 3RPYA 3L8SA 4FTAA 4BHZA 4PF4A 1KOAA 3DKOA 4HCTA 5LMKC 4S30A 1H28A 2W1EA 3V5WA 3ALNA 3R9NA 4ANMA 1REJA 3BU3A 2W1HA 2W5HA 3QC4A 2R3QA 2F2UA 2QLQA 5D41A 5FQDC 2OJGA 4QP4A 4ASXA 5AP4A 3UZPA 3NUSA 3B2TA 5EKOA 4LUDA 3DJ5A 1H4LA 1XBCA 1ZMUA 3VUTA 2WNTA 1AQ1A 2AYPA 3IW5A 4BDEA 4C58A 2UVYA 3VS4A 3D7TA 4RFZA 4IACA 4D2SA 5LCJA 5M08A 1Y8GA 3FZSA 3QCYA 2R3OA 2WXVA 4IB0A 4O6EA 3SRVA 3LKMA 5ACBC 4CRSA 2VAGA 1MRYA 3CY3A 2C5NA 2Z7LA 5CF8A 3CY2A 2G2HA 1OVEA 3A7JA 2ITUA 2J0MB 2XIYA 3JR1A 4RX5A 2RFEA 4DH3A 4BHNA 1UU8A 3GCVA 1UU7A 4RPVA 3U9NA 3I0OA 3PP0A 3Q60A 4GJ3A 1IA9A 2ETKA 2PVHA 5DRDA 5ITAA 4I20A 2JKQA 4QMUA 5E8VA 5AEPA 1J7IA 5CF5A 2YWPA 1OL2A 2YIYA 2ZMDA 3OZ6A 4ACGA 4ZIMA 5HOAA 3ORXA 4QQCA 4YHTA 3U4UA 2OBJA 4ENXA 4PDYA 3TNQB 3AC2A 4UMRA 4BKZA 5CANA 4GIIA 1J7UA 3LQ3A 4S34A 3VNTA 4PX6A 3ZEPA 3EQPA 1ZY5A 2UZBA 3NLBA 4M68A 2VTTA 4P5ZA 3WE8A 4QNYA 2A4LA 4F9YA 3FMEA 4O21A 2YLFA 2CGVA 5C03A 3UGCA 5E91A 3HAMA 5JEBA 2XNMA 2VTHA 3KMWA 1Z57A 5EYDA 2WEVA 4QYGA 2Z7SA 2Y6MA 5FM2A 4LV8A 4NWMA 2PTKA 3CQEA 2BR1A 4AU8A 3QTIA 3QLFA 3R01A 2O63A 1FBNA 5I9XA 1BKXA 3E64A 2PVNA 2YERA 4FVPA 3UNKA 4G31A 4BY9E 3REPA 3EMGA 3PRFA 4QMOA 3VUDA 3TWJA 3MFSA 2JIVA 4FSNA 4GS6A 2HZ0A 2IO6A 4HGSA 3QYWA 4FE2A 3W2PA 3E87A 1U59A 3BWJA 3SW7A 2WAJA 2R3RA 3C4XA 4YC8A 5DT3A 2B53A 4AWIA 3FMHA 2BCJA 4EJ7A 4YJVA 3AC1A 4EZ5A 4D0XA 2ZV8A 3RPRA 1T45A 3F2NA 4CTBA 4CLIA 4MXXA 4TWPA 3TCPA 4IWQA 1CTPE 3CTJA 2WIHA 3QCSA 4R6VA 4FTCA 3ZFMA 4TYHA 4MXOA 3SG8A 3ORPA 4PDSA 3KXMA 4CNHA 4TNBA 5HE1A 2BRGA 3UJGA 2PMOX 4FUYA 4NU1A 4Y72A 4C3FA 2BDJA 3LOKA 4RIYB 4FKTA 4C37A 5CEPA 3PXQA 4IWPA 2OJFE 4FV9A 5HO7A 4EZ7A 4QP1A 3ALOA 3NPCA 1W84A 3Q4TA 4J52A 4FKUA 2E9UA 5IQHA 4ZJIA 1GZNA 1J91A 4R8QA 3KGAA 2PVFA 1OIYA 3KCFA 5EOLA 4FZFB 3EIDA 2X81A 4FG9A 4KWPA 3CQWA 2CLQA 3WILA 1PKGA 2B9IA 3CTHA 4G9CA 4ZK5A 5CZIA 4EKKA 3F5GA 4MF0A 1FPUA 2WMAA 2XK3A 3OC1A 2ITZA 5TE0A 3TDVA 3F2AA 3MVMA 4PMSA 4QNAA 4YBJA 4FKJA 5CXZA 2J9MA 4JR7A 3B8RA 3EQRA 5CI7A 5LCKA 3KC3A 3UG2A 4WKQA 2VX3A 1Q8YA 3W32A 4AT3A 2C6KA 3LJ0A 3MFUA 4BKYA 2OZAB 5EI6A 2PHKA 5EH0A 2ETMA 2VWYA 3LM5A 4YZNA 4IAKA 2JFMA 5J87A 3F5PA 4I0SA 3COIA 5LARA 5CAVA 2WTKC 4FNWA 2GFSA 3QU0A 2P2HA 3PPKA 5KKRC 4GK2A 3MPAA 4W9WA 4GL9A 2WOUA 4ZMEA 2C30A 4MQ2A 4FK3A 2I1MA 5CF6A 4JAIA 2CMWA 5BYLA 4FOBA 4XP2A 5DBXA 4PMPA 3TZ9A 5AM7A 3OEZA 2CCHA 2ITOA 4FT9A 3FI3A 4DC2A 4FICA 4W8DA 4CEGA 3EYHA 1HCLA 2W17A 3BGPA 3ORIA 3HP5A 5HE2A 1M52A 4QP6A 3LPBA 4M0YA 4AW1A 4Z55A 3D7ZA 3DY7A 5H3QA 2QKRA 3OUNB 4IC8A 4U81A 4JVGA 5AJQA 4EH5A 4UZDA 4QRCA 1JQHA 2IWIA 2RGPA 3POOA 2VTSA 2CKPA 4O0TA 1OM1A 5DPVA 2Z7QA 3KRXA 3VBXA 3SA0A 3BYMA 4H1MA 4RC4A 4DITA 2HY0A 5K5XA 4EH4A 3LXNA 4QQTA 5CAPA 3QTWA 1W98A 2I6LA 2R0UA 3BLQA 4ZOGA 3SLSA 4EQMA 5KMLA 3ZH8A 4CFNA 3LLAA 4E6QA 1H24A 5DE2A 4HYSA 4UMPA 3IONA 3RK9A 2R7IA 3JY0A 2PVLA 4L3PA 1WBPA 4O0XA 3H0ZA 5ETIA 3VS3A 4AT4A 3U54A 2E9OA 2FA2A 4YTCA 3QTRA 1JSUA 2YCFA 3TV7A 1ZOEA 4BBEA 3WOWA 4HVIA 3OWLA 5I0BA 2JDVA 2C47A 1F3MC 4BTKA 4PL5A 3HMIA 3R04A 4APPA 4DTBA 2CSNA 4NKAA 4JNWA 1UNLA 4FEUA 4O83A 2R7BA 4M0ZA 4R1YA 3RCDA 3S95A 3ZSIA 2PUPA 5BUIA 4F7NA 3MY0A 4HNIA 4KSPA 4XUFA 3MTLA 4O86A 3MY5A 1PMEA 3IW8A 2QOQA 2X7GA 1U4DA 4NW6A 1RW8A 2XYUA 3G5DA 3QKMA 2W1FA 4FT3A 1MP8A 3BQRA 3OW4A 4NH1A 5E7RA 5E8ZA 4ZY6A 4RX7A 4IW0A 4U42A 3HUBA 4F70A 3FLWA 4FSRA 5C9CA 3G0FA 3DLZA 5M4FA 4I1ZA 3E92A 2HCKA 3MH1A 3I60A 4Y46A 1H01A 3FSKA 2J0JA 3QQFA 4IMYA 5E8UA 3NCZA 4AZEA 3SXSA 4FKSA 3VBWA 4NM5A 4UALA 5HORA 3FKOA 3C4CA 5DA3A 5IQIA 2VX0A 3HMOA 3CKXA 4DFNA 4KRCA 1STCE 3T8OA 2BPMA 5AP5A 4KNBA 3FQSA 3C50A 1Q41A 3AD6A 4I23A 4FZ7A 1XH7A 1OPJA 2YAAA 3FC1X 3HV7A 4G6NA 3ZUTA 4AN2A 3DBQA 4IM3A 2JAMA 3DAKA 3AC5A 1XH8A 2WMUA 3P78A 4OR5A 1R0EA 5CQUA 2YM7A 4BCHA 4LV5A 2YJSA 3OT3A 3VF8A 4YJQA 4X6RA 5CAQA 5M4UA 3PJ3A 4X21A 4NYEA 3ZSHA 1YRPA 1YW2A 3W55A 5EHOA 4XV2A 4ENYA 5IEVA 5EQPA 3R8PA 3EJ1A 3QKKA 1P4FA 3CR0A 5HESA 1WBSA 2Y6OA 4ZP5A 4F6UA 3R8UA 5LMKA 2WMVA 2Z60A 1W0XC 4B8LA 1NA7A 4E6DA 4TL0A 4FC0A 5CU3A 4V01A 4P90A 5EM8A 2IN6A 4O38A 3NYNA 4QPMA 2QVSE 2C6DA 4FIIA 3C13A 1H07A 4MEDA 4XV3A 4DA5A 5G1XA 3A7FA 3BEAA 4BYIA 4GRBA 5JK3A 3QCXA 4X3JA 3BHHA 2V62A 3IG7A 3VS1A 3GU8A 4F63A 3PXKA 2QNJA 4LG4A 4IM0A 5AAFA 3K2LA 4ANLA 3FDNA 3MPTA 3SV0A 3FMMA 4IH8A 1ZWSA 5HX8A 5JFXA 1YHWA 2J7TA 5E4HA 5AUTA 1DI9A 3LCDA 4OTIA 5I4NA 3PP1A 3DDQA 4FF8A 2WQBA 1YVJA 2VWVA 1R3CA 2QLUA 4IHPA 1FOTA 4IWDA 3SDJA 3HRBA 2O0UA 4D4RA 2XIKA 3IO7A 3NNUA 5H8GA 4X2KA 5F4NA 2WHBA 3R28A 5LVMA 4FV4A 4L7FA 4R3CA 4NTTA 3UVRA 2JDRA 3TJDA 4C2VA 2C6EA 2W1CA 5BUEA 4RJ4A 4YPDA 1NY3A 4IAAA 2ZM4A 4MKCA 3KL8A 5CT7A 4CRLA 4DFLA 2YIRA 5HLWA 4FT5A 4OAVB 5EG3A 2HELA 4FODA 1OL1A 1DAYA 3ZONA 1Q8ZA 4BTJA 2UUEA 4AZFA 4FKQA 5M44A 3FXWA 2BTRA 4H58A 4M69A 3QZHA 1ZYDA 3SW4A 3BYOA 2X1NA 3LE6A 3CP9A 1KE8A 4D2VA 4CV9A 3C0HA 2VNWA 3HA8A 2XM8A 4L9IA 2GQRA 3ZUVA 2QONA 3GC0A 3P08A 4J53A 4KIQA 4LGGA 3PWYA 3LMIA 4ZXTA 2O8YA 1X8BA 4L52A 4AA4A 4ZTRA 4IC7A 3A8XA 4ITJA 1KE9A 4EYMA 5AAEA 2VO0A 3BYUA 4F7JA 3FPMA 5HQ0A 1XR1A 3IK3A 4JDHA 3LM0A 5HCXA 1U46A 3QQUA 4EYJA 3TTIA 1IA8A 5HTBA 4E26A 2P3GX 3NVMB 4DH8A 3AGMA 2V5QA 2YDJA 5FP6A 3F3TA 2JDTA 1PMUA 2ZV2A 4ZJJA 5G6VA 5ACKA 2YCRA 5L8KA 1G8AA 3BBWA 2WQMA 5HNIX 3KKVA 4FZDB 3UG1A 4EOMA 5JQ5A 4C34A 2W1ZA 2PWLA 2XS0A 3EQFA 3QRJA 3PFQA 4IX4A 1PF8A 3M42A 4E5WA 5J1WA 4XX9A 4X2NA 2YIQA 2PSQA 3Q9ZA 4JRVA 5J5TA 3F2RA 4UY9A 5HKMA 4OTRA 4CFUA 4Z16A 5IZFA 4J1RA 1CKIA 2VTIA 3PG3A 3PVBA 3IECA 1WFCA 4CKJA 2HYYA 3UDBA 1YI3A 3KXZA 3QRTA 4IAYA 4IXPA 4UX9A 2YIXA 4JX7A 3QGWA 4TY1A 3ZLWA 2PYWA 2FGIA 3LIJA 4FKGA 5AUWA 4A4OA 5A6NA 2Q83A 3L8PA 3A99A 3QAME 4ZSEA 3EN4A 3VO3A 1L3RE 2C0OA 5F1ZA 3RAWA 4WOVA 1ND4A 3S00A 3ULZA 1SVGA 3HYHA 4O0YA 2B4SB 1J1BA 3QX4A 4QMWA 4RFMA 5ETCA 5LMAA 5CENA 2W06A 4AGWA 3DZOA 3FMKA 5T68A 3A2CA 3QHWA 2RSVA 2YIWA 5EI8A 2R5TA 2BTSA 3P0MA 1OI9A 3BKBA 3O96A 3SKCA 2YM3A 1GOLA 1NVSA 2IVSA 5HIBA 4BGQA 3BE9A 3BPRA 4CQEA 4TWOA 5GIOE 4Z7GA 4QYEA 5HG8A 3TEIA 2BROA 4CTCA 3Q6WA 3QQHA 4HOKA 2R3PA 3AT4A 3PRIA 3GXLA 3UMWA 3S2PA 2FSTX 3CTQA 4IEBA 4OTQA 4AE6A 4BZOA 2FYSA 4FTMA 4IADA 2H8HA 3KF4A 3JY9A 2WO6A 2UW8A 3CE3A 4H1JA 4MBJA 4W9XA 2VWUA 4RIWA 4BRXA 4FL1A 4YO4A 5FXRA 2JIUA 3Q2MA 3BIZA 1QPDA 1ZY4A 3HL7A 4S2ZA 2WTVA 1DS5A 3RGFA 4TYGA 3D15A 3QTSA 2R3HA 2O2UA 2UZTA 4HYIA 3NNXA 4EK3A 4RX8A 4PNKA 4RZVA 2FSLX 1CM8A 4R5YA 1KV1A 5FUTA 3UC4A 3HV6A 3MV5A 2VWIA 1ZZ2A 3E63A 3LFSA 4QYFA 1S9IA 1WBTA 3TV4A 3GGFA 3ORNA 1V0BA 4FV3A 2C1AA 1TQPA 3OP5A 2WTWA 2X8DA 1PRYA 2JDSA 4RJ8A 2HAKA 3E8DA 5EHLA 3G6HA 3R9RA 3AOXA 4F0IA 4ONAA 5JFVA 2YZAA 2HZNA 3GT8A 4ACHA 5FBOA 2PVMA 3FZRA 3VBTA 4E4NA 2QO2A 2PVKA 2V7AA 2DQ7X 5DVRA 4BGHA 2X0GA 3MA6A 1VYZA 3D9VA 2UW3A 4RX9A 3LCSA 4FSYA 2WOTA 5J95A 5L2QA 3BX5A 5IUIA 3LMHA 2AC5A 5J8IA 4BF2A 3SXRA 3OF0A 2R64A 1YDTE 5HG5A 2OI4X 2C6TA 3QL8A 5HEZA 2R3JA 2QOLA 3R1YA 1OKYA 2I0HA 3HRCA 4M7IA 2EUFB 4A9SA 5FWKK 4A4XA 4GU9A 5DT0A 3TUCA 2ITQA 4EEVA 1NVQA 4L44A 2XNBA 3HNGA 4JBQA 3DBCA 4JBVA 3DPKA 4PTCA 5HIDA 5CVGA 4DCEA 4TXCA 3I0QA 2DYLA 3FUPA 2QO9A 4EBWA 2ZV7A 4UWBA 3B8QA 4MCVA 2BAJA 4XMOA 3PSCA 4RQKA 4LUEA 5HTIA 4HZRA 3IKAA 3UNZA 1M2RA 2UW9A 5IMXA 1S9JA 4O1OA 1H08A 3DB6A 4NW5A 4YJPA 1OUKA 5CEQA 4CMTA 3S1HA 4K2RA 3D4QA 2CPKE 5HBHA 3VW8A 1TQMA 4WIHA 3UPXA 3ZCLA 3R71A 5TR6A 4OW8A 1UWHA 3R2YA 3MVLA 4A07A 2XBJA 4U5JA 1NT2A 1PW2A 4AT5A 5KBQA 4CZUA 2OKRA 2ZOQA 1WCCA 3HLLA 4YP8A 5CYIA 3ZLXA 4AOJA 3IW4A 3H9OA 5EW9A 3KMMA 3KEXA 5TOZA 3POZA 4FZ6A 4FVQA 3WZDA 5LJJA 2XNGA 3OMVA 4LL5A 2YA9A 4C4JA 5DEYA 3FLNC 4FMQA 4Z9LA 4HVHA 4RSSA 3R2BA 4GCJA 4C33A 3ZC5A 2HENA 5IA0A 1REKA 4Y5HA 4FIGA 3DJ6A 3JVRA 4WNOA 4AOIA 1VZOA 1Q4LA 3QRUA 5AX9A 4FBXA 2W05A 2J6MA 3ZM4A 4G3FA 4IAZA 4D9UA 3DFAA 3I7CA 4RZWA 5IQFA 2R3GA 3C51A 5LWMA 3R7OA 3VF9A 2V55A 2ZAZA 1YWNA 5HCYA 2CCIA 4RFYA 4I93A 4OTFA 3OY1A 2OIBA 4DH7A 4FYNA 5GNKA 3OFMA 3BWFA 4ZTSA 4EOOA 5KMMA 2VV9A 2XB7A 4IWOA 4YJOA 3RZBA 2PE0A 4FSWA 4YZ9A 2ZJWA 4C35A 3SHEA 1JKLA 4H3QA 4V05A 4MBLA 5DNRA 2Y4PA 4O96A 2XJ1A 3FHIA 3OWJA 4U9AA 3RZFA 4UN0C 4E20A 4OLIA 1M17A 3FLQA 4IFCA 3FY2A 3SXFA 3OCTA 5AA8A 3FMDA 5CVFA 5TT7A 3W1FA 2ZDUA 3LMGA 2C5XA 1YXVA 1YDRE 2XEZA 5J79A 5AR4A 3E3BX 3VVHA 4UB7A 2XYNA 2QC6A 4FYOA 3V6RA 4I22A 3ZO2A 2FUMA 2W1IA 2PZ5A 5EI2A 2ITTA 3ZO3A 2C68A 5HNBA 3EKKA 1G5SA 1XH6A 4UMUA 4FEQA 2GTNA 2YM4A 5BQ0A 1WBOA 4ZAUA 5AADA 5AR8A 2V22A 3VS7A 4GH2A 4Q9ZA 1OPKA 3DOGA 3WF5A 3CSVA 4WG3A 4MBIA 4F4PA 4KD1A 3A7GA 4NJ3A 3RI1A 3BCEA 4M15A 3LXPA 4C3RA 4B9DA 3GOPA 4XG6A 5A4QA 2A1AB 3GCSA 5FEEA 3VW6A 3DFCB 4RGJA 3PVUA 4RMZA 5FRIA 4AOTA 2ZDTA 2EWAA 3G2FA 4LMUA 2YDKA 2C6MA 4J8NA 2WTDA 3F66A 4PMTA 4EWHA 4YPSA 3CXWA 4IB1A 3U87A 3WARA 4AAAA 4EWQA 4M8TA 4HCUA 5EM6A 5LMBA 3KULA 5HNGA 4BYJA 4KAOA 3EQBA 4FGRA 1BMKA 3FLSA 2QD9A 3OW3A 2ZYBA 2R0IA 2UZDA 3EQIA 3RAKA 3D5VA 5DT4A 3PSBA 1UNGA 4DEDA 2CNQA 3G51A 5AP7A 4BI0A 2WMTA 4FG7A 4O84A 1OZ1A 4IX6A 1JBPE 3RNIA 2BRMA 2ZVAA 3FKNA 3ZS5A 5L3AA 1XO2B 3QA8A 3ZRLA 4AZWA 4ERWA 3G6GA 4FSTA 3P7BA 4GT5A 4HYUA 4O0SA 3H3CA 4F6WA 5HLNA 1Z5MA 4V0GB 5HG9A 4DF3A 5IG1A 3C1XA 5ANIA 1OL5A 3KQ7A 3DKCA 2WQOA 5IUGA 1XJDA 4KKGA 1H26A 4UYNA 3EN5A 4QYHA 4ZTQA 1YQJA 4MD7E 2X2KA 4FTIA 4NEUA 3CC6A 2VO6A 4YMJA 1VYWA 2JIIA 4I6FA 4IVBA 1FQ1B 4OT6A 5TKDA 3QXPA 2ITXA 3LHJA 4RWLA 3UZTA 4BL1A 2GMXA 4YLJA 3C4ZA 4AGUA 4DG0E 3AG9A 4IVCA 4PDPA 2XK6A 5HICA 3WF7A 3G0EA 2QOFA 5IKWA 1ZAOA 2UZEA 3F3VA 2DWBA 5C8MA 3PUPA 4B4LA 4R78A 5GJFA 4QTDA 4C4EA 5E92A 4E6AA 4DFBA 3QZFA 1Q8TA 3CGOA 2X2LA 4D0WA 3ENMA 2F7XE
chains in the Genus database with same CATH superfamily
1HCKA 5CT0A 2IVTA 4QQ5A 3V5JA 3W0OA 4K1BA 2VTQA 3G90X 5CSWA 1OIUA 3DTCA 1SM2A 4NIFB 3DXPA 3KXHA 4ZS0A 2WGJA 3ZMMA 3L9MA 4FIHA 5L2WA 3E7OA 3BGQA 3QTQA 3DAJA 4N70A 1H27A 2F7EE 2UZWE 4FG8A 3OUKA 3ET7A 2WELA 3F88A 2I0YA 2XIXA 3LFFA 3VULA 4BCIA 4JDJA 3DGKA 4ZEGA 3TNPC 2FVDA 2R2PA 1UU9A 3ZTXA 5DR2A 1CDKA 2XAMA 1TKIA 2QODA 4RA5A 3LFEA 2JFLA 3V01A 3C0GA 3IDBA 3OTVA 4LL0A 4E4XA 2VTLA 2Y4IB 3DQWA 3ACJA 1M14A 3DS6A 1TZDA 5HE3A 1MQBA 3LFQA 4AUAA 2GPHA 4EZ3A 1P2AA 2CKEA 2F7ZE 3OD6X 3PE2A 4TZRA 4YO6A 3V3VA 3H0YA 5DRBA 1U54B 3DJ7A 3IOPA 3MGYA 2C5OA 4L00A 4ZTHA 5CLPA 5L6WL 2PZPA 2RIOA 3FI2A 4JI9A 5AUZA 3U6JA 3NW7A 2YZLA 2ESMA 4O22A 2W5AA 2XJ2A 5A4TA 1ZZLA 3EWHA 3N4VA 4FJVA 3TNWA 3VS0A 3PA5A 4YJRA 2JGZA 2ZB0A 3EQCA 4PP9A 4C3PA 4BCKA 2BIKB 3TNIA 3G33A 4O2PA 4D9TA 4R77A 3WZEA 3NW6A 3R0TA 4WRSA 4A9TA 2X9FA 4QMNA 3ODZX 4C61A 2YFXA 4PDOA 3GENA 3UIUA 2J51A 4RVKA 3R9HA 3NAYA 3U55A 3LFBA 3K5VA 5AUVA 3VRYA 3UDZA 4RIYA 3H4JA 2WPAA 3NYVA 5D7AA 3ORZA 4FIEA 5D7VA 4ZMFA 3MB7A 1T46A 4BC6A 1F0QA 2R3KA 4D1SA 2Y8OA 4PRJA 3FV8A 3JYAA 1WZYA 1JAMA 2REIA 3C5UA 4YTFA 3LJ2A 4AGDA 4GKIA 2BVAA 3PDTA 1LEWA 2XRUA 4FT7A 3NNVA 5FBNC 2HXLA 4Z7HA 2EB2A 3R22A 5CU0A 5EKNA 2YCSA 4FTOA 4E5BA 3JVSA 5E90A 4BB4A 2ETRA 2IVVA 3ROCA 2GQSA 3W18A 4GU6A 4ZSLA 3SC1A 2FSOX 3FZOA 4RA4A 2ZB1A 2WMXA 4FTQA 4X3FB 4DGOA 1MRUA 4NM0A 3VRZA 4ZS4A 2GDOA 5DR6A 2QOCA 1YOMA 2FSMX 4G3GA 5ANJA 2F9GA 2OZAA 4DHJA 2VTMA 3GCPA 1UVRA 5AP0A 4L68A 4I0TA 5LVNA 3ORTA 4AACA 4IIRA 5ANGA 3AC4A 4KSQA 4ALUA 4AN9A 5KMJA 5M07A 4BIBA 3W2QA 4PPAA 3COKA 1SNXA 2C5YA 4QMSA 5GJDA 2F49A 4WA9A 5JZJA 1Q24A 4EK6A 4PPCA 2G2IA 4QMXA 5CEKA 4BCJA 5I9WA 2GNFA 4BCMA 2ZM1A 4FV2A 5AWMA 5K0KA 3RBWA 4E1ZA 4JS8A 4JRNA 5BNJA 4YC3A 3PA4A 3C4EA 4G34A 3KXNA 2BZIB 4U43A 3UIXA 1WMKA 4O7WA 5CY3A 5F20A 3QXOA 2LAVA 3T9TA 4W4WA 3UYSA 4DH1A 4F99A 3ZLYA 2ITPA 4AZVA 4BCGA 1BL7A 3LQ8A 4ASEA 5GZAA 1VEBA 3PXZA 3R83A 2GTMA 2KULA 5LWNA 2AUHA 4L6QA 5BVDA 1JLUE 2B7AA 1GIIA 2BAKA 2Y0AA 2Y9QA 5DOSA 3Q32A 5CASA 3P86A 3G15A 5AV0A 4EUUA 2HXQA 5CZHA 4FNXA 3CPCA 3GB2A 4TWCA 1UA2A 3D2IA 2WU6A 3EZRA 4FKIA 2XKEA 3RK7A 3UE4A 4XYFA 2VU3A 3R73A 4QP2A 3RAHA 3PE1A 4FV8A 4GYIA 1M7NA 2VO3A 4QYYA 4M97A 3K3JA 1OBDA 1DM2A 4BVUA 4R1VA 4NCTC 4NFNA 3LZBA 2HZ4A 4TKSA 4U8ZA 2W0JA 4LM5A 5GZ9A 3QZGA 4UXLA 4AF3A 1Y8YA 4ITIA 4YLLA 5IEXA 2WMWA 3SGCA 3HGKA 4DDIA 4O6LA 3EOCA 4YHJA 3UIMA 2VWBA 2VTPA 5I9ZA 5E1SA 4NM7A 5K0XA 3AMYA 4S32A 4YTHA 4J97A 2YCQA 2BRHA 4I6QA 3KB7A 3AD4A 4OTDA 1QPJA 4MUQA 2GNLA 4FV5A 3F5XA 4H36A 4TRLA 1XMMA 1H00A 3Q96A 4Y73A 4TYEA 5BMMA 4E7WA 3UC3A 5J9ZA 4C8BA 3GC9A 4LOOA 5CWZA 4G3EA 5F94A 4EQUA 3R8LA 4DG3E 4XOZA 3UOKA 3MH3A 2H6DA 1KE7A 1YI6A 5AV2A 2VO7A 4GJ2A 2XRWA 4AW0A 5BVOA 5GIPE 5EW3A 2A27A 4QMMA 3Q9YA 4B7TA 5L2IA 3UODA 4C4FA 5EYKA 3HECA 4DGGA 4OBQA 1IEPA 1OIRA 4RC2A 4TTHB 5FLFA 5KHWA 3EN7A 4MH7A 2OGVA 5HO6A 4ZZMA 3V5LA 4D2RA 4ERKA 2ITWA 2XIRA 3GCUA 3F82A 2WMQA 1K9AA 2UVXA 4FSMA 4S33A 4YSJA 5JN2A 4JQ8A 3HMPA 4JR3A 3PVGA 2BILB 4NT4A 4XNEA 2PULA 4AE9A 4H3PA 5DEWA 1XWSA 5AP1A 1O9UA 1ZMWA 4CYJA 2XIZA 3GOKA 3DK6A 3F5UA 4RIOA 4YZDA 3T9IA 5A4EA 4M66A 4BI2A 4F7LA 4YJSA 1YI4A 4Y83A 2OFVA 2CGUA 5CVHA 5I3RA 4MF1A 2PY3A 4EHZA 4HW7A 4FK6A 1YOLA 1MQ4A 4WSYA 3NZ0A 4JX3A 3BBTB 1J1CA 3TYKA 5CF4A 4XJ0A 4ZLZA 5C1QB 3BHUA 3OWKA 4AFEA 4HVDA 4PMMA 3NWWA 4RWIA 3Q9WA 4C4IA 2BRBA 3S3IA 4DTKA 2P33A 5AV1A 3SVVA 5CTPA 3TUDA 4WG5A 5AP2A 5H8BA 2QG5A 2WIPA 5CU4A 2G9XA 4D1XA 1CKPA 1BX6A 5IH6A 3NIEA 3UO4A 3GU5A 4I4EA 5HVYA 2WEIA 4UYAA 2J90A 2C4GA 3H30A 2GNHA 2HY81 1U5RA 3WIGA 3GC8A 2EB3A 2VX1A 2C5VA 2OXDA 3EN6A 1FVVA 3EN9A 3PA3A 4II5A 5IA2A 5FTGA 2X7OA 5H8EA 4DFXE 3HUCA 3GNIB 1JSTA 1YXSA 3RTPA 1KOBA 3R7EA 5LOHA 4J71A 3HKOA 5JKGA 5HCZA 5A4CA 3FC2A 4L46A 5CX9A 5AP3A 4G2FA 4G16A 3TIZA 4A06A 4YR8A 2XA4A 4BR3A 3QLGA 3NVKI 3VC4A 4MHAA 2QU5A 5L2TA 3GCQA 3A4PA 3RK5A 3E3PA 3IPHA 2A0CX 4K33A 4AFJA 3UO6A 3FL5A 2WTCA 3GUBA 4FNYA 4QP3A 4XG7A 3Q3BA 4AN3A 5A9UA 2CKOA 3OXIA 4A9UA 3Q2JA 2I0VA 3OBJA 2JAVA 4I21A 4C36A 1G8KA 1B38A 3BL9A 3PIZA 3R00A 4PUZA 4DN5A 2J4ZA 3DT1A 3FE3A 4NTSA 2UVZA 5ANEA 1PJKA 5CEMA 5IH5A 1PHKA 3MVHA 5TF9A 4LYNA 4YNEA 4FTLA 4ALVA 4BDAA 5HU9A 2QOKA 3TT0A 5AUXA 3ATSA 4PPBA 5BVFA 2R3NA 2QHMA 5CAUA 4R7BA 4MXYA 4YNOA 2UW7A 2VTNA 1R0PA 3RPOA 5IA4A 2E2BA 4Q9SA 3Q4ZA 2CNVA 2BHEA 3WI6A 3DXQA 4FL3A 4EH6A 3BE2A 2DUVA 4NZWB 4WHZA 5KX8A 4I6HA 2WB8A 3OVVA 4GG7A 2XK4A 2IW8A 4BTFA 2NPQA 5I9VA 1BL6A 5JH6A 2C0IA 5C4LA 3KF7A 3GU6A 3VQUA 3DK7A 1XHAA 2QU6A 3KRLA 4P4CA 4CD0A 4AXFA 3OXTA 1HOWA 4I41A 3NUAA 4B8MA 4KIKB 3M2WA 2X39A 3DK3A 4B99A 3D0EA 3H10A 4DHIB 4FX3A 2GCDA 3CCNA 4RJ3A 4EHEA 2XARA 3THBA 3TNHA 3NS9A 3ZUUA 4KINA 5HD4A 4JL9A 2VGPA 4IB5A 1PXIA 4U3ZA 2WMBA 5T6KA 4F9BA 4DGLC 4E3CA 3MESA 2OFUA 2BALA 1KSWA 4QTEA 4FOCA 3P79A 3VQHA 1JVPP 4O81A 2BFXA 3U51A 5IU2A 5C26A 4DBXA 2G1TA 3HV4A 3A60A 4EJNA 1YXTA 3KU2A 3NUYA 5CXHA 2J0IA 4LRJA 2W7XA 4FKOA 4EONA 5GZ8A 2VWZA 3L8VA 3FHRA 1SVHA 3VWAA 5K4JA 3W0QA 5EFQA 3RWQA 1G3NA 2NYAA 5KE0A 2QCSA 3GQIA 3QX2A 3FZTA 4USEA 4BIEA 1TFFA 3DDPA 5ANKA 3EZVA 2H9VA 4FRFA 4GW8A 2XBAA 3CPBA 4I4FA 2IJMA 2CGWA 3T3UA 3ZU7A 2JKMA 4EOQA 2QO7A 3W2OA 4O27B 1H0WA 4TPTA 4DLIA 2Y4IC 3QGYA 1M2PA 1Y6BA 2Z2WA 4EH7A 4QMQA 3O7LD 2QOOA 3D83A 3O50A 4WG4A 4F0FA 4XCUA 3HA6A 4MXCA 4DFZE 3BQCA 3QCQA 4FSQA 3TN8A 1YHVA 4OTPA 4D28A 3R02A 3Q4UA 4ANQA 4YURA 2YWVA 4TWNA 3IW7A 4MAOA 5CI6A 3F6XA 3VN9A 2X6EA 3W33A 2UZLA 5BVNA 4O82A 4KUJA 3FY0A 4RT7A 5HG7A 4IZAA 3A8WA 1ZXEA 5LVPA 1Q8WA 3DXNA 3MPMA 2X0QA 4CV8A 3BGZA 3L8XA 3FYKX 4DINA 3P5JC 5K5NA 3ZO4A 4C7TA 3DZQA 3JPVA 4C38A 1PXJA 3NIZA 5I5ZA 2QOHA 5CEOA 1YOJA 2QR7A 2XZSA 4IAFA 4WO5A 5M09A 4HGEA 3UZRA 2E9PA 3C7QA 4UWYA 4O0VA 4IBMA 3ACKA 4OGRA 3VUHA 3E93A 1TQIA 2WZJA 3ZYAA 3WIKA 4RIXB 3IOKA 3AXWA 2Z7RA 3UOJA 4GV1A 4ASDA 4ORKA 1CKJA 3BLHA 3PIYA 5CSVA 4DEAA 4EH3A 5DN3A 1OITA 5KO1A 2RFNA 3SG9A 1H25A 2GNJA 3DNDA 3AGLA 5CNOA 3PIXA 3ZZWA 2XNEA 3ZEWA 4U6RA 2G01A 3NSZA 3OEFX 2C0TA 5HLPA 1A48A 3PPJA 5KCVA 3V04A 4MXAA 4DTAA 4I5HA 5L6OA 3DBFA 2ITNA 3EQHA 4NM3A 3VS5A 4JIKA 3UP7A 4IAIA 2ZV9A 3DBDA 3NYXA 3UQCA 1PYXA 4QMVA 1Y57A 4FNZA 4XV9A 2FO0A 2VN9A 3EFLA 1V0OA 4NL0A 5CS6A 1OGYA 4X3FC 2BIYA 3GI3A 4BIDA 3P5KA 4XLIA 3I81A 3QKLA 3ORMA 3OBGA 2PE2A 2XK8A 2AQXA 2JITA 3UYTA 3U9CA 4NCTA 5ANDA 3W2CA 3ETAA 5JQ8A 5IA1A 1H8FA 2RL5A 3PJCA 2VTAA 1P14A 4JDIA 4P5QA 3EKNA 3I5ZA 4QTAA 5EW8A 2WMSA 5I3OA 4EOIA 2X2MA 4HZSA 2UZVA 3MJ2A 4CSVA 3V8TA 3FI4A 3MWUA 4X7QA 4C02A 4GKHA 1O6LA 2XJ0A 4AP7A 4NJDA 3VBQA 5DYJA 1UNHA 3LAUA 5EDQA 2OU7A 2BZHB 5M55A 1URCA 3SX9A 3KXXA 4DCAA 2PMLX 5I9UA 2XMYA 3UNJA 3ZOSA 4BCOA 2R4BA 3W0NA 2B52A 2XKCA 2HW7A 4FKWA 3T3VA 4QMZA 5AR7A 2A98A 5HZNA 4XG9A 4FVRA 1Q3WA 4BZNA 4BCFA 1L8TA 3TKHA 4I5CA 3QHRA 4E4LA 3OTUA 2WQEA 5LQFA 2X4ZA 4D58A 3QQKA 5BYYA 3KRWA 5AP6A 3MH2A 4RG0A 2WQNA 1Q62A 3TUBA 3R1NA 4FKRA 4C2WA 5J9LA 4RBLA 2VD5A 5M53A 4FTNA 4TYJA 5C8KA 4IE9A 4BDKA 5D11A 3SOAA 3E7VA 3AT3A 2G2FA 2PVJA 2YM8A 1GNGA 3VUKA 3A61A 2NRYA 4CT2A 4BDDA 5FXQA 3WYXA 4B0GA 4EHVA 5JFWA 4GIHA 4P7EA 4YBKA 3Q4CA 4O7LA 4FL2A 5H2UA 4G3CA 1UKHA 4I92A 3KFAA 1JKKA 4GFMA 1OKVA 3AQVA 5E1EA 5CSPA 3GFEA 4L42A 3GC7A 4RWKA 1I09A 3R1SA 2IPXA 3PZEA 4F78A 4X0MA 4O1PA 4U40A 5JGAA 3QALE 4ZTLA 1IRKA 3A62A 3ELJA 3F61A 3KVXA 3NNWA 3QZIA 1FINA 2WD1A 3QTXA 4G5JA 5E8WA 4Y95A 3LJ1A 1IAJA 2PE1A 5K3YA 3D5UA 1KUTA 1W2DA 2JBPA 4QOXA 3V5QA 4U41A 4LI5A 3COHA 4QP8A 4F08A 2VTOA 1G8JA 4TT7A 2IG7A 3ZFXA 3GP0A 4GK3A 3WF9A 2H34A 5EM5A 5FGKA 4FIJA 4KB8A 2YDIA 4O91A 5EM7A 2YM6A 4FKLA 2X9EA 2C6OA 2VWWA 4C0TA 3W16A 3QD4A 1XH9A 4USDA 3HX4A 3PY1A 5IQBA 5L8LA 3OWPA 3BZ3A 2RF9A 5DLSA 5AA9A 3ZRMA 2W9ZB 4HCVA 3ID6C 5KBRA 1P5EA 2B9FA 3FKLA 2WFYA 4HJOA 1OUYA 4YZBA 1R78A 1YWVA 3P7AA 3QUDA 1ZRZA 4FTJA 2RFDA 3QD0A 3V5TA 1YKRA 1OECA 4DH5A 4EI4A 5BPYA 4DLJA 2WTJA 2OLCA 3CD3A 3DTWA 1FMKA 1VR2A 3EB0A 3KVWA 4L8MA 4PTGA 4UZHA 4Y8DA 1OL6A 5ETAA 4BDGA 3OCGA 4Q2AA 3QTUA 5JSMA 4O7YA 1U5QA 2BDWA 1H1PA 4YHFA 5EHYA 4R3RA 1ZOGA 4C62A 4FTKA 4BDIA 5JMSA 3O8PA 1W2FA 3Q04A 4C57A 1Y91A 5IMEA 4Q5EA 4HYHA 3LFAA 4K77A 3NAXA 4H39A 4RJ6A 2XKDA 3C0IA 4ACDA 1J3HA 5B2LA 3DKFA 3M11A 1YHSA 3RJCA 3NFFB 3NUUA 3BU5A 3PJ8A 3TDWA 4XP3A 4FTUA 4A4LA 4DHFA 5IPJA 3VAPA 3TJCA 4TNDA 3TG1A 3KRRA 4RJ7A 1WVXA 4BDFA 4EBVA 2B1PA 3RHKA 4EH9A 5AV4A 1OL7A 2HW6A 4XS2A 3WZKA 4CFVA 3ITZA 1CSNA 3EQDA 4K11A 3ZBXA 3OG7A 4MTAA 4BDHA 4IB3A 3AKLA 4J96A 4ZSJA 4YTIA 4Y85A 2IW6A 4V0GA 1PXLA 2ZMCA 4HVGA 3D7TB 5EYMA 4RLKA 5LVLA 2XCHA 5KZIA 3MA3A 3R7VA 3SRVB 4DE4A 4LMNA 4IFGA 4USFA 3IGOA 1O6YA 4G1WA 4CMOA 4JIAA 4PL3A 2PUNA 4ZTMA 5F95A 3DLSA 4F9CA 3GVUA 1XH4A 3VS6A 4E8AA 5KMIA 2CN5A 4PTEA 2P55A 1GZKA 3RM6A 4CYIA 3WZJA 5J9YA 2O65A 3LXKA 4QQJA 3U8WA 2B55A 4J7BA 4EOJA 1OBGA 2OIQA 3E62A 3L9PA 4JG7A 4D2WA 4JDKA 1LR4A 2GSFA 3LCOA 3FZPA 3HAVA 2GNIA 2EVAA 3NUXA 3P9JA 4OBPA 4XG4A 4EH8A 3ZBFA 3DA6A 5J7BA 5AV3A 5IA3A 2OSCA 1FGKA 4AG8A 4I5MA 4O4EA 4J99A 3KREA 3R7YA 4BTMA 2GHGA 2ERZE 2PUUA 5EDRA 1W8CA 4RRVA 3UTOA 1OKZA 3IW6A 3FJQE 2J0LA 3O71A 3HMMA 4WUNA 4F7SA 5D12A 1ST4A 4FTRA 4WRGA 3FEGA 3MFTA 3I6WA 4MD8E 2F2CB 4NIFA 5HU3A 5LVOA 4N57A 1V0PA 3NEWA 4ZY5A 3CGFA 1PXKA 2W99B 3N9XA 2IW9A 4WBOA 2BHHA 4F0GA 4KS8A 3OY3A 3NFGB 1Q5KA 4IANA 4O7RA 1GZ8A 3PTGA 4R3PA 3ZC6A 3P1AA 3NUPA 3PY0A 4G6OA 4JOAA 4K0YA 4LFIA 3SAYA 5D9HA 3PLSA 4K9YA 4YU2A 1PYEA 3GQLA 4E73A 3CD8A 4ZY4A 3AKJA 3PJ1A 4O7NA 4AAYA 3MSSA 3A7IA 5DWRA 3ZO1A 4ZLYA 5F9EA 5CSHA 3DU8A 3BLRA 4W4VA 1M7QA 3DBEA 4UWCA 1JOWB 1U54A 3IGGA 3LCTA 1PY5A 3UBDA 4KIPA 2OH0E 3PXYA 2UV2A 4GK4A 5DG5A 3UO5A 3MN3A 4YUQA 4CT1A 5HIEA 2DS1A 2WU7A 3BHTA 2IZSA 4EOSA 5FDPA 2JDOA 3ZDUA 3HEGA 4TYHB 4N4SA 2UZNA 2HIWA 4QTCA 2OG8A 4U80A 2GS2A 4J8MA 4ACMA 3R1QA 2EXCX 4U97A 4H05A 2BMCA 4ID7A 2RFSA 2FH9A 3HV3A 2VTJA 3Q52A 1AD5A 4HPTE 2XNPA 4O0UA 3WE4A 4F1TA 3UDSA 2B9HA 3OROA 5JT2A 1JKSA 3FZ1A 4DEIA 5FD2A 4BCQA 4BCPA 5IQCA 3ZRKA 3JXWA 3TV6A 4ACCA 3PPZA 1K2PA 3UOLA 5BX0A 3NMUF 2YAKA 3FLZA 4BDJA 3KN5A 5HHWA 3R9DA 4CQGA 4EH2A 4GT4A 3SOCA 4D4SA 5J1VA 3VJNA 2XNNA 1OIQA 3L9LA 3JUHA 1IG1A 5E8SA 3E5AA 2AC3A 2J5FA 3FQHA 1JSVA 4U3YA 3GBZA 5ANOA 2YJRA 3MFRA 4OBOA 3V5PA 4X3FA 4YC6A 2FB8A 3R8ZA 2VWXA 3TTJA 1YDSE 2UW6A 3NUNA 4JLCA 4NSTA 3FQEA 4P2KA 4EHGA 4EK8A 4FA2A 4MX9A 1KE6A 1XBAA 1QMZA 2O5KA 3LCKA 1SMHA 2RG5A 2NP8A 3KY2A 2OJ9A 4WNMA 5AR2A 4CG8A 1UKIA 5J7HA 4PP7A 3RWPA 4I5PA 1GY3A 2XVDA 2C3LA 4XRLA 1ZYJA 3R21A 1E9HA 4XG3A 5FEDA 5BYZA 4IJPA 2OICA 3WYYA 2OXXA 4JT3A 4O4FA 5I9YA 4AXCA 4RC3A 4GT3A 3VS2A 1QCFA 3QUPA 4OTHA 1WVYA 5FTQA 3NRMA 4AXAA 1VJYA 3GEQA 2OWBA 3CS9A 3LFNA 3MI9A 3LFCA 3MS9A 1XQZA 1B39A 4HGTA 4LOQA 3RP9A 3I6UA 4U79A 4U45A 3R7UA 3BV3A 3OXZA 5L8JA 2XH5A 4GYGA 3RM7A 1W82A 5C8NA 4IDTA 1YXUA 3UVPA 3QBNA 5IH4A 4IZ5A 4WT6A 4CFXA 3C4WA 2CNUA 5KMOA 4TYIA 4G3DA 2JBOA 4XG2A 4U44A 2GS6A 4PY1A 4PQNA 3C4FA 3NYOA 4N6ZA 5IQAA 2GNGA 4OTWA 4MYGA 4WBBB 3P4KA 3TKUA 5E8TA 4HGLA 4YJNA 3QD3A 3FXZA 4AZSA 3KN6A 2HWPA 3TZ8A 2B54A 5D1JA 1NXKA 5IUHA 3K3IA 3B2WA 3ZXZA 5ICPA 4XLVA 4KS7A 1O6KA 5A54A 3LVPA 4H3BA 3MVJA 4O7TA 3RALA 4AZTA 3BU6A 3ERKA 3KA0A 3KIOC 2CN8A 4YJUA 2W9FB 3DKGA 4EORA 4QMYA 4CFMA 4HVSA 4DT8A 3WBLA 1LPUA 4LGDA 3OCBA 3EQGA 3CJFA 3CQUA 2PU8A 4ANBA 1GAGA 1M2QA 4QMPA 4BGGA 3ATTA 1DI8A 3BV2A 3HZTA 3WF6A 3E8NA 3IS5A 5M56A 5M4IA 4M84A 5KHXA 4O7SA 5KNJA 2GS7A 4OTGA 5CU2A 4AW2A 3LFDA 3UQFA 4XG8A 1J7LA 1QPEA 1KV2A 4EL9A 5HGIA 3RPSA 5HVKA 5IA5A 1YXXA 4EUTA 2YN8A 1PMVA 4QP9A 3R8VA 2R9SA 3CKWA 1OMWA 3QWJA 4TN6A 3RMFA 4A7CA 4BI1A 4FGBA 5FDXA 5H9BA 4TW9A 4Q5HA 3CBLA 4D1ZA 4YJTA 3OOGA 3FMLA 4LQMA 4JG8A 4O4DA 2OH4A 4L45A 5IQGA 2P2IA 3LLTA 4MXZA 2WTIA 5E8YA 3TIYA 1I44A 2B9JA 3HRFA 4KKHA 2BZKB 2Q0BA 2A2AA 2PZRA 2XK7A 2Q0NA 4EK5A 4DYMA 2NNWB 2BFYA 1NVRA 2VZ6A 3OOMA 4RVTA 4KBKA 4AS0A 4JG6A 2WKMA 1ERKA 4CKRA 5IISA 4M67A 3EL7A 2BKZA 4BZDA 2VUWA 4DEBA 5FTOA 4AQCA 3O8UA 4L43A 3MDYA 5JZNA 4XV1A 1WBWA 3VHKA 4EQCA 3MTFA 1H0VA 1AGWA 1Q3DA 1GZOA 3N51A 1Z9XA 3ANRA 3HMNA 3QA0A 1Q61A 3P23A 4QO9A 4EKLA 4ZJVA 3ZFYA 1ZYSA 4ZLOA 2HOGA 4NK9A 4R5SA 3FPQA 2UZUE 3D94A 1PXNA 3FL4A 4KRDA 3V8SA 2W5BA 3F9NA 1A9UA 2GU8A 2BAQA 3NDMA 5HO8A 4DT9A 4OT5A 3H9FA 3UMXA 3MIYA 4KA3A 4MVFA 4D5KA 4ZZOA 2X6DA 4PL4A 4QT1A 2PUIA 5HX6A 2ZFYA 2VGOA 2E9NA 3ODYX 4U7ZA 4YGAA 4XH6A 4FEVA 3QD2B 1QPCA 3AT2A 3N4UA 3EH9A 3VBVA 4JJRA 4CCBA 5AM6A 4D5HA 3DV3A 4FTTA 4ZTNA 1PXOA 3O0GA 4O2ZA 2PMIA 1FGIA 4IZ7A 1OB3A 3Q9XA 3UOHA 4GEOA 3I5NA 4F1OA 2I7QA 4G6LA 2ONLC 2W4KA 1E1VA 3O8TA 5HD7A 5M06A 3ZSGA 3D5WA 3TKIA 4B6LA 3OHTA 1KWPA 3ENHA 4FV7A 3BEGA 2QOIA 5GJGA 3ZHPC 5LXMA 1APME 2OJJA 3PXRA 3PY3A 3R7GA 4MWHA 5EOBA 3R63A 3FLYA 4BDBA 4Y5QA 2HK5A 3HDNA 4GVJA 4IQ6A 4JQEA 3FXXA 4I3ZA 1YWRA 3FMJA 4I6BA 5GINE 2IF8A 2Z8CA 3G9LX 3ORKA 5EYCA 4FI1A 1JNKA 5AIKA 5DGZA 3TXOA 4E93A 4F64A 5K9IA 2B0QA 4BBFA 3IDCA 5CNNA 5B2KA 4LRKA 4IVAA 1UU3A 4D55A 2EU9A 4F1MA 5AUYA 4UBAA 3HP2A 4O0WA 1PKDA 2WMRA 1H1RA 3FAAA 3I7BA 3OS3A 5ETFA 5HI2A 2HZIA 4G17A 4O7VA 2BZJA 3NCGA 3QWKA 3MH0A 4KKEA 1WVWA 2JLDA 4L7SA 5FM3A 3TL8A 5CAOA 3PWDA 1BYGA 2QURA 3BYSA 4BKJA 3PYYA 4MD9E 2ZM3A 3TZ7A 2OW3A 2OXYA 3QUEA 5B7VA 4KBCA 2NRUA 3I1AA 4NUSA 4IZYA 4YZCA 5CALA 3C5IA 3EL8A 5M57A 3RPVA 4M69B 4C4GA 5IQEA 1ZARA 4YZMA 3E8EA 3R9OA 3F3ZA 4D4VA 5E8XA 1URWA 4QPAA 4EK4A 4CFWA 1GIJA 4IVDA 1WAKA 4PV0A 5EK7A 2V7OA 3QQJA 4FIFA 5EDPA 3W2RA 3UPZA 4FEXA 3QRIA 3RCJA 2PPQA 4AA0A 4D2PA 5AR3A 2G15A 5HTCA 4I0RA 2KTYA 3QQGA 4KIOA 3FWQA 3R6XA 5HVJA 5IDNA 4MNEB 2E9VA 3BI6A 4RVLA 5BVEA 4DEEA 2EXMA 3QFVA 5AMNA 2C3IB 4FKVA 3WZUA 1H1WA 3H9RA 3NX8A 3FYJX 4WSQA 2CKQA 4EC9A 5HE0A 4MNEA 1ZLTA 5DR9A 3O2MA 4NKSA 4K6ZA 3RVGA 3LXLA 2I40A 1A06A 1R39A 1W7HA 2GFCA 3BELA 5C4KA 3BRBA 4BCNA 3Q6UA 1BI7A 2ACXA 4XP0A 4FUXA 1FVTA 1RE8A 5CEIA 2GHLA 4ITHA 3BHVA 3PVWA 3PG1A 4FV1A