4L8MA

Human p38 map kinase in complex with a dibenzoxepinone
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
348
structure length
339
Chain Sequence
b'RPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHTVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mitogen-activated protein kinase 14
publication title Metabolically Stable Dibenzo[b,e]oxepin-11(6H)-ones as Highly Selective p38 MAP Kinase Inhibitors: Optimizing Anti-Cytokine Activity in Human Whole Blood.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 111
structure length 339
sequence length 348
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2013-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4l8mA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4l8mA01
3JVSA 2YM7A 4EK3A 3QCYA 2YEXA 1W7HA 5JGDA 3V8SA 4I5HA 1FQ1B 3IPHA 4HVSA 4IJ9A 4LV5A 5JQ8A 5AAEA 4IB0A 3ZO2A 4CCBA 3QRJA 4Z7HA 1CMKE 1KE6A 1GIJA 1Q8TA 2F2CB 2XRWA 3R8UA 4ARKA 4FEQA 1L3RE 3V5LA 3FC1X 3FYKX 3EQGA 2YCRA 3G0EA 2R3PA 3UE4A 3KEXA 4B4LA 3OCSA 3NVMB 3B2TA 4E3CA 4FV0A 3QZGA 2JD5A 4N0SA 5I4NA 4HVHA 4TPTA 4W9XA 4BN1A 2X81A 5TE0A 4XHKB 3EZRA 4NIFB 5FP5A 2OFVA 4C62A 4MD7E 3P79A 5EDPA 2VWZA 1FMKA 2YDIA 3PJ2A 4EK8A 4ZZOA 2OGVA 5ACKA 4JL9A 4KS7A 2XH5A 4FSTA 2BZJA 5CENA 5LVNA 3S2PA 3LCTA 3OHTA 3NR9A 2BUJA 4YZCA 3KFAA 1Q8UA 1ZOGA 4CQGA 4TYHA 4IZ5A 3ZO3A 5EOBA 3HMNA 4OR5A 3EFKA 3VBWA 4KKHA 4FTRA 2WXVA 4GFGA 4CYIA 4NM3A 2XK7A 4MEDA 3R7GA 5LOHA 1QCFA 2C5VA 4D28A 2WQBA 5HX8A 3TL8A 2VTTA 3OMVA 3GU8A 1G5SA 4L6QA 3KULA 2FB8A 2X4ZA 4O86A 2FO0A 2F57A 3P1AA 1Z9XA 3TV6A 3OT3A 3WF5A 3FI4A 3ZLXA 3E92A 4QMYA 4W4WA 4FKUA 1H25A 3RKBA 2W0JA 3SOCA 3P78A 1H24A 1PYEA 1BKXA 3D5WA 3R1NA 1YOMA 3W55A 5HIBA 4O7SA 4O1OA 1KV1A 4G9RA 4D1SA 3LM0A 4EYMA 2ZV8A 2JIVA 2J5FA 3WYXA 4MKCA 3ZSGA 4CG8A 2IZUA 4RLKA 5C8NA 1GZKA 4BZNA 2UZOA 3LMGA 3EFWA 3BGZA 3LXKA 5JRSA 3WF7A 4OTHA 3COKA 4DH8A 2FSTX 2X9FA 1ZYSA 4IACA 2XNPA 4O7ZA 3FMNA 3ZBXA 4O6LA 3OTVA 1HCLA 3FSFA 2YFXA 5D7AA 3KKVA 3NUXA 3PE1A 4E6QA 5EM5A 3ZO4A 3OCGA 3DK7A 2IW9A 5LMKC 1O6LA 3G15A 4NH1A 4DEBA 4QRCA 1M7NA 3ORTA 4YSJA 2R3FA 4IX5A 2OJJA 4RA4A 4DINA 4CQEA 1OM1A 2BROA 4KAOA 5HX6A 3LMHA 4BZOA 2QHNA 3LFFA 4H3QA 2BFYA 4S34A 4TWNA 4EHZA 5CANA 2VZ6A 4GL9A 4IAFA 5EW9A 3UYSA 4CTBA 3LJ1A 5KKRC 4FZFB 2QONA 4G9CA 5DR2A 3V04A 3SGCA 5KMNA 3Q4CA 5B2MA 3M2WA 5CZHA 3TG1A 4YO4A 3MTLA 4I93A 4JRNA 4WG4A 3QHWA 1SYKA 2XIYA 3R2BA 4L44A 4L7FA 2VO0A 4IX3A 3W1FA 5FUTA 4BCIA 5CZIA 5AUUA 4ZEGA 3TM0A 2VNYA 3ZEWA 5ITAA 3UZTA 5IG1A 3RI1A 4BCFA 5M4UA 4CRLA 2C0TA 2J50A 4QMOA 5IEVA 2JAMA 2UZNA 3S4QA 1WVYA 1REJA 1W83A 2PZRA 4BY9E 3QQFA 4TW9A 2IZSA 2YDKA 5HE1A 5HE2A 1V1KA 3DDQA 3ZLSA 3BLRA 3D83A 3PYYA 3W8QA 5M08A 4AP7A 3B8QA 3EQIA 3EYHA 4NWMA 2UW4A 4AAAA 4GUBA 2R7IA 1DI8A 3BE9A 5EW8A 3WI6A 1Q24A 4ACCA 1QPEA 3QAME 3EJ1A 4KA3A 1R3CA 4PDPA 4YZDA 2IZTA 5ETFA 2R3GA 5CAQA 3QF9A 3ZMMA 4M66A 3N4TA 1H07A 4G3FA 3DNDA 4GG5A 4ASZA 4K33A 5J1VA 5IA2A 4QPAA 1NW1A 3ACJA 1GZNA 4RQKA 5AEPA 3Q04A 4ZSGA 2QOHA 3DJ6A 2V22A 5TF9A 3PJ8A 3NYVA 2RFDA 3PJ1A 5E9EA 4TYJA 4XRLA 3HL7A 3D2IA 4FT9A 4QTAA 2HXLA 3OC1A 5K5XA 5FLFA 4IAIA 4K6ZA 4C59A 5M44A 2ZM1A 3H3CA 3AD4A 5DI1A 1AQ1A 4FT0A 4FTKA 4XG9A 3F7WA 4O7LA 2HY0A 2YM6A 4KKEA 1GOLA 4DEHA 5L2TA 2CSNA 2V7OA 2QLQA 3CIKA 4Q9SA 3ZZEA 4DTKA 3S95A 3KY2A 4AGDA 3PPZA 4JDIA 5AUXA 4EJ7A 3QTIA 3ZHPC 5ACBC 4ENXA 3I0QA 5CY3A 2P3GX 4CKRA 4Z16A 2W1ZA 4ZTHA 3HP5A 4BTFA 2PVNA 3AD5A 3S00A 1RW8A 1H01A 2W4KA 2DQ7X 1CKPA 3MVMA 4ZTRA 2QOOA 4YLKA 5IQHA 2OZOA 3QYWA 5ETCA 5CXZA 5M4FA 4KD1A 3MH3A 3RAKA 2J5EA 4L8MA 2OXYA 3MW1A 3OXTA 5HESA 4AT4A 2C6OA 4QYEA 3NUUA 4BYIA 4L45A 4DBNA 3GXLA 5IISA 3RNIA 1YI3A 5IA4A 1YHVA 4UMQA 5CVGA 3CY3A 4NL0A 3AT4A 3E87A 1H1PA 2P2IA 3AD6A 2J0KA 3NLBA 4I6BA 3UOHA 3T3VA 3SQQA 1I44A 3F82A 3JXWA 4FV6A 2R3IA 4JAJA 4ZLYA 4TNBA 2R9SA 2QC6A 3RJCA 4F08A 5J7HA 4FEXA 3PSDA 3RBWA 4RX7A 2J7TA 5C1QB 5DNRA 4EZ3A 3L9MA 2ITNA 4G3CA 4LUDA 1ZYLA 4H1JA 5H3QA 4E4XA 3E93A 4CCUA 2C1BA 5JGBA 3F61A 3HGKA 3LFDA 1UNHA 4AZTA 4RBLA 3R1SA 2C30A 2XYNA 2J2IB 4I23A 1Q8WA 4EZ5A 4QP1A 4UALA 2EWAA 2W5BA 3BV2A 3G90X 3GT8A 4J52A 2PVMA 3ZFXA 5IA0A 3FMMA 5JSMA 4C3PA 2W4JA 5HTIA 3ORIA 2ZVAA 3VBTA 4A4LA 2XNBA 4FGRA 3MH1A 3R73A 4DCAA 4G5PA 2C3JA 4G16A 3LFNA 4USFA 2UZLA 3BQCA 4LOPA 2JDSA 3KMMA 3KVWA 3GCPA 3O96A 4RSSA 4A9TA 4F9YA 1JQHA 2WMWA 3E8CA 3GOPA 4BI1A 2WKMA 5CQWA 3PTGA 4QQCA 2ZOQA 1Q99A 1FVTA 2XIRA 3OTUA 1YQJA 1OL2A 4OUCA 2WQNA 3R7IA 2OSCA 2HAKA 1YDTE 5LMBA 3BQRA 4FV8A 4DAWA 2F2UA 4JBOA 2J51A 2OF4A 3CE3A 2PZIA 4FTIA 4BDHA 3KU2A 5EM8A 3R8PA 3RM7A 4I0RA 3UP7A 4CG9A 5E90A 4L43A 5AR8A 3H9OA 4WNOA 1XH9A 4CTCA 3ZONA 4HGSA 3R0TA 2EVAA 1UU9A 3MESA 3BV3A 4XP2A 4QP6A 4AACA 2WMSA 3R22A 2Z8CA 4DITA 3O8PA 4UV0A 3GENA 2QU6A 4PMSA 4RC2A 5A4LA 4C2WA 4BDGA 4ALWA 2ITWA 1SNUA 4MNFA 5AAGA 1MUOA 3I7BA 1H28A 3IW6A 3DU8A 4APPA 2I0YA 4M0ZA 4KIPA 4ZTLA 3ZBFA 1FMOE 2C3LA 2W5AA 4BGGA 1Z57A 2VO6A 4JS8A 1QPCA 2BZIB 4KIKA 1OVEA 3ORPA 3II5A 4Q2AA 4DG3E 1JNKA 4F9WA 3ZC6A 3HNGA 4Z9LA 1JKKA 4HJOA 5A4QA 2UW7A 1BI8A 3Q5IA 2XJ2A 4CFVA 2ZJWA 5GZAA 3MJ2A 4K0YA 1WBOA 4QYYA 2VTQA 4GVJA 5HHWA 3GU4A 4DF3A 4D4SA 4DG2E 4GCJA 5CAPA 4YTHA 2RIOA 3ULZA 2CCIA 4EOMA 2QCSA 2RGPA 4IVDA 3DQXA 4HGLA 3L8XA 4FK3A 4GIIA 2HW7A 4D2TA 3C7QA 4EH6A 4ORKA 1JLUE 2QG7A 3G51A 4IAZA 4CMTA 2I0HA 3NIEA 3V5TA 5C27A 4ANNA 4A9SA 4J8NA 4LGDA 1H00A 5HU9A 2GQRA 4EQMA 4U45A 3AMBA 2P2HA 3R00A 2VD5A 3Q53A 2W1GA 3V5WA 3WARA 4C37A 2VWXA 3IOKA 5K0XA 5CEMA 3C5IA 5AP3A 2BVAA 2ZV7A 3K54A 2JKKA 4FR4A 5E8VA 4QYGA 4JJRA 4TWPA 2WD1A 4O21A 3TNHA 5AR2A 5F9EA 5L4QA 4G6LA 3D7ZA 4LOOA 5T6KA 3A62A 3DFCB 1BL6A 2EU9A 4JRVA 3UG1A 5GZ8A 2BTSA 3C9WA 3GBZA 1NVRA 4FNXA 3MVHA 2ZDTA 4QT1A 5CSXA 1X8BA 4FG8A 4BKJA 2VWWA 3FLSA 3FMKA 4QPSA 4U9AA 5KMIA 3DBEA 3PSBA 3R9RA 3QALE 4ZJIA 1UWJA 3TXOA 3R9OA 3CGOA 3KN5A 3VULA 2HWOA 3UGCA 3IKAA 4G6NA 4C8BA 5BVKA 4ZTMA 3R7VA 3K3IA 3FWQA 4G2FA 4C58A 4JOAA 4QNYA 3RALA 3EQHA 1PJKA 3F6XA 4H36A 1ZMWA 4TYGA 2WPAA 5ANOA 2F7EE 1OPKA 2ZB1A 3RGFA 4DEGA 2XIKA 4C7TA 3IO7A 2EXMA 1ZRZA 1KE8A 1J7UA 3IGOA 2VWUA 3QD2B 3DNEA 3CQUA 3MS9A 4RWKA 4YC3A 4EH2A 4MBJA 4QMZA 2QR7A 1Q97A 4FV7A 4AXAA 4UMUA 3RHKA 3UO5A 1WCCA 4RIYB 5CF8A 3NGAA 2B0QA 4CZTA 3IQ7A 3OCBA 2RF9A 2ZV2A 4AQCA 4FV9A 3PXFA 4RQVA 5CASA 1YXVA 1Y8GA 2AC3A 5E7RA 4CKIA 4FV3A 1YHSA 3COIA 4FIJA 4RIXB 4QMNA 2UW9A 2BTRA 3FMLA 2UZTA 1GAGA 4TZRA 1BL7A 3OFMA 4OTWA 5CSWA 4D0XA 3LLAA 3OT8A 4D58A 2HZNA 1XBBA 2OH4A 3P4KA 4X7QA 1OUYA 3ORLA 4LRJA 2WMAA 4OBPA 3OD6X 4L3JA 4R3CA 4TWCA 4QO9A 5IUGA 5FTQA 2Z60A 5AUWA 1XHAA 4QNAA 4C4IA 1IR3A 1H0WA 3TV4A 5IMEA 2J0IA 3JYAA 2ITQA 4RFYA 3MA6A 1J91A 3CBLA 3GGFA 3CC6A 5HOAA 1H08A 4R7HA 4ZY5A 3LIJA 3C4EA 2H9VA 3BCEA 1UKHA 2FSMX 3KA0A 3TUDA 4OTRA 5M56A 1JKLA 2UVZA 3TEIA 3I4BA 1NXKA 4DEDA 4O1PA 5J9LA 4J8MA 4HCUA 5FM2A 4E5WA 1BX6A 2O64A 4L3LA 4O0VA 3D5VA 4BCHA 1YDSE 5EDQA 1OBDA 3K2LA 4I0SA 4NU1A 5ANEA 4BFMA 3ZDUA 2C6KA 3WOWA 2PE2A 3CEKA 3WILA 3FC2A 3PWYA 4MBIA 1OKYA 4U40A 4IC8A 2C0OA 4CMOA 4AUAA 4MK0A 4B99A 3AGLA 4CXAA 4XV9A 5LVLA 3QLGA 4NM5A 5AUYA 4IWPA 1KE9A 3A99A 5DOSA 4L52A 4CFUA 3EQFA 1ND4A 4C3FA 3U8WA 3HKOA 3BYOA 4RJ6A 5DBXA 5H8GA 3B2WA 2Y9QA 2RG6A 4FKIA 5FEQA 3ZFYA 5BVEA 2QOKA 4A9RA 3UNZA 3GC9A 3ORMA 4BWKA 4YR8A 4IVAA 5FBNC 1E1VA 3UPXA 3LOKA 3SKCA 2W1DA 1XO2B 2ITUA 3DDPA 3FKOA 3LFCA 4RIWB 4RJ7A 1F5QA 2YIRA 3N9XA 4RWIA 5G6VA 4QMTA 3RCDA 2FSLX 4BCGA 4EH5A 2JBPA 2R3HA 3U4UA 4UWBA 1OKWA 3SV0A 4G3DA 4YUQA 4GYGA 2NNWB 2G2HA 2GQGA 5KZIA 4O7TA 3GU5A 2B55A 2XBJA 3HDNA 4I22A 4RC4A 3UC3A 1W8CA 4FIHA 1B38A 2CJMA 3P86A 3VW8A 3HV7A 3AC4A 4G3EA 3NMUF 2B53A 4H3BA 4LG4A 2OICA 4A06A 4FL2A 4DEIA 4C3RA 4EK4A 2PVKA 4LL5A 3ITZA 4LGGA 5DR9A 4X2GA 1SVHA 2JDTA 1PW2A 4OTPA 3R8LA 2PULA 3LXLA 3PVUA 3EKNA 3GI3A 3R1YA 4RMZA 4XOZA 2VU3A 3FKNA 5HCZA 4ERWA 4Z7GA 1PMVA 3ZTXA 4BF2A 4CNHA 4IWOA 3V6SA 5IA5A 4EKLA 5BX0A 1ZAOA 3RK5A 3TZ9A 2VTPA 4AZVA 2OWBA 4E4LA 3ZM9A 4Q5HA 4ZS0A 5IA1A 4XH6A 3BE2A 3LVPA 4X2JA 2BDWA 3FLNC 3PXZA 5K0KA 2Y4PA 4EK5A 3Q9WA 5TR6A 4NJ3A 4PDOA 2BRBA 4OLIA 5DEWA 5AP6A 1PRYA 3FI2A 3BGPA 4IB5A 5EYDA 4AGCA 4BCQA 5IEYA 3NNUA 4Z55A 3C0IA 2WFYA 4MAOA 4O38A 3TDWA 4R1VA 2B9HA 5AP0A 2C0IA 4RJ3A 4YU2A 3E8DA 3BHUA 4XMOA 4CSVA 4F6UA 3QRTA 2GNLA 1OUKA 5EI8A 4AE9A 2BKKA 5M06A 1UNLA 5FBOA 4Y83A 3E7VA 3K3JA 4RVLA 3R8VA 5LJJA 2PUNA 3F3UA 3DK6A 4BCNA 1MRVA 3NYOA 3QTZA 3KRXA 5DE2A 5A3XA 3ZH8A 1JSVA 1J7IA 2FUMA 3N51A 3UODA 2VTRA 2J9MA 3ZDIA 4F0IA 5I3RA 1KE5A 4WG3A 3H9RA 2CNQA 4I6QA 3E62A 4U97A 3V3VA 2PVRA 3KC3A 4FG7A 4E6DA 5KCVA 4EH8A 3KXHA 1H1WA 2IN6A 5IUIA 5KE0A 2CN5A 4OTGA 3ZRMA 4DFXE 4RWLA 3VBYA 4L01A 2PWLA 3VHKA 4AW1A 2QNJA 5L2IA 5BQ0A 4DLIA 5M57A 3CQEA 5AIRA 4JXFA 2VN9A 4FMQA 4PNIA 5HU3A 3IDCA 2QD9A 4I6HA 4FODA 2X2KA 3FXWA 4GFMA 4O0YA 4F6WA 4OAUC 3UMXA 2CN8A 3DV3A 3FKLA 3QQJA 3F5UA 1GY3A 4HYSA 4IAKA 4M0YA 4PV0A 4ACDA 4FTOA 4GV1A 4WNKA 3QRUA 4YLLA 3R83A 1Q5KA 3VS3A 5FRIA 3EB0A 2W1IA 3EN5A 2F4JA 2JKQA 3EQCA 3I5ZA 3IS5A 4QOXA 4FSRA 4FKVA 4FKSA 4EKKA 1TQPA 3CTQA 2NPQA 4BIBA 3O51A 3OY3A 5GJGA 4ZOGA 5AA8A 4D2WA 2ZMDA 3WIGA 2HW6A 4FEWA 3UPZA 4ITJA 5BUJA 4WNMA 4GW8A 1XH6A 2ITTA 2YITA 1REKA 2VTMA 3F5GA 3FZTA 4M13A 4RLLA 5DRDA 3EWHA 3QKMA 3QUDA 4AA4A 2PVFA 2XCKA 4BR3A 3Q2MA 4DFYA 4F9AA 4HZSA 3RK9A 2XB7A 2OIDA 1PXKA 3QUEA 4FV2A 4BIDA 1KOAA 3DY7A 5HVKA 4I5MA 3QTXA 4V01A 3I6UA 2XYUA 3OZ6A 2HYYA 5IDPA 4IZ7A 4JAIA 5CNOA 5D11A 4OTIA 2R3JA 2UV2A 1VZOA 4CLJA 1T45A 2OJGA 1NA7A 3F88A 4ONAA 1OL5A 2IWIA 2X4FA 3F3ZA 4PTGA 5EYCA 4G6OA 2J90A 4IDVA 5KHWA 3DKCA 3HRBA 2RL5A 4U5JA 5CSVA 3L9PA 2W1EA 5J87A 3F3TA 4HPUE 5BYYA 4QMQA 3DPKA 5CU4A 3HUBA 5LMAA 1LPUA 5H2UA 4Q5EA 2JITA 4EOIA 3RVGA 5HIDA 2CHLA 2NP8A 3KK9A 2XK9A 4QYFA 1PXLA 2XM8A 2WOUA 3DXQA 4LGHA 4X21A 3HMMA 4IVBA 4NW6A 4LRMA 4FZ6A 5AR4A 5J1WA 4TYHB 4GSBA 3I5NA 4E4MA 1Q41A 2G2FA 2RFNA 3CTJA 4PDYA 1U5RA 3DKGA 4H39A 5IDNA 4KBCA 2JDOA 3PUPA 3HA6A 1YVJA 2CMWA 4I20A 5E8WA 3C0GA 4F9CA 2XKEA 5E92A 3GFWA 4CLIA 1YI6A 3BHVA 3KULB 5M4CA 2ZMCA 5TOZA 2XJ0A 3NNXA 4C38A 2IVUA 4O7YA 3VUIA 2E9PA 1OIQA 2I7QA 3L8VA 1YWRA 4YJPA 2EB2A 4C4HA 3EL7A 3VS2A 3LKMA 5AR5A 3RPOA 1PXNA 3EHAA 3ZRKA 4F6SA 1J3HA 2OXDA 2Y8OA 5CAUA 5BVOA 4HZRA 4AOTA 4YPDA 3BIZA 5EQYA 5DT0A 4E93A 5H8EA 2G1TA 3UVQA 5J9YA 3LCKA 4G17A 2WO6A 2W17A 4BGHA 2IZRA 3A4PA 3OWLA 2WQEA 4IAYA 3V5JA 3W2QA 5GIPE 4PF4A 3OXZA 4R5SA 2H34A 2YAAA 1R39A 4Y5QA 1VYWA 3IW7A 3U54A 3ORXA 4E20A 3R9DA 4BDCA 4U80A 5BYLA 2P0CA 4DLJA 3WE8A 3DKFA 4M8TA 5DMZA 3QCSA 1H27A 2QODA 2YLEA 3CKXA 3OW4A 4UBAA 3ZCLA 5K9IA 5B0XA 3LXPA 3ORNA 3FV8A 5GIOE 2C6TA 5HTBA 4IHPA 2XP2A 3O17A 4LMUA 4U43A 3FLQA 3KB7A 2ZYBA 3HMPA 2IPXA 4PL5A 3NYNA 2WAJA 2UW3A 2QHMA 4PTEA 3D9VA 4KSPA 3TJDA 4LFIA 5HTCA 4ZTQA 1R0PA 4FSMA 1DM2A 3CTHA 4O0UA 3RAWA 3QYZA 1JVPP 1OKVA 5KKRB 4QQJA 5DT3A 4ANSA 4S31A 3IW4A 4G34A 1QPJA 2PVYA 3PA4A 4ZZNA 4CFWA 4BBFA 5IH6A 1YDRE 2UW5A 3DT1A 1W84A 4ASXA 5HEZA 1QL6A 3NNVA 3OS3A 1F3MC 3KCFA 2QQ7A 2Z7QA 1JKSA 3VW6A 2C47A 1ZWSA 5M09A 3R01A 1ATPE 4MXXA 4DGOA 1WZYA 4BTJA 4V05A 4FK6A 4FZ7A 5CEQA 3NWWA 4JX7A 4GK2A 2EUFB 2PU8A 3LJ0A 4DH3A 4YC6A 2P4IA 4WUNA 3RTPA 5CU0A 1OPLA 4HPTE 3VJOA 4UX9A 1ZYCA 3SW4A 3EN4A 3M42A 4PPBA 5LVMA 4ID7A 2QR8A 5CVHA 4F0GA 3R04A 4F7JA 4O82A 4MD9E 2HZ4A 4FV5A 3ROYA 4JQ7A 3M11A 3MY5A 3CCNA 4PMMA 4WRGA 2UVXA 5F4NA 2Z02A 2WZJA 2Z7LA 4IBMA 3BHHA 5EM7A 3QBNA 5AP2A 5BUIA 4ASEA 3R6XA 5L8JA 2GCDA 4ZJVA 2Q83A 3R9NA 4NYEA 4FG9A 3C5UA 4EC8A 3DLZA 2OBJA 5F1ZA 4BDDA 4F09A 5HG8A 2X7GA 3BLQA 4BYJA 2FH9A 4UZHA 2B4SB 3U4WA 2CNVA 1NVQA 3PXRA 4WKQA 2PVJA 5DN3A 1V0BA 1P14A 4DBXA 3NUPA 3VRZA 4QQ5A 4H58A 1WMKA 4RWJA 1IAJA 4TWOA 5JRQA 4J99A 3P7AA 3G33A 3FPQA 4DG0E 4O7WA 2OZAA 3NDMA 3JY0A 5ICPA 4V0GB 3TTJA 3UZPA 3R2YA 4CZYB 1PXJA 2G01A 3PRFA 4K77A 5DG5A 5F94A 1A06A 4F64A 2WEIA 1STCE 1K3AA 3OBGA 4U79A 4GJ3A 4QMMA 2UUEA 3HRFA 4WBBB 3KXGA 5KUPA 3RMFA 2C6LA 4C4EA 2B7AA 5JN2A 1URWA 3FQSA 4RJ4A 5AIKA 5M53A 2EXCX 3MJ1A 4IM0A 3DBQA 5BVWA 3G0FA 3TIZA 3MB7A 3MFSA 5AV4A 5A46A 2GHLA 4N4SA 5D10A 1M52A 2OF2A 5DWRA 4MXZA 3D4QA 3EN7A 4EH4A 5CEOA 4BCMA 4XS2A 4PTCA 2HZ0A 5E8YA 5HQ0A 1U59A 1YRPA 3C4ZA 3EFLA 3Q4TA 4U42A 3NW7A 2WTIA 2YERA 3FLZA 3FZRA 3EQBA 3DA6A 3LFAA 3LQ5A 3QC9A 3VAPA 4IQ6A 1M14A 4FOCA 4M69A 4DTBA 4KUJA 2UZBA 1H26A 4HYIA 1Q61A 4MHAA 2YJSA 4Y5HA 3MBLA 2ETRA 2X9EA 2WMXA 3BRBA 3BU5A 1YKRA 5CI6A 2JBOA 4E73A 3SAYA 2BRMA 4PUZA 3BEAA 1HOWA 2AC5A 4TYIA 4IAAA 2A1AB 2YIYA 3H30A 3I6WA 3JPVA 2WHBA 3OWPA 4PQNA 4XBRA 2GU8A 5EYKA 4BI0A 4YJNA 1MP8A 2VWIA 2XNMA 4PY1A 5AV1A 4A4OA 5K4JA 4D5KA 4FZAB 2ITYA 3G6HA 2WMVA 4KIOA 5IQIA 2ITZA 2OH0E 2WIPA 1JBPE 2GSFA 2HIWA 4GRBA 4JIAA 5GJFA 5IPJA 3AC1A 1O9UA 3AG9A 3FL5A 3PJ3A 2CCHA 4M67A 1Q62A 2JIUA 4NK9A 2JKOA 5CS6A 4FKOA 3TNPC 4AFJA 3TZ7A 2JDVA 3FYJX 4FV4A 5LCKA 3V5QA 5LVOA 4M7IA 4MXYA 3E3BX 3UOKA 1SM2A 1SMHA 1VJYA 3R71A 4FIGA 2VWVA 2XM9A 4N6YA 5H9BA 3LZBA 2XBAA 4XP3A 3OVVA 2R3RA 3MI9A 4F1TA 1CSNA 2SRCA 4UY9A 3DZQA 3QZFA 4C2VA 3D5UA 5CVFA 5AUZA 1RJBA 4HNIA 5CNNA 2I1MA 4ZSEA 1XBCA 4FVRA 5FDXA 3KRLA 2OIQA 2O0UA 2VO3A 4IW0A 3WBLA 4ZLOA 1K2PA 2P55A 5KNJA 4EWQA 4EOQA 3WE4A 3NUYA 3CXWA 4OBQA 3A7IA 3DOGA 5E1EA 3U87A 3W2SA 2XCHA 2XKDA 2OLCA 3SD0A 3CJGA 1XH5A 4A7CA 2LAVA 1DI9A 4FF8A 3W2OA 4R7BA 1BMKA 4R3RA 2FA2A 1YXSA 3OROA 2WMUA 2XEYA 4D4YA 5AP1A 3KMWA 3LFQA 4S33A 3RAHA 4DGNA 1F0QA 4FKQA 5EQEA 3FJQE 4WIHA 3FL4A 3TIYA 4BBEA 2YAKA 4RFZA 4UWCA 4NM0A 2ITOA 4FT5A 5HLPA 4BI2A 4RX9A 2BR1A 2W1FA 2VTHA 4JR3A 4DGGA 5HBHA 3OWKA 3EFJA 4IZYA 4JLCA 4BCOA 5I5ZA 4YZ9A 2IO6A 3HV3A 3LQ8A 5TKDA 4R6VA 4YO6A 2O2UA 4FGBA 3WZUA 4EOLA 4WD5A 3V8WA 4O2PA 2ONLC 5LVPA 3TDVA 4ZP5A 2ITPA 4JDKA 3SW7A 1PHKA 3O0GA 4O7VA 4F70A 4PP9A 3HMIA 5LCJA 3OOMA 4EZ7A 4EYJA 2R3MA 4IIRA 2GFCA 2ONLA 2B54A 2YIWA 2I6LA 3EN9A 4XX9A 3ZO1A 3CY2A 4FV1A 4QTCA 3OEZA 4USDA 3UQCA 3EQRA 2ZAZA 2CKEA 3VS7A 5A14A 3UO6A 1GZOA 3U6HA 2X7OA 1BUHA 2GS7A 2I0VA 3NNWA 4I94A 4WOVA 4FI1A 3KF4A 4CKJA 1OBGA 1U54A 3A7JA 3KMUA 4FC0A 3VQUA 3W2CA 5M07A 2IVVA 4DFNA 1URCA 2BALA 2OO8X 4OAVB 4WNPA 2ACXA 3UYTA 1YWNA 3GU6A 3VS1A 4DYMA 2WMBA 2UW6A 1W98A 2BZHB 4UB7A 3CGFA 1FOTA 1ZLTA 2WIHA 3DZOA 4CFXA 5J7BA 3ATTA 5I9VA 3GC0A 2HXQA 3HUCA 4FZDB 4L42A 1FGKA 2YCFA 3COHA 3FHRA 3DBFA 2AYPA 4KRCA 3VBQA 5HLWA 2OFUA 2BIKB 2WTCA 3CQWA 4YJVA 5HO6A 3ZS5A 3R63A 1UKIA 2HENA 3ALNA 3GCQA 2QOLA 2XK3A 1EH4A 4FIFA 4W4VA 2RFEA 1L8TA 2BFXA 3Q4ZA 4ZSJA 1QMZA 2PPQA 4LRKA 4G5JA 4QQTA 2JLDA 1GIHA 1Y6AA 3C51A 4ANOA 1KUTA 3C4CA 4D4VA 3ZUVA 2UW0A 4OTQA 2LGCA 1YXTA 3QTSA 5E91A 3GP0A 3KQ7A 4S32A 3AC3A 2YWVA 3LCDA 1J1BA 2ITVA 4EUUA 2GNGA 1UNGA 2PHKA 3MIYA 3P23A 3UOLA 4BIEA 4GIHA 5CAVA 4GKIA 1VR2A 1JSUA 4NM7A 3KF7A 3AXWA 4EWHA 3KXNA 2C6DA 3HX4A 4YHFA 3LAUA 4YHJA 4BDKA 4AF3A 2X39A 3WF6A 2QURA 1IRKA 2BHHA 3FSKA 4F7LA 3HV5A 3ID6C 5B2LA 4O6EA 2G15A 2C5OA 4IH8A 4XV2A 4EORA 3Q60A 2V62A 4QD6A 4QTDA 3NCGA 5E8UA 3MFRA 5T68A 5CSPA 4LI5A 3D94A 4X2FA 1UU3A 4BCPA 4J96A 1PXIA 3QKLA 4KRDA 3W16A 4APCA 1WVXA 2B1PA 3HEGA 3O2MA 1HCKA 3CS9A 5DGZA 4EONA 1V0PA 3QD3A 5HVYA 5AM7A 5HORA 3CSVA 2CLQA 4O0RA 4FICA 3LFSA 3QQHA 3RZFA 3QTRA 3RM6A 4KBKA 4FTCA 4EH3A 3FMEA 3ZLYA 2Y4IC 5C4LA 3LM5A 3OW3A 4IB3A 2B9FA 4UMRA 1MRYA 3D5XA 4GT5A 3SLSA 4C61A 4XJ0A 4R1YA 3QA0A 2GHMA 3G5DA 3SDJA 4JQ8A 2WNTA 4EHVA 4PP7A 3LPBA 4HYUA 5FP6A 5J8IA 3TNWA 2A0CX 2JFLA 3HMOA 4QP7A 5JZNA 1Y6BA 2F7ZE 4RJ5A 3R7EA 2C6EA 5C9CA 1TVOA 4FTMA 2WTWA 3P5KA 4GUEA 4K11A 4X3JA 3A2CA 3QZIA 3R9HA 3WF8A 4CD0A 4ZAUA 5L6OA 4ZS4A 4RPVA 2CGUA 2JEDA 4JIKA 3UO4A 4DA5A 4CVAA 4GS6A 2GS2A 2XS0A 2H6DA 2QKRA 4C0TA 2FSOX 3QTQA 4TYEA 4M3QA 5HE3A 2YHVA 3ATSA 3QCXA 5JKGA 3GQIA 5C8KA 3PY3A 5HBEA 4F0FA 5EHOA 2RFSA 1IAHA 1ZYDA 3K5VA 4WA9A 3NSZA 3AQVA 3THBA 1ZOEA 1M17A 2O65A 2YN8A 3DS6A 3L9LA 3ALOA 1BYGA 3ELJA 1DAYA 1DAWA 4M14A 4EI4A 3QX4A 2EB3A 5CU6A 2BAJA 2F9GA 4L00A 5HO8A 3DCVA 4X3FC 3H10A 3RWQA 2QOQA 4FT3A 3HECA 5HBJA 3P7CA 4FNZA 4PL4A 2JKMA 2BPMA 4X3FA 1O6YA 5EYMA 5KO1A 3SG8A 4J53A 2GTMA 5EH0A 4EOPA 4AN9A 2VGPA 3UIUA 3VUTA 3OEFX 1ZXEA 4YJSA 3JS2A 3VS4A 3EH9A 3L8PA 5HO7A 2C5NA 5FEDA 4RIYA 3E5AA 3DXPA 3MVJA 3REPA 4O7NA 5DFPA 5FWKK 4FYOA 4H3PA 4AWIA 2C3IB 4CYJA 4U0IA 1Q8YA 3SRVB 1YHWA 2XZSA 4I24A 3PP0A 4HYHA 3MYGA 4FNYA 2NRYA 3GU7A 3F7ZA 2XNOA 3SXSA 3BKBA 3V51A 4H05A 4ZMEA 2REIA 1GNGA 2VTLA 2QOCA 2QO7A 4D2RA 4AGUA 2GNFA 4BDFA 4RG0A 2VTNA 4FL1A 3FI8A 3QGWA 1Z5MA 3PVGA 3PVWA 3QRIA 4ALUA 4PWNA 2XIZA 5IQGA 4X6RA 5AV3A 3DQWA 3E7OA 5C01A 3DB8A 4B0GA 3LCOA 4O96A 5IQCA 3PG3A 4IFCA 5TO8A 3PPJA 2UVYA 2HZIA 4HCTA 2GQSA 2JAVA 5KZ0A 3IDPA 5G1XA 4YP8A 1Y57A 3EMGA 3F2AA 1PMEA 4OT5A 4QP4A 4XG4A 1FGIA 4RIOA 1P4FA 5HIEA 4FEUA 3PJCA 4NCTA 3RHXA 3HDMA 5ANIA 3ZM4A 3PIXA 3R8ZA 2ERKA 3W33A 4F7NA 3SG9A 3FZPA 4AW0A 4C57A 5A6OA 1R78A 2H8HA 3SXFA 4GMYA 1AD5A 4EOSA 2YM8A 2FVDA 3FLWA 5BYZA 4ZY4A 3GB2A 2BILB 4BWXA 4ZSAA 5IEXA 3ZC5A 5FXRA 3TUBA 3N4VA 5AFVA 4J1RA 3C13A 3D0EA 3LE6A 4XYFA 4YZBA 5LQFA 5IQBA 2GHGA 4P5QA 4P7EA 2IG7A 3QC4A 3R02A 3VUHA 4RC3A 1PYXA 3TZMA 5IA3A 5L2WA 4E5AX 4RFMA 2PE0A 3T9IA 1Q3DA 1A9UA 2YZLA 3OCTA 3C1XA 3PZHA 2BCJA 2R3OA 5AWMA 3NEWA 1UU8A 3SC1A 4KIQA 5ANKA 1MQBA 5EI6A 4ZTNA 1S9IA 4YGAA 3AMAA 2V55A 2WEVA 3VIDA 5HG5A 5F20A 5K3YA 4BRXA 4MQ2A 5A6NA 2WQOA 4MTAA 2Z7RA 4FKTA 4NTSA 2A2AA 3NYXA 3DBCA 4NSTA 4BKZA 2WU7A 4F63A 4XRJA 4CV8A 3UQFA 4FA2A 1PXOA 3GCSA 3PRIA 5IKWA 4I3ZA 2HWPA 4XG7A 5ANJA 3ERKA 2BRHA 5KBRA 4FSQA 5JFWA 1Q4LA 4ACHA 1UA2A 3TCPA 2ZV9A 4U6RA 4RJ8A 4QYHA 3LHJA 4ASDA 5AP5A 1VEBA 5AUVA 2FGIA 3TI1A 4DFZE 4FVQA 3FY2A 4U3YA 5D41A 5AM6A 4X2NA 2QO2A 1PMNA 4WG5A 2XJ1A 4Y8DA 1MRUA 3IW8A 5KHXA 5KMKA 3FPMA 5EK7A 2YISA 3FE3A 2Z7SA 4EOJA 5CF4A 1ZY4A 3KVXA 3Q2JA 4YJTA 2CDZA 1RQQA 1Y91A 4IWQA 4I5CA 1UVRA 3H9FA 4V04A 1OPJA 4MF1A 4I1ZA 3VS5A 2GS6A 1SVEA 3LMIA 3B8RA 2OXXA 3FZ1A 5IQEA 3VUMA 2C6MA 3AMYA 5CT0A 3ENHA 4EQCA 4BICA 3L1SA 4D1XA 2IJMA 2WTKC 3C0HA 1XR1A 4JDJA 5BUEA 4C4GA 2XF0A 3FI3A 1FBNA 2XMYA 3ANQA 2OJFE 2EXEA 3R7UA 5CEPA 4K8AA 3VO3A 2DWBA 3F66A 4D55A 3MN3A 5FM3A 3MWUA 5HNBA 2BRNA 2CGWA 4UXQA 1V0OA 3E88A 5DPVA 5I9XA 3QZHA 5AP4A 4ENYA 4CT2A 5I0BA 4LV8A 4AA0A 2W06A 1VYZA 4AT3A 5DRBA 1CM8A 3VHEA 3HAMA 2X8IA 3OBJA 3KREA 4JG8A 2ZB0A 5HG7A 2QU5A 4ZXTA 1O6KA 1WFCA 4O0TA 3C4XA 3UC4A 1IG1A 4CMUA 3POOA 3A8XA 3MSSA 4I41A 1H1QA 3KRRA 1K9AA 3QXPA 2BMCA 3GQLA 4H1MA 3HV6A 5CLPA 4D5HA 1PY5A 2DS1A 3KCKA 4QP8A 3O50A 2PUPA 3QQKA 4MH7A 5FTGA 2VX3A 4UN0C 5IQFA 5AP7A 4J71A 1TKIA 4GG7A 5CXHA 5GNKA 4RVTA 2ZM3A 3FXZA 3CP9A 3MA3A 3MGYA 5HG9A 2AUHA 5L6PA 4ITHA 4II5A 3ZLWA 3QQGA 2F49A 5FGKA 4AZEA 5HGIA 1JSTA 4E6AA 1U4DA 5IMXA 5CF6A 3PP1A 5AAFA 5C8MA 5ETAA 2GPHA 2W9FB 3HVCA 2WQMA 3DTWA 2C6IA 3OF0A 2J0LA 3VVHA 3QU0A 2X1NA 4GVAA 5EKNA 4AS0A 4PDSA 4I21A 4O22A 5AX3A 4NUSA 4U81A 5DYJA 4I4EA 4IFGA 5CT7A 2I0EA 1WVWA 1SZMA 4F9BA 4AGWA 4HVGA 1OIUA 3UMWA 1XH7A 2R0IA 1KOBA 3QTWA 4MQ1A 3TV7A 3HA8A 3A7HA 2WMRA 3BLHA 4IE9A 4RRVA 3HYHA 2YCQA 1OMWA 4MVFA 4TY1A 3E63A 5HCYA 3UQGA 4HVIA 5EQPA 4HVDA 3BX5A 3PZEA 3MFTA 4AZWA 4MNEA 3R7OA 2R4BA 4NFMA 2JIIA 3OXIA 4WO5A 3RINA 5JQ5A 4DH5A 2PMLX 5HKMA 3A7FA 3MFUA 4EBWA 3O23A 3N4UA 3ULIA 4WRSA 1PF8A 2XUUA 3W2PA 1JPAA 2B9JA 3NX8A 2W1HA 3K5UA 4ACGA 2C5YA 2O8YA 4R78A 4EL9A 2Q0NA 3BYMA 3MPMA 4RA5A 4Y73A 5AX9A 2P33A 3WZKA 3BHTA 2RKUA 3D7TA 3D14A 3PLSA 4FKWA 3ZFMA 4C33A 3FDNA 3GFEA 2JDRA 1GJOA 3RPSA 4P5ZA 4DCEA 5M55A 2VGOA 2XA4A 3CPBA 4UMPA 3U6IA 4U41A 4D9UA 4OGRA 1U46A 5ANDA 4F99A 3RP9A 1OB3A 4YTFA 5BVDA 4TTHB 3CR0A 3EKKA 3G9NA 5A4TA 3SOAA 3R30A 2W4OA 5IZFA 4U8ZA 5EM6A 4JQEA 3U9NA 2GNIA 3F2NA 3CD8A 1CTPE 4QMPA 3ODZX 2VRXA 4YTCA 2ESMA 1JOWB 3E64A 2R0UA 4JNWA 3VN9A 5FXSA 2YZAA 4NKSA 3MPAA 4KBAA 4NIFA 4RZWA 3TKUA 1PXPA 2BAQA 4BB4A 2R64A 3F69A 5JH6A 4WUAA 1OIRA 1YWVA 4JBQA 1XKKA 2X2LA 4YHTA 2OZAB 4DE4A 2CLXA 3KXXA 4YBKA 5FTOA 4EH9A 3S1HA 3F5PA 4L46A 4D2VA 5K5NA 3CKWA 5CX9A 1R0EA 4L7SA 3ACKA 4UZDA 5BPYA 3EOCA 3AC8A 5J79A 1OZ1A 4C35A 4UEUA 2X0GA 3LFEA 4DC2A 1G8AA 3HV4A 4ZY6A 3NAYA 5AMNA 4EUTA 4CFMA 2A4LA 4AX8A 4GK4A 4IM2A 2WU6A 2E9NA 4PPAA 4BGQA 4BCJA 1OGUA 4OT6A 5CALA 3HZTA 3PY0A 2GMXA 1KV2A 2X6DA 4FTLA 4JG6A 3SHEA 5AUTA 5LMKA 4E8AA 1PMUA 2BZKB 5B2KA 4M69B 1LUFA 4EEVA 4JT3A 4YBJA 2XVDA 3IOPA 4Q9ZA 3ZYAA 4XEYA 4ANQA 2VWYA 3Q9XA 5E8TA 3FBVA 4XG2A 5EHYA 4W8EA 2OU7A 4GYIA 3PPKA 1ZZ2A 3UIBA 2VO7A 3P0MA 4KABA 3VUDA 5L2QA 5AA9A 3DFAA 4R3PA 4TRLA 4D9TA 4CZUA 4BVUA 5HNIX 2W5HA 4DGMA 4Y46A 1J1CA 2PSQA 5M4IA 2XK4A 1LP4A 4QMWA 4IM3A 4TKSA 4RVKA 4FBXA 5BVNA 5FEEA 3R8MA 4M97A 4OW8A 3W2RA 5JK3A 5JEBA 3W32A 3FXXA 2RSVA 4CGAA 3PE2A 1LEZA 2R2PA 3AOXA 3WZEA 4GJ2A 3UVRA 2X8DA 3AC2A 4IANA 4B6LA 4FSNA 4NTTA 4BL1A 4YNOA 4O2ZA 3LLTA 2YIXA 1ZZLA 3I7CA 4R7IA 4K9YA 3DAJA 2ZDUA 4E6CA 4LYNA 5ETIA 2Z2WA 4QMVA 2J6MA 5CI7A 3MH2A 4RGJA 3PXYA 2BAKA 3C4FA 4JG7A 4KNBA 3Q6WA 3BYUA 4A4XA 3PIZA 4C02A 4PMPA 3JR1A 4IC7A 3Q4UA 4Z3VA 2HY81 5AV2A 3BGQA 4EH7A 2WTDA 4IJPA 2HCKA 5LARA 3VF9A 4AG8A 3IECA 4ZLZA 3UNKA 3OY1A 4FEVA 4W4XA 3PA3A 1XQZA 4UYNA 4G3GA 2YA9A 3OUNB 4GH2A 3ZRLA 3V01A 3GCVA 3EL8A 3F3VA 2CNUA 4F4PA 4DEAA 2C5XA 3SXRA 3RAIA 3EN6A 3V6RA 5GJDA 4C36A 3FY0A 3UP2A 4RX8A 2WTJA 4CT1A 1OITA 4LL0A 5CWZA 3U6JA 2YDJA 2XEZA 4FNWA 4QP2A 2JGZA 4TL0A 3H4JA 2GNHA 4JI9A 4ALVA 1WBSA 5LXMA 5HD7A 2H96A 4DTAA 2KULA 1M2PA 2W9ZB 4IX6A 4I92A 4LUEA 1ZARA 5E8SA 5BNJA 5I9WA 2XIXA 4P2KA 5L3AA 5IQAA 3OUKA 5E1SA 1IASA 5D9HA 2VNWA 4V0GA 1ZMVA 3QUPA 3QX2A 2WB8A 4FTAA 5EW3A 3VUGA 4BTKA 3DXNA 4RZVA 3TUCA 4O0SA 3WZDA 5HNGA 5DT4A 5D1JA 3L9NA 3FHIA 1LEWA 2OJIA 3KXMA 3TTIA 2VTSA 3NS9A 5CYIA 4EJNA 2WGJA 5AR7A 1H8FA 4MWIA 3KRWA 4YURA 3I79A 3RZBA 4ERKA 2C68A 3FZSA 4AZFA 5A9UA 1ERKA 5KBQA 3NW5A 1OKZA 5FQDC 3BELA 2IW8A 2UZDA 3EYGA 4B8LA 3BWFA 4BDBA 2XNGA 3Q96A 4UMTA 4AN3A 4MCVA 1YW2A 4F7SA 3RPRA 2YM3A 4TNDA 2E2BA 2RG5A 4WBOA 1G8SA 3VS0A 4YJOA 3UJGA 4ZSLA 3Q6UA 4FT7A 3SA0A 2GTNA 3ANRA 3GC8A 3O7LB 4AT5A 4KIKB 2PZ5A 1M2RA 1OL1A 2R3KA 3FQEA 3R21A 4GU9A 5A54A 1U54B 2W1CA 3BPRA 4J97A 3BEGA 4XCUA 2BIYA 3MY0A 5JMSA 3V5PA 4O84A 3OP5A 4QTEA 3A61A 5KMOA 3UVPA 3GEQA 5J5SA 5J95A 4XUFA 4P4CA 4GT3A 2BDJA 5D7VA 5GZ9A 2KTYA 2IVSA 2XNEA 2OI4X 4XLIA 2X7FA 3NUAA 3AC5A 4N70A 3KN6A 4O91A 5IUHA 3VUKA 4FTJA 4USEA 5HI2A 4ZMFA 4NZWB 4NJDA 1YXXA 4FTUA 3HAVA 4XBUA 3FMJA 3KL8A 3O8TA 3DJ7A 1WBWA 2O3PA 4AOIA 2BRGA 3UZRA 4RT7A 4IMYA 3QGYA 4EK6A 3NZ0A 3I81A 4KINA 3TNQB 2C69A 2ITXA 4D2SA 4C4FA 5TT7A 4LMNA 5K4IA 2VTAA 3VQHA 3A7GA 3WZJA 4QP9A 3GOKA 3EQPA 1JAMA 3JUHA 4MWHA 3Q5ZA 4XG3A 4ZTSA 4BTMA 4J98A 4D1ZA 5HVJA 3E8EA 4YJRA 4FIEA 2R7BA 5IU2A 5GHVA 2Y6OA 4KKGA 3MTFA 5HCXA 4HGTA 1GIIA 4IZAA 2PZYA 2XKFA 1RE8A 3Q9YA 4KSQA 4BKYA 3CPCA 3IW5A 4C4JA 5IH4A 3PLAE 4L67A 4HOKA 3ZZWA 4CEGA 1WAKA 1XWSA 1NVSA 1OECA 2PTKA 3SX9A 1BI7A 5ANGA 4B8MA 5AADA 3U55A 4PPCA 3GNIB 4UWYA 1H1SA 2PYWA 4I6FA 4FKJA 5DA3A 3VS6A 4MXCA 2ETMA 5I3OA 5FG8A 4AZSA 4BDAA 3M1SA 4IDTA 4Y72A 1NT2A 4K2RA 3UDBA 4N6ZA 3W8LA 2VTOA 5GINE 2QOFA 5L6WL 2YCSA 2XK6A 5I9YA 4M12A 5L2SA 1WBVA 3OG7A 1W0XC 4QMUA 5FD2A 4AN2A 5C4KA 3IONA 2XK8A 3MDYA 4M15A 5H8BA 5LWMA 2QOBA 4D4RA 3ZXZA 5CSHA 1MQ4A 4I4FA 1YXUA 2Y4IB 2PK9A 1QPDA 3QQLA 4BBMA 3BZ3A 3EZVA 2Y0AA 4U3ZA 4ZIMA 5L8KA 4PNKA 5C26A 2CGXA 2OK1A 4AE6A 3F2RA 4PMTA 3A4OX 4FIIA 4YNEA 3U51A 3L8SA 2GDOA 4EHGA 5HZNA 1P4OA 4HGEA 4B7TA 2V5QA 3FMDA 5LWNA 3W18A 2J0JA 3DGKA 2PUIA 4BHZA 1B6CB 4LOQA 4RVMA 3O71A 2F7XE 4ITIA 4FKPA 4MX9A 5DR6A 4BC6A 1TQMA 5J5TA 4A9UA 3TNIA 3ETAA 3ET7A 1Q8ZA 4E7WA 5J9ZA 3QHRA 4WSQA 1B39A 4K1BA 1CKJA 2B9IA 3RNYA 5HE0A 3NUNA 5FDPA 2BDFA 2C4GA 2VX0A 3WYYA 5EDRA 3P9JA 2VTJA 2E9VA 4D0WA 1CDKA 4DT9A 5E8XA 5DH3A 2J0MB 3VC4A 2YABA 1H1RA 2A19B 4PRJA 3QWJA 3TWJA 3VBVA 4DHFA 3S0OA 1PXMA 4JR7A 4QMSA 4FKGA 3MV5A 4J7BA 4DGLC 3NUSA 4YJQA 2R5TA 4W4YA 4BDJA 4L9IA 4MD8E 4J95A 4MBLA 4F65A 3DB6A 3QA8A 2CKPA 3JVRA 4X3FB 4L53A 2C1AA 2WMQA 3BYVA 2VAGA 4FE2A 4GEOA 3IGGA 2G9XA 4JBPA 5M51A 4GFOA 4L3PA 4O27B 3DJ5A 4U7ZA 1KE7A 3P08A 5CU3A 1T46A 1WBPA 5AR3A 5HD4A 2NRUA 3C4WA 1J7LA 3A60A 4ACMA 5CTPA 4YLJA 1WBTA 1YOLA 5EFQA 1SNXA 4QP3A 3UNJA 4IVCA 3QCQA 3OWJA 3IDBA 2PY3A 5A4EA 3QRKA 5I9UA 3FEGA 3BBTB 4X0MA 3GCUA 2B52A 3Q52A 4WHZA 2YLFA 3R28A 2X2MA 5B7VA 3DLSA 3ZEPA 4G31A 3PY1A 3FMHA 4DN5A 1KSWA 3OOGA 4X6QC 4DH7A 2JC6A 2R3NA 1FVRA 3H0YA 2OJ9A 4F1OA 2ZM4A 1UV5A 4XG6A 3PXQA 3V8TA 4JDHA 3CD3A 4IADA 4O7RA 2UZEA 3U9CA 4BDEA 4PL3A 3QFVA 2UZVA 4AU8A 5IF1A 5EKOA 5JFSA 5KMMA 2Y6MA 3QTUA 4FSUA 4NT4A 5AJQA 3G2FA 4LM5A 4CV9A 4K18A 1M7QA 3NW6A 4YPSA 3POZA 4M68A 2PE1A 2ETKA 3AT2A 1OL7A 5EOLA 4FSYA 4EC9A 3ORKA 3TZ8A 4W8DA 4EOKA 2O63A 3RPVA 3MIAA 4Y85A 2CKQA 4NFNA 4OTFA 3MH0A 4HCVA 3T8OA 2W99B 3NCZA 1CKIA 4YTIA 3EQDA 4UYAA 1Y8YA 4OTDA 3T3UA 5IQDA 1PKDA 4IB1A 2Q0BA 3FQHA 3WF9A 3ZSIA 5JT2A 2W96B 3R1QA 2VUWA 3RWPA 2OG8A 2PMOX 4GT4A 4I5PA 4L68A 2ERZE 3ZUUA 1G3NA 4JVGA 4RIXA 3LCSA 4CFFA 2I40A 2PMNX 2UZUE 3WIKA 1LR4A 2X6EA 3AGMA 3TN8A 4IWDA 1OI9A 2BHEA 5BMSA 4MXAA 3RK7A 4XOYA 3NAXA 3TKHA 3ZSHA 2VX1A 4FTQA 4TT7A 3GC7A 3I1AA 3ODYX 2PVHA 4XG8A 4AFEA 2E9OA 4G1WA 4E26A 5DLSA 2OW3A 3DKOA 1TQIA 4NCTC 3VNTA 2UZWE 4BDIA 4E1ZA 3PWDA 1FINA 4FX3A 2JFMA 1WBNA 2YIQA 3PIYA 4QMLA 4HNFA 3QXOA 3UOJA 3LQ3A 4ZK5A 3O7LD 3HP2A 4AW5A 4MYGA 4O81A 1P2AA 1UWHA 4XV1A 4FTTA 4YZMA 4BWPA 4FSZA 1JKTA 4DFLA 2QKWB 3Q9ZA 4XP0A 4FL3A 3W10A 3HRCA 2VV9A 2V0DA 2WTVA 3FUPA 4HW7A 1IA8A 5HICA 5C03A 5DIAA 5DVRA 3R7YA 2QG5A 2G2IA 3NPCA 4FUXA 1APME 2YACA 4FYNA 4FUYA 4KS8A 4NEUA 4QPMA 4DT8A 4EHEA 4FOBA 1XH8A 4IX4A 3EIDA 4DFUA 3KGAA 3CJFA 2W05A 3QD4A 3QL8A 4GK3A 3DAEA 1YI4A 4I0TA 5D12A 5BMMA 3QKKA 3I0OA 4S2ZA 3O8UA 1XJDA 3PDTA 1P5EA 1U5QA 3HLLA 4WT6A 5EHLA 4BZDA 4JX3A 2QVSE 4EBVA 3E3PA 3TT0A 2HOGA 5HLNA 4KB8A 4EQUA 3SRVA 1AGWA 2VWBA 3NVKI 1IEPA 2IW6A 3NRMA 3VF8A 3MPTA 3PVBA 2OIBA 4FKLA 3D2KA 3LJ2A 1UU7A 3ENMA 4O0XA 4E5BA 4GKHA 3CLYA 4RIWA 2XRUA 5EI2A 2PMIA 2WTKB 3FLYA 5BVFA 2PL0A 4DH1A 1YOJA 2V7AA 4ZJJA 3MVLA 2GNJA 1E9HA 3DK3A 3G9LX 5CEKA 4PX6A 3H0ZA 2R3QA 2WOTA 3VWAA 1Q3WA 3MB6A 3QD0A 3GVUA 3NIZA 2WELA 4B9DA 4QTBA 2O5KA 2X8EA 3BWJA 4KWPA 4ANBA 1FVVA 1A48A 3KRJA 3PG1A 3IG7A 4IEBA 1BLXA 2VTIA 3E8NA 5F95A 4GU6A 2YM5A 3BU3A 4BCKA 4ZZMA 3GUBA 2HELA 4S30A 3ZXTA 3VJNA 4O83A 2QOIA 3LXNA 4P90A 3C50A 3FAAA 4YJUA 2XKCA 4Y95A 5L8LA 4NKAA 4FTNA 3F5XA 4XV3A 3QQUA 4YMJA 4MF0A 2Y7JA 4R5YA 1ZOHA 4FKRA 1FPUA 4M84A 2W7XA 4A07A 3D15A 4DFBA 1NY3A 4AA5A 2J4ZA 4A9YA 3RCJA 5KMJA 3RPYA 5CEIA 3MY1A 5CF5A 5E4HA 2QI8A 1PKGA 1H4LA 5FXQA 2CKOA 3BYSA 2DUVA 5JGAA 2CGVA 3P7BA 4YSMA 3PXKA 1W82A 1M2QA 4AW2A 3LW0A 4R77A 5T3QA 5A4CA 2PZPA 4UXLA 3A8WA 5EG3A 4W9WA 3DBDA 1ZYJA 4MXOA 4FVPA 3TACA 3ZUTA 4CFNA 2HK5A 1JWHA 3BU6A 5DHJA 3Q3BA 1ZY5A 3BBWA 2UW8A 3Q32A 3UIXA 3KK8A 3F9NA 2YWPA 3QLFA 3COMA 3BHYA 3PA5A 4QMXA 4TXCA 1RDQE 4U44A 5DEYA 3UG2A 3UIMA 2PVLA 3IK3A 3ROCA 2YJRA 1ZMUA 2QO9A 1R1WA 2E9UA 1GZ8A 3ZOSA 3DAKA 5CAOA 1XBAA 2DYLA 2QLUA 4R8QA 5AV0A 2GFSA 3T9TA 4FSWA 3VRYA 4E4NA 2PUUA 5JFVA 1KWPA 4X2KA 4YZNA 4LQMA 1SVGA 2NO3A 4OBOA 3UTOA 4ANLA 1S9JA 2YM4A 5CU2A 1XH4A 2OKRA 1H0VA 4IXPA 4ANMA 4XLVA 4AOJA 4YC8A 4MNEB 2FYSA 3QWKA 3UBDA 3F3WA 3PFQA 5IH5A 5I9ZA 1E1XA 3AT3A 5KMLA 4JBVA 4C34A 3LFBA 3S3IA 1IA9A 3JY9A 2XNNA 4BHNA 4CRSA 1OIYA 2CPKE 3VBXA 4DEEA 1OL6A 2R3LA 4TN6A 3KXZA 3ZU7A 4EOOA 2C3KA 3PSCA 3G6GA 3I60A 5JFXA 3ORZA 1I09A 3DTCA 1DS5A 2BKZA 4WSYA 3TJCA 4O0WA 5CQUA 4D2PA 5JZJA 4NW5A 4RX5A 5KX8A 3D7TB 3TKIA 3SVVA 2IVTA 5E8ZA 4F1MA 2WMTA 2A27A 3BI6A 3FZOA 4XNEA 4N57A
chains in the Genus database with same CATH superfamily
3JVSA 2YM7A 4EK3A 3QCYA 2YEXA 1W7HA 5JGDA 3V8SA 4I5HA 1FQ1B 3IPHA 4HVSA 4IJ9A 4LV5A 5JQ8A 5AAEA 4IB0A 3ZO2A 4CCBA 3QRJA 4Z7HA 1CMKE 1KE6A 1GIJA 1Q8TA 2F2CB 2XRWA 3R8UA 1XMMA 4ARKA 4FEQA 1L3RE 3V5LA 3FC1X 3FYKX 3EQGA 2YCRA 3G0EA 2R3PA 3UE4A 3KEXA 4B4LA 3OCSA 3NVMB 3B2TA 4E3CA 4FV0A 3QZGA 2JD5A 4N0SA 5I4NA 4HVHA 4TPTA 4W9XA 4BN1A 2X81A 5TE0A 4XHKB 2A98A 3EZRA 4NIFB 5FP5A 2OFVA 4C62A 4MD7E 3P79A 5EDPA 2VWZA 1FMKA 2YDIA 3PJ2A 4EK8A 4ZZOA 2OGVA 5ACKA 4JL9A 4KS7A 2XH5A 4FSTA 2BZJA 5CENA 5LVNA 3S2PA 3LCTA 3OHTA 3NR9A 2BUJA 4YZCA 3KFAA 1Q8UA 1ZOGA 4CQGA 4TYHA 4IZ5A 3ZO3A 5EOBA 3HMNA 4OR5A 3EFKA 3VBWA 2XALA 4KKHA 4FTRA 2WXVA 4GFGA 4CYIA 4NM3A 2XK7A 4MEDA 3R7GA 5LOHA 1QCFA 2C5VA 4D28A 2WQBA 5HX8A 1TFFA 3TL8A 2VTTA 3OMVA 3GU8A 1G5SA 4L6QA 3KULA 4LDTA 2FB8A 2X4ZA 4O86A 2FO0A 2F57A 3P1AA 1Z9XA 3TV6A 3OT3A 3WF5A 3FI4A 3ZLXA 3E92A 4QMYA 4W4WA 4FKUA 1H25A 3RKBA 2W0JA 3SOCA 3P78A 3AKKA 1H24A 1PYEA 1BKXA 3D5WA 3R1NA 1YOMA 3W55A 5HIBA 4O7SA 4O1OA 1KV1A 4G9RA 4D1SA 3LM0A 4O4DA 4EYMA 2ZV8A 2JIVA 2J5FA 3WYXA 4MKCA 3ZSGA 4CG8A 2IZUA 4RLKA 5C8NA 1GZKA 4BZNA 2UZOA 3LMGA 3EFWA 3BGZA 3LXKA 5JRSA 3WF7A 4OTHA 3COKA 4DH8A 2FSTX 2X9FA 1ZYSA 4IACA 2XNPA 4O7ZA 3FMNA 3ZBXA 4O6LA 3OTVA 1HCLA 3FSFA 2YFXA 5D7AA 3KKVA 3NUXA 3PE1A 4E6QA 5EM5A 3ZO4A 3OCGA 3DK7A 2IW9A 5LMKC 1O6LA 3G15A 4NH1A 4DEBA 4QRCA 1M7NA 3ORTA 4YSJA 2R3FA 4IX5A 2OJJA 4RA4A 4DINA 4CQEA 1OGYA 1OM1A 2BROA 4KAOA 5HX6A 3LMHA 4BZOA 2QHNA 3LFFA 4H3QA 2BFYA 4S34A 4TWNA 4EHZA 5CANA 2VZ6A 4GL9A 4IAFA 5EW9A 3UYSA 4CTBA 3LJ1A 5KKRC 4FZFB 2QONA 4G9CA 5DR2A 3V04A 3SGCA 5KMNA 3Q4CA 5B2MA 3M2WA 5CZHA 3TG1A 4YO4A 3MTLA 1VLRA 4I93A 4JRNA 4WG4A 3QHWA 1SYKA 2XIYA 3R2BA 4L44A 4L7FA 2VO0A 4IX3A 3W1FA 5FUTA 4BCIA 5CZIA 5AUUA 4ZEGA 3TM0A 2VNYA 3ZEWA 5ITAA 3UZTA 4BJJB 5IG1A 3RI1A 4BCFA 5M4UA 4CRLA 3NFGB 2C0TA 2J50A 4QMOA 5IEVA 2JAMA 2UZNA 3S4QA 1WVYA 1REJA 1W83A 2PZRA 4BY9E 3QQFA 4TW9A 2IZSA 2YDKA 5HE1A 5HE2A 1V1KA 3DDQA 3ZLSA 3BLRA 3D83A 3PYYA 3W8QA 5M08A 4AP7A 3B8QA 3EQIA 3EYHA 4NWMA 2UW4A 4AAAA 4GUBA 2R7IA 1DI8A 3BE9A 5EW8A 3WI6A 1Q24A 4ACCA 1QPEA 3QAME 3EJ1A 4KA3A 1R3CA 4PDPA 4YZDA 2IZTA 5ETFA 2R3GA 5CAQA 3QF9A 3ZMMA 4M66A 3N4TA 1H07A 4G3FA 3DNDA 4GG5A 4ASZA 4K33A 5J1VA 5IA2A 3TMOA 4QPAA 1NW1A 3ACJA 1GZNA 4RQKA 5AEPA 3Q04A 4ZSGA 2QOHA 3DJ6A 2V22A 5TF9A 3PJ8A 3NYVA 2RFDA 3PJ1A 5E9EA 4TYJA 4XRLA 3HL7A 3D2IA 4FT9A 4QTAA 2HXLA 3OC1A 5K5XA 5FLFA 3W0PA 4IAIA 4K6ZA 4C59A 5M44A 3W0OA 2ZM1A 3H3CA 3AD4A 5DI1A 1AQ1A 4FT0A 4FTKA 4XG9A 3F7WA 4O7LA 2HY0A 2YM6A 4KKEA 1GOLA 4DEHA 5L2TA 2CSNA 2V7OA 2QLQA 3CIKA 4Q9SA 3ZZEA 4DTKA 3S95A 3KY2A 4AGDA 3PPZA 4JDIA 5AUXA 4EJ7A 3QTIA 3ZHPC 5ACBC 4ENXA 4DHIB 3I0QA 5CY3A 2P3GX 4CKRA 4Z16A 2W1ZA 4ZTHA 3HP5A 4BTFA 2PVNA 3AD5A 3S00A 1RW8A 1H01A 2W4KA 2DQ7X 1CKPA 3MVMA 4ZTRA 2QOOA 4YLKA 5IQHA 2OZOA 3QYWA 5ETCA 5CXZA 5M4FA 4KD1A 3MH3A 3RAKA 2J5EA 4L8MA 2OXYA 3MW1A 3OXTA 5HESA 4AT4A 2C6OA 4QYEA 3NUUA 4BYIA 4L45A 4DBNA 3GXLA 5IISA 1G8KA 3RNIA 1YI3A 5IA4A 1YHVA 4UMQA 5CVGA 3CY3A 4NL0A 3AT4A 3E87A 1H1PA 2P2IA 3AD6A 2J0KA 3NLBA 4I6BA 3UOHA 3T3VA 3SQQA 1I44A 3F82A 3JXWA 4FV6A 2R3IA 4JAJA 4ZLYA 4TNBA 2R9SA 2QC6A 3RJCA 4F08A 5J7HA 4FEXA 3PSDA 3RBWA 4RX7A 2J7TA 5C1QB 5DNRA 4EZ3A 3L9MA 2ITNA 4G3CA 4LUDA 1ZYLA 4H1JA 5H3QA 4E4XA 3E93A 4CCUA 2C1BA 5JGBA 3F61A 3HGKA 3LFDA 1UNHA 4AZTA 4RBLA 3R1SA 2C30A 2XYNA 2J2IB 4I23A 1Q8WA 4EZ5A 4QP1A 4UALA 2EWAA 2W5BA 3BV2A 3G90X 3GT8A 4J52A 2PVMA 3ZFXA 5IA0A 3O5AA 3FMMA 5JSMA 4C3PA 4QDEA 2W4JA 5HTIA 3ORIA 2ZVAA 3VBTA 4A4LA 2XNBA 4FGRA 3MH1A 3R73A 4DCAA 4G5PA 2C3JA 4G16A 3LFNA 4USFA 2UZLA 3BQCA 4LOPA 2JDSA 3KMMA 3KVWA 3GCPA 3O96A 4RSSA 4A9TA 4F9YA 1JQHA 2WMWA 3E8CA 3GOPA 4BI1A 3W0MA 2WKMA 5CQWA 3PTGA 4QQCA 2ZOQA 1Q99A 1FVTA 2XIRA 3OTUA 1YQJA 1OL2A 4OUCA 2WQNA 3R7IA 2OSCA 2HAKA 1YDTE 5LMBA 3BQRA 4FV8A 4DAWA 2F2UA 4JBOA 2J51A 2OF4A 3CE3A 2PZIA 4FTIA 4BDHA 3KU2A 5EM8A 3R8PA 3RM7A 4I0RA 3UP7A 4CG9A 5E90A 4L43A 5AR8A 3H9OA 4WNOA 1XH9A 4CTCA 3ZONA 4HGSA 3R0TA 2EVAA 1UU9A 3MESA 3BV3A 4XP2A 4QP6A 4AACA 2WMSA 3R22A 2Z8CA 4DITA 3O8PA 4UV0A 3GENA 2QU6A 4PMSA 4RC2A 5A4LA 4C2WA 4BDGA 4ALWA 2ITWA 1SNUA 4MNFA 5AAGA 1MUOA 3I7BA 1H28A 3IW6A 3DU8A 4APPA 2I0YA 4M0ZA 4KIPA 4ZTLA 3ZBFA 1FMOE 2C3LA 2W5AA 4BGGA 1Z57A 2VO6A 4JS8A 1QPCA 2BZIB 4KIKA 1OVEA 3ORPA 3II5A 4Q2AA 4DG3E 1JNKA 4F9WA 3ZC6A 3HNGA 4Z9LA 1JKKA 4HJOA 5A4QA 2UW7A 1BI8A 3Q5IA 2XJ2A 4CFVA 2ZJWA 5GZAA 3MJ2A 4K0YA 1WBOA 4QYYA 2VTQA 4GVJA 5HHWA 3GU4A 4DF3A 4D4SA 4DG2E 4GCJA 5CAPA 4YTHA 2RIOA 3ULZA 2CCIA 4EOMA 2QCSA 2RGPA 4IVDA 3DQXA 4HGLA 3L8XA 4FK3A 4GIIA 2HW7A 4D2TA 3C7QA 4EH6A 4ORKA 1JLUE 2QG7A 3G51A 4IAZA 4CMTA 2I0HA 3NIEA 3V5TA 5C27A 4ANNA 4A9SA 4J8NA 4LGDA 1H00A 1W2CA 5HU9A 2GQRA 4EQMA 4U45A 3AMBA 2P2HA 3R00A 2VD5A 3Q53A 2W1GA 3V5WA 3WARA 4C37A 2VWXA 3IOKA 5K0XA 5CEMA 3C5IA 5AP3A 2BVAA 2ZV7A 3K54A 2JKKA 4DDIA 4FR4A 5E8VA 4QYGA 4JJRA 4TWPA 2WD1A 4O21A 3TNHA 5AR2A 5F9EA 5L4QA 4G6LA 3D7ZA 4LOOA 5T6KA 3A62A 3DFCB 1BL6A 2EU9A 4JRVA 3UG1A 5GZ8A 2BTSA 3C9WA 3GBZA 1NVRA 4FNXA 3MVHA 2ZDTA 4QT1A 5CSXA 1X8BA 4FG8A 4BKJA 2VWWA 3FLSA 3FMKA 4QPSA 4U9AA 5KMIA 3DBEA 3PSBA 3R9RA 3QALE 4ZJIA 1UWJA 3TXOA 3R9OA 3CGOA 3KN5A 3VULA 2HWOA 3UGCA 3IKAA 4G6NA 4C8BA 5BVKA 4ZTMA 3R7VA 3K3IA 3FWQA 4G2FA 4C58A 4JOAA 4QNYA 3RALA 3EQHA 1PJKA 3F6XA 4H36A 1ZMWA 4TYGA 2WPAA 5ANOA 2F7EE 1OPKA 2ZB1A 3RGFA 4DEGA 2XIKA 4C7TA 3IO7A 2EXMA 1ZRZA 1KE8A 1J7UA 3IGOA 2VWUA 3QD2B 3DNEA 3CQUA 3MS9A 4RWKA 4YC3A 4EH2A 4MBJA 4QMZA 2QR7A 1Q97A 4FV7A 4AXAA 4UMUA 3RHKA 3UO5A 1WCCA 4RIYB 5CF8A 3NGAA 2B0QA 4CZTA 3IQ7A 3OCBA 2RF9A 2ZV2A 4AQCA 4FV9A 3PXFA 4RQVA 5CASA 1YXVA 1Y8GA 2AC3A 5E7RA 4CKIA 4FV3A 1YHSA 3COIA 4FIJA 4RIXB 4QMNA 2UW9A 2BTRA 3FMLA 2UZTA 1GAGA 4TZRA 1BL7A 3OFMA 4OTWA 5CSWA 4D0XA 3LLAA 3OT8A 4D58A 2HZNA 1XBBA 2OH4A 3P4KA 4X7QA 1OUYA 3ORLA 4LRJA 2WMAA 4OBPA 3OD6X 4L3JA 4R3CA 4TWCA 4QO9A 5IUGA 5FTQA 2Z60A 5AUWA 1XHAA 4QNAA 4C4IA 1IR3A 1H0WA 3TV4A 5IMEA 2J0IA 3JYAA 2ITQA 4RFYA 3MA6A 1J91A 3CBLA 3GGFA 3CC6A 5HOAA 1H08A 4R7HA 4ZY5A 3LIJA 3C4EA 2H9VA 3BCEA 1UKHA 2FSMX 3KA0A 3TUDA 4OTRA 5M56A 2IEWA 1JKLA 2UVZA 3TEIA 3I4BA 1NXKA 4DEDA 4O1PA 5J9LA 4J8MA 4HCUA 5FM2A 4E5WA 1BX6A 2O64A 4L3LA 4O0VA 3D5VA 4BCHA 1YDSE 5EDQA 1OBDA 3K2LA 4I0SA 4NU1A 5ANEA 4BFMA 3ZDUA 4DHJA 2C6KA 3WOWA 2PE2A 3CEKA 3WILA 3FC2A 3PWYA 4MBIA 1OKYA 4U40A 4IC8A 2C0OA 4CMOA 4AUAA 4QDVA 4MK0A 4B99A 3AGLA 4CXAA 4XV9A 5LVLA 3QLGA 4NM5A 5AUYA 4IWPA 1KE9A 3A99A 5DOSA 4L52A 4CFUA 3EQFA 1ND4A 4C3FA 3U8WA 3HKOA 3BYOA 4RJ6A 5DBXA 5H8GA 3B2WA 2Y9QA 2RG6A 4FKIA 5FEQA 3ZFYA 5BVEA 2QOKA 4A9RA 3UNZA 3GC9A 3ORMA 4BWKA 4YR8A 4IVAA 5FBNC 1E1VA 3UPXA 3LOKA 3SKCA 2W1DA 1XO2B 2ITUA 3DDPA 3FKOA 3LFCA 4RIWB 4RJ7A 1F5QA 2YIRA 3N9XA 4RWIA 5G6VA 4QMTA 3RCDA 2FSLX 4BCGA 4EH5A 2JBPA 2R3HA 3U4UA 4UWBA 1OKWA 3SV0A 4G3DA 4YUQA 4GYGA 2NNWB 4AAYA 2G2HA 2GQGA 5KZIA 4O7TA 3GU5A 2B55A 2XBJA 3HDNA 4I22A 4RC4A 3UC3A 1W8CA 4FIHA 1B38A 2CJMA 3P86A 3VW8A 3HV7A 3AC4A 4G3EA 3W0SA 3NMUF 2B53A 4H3BA 4LG4A 2OICA 4A06A 4FL2A 4DEIA 4C3RA 4EK4A 2PVKA 4LL5A 3ITZA 4LGGA 5DR9A 4X2GA 1SVHA 2JDTA 1PW2A 4OTPA 3R8LA 2PULA 3LXLA 3PVUA 3EKNA 3GI3A 3R1YA 4RMZA 4XOZA 2VU3A 3FKNA 5HCZA 4ERWA 4Z7GA 1PMVA 3ZTXA 4BF2A 4CNHA 4IWOA 4FJVA 3V6SA 5IA5A 4EKLA 5BX0A 1ZAOA 3RK5A 3TZ9A 2VTPA 4AZVA 2OWBA 4E4LA 3ZM9A 4Q5HA 4ZS0A 5IA1A 4XH6A 3BE2A 3LVPA 4X2JA 2BDWA 3FLNC 3PXZA 5K0KA 2Y4PA 4EK5A 3Q9WA 5TR6A 4NJ3A 4PDOA 2BRBA 4OLIA 5DEWA 5AP6A 1PRYA 3FI2A 3BGPA 4IB5A 5EYDA 4AGCA 4BCQA 5IEYA 3NNUA 4Z55A 3C0IA 2WFYA 4MAOA 4O38A 3TDWA 4R1VA 2B9HA 5AP0A 2C0IA 4RJ3A 4YU2A 3E8DA 3BHUA 4XMOA 4CSVA 4F6UA 3QRTA 2GNLA 1OUKA 5EI8A 4AE9A 2BKKA 5M06A 1UNLA 5FBOA 4Y83A 3E7VA 3K3JA 4RVLA 3R8VA 5LJJA 2PUNA 3F3UA 3DK6A 4BCNA 1MRVA 3NYOA 3QTZA 3KRXA 5DE2A 5A3XA 3ZH8A 1JSVA 1J7IA 2FUMA 3N51A 3UODA 2VTRA 2J9MA 3ZDIA 4F0IA 5I3RA 1KE5A 4WG3A 3H9RA 2CNQA 4I6QA 3E62A 4U97A 3V3VA 2PVRA 3KC3A 4FG7A 4E6DA 5KCVA 4EH8A 3KXHA 1H1WA 2IN6A 5IUIA 5KE0A 2CN5A 4OTGA 3ZRMA 4DFXE 4RWLA 3VBYA 4L01A 2PWLA 3VHKA 4AW1A 2QNJA 5L2IA 5BQ0A 4DLIA 5M57A 3CQEA 5AIRA 4JXFA 2VN9A 4FMQA 4PNIA 5HU3A 3IDCA 2QD9A 4I6HA 4FODA 2X2KA 3FXWA 4GFMA 4O0YA 4F6WA 4OAUC 3UMXA 2CN8A 3DV3A 3FKLA 3QQJA 3F5UA 1GY3A 4HYSA 4IAKA 4M0YA 4PV0A 4ACDA 4FTOA 4GV1A 4WNKA 3QRUA 4YLLA 3R83A 1Q5KA 3VS3A 5FRIA 3EB0A 2W1IA 3EN5A 2F4JA 2JKQA 3EQCA 3I5ZA 3IS5A 4QOXA 4FSRA 4FKVA 4FKSA 4EKKA 1TQPA 3CTQA 2NPQA 4BIBA 3O51A 3OY3A 5GJGA 4ZOGA 5AA8A 4D2WA 2ZMDA 3WIGA 2HW6A 4FEWA 3UPZA 4ITJA 5BUJA 4WNMA 4GW8A 1XH6A 2ITTA 2YITA 1REKA 2VTMA 3F5GA 3FZTA 4M13A 4RLLA 5DRDA 3EWHA 3QKMA 3QUDA 4AA4A 2PVFA 2XCKA 4BR3A 3Q2MA 4DFYA 4F9AA 4HZSA 3RK9A 2XB7A 2OIDA 1PXKA 3QUEA 4FV2A 4BIDA 1KOAA 3DY7A 5HVKA 4I5MA 3QTXA 4V01A 3I6UA 2XYUA 3OZ6A 2HYYA 5IDPA 4IZ7A 4JAIA 5CNOA 5D11A 4OTIA 2R3JA 2UV2A 1VZOA 4CLJA 1T45A 2OJGA 1NA7A 3F88A 4ONAA 1OL5A 2IWIA 2X4FA 3F3ZA 4PTGA 5EYCA 4G6OA 2J90A 4IDVA 5KHWA 3DKCA 3HRBA 2RL5A 4U5JA 5CSVA 3L9PA 2W1EA 5J87A 3F3TA 4HPUE 5BYYA 4QMQA 3DPKA 5CU4A 3HUBA 5LMAA 1LPUA 5H2UA 4Q5EA 2JITA 4EOIA 3RVGA 5HIDA 2CHLA 4F78A 2NP8A 3KK9A 2XK9A 4QYFA 1PXLA 2XM8A 2WOUA 3DXQA 4LGHA 4X21A 3HMMA 4IVBA 4NW6A 4LRMA 4FZ6A 5AR4A 5J1WA 4TYHB 4GSBA 3I5NA 4E4MA 1Q41A 2G2FA 2RFNA 3CTJA 4PDYA 1U5RA 3DKGA 4H39A 5IDNA 4KBCA 2JDOA 3PUPA 3HA6A 1YVJA 2CMWA 4I20A 5E8WA 3C0GA 4F9CA 2XKEA 5E92A 3GFWA 4CLIA 1YI6A 3BHVA 3KULB 3VONA 5M4CA 2ZMCA 5TOZA 2XJ0A 3NNXA 4C38A 2IVUA 4O7YA 3VUIA 2E9PA 1OIQA 2I7QA 3L8VA 1YWRA 4YJPA 2EB2A 4C4HA 3EL7A 3VS2A 3LKMA 5AR5A 3RPOA 1PXNA 3EHAA 3ZRKA 4F6SA 1J3HA 2OXDA 2Y8OA 5CAUA 5BVOA 4HZRA 4AOTA 4YPDA 3BIZA 5EQYA 5DT0A 4E93A 5H8EA 2G1TA 3UVQA 5J9YA 3LCKA 4G17A 2WO6A 2W17A 4BGHA 2IZRA 3A4PA 3OWLA 2WQEA 4IAYA 3V5JA 3W2QA 5GIPE 4PF4A 3OXZA 4R5SA 2H34A 2YAAA 1R39A 4Y5QA 1VYWA 3IW7A 3U54A 3ORXA 4E20A 3R9DA 4BDCA 4U80A 5BYLA 2P0CA 4DLJA 3WE8A 3DKFA 4M8TA 5DMZA 3QCSA 1H27A 2QODA 2YLEA 3CKXA 3OW4A 4UBAA 3ZCLA 5K9IA 5B0XA 3LXPA 3ORNA 3FV8A 5GIOE 4O4BB 2C6TA 5HTBA 4IHPA 2XP2A 3O17A 4LMUA 4U43A 3FLQA 3KB7A 2ZYBA 3HMPA 2IPXA 4PL5A 3NYNA 2WAJA 2UW3A 2QHMA 4PTEA 3D9VA 4KSPA 3TJDA 4LFIA 5HTCA 4ZTQA 1R0PA 4FSMA 1DM2A 3CTHA 4O0UA 3RAWA 3QYZA 1JVPP 1OKVA 5KKRB 4QQJA 5DT3A 4ANSA 4S31A 3IW4A 4G34A 1QPJA 2PVYA 3PA4A 4ZZNA 4CFWA 4BBFA 5IH6A 1YDRE 2UW5A 3DT1A 1W84A 4ASXA 5HEZA 1QL6A 3NNVA 3OS3A 1F3MC 3KCFA 2QQ7A 2Z7QA 1JKSA 3VW6A 2C47A 1ZWSA 5M09A 3R01A 1ATPE 4MXXA 4DGOA 1WZYA 4BTJA 4V05A 4FK6A 4FZ7A 5CEQA 3NWWA 4JX7A 4GK2A 2EUFB 2PU8A 3LJ0A 4DH3A 4YC6A 2P4IA 4WUNA 3RTPA 5CU0A 1OPLA 4HPTE 3VJOA 2X0PA 1ZYCA 3SW4A 3EN4A 3M42A 4PPBA 5LVMA 4UX9A 4ID7A 2QR8A 5CVHA 4F0GA 3R04A 4F7JA 4O82A 4MD9E 2HZ4A 4FV5A 3ROYA 4JQ7A 3M11A 3MY5A 3CCNA 4PMMA 4WRGA 2UVXA 5F4NA 2Z02A 2WZJA 2Z7LA 4IBMA 3BHHA 5EM7A 3QBNA 5AP2A 5BUIA 4ASEA 3R6XA 5L8JA 2GCDA 4ZJVA 2Q83A 3R9NA 4NYEA 4FG9A 3C5UA 4EC8A 3DLZA 2OBJA 5F1ZA 4BDDA 4F09A 5HG8A 2X7GA 3BLQA 4BYJA 2FH9A 4UZHA 2B4SB 3U4WA 2CNVA 1NVQA 3PXRA 4WKQA 2PVJA 5DN3A 1V0BA 1P14A 4DBXA 3NUPA 3VRZA 4QQ5A 4H58A 1WMKA 4RWJA 1IAJA 4TWOA 5JRQA 4J99A 3P7AA 3G33A 3FPQA 4DG0E 4O7WA 2OZAA 3NDMA 3JY0A 5ICPA 4V0GB 3TTJA 3UZPA 3R2YA 4CZYB 1PXJA 2G01A 3PRFA 4K77A 5DG5A 5F94A 1A06A 4F64A 2WEIA 1STCE 1K3AA 3OBGA 4U79A 4GJ3A 4QMMA 2UUEA 3HRFA 4WBBB 3KXGA 5KUPA 3RMFA 2C6LA 4C4EA 3BL7A 2B7AA 5JN2A 1URWA 3FQSA 4RJ4A 5AIKA 5M53A 1TZDA 2EXCX 3MJ1A 4IM0A 3DBQA 5BVWA 3G0FA 3TIZA 3MB7A 3MFSA 5AV4A 5A46A 2GHLA 4N4SA 5D10A 1M52A 2OF2A 5DWRA 4MXZA 3D4QA 3EN7A 4EH4A 5CEOA 4BCMA 4XS2A 4PTCA 2HZ0A 5E8YA 5HQ0A 1U59A 1YRPA 3C4ZA 3EFLA 3Q4TA 4U42A 3NW7A 2WTIA 2YERA 3FLZA 3FZRA 3EQBA 3DA6A 3LFAA 3LQ5A 3QC9A 3VAPA 4IQ6A 1M14A 4FOCA 4M69A 4DTBA 4KUJA 2UZBA 1H26A 4HYIA 1Q61A 4MHAA 2YJSA 4Y5HA 3MBLA 2ETRA 2X9EA 2WMXA 3BRBA 3BU5A 1YKRA 5CI6A 2JBOA 4E73A 3SAYA 2BRMA 4PUZA 3BEAA 1HOWA 2AC5A 4TYIA 4IAAA 2A1AB 2YIYA 3H30A 3I6WA 3JPVA 2WHBA 3OWPA 4PQNA 4XBRA 2GU8A 2X0QA 5EYKA 1ST4A 4BI0A 4YJNA 1MP8A 2VWIA 2XNMA 4PY1A 5AV1A 4A4OA 5K4JA 4D5KA 4FZAB 2ITYA 3G6HA 2WMVA 4KIOA 5IQIA 2ITZA 2OH0E 2WIPA 1JBPE 2GSFA 2HIWA 4GRBA 4JIAA 4DDGA 5GJFA 5IPJA 3AC1A 1O9UA 3AG9A 3FL5A 3PJ3A 2CCHA 4M67A 1Q62A 2JIUA 4NK9A 2JKOA 5CS6A 4FKOA 3TNPC 4AFJA 3TZ7A 2JDVA 3FYJX 4FV4A 5LCKA 3V5QA 5LVOA 4M7IA 4MXYA 3E3BX 3UOKA 1SM2A 1SMHA 1VJYA 3R71A 4FIGA 2VWVA 2XM9A 4N6YA 5H9BA 3LZBA 2XBAA 4XP3A 3OVVA 2R3RA 3MI9A 4F1TA 1CSNA 2SRCA 4UY9A 3DZQA 3QZFA 4C2VA 3D5UA 5CVFA 5AUZA 2NYAA 1RJBA 4HNIA 5CNNA 2I1MA 4ZSEA 1XBCA 4FVRA 5FDXA 3KRLA 2OIQA 2O0UA 2VO3A 4IW0A 3WBLA 4ZLOA 1K2PA 2P55A 5KNJA 4EWQA 4EOQA 3WE4A 3NUYA 3CXWA 4OBQA 4JMQA 3A7IA 3DOGA 5E1EA 3U87A 3W2SA 2XCHA 2XKDA 2OLCA 3SD0A 3CJGA 1XH5A 4A7CA 2LAVA 1DI9A 4FF8A 3W2OA 4R7BA 1BMKA 4R3RA 2FA2A 1YXSA 3OROA 2WMUA 2XEYA 4D4YA 5AP1A 3KMWA 3LFQA 4S33A 3RAHA 4DGNA 1F0QA 4FKQA 5EQEA 3FJQE 4WIHA 3FL4A 3TIYA 4BBEA 2YAKA 4RFZA 4UWCA 4NM0A 2ITOA 4FT5A 5HLPA 4BI2A 4RX9A 2BR1A 2W1FA 2VTHA 4JR3A 4DGGA 2IF8A 5HBHA 3OWKA 3EFJA 4IZYA 4JLCA 4BCOA 5I5ZA 4YZ9A 3W0RA 2IO6A 3HV3A 3LQ8A 5TKDA 4R6VA 4YO6A 2O2UA 4FGBA 3WZUA 4EOLA 4WD5A 3V8WA 4O2PA 2ONLC 5LVPA 3TDVA 4ZP5A 2ITPA 4JDKA 3SW7A 1PHKA 3O0GA 4O7VA 4F70A 4PP9A 3HMIA 5LCJA 3OOMA 4EZ7A 4EYJA 2R3MA 4IIRA 2GFCA 2ONLA 2B54A 2YIWA 2I6LA 3EN9A 4XX9A 3ZO1A 3CY2A 4FV1A 4QTCA 3OEZA 4USDA 3UQCA 3EQRA 2ZAZA 2CKEA 3VS7A 5A14A 3UO6A 1GZOA 3U6HA 2X7OA 1BUHA 2GS7A 2I0VA 3NNWA 4I94A 4WOVA 4FI1A 3KF4A 4CKJA 1OBGA 1U54A 3A7JA 3KMUA 4FC0A 3VQUA 3W2CA 5M07A 2IVVA 4DFNA 1URCA 2BALA 2OO8X 4OAVB 4WNPA 2ACXA 3UYTA 1YWNA 3GU6A 3VS1A 4DYMA 2WMBA 2UW6A 1W98A 2BZHB 4UB7A 3CGFA 1FOTA 1ZLTA 2WIHA 3DZOA 4CFXA 5J7BA 3ATTA 5I9VA 3GC0A 2HXQA 3HUCA 4FZDB 4L42A 1FGKA 2YCFA 3COHA 3FHRA 3DBFA 2AYPA 4FRFA 4KRCA 3VBQA 5HLWA 2OFUA 2BIKB 2WTCA 3CQWA 4YJVA 5HO6A 3ZS5A 3R63A 1UKIA 2HENA 3ALNA