4L8MA

Human p38 map kinase in complex with a dibenzoxepinone
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
348
structure length
339
Chain Sequence
RPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHTVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/transferase inhibitor
molecule keywords Mitogen-activated protein kinase 14
publication title Metabolically Stable Dibenzo[b,e]oxepin-11(6H)-ones as Highly Selective p38 MAP Kinase Inhibitors: Optimizing Anti-Cytokine Activity in Human Whole Blood.
pubmed doi rcsb
source organism Homo sapiens
total genus 111
structure length 339
sequence length 348
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2013-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4l8mA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4l8mA01
5FGKA 4U80A 4BC6A 4E73A 4GJ2A 4USEA 2JC6A 4W8DA 2OJJA 4JLCA 4DFLA 4K33A 4WG5A 5M09A 3FSFA 4M69B 3PY1A 4GT4A 5CYIA 3WF6A 3GBZA 5F94A 2PUNA 3DQXA 3TUDA 4PV0A 2C3IB 3BU5A 3VBXA 3MH1A 5CU0A 2QR7A 4JBOA 4IWOA 2HZ4A 4FVPA 2VV9A 4KKHA 1O6KA 4F6UA 4CV9A 5IEYA 1YXVA 2X4FA 3EHAA 3TKHA 2YAAA 5C9CA 3CY3A 4AGWA 5JQ8A 5AR7A 4FKSA 4RIOA 3SAYA 4I1ZA 1CKIA 4J71A 4JR7A 3EFWA 1KE9A 4ZOGA 3LXPA 4RJ7A 3QHRA 1PRYA 4C57A 3Q4ZA 3ROYA 4FYNA 4OW8A 2XNBA 3HDNA 4PMSA 4RIWB 4E8AA 2G9XA 5T6KA 3VF8A 3PP0A 2ZV2A 5ANKA 2QO7A 4AW0A 4DBNA 3NZ0A 5AFVA 5L8KA 2PE0A 5GJFA 4ERKA 3CQUA 3PY0A 5AP6A 2R3HA 1NXKA 2WMWA 1SZMA 4NJ3A 3COKA 4RFYA 3KXZA 5J9ZA 2GNHA 4K1BA 3HA8A 4P7EA 2WMRA 3RKBA 5BQ0A 2VD5A 3V51A 3GQLA 1SNXA 3R1YA 4E5WA 5KMMA 3UZPA 2E9OA 2JGZA 2P4IA 4FMQA 4YJOA 4C4EA 4PTEA 1JBPE 3ZFYA 5AR5A 3OCBA 1UNHA 2YLFA 3QZFA 4XG3A 3KA0A 2GHMA 3PVUA 4QYYA 5BUJA 4LL0A 5IMEA 3GC8A 4OTDA 2I0HA 3QQKA 4D2PA 4JDHA 5EFQA 5CX9A 5DYJA 1NY3A 3NNVA 1CKJA 5L2IA 5GZ9A 3F3TA 2X7GA 3CEKA 3NSZA 4TWNA 2EWAA 4CFNA 3LKMA 4H1JA 5CASA 1YQJA 4I92A 4EORA 3OC1A 4HVGA 5J9LA 4FV5A 2UZDA 2PMLX 5EKOA 1YWNA 1W83A 4JL9A 1Q3DA 1CDKA 1KUTA 3NMUF 4B8MA 3PZHA 3Q4TA 3QYWA 4HGSA 4HZRA 1JSTA 4YJNA 2A0CX 3FMLA 2G01A 5CY3A 2F9GA 3RHKA 2C69A 3PSCA 5M56A 4PX6A 1PXOA 2ZDTA 4QP7A 5HTIA 2HENA 3IOPA 5CANA 5LVMA 4BDAA 1TQIA 3RM7A 3DY7A 4NT4A 3GU8A 4FIJA 4EK5A 4XP0A 3CXWA 4C4HA 2BHEA 2JAMA 5CNOA 3ZLXA 4PP9A 3IGGA 3OWLA 4BGHA 4XUFA 2C3KA 2P33A 2X1NA 3CTJA 4MWIA 3RCDA 4F65A 5LARA 2WXVA 4FSYA 2FB8A 5EM7A 3FZSA 3AMAA 2YDKA 3NYVA 3SOCA 5L8JA 4S34A 2R3NA 3RCJA 3K3IA 4YNEA 3E62A 5IG1A 5LMAA 4RC4A 2VWBA 4GUEA 1YOMA 4N6YA 4EOLA 1KV1A 4GS6A 3QC9A 3QWJA 4XG6A 3EOCA 3F9NA 5IA4A 3E88A 2JFLA 1VYWA 3DCVA 1ZYLA 3H9RA 1J1CA 4LUEA 3UP7A 5AM6A 2WTKC 3QLFA 2GS7A 5HG9A 4ITJA 5BVDA 4ORKA 3L9NA 3GFWA 4TL0A 4G9RA 4ZSLA 1Z57A 3F82A 4IMYA 3DKOA 2YIXA 3S2PA 2Y4IC 4FYOA 4MBJA 3AT3A 5HORA 1PMEA 1JKKA 4AGCA 4F0IA 4JRNA 4QMUA 2R4BA 4HPUE 5M51A 4O96A 2J9MA 1H1SA 2W9FB 4M7IA 3QZIA 2R3OA 2O2UA 3FMNA 3CKWA 2XF0A 4FTNA 4QMSA 5HEZA 3G33A 3TNWA 3BGPA 3FL4A 4Q9ZA 5B7VA 3BYVA 5E8SA 3I0OA 4JOAA 4J1RA 1URWA 2PUIA 4JG7A 1UU8A 3KXNA 3R1SA 4ZS0A 3PPZA 4EBVA 3QD4A 3PXZA 5EM8A 4FV1A 3FUPA 4BCJA 4OTGA 4AW5A 2X2MA 5A54A 5E8ZA 5CF6A 3C50A 5AM7A 4FTOA 4MBLA 4Z9LA 4BTMA 4V01A 3Q32A 5HTCA 4U40A 5AP5A 1G8AA 1GZOA 5TO8A 4FNXA 1LEZA 4YP8A 5H3QA 4DH5A 4RX7A 4FUXA 2C6KA 2JDVA 3VS4A 3WF9A 1U5QA 1Q4LA 4IB1A 4H3PA 5KCVA 4CKIA 5HU9A 3R0TA 5EM5A 4BDCA 2R3FA 3MFRA 3QQUA 5L6OA 4FEUA 2YJRA 3II5A 5I3OA 2X9FA 4ASZA 2XM8A 3KVXA 3DKGA 4BZNA 3DDQA 4O81A 4L7FA 4J96A 4RX8A 4CNHA 4L42A 5DLSA 2HIWA 3PE2A 5CEQA 1P2AA 1OBDA 3LIJA 4HNFA 4D4YA 4GU6A 5E8YA 5IQCA 2YLEA 4IVBA 3R7IA 3NUXA 4M3QA 4XG4A 3E7VA 1FMKA 3DZOA 3WZKA 3UQGA 3HL7A 4PL4A 2Z60A 3PTGA 4LL5A 4WNPA 4FZFB 4UV0A 3TI1A 4QTEA 3SD0A 2XEZA 3PVBA 4EHZA 3IKAA 1ZZLA 1OZ1A 1YRPA 4QTDA 4AZVA 2WIPA 1LUFA 2RFDA 4O7ZA 3MIYA 4O7VA 4R77A 2GNJA 3D5XA 2PVKA 2WB8A 4AG8A 1V0PA 2VZ6A 3SLSA 2VWZA 4ZSAA 2C30A 1ERKA 3PIZA 5DN3A 2FUMA 5AIKA 3OBGA 5JGBA 1EH4A 4DEBA 3CE3A 3ZO2A 4C37A 4FV2A 3P0MA 4BKYA 5AUXA 1IEPA 3OG7A 3EB0A 4BCOA 4FEVA 3BX5A 3UODA 4DFBA 1RW8A 3KRJA 1GZKA 2DWBA 3HKOA 2QOHA 1H25A 2GDOA 2XK7A 1GZNA 3HUCA 4G1WA 4YLLA 3VHEA 4AT5A 3W2QA 3RTPA 3BYSA 2ITWA 1UA2A 2BFYA 2ZDUA 3ANQA 4BCHA 4G5PA 3VIDA 5HO8A 3JUHA 5AUUA 2I7QA 1U46A 2C0IA 4N4SA 1PKGA 3T3VA 2JDOA 2OH4A 4NUSA 3K2LA 3OW4A 5T68A 5L2WA 2EU9A 3CTQA 4BIEA 1VZOA 1Q3WA 3KN6A 1J3HA 3VUHA 3ZRMA 4RJ5A 4WA9A 3EFJA 4AFEA 5JN2A 4XG7A 4I22A 4NW6A 2F2CB 5DA3A 1BKXA 2BR1A 2BTSA 3QLGA 5CI6A 4BVUA 2ITNA 4LI5A 3NW5A 4MXZA 5FTOA 4PPBA 5LMKA 1WVYA 1YDTE 3F2RA 2XK8A 3UVPA 2VTAA 5L4QA 2HYYA 1W84A 3F7WA 4PNKA 3KMWA 4EQUA 4JJRA 3KULB 3LXLA 4CMTA 3HAMA 1O9UA 2ITPA 4LOQA 4A9YA 2XNMA 3F5PA 2VTPA 3W2PA 4M67A 4LRKA 4A4LA 1DAWA 2XNNA 3CPBA 5ACKA 4NIFB 5KBQA 5KHXA 3RZBA 2H8HA 2HXLA 3GVUA 5DHJA 4ALUA 4X3FA 4AA0A 5HO6A 4RMZA 3W2CA 2UZUE 5CVHA 3HV4A 2QOKA 4FSWA 4FV4A 3KY2A 4HYIA 4RPVA 3OT3A 5DI1A 5KHWA 5C8MA 3DB6A 3QCQA 1KE7A 4RQKA 2WELA 1SVEA 3PFQA 3QTSA 4RBLA 4O0YA 1L3RE 5I9VA 4BHNA 4RZWA 1OB3A 4ARKA 3W32A 2BKZA 4DGMA 3BPRA 1JWHA 4NM5A 2UZLA 4M69A 5HCZA 4FTKA 1BMKA 3UOLA 3QRJA 4ACHA 3SXFA 1RE8A 5I3RA 2JKOA 1ZYDA 4I6QA 4BYJA 4GYIA 3RGFA 2X6DA 4B9DA 4L45A 3ZZWA 2W4KA 4RFMA 2UW6A 3F7ZA 5A46A 2QURA 3LMGA 2PVMA 5FBNC 5LCJA 3R2BA 4ZZNA 3ZUUA 4XJ0A 3HMMA 3WZDA 2OBJA 3HVCA 3I7BA 3PA4A 4CD0A 4PDYA 2W1HA 3A8XA 4X2JA 4FEQA 5D11A 5B2LA 2GPHA 1JOWB 1S9IA 2QG7A 4O7RA 3MY0A 1GJOA 2VWWA 2XIXA 4RIWA 5HCXA 5KMIA 3OMVA 1OIUA 4O0UA 5J79A 1A48A 1YXTA 3A61A 4I5PA 3Q9XA 4IB0A 4CFFA 3ORKA 2VTSA 2WMAA 3FZRA 4PQNA 4QMXA 4LOPA 4KBKA 4JQEA 4E6QA 4F0FA 4F09A 2X6EA 1TKIA 3PG1A 4U3ZA 1BL7A 3RBWA 4CZYB 3TKIA 3P5KA 4D4VA 4XBRA 3JR1A 3OTUA 3C4FA 2RL5A 1TQPA 1OKZA 3DGKA 3RP9A 5AEPA 3NUPA 4WO5A 4HYSA 4CYIA 5AP0A 5L8LA 2E9PA 4YHTA 1V0BA 4AXAA 2W5BA 4XYFA 2UW4A 4EHEA 2J6MA 3EZRA 4KS7A 2JLDA 2ZOQA 2OO8X 3D5VA 4E4MA 3F69A 4P5ZA 3DTWA 3V01A 1FVTA 1JKSA 3RPYA 2BFXA 4CZUA 3GCUA 4F1MA 5IA0A 4HOKA 5M44A 3PVGA 3UDBA 3VWAA 3A7HA 1KWPA 4BB4A 4DLIA 3PJ8A 3BHHA 3BV2A 4BBFA 3K3JA 4HPTE 1WAKA 2FH9A 3FKOA 3PE1A 3DT1A 4GW8A 3SDJA 2ITOA 3SV0A 5IUGA 3UYTA 1H28A 5D7VA 4YZ9A 5EYMA 3LMIA 4ENXA 2J90A 3UVQA 3DK7A 3OW3A 5DE2A 3KVWA 4X3JA 4MD8E 1OIQA 2BAKA 2GNIA 2PVNA 4GG7A 2OGVA 3CKXA 3D2KA 3KXMA 1Q62A 4FG7A 3TTJA 2BILB 3WF8A 4EH8A 5CF4A 3G15A 2WHBA 4X2NA 4D9UA 2A27A 2W96B 4FTLA 5HE0A 2BRMA 2JDTA 2PZ5A 2BZJA 2XB7A 4KB8A 2UZWE 4GVAA 2B54A 5FXQA 5GJDA 4J53A 5CZHA 5DNRA 3ULIA 3V3VA 4Y73A 3Q60A 4IEBA 2HW6A 3MV5A 3NIEA 3QUDA 3NGAA 2P0CA 3QKLA 3VS5A 3ORPA 2WOUA 2XH5A 4D1ZA 5EQYA 2XNOA 4GFMA 5B2KA 5JFXA 4BWPA 3DJ7A 4BCNA 2VAGA 4B8LA 3BHUA 4CLJA 4GEOA 2KTYA 4WNKA 4FZ6A 4J8MA 4M84A 5K4JA 1REJA 5D9HA 3UOKA 3QZHA 3FY2A 1QL6A 4ZY6A 2QD9A 3C9WA 3H3CA 5HNBA 3PJ3A 3FMMA 4L43A 3Q5IA 5H8EA 3SG8A 4ZSEA 3ORIA 3D14A 4U0IA 4RC3A 2W1CA 3H10A 3LFFA 4IBMA 3FLQA 5E91A 2X2KA 2X81A 1OITA 1PXLA 3SRVB 3N9XA 3AGMA 2EUFB 4CCUA 1FGIA 3LMHA 4GKHA 5CZIA 4CZTA 3PPKA 1YOLA 4J95A 2B0QA 4LRJA 2BALA 4TPTA 4OT5A 2IPXA 3QGYA 3ZO4A 2WU6A 2X39A 5E92A 3RAHA 3FI3A 3OWJA 4MVFA 4NL0A 3BHVA 4LGGA 4CFVA 5ETIA 3LM0A 1GIHA 4DLJA 2O64A 5CSWA 4DFZE 3QQGA 4EZ3A 4XRJA 3FPMA 2C3JA 1VR2A 3S1HA 3C4WA 4AACA 4GJ3A 2QKRA 2ZMDA 5DT4A 3F5GA 2IW9A 1W82A 4C62A 4O7LA 2UZTA 1OL7A 3AT2A 3T9IA 3KCFA 1J7IA 3VS2A 3BQRA 4QP8A 3H9OA 5D41A 5AX3A 3KREA 3E3BX 2QR8A 4AZWA 2BTRA 3LFQA 4BZDA 5CEMA 3HECA 5IQIA 5C4KA 3KRLA 3TCPA 4H36A 3ZXTA 3JY9A 1YDSE 4UXQA 3TIZA 2OJGA 4UYNA 5FXRA 3ZC5A 2XP2A 3WYYA 1BI8A 1WBOA 2PVFA 4CFXA 3TWJA 4OTRA 3ZLSA 4FICA 3IW6A 4JG8A 4ZMFA 3O2MA 3V6SA 2OK1A 3QC4A 4EZ5A 2C5VA 5J9YA 3SXRA 3KRXA 5JT2A 4KKEA 2H6DA 4A07A 2QU5A 3FBVA 3CS9A 4MD7E 2YCRA 3PLSA 4GIHA 4WKQA 2RIOA 4UWBA 5KMLA 3SKCA 3LPBA 1UKHA 2QLUA 1K2PA 5BYYA 5AV4A 4AGUA 3ZEPA 4ZTMA 4ZTRA 3C4CA 4QOXA 3UIUA 4EH4A 4IWDA 2UW3A 4FSQA 4AZTA 1UNLA 5CAVA 5HO7A 1YHVA 4PL3A 3NYOA 5FP5A 4FG8A 1JLUE 2BRHA 3WE4A 2PSQA 2QOLA 3ELJA 3NR9A 4DCEA 3AQVA 4IX5A 3NNUA 2BZIB 3DNDA 4JVGA 1QPDA 4Y5QA 2X8DA 4Y83A 3TDVA 3UMWA 3JVSA 4ASXA 4EOIA 4MHAA 3RWQA 1OL6A 4DFYA 4IM0A 4XHKB 4G3DA 5FUTA 1ZMWA 3OF0A 5E1EA 3RWPA 3PPJA 3C4EA 4XG2A 3R8UA 4PTGA 4FKJA 4FIIA 4QMNA 4QP9A 5JZNA 4EL9A 4YC8A 5KBRA 3CQEA 4IZ5A 4R5SA 3VNTA 2UZBA 2X8EA 1KE6A 3DBCA 4I6BA 4O83A 2QU6A 4JIKA 4YLKA 2XK6A 4QMMA 5JEBA 5EOLA 1GIJA 2HZ0A 2QQ7A 4QMTA 4EOOA 5IDNA 2AUHA 3UP2A 3BZ3A 4DGNA 2F2UA 5C26A 4RG0A 3KB7A 4ENYA 5CSXA 1GY3A 4YC3A 4M66A 4PUZA 4ZXTA 1CSNA 5JRSA 3ZSHA 4DITA 4E26A 3HP5A 5HBJA 4EYMA 3Q2JA 2VX3A 1IASA 4BDJA 1E1XA 5JK3A 3COHA 5CALA 3KULA 5DGZA 4BKJA 2VO0A 4CVAA 4G3CA 3KKVA 4QP3A 2H96A 3RZFA 2W0JA 4EOMA 5IA1A 1W98A 1MQBA 4MKCA 3TV7A 3HV6A 4PPAA 3Q53A 3EYGA 4ZAUA 2Z02A 3KMUA 1BX6A 2GU8A 2CCHA 3HV5A 4HW7A 5A4LA 3UVRA 4NIFA 5L2QA 4E6DA 3BELA 5HLWA 2BDWA 5AUYA 3HMIA 5BX0A 5HVKA 5J7BA 3LAUA 4XOYA 1HOWA 2J0IA 2Y7JA 2ZB0A 4V0GB 5HG8A 3LOKA 3VS1A 4EH2A 4O7SA 2UVZA 5ITAA 3EQDA 5DR6A 2J5EA 3TDWA 4P90A 4R1VA 1WBSA 2ZV9A 2WAJA 4RJ3A 2RG5A 3OVVA 3NAXA 3KC3A 2QO9A 4LM5A 3Q04A 4O38A 2YCFA 4H3BA 1P14A 2G1TA 4FTIA 1U5RA 4YJSA 4Y95A 3IDCA 3QCSA 5GINE 2QI8A 3IDPA 1MRYA 4FNWA 4XV3A 4CQEA 3FQSA 3P1AA 3IW7A 1U59A 3V5PA 5CF5A 2YM8A 4QMWA 2C5XA 5M06A 4L7SA 2BIYA 3ZXZA 4E6CA 3MFSA 4JI9A 2R3KA 4YHJA 5AV0A 5TT7A 5IF1A 3MVLA 3Q96A 1PF8A 3OWKA 4CFUA 3GXLA 5HX6A 3QUEA 4FZAB 3I5NA 4FTJA 4G31A 3FEGA 4WRSA 5JFWA 2R64A 4TYHB 5AV2A 4IHPA 3NUSA 2VTJA 1G5SA 4F6SA 3Q52A 4I24A 1ND4A 2PVLA 3Q9WA 4NFNA 2ONLA 2HK5A 4QP2A 4O0VA 3R7EA 3P08A 4J7BA 4MYGA 1WFCA 2IW8A 4D58A 4V05A 2DUVA 2CNQA 4KA3A 4J98A 4JDJA 1OVEA 5G6VA 4UX9A 4F9YA 4CTCA 3UPXA 3HRCA 4O22A 4UZDA 4AOJA 3Q5ZA 2FVDA 2R0UA 4BDGA 3E5AA 4ITIA 3RALA 2GFCA 4YUQA 2WEIA 4FTAA 3OUNB 4UXLA 5EHOA 4E20A 2DYLA 4BTJA 5EOBA 2REIA 3BLRA 2OKRA 2XNPA 2WKMA 3PUPA 3W18A 4PWNA 1Q99A 1KSWA 1BYGA 2ZB1A 3E64A 4QMZA 2GQRA 3C0IA 2I0YA 2R0IA 3P7CA 4IDTA 4UWCA 4UYAA 5L2TA 2IJMA 3DLSA 4JBVA 4NCTC 3ZSGA 3QCXA 4DC2A 3ZDIA 1FPUA 2GTNA 2JBPA 3G0EA 4I41A 4NEUA 3ZH8A 5IPJA 3O8PA 5CAUA 3VBQA 3HMOA 3F88A 4FTMA 4EC8A 5CU3A 4FNZA 1J91A 4Z3VA 2WMUA 1MRVA 3GU4A 2Z7QA 4ZMEA 4TYEA 4FV6A 5IISA 3AT4A 3IO7A 1L8TA 3RM6A 3ZUTA 4FK6A 2XJ1A 1Q8WA 3IECA 3BU3A 3CD8A 3AC2A 4BI0A 4C4GA 4P4CA 4I4FA 3SOAA 2WZJA 3WOWA 5LXMA 4AFJA 3DBEA 5J5SA 5FBOA 2GHGA 3F6XA 5HE1A 5KMOA 4BDKA 5JH6A 4JQ8A 4BCQA 2C1BA 2F57A 3Q3BA 4ALVA 1XH9A 2ZAZA 3KEXA 5J87A 4C4JA 2FSLX 3BCEA 3PWYA 3HA6A 5KKRC 4EWQA 5A14A 2UZNA 3FY0A 5AA9A 5ANOA 2PY3A 3R8PA 3VW6A 4YPDA 3POZA 4TYIA 4FSTA 5AUVA 3AD5A 3OD6X 4X7QA 2QHNA 1M17A 4GCJA 4XP3A 2G2HA 4Z7HA 4PRJA 5KZIA 3R8MA 4C3PA 4PP7A 2CN8A 4MEDA 4UEUA 4O0SA 2GSFA 4QRCA 5KMNA 5AP2A 2YCQA 1Q8UA 2XNEA 3RPVA 5IA2A 3SVVA 4FT0A 1H1QA 3KRRA 3Q9ZA 1GAGA 3LW0A 3PRIA 2XIZA 3Q4CA 5HD7A 4RWJA 5IQGA 2ERZE 2BAQA 4G3FA 4FL2A 3KRWA 4XG8A 3ZDUA 3V8WA 5HZNA 2W1GA 4YZCA 4E5AX 4U42A 2WTVA 5A9UA 2B9HA 3F2AA 1DM2A 4UB7A 3GI3A 4FIEA 4W4XA 2XEYA 4WBOA 3UZRA 4KABA 4X6RA 5BMSA 5LVLA 3VBWA 4HCTA 4YTHA 4ANBA 5HESA 4KKGA 1GZ8A 5AR8A 2Q0NA 4NSTA 2JKMA 4QQTA 5JMSA 4YC6A 2O0UA 4E4NA 1R0EA 4A7CA 4ZLOA 4L3JA 5K0KA 2HELA 4K77A 5AIRA 2BKKA 3EN6A 2HOGA 3IONA 2I0VA 1IRKA 5KMKA 5HVJA 3EN7A 3VRYA 5M08A 2PVRA 5HIEA 3QKMA 5AV3A 2C5YA 3QRUA 4UBAA 5DIAA 3JYAA 4NH1A 2GS2A 3SRVA 4G6LA 4O0TA 4C3FA 5I4NA 3PLAE 2NRUA 3MH2A 2R9SA 2YIRA 4OLIA 4TT7A 3QQFA 4EH7A 1R1WA 4G6OA 4FSNA 2QC6A 4BL1A 3FLZA 4EK4A 3VO3A 5HG7A 3D5WA 3QFVA 4WG3A 5D7AA 5AUZA 4FGBA 4U7ZA 1PMUA 4Y8DA 4JAJA 3MTLA 4FKQA 1LPUA 3R9DA 2IO6A 2P2HA 5AAEA 4BDBA 2VTNA 3Q2MA 4FTQA 5BUIA 3MN3A 5AAFA 4WBBB 1SVGA 4UY9A 3H9FA 4BWXA 4YJPA 2ZYBA 4I5HA 5BVOA 3LQ3A 4QYFA 5AWMA 1YDRE 3EMGA 2Z7LA 3QCYA 2C0TA 3CY2A 4QPSA 3JS2A 2CGWA 4FEXA 5IUIA 4Y46A 3C0HA 2YDIA 2A4LA 3FPQA 1P4FA 4BYIA 3S3IA 3K54A 5CQWA 4MXOA 3UO5A 1MQ4A 3FXZA 3KCKA 4IAAA 3BE2A 4ASDA 3P4KA 2EVAA 4S32A 3NWWA 3F3ZA 3F5UA 2QLQA 3NPCA 2FA2A 5FQDC 5M07A 3EN5A 4IC8A 2BRNA 3CQWA 5DRBA 3SXSA 4M15A 2WQEA 1H07A 3RK9A 3SA0A 4PY1A 4X21A 4YMJA 3DJ5A 3UJGA 2YM4A 1G8SA 4K8AA 2XJ0A 4QTBA 4W9XA 1U4DA 1ZMVA 2XKFA 4BIBA 3GFEA 4PF4A 5GIOE 1IA9A 1YWVA 4FOBA 3NDMA 3QZGA 3N4VA 1DAYA 3S00A 3AC4A 3KXGA 5HGIA 2PZRA 3N4TA 4BR3A 1H4LA 4RLLA 2ZMCA 3D9VA 3GB2A 5F95A 4TW9A 4EZ7A 4KBAA 2WOTA 1REKA 3BYOA 3T3UA 4D2SA 4ANNA 3AD4A 3DFCB 4MXYA 5HI2A 5IMXA 4RVLA 1PMVA 4BY9E 3OY1A 1I44A 4R7IA 1ZY4A 4IM2A 1H01A 4IAKA 4U44A 3U54A 4OTFA 2GCDA 4YZMA 2VNWA 1GIIA 3LJ0A 3P9JA 3SQQA 3R02A 3L8SA 4IACA 2JFMA 2F4JA 2CKQA 4D2WA 3ZUVA 2JDSA 2VUWA 2BZHB 4HJOA 4RWKA 4RFZA 4CSVA 4EKKA 4C8BA 1FBNA 5J1VA 4AW1A 4F9BA 4MXXA 2C6LA 4RVKA 2GQSA 3D7TB 5AMNA 3MVMA 5F4NA 4GFOA 5DEYA 3F61A 5CAOA 5HU3A 4DG2E 5DT3A 4XV2A 2A2AA 3EWHA 3L9PA 3VUMA 3FI8A 3H30A 3MB7A 5E8UA 3DS6A 5KE0A 3HP2A 5M4FA 2UV2A 2F7XE 2C6IA 4MXCA 3EQGA 3U4UA 4H39A 3LCOA 3FXWA 2JDRA 4NKSA 4RWLA 4TWOA 1WBWA 4BI2A 1PXKA 3R8ZA 4IAZA 1YHSA 1ZWSA 2UUEA 3OOMA 4BDHA 3LFBA 2CHLA 2PZPA 3QQLA 5IQHA 4EJNA 2XK9A 2C6MA 4M13A 2WTKB 3KK9A 4D2TA 4V0GA 4D5KA 3DAKA 5CU2A 3DBFA 4FVQA 4TZRA 3DZQA 5C1QB 3MGYA 4L01A 3HGKA 2YHVA 5CENA 3ZHPC 3QD3A 4IM3A 2R3PA 5CT0A 2ZVAA 1OL2A 2R5TA 2OZAB 4YZNA 1J1BA 1UKIA 2YM3A 3COIA 5E7RA 5CEIA 3W2OA 5HOAA 4DTAA 1Z9XA 2BRGA 2OZOA 2DQ7X 3HNGA 1YHWA 1XHAA 1KE5A 4ACMA 3O50A 3E92A 4RIXB 4IZAA 4AF3A 3OCTA 3FXXA 3H4JA 3FC1X 4B4LA 2PMIA 4OBOA 5HTBA 4FSMA 4S30A 3FLYA 3G9NA 3KK8A 5I0BA 4CCBA 4O21A 3ZO1A 3VVHA 3QQHA 3LFEA 4DGOA 3G51A 4BWKA 4N70A 3O8TA 4ZLZA 3DV3A 5CSVA 3V6RA 2I6LA 2X7FA 2OW3A 1M7NA 4IW0A 4TYHA 5C27A 3TL8A 3WE8A 4OTHA 5CTPA 4F1OA 2VTTA 3ZYAA 5KMJA 5K4IA 3GC0A 1PXMA 3R01A 5M55A 4RVMA 4Y85A 2E9VA 4GVJA 3W2SA 3MH0A 3W55A 2EXEA 2GQGA 2UW7A 2PPQA 3NX8A 5HVYA 3OWPA 5HKMA 1OIRA 3VRZA 3GU7A 2XRWA 4I5MA 2ITQA 4HVHA 4HGEA 5DMZA 5CXHA 3ZRLA 5HD4A 3UPZA 3O96A 4K18A 2I1MA 5LWMA 4QTCA 4FK3A 4BDFA 3EQBA 5DR9A 4C61A 2B4SB 3IPHA 4BTKA 4EH3A 3WZEA 2W1FA 4R8QA 4EHVA 2NPQA 3KQ7A 3GOPA 3K5UA 4QYEA 4X2FA 4PMPA 3NW7A 4PTCA 4ANLA 3BKBA 5IH6A 2WIHA 4A9UA 3DNEA 2C47A 3DFAA 4USDA 3TZ7A 2GNGA 1JSVA 2ITVA 4L53A 2VWIA 4EOJA 2HXQA 4F6WA 5I9WA 3G90X 2YN8A 4FOCA 2OLCA 2W4OA 4ZLYA 4BZOA 4JNWA 5HNGA 3BE9A 1P5EA 3FDNA 3C7QA 4KIOA 1F3MC 3DBDA 4ZJJA 1Q8ZA 4A4OA 2H34A 4WNMA 3CP9A 4ANOA 2WNTA 2Z2WA 3HMPA 1ZZ2A 3VC4A 1WBPA 3NVKI 4XNEA 4DF3A 5L6WL 4YBJA 3ORMA 3VAPA 2VRXA 4FT5A 4JQ7A 4EOKA 2WMBA 1IAJA 4TTHB 5EDRA 3U6HA 1WBNA 3ZOSA 2W05A 2ITYA 3GC9A 4W4VA 2EXCX 4M0YA 3OEZA 4MX9A 3DXQA 1H08A 2VGOA 1DI8A 3R9RA 5BNJA 3MA6A 4RJ4A 2Y4PA 4FL3A 2WQBA 4GSBA 1E1VA 1R78A 2G2IA 3FZPA 4QNYA 4E7WA 5E8VA 3MJ2A 1OPLA 1PXNA 3DK6A 3COMA 2XVDA 2PUUA 3E3PA 2Q83A 1FVVA 1JKTA 5J8IA 3UQFA 1M52A 1UNGA 4BDEA 3FZ1A 5H8GA 1F0QA 5I9ZA 4IDVA 3AXWA 3WARA 2IN6A 1E9HA 3O71A 4UALA 5A3XA 4TN6A 2PZYA 2BZKB 4O0WA 4LMUA 2R2PA 4WRGA 2CN5A 3R7YA 4FKLA 2I0EA 1I09A 4EOPA 4XH6A 4ERWA 3LXKA 3R71A 3A7FA 4DTKA 4WUNA 5HCYA 3HRFA 4GK2A 4BCGA 2ZV7A 3F3VA 4NM7A 3BWFA 1YXSA 2E2BA 2PE1A 3EIDA 4GH2A 4H3QA 4MNEB 2CSNA 3GEQA 4DT9A 1XBBA 4O0RA 4FKOA 3QRKA 2WTWA 5EW9A 2VWUA 4FGRA 3FAAA 3PXYA 2ZM3A 3ZZEA 2QOQA 2XKDA 4RQVA 3H0ZA 4L00A 3AG9A 4NM0A 5AADA 3FLWA 1VEBA 3NRMA 4FV8A 4JIAA 3SG9A 5BVWA 4D1XA 2PVYA 1SM2A 2OIQA 4MCVA 2J0JA 2QNJA 4UMQA 2OXYA 3VN9A 3F3WA 3ZEWA 5GZAA 4O86A 1RQQA 5C03A 4WG4A 2YA9A 4MK0A 4DFUA 4I0SA 4EKLA 3CIKA 1W8CA 3NUUA 3NW6A 4OT6A 3OS3A 4AX8A 4FTUA 2V5QA 4IC7A 1M2QA 4GMYA 4QQJA 3R6XA 2FGIA 5DVRA 3WYXA 1FVRA 4UN0C 5FRIA 3WZJA 4G16A 3G0FA 2C6OA 2UZEA 4DGGA 2G2FA 2J7TA 3DOGA 5F9EA 2UW9A 1UU3A 2R3LA 2Q0BA 4R5YA 3I81A 4NW5A 1ZYSA 2Y8OA 3QKKA 3UIBA 5BVFA 3MDYA 3NNWA 4APPA 4U8ZA 2CDZA 3TJDA 2QOOA 5CNNA 2QODA 4LV8A 5ANGA 4ANQA 3A8WA 1H8FA 3KL8A 4RJ6A 4X6QC 4D4RA 4UMPA 3ULZA 4R7BA 2B7AA 3VBTA 3RMFA 5FTQA 1V0OA 3O23A 2W1DA 1XH8A 4XOZA 4G34A 5M4IA 4M0ZA 4M68A 2B1PA 4XP2A 2OI4X 4KIKB 3ERKA 4ZP5A 2QO2A 3UMXA 3NVMB 2YJSA 3E8NA 5AP4A 3T8OA 4DEGA 3FL5A 2LGCA 1OBGA 2QG5A 3EKNA 3EYHA 2W06A 3ID6C 3ACKA 3GU5A 4RIYB 3G2FA 4RSSA 3ZFMA 4JXFA 3LFAA 5E8XA 1P4OA 3A7JA 4HVDA 5FWKK 3R63A 2UVYA 4EHGA 5E4HA 5IU2A 3C5IA 2OJIA 5M57A 4F64A 2XS0A 4QTAA 4X0MA 3LFSA 3TM0A 2Y6MA 4BFMA 4F7SA 3BBWA 3CSVA 4FC0A 5H9BA 1O6YA 4EQMA 2NP8A 1FQ1B 3O51A 2IVSA 3RINA 1OGUA 4U3YA 1OECA 4XLVA 5EG3A 4DEHA 5FLFA 4IQ6A 3DXPA 3SW4A 4BTFA 3ORZA 3KFAA 4PL5A 3KMMA 2JITA 4NU1A 5DG5A 4HGTA 2RSVA 3TACA 5I9UA 4PDOA 2WGJA 3FLNC 4FA2A 3ATSA 3V5LA 1KV2A 5JKGA 2YAKA 4QNAA 2OF4A 3JXWA 2X9EA 5LMKC 4GU9A 1YXUA 4IX3A 4XS2A 2ERKA 2HW7A 4ZJIA 3UC3A 4ZZOA 2YCSA 2GFSA 4O7WA 3VS7A 3GNIB 1ZAOA 2J0LA 4L68A 1WCCA 3FMKA 3MY5A 2VWYA 5CVFA 3TZ8A 2P3GX 3B8RA 3GQIA 5EH0A 5FD2A 3UIXA 3I7CA 3WIGA 4ITHA 2SRCA 2JEDA 2OIDA 2J50A 2R3QA 5KNJA 5K5XA 2P55A 2WMQA 2P2IA 3E63A 3D7TA 4WSQA 3A7GA 5L2SA 4I0TA 1JSUA 2VU3A 3GC7A 2VO6A 3MPTA 1GNGA 2OF2A 3NS9A 4X3FC 4OR5A 3PJCA 3T9TA 3WZUA 2J0KA 3ORLA 2PK9A 3FZTA 3I0QA 1ZRZA 2PTKA 4A4XA 1CTPE 3IW8A 1WVWA 3MY1A 3P79A 5CWZA 4F9CA 3C4XA 3R1QA 3QTQA 3V8TA 3W10A 4FTTA 3U87A 4QD6A 4C2VA 3L8VA 4FBXA 3LCTA 3VULA 5CXZA 5TR6A 5CAQA 2UVXA 3MWUA 2W1EA 4C3RA 2WTIA 4ZZMA 1B6CB 1H0VA 4DFNA 3DKFA 3VS6A 3DBQA 2IZUA 3QYZA 5TKDA 3ZU7A 5TE0A 4BCFA 2XCKA 3ZM9A 4II5A 3V5JA 3HV7A 1A06A 4FEWA 4FI1A 4J97A 3ZBXA 3ZONA 3IS5A 3BGZA 3DA6A 3FI4A 2R3RA 3KU2A 1SNUA 4MXAA 4U6RA 3W2RA 2JKKA 5CEOA 4BCMA 2HAKA 1H1RA 2OZAA 4TWPA 2OXXA 4BDDA 4CTBA 4KRDA 4X2KA 5AUTA 4ZS4A 2YABA 2E9UA 4IVCA 3UNJA 4OAUC 4YJUA 1APME 4RIXA 3TNIA 4BCPA 5DBXA 3TJCA 3GGFA 3MESA 1PYXA 2O63A 4XEYA 3QRTA 3PYYA 5KX8A 2XKEA 2WPAA 1FOTA 4P2KA 4HCVA 3LLTA 4NYEA 3UQCA 4DT8A 3QTXA 3CTHA 1NW1A 2CKOA 5BVNA 3BEGA 1PXJA 3BU6A 3GCSA 4IZYA 4O1OA 2HCKA 4PMTA 4C7TA 4EC9A 1WVXA 4ZSJA 3PZEA 4N57A 3BHTA 4WIHA 5CSPA 1R0PA 1Q8TA 4YJQA 1Z5MA 3NUNA 1YI3A 3C1XA 4QMQA 2HWPA 4ZY4A 3HMNA 5HX8A 2YITA 3FYJX 2WEVA 4G6NA 4GG5A 4KBCA 2PMNX 4AW2A 4GRBA 3TNPC 3W8LA 4AAAA 3D0EA 3H0YA 4FV7A 2ESMA 3A4PA 4CFWA 3EQHA 5J7HA 4GYGA 5ACBC 3UG1A 3VBVA 3IQ7A 3D4QA 5CT7A 2VTQA 4L9IA 3OUKA 5IA5A 4FKVA 4AT4A 1Q97A 2WTCA 4MTAA 3DB8A 1Y57A 1NA7A 2IWIA 4OGRA 4FKUA 4IVDA 2YERA 2PWLA 3DAEA 3E8DA 5BMMA 4CGAA 1M7QA 2C68A 2C5NA 4U9AA 4YNOA 5IZFA 1S9JA 4Q9SA 5EHYA 3KN5A 3RK7A 4B7TA 4IJPA 1YI4A 5E8TA 4OTWA 3SX9A 3WILA 2YIQA 5IQBA 3U55A 4O27B 1ZXEA 2ZM4A 4NWMA 3QUPA 1JPAA 5HG5A 1IG1A 3IG7A 4UMUA 2YZAA 1JAMA 2UW8A 2XRUA 5DOSA 5E1SA 4EJ7A 4RRVA 2XCHA 3TUCA 3DJ6A 2XIRA 3CJGA 2W1ZA 4JBQA 4C34A 4Q5EA 5FDXA 5IH5A 4WT6A 1XH7A 2CKEA 3K5VA 1OMWA 4C58A 5FG8A 1OL5A 3PJ1A 1BI7A 2R3IA 5JGDA 2CJMA 2BDFA 2CCIA 3UBDA 4C0TA 2FSMX 4U5JA 4GV1A 2OU7A 3R9NA 2AC5A 4P5QA 4IE9A 2IZRA 4LYNA 2IG7A 2XNGA 3OXTA 3UO4A 3ZLWA 5CEPA 5E8WA 5IEXA 1YOJA 2RGPA 4U79A 3GUBA 4D0XA 3U4WA 2BVAA 4F4PA 5JSMA 3VUTA 3I4BA 3QD0A 3DAJA 4QMPA 1U54B 4YZDA 3MYGA 4I93A 1PW2A 4DEIA 4ALWA 1Y6BA 2YIWA 4UZHA 4D55A 4ANSA 4A9SA 5JZJA 3BLHA 3PG3A 4YURA 1BL6A 2O3PA 2Z7SA 4L67A 2PL0A 2UZOA 2Y6OA 3R21A 2B55A 4OTIA 4YHFA 1XWSA 3QXOA 2PZIA 5BVEA 4ACGA 2O8YA 3HEGA 4ZTSA 4AGDA 1O6LA 4ID7A 2PULA 3V5TA 2QOFA 5FEDA 1M2RA 1Q24A 4ZTQA 4USFA 4MQ2A 1Q5KA 5AR4A 5B0XA 4S31A 3WF5A 4J99A 1BLXA 4HCUA 1H00A 5C8KA 5LVNA 4IAFA 1UU7A 3FKNA 4X2GA 3UC4A 2HZNA 4PNIA 3B2WA 5C01A 4ACDA 4AS0A 2VO7A 2OSCA 2V0DA 2YISA 3ALOA 4QQCA 4PPCA 4NFMA 1QPJA 2OIBA 3IK3A 4YGAA 1Y8YA 2VO3A 3NCGA 3NUAA 3SW7A 4CG9A 1OKWA 1OIYA 5ANJA 4G3EA 4L52A 1QMZA 4DG3E 3I5ZA 4XG9A 3NIZA 4F1TA 4W4YA 1WBTA 4ZTHA 1ZARA 3AD6A 4MNEA 5AV1A 4AZSA 1W7HA 2BUJA 2XJ2A 5CU6A 3VUDA 3E8EA 3MI9A 4OAVB 2OWBA 3BRBA 4TY1A 3NEWA 4CMUA 4J52A 5M53A 2FSTX 1HCKA 4UMTA 3S4QA 2A1AB 2R3JA 4YSMA 2O5KA 1H1WA 3VHKA 3O7LD 3MS9A 1IAHA 2XK4A 3Q6UA 1WBVA 4IAYA 4RA5A 3DXNA 1ATPE 3GENA 4U41A 4F08A 2J4ZA 2VX1A 1YWRA 2CLQA 3FZOA 2PMOX 2G15A 3QTIA 3NUYA 5LCKA 4C36A 3FQEA 5EKNA 2BCJA 2VGPA 2YWVA 2J2IB 1URCA 1OUYA 1YKRA 3S95A 4I23A 4N0SA 4YO6A 4DGLC 3AC8A 3M1SA 2W5HA 3RPOA 3LFCA 3DU8A 2VN9A 3GU6A 3ORNA 4Y72A 3ROCA 1UWHA 4C38A 3FQHA 1IA8A 2WQNA 1F5QA 3FMDA 3LHJA 3RAKA 4BF2A 4DYMA 5HICA 2XIYA 3EKKA 3RHXA 4BRXA 2H9VA 5IQDA 4N6ZA 4O0XA 5I9XA 2YDJA 4CRLA 4EOQA 2B9FA 2O65A 2VTOA 5LMBA 4DCAA 1NVRA 3DKCA 3VS3A 2CGUA 4RA4A 2FYSA 4F7LA 1WZYA 4R7HA 4Y5HA 3P78A 2PUPA 3R30A 2XMYA 4TXCA 5IQAA 3QU0A 3C0GA 3MBLA 4OTQA 3TZMA 3OFMA 4A9TA 4KUJA 3AOXA 4I0RA 4D4SA 5HE2A 2WTDA 2XKCA 3QTZA 1B39A 3P86A 4KIKA 5FXSA 2V62A 3MFUA 3EJ1A 4AA4A 4AU8A 1OKYA 2WMVA 5FEEA 4C59A 4LGDA 2J5FA 1TVOA 5BYLA 3PA3A 1PJKA 3F66A 3HLLA 4IB5A 3VW8A 1ZYCA 4I21A 5CVGA 3UIMA 3LFNA 2VWXA 3POOA 4RIYA 2R7IA 5EDPA 4EK3A 5G1XA 4HGLA 3TEIA 2CPKE 3PP1A 3QA0A 5HHWA 2YWPA 1H0WA 5AUWA 2UZVA 5AP3A 4YU2A 3EFKA 3R8VA 4K6ZA 4BIDA 3OEFX 3EQIA 2BIKB 5KO1A 4GFGA 4R3RA 3OHTA 4DN5A 2OFUA 5ANDA 4CLIA 1W0XC 3GCPA 3REPA 2XUUA 4KRCA 3W1FA 2JAVA 2OFVA 4IADA 3VJOA 4DEEA 4TYJA 3A60A 4L6QA 1ZOGA 2AC3A 2C6EA 2XYNA 4DG0E 5DFPA 4EBWA 4HVSA 3HZTA 2AYPA 2CGXA 3PSBA 3ZLYA 2VTMA 4EWHA 4L3PA 3TV4A 4ASEA 4FUYA 4FX3A 2ITTA 3AC1A 3ITZA 5LJJA 4EEVA 4YJTA 5CAPA 3SC1A 5GZ8A 2W9ZB 3OZ6A 5A4QA 4BBMA 4BGQA 2GHLA 3JVRA 2EXMA 5CEKA 3QALE 5EYDA 2WQOA 4AZFA 4A06A 2C3LA 3MFTA 3R28A 4AN3A 5HBEA 4GT3A 4QMVA 3A2CA 3WIKA 3EQPA 1XH6A 1YVJA 3QRIA 4CEGA 4GL9A 3ENHA 4EH5A 5KKRB 3NCZA 3KGAA 3FKLA 2V55A 3L8PA 5GNKA 4KSQA 4E5BA 4GK3A 5HLNA 3U6JA 1K3AA 1X8BA 3ZFXA 5BVKA 3AGLA 3R8LA 4L46A 4DAWA 1TQMA 1PYEA 4YLJA 5I9YA 4DE4A 4EQCA 3BGQA 1JVPP 3QGWA 5K3YA 1Y91A 3RJCA 2HY81 5JFVA 2LAVA 2QONA 2WD1A 2XK3A 2EB3A 3UYSA 5EI8A 4XLIA 5GIPE 3UOHA 1FMOE 5JQ5A 3QBNA 3RNIA 5HE3A 2HWOA 4XX9A 3PSDA 1QPCA 1QCFA 1H24A 5IA3A 4NTTA 3EN4A 4CKJA 4L3LA 2YFXA 4AZEA 3O0GA 3IOKA 4FV3A 3OT8A 3VUIA 4E4XA 2JIUA 4FKPA 1XH4A 3ACJA 5F1ZA 2C6DA 2PU8A 3LLAA 4TKSA 3ZRKA 2WMTA 5FDPA 4H05A 4FL1A 5J95A 2BDJA 4L8MA 5D1JA 4ZTNA 4KS8A 2HZIA 3L9LA 3O8UA 2XZSA 3LJ1A 3QTRA 5EDQA 2W99B 1RJBA 5T3QA 1T46A 2ONLC 1FINA 3MIAA 3OCGA 4QP4A 2JIIA 5DH3A 4B6LA 4O1PA 2CMWA 3DQWA 3G6HA 3M11A 3GCQA 3OBJA 3OP5A 3O17A 4RZVA 3UG2A 4R78A 4FV9A 1IR3A 2QKWB 3MPMA 1JNKA 2DS1A 3R2YA 4IX4A 5DT0A 5H8BA 5LQFA 3OOGA 5HQ0A 1LP4A 2QCSA 1J7LA 1CM8A 4W9WA 1CKPA 3ZO3A 4H58A 4IH8A 3MPAA 1YXXA 4FT7A 4R3PA 2ETMA 2GNLA 4RX5A 3UO6A 1RDQE 1H26A 5DEWA 2WMSA 3R9OA 3AC5A 2XBJA 4ZTLA 2KULA 4RT7A 4KIQA 4O7YA 3IW5A 1XH5A 3L1SA 2XBAA 4F7NA 2Y4IB 5CU4A 4RX9A 3RAIA 2J0MB 4QPAA 3EL8A 3TXOA 4CRSA 3VF9A 4IVAA 3IW4A 4G17A 3FMHA 4ZSGA 3HRBA 2A19B 3ZSIA 1PHKA 4IJ9A 5F20A 2X0GA 3VUGA 2WTJA 3Q9YA 3CLYA 3IGOA 1Y8GA 4JDKA 1XO2B 5HIBA 2OJFE 3DK3A 5ANEA 4DH1A 2HY0A 3ENMA 1VYZA 3ANRA 3KXXA 4DFXE 3FHRA 3LCKA 4I5CA 3WBLA 1OKVA 1T45A 4JR3A 2PYWA 3CGFA 5FP6A 4F99A 3EQFA 4FF8A 3BIZA 3QXPA 4BI1A 4EH6A 3E8CA 4FE2A 3PXFA 4QT1A 3U8WA 3BEAA 2CNVA 4FSRA 2V7AA 2X7OA 2IZTA 4I94A 3U9CA 1AD5A 3QX4A 3UNZA 4BICA 4O2ZA 3FYKX 4U81A 3QTWA 2Z8CA 5EQEA 2WFYA 4U43A 2QVSE 3TIYA 3RK5A 2GMXA 4NJDA 3E93A 2GTMA 4FR4A 5JRQA 2CGVA 3M42A 3RVGA 4AQCA 4D2VA 3CD3A 4GIIA 2B52A 3FV8A 2VTRA 1ZY5A 4AA5A 3I60A 3R04A 1A9UA 1U54A 4FSUA 4F70A 4Q2AA 4YPSA 4ACCA 3AMBA 3PA5A 4I3ZA 3G9LX 3HDMA 4QP1A 5EW8A 4C2WA 3THBA 2X4ZA 4CG8A 1LR4A 3BV3A 1KOAA 3AC3A 3F3UA 3FE3A 3LFDA 5A4TA 5AX9A 4E93A 2EB2A 1G3NA 2OJ9A 4S33A 2FO0A 4PDPA 3EFLA 2ZM1A 4NK9A 1YW2A 4MBIA 4JT3A 3OROA 4LQMA 4LG4A 2R3MA 1ZOEA 4HZSA 5M4UA 3G6GA 1XQZA 1OI9A 3V04A 2BPMA 3A99A 2QOIA 1K9AA 2OICA 3D7ZA 3F2NA 4RVTA 4WNOA 4YBKA 4F9WA 2VTLA 1DS5A 4S2ZA 4KWPA 3VQUA 2ETRA 4DEAA 5KZ0A 4HVIA 4YTFA 3PDTA 4FKRA 4LUDA 2NO3A 5AJQA 4YTCA 3EN9A 4I20A 3V5WA 2B9JA 4IIRA 3FMJA 3BQCA 3ZMMA 3LM5A 4OTPA 4HYHA 4MQ1A 3GOKA 4EI4A 4IANA 2VX0A 3BWJA 2YACA 3A62A 3CBLA 3MW1A 2ITUA 4QMOA 4TNBA 4FTRA 4O7TA 3FI2A 1Q61A 4IWPA 5AAGA 4FT3A 3MTFA 4QP6A 4LV5A 1OPKA 4NM3A 4JDIA 4O2PA 3R7UA 4AT3A 3LCSA 1KE8A 4IZ7A 5AP7A 2PE2A 3O7LB 4R1YA 4M14A 3RPSA 3L9MA 2XYUA 2V22A 3CR0A 3JPVA 4V04A 4FT9A 4ZK5A 4F9AA 4E4LA 5K9IA 1UVRA 3P7BA 3CGOA 4I6HA 4O6LA 1NT2A 4HYUA 5J5TA 5K0XA 1M2PA 4AN2A 4KAOA 3DPKA 4M12A 4M97A 4FZDB 4AUAA 4E1ZA 4APCA 4LFIA 5ETFA 3MVHA 5A4EA 4D0WA 3TG1A 3NLBA 3PWDA 3PXRA 3HYHA 4FV0A 5CI7A 3OXZA 4Z16A 3FWQA 1MUOA 1ZMUA 5E90A 3GCVA 2C0OA 2YEXA 5AA8A 2ACXA 4GT5A 5C4LA 5IDPA 4CMOA 4RGJA 3TNHA 1J7UA 4FZ7A 1ZLTA 4HNIA 5CQUA 3NYNA 1M14A 5ETAA 3R83A 1VJYA 3V5QA 2UW0A 1OM1A 4C35A 2VWVA 3QAME 5FEQA 3N51A 3V8SA 2ZJWA 3CCNA 2RG6A 4I6FA 4FODA 2F7EE 3ODYX 4WUAA 3D94A 3R9HA 4DINA 5LVPA 2I40A 3E87A 3W16A 4EUTA 5LOHA 3L8XA 3UGCA 3D2IA 3UE4A 3C4ZA 3KF7A 2IW6A 2IZSA 1UV5A 5ETCA 3I6UA 3TN8A 2J51A 2IVTA 4TNDA 3UZTA 4NZWB 1H27A 4O7NA 4F0GA 3R73A 4ONAA 3M2WA 5KUPA 4CQGA 4JX7A 4I4EA 1SYKA 2ZV8A 4BHZA 3TUBA 4E6AA 3HUBA 3MSSA 3QTUA 4JG6A 5IH4A 3R7GA 2JIVA 3JY0A 4AN9A 4OUCA 5EI2A 3B8QA 3VS0A 4F7JA 1UWJA 4GUBA 4BGGA 4K9YA 4R3CA 3HAVA 1AGWA 4IWQA 3A7IA 3LXNA 4DTBA 3KXHA 2OG8A 3PY3A 3TV6A 4FKIA 4XV1A 2BMCA 2JKQA 4YR8A 4OBQA 4LGHA 4NCTA 1Q8YA 3W8QA 4CT2A 4D9TA 4OBPA 4O84A 3PJ2A 5TOZA 2BHHA 1NVSA 3Q4UA 5EK7A 4MH7A 3EQRA 4FIFA 1OUKA 5FM3A 4IAIA 4D1SA 3CJFA 4H1MA 3WI6A 3ZBFA 4QYGA 3QL8A 2X8IA 4FG9A 4XMOA 1MP8A 4O82A 1PXPA 2B9IA 3I6WA 4AE9A 2W5AA 3NNXA 3BI6A 4KSPA 1ZOHA 3VBYA 4FIHA 4C4FA 4IFGA 4EONA 4WHZA 5GHVA 4O6EA 1OL1A 1SMHA 4IB3A 4YJVA 2XA4A 3LQ5A 1BUHA 3QWKA 4QQ5A 4K0YA 4QYHA 2JD5A 5ANIA 3VUKA 5A4CA 5IQEA 4KNBA 2QHMA 2Z7RA 3FJQE 3ZCLA 4QMLA 1STCE 3RPRA 5LVOA 4QMYA 5I5ZA 2B53A 3MA3A 5LWNA 4J8NA 2QOBA 1B38A 5HNIX 2W7XA 1XKKA 4LRMA 4QPMA 3NAYA 3UOJA 2ETKA 3D83A 5AP1A 4BN1A 5BUEA 5CF8A 3EL7A 4JX3A 4DHFA 4ZJVA 5M4CA 5L3AA 1OPJA 2NRYA 3D15A 2FSOX 3OXIA 4FIGA 3I1AA 2CLXA 4G3GA 5FTGA 3TZ9A 5EHLA 3OCSA 4JRVA 4YJRA 4CKRA 3ET7A 3ORXA 3UNKA 3QD2B 5FM2A 2Y9QA 4FTCA 4C02A 4KD1A 4W8EA 5D10A 3FMEA 2C4GA 1ZYJA 4M8TA 3MJ1A 3TKUA 4DH8A 4ZEGA 4EK6A 3PVWA 4XBUA 2IVUA 2C1AA 2XIKA 3HX4A 4FKGA 3ATTA 3DLZA 4DH7A 3G5DA 4LOOA 3DDPA 4Q5HA 2R7BA 3P7AA 4AWIA 4DBXA 4DA5A 3E7OA 5K5NA 5D12A 4YZBA 1XJDA 3PRFA 2RF9A 3ZS5A 2WMXA 4K11A 5CSHA 5CLPA 2BAJA 5DWRA 4AE6A 4ZIMA 3RI1A 4YSJA 3R1NA 3F5XA 5BPYA 3C5UA 5EYKA 4MF0A 2WU7A 4RC2A 3U51A 5DPVA 1PY5A 4FSZA 4EK8A 5ICPA 3FHIA 3WF7A 4AOTA 3ALNA 2V7OA 2F49A 2OH0E 4D28A 1QPEA 5E9EA 4QO9A 4C4IA 5IQFA 1DI9A 2NNWB 4CYJA 3A4OX 4IXPA 5HLPA 1XR1A 3BYMA 2UW5A 3IDBA 4PMMA 4CV8A 3S0OA 4NKAA 4XRLA 2YM6A 3R22A 2BRBA 3R7VA 5A6NA 3C51A 3GT8A 5TF9A 4YTIA 5AR2A 2PVHA 3PIXA 3CPCA 4AP7A 4MD9E 5DR2A 4DH3A 3VJNA 3EH9A 4AOIA 4EOSA 4G2FA 3QQJA 4MWHA 4WD5A 2GS6A 3RAWA 3LJ2A 5EYCA 4RLKA 5CS6A 4YO4A 5IUHA 2IVVA 3BLQA 3ODZX 4BCKA 5A6OA 5C8NA 3OTVA 4MF1A 4A9RA 4JAIA 5EI6A 5EW3A 3W33A 4KINA 3EQCA 3U6IA 3B2TA 1JKLA 3CC6A 4BBEA 3MVJA 1PXIA 3QHWA 4FKTA 4WSYA 1LEWA 4FKWA 3LE6A 2YIYA 5DRDA 4CFMA 3MH3A 2E9NA 3UTOA 5L6PA 2XM9A 1H1PA 2BROA 2X2LA 3BBTB 4U97A 4B0GA 4JBPA 5B2MA 3OY3A 4WOVA 4U45A 4DEDA 4EH9A 4CXAA 2JBOA 4EYJA 2VNYA 2W17A 1R39A 4D5HA 2C6TA 3RNYA 5BYZA 3PXKA 5H2UA 3R00A 2CKPA 2Y0AA 1JQHA 2W1IA 4MAOA 2C5OA 2ITZA 4C33A 1GOLA 1HCLA 1CMKE 2YM5A 3MB6A 4UWYA 2RFNA 4MNFA 4XV9A 4E3CA 1PMNA 5JFSA 1Y6AA 5IKWA 4NTSA 1MRUA 4TRLA 4UMRA 4GK4A 3NYXA 4TYGA 4G5JA 3FLSA 5AR3A 4BDIA 1Q41A 3FC2A 4BCIA 1AQ1A 4IFCA 2WQMA 3C13A 2RKUA 3EZVA 3I79A 4RJ8A 3TT0A 1NVQA 2VTIA 4L44A 5J1WA 3N4UA 3DTCA 3ZTXA 2F7ZE 1XBAA 1KOBA 2GNFA 5HBHA 3BHYA 3GP0A 3P23A 4EUUA 4KIPA 2ITXA 1PKDA 1UU9A 2YZLA 3TNQB 4F63A 3LVPA 5IEVA 3BYUA 1FGKA 4XCUA 1V1KA 3QX2A 3TTIA 4ANMA 2CNUA 4TWCA 3LZBA 1R3CA 4BKZA 4CT1A 3Q6WA 3ORTA 4IX6A 4PDSA 5HIDA 3SGCA 3SHEA 2PHKA 3FSKA 4GKIA 3LQ8A 4O91A 2OXDA 3D5UA 4R6VA 1WMKA 3R7OA 3QF9A 2RFSA 2VTHA 3HV3A 4FNYA 1XBCA 4D2RA 5EM6A 2W4JA 1SVHA 3KF4A 4RWIA 5JGAA 3LCDA 2YM7A 3ETAA 2RFEA 3QA8A 3ZM4A 2WO6A 4LMNA 2QOCA 4B99A 4Z55A 4W4WA 2R3GA 5GJGA 3PXQA 3ZC6A 5EQPA 2PVJA 4X3FB 3U9NA 4JS8A 3PIYA 4ZY5A 4FVRA 4G9CA 1YI6A 4Z7GA 3AMYA 3VQHA 4K2RA
chains in the Genus database with same CATH superfamily
5FGKA 4U80A 4BC6A 4E73A 4GJ2A 4USEA 2JC6A 4AXEA 4W8DA 2OJJA 4JLCA 4DFLA 4K33A 4WG5A 5M09A 3FSFA 4M69B 3PY1A 4GT4A 5CYIA 3WF6A 3GBZA 5F94A 2PUNA 3DQXA 3TUDA 4PV0A 2C3IB 3BU5A 3VBXA 3MH1A 5CU0A 2QR7A 4JBOA 4IWOA 2HZ4A 1W2FA 4FVPA 2VV9A 4KKHA 1O6KA 4F6UA 4CV9A 5IEYA 1YXVA 2X4FA 3EHAA 3TKHA 2YAAA 5C9CA 3CY3A 4AGWA 5JQ8A 5AR7A 4FKSA 4RIOA 3SAYA 4I1ZA 1CKIA 4J71A 4DDIA 4JR7A 3EFWA 1KE9A 4ZOGA 3LXPA 4RJ7A 3QHRA 1PRYA 4C57A 3Q4ZA 3ROYA 4FYNA 4OW8A 2XNBA 3HDNA 4PMSA 4RIWB 4E8AA 2G9XA 5T6KA 3VF8A 3PP0A 2ZV2A 5ANKA 2QO7A 4AW0A 4DBNA 3NZ0A 5AFVA 5L8KA 2PE0A 5GJFA 4ERKA 3CQUA 3PY0A 5AP6A 2R3HA 1NXKA 2WMWA 1SZMA 4NJ3A 3COKA 4RFYA 3KXZA 5J9ZA 2GNHA 4K1BA 3HA8A 4P7EA 2WMRA 3RKBA 5BQ0A 2VD5A 3V51A 3GQLA 1SNXA 3R1YA 4E5WA 5KMMA 3UZPA 2E9OA 2JGZA 2P4IA 4FMQA 4YJOA 4C4EA 4PTEA 1TFFA 1JBPE 3ZFYA 5AR5A 3OCBA 1UNHA 2YLFA 3QZFA 4XG3A 3KA0A 2GHMA 3PVUA 4QYYA 5BUJA 4LL0A 5IMEA 3GC8A 4OTDA 2I0HA 3QQKA 4D2PA 1TZDA 4JDHA 5EFQA 5CX9A 5DYJA 1NY3A 3NNVA 1CKJA 5L2IA 5GZ9A 3F3TA 2X7GA 3CEKA 3NSZA 4TWNA 4F78A 2EWAA 4CFNA 4MUQA 3LKMA 4H1JA 5CASA 1YQJA 4I92A 4EORA 3OC1A 4HVGA 5J9LA 4FV5A 2UZDA 2PMLX 5EKOA 1YWNA 1W83A 4JL9A 1Q3DA 1CDKA 1KUTA 3NMUF 4B8MA 3PZHA 3Q4TA 3QYWA 4HGSA 4HZRA 1JSTA 4YJNA 2A0CX 3FMLA 2G01A 5CY3A 2F9GA 3RHKA 3W0PA 3PFYA 2C69A 3PSCA 5M56A 4PX6A 1PXOA 2ZDTA 4QP7A 5HTIA 2HENA 3IOPA 5CANA 5LVMA 4BDAA 1TQIA 3RM7A 3DY7A 4NT4A 3GU8A 4FIJA 4EK5A 4XP0A 3CXWA 4C4HA 2BHEA 2JAMA 5CNOA 3ZLXA 4PP9A 3IGGA 3OWLA 4BGHA 4XUFA 2C3KA 2P33A 2X1NA 3CTJA 4MWIA 3RCDA 4F65A 5LARA 2WXVA 4FSYA 2FB8A 5EM7A 3FZSA 3AMAA 2YDKA 3NYVA 3SOCA 4DDGA 5L8JA 4S34A 2R3NA 3RCJA 3K3IA 4YNEA 3E62A 5IG1A 5LMAA 4RC4A 2VWBA 4GUEA 1YOMA 4N6YA 4EOLA 1KV1A 4GS6A 3QC9A 3QWJA 4XG6A 3EOCA 3F9NA 5IA4A 3E88A 2JFLA 1VYWA 3DCVA 1ZYLA 3H9RA 1J1CA 4LUEA 3PUFC 3UP7A 5AM6A 2WTKC 3QLFA 2GS7A 5HG9A 4ITJA 5BVDA 4ORKA 3L9NA 3GFWA 4TL0A 4G9RA 4ZSLA 1Z57A 3F82A 4IMYA 3DKOA 2YIXA 3S2PA 2Y4IC 4FYOA 4MBJA 3AT3A 5HORA 1PMEA 1JKKA 4AGCA 4F0IA 4JRNA 4QMUA 2R4BA 4HPUE 5M51A 4O96A 2J9MA 1H1SA 2W9FB 4M7IA 3QZIA 2R3OA 4LDTA 2O2UA 3FMNA 3CKWA 2XF0A 4FTNA 4QMSA 5HEZA 3G33A 3TNWA 3BGPA 3FL4A 4Q9ZA 5B7VA 3BYVA 5E8SA 3I0OA 4JOAA 4J1RA 1URWA 2PUIA 4JG7A 1UU8A 3KXNA 3R1SA 4ZS0A 3PPZA 4EBVA 3QD4A 3PXZA 5EM8A 4FV1A 3FUPA 4BCJA 3W0SA 4OTGA 4AW5A 1G8JA 2X2MA 5A54A 5E8ZA 5CF6A 3C50A 5AM7A 4FTOA 4MBLA 4Z9LA 4BTMA 4V01A 3Q32A 5HTCA 4U40A 5AP5A 1G8AA 1GZOA 5TO8A 4FNXA 1LEZA 4YP8A 5H3QA 4DH5A 4RX7A 4FUXA 2C6KA 2JDVA 3VS4A 3WF9A 1U5QA 1Q4LA 4IB1A 4H3PA 5KCVA 4CKIA 5HU9A 3R0TA 5EM5A 4BDCA 2R3FA 3MFRA 3QQUA 5L6OA 4FEUA 2YJRA 3II5A 5I3OA 2X9FA 4ASZA 2XM8A 3KVXA 3DKGA 4BZNA 3DDQA 4O81A 4L7FA 4J96A 4RX8A 4CNHA 4L42A 5DLSA 2HIWA 3PE2A 5CEQA 1P2AA 1OBDA 3LIJA 4HNFA 4O4FA 4D4YA 4GU6A 5E8YA 5IQCA 2YLEA 4IVBA 3R7IA 3NUXA 4M3QA 4XG4A 3E7VA 1FMKA 3DZOA 3WZKA 3UQGA 3HL7A 4PL4A 2Z60A 3PTGA 4LL5A 4WNPA 4FZFB 4UV0A 3TI1A 4QTEA 3SD0A 2XEZA 3PVBA 4EHZA 3IKAA 1ZZLA 1OZ1A 1YRPA 4QTDA 4AZVA 2WIPA 1LUFA 2RFDA 4O7ZA 3MIYA 4O7VA 4R77A 2GNJA 3D5XA 2PVKA 2WB8A 4AG8A 1V0PA 2VZ6A 3SLSA 2VWZA 4ZSAA 2C30A 1ERKA 3PIZA 5DN3A 2FUMA 5AIKA 3OBGA 5JGBA 1EH4A 4DEBA 3CE3A 3ZO2A 4C37A 4FV2A 3P0MA 4BKYA 5AUXA 1IEPA 3OG7A 3EB0A 4BCOA 4FEVA 3BX5A 3UODA 4DFBA 1RW8A 3KRJA 1GZKA 2DWBA 3HKOA 2QOHA 1H25A 2GDOA 2XK7A 1GZNA 3HUCA 4G1WA 4YLLA 3VHEA 4AT5A 3W2QA 3RTPA 3BYSA 2ITWA 1UA2A 2BFYA 2ZDUA 3ANQA 4BCHA 4G5PA 3VIDA 5HO8A 3JUHA 5AUUA 2I7QA 1U46A 2C0IA 4N4SA 1PKGA 3T3VA 2JDOA 2OH4A 4NUSA 3K2LA 3OW4A 5T68A 5L2WA 2EU9A 3CTQA 4BIEA 1VZOA 1Q3WA 3KN6A 1J3HA 3VUHA 3ZRMA 4RJ5A 4WA9A 3EFJA 4AFEA 5JN2A 4XG7A 4I22A 4NW6A 2F2CB 2AQXA 1BKXA 5DA3A 2BR1A 2BTSA 3QLGA 5CI6A 4BVUA 2ITNA 4LI5A 3NW5A 4MXZA 5FTOA 4PPBA 5LMKA 1WVYA 1YDTE 3F2RA 2XK8A 3UVPA 2VTAA 5L4QA 2HYYA 1W84A 3F7WA 4PNKA 3KMWA 4EQUA 4JJRA 3KULB 3LXLA 4CMTA 3HAMA 1O9UA 2ITPA 4LOQA 4A9YA 2XNMA 3F5PA 2VTPA 3W2PA 4M67A 4LRKA 4A4LA 1DAWA 2XNNA 3CPBA 5ACKA 4NIFB 5KBQA 5KHXA 3RZBA 2H8HA 2HXLA 3GVUA 5DHJA 4ALUA 4X3FA 4AA0A 2XALA 5HO6A 4RMZA 3W2CA 2UZUE 5CVHA 3HV4A 2QOKA 4FSWA 4FV4A 3KY2A 4HYIA 4RPVA 3OT3A 5DI1A 5KHWA 5C8MA 3DB6A 3QCQA 1KE7A 4RQKA 2WELA 1SVEA 3PFQA 3QTSA 4RBLA 4O0YA 1L3RE 5I9VA 4BHNA 4RZWA 1OB3A 4ARKA 3W32A 2BKZA 4DGMA 3BPRA 1JWHA 4NM5A 2UZLA 4M69A 5HCZA 4FTKA 1BMKA 3UOLA 3QRJA 4ACHA 3SXFA 1RE8A 5I3RA 2JKOA 1ZYDA 4I6QA 4BYJA 4GYIA 3RGFA 2X6DA 4B9DA 4L45A 3ZZWA 2W4KA 4RFMA 2UW6A 3F7ZA 5A46A 2QURA 3LMGA 2PVMA 5FBNC 5LCJA 3R2BA 4ZZNA 3ZUUA 4XJ0A 3HMMA 3WZDA 2OBJA 3HVCA 3I7BA 3PA4A 4CD0A 4PDYA 2W1HA 3A8XA 4X2JA 4FEQA 5D11A 5B2LA 2GPHA 1JOWB 1S9IA 2QG7A 4O7RA 3MY0A 1GJOA 2VWWA 2XIXA 4RIWA 5HCXA 5KMIA 3OMVA 1OIUA 4O0UA 5J79A 1A48A 1YXTA 3A61A 4I5PA 3Q9XA 4IB0A 4CFFA 3ORKA 2VTSA 2WMAA 3FZRA 4PQNA 4QMXA 4LOPA 4KBKA 4JQEA 4E6QA 4F0FA 4F09A 2X6EA 1TKIA 3PG1A 4U3ZA 1BL7A 3RBWA 4CZYB 3TKIA 3P5KA 4D4VA 4XBRA 3JR1A 3OTUA 3C4FA 2RL5A 1TQPA 1OKZA 3DGKA 3RP9A 5AEPA 3NUPA 4WO5A 4HYSA 4CYIA 5AP0A 5L8LA 2E9PA 4YHTA 1V0BA 4AXAA 2W5BA 4XYFA 2UW4A 4EHEA 2J6MA 3EZRA 4KS7A 2JLDA 2ZOQA 2OO8X 3D5VA 4E4MA 3F69A 4P5ZA 3DTWA 3V01A 1FVTA 1JKSA 3RPYA 2BFXA 4CZUA 3GCUA 4F1MA 3NFFB 5IA0A 4HOKA 5M44A 3PVGA 3UDBA 3VWAA 3A7HA 1KWPA 4BB4A 4DLIA 3PJ8A 3BHHA 3BV2A 4BBFA 3K3JA 4HPTE 1WAKA 2FH9A 3FKOA 3PE1A 3DT1A 4GW8A 3SDJA 2ITOA 3SV0A 5IUGA 3UYTA 1H28A 5D7VA 4YZ9A 5EYMA 3LMIA 4ENXA 2J90A 3UVQA 3DK7A 3OW3A 5DE2A 3KVWA 4X3JA 4MD8E 1OIQA 2BAKA 2GNIA 2PVNA 4GG7A 2OGVA 3CKXA 3D2KA 3KXMA 1Q62A 4FG7A 3TTJA 2BILB 3WF8A 4EH8A 5CF4A 3G15A 2WHBA 4X2NA 4D9UA 2A27A 2W96B 4FTLA 5HE0A 2BRMA 2JDTA 2PZ5A 2BZJA 2XB7A 4KB8A 2UZWE 4GVAA 2B54A 5FXQA 5GJDA 4J53A 5CZHA 5DNRA 3ULIA 3V3VA 4Y73A 3Q60A 4IEBA 2HW6A 3MV5A 3NIEA 3QUDA 3NGAA 2P0CA 3QKLA 3VS5A 3ORPA 2WOUA 2XH5A 4D1ZA 5EQYA 2XNOA 4GFMA 5B2KA 5JFXA 4BWPA 3DJ7A 4BCNA 2VAGA 4B8LA 3BHUA 4CLJA 4GEOA 2KTYA 4WNKA 4FZ6A 4J8MA 4M84A 5K4JA 1REJA 5D9HA 3UOKA 3QZHA 3FY2A 1QL6A 4ZY6A 2QD9A 3C9WA 3H3CA 5HNBA 3PJ3A 3FMMA 4L43A 3Q5IA 5H8EA 3SG8A 4ZSEA 3ORIA 3D14A 4U0IA 4RC3A 2W1CA 3H10A 3LFFA 4IBMA 3FLQA 5E91A 2X2KA 2X81A 1OITA 1PXLA 3SRVB 3N9XA 3AGMA 2EUFB 4CCUA 1FGIA 3LMHA 4GKHA 5CZIA 4CZTA 3PPKA 1YOLA 4J95A 2B0QA 4LRJA 2BALA 3W0OA 4TPTA 4OT5A 2IPXA 3QGYA 3ZO4A 2WU6A 2X39A 5E92A 3RAHA 3FI3A 3OWJA 4MVFA 4NL0A 3BHVA 4LGGA 4CFVA 5ETIA 3LM0A 1GIHA 4DLJA 2O64A 5CSWA 4DFZE 3QQGA 4EZ3A 4XRJA 3FPMA 2C3JA 1VR2A 3S1HA 3C4WA 4AACA 4GJ3A 2QKRA 2ZMDA 5DT4A 3F5GA 2IW9A 1W82A 4C62A 4O7LA 2UZTA 1OL7A 3AT2A 3T9IA 3KCFA 1J7IA 3VS2A 3BQRA 4QP8A 3H9OA 5D41A 5AX3A 3KREA 3E3BX 2QR8A 4AZWA 4FJVA 2BTRA 3LFQA 4BZDA 4FRFA 5CEMA 3HECA 5IQIA 5C4KA 3KRLA 3TCPA 4H36A 3ZXTA 3JY9A 1YDSE 4UXQA 3TIZA 2OJGA 4UYNA 5FXRA 3ZC5A 2XP2A 3WYYA 1BI8A 1WBOA 2PVFA 4CFXA 3TWJA 2X0PA 4OTRA 3ZLSA 4FICA 3IW6A 4JG8A 4ZMFA 3O2MA 3V6SA 2OK1A 3QC4A 4EZ5A 2C5VA 5J9YA 3SXRA 3KRXA 5JT2A 4KKEA 2H6DA 4A07A 2QU5A 3FBVA 3CS9A 4MD7E 2YCRA 3PLSA 4GIHA 4WKQA 2RIOA 1XMLA 4UWBA 5KMLA 1W2DA 3SKCA 3LPBA 1UKHA 2QLUA 1K2PA 5BYYA 5AV4A 4AGUA 3ZEPA 4ZTMA 4ZTRA 3C4CA 4QOXA 3UIUA 4EH4A 4IWDA 2UW3A 4FSQA 4AZTA 1UNLA 5CAVA 5HO7A 1YHVA 4PL3A 3NYOA 5FP5A 4FG8A 1JLUE 2BRHA 3WE4A 2PSQA 2QOLA 3ELJA 3NR9A 4DCEA 3AQVA 4IX5A 3NNUA 2BZIB 3DNDA 4JVGA 1QPDA 4Y5QA 2X8DA 4Y83A 3TDVA 3UMWA 3JVSA 4ASXA 4EOIA 4MHAA 3RWQA 1OL6A 4DFYA 4IM0A 4XHKB 4G3DA 5FUTA 1ZMWA 3OF0A 5E1EA 3RWPA 3PPJA 3C4EA 4XG2A 3R8UA 4PTGA 4FKJA 4FIIA 4QMNA 4QP9A 5JZNA 4EL9A 4YC8A 5KBRA 3CQEA 4IZ5A 4R5SA 3VNTA 2UZBA 2X8EA 1KE6A 3DBCA 4I6BA 4O83A 2QU6A 4JIKA 4YLKA 2XK6A 4QMMA 5JEBA 5EOLA 1GIJA 2HZ0A 2QQ7A 4QMTA 4EOOA 5IDNA 2AUHA 3UP2A 3BZ3A 4DGNA 2F2UA 5C26A 4RG0A 3KB7A 4ENYA 5CSXA 1GY3A 4YC3A 4M66A 4PUZA 4ZXTA 1CSNA 5JRSA 3ZSHA 4DITA 4E26A 3HP5A 5HBJA 4EYMA 3Q2JA 2VX3A 1IASA 4BDJA 1E1XA 5JK3A 3COHA 5CALA 3KULA 5DGZA 4BKJA 2VO0A 4CVAA 4G3CA 3KKVA 4QP3A 2H96A 3RZFA 2W0JA 4EOMA 5IA1A 1W98A 1MQBA 4MKCA 3TV7A 3HV6A 4PPAA 3Q53A 3EYGA 4ZAUA 2Z02A 3KMUA 1BX6A 2GU8A 2CCHA 3HV5A 4HW7A 5A4LA 3UVRA 4NIFA 5L2QA 4E6DA 3BELA 5HLWA 2BDWA 5AUYA 3HMIA 5BX0A 5HVKA 5J7BA 3LAUA 4XOYA 1HOWA 2J0IA 2Y7JA 2ZB0A 4V0GB 5HG8A 3LOKA 3VS1A 4EH2A 4O7SA 2UVZA 5ITAA 3EQDA 5DR6A 2J5EA 3TDWA 4P90A 4R1VA 1WBSA 2ZV9A 2WAJA 4RJ3A 2RG5A 3OVVA 3NAXA 3KC3A 2QO9A 4LM5A 3Q04A 4O38A 2YCFA 4H3BA 1P14A 2G1TA 4FTIA 1U5RA 4YJSA 4Y95A 3IDCA 3QCSA 5GINE 2QI8A 3IDPA 1MRYA 4FNWA 4XV3A 4CQEA 3FQSA 3P1AA 3IW7A 1U59A 3V5PA 5CF5A 2YM8A 4QMWA 2C5XA 5M06A 4L7SA 2BIYA 3ZXZA 4E6CA 3MFSA 4JI9A 2R3KA 4YHJA 5AV0A 5TT7A 5IF1A 3MVLA 3Q96A 1PF8A 3OWKA 4CFUA 3GXLA 5HX6A 3QUEA 4FZAB 3I5NA 4FTJA 4G31A 3FEGA 4WRSA 5JFWA 2R64A 4TYHB 5AV2A 4IHPA 3NUSA 2VTJA 1G5SA 4F6SA 3Q52A 4I24A 1ND4A 2PVLA 3Q9WA 4NFNA 2ONLA 2HK5A 4QP2A 4O0VA 3R7EA 3P08A 4J7BA 4MYGA 1WFCA 2IW8A 4D58A 4V05A 2DUVA 2CNQA 4KA3A 4J98A 4JDJA 1OVEA 5G6VA 4UX9A 4F9YA 4CTCA 4AAYA 3UPXA 3HRCA 4O22A 4UZDA 4AOJA 3Q5ZA 2FVDA 2R0UA 4BDGA 3E5AA 4ITIA 3RALA 2GFCA 4YUQA 2WEIA 4FTAA 3OUNB 4UXLA 5EHOA 4E20A 2DYLA 4BTJA 5EOBA 2REIA 3BLRA 2OKRA 2XNPA 2WKMA 3PUPA 3W18A 4PWNA 1Q99A 1KSWA 1BYGA 2ZB1A 3E64A 4QMZA 2GQRA 3C0IA 2I0YA 2R0IA 3P7CA 4IDTA 4UWCA 4UYAA 5L2TA 2IJMA 3DLSA 4JBVA 4NCTC 3ZSGA 3QCXA 4DC2A 3ZDIA 1FPUA 2GTNA 2JBPA 3G0EA 4I41A 4NEUA 3ZH8A 5IPJA 3O8PA 5CAUA 3VBQA 3HMOA 3F88A 4FTMA 4EC8A 5CU3A 4FNZA 1J91A 4Z3VA 2WMUA 1W2CA 1MRVA 3GU4A 2Z7QA 4ZMEA 4TYEA 4FV6A 5IISA 3AT4A 3IO7A 1L8TA 3RM6A 3ZUTA 4FK6A 2XJ1A 1Q8WA 3IECA 3BU3A 3CD8A 3AC2A 4BI0A 4C4GA 4P4CA 4I4FA 3SOAA 3KIOC 2WZJA 3WOWA 5LXMA 4AFJA 3DBEA 5J5SA 5FBOA 2GHGA 3F6XA 5HE1A 5KMOA 4BDKA 5JH6A 4JQ8A 4BCQA 2C1BA 2F57A 3Q3BA 4ALVA 1XH9A 2ZAZA 3KEXA 5J87A 4C4JA 2FSLX 3BCEA 3PWYA 3HA6A 5KKRC 4EWQA 5A14A 2UZNA 3FY0A 5AA9A 5ANOA 2PY3A 3R8PA 3VW6A 4YPDA 3POZA 4TYIA 4FSTA 5AUVA 3AD5A 3OD6X 4X7QA 2QHNA 1M17A 4GCJA 4XP3A 2G2HA 4Z7HA 4PRJA 5KZIA 3R8MA 4C3PA 4PP7A 2CN8A 4MEDA 4UEUA 4O0SA 2GSFA 4QRCA 5KMNA 5AP2A 2YCQA 1Q8UA 2XNEA 3RPVA 5IA2A 3SVVA 4FT0A 1H1QA 3KRRA 3Q9ZA 1GAGA 3LW0A 3PRIA 2XIZA 3Q4CA 5HD7A 4RWJA 5IQGA 2ERZE 2BAQA 4G3FA 4FL2A 3KRWA 4XG8A 3ZDUA 3V8WA 5HZNA 2W1GA 4YZCA 4E5AX 4U42A 2WTVA 5A9UA 5BV3A 2B9HA 3F2AA 1DM2A 4UB7A 3GI3A 4FIEA 4W4XA 2XEYA 4WBOA 3UZRA 4KABA 4X6RA 5BMSA 5LVLA 3VBWA 4HCTA 4YTHA 4ANBA 5HESA 4KKGA 1GZ8A 5AR8A 2Q0NA 4NSTA 2JKMA 4QQTA 5JMSA 4YC6A 2O0UA 4E4NA 1R0EA 4A7CA 4ZLOA 4L3JA 5K0KA 2HELA 4K77A 5AIRA 2BKKA 3EN6A 2HOGA 3IONA 2I0VA 1IRKA 5KMKA 5HVJA 3EN7A 3VRYA 5M08A 2PVRA 5HIEA 4O4EA 3QKMA 5AV3A 2C5YA 3QRUA 4UBAA 5DIAA 3JYAA 4NH1A 2GS2A 3SRVA 4G6LA 4O0TA 4C3FA 5I4NA 2X0OA 2NRUA 3PLAE 3MH2A 2R9SA 2YIRA 4OLIA 4TT7A 3QQFA 4EH7A 1R1WA 2XAOA 4G6OA 4FSNA 2QC6A 4BL1A 3FLZA 4EK4A 3VO3A 5HG7A 3D5WA 3QFVA 4WG3A 5D7AA 5AUZA 4FGBA 4U7ZA 1PMUA 4Y8DA 4JAJA 3MTLA 4FKQA 1LPUA 3R9DA 2IO6A 2P2HA 5AAEA 4BDBA 2VTNA 3Q2MA 4FTQA 5BUIA 3MN3A 5AAFA 4WBBB 1SVGA 4UY9A 3H9FA 4BWXA 4YJPA 2ZYBA 4I5HA 5BVOA 3LQ3A 4QYFA 5AWMA 1YDRE 3EMGA 2Z7LA 3QCYA 2C0TA 3CY2A 4QPSA 3JS2A 2CGWA 4FEXA 5IUIA 4Y46A 3C0HA 2YDIA 2A4LA 3FPQA 1P4FA 4BYIA 3S3IA 3K54A 5CQWA 4MXOA 3UO5A 1MQ4A 3FXZA 3KCKA 4IAAA 3BE2A 4ASDA 3P4KA 2EVAA 4S32A 3NWWA 3F3ZA 3F5UA 2QLQA 3NPCA 2FA2A 5FQDC 5M07A 3EN5A 4IC8A 2BRNA 3CQWA 5DRBA 3SXSA 4M15A 2WQEA 1H07A 3RK9A 3SA0A 4PY1A 4X21A 4YMJA 3DJ5A 3UJGA 2YM4A 1G8SA 4K8AA 2XJ0A 4QTBA 4W9XA 1U4DA 1ZMVA 2XKFA 4BIBA 3GFEA 4PF4A 5GIOE 4O4BB 1IA9A 1YWVA 4FOBA 3NDMA 3QZGA 3N4VA 1DAYA 3S00A 3P5JC 3AC4A 3KXGA 5HGIA 2PZRA 3N4TA 4BR3A 1H4LA 4RLLA 2ZMCA 3D9VA 3GB2A 5F95A 4TW9A 4EZ7A 4KBAA 2WOTA 1REKA 3BYOA 3T3UA 4D2SA 2AEGA 4ANNA 3AD4A 3DFCB 4MXYA 5HI2A 5IMXA 4RVLA 1PMVA 4BY9E 3OY1A 1I44A 4R7IA 1ZY4A 4IM2A 1H01A 4IAKA 4U44A 3U54A 4OTFA 2GCDA 4YZMA 2VNWA 1GIIA 3LJ0A 3P9JA 3SQQA 3R02A 3L8SA 4IACA 2JFMA 2F4JA 2CKQA 4D2WA 3ZUVA 2JDSA 2VUWA 2BZHB 4HJOA 4RWKA 4RFZA 4CSVA 4EKKA 4C8BA 1FBNA 5J1VA 4AW1A 4F9BA 4MXXA 2C6LA 4RVKA 2GQSA 3D7TB 5AMNA 3MVMA 5F4NA 4GFOA 5DEYA 3F61A 5CAOA 5HU3A 4DG2E 5DT3A 4XV2A 2A2AA 3EWHA 3L9PA 3VUMA 3FI8A 3H30A 3MB7A 5E8UA 3DS6A 5KE0A 3HP2A 5M4FA 2UV2A 2F7XE 2C6IA 4MXCA 3EQGA 3U4UA 4H39A 3LCOA 3FXWA 2JDRA 4NKSA 4RWLA 4TWOA 1WBWA 4BI2A 1PXKA 3R8ZA 4IAZA 1YHSA 1ZWSA 2UUEA 3OOMA 4BDHA 3LFBA 2CHLA 2PZPA 3QQLA 5IQHA 4EJNA 2XK9A 2C6MA 4M13A 2WTKB 3KK9A 4D2TA 4V0GA 4D5KA 3DAKA 5CU2A 3DBFA 4FVQA 4TZRA 3DZQA 5C1QB 3MGYA 4L01A 3HGKA 2YHVA 5CENA 3ZHPC 3QD3A 4IM3A 2R3PA 5CT0A 2ZVAA 1OL2A 2R5TA 2OZAB 4YZNA 1J1BA 1UKIA 2YM3A 3COIA 5E7RA 5CEIA 3W2OA 5HOAA 4QDEA 1Z9XA 4DTAA 2BRGA 2OZOA 2DQ7X 3HNGA 1YHWA 1XHAA 1KE5A 4ACMA 3O50A 3E92A 4RIXB 4IZAA 4AF3A 3OCTA 3FXXA 3H4JA 3FC1X 4B4LA 1G8KA 2PMIA 4OBOA 5HTBA 4FSMA 4S30A 3FLYA 3G9NA 3KK8A 5I0BA 4CCBA 4O21A 4JMQA 3ZO1A 3VVHA 3QQHA 3LFEA 4DGOA 3G51A 4BWKA 4N70A 3O8TA 4ZLZA 3DV3A 5CSVA 3V6RA 2I6LA 2X7FA 2OW3A 1M7NA 4IW0A 4TYHA 5C27A 3TL8A 3WE8A 4OTHA 5CTPA 4F1OA 2VTTA 3ZYAA 5KMJA 5K4IA 3GC0A 1PXMA 3R01A 5M55A 4RVMA 4Y85A 2E9VA 4GVJA 3W2SA 3MH0A 3W55A 2EXEA 2GQGA 2UW7A 2PPQA 3NX8A 5HVYA 3OWPA 5HKMA 1OIRA 3VRZA 3GU7A 2XRWA 4I5MA 2ITQA 4HVHA 4HGEA 5DMZA 5CXHA 3ZRLA 5HD4A 3UPZA 3O96A 4K18A 2I1MA 5LWMA 4QTCA 4FK3A 4BDFA 3EQBA 5DR9A 4C61A 2B4SB 3IPHA 4BTKA 4EH3A 3WZEA 4QDVA 3W0MA 2W1FA 4R8QA 4EHVA 2NPQA 3KQ7A 3GOPA 3K5UA 4QYEA 4X2FA 4PMPA 3NW7A 4PTCA 4ANLA 3BKBA 5IH6A 2WIHA 1ST0A 4A9UA 3DNEA 2C47A 3DFAA 4USDA 3TZ7A 4DHJA 2GNGA 1JSVA 2ITVA 4L53A 2VWIA 4EOJA 2HXQA 4F6WA 5I9WA 3G90X 2YN8A 4FOCA 2OLCA 2W4OA 4ZLYA 4BZOA 4JNWA 5HNGA 3BE9A 3AKLA 1P5EA 3FDNA 3C7QA 4KIOA 1F3MC 3DBDA 4ZJJA 1Q8ZA 4A4OA 2H34A 4WNMA 3CP9A 4ANOA 2WNTA 2Z2WA 3HMPA 1ZZ2A 3VC4A 1WBPA 3NVKI 4XNEA 4DF3A 5L6WL 4YBJA 3ORMA 3VAPA 2VRXA 4FT5A 4JQ7A 4EOKA 2WMBA 1IAJA 4TTHB 5EDRA 3U6HA 1WBNA 3ZOSA 4AXFA 2W05A 2ITYA 3GC9A 4W4VA 2EXCX 4M0YA 3OEZA 4MX9A 3DXQA 1H08A 2VGOA 1DI8A 3R9RA 5BNJA 3MA6A 4RJ4A 2Y4PA 4FL3A 2WQBA 4GSBA