3D5WA

Crystal structure of a phosphorylated polo-like kinase 1 (plk1) catalytic domain in complex with adp.
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
287
structure length
284
Chain Sequence
KEIPDVLVDPRTMKRYMRGRFLGKGGFAKCYEITDMDTKEVFAGKVVPKSMLPHQKEKMSTEIAIHKSLDNPHVVGFHGFFEDDDFVYVVLEICRRRSLLELHKRRKAVTEPEARYFMRQTIQGVQYLHNNRVIHRDLKLGNLFLNDDMDVKIGDFGLATKIEFDGERKKLCGTPNYIAPEVLCKKGHSFEVDIWSLGCILYTLLVGKPPFETSCLKETYIRIKKNEYSVPRHINPVASALIRRMLHADPTLRPSVAELLTDEFFTSGYAPMRLPTSCLTVPPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Polo-like kinase 1
publication title Structures of the wild-type and activated catalytic domains of Brachydanio rerio Polo-like kinase 1 (Plk1): changes in the active-site conformation and interactions with ligands.
pubmed doi rcsb
source organism Danio rerio
molecule tags Transferase
total genus 77
structure length 284
sequence length 287
ec nomenclature ec 2.7.11.21: Polo kinase.
pdb deposition date 2008-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3d5wA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3d5wA01
4E5BA 5H8BA 4Y46A 2C6MA 3NUSA 3O17A 5HVJA 3VRZA 2XEZA 1YVJA 3BI6A 3KF4A 3LHJA 4F0GA 3UQFA 3CD8A 4TXCA 2VZ6A 4UMTA 5DA3A 5EM6A 4IAFA 1Q8ZA 3LAUA 4A4OA 4GS6A 3LJ0A 5HBHA 1PMUA 3MS9A 2JD5A 4EKKA 5IUHA 5E8YA 5IUIA 3MA6A 4KSPA 3U54A 4KKEA 4ONAA 4S33A 5M4CA 1ZZ2A 2GHMA 3LXKA 5FRIA 3DKFA 4G3DA 2LAVA 1PXIA 4RIXB 3Q60A 4EL9A 4E6CA 5DMZA 3ZM4A 5E91A 2BKZA 5CEKA 1IASA 3S1HA 2WPAA 3WF9A 2W4JA 3UMXA 1KWPA 3GCVA 3FI4A 4LOQA 2JBOA 3BYSA 1PF8A 4D5HA 4EH3A 3ATTA 4H3BA 3COHA 4AX8A 3S4QA 3ZONA 3VULA 1RJBA 4L7FA 2PUPA 4O21A 3E7OA 3U51A 5AUTA 4EKLA 2VNWA 4L43A 3NW6A 4FTOA 4XEYA 1AD5A 3LJ1A 4OAVB 3FPMA 2EU9A 5C03A 3VQUA 1VR2A 2BUJA 4FSMA 4HYUA 4DTBA 4BGHA 5IDNA 1KUTA 4PDPA 5F20A 1QL6A 3HA8A 4FTJA 2DWBA 2BTRA 3CY2A 4U81A 4DFZE 2GPHA 1NY3A 2WMRA 3Q5ZA 4IAAA 4DA5A 3MVMA 1SYKA 4AZVA 2YIRA 4L01A 3TKHA 5AAGA 4BRXA 4ZJVA 4J8MA 5T3QA 3VJOA 3FQEA 3DB6A 4IVAA 4JDKA 3PJ1A 4UZHA 3UYTA 3R71A 4HGSA 4FKGA 3PDTA 3BIZA 4ENYA 1LEWA 3OP5A 2Y8OA 2C6DA 4JOAA 4QD6A 1UU8A 2VN9A 3NDMA 4G3CA 1X8BA 3R7EA 3R8ZA 3FI8A 3RP9A 2BZKB 3VS4A 5CENA 3LCKA 3HKOA 3BEGA 4BBMA 3UIMA 1WZYA 5A6NA 2BRNA 5H3QA 5IU2A 3OOMA 2YN8A 4WUAA 2EXEA 3WARA 4F63A 1ZMVA 4FR4A 5I0BA 2XYUA 4YTFA 2XM9A 1XH6A 1H8FA 2JIIA 2VGPA 3QAME 3Q4ZA 4CZUA 2E2BA 2G15A 3MY0A 3P08A 4Y8DA 1CTPE 3C4CA 2XEYA 3PXYA 2IN6A 1GZNA 3Q04A 2QNJA 1OL7A 4YPDA 5EI2A 4MBIA 5G6VA 3ZLWA 4CFMA 2GS2A 3I81A 2WD1A 1WCCA 3QBNA 5J87A 3WYYA 4EH2A 4E8AA 4CYJA 3VUHA 2WAJA 3TXOA 2BRHA 3FZ1A 4IM3A 3FQSA 3KXZA 2W96B 4YJQA 5HG8A 2WMBA 3WIKA 5L4QA 5J1WA 4C4IA 4H39A 5LJJA 2FSTX 3AMYA 3R00A 2CKOA 5JGAA 3P1AA 4A07A 5CSWA 4F08A 1V0BA 2ZJWA 3OFMA 1IA9A 3SLSA 2DYLA 2YM5A 3DK6A 3AT2A 3KXNA 3OWJA 3QUEA 3R2BA 4FIHA 4JAIA 5EOLA 1V0PA 5AP4A 5AAFA 2Y4PA 3QTXA 4C59A 3R0TA 1H1RA 4M7IA 4ZTSA 2O0UA 5DT4A 5CANA 3OMVA 3RM7A 3FLWA 5K9IA 1WMKA 4I5MA 2ETRA 4EOSA 3E7VA 2BZJA 1F3MC 3N4UA 4HNFA 4BWPA 3G6GA 3PY0A 3LJ2A 1YXVA 3MV5A 1OKVA 2BRMA 4JI9A 2IVUA 4S34A 2C6OA 3E3PA 2XK4A 3PVBA 5DNRA 2PZPA 4NFNA 2QU6A 4AT3A 2V55A 1P2AA 2AC3A 4C58A 4DYMA 5CWZA 3MH1A 4G3FA 4MXZA 3RZFA 3BU5A 3W8LA 3TEIA 2BRBA 3BHHA 2PVRA 3GC7A 4YJOA 3EFKA 5GZAA 4QNYA 4C4EA 1R1WA 3UZTA 4JQEA 4AOTA 1O6YA 1OBGA 3R8UA 5C26A 2GQRA 1YDTE 2XNBA 4D4YA 2X7FA 2Z2WA 3EFLA 4IB5A 3W8QA 4I20A 1KE9A 3U9CA 4UMRA 4L53A 3FBVA 2QD9A 5CAVA 2I1MA 3GC8A 4BZOA 4U9AA 4J1RA 4JG7A 4DG3E 3TNWA 5FDPA 4FSWA 4D2PA 5AUYA 4NJDA 3LIJA 3EYGA 1PXOA 4N4SA 4ASZA 4O7SA 2C6LA 4FEVA 5FEDA 3ZCLA 4DEDA 5IA1A 3C5UA 4F6WA 4QP4A 3ZFXA 2ZM4A 4R5SA 4E4LA 2XKEA 2YCFA 3GFWA 3Q53A 4ZLYA 5HO8A 3MPAA 4BIEA 3MH0A 2QOQA 3ZHPC 3TZ7A 4S31A 2UUEA 3NUNA 3OW4A 3CKXA 2IVSA 5EQEA 3ZBFA 5IA0A 5AV1A 5AP7A 1H08A 4PMTA 2J4ZA 2P55A 5M56A 4CLJA 5TF9A 5J9LA 4TYIA 3FL4A 2ITVA 4XBUA 5EM8A 5EW8A 3UQGA 1KOBA 4FT3A 2GTNA 2YIQA 3BHVA 3D5UA 4I4EA 4A4XA 4ERKA 3QU0A 2BTSA 4FG8A 2XK9A 4R7IA 2QOHA 5K3YA 2NNWB 4EUUA 3NNWA 2WMAA 2IW9A 4AE9A 2OKRA 5AIKA 3G90X 4QQ5A 3QTUA 3M2WA 3MB7A 4TT7A 3RAIA 4FVRA 2QG5A 3IW6A 4OTRA 2WQOA 3CEKA 3WYXA 4GV1A 3C51A 1JSTA 2VWBA 3QHWA 2WQEA 3E87A 4I21A 4XV9A 5IEVA 3U6HA 2W4OA 1XH5A 3KRJA 4CMUA 4D9UA 5GJFA 3RTPA 2J90A 2ITYA 4ZZNA 4JQ8A 5ANOA 5BNJA 4O0RA 4ASXA 1GIIA 4CRLA 3ZLYA 1ZOEA 2IZRA 2OH0E 4GYGA 4O96A 3TIZA 4DBNA 4C37A 3NUUA 3EQRA 3SKCA 4U41A 4QMMA 4E93A 5KX8A 5LMAA 4PMMA 4HCVA 4ZSLA 5H8GA 3UP7A 5GIOE 3S3IA 4BB4A 5FXRA 2CNVA 1I09A 3R73A 1OIQA 3DJ6A 4U5JA 3MESA 4N57A 3L9PA 3IECA 3PP1A 2VV9A 5ANDA 4G2FA 4EI4A 4EOIA 4HYHA 3HMOA 3CD3A 3O7LB 4FNZA 3VBQA 3Q9YA 3REPA 4OTGA 4LMNA 5HE1A 3NGAA 3R04A 2DQ7X 1OZ1A 4BI1A 1FGIA 1MUOA 4NIFB 2ERKA 2AYPA 4R8QA 4A7CA 2ZDTA 5DHJA 5AR8A 4QP7A 2B9JA 5KKRC 2B52A 4APPA 3NYNA 3F7WA 5K0KA 3B8RA 1Q3DA 4F9CA 3BQRA 2VWUA 4FK6A 5HU9A 3ROYA 3ANQA 5FG8A 5FQDC 4YC6A 4GUBA 4IHPA 4FT0A 1E1XA 3F88A 4PUZA 1PXNA 3S0OA 3MIYA 1K2PA 3NNVA 2CN5A 2CMWA 2C3LA 1ZOGA 5DEYA 4HVIA 2VTMA 1K9AA 4HOKA 4F1OA 4FKUA 4IWDA 3F5XA 1IA8A 1ZLTA 3LCTA 3PSBA 4FIJA 5C01A 3RKBA 4GH2A 4MVFA 1ZAOA 3GENA 4AS0A 3K3IA 5BUJA 1XH8A 2ZV7A 3Q4CA 4D0XA 4NKAA 4QMZA 4O86A 4XRLA 4CTCA 3QRJA 3HV6A 2NO3A 2OJIA 3QD4A 1YXTA 4AOJA 4G16A 3B8QA 4CZYB 4I22A 4P2KA 4FTQA 3V3VA 1L8TA 2VU3A 3NIEA 1OL5A 2GNFA 2R2PA 2GMXA 2C1AA 2NPQA 1A48A 1CKIA 3BCEA 4JR7A 2XIXA 4U6RA 4I4FA 2W5HA 2X2LA 5HLNA 5JZJA 2YDJA 1U5QA 2W4KA 3FKLA 4E6QA 3KXMA 1R78A 5AV2A 1IG1A 2YWPA 3VS5A 3HV3A 3IOKA 2YISA 4XNEA 3V01A 4PDYA 3U55A 4FICA 4KA3A 3PP0A 2Z7QA 2RG5A 4IZYA 3V5JA 4BGQA 4ZAUA 4AT4A 4JBQA 5HTCA 4BDEA 2E9NA 3A7FA 2CGUA 4QNAA 1H26A 4AOIA 3W2PA 3EQIA 3NYXA 3BLHA 2UZLA 3BYUA 3RBWA 2YITA 3SXSA 3VNTA 5IA2A 3I7BA 5BYZA 4JJRA 2XRWA 1Z5MA 3AC8A 3F7ZA 3I7CA 3ACJA 4BWXA 3BRBA 2C5YA 4X6QC 5BVNA 4X6RA 4O7NA 3E64A 3P4KA 3FLQA 5AR2A 4O83A 3BBWA 2A27A 4C4GA 3QHRA 2GSFA 1WVWA 3KK9A 2CHLA 2V62A 3KY2A 3SHEA 2PMOX 3A7HA 3ORMA 4AZFA 2VO3A 3O23A 4JDJA 3ZO1A 3PA4A 4UB7A 5DPVA 4ZSGA 5T6KA 3ZMMA 5A6OA 1ZYSA 5FBOA 2PE1A 2WU6A 2A4LA 3GGFA 5CX9A 4UALA 4PDSA 1OPJA 3AC5A 1XHAA 2NRUA 3OXZA 2C68A 2W5AA 3P7BA 4ZS4A 3C0HA 1IAHA 1Y6BA 4PPAA 4CNHA 4ITIA 3OROA 2WMSA 4O0WA 3DY7A 2QONA 4IW0A 5CLPA 2OZAB 5A4EA 4JVGA 4R3PA 5GIPE 5ANGA 5AAEA 4BCOA 3GCPA 3VUKA 3C4EA 3MBLA 4H3PA 2CCHA 3OS3A 4PL5A 2XF0A 3LM5A 4IAKA 4J53A 5IQBA 2E9UA 2WQNA 4O0TA 3QD2B 1ZMWA 3BBTB 3DBDA 1UNGA 4FSTA 4MEDA 4TWNA 2HY0A 3KRXA 4F7LA 2W06A 3DAEA 3FZRA 4FVQA 4NFMA 1SVEA 4WUNA 1BL6A 4AZEA 4FK3A 3EQBA 2QKRA 3QLGA 1UNHA 2QR8A 4KBAA 5HVYA 3UYSA 3OUKA 5ACKA 3L8SA 4G1WA 3FSKA 3PWYA 4C35A 2F7ZE 3VUMA 4CD0A 5CEPA 4BY9E 5EYKA 4DEEA 3LXNA 4AW2A 4MQ1A 4NYEA 5F9EA 2WGJA 2F7EE 5E92A 4AXAA 3O8TA 4O2ZA 2Y6MA 3DOGA 5E9EA 5H8EA 1MRYA 3ZYAA 3UJGA 3DK3A 5DN3A 4CG8A 2C0OA 3VBXA 1FBNA 1SM2A 5ITAA 3CR0A 5I3OA 4PPBA 4TNDA 2BVAA 2O3PA 2GNGA 4LOOA 3AT3A 4QTBA 4AZTA 3KXHA 4FV8A 4YZ9A 3QTSA 4JDIA 4GYIA 2WO6A 3PJ8A 5FGKA 3NPCA 2C69A 4I41A 5LMBA 3GUBA 5ETFA 5EI6A 5DEWA 4DEHA 4GFOA 1CKPA 1R3CA 3UNJA 3FKNA 2FH9A 2XVDA 1XWSA 3UIUA 1F0QA 3MFSA 4RIYA 2OXYA 5BUEA 5HIEA 1JBPE 1Q3WA 5J79A 2YJRA 2WTCA 4F70A 2GQGA 1M14A 3F6XA 4K0YA 3QQKA 2PHKA 4UXQA 3VUIA 3TIYA 4CKJA 2O63A 4G5JA 3R28A 3FLYA 1GZKA 3DNDA 1RE8A 5HHWA 3AXWA 4LFIA 4R6VA 1V1KA 4BYJA 5ANJA 1R0EA 4UMQA 2PUUA 2Q0NA 5M06A 2VX1A 3RK9A 3FXWA 4ZLOA 5B2MA 2X39A 4YC3A 3LLTA 4L46A 3W2OA 3MGYA 1Q4LA 4PX6A 4X2JA 3MH3A 4XV3A 4NUSA 5EKOA 3ZSHA 3JY0A 5CY3A 1YI6A 4ID7A 5DBXA 3Q2JA 1ZYCA 4RFMA 4YURA 5I9YA 2V7AA 4CFVA 3NVKI 5E8XA 3R9OA 2XNPA 1OIRA 4I23A 2XIYA 3A8WA 3CBLA 3KU2A 4E7WA 3P9JA 3RCJA 2UW4A 1STCE 2JDVA 1BKXA 2FA2A 3E3BX 2WELA 4EYMA 3UMWA 3QC9A 5IMXA 1W0XC 1JSUA 3BKBA 3P5KA 4QYYA 2GNHA 3I0QA 3D94A 3RK7A 2ZMCA 3GEQA 2J0JA 4IMYA 4ZIMA 4QP1A 3DS6A 5AMNA 4QP3A 2PL0A 3VW6A 4WRGA 4BCNA 5ANIA 2G2FA 2R3RA 2OJGA 2R3GA 4PNKA 3DV3A 3ZLSA 3VHEA 4CFUA 5IQDA 3F69A 4MXOA 1O6LA 3NUYA 4MQ2A 2WIPA 4MD7E 4RJ6A 3DLZA 3QXOA 3DA6A 3OTVA 5I9XA 2JKOA 1OUYA 2V5QA 2VTNA 3JPVA 3NRMA 5JKGA 1HOWA 3LCDA 4RVKA 4U45A 5GZ9A 3S95A 5CXZA 4AW5A 4XBRA 1J1BA 3RPRA 4KNBA 4B4LA 3FHRA 5M08A 4H1MA 1H1PA 3V8SA 1CDKA 4IAYA 3T8OA 5JT2A 2ZV9A 2QQ7A 4YSMA 3FV8A 4BICA 4USFA 4BDDA 4EOKA 2QC6A 4DFBA 3W16A 3EL7A 4V05A 2XBJA 1RW8A 3SDJA 2UVZA 3RK5A 1P4OA 4FKSA 3Q9XA 3L9NA 2OI4X 2VAGA 3EJ1A 3FQHA 3O96A 1PXLA 4FSZA 4M97A 3HP2A 4XG6A 5DFPA 4IFGA 5HLPA 4GFGA 3PJCA 4OTHA 5FLFA 3RPOA 3AMAA 3VIDA 3HYHA 2C0IA 4BBFA 2R3LA 4DC2A 4OR5A 4KRDA 2YM6A 2W1GA 1Q5KA 3C50A 2X4ZA 4NK9A 5HZNA 1VYZA 3OY1A 3BYMA 4BDBA 5C8KA 3SXRA 4QMYA 5FTQA 2QCSA 4DLJA 4EH9A 5AR5A 4D2WA 2X7GA 5HCYA 4RWKA 4RIXA 1MQBA 2X8IA 4MNEA 3VN9A 4LG4A 2A0CX 1S9JA 2EB2A 4IIRA 3CPBA 3VS2A 3KREA 3LFNA 5IQHA 4CTBA 4NTTA 4J98A 4FV6A 2WZJA 2PY3A 3BE2A 5D1JA 1BL7A 2ITZA 2UW6A 3RM6A 3R1QA 4MAOA 4CT1A 5AWMA 4YO6A 4DT9A 1WVXA 4JBVA 1NVRA 5FDXA 3HRBA 3CS9A 4HPUE 3CXWA 2HXLA 3Q6WA 4IZ5A 4RJ3A 5AM7A 4CFNA 3PIXA 5JMSA 3PSCA 4UEUA 5JFXA 2G1TA 4FEQA 3QZFA 3R7GA 2HZNA 2CGXA 2VTHA 3RALA 5JK3A 4JG6A 4FODA 1TKIA 4PQNA 1XR1A 5AV3A 4EHEA 3W2RA 4RT7A 4L3JA 2PULA 5AM6A 4H3QA 1M2QA 4O0UA 4I0SA 4IEBA 4RA4A 1Q24A 4ZSEA 3VBTA 3E8CA 5AUUA 4F9AA 3VVHA 3AD6A 1AQ1A 5BPYA 5EM7A 5HG5A 5M4FA 4QYFA 4FT7A 4QPSA 5BVFA 4EK4A 2RFEA 2IWIA 3W2CA 4KKHA 5IH4A 1UA2A 1NVQA 4FTKA 4HGLA 5CQWA 4JR3A 4WNOA 2BAJA 3SQQA 2WTKC 3TNPC 2QR7A 3QGYA 4M12A 5DLSA 4YBKA 4ITJA 4MXYA 3CC6A 4KRCA 4GRBA 5HNIX 3ETAA 2XM8A 3COMA 4DFLA 1OPKA 4DEGA 2H8HA 1PXPA 3VS7A 5E8WA 3DXPA 3HUCA 3NUPA 3IS5A 3A7JA 4IC8A 4QP2A 3TKUA 4UMUA 1REKA 2H96A 1ATPE 5EI8A 4ZEGA 5HTBA 4FYNA 2IZSA 3DK7A 3DDPA 3FLSA 1GIHA 3R8MA 4FNXA 4X0MA 4V04A 2OF4A 3MA3A 2IW6A 4IDTA 3V6SA 3PY3A 3U8WA 4BDAA 3HAMA 1K3AA 2I0YA 3HV5A 4QT1A 4DLIA 3NLBA 3FZOA 4FG7A 4FSUA 2WFYA 3R9HA 3NIZA 4CXAA 4RQVA 4IADA 3QCSA 1H27A 4LM5A 4U42A 2EUFB 4HJOA 4RRVA 4JL9A 4W8DA 5CZHA 2XK6A 4JDHA 3A62A 2JIVA 1OL1A 3CPCA 3D7TB 3KVWA 3KULB 4MH7A 1DM2A 4G34A 4A9UA 3T9IA 3FI3A 2BDJA 2XJ2A 1XH4A 1XH9A 4O22A 5CVFA 3HV4A 5M53A 4FKQA 5JFWA 3NCZA 3LFDA 5HU3A 2ZOQA 3H9RA 1ZYDA 4Z9LA 1T45A 4BCPA 3L9MA 4C38A 3EFWA 4MWHA 4R3RA 2KTYA 5HD7A 1FMOE 1TQPA 3CJGA 2ZV8A 4BC6A 3KRWA 4J99A 4IM2A 4MNEB 3PXFA 4RJ5A 5CT7A 4BCHA 3UNKA 4PV0A 4M84A 2YAKA 2XNEA 3FSFA 4JNWA 3E93A 4FYOA 2VTRA 3EOCA 1URCA 3OBGA 2VO0A 1QPDA 3TV7A 4F9WA 3MPTA 3QA0A 2WTVA 4DH8A 2JAMA 1H00A 2J0KA 3QWKA 3MPMA 4CV9A 4D4RA 5FWKK 4ORKA 3LMIA 3DFAA 3R22A 4IJ9A 2VO7A 4ZTHA 5CU6A 3RVGA 3DQWA 3O8UA 4Y95A 3QD0A 2WMQA 3OBJA 5D9HA 1JKSA 1F5QA 1YDRE 1Z9XA 2PTKA 2CNQA 3QALE 4O0SA 4S2ZA 4C3PA 2BALA 2R64A 4A4LA 4BCQA 1J7UA 2VWVA 3U87A 3ORPA 4PMPA 2OLCA 2HZ0A 4MXXA 2VTJA 3VAPA 1YOLA 3HX4A 4C34A 1Y57A 4RIOA 4IX5A 4ERWA 4M68A 3QTIA 2CN8A 4D5KA 2I0EA 4R5YA 4DFUA 4XP2A 4ANNA 2C30A 1WAKA 3QCQA 1VJYA 3OW3A 4IZ7A 4WO5A 3R6XA 5HE2A 2B9FA 5AEPA 5CI6A 4CFXA 3DLSA 2H34A 3K54A 5EYDA 3FY2A 1SZMA 1ZYJA 2QO2A 5A3XA 4D55A 2G01A 5CSVA 4MX9A 5BQ0A 1BI7A 3W55A 2G2HA 2R3MA 2BIKB 1PMNA 4FV3A 4NZWB 4CVAA 4O7YA 4FVPA 1JQHA 2JKKA 4A9SA 2BHHA 1J91A 2ITNA 1FMKA 3E63A 4JLCA 1P14A 4EWHA 5HQ0A 1NT2A 4WIHA 2VO6A 3B2TA 4NWMA 1UWHA 3VBVA 5E8VA 2C6IA 3UPZA 1WBSA 1ZYLA 3R83A 2QODA 3UE4A 1YW2A 2UZUE 2OF2A 1YWNA 3E8DA 5JRSA 3GQIA 3SW7A 5IQFA 1JOWB 4LL0A 1XQZA 2OIBA 2WOUA 2Y0AA 3AGMA 2EWAA 4DFXE 5CF5A 4RC4A 3LQ3A 5TKDA 3NNXA 4U44A 3RZBA 4DGGA 3OEZA 2J2IB 4R1VA 5C1QB 1DAWA 1YOMA 3F61A 2UZVA 1YDSE 2OWBA 2YM3A 3MY5A 3VF8A 3ULZA 5HICA 3V5QA 3OT3A 4L67A 4XG3A 5H2UA 4FGRA 5EDQA 4QYGA 4F09A 2BFXA 1XJDA 4W9XA 2YABA 1T46A 1XBBA 3ALOA 4KAOA 3RWPA 1H07A 4CV8A 3QLFA 3R9RA 3BHYA 3C4XA 2J6MA 3BEAA 2BHEA 4ZY6A 4N6ZA 3F5UA 5K0XA 2FYSA 3DB8A 4FV7A 3IPHA 3TDWA 3FXXA 3RGFA 4YMJA 4LGDA 4IAIA 5T68A 2HWOA 2R3IA 2VTOA 4FOCA 3FY0A 4GK2A 4AGDA 1WBTA 5CAQA 2R3OA 5B2KA 3GB2A 2UZDA 5KMOA 4XV1A 2QURA 3H4JA 4NIFA 4DITA 4II5A 4F6SA 4AW0A 3RMFA 1REJA 2HELA 3D5XA 4P5QA 3UIBA 3ALNA 1NVSA 3ZS5A 4EUTA 3D0EA 3Q52A 3PZHA 3QC4A 4GG5A 5I9UA 4B9DA 3AT4A 4F9BA 4CEGA 4YLJA 2CSNA 4BIBA 4O81A 5EFQA 2RGPA 2XNOA 4IXPA 1CKJA 1YOJA 3BU6A 4MBLA 5CAUA 4YZDA 2W7XA 4IAZA 5L2QA 3KCFA 5AA8A 4L42A 4FV9A 5IH5A 3OWLA 4Y83A 2Z02A 1R39A 3DAJA 1MRUA 4EOJA 4H36A 5CU4A 2E9OA 1IR3A 1SMHA 1OBDA 3BX5A 3P78A 3QUDA 2UZTA 5DWRA 4O7WA 4FTUA 4RPVA 2W1EA 4QTCA 4J97A 3HMNA 3F3VA 3ZUUA 4X21A 2Y4IB 5B0XA 4QMVA 1JPAA 3C7QA 2AUHA 4QMTA 2VTSA 3ITZA 4FI1A 4TWCA 2YZLA 4WG5A 5D7VA 3VHKA 3NVMB 4DGNA 4W4VA 3PLAE 3KMMA 4XG9A 3ULIA 4MWIA 3V04A 3ZZEA 3I0OA 4YJUA 3LQ8A 1QPCA 2CCIA 5AR7A 3BWJA 5FEQA 4XCUA 3R8VA 2X0GA 2E9VA 2F2CB 4YTCA 2EXCX 3D15A 3MN3A 4GW8A 1OIUA 4GU9A 5K5XA 3S2PA 5L6PA 1OIYA 4HGTA 2BKKA 1YWVA 2BZHB 2OIDA 3KRLA 4Y72A 2Z7SA 4Y5HA 4BHNA 5BVOA 4NSTA 4RVTA 2F2UA 4G6NA 4XS2A 1L3RE 2LGCA 3FE3A 2FUMA 3W2QA 4CFFA 2ITXA 4BDGA 1YRPA 3EYHA 4GSBA 5IMEA 1PW2A 1IRKA 2QLUA 4MXCA 4AE6A 4P90A 1ZARA 4KD1A 3I5ZA 4J52A 2WU7A 4BCKA 1UU7A 2ZVAA 4AP7A 1GY3A 4NCTA 2IO6A 4FZ7A 2J0LA 3VO3A 4XP0A 2PVKA 2CNUA 3EKNA 3DTWA 3DBFA 4I6FA 3DQXA 3CIKA 5BVDA 2H9VA 2ESMA 3BHUA 4MF1A 5FD2A 4IC7A 3RNIA 2VUWA 2X9EA 4JX7A 5AR3A 3TUCA 3E5AA 3QTZA 4E5AX 4RJ4A 2W17A 2R3JA 3Q6UA 3EQGA 3R1SA 4K33A 5EH0A 2HZIA 3RPYA 4DH7A 4CLIA 4XP3A 4MD8E 4EK5A 1M2PA 2FSOX 4M66A 3ATSA 2YM4A 3IGOA 2IG7A 4YPSA 3EQPA 3OD6X 2WMWA 3P7CA 4F1MA 4GKIA 1CSNA 4D1XA 4PTEA 4I3ZA 3UOLA 5J7HA 2RIOA 3GI3A 4QMNA 4DBXA 5BVKA 5F95A 3R01A 4K8AA 3HMIA 5J5SA 4O7LA 3MFTA 4AFJA 3R2YA 4RLLA 1H1SA 5KMNA 4S30A 3RAKA 2BMCA 3PZEA 2PVFA 3MVJA 4WRSA 3GU4A 3SG8A 3SOCA 5IQIA 1JNKA 4CFWA 1OKZA 4HNIA 4I0RA 2XIKA 3GC0A 2ERZE 3QZHA 3ZRLA 1UVRA 2OFVA 2WOTA 2HAKA 2OZAA 2H6DA 1WBWA 2W1HA 3C9WA 5EHLA 2XNNA 4FTLA 4QPMA 4XHKB 4LRKA 5KE0A 3ORNA 1GNGA 1UU3A 3HRCA 4QP6A 4AA0A 4FT5A 4D2RA 4QRCA 3F2NA 4BBEA 1BX6A 5E8UA 3A2CA 3CQWA 3IDPA 1PXMA 3R9NA 2ONLA 2GS7A 4XRJA 4M69B 4FEXA 1HCLA 4HZSA 3ZO3A 4QOXA 5IF1A 2Q83A 3VWAA 3WF8A 3RCDA 3QQFA 4L00A 2EXMA 1PXKA 1YI3A 3FDNA 4GK4A 4IB1A 4RLKA 3DNEA 2J0IA 3C4FA 2XMYA 5BUIA 2JDRA 4H1JA 5J8IA 4PP7A 3KVXA 4A06A 3PRFA 3SRVA 1YHWA 4ANMA 5E1SA 3FMNA 4J95A 5EK7A 4I94A 2O2UA 2UZWE 1GOLA 1ZXEA 3POOA 1Q8TA 3LFEA 3VJNA 3F3TA 1XBAA 2YM8A 1TQMA 2PZIA 1B6CB 2JDSA 2R7IA 3ZDUA 3VS6A 3CP9A 3CQEA 3WZUA 4BDHA 4DT8A 4BDKA 3PIYA 4GVAA 3UVQA 3NWWA 3KCKA 2R3PA 3OOGA 3F3UA 4LGHA 3JVRA 3F82A 2IJMA 3KMUA 4ZP5A 5IPJA 4YZMA 3IW5A 4CG9A 4BI2A 3CGFA 3M11A 1ZY4A 3PE1A 4NCTC 3W32A 4EK8A 2UVXA 5IH6A 5IUGA 4O6EA 3ZTXA 4NT4A 4BGGA 4PP9A 4DFYA 2HY81 5HCXA 3KQ7A 3LFFA 4H05A 3FPQA 1G5SA 2E9PA 4E26A 3PRIA 4E4MA 4AGWA 5H9BA 3CE3A 4CSVA 3VUTA 3CTQA 2R5TA 4K2RA 4C61A 3UOJA 2HCKA 2ZMDA 4FIEA 4FKLA 1I44A 3PLSA 3CQUA 5HBEA 3ACKA 3PE2A 1QCFA 4EH4A 3KXGA 4KS7A 5DG5A 4CYIA 4UY9A 3UC3A 4M0ZA 4NEUA 4JBOA 5AP3A 4BZDA 4C0TA 3U6JA 2HZ4A 1BYGA 1ZZLA 3JR1A 5HG7A 5J95A 3UOHA 4ZSJA 4WSQA 3TT0A 2YFXA 3QD3A 1JKLA 5J9ZA 5IQCA 1B39A 5EW9A 5C9CA 4D1SA 5KMJA 4O84A 2BZIB 1W98A 4WG4A 5LARA 4BCGA 3CTJA 3MFRA 4C62A 3GC9A 4ZSAA 2GFCA 4HZRA 4MYGA 4IX6A 3COKA 5I4NA 4FGBA 4M15A 1A06A 3FL5A 5AP6A 5HE3A 4ZK5A 5IA4A 3GCUA 5IG1A 4F7NA 4IB3A 4FMQA 5D11A 4GUEA 4UV0A 3QRIA 3Q9WA 1E1VA 4EOMA 5M51A 2OG8A 2C6KA 2UW7A 3D83A 4GK3A 3UBDA 5BVEA 3JVSA 4RC3A 2GNIA 2PE2A 4LYNA 5E8SA 5DR9A 2CPKE 4FA2A 4WG3A 3KGAA 5IA3A 2WMUA 4K77A 4AF3A 4NM5A 5HTIA 5CF8A 2JITA 5E8ZA 2ITPA 3E8EA 1LR4A 4O0VA 3EN5A 2GTMA 3PPZA 4LUEA 4USDA 4ANLA 2YWVA 5DGZA 3SGCA 2PZYA 4FX3A 2O64A 3H0YA 1VZOA 1H25A 4KWPA 4QP9A 2ONLC 5CU3A 4AGCA 2B54A 2X2MA 4WD5A 2IVVA 4RX5A 3KXXA 4EK3A 5EDPA 3I79A 2Z8CA 3U4UA 3WOWA 3LOKA 3D4QA 3ZBXA 1P5EA 5L3AA 4W8EA 4QYHA 4FTMA 2WQMA 3ORTA 4X2FA 3SX9A 3F9NA 2OJFE 4HCTA 3T3VA 4EJ7A 4GT3A 3SRVB 3D14A 4UMPA 2YCQA 1WBVA 4HVGA 4FEUA 4P4CA 4FSNA 3BV2A 4U40A 4YTHA 1SVHA 2WMTA 3AC4A 3PJ3A 2UW0A 4EJNA 4O27B 4QO9A 4IFCA 2WTIA 3Q32A 2F9GA 3QX2A 5I9ZA 4D0WA 3TDVA 3MFUA 2OJ9A 5KMMA 1IEPA 4YJNA 3EH9A 5AV4A 3DT1A 4L52A 2QOKA 3TZMA 2ITUA 1G8SA 4I93A 3A99A 2P3GX 2GQSA 5HOAA 4TL0A 3VC4A 2QHMA 4V01A 2YZAA 3EFJA 3EN4A 4DTAA 4XMOA 3BV3A 4UBAA 3ID6C 3O71A 3ORKA 4AN2A 3KN5A 1PRYA 2R4BA 3GT8A 1MP8A 2V22A 4P7EA 2R3HA 2FVDA 2J5EA 3UQCA 4IQ6A 4OTPA 3WIGA 1ZOHA 1GIJA 2XCHA 3P79A 2OJJA 2C4GA 3BGZA 2HW7A 2ITQA 2XH5A 3RHXA 3TTIA 2UZBA 3BGPA 1RDQE 4K11A 4XX9A 1BUHA 3QTQA 5CASA 4KUJA 2BPMA 5CAPA 3ZSGA 4KBCA 2YIXA 3GCSA 4I0TA 3QRUA 5EHYA 2O65A 1ERKA 1TVOA 1M52A 4IB0A 3FWQA 4BCFA 3W2SA 3VBWA 2I6LA 4BTJA 3R02A 4DTKA 5CSPA 3LFCA 4YO4A 2PSQA 1V0OA 1PY5A 5FTGA 4LV5A 4CT2A 5I5ZA 3ORLA 3FMHA 4MXAA 2YLEA 4BR3A 4XOYA 3BGQA 4M3QA 4X3JA 3AC1A 3ZOSA 1KSWA 1OKWA 4LV8A 2VWXA 3QQHA 4L8MA 2R3NA 3DBQA 3WI6A 2XIRA 3LXLA 4Y5QA 4OGRA 3CCNA 3UODA 5LVOA 4YLKA 4JQ7A 5DT3A 3I6UA 3E92A 4OT6A 2XA4A 4M0YA 2HK5A 3P0MA 4RWLA 4FL2A 1WBPA 5CS6A 5J9YA 3ZEWA 3FI2A 4LQMA 4BKZA 2B7AA 2X7OA 3ZM9A 2W9ZB 2VTTA 3R7VA 1APME 3ZDIA 2JDTA 5HEZA 4FUYA 5M55A 4FV0A 5AA9A 5CSHA 2WHBA 5FP5A 4FC0A 2WEIA 4PMSA 5CNOA 3UO5A 5C27A 4D1ZA 5FUTA 4LOPA 2JAVA 3W10A 4USEA 2YCRA 4IBMA 5TOZA 4AQCA 3DAKA 5LVMA 4X3FA 1DI9A 3R1YA 3GP0A 3HDMA 5HLWA 1OB3A 3PYYA 2HW6A 1FPUA 3FMDA 1AGWA 2IZUA 4LUDA 5E90A 5JH6A 1OKYA 2P33A 4FKVA 3R7YA 2XB7A 3IO7A 4YLLA 5IEYA 3ODYX 4FSRA 3PIZA 4FV1A 3G5DA 2PVJA 3ENMA 1UWJA 3ZLXA 3D7TA 3KRRA 3EHAA 3KULA 4FZDB 4F9YA 3R9DA 3D7ZA 2QKWB 3IGGA 5JQ8A 4KIKB 1UNLA 5M07A 1YWRA 4B6LA 4AAAA 3HMMA 1U46A 3FMKA 4MNFA 4D4SA 3LPBA 3MTLA 5CXHA 4DGOA 2VTQA 4DGMA 5DE2A 4XYFA 1J7LA 5C8MA 4F0FA 4RGJA 2J9MA 2RL5A 3NAXA 4W9WA 3IK3A 4DHFA 3I5NA 4BF2A 3TCPA 2C47A 4GG7A 4W4XA 4FTTA 3HVCA 3DKOA 2OICA 2QO7A 3CY3A 5FBNC 4FF8A 2ZB0A 1SNUA 4CMTA 4BCIA 3N4TA 1KV1A 2GU8A 3EQFA 2XKDA 4O0YA 4LI5A 3LE6A 4D2SA 5HVKA 2PVYA 4O6LA 4UXLA 4TPTA 5CT0A 4C7TA 4QMPA 4WBOA 1PYEA 5LVLA 3KB7A 4BWKA 4F65A 4EBWA 2BR1A 5FM3A 3Q4UA 3SG9A 4MTAA 4I6HA 4IX4A 3PTGA 4YJSA 2ACXA 4UYAA 2UW8A 4FNWA 4CCUA 4X7QA 4ALVA 3U9NA 4FKJA 4LMUA 1WBNA 4EOOA 3Q2MA 1S9IA 4E5WA 2C3KA 5IDPA 4QP8A 3OCTA 4G6OA 4NTSA 4AACA 5KCVA 5F4NA 1FVVA 2JLDA 4EOPA 2DS1A 5JZNA 5JQ5A 2ETMA 3EZRA 3LQ5A 1VYWA 3QA8A 4ANQA 3DPKA 5ACBC 5HIBA 3JXWA 3MDYA 4ACMA 5LMKA 3R21A 3MJ2A 3PJ2A 2X9FA 4RSSA 2WMXA 3F2AA 2PZRA 3EL8A 5HO7A 3R8LA 4BKJA 2YDIA 1YQJA 3CJFA 4FOBA 1U54B 3DJ7A 3ORIA 3ORZA 2PMLX 4BN1A 3MVHA 3EMGA 4BTMA 4YU2A 3G0FA 3FEGA 4CKRA 5KMIA 4ARKA 2XK3A 4ACGA 3CKWA 1GZ8A 4RC2A 1U5RA 1G8AA 4I24A 4U80A 1DAYA 2OIQA 5DR6A 5EQYA 3HMPA 2BDFA 3OT8A 4DE4A 3FMLA 2W1FA 3QQLA 4MD9E 3ZXTA 4AG8A 3CLYA 3FAAA 4MCVA 5K4JA 5L2TA 2YIYA 2F4JA 4OTFA 3QTRA 1OL2A 3K5UA 5A54A 1Q8WA 3C4WA 2QU5A 1UKIA 2QOBA 1LEZA 2Z7RA 1W84A 2WQBA 3GXLA 3H9OA 4HYSA 5DH3A 4ZTRA 4X3FC 4GT5A 3W1FA 3TUDA 5DOSA 3DXNA 4X2NA 3P7AA 4BDFA 2WTWA 4WHZA 4X3FB 2W9FB 3WZDA 4TYHB 3ZH8A 4BZNA 3HP5A 2VRXA 3BYVA 3QYZA 3HL7A 4ALWA 4DFNA 1JVPP 3OVVA 4NH1A 4TKSA 4G17A 3KN6A 4QTAA 2WIHA 3V5WA 2O8YA 4AW1A 4XG7A 5KUPA 3B2WA 3T3UA 4C57A 5M44A 3SD0A 3BELA 3E88A 2VTAA 2F57A 3DU8A 2YA9A 5E8TA 3P23A 3FC1X 3A8XA 1G3NA 4DEAA 3S00A 4O82A 4JT3A 3HNGA 1OPLA 3HEGA 4D58A 4IX3A 3PVUA 5L8LA 2JFLA 3LVPA 2XZSA 3NX8A 3QKKA 3HGKA 4ZLZA 2C6TA 4HGEA 4GFMA 5ANKA 3F3ZA 3DBEA 3H3CA 3QKLA 4JXFA 3UVRA 5D41A 1CM8A 3PSDA 3PVGA 2OW3A 2IVTA 3FZSA 2XRUA 3BLRA 4ZJJA 4K18A 4RMZA 2ZB1A 2OH4A 4FKTA 1M17A 2BROA 2J51A 3OXTA 5LWMA 3MSSA 3BU3A 2YERA 4FE2A 4W4YA 2Y7JA 3MW1A 3GFEA 3R30A 2ITWA 4RZWA 5TO8A 3SC1A 2I0HA 3W33A 3OHTA 4QQTA 4EZ7A 3BLQA 2JKMA 3GU8A 4FUXA 2HXQA 1Z57A 2EB3A 4MHAA 4FTCA 1H1WA 4G9RA 4PDOA 1PMEA 2IZTA 4RZVA 4CKIA 3A7IA 3UDBA 3ZRKA 4UWCA 3UVPA 4EZ5A 1ZY5A 4IVDA 4YTIA 5ICPA 3R7OA 5CSXA 5LMKC 1BLXA 1XH7A 3EN7A 4E73A 4IZAA 4IE9A 4RA5A 1Y91A 2X1NA 3V8WA 3MH2A 4LRJA 2WXVA 2KULA 5L6WL 4ZJIA 5L2SA 3L8XA 2XNGA 2QLQA 4JRVA 1ZWSA 3GU7A 2RFDA 5HIDA 5KBRA 1J1CA 2XBAA 4W4WA 4FIFA 3EQCA 5GJGA 4ZZOA 4R3CA 4Y73A 4ZMFA 2JGZA 4PF4A 4AZWA 1Y6AA 1FVRA 2UZOA 3NUAA 3FJQE 2YHVA 4NW6A 4Z7GA 2W1CA 3D2KA 4ACHA 4HVDA 4PWNA 3FLNC 4RWJA 3ZFYA 1Q97A 3DJ5A 4EBVA 3K2LA 4DCEA 4EK6A 4TY1A 3AOXA 2VX3A 2Y6OA 2G2IA 4XLVA 2OBJA 2JEDA 5J7BA 3D5VA 2OSCA 4HCUA 5AX3A 2B0QA 3C1XA 4YJVA 4FTIA 4L3LA 4JRNA 4RX9A 1UU9A 3D9VA 3OEFX 4JBPA 2C5XA 4O1PA 5AUXA 5CI7A 2ETKA 3ZUTA 3SOAA 4RVLA 2HENA 5M57A 4E4XA 3HLLA 5GNKA 3FLZA 4D28A 3EIDA 3G0EA 4JIAA 3F2RA 1PKDA 1QPJA 5AR4A 2R0UA 3QYWA 4EOQA 4F0IA 4DGLC 4F99A 3FUPA 4GIIA 3ZSIA 5DIAA 4Z16A 2HOGA 4EYJA 2PWLA 1NW1A 4O7VA 4ENXA 4RQKA 5L8JA 3F66A 3ODZX 4E6DA 2XYNA 2C5VA 2YM7A 3QCYA 4GU6A 3WILA 3CSVA 3GCQA 4FZFB 4OTWA 3QKMA 3LMGA 1ZRZA 2GHLA 1CMKE 1PYXA 3BE9A 4APCA 3ERKA 1OL6A 2OGVA 3NAYA 4BHZA 5DYJA 5CAOA 2YACA 3EKKA 3BHTA 3G15A 2XJ1A 3TI1A 3I4BA 1JKTA 4JAJA 2CGVA 2X8EA 4YNOA 4ZTMA 2YDKA 2PE0A 2R3KA 4X2GA 4S32A 2NP8A 3C4ZA 4RG0A 3TNIA 2OXDA 4BKYA 5HCZA 4M14A 4C3FA 4OBOA 4DCAA 3LW0A 4BTKA 2OU7A 3AMBA 3LFAA 4OBPA 4XOZA 4I5HA 5CTPA 2Z60A 2XK8A 2C0TA 3R7UA 3ZFMA 3RAHA 4QMWA 3TACA 5LWNA 4BIDA 1JWHA 3K5VA 3VUDA 1XKKA 1HCKA 1H4LA 1ZMUA 4L6QA 4Q5HA 1QMZA 4Q9ZA 3GOPA 4YBJA 4J96A 1WFCA 4Z3VA 2Y9QA 4I6BA 3TUBA 2CKPA 3OCGA 2HIWA 4HW7A 3DZOA 4XH6A 3WF6A 2CJMA 2RG6A 4EQCA 4KSQA 3H0ZA 1ND4A 3VBYA 4Q5EA 3OWPA 5KMKA 1Q8YA 1WBOA 3IW4A 3MYGA 2NRYA 4R1YA 2Y4IC 3PXZA 4IJPA 4TWOA 1LP4A 4M69A 3HDNA 4K9YA 3R1NA 5E1EA 4G3GA 4FZAB 1H28A 2XUUA 4JIKA 5HNGA 5M4UA 4O0XA 4QPAA 3OG7A 3H30A 1Q41A 3DXQA 4OTQA 3L8PA 5D7AA 5A9UA 2JC6A 2ZV2A 2GHGA 3G2FA 5L6OA 2AC5A 1H0VA 3ET7A 3A60A 2B9IA 4TZRA 3RPSA 3DKCA 3JUHA 1YHSA 4KS8A 4JG8A 3JY9A 3V51A 2Z7LA 3I1AA 4CQGA 4OAUC 2YIWA 1KE5A 3JYAA 3TNHA 1JAMA 3UZPA 3QRKA 3RI1A 4FTNA 2J7TA 3N51A 4N0SA 5A4TA 4K1BA 2GCDA 2UZEA 2WMVA 2CLQA 4IACA 4GIHA 4GMYA 2W1ZA 1MQ4A 4ANSA 2UW9A 1TQIA 2WTJA 1YXXA 3N9XA 4WNKA 5LXMA 1RQQA 3RNYA 3O7LD 4ZOGA 4PY1A 4DG2E 4KINA 2X8DA 4ZTLA 3QF9A 2ZYBA 1U59A 4BTFA 3CTHA 4C36A 5TE0A 5LVPA 4YHJA 3QQUA 3MY1A 3IOPA 5LVNA 3FKOA 4MBJA 5KHWA 3CGOA 1YKRA 3DDQA 2ZM1A 3LM0A 4FL3A 2O5KA 3BZ3A 4YHFA 5ETIA 5LQFA 2BAQA 4C2VA 1KE8A 4O7RA 3N4VA 4QMSA 3F5PA 3KK8A 5FEEA 2BRGA 1Q62A 4ACCA 5BYYA 4O7ZA 5E4HA 5AFVA 1YHVA 4QMLA 3IW8A 3R63A 5HKMA 3ZUVA 1E9HA 5C4KA 4YHTA 4DEIA 3FMJA 5JGDA 5GINE 5AADA 5DVRA 4GCJA 3C0GA 4GJ3A 2PUIA 3UTOA 3POZA 5I3RA 5GZ8A 4TYEA 4KKGA 3ZO2A 4YP8A 1PXJA 4EORA 4KB8A 3SA0A 4U43A 1H1QA 3UO6A 2FGIA 1SVGA 3PWDA 5GJDA 4WSYA 3TV6A 3ZC6A 4RVMA 4ZTNA 1Y8GA 3FYKX 3LFSA 3NYOA 3PPKA 2I0VA 1OITA 3UP2A 2F49A 4N6YA 3HECA 2VWWA 2QOOA 4FBXA 2A2AA 3OF0A 4YJTA 2BAKA 3OWKA 2J50A 3OY3A 4HYIA 3MIAA 5AV0A 3NCGA 4FT9A 2PVHA 5KZIA 4ANBA 4NJ3A 5IEXA 4AZSA 1M7NA 3AGLA 3HZTA 5J5TA 3GU6A 2XKFA 4J8NA 2HWPA 4TRLA 3V5TA 2I7QA 4QTDA 4AUAA 4E3CA 1Q8UA 4GVJA 4C3RA 4F7JA 4OLIA 3AG9A 3ELJA 4FKIA 2FO0A 4O2PA 5CQUA 5FM2A 3W18A 4J7BA 2QOIA 2JDOA 2VGOA 4OUCA 2QHNA 3OCSA 3UIXA 5K4IA 2CLXA 1W82A 3DCVA 4KIPA 4NM3A 4C33A 1UV5A 5KMLA 3ZO4A 2BCJA 4B0GA 2FB8A 4RFYA 5JRQA 3VS0A 5JGBA 5JSMA 5ETAA 5KKRB 2OZOA 4D9TA 4GL9A 5BMSA 1P4FA 3IDCA 2XKCA 4YZBA 1LUFA 5CZIA 3ZEPA 5D12A 1NA7A 4DEBA 5C8NA 4IWPA 4KBKA 3VW8A 4FTRA 5AP2A 4EH8A 1PKGA 2W05A 1OGUA 2UV2A 5AP5A 3IDBA 3UG2A 2X4FA 2QG7A 2IPXA 4M8TA 5EW3A 3RHKA 2VTPA 5AUVA 4OBQA 3VS1A 5AJQA 1JKKA 3LLAA 5M09A 2OO8X 2UVYA 4PL3A 4WBBB 4HPTE 3DGKA 3RJCA 2B53A 2A19B 5M4IA 4BCJA 1GAGA 1M2RA 4DH5A 1PHKA 4YR8A 3WZKA 5K5NA 3U6IA 1FOTA 1YI4A 4FZ6A 4J71A 3NUXA 1DS5A 2R0IA 3O0GA 2J5FA 3LFBA 3Q5IA 4UYNA 3TG1A 4I6QA 3NEWA 4I92A 3GNIB 1OUKA 5B7VA 4AT5A 4L45A 1OECA 1H01A 1XBCA 3OXIA 4TWPA 4G31A 1YXSA 4DAWA 3L8VA 3UC4A 5AP1A 1JLUE 3SXFA 4QMQA 2V0DA 4TYJA 5DI1A 4PNIA 4YGAA 5AX9A 4EHZA 4L7SA 4HVHA 4P5ZA 5EOBA 2UZNA 4NKSA 4WA9A 4CGAA 3E8NA 4O7TA 3V5LA 4XV2A 3LFQA 2C3IB 3D5WA 4OTDA 2PMIA 4QQJA 5AIRA 3RPVA 3V8TA 3ZC5A 2CKQA 3G9LX 3QWJA 5AUWA 3GQLA 4L44A 4WOVA 4G5PA 3V5PA 2I40A 3FMEA 4ZXTA 4U97A 2RSVA 4I5PA 4BYIA 5HO6A 5C4LA 5AUZA 3UOKA 5TR6A 4B8LA 3M42A 3NYVA 4QMUA 1H24A 1QPEA 1J3HA 3PXRA 5IQAA 4UWBA 4XJ0A 2JKQA 5F1ZA 4AN9A 2VTLA 4AFEA 5EG3A 2VWYA 3I60A 2YEXA 1FQ1B 3BWFA 4D2VA 1H0WA 4ZTQA 1W7HA 5KZ0A 4AGUA 5CF6A 3VQHA 2RFSA 1KV2A 3IONA 4C4HA 2PVNA 2OK1A 4O1OA 3A61A 3RAWA 5CYIA 4AA4A 3OUNB 3PA5A 4TNBA 3NW7A 4U0IA 3L1SA 3SAYA 2C6EA 3NMUF 2C5OA 3MJ1A 5L8KA 3MI9A 3PG1A 4BDIA 4PTGA 3TJCA 4IWQA 4X2KA 1O6KA 4JX3A 4DN5A 4EWQA 1Q61A 2RF9A 4ZY4A 4UZDA 4PRJA 2HYYA 3TV4A 3UG1A 3O8PA 4H58A 4IH8A 3PUPA 5L2IA 3HRFA 3BPRA 1W8CA 5BVWA 3A4OX 3NZ0A 5EYCA 4ALUA 4UX9A 4CCBA 3MWUA 2P4IA 3SW4A 1NXKA 3Q96A 4F6UA 5D10A 5HG9A 4QMXA 2X6DA 2GNLA 1KOAA 3TNQB 3TWJA 3TZ9A 1VEBA 3C13A 3PA3A 4KIKA 5DT0A 5ANEA 3AD5A 3QL8A 3SVVA 3PPJA 4EHVA 2R7BA 2WB8A 4O38A 5DRDA 2UW5A 3Q3BA 2V7OA 2CKEA 4I1ZA 3TL8A 1O9UA 4GEOA 4EH5A 4OT5A 4IVCA 5EHOA 4TN6A 3QGWA 4FV2A 4CQEA 4D2TA 1FVTA 3EQDA 4UWYA 5HX6A 5KNJA 4DF3A 3FMMA 2CGWA 4AWIA 1B38A 4AA5A 3EB0A 4BCMA 1EH4A 1PJKA 3ENHA 1UKHA 2W5BA 2XK7A 4WT6A 2YCSA 2BDWA 3QX4A 4QMOA 3DZQA 4UN0C 5BMMA 5IZFA 4FIIA 3I6WA 5FP6A 4E6AA 4ZMEA 3VRYA 3WF7A 3UZRA 2PMNX 2PVLA 3Q4TA 5JN2A 3D2IA 4FNYA 2P2IA 5KBQA 4FKOA 4V0GA 2QO9A 2X2KA 5I9WA 4LRMA 5BYLA 4FV5A 4YJPA 2J0MB 4GT4A 2ZDUA 2JBPA 2F7XE 3MTFA 3PY1A 4EZ3A 5A14A 5CEMA 4YJRA 3C5IA 4FIGA 4G6LA 2QOCA 2B4SB 4FKRA 3G33A 2ITTA 2VD5A 3OTUA 4R7HA 5A4QA 4U7ZA 4WKQA 2CDZA 2W0JA 1GJOA 3TKIA 4MKCA 5KHXA 3UO4A 4BVUA 2XP2A 5DRBA 4BDJA 3U4WA 4C8BA 5CALA 3AQVA 3QXPA 3DTCA 5HE0A 3G51A 4TYGA 5F94A 1DI8A 3AC2A 3OC1A 3VS3A 2WEVA 4BL1A 3IW7A 5IKWA 3FZPA 3IKAA 4A9YA 4WNMA 4U3YA 2R3QA 2P2HA 3UGCA 3GOKA 3MVLA 3PXKA 4ITHA 4QQCA 3QRTA 4M13A 4IWOA 3ANRA 5LCJA 2PU8A 3EQHA 1Y8YA 3ZRMA 2Q0BA 2SRCA 4R7BA 2B9HA 1U54A 5HNBA 3SV0A 4I5CA 3P86A 2ITOA 3MB6A 4KIOA 4OTIA 4FG9A 3WF5A 3DBCA 3LXPA 2QVSE 3HA6A 4TTHB 5JEBA 3ZXZA 1OI9A 2FSMX 3NSZA 4BI0A 3TN8A 3T9TA 3AC3A 4L68A 5EDRA 4U8ZA 4RIWA 4BFMA 4EC8A 3TM0A 4YNEA 4YC8A 3AD4A 3HUBA 4IVBA 4D4VA 4GJ2A 2A1AB 4EC9A 4R77A 2GS6A 4QTEA 2YAAA 3R8PA 2C3JA 3ORXA 5A4CA 2VNYA 2YLFA 2PVMA 2X6EA 3NS9A 3WE8A 3QFVA 2DUVA 1OM1A 5ETCA 4TYHA 4BDCA 2BILB 4RBLA 3F5GA 2BIYA 3K3JA 3HAVA 3NR9A 4DH1A 1BI8A 4PPCA 3KFAA 3FC2A 4L9IA 4QYEA 2RFNA 2XIZA 4G9CA 2VWIA 4RJ8A 5FTOA 4ZZMA 3ZZWA 1Q99A 5IQGA 5HX8A 1URWA 5EYMA 3H9FA 4E4NA 3H10A 3RINA 4A9TA 4JS8A 5LCKA 3KC3A 4O91A 4LL5A 4RX8A 2B55A 4U3ZA 3JS2A 4EONA 3KA0A 4AU8A 4LGGA 4C4FA 3O2MA 2QOFA 3OCBA 5FXSA 5AP0A 2W99B 2PYWA 2WTDA 3V6RA 2PUNA 4RX7A 1SNXA 3LCOA 3TJDA 5TT7A 2JFMA 2B1PA 4F7SA 5JFVA 1R0PA 5CU0A 4XG8A 4EEVA 4Q2AA 3PXQA 1BMKA 5CVGA 3TZ8A 4GKHA 2FSLX 2GDOA 4CMOA 5EKNA 4KABA 4YSJA 5EM5A 2C5NA 3BQCA 1FINA 2XJ0A 4U79A 3DKGA 4EH7A 2BFYA 3M1SA 5I9VA 4YZNA 4NU1A 4XG4A 5CNNA 1FGKA 4Z7HA 4B8MA 3QCXA 4DG0E 3A4PA 3G9NA 3II5A 2P0CA 4MF0A 4FTAA 4V0GB 1WVYA 2W1DA 2QI8A 5JFSA 1JSVA 1M7QA 2UW3A 3NW5A 4B99A 4ZS0A 4NM7A 4WNPA 2G9XA 3KL8A 3EZVA 2GNJA 2R9SA 4OW8A 3L9LA 4C02A 4IANA 4TW9A 2PZ5A 4RIYB 3QQGA 4ANOA 3O51A 4CRSA 5B2LA 4Y85A 3GVUA 3O50A 5G1XA 2GFSA 3QZGA 5CEIA 2WKMA 5J1VA 2VTIA 4G3EA 1YXUA 4E20A 3Q9ZA 4L3PA 4A9RA 4EQUA 3QQJA 5KO1A 4IDVA 5HORA 2IW8A 4N70A 2VWZA 3FXZA 3FHIA 1GZOA 5GHVA 4DINA 4E1ZA 4F64A 4F1TA 3WE4A 4RWIA 1XO2B 2OFUA 3DFCB 3COIA 3NNUA 5IQEA 1IAJA 3PVWA 1KE6A 3HV7A 2PK9A 2XS0A 5DR2A 3PFQA 1OVEA 3KF7A 1U4DA 2PPQA 4XUFA 4YZCA 2JIUA 3G6HA 5CEQA 5A46A 5HBJA 2EVAA 4FKPA 5L2WA 5E7RA 4F4PA 1KE7A 4XLIA 4EQMA 3OZ6A 3QZIA 2OXXA 4PTCA 4Q9SA 5HI2A 4B7TA 3UPXA 4HVSA 3R7IA 4EH6A 5HGIA 1A9UA 1MRVA 4RIWB 3F3WA 4FSYA 4C2WA 2REIA 5LOHA 3E62A 3EN9A 4FV4A 4DH3A 3WZJA 5CEOA 4ASDA 2W1IA 4RJ7A 2ZAZA 3A7GA 4XG2A 5HESA 3LKMA 3VF9A 4C4JA 3C0IA 4CZTA 2VX0A 2XNMA 4M67A 5IISA 5CVHA 3TTJA 3UNZA 3VUGA 3ZU7A 3KEXA 3EWHA 3LZBA 4NW5A 3QTWA 2WTKB 3IQ7A 4FKWA 3BYOA 5BX0A 1OMWA 3RWQA 4ACDA 1J7IA 5EQPA 3FYJX 3GBZA 5CF4A 3FZTA 3KMWA 2R3FA 3IG7A 5FXQA 1LPUA 3WBLA 3EN6A 4FL1A 3KKVA 4KIQA 3LCSA 4FEWA 2ZM3A 3ROCA 4AN3A 5IA5A 4FSQA 4EHGA 3LMHA 3THBA 1PMVA 1W83A 4K6ZA 4YUQA 4NM0A 3QUPA 2X81A 4R78A 2WNTA 3GU5A 4Z55A 2XCKA 2RKUA 2C1BA 4ZY5A 4NL0A 2YJSA 4PL4A 5HD4A 4EOLA 3WZEA 5A4LA 4ASEA 4IM0A 4MK0A 3PG3A 2QOLA 4RFZA 5CU2A
chains in the Genus database with same CATH superfamily
4E5BA 5H8BA 4Y46A 2C6MA 3NUSA 3O17A 5HVJA 3VRZA 2XEZA 1YVJA 3BI6A 3KF4A 3LHJA 4F0GA 3UQFA 3CD8A 4TXCA 2VZ6A 4UMTA 5DA3A 5EM6A 4IAFA 1Q8ZA 3LAUA 4A4OA 4GS6A 3LJ0A 5HBHA 1PMUA 3MS9A 2JD5A 4EKKA 5IUHA 5E8YA 5IUIA 3MA6A 4KSPA 3U54A 4KKEA 4ONAA 4S33A 5M4CA 1ZZ2A 2GHMA 3LXKA 5FRIA 3DKFA 4G3DA 2LAVA 1PXIA 4RIXB 3Q60A 4EL9A 4E6CA 5DMZA 3ZM4A 5E91A 2BKZA 5CEKA 1IASA 3S1HA 2WPAA 3WF9A 2W4JA 3UMXA 1KWPA 3GCVA 3FI4A 4LOQA 2JBOA 3BYSA 1PF8A 4D5HA 4EH3A 3ATTA 4H3BA 3COHA 4AX8A 3W0MA 3S4QA 1W2DA 3ZONA 3VULA 1RJBA 4L7FA 2PUPA 4O21A 3E7OA 3U51A 5AUTA 4EKLA 2VNWA 4L43A 3NW6A 4FTOA 4XEYA 1AD5A 3LJ1A 4OAVB 3FPMA 2EU9A 5C03A 3VQUA 1VR2A 2BUJA 4FSMA 4HYUA 4DTBA 4BGHA 5IDNA 1KUTA 4PDPA 5F20A 1QL6A 3HA8A 4FTJA 2DWBA 2BTRA 3CY2A 4U81A 4DFZE 2GPHA 1NY3A 2WMRA 3Q5ZA 4IAAA 4DA5A 3MVMA 1SYKA 4AZVA 2YIRA 4L01A 3TKHA 5AAGA 4BRXA 4ZJVA 4J8MA 5T3QA 3VJOA 3FQEA 3DB6A 4IVAA 4JDKA 3PJ1A 4UZHA 3UYTA 3R71A 4HGSA 4FKGA 3PDTA 3BIZA 4ENYA 1LEWA 3OP5A 2Y8OA 2C6DA 4JOAA 4QD6A 1UU8A 2VN9A 3NDMA 4G3CA 1X8BA 3R7EA 3R8ZA 3FI8A 3RP9A 2BZKB 3VS4A 5CENA 3LCKA 3HKOA 3BEGA 4BBMA 3UIMA 1WZYA 5A6NA 2BRNA 5H3QA 5IU2A 3OOMA 2YN8A 4WUAA 2EXEA 1G8JA 3WARA 4F63A 1ZMVA 4FR4A 5I0BA 2XYUA 4YTFA 2XM9A 2XAOA 1XH6A 1H8FA 2JIIA 2VGPA 3QAME 3Q4ZA 4CZUA 2E2BA 2G15A 3MY0A 3P08A 4Y8DA 1CTPE 3C4CA 2XEYA 3PXYA 2IN6A 1GZNA 3Q04A 2QNJA 1OL7A 4YPDA 5EI2A 4MBIA 5G6VA 3ZLWA 4CFMA 2GS2A 3I81A 2WD1A 1WCCA 3QBNA 5J87A 3WYYA 4EH2A 4E8AA 4CYJA 3VUHA 1ST0A 2WAJA 3TXOA 2BRHA 3FZ1A 4IM3A 3FQSA 3KXZA 2W96B 4YJQA 5HG8A 2WMBA 3WIKA 5L4QA 5J1WA 4C4IA 4H39A 5LJJA 2FSTX 3AMYA 3R00A 2CKOA 5JGAA 3P1AA 4A07A 5CSWA 4F08A 1V0BA 2ZJWA 3OFMA 1IA9A 3SLSA 2DYLA 2YM5A 3DK6A 3AT2A 3KXNA 3OWJA 3QUEA 3R2BA 4FIHA 4JAIA 5EOLA 1V0PA 5AP4A 5AAFA 2Y4PA 3QTXA 4C59A 3R0TA 1H1RA 4M7IA 4ZTSA 2O0UA 5DT4A 5CANA 3OMVA 3RM7A 3FLWA 5K9IA 1WMKA 4I5MA 2ETRA 4EOSA 3E7VA 2BZJA 1F3MC 3N4UA 4HNFA 4BWPA 3G6GA 3PY0A 3LJ2A 1YXVA 3MV5A 1OKVA 2BRMA 4JI9A 2IVUA 4S34A 2C6OA 3E3PA 2XK4A 3PVBA 5DNRA 2PZPA 4NFNA 2QU6A 4AT3A 2V55A 1P2AA 2AC3A 4C58A 4DYMA 5CWZA 3MH1A 4G3FA 4MXZA 3RZFA 3P5JC 3BU5A 3W8LA 3TEIA 2BRBA 3BHHA 2PVRA 3GC7A 4YJOA 3EFKA 5GZAA 4QNYA 4C4EA 1R1WA 3UZTA 4JQEA 4AOTA 1O6YA 1OBGA 3R8UA 5C26A 2GQRA 1YDTE 2XNBA 4D4YA 2X7FA 2Z2WA 3EFLA 4IB5A 3W8QA 4I20A 1KE9A 3U9CA 4UMRA 4L53A 3FBVA 2QD9A 5CAVA 3PUFC 2I1MA 3GC8A 4BZOA 4U9AA 4J1RA 4JG7A 4DG3E 3TNWA 5FDPA 4FSWA 3PFYA 4D2PA 5AUYA 4NJDA 3LIJA 3EYGA 1PXOA 4N4SA 4ASZA 4O7SA 2C6LA 4FEVA 5FEDA 3ZCLA 4DEDA 5IA1A 3C5UA 4F6WA 3NFGB 4QP4A 3ZFXA 2ZM4A 4R5SA 4E4LA 2XKEA 2YCFA 3GFWA 3Q53A 4ZLYA 5HO8A 3MPAA 4BIEA 3MH0A 2QOQA 3ZHPC 3TZ7A 4S31A 3BL9A 2UUEA 3NUNA 3OW4A 3CKXA 2IVSA 5EQEA 3ZBFA 5IA0A 5AV1A 5AP7A 1H08A 4PMTA 2J4ZA 2P55A 5M56A 4CLJA 5TF9A 5J9LA 4TYIA 3FL4A 2ITVA 4XBUA 5EM8A 5EW8A 3UQGA 1KOBA 4FT3A 2GTNA 2YIQA 3BHVA 3D5UA 4I4EA 4A4XA 4ERKA 3QU0A 2BTSA 4FG8A 2XK9A 4R7IA 2QOHA 5K3YA 2NNWB 4EUUA 3NNWA 2WMAA 2IW9A 4AE9A 2OKRA 5AIKA 3G90X 4QQ5A 3QTUA 3M2WA 3MB7A 4TT7A 3RAIA 4FVRA 2QG5A 3IW6A 4OTRA 2WQOA 3CEKA 3WYXA 4GV1A 3VONA 3C51A 1JSTA 2VWBA 3QHWA 2WQEA 3E87A 4I21A 4XV9A 5IEVA 3U6HA 2W4OA 1XH5A 3KRJA 4CMUA 4D9UA 5GJFA 3RTPA 2J90A 1XMMA 2ITYA 4ZZNA 4JQ8A 5ANOA 5BNJA 4O0RA 4ASXA 1GIIA 4CRLA 3ZLYA 1ZOEA 2IZRA 2OH0E 4GYGA 4O96A 3TIZA 4DBNA 4C37A 3NUUA 3EQRA 3SKCA 4U41A 4QMMA 4E93A 5KX8A 5LMAA 4PMMA 4HCVA 4ZSLA 5H8GA 3UP7A 5GIOE 3S3IA 4BB4A 5FXRA 2CNVA 1I09A 3R73A 1OIQA 3DJ6A 4U5JA 3MESA 4N57A 3L9PA 3IECA 3PP1A 2VV9A 5ANDA 4G2FA 4EI4A 4EOIA 4HYHA 3HMOA 3CD3A 3O7LB 4FNZA 3VBQA 3Q9YA 3REPA 4OTGA 4LMNA 5HE1A 3NGAA 3R04A 2DQ7X 1OZ1A 4BI1A 1FGIA 1MUOA 4NIFB 2ERKA 2AYPA 4R8QA 4A7CA 2ZDTA 5DHJA 5AR8A 4QP7A 2B9JA 5KKRC 2B52A 4APPA 3NYNA 3F7WA 5K0KA 3B8RA 1Q3DA 4F9CA 3BQRA 2VWUA 4FK6A 5HU9A 3ROYA 3ANQA 5FG8A 5FQDC 4YC6A 4GUBA 4IHPA 4FT0A 1E1XA 3F88A 4PUZA 1PXNA 3S0OA 3MIYA 1K2PA 3NNVA 2CN5A 2CMWA 2C3LA 1ZOGA 5DEYA 4HVIA 2VTMA 1K9AA 4HOKA 4F1OA 4FKUA 4IWDA 3F5XA 1IA8A 1ZLTA 3LCTA 3PSBA 4FIJA 5C01A 3RKBA 4GH2A 4MVFA 1ZAOA 3GENA 4AS0A 3K3IA 5BUJA 1XH8A 2ZV7A 3Q4CA 4D0XA 4NKAA 4QMZA 4O86A 4XRLA 4CTCA 3QRJA 3HV6A 2NO3A 2OJIA 3QD4A 1YXTA 4AOJA 4G16A 3B8QA 4CZYB 4I22A 4P2KA 4FTQA 3V3VA 1L8TA 2VU3A 3NIEA 1OL5A 2GNFA 2R2PA 2GMXA 2C1AA 2NPQA 1A48A 1CKIA 3BCEA 4JR7A 2XIXA 4U6RA 5BV3A 4I4FA 2W5HA 2X2LA 5HLNA 5JZJA 2YDJA 1U5QA 2W4KA 3FKLA 4E6QA 3KXMA 1R78A 5AV2A 1IG1A 2YWPA 3VS5A 3BLAA 3HV3A 3IOKA 2YISA 4XNEA 3V01A 4PDYA 3U55A 4FICA 4KA3A 3PP0A 2Z7QA 2RG5A 4IZYA 3V5JA 4BGQA 4ZAUA 4AQKA 4AT4A 4JBQA 5HTCA 4BDEA 2E9NA 3A7FA 2CGUA 4QNAA 1H26A 4AOIA 3W2PA 3EQIA 3NYXA 3BLHA 2UZLA 3BYUA 3RBWA 2YITA 3SXSA 3VNTA 5IA2A 3I7BA 5BYZA 4JJRA 2XRWA 1Z5MA 3AC8A 3F7ZA 3I7CA 3ACJA 4BWXA 3BRBA 2C5YA 4X6QC 5BVNA 4X6RA 4O7NA 4AXEA 3E64A 3P4KA 3FLQA 5AR2A 4O83A 3BBWA 2A27A 4C4GA 3QHRA 2GSFA 1WVWA 3KK9A 2CHLA 2V62A 3KY2A 3SHEA 2PMOX 3A7HA 3ORMA 4AZFA 2VO3A 3O23A 4JDJA 3ZO1A 1G8KA 3PA4A 4UB7A 5DPVA 4ZSGA 5T6KA 3ZMMA 5A6OA 1ZYSA 5FBOA 2PE1A 2WU6A 2A4LA 3GGFA 5CX9A 4UALA 4PDSA 1OPJA 3AC5A 1XHAA 2NRUA 3OXZA 2C68A 2W5AA 3P7BA 4ZS4A 3C0HA 1IAHA 1Y6BA 4PPAA 4CNHA 4ITIA 3OROA 2WMSA 4O0WA 3DY7A 2QONA 4IW0A 5CLPA 2OZAB 5A4EA 4JVGA 4R3PA 5GIPE 5ANGA 5AAEA 4BCOA 3GCPA 3VUKA 3C4EA 3MBLA 4H3PA 2CCHA 3OS3A 4PL5A 2XF0A 3LM5A 4IAKA 4J53A 5IQBA 2E9UA 2WQNA 4O0TA 3QD2B 1ZMWA 3BBTB 3DBDA 1UNGA 4FSTA 4MEDA 4TWNA 2HY0A 3KRXA 4F7LA 2W06A 3DAEA 4DHZA 3FZRA 4FVQA 4NFMA 1SVEA 4WUNA 1BL6A 4AZEA 4FK3A 3EQBA 2QKRA 3QLGA 1UNHA 2QR8A 4KBAA 5HVYA 3UYSA 3OUKA 5ACKA 3L8SA 4G1WA 3FSKA 3PWYA 4C35A 2F7ZE 3VUMA 4CD0A 5CEPA 4BY9E 5EYKA 4DEEA 3LXNA 4AW2A 4MQ1A 4NYEA 5F9EA 2WGJA 2F7EE 5E92A 4AXAA 3O8TA 4O2ZA 2Y6MA 3DOGA 5E9EA 5H8EA 1MRYA 3ZYAA 3UJGA 3DK3A 5DN3A 4CG8A 2C0OA 3VBXA 1FBNA 1SM2A 5ITAA 3CR0A 5I3OA 4PPBA 4TNDA 2BVAA 2O3PA 2GNGA 4LOOA 3AT3A 4QTBA 4AZTA 3KXHA 4FV8A 4YZ9A 3QTSA 3TMOA 4JDIA 4GYIA 2WO6A 3PJ8A 5FGKA 3NPCA 2C69A 4I41A 5LMBA 3GUBA 5ETFA 5EI6A 5DEWA 4DEHA 4GFOA 1CKPA 1R3CA 3UNJA 3FKNA 2FH9A 2XVDA 1XWSA 3UIUA 1F0QA 3MFSA 4RIYA 2OXYA 5BUEA 5HIEA 1JBPE 1Q3WA 5J79A 2YJRA 2WTCA 4F70A 2GQGA 1M14A 3F6XA 4K0YA 3QQKA 2PHKA 4UXQA 3VUIA 3TIYA 4CKJA 2O63A 4G5JA 3R28A 3FLYA 1GZKA 3DNDA 1RE8A 5HHWA 3AXWA 4LFIA 4R6VA 1V1KA 4BYJA 5ANJA 1R0EA 4UMQA 2PUUA 2Q0NA 5M06A 2VX1A 3RK9A 3FXWA 4ZLOA 5B2MA 2X39A 4YC3A 3LLTA 4L46A 3W2OA 3MGYA 1Q4LA 4PX6A 4X2JA 3MH3A 4XV3A 4NUSA 5EKOA 3ZSHA 3JY0A 5CY3A 1YI6A 4ID7A 5DBXA 1ST4A 3Q2JA 1ZYCA 4RFMA 4YURA 5I9YA 2V7AA 4CFVA 3NVKI 5E8XA 3R9OA 2XNPA 1OIRA 4I23A 2XIYA 3UDZA 3A8WA 3CBLA 3KU2A 4E7WA 3P9JA 3RCJA 2UW4A 1STCE 3W0QA 2JDVA 1BKXA 2FA2A 3E3BX 2WELA 4EYMA 3UMWA 3QC9A 5IMXA 1W0XC 1JSUA 3BKBA 3P5KA 4QYYA 2GNHA 3I0QA 3D94A 3RK7A 2ZMCA 3GEQA 2J0JA 4IMYA 4ZIMA 4QP1A 3DS6A 5AMNA 4QP3A 2PL0A 3VW6A 4WRGA 4BCNA 5ANIA 2G2FA 2R3RA 2OJGA 2R3GA 4PNKA 3DV3A 3ZLSA 3VHEA 4CFUA 5IQDA 3F69A 4MXOA 1O6LA 3NUYA 4MQ2A 2WIPA 4MD7E 4RJ6A 3DLZA 3QXOA 3DA6A 3OTVA 5I9XA 2JKOA 1OUYA 2V5QA 2VTNA 3JPVA 3NRMA 5JKGA 1HOWA 3LCDA 4RVKA 4U45A 5GZ9A 3S95A 5CXZA 4AW5A 4XBRA 1J1BA 3RPRA 4KNBA 4B4LA 3FHRA 5M08A 4H1MA 1H1PA 3V8SA 1CDKA 4IAYA 3T8OA 5JT2A 2ZV9A 2QQ7A 4YSMA 3FV8A 4BICA 4USFA 4BDDA 4EOKA 2QC6A 4DFBA 3W16A 3EL7A 4V05A 2XBJA 1RW8A 3AKKA 3SDJA 2UVZA 3RK5A 1P4OA 4FKSA 3Q9XA 3L9NA 2OI4X 2VAGA 3EJ1A 3FQHA 3O96A 1PXLA 4FSZA 4M97A 3HP2A 4XG6A 5DFPA 4IFGA 5HLPA 4GFGA 3PJCA 4OTHA 5FLFA 3RPOA 3AMAA 3VIDA 3HYHA 4F78A 2C0IA 4BBFA 2R3LA 4DC2A 4OR5A 4KRDA 2YM6A 2W1GA 1Q5KA 3C50A 2X4ZA 4NK9A 5HZNA 1VYZA 3OY1A 3BYMA 4BDBA 5C8KA 2XARA 3SXRA 4QMYA 5FTQA 2QCSA 4DLJA 4EH9A 5AR5A 4D2WA 2X7GA 5HCYA 4RWKA 4RIXA 1MQBA 2X8IA 4MNEA 3VN9A 4LG4A 2A0CX 1S9JA 2EB2A 4IIRA 3CPBA 3VS2A 3KREA 3LFNA 5IQHA 4CTBA 4NTTA 4J98A 4FV6A 2WZJA 2PY3A 3BE2A 5D1JA 1BL7A 2ITZA 2UW6A 3RM6A 3R1QA 4MAOA 4CT1A 5AWMA 4YO6A 4DT9A 1WVXA 4JBVA 1NVRA 5FDXA 3HRBA 3CS9A 4HPUE 2AEGA 3CXWA 2HXLA 3Q6WA 4IZ5A 4RJ3A 5AM7A 4CFNA 3PIXA 5JMSA 3PSCA 4UEUA 5JFXA 2G1TA 4FEQA 3QZFA 3R7GA 2HZNA 2CGXA 2VTHA 3RALA 5JK3A 4JG6A 4FODA 1TKIA 4PQNA 1XR1A 5AV3A 4EHEA 3W2RA 4RT7A 4L3JA 2PULA 5AM6A 4H3QA 1M2QA 4O0UA 4I0SA 4IEBA 4RA4A 1Q24A 4ZSEA 3VBTA 3E8CA 5AUUA 4F9AA 3VVHA 3AD6A 1AQ1A 5BPYA 5EM7A 5HG5A 5M4FA 4QYFA 4FT7A 4QPSA 5BVFA 4EK4A 2RFEA 2IWIA 3W2CA 4KKHA 5IH4A 1UA2A 1NVQA 4FTKA 4HGLA 5CQWA 4JR3A 4WNOA 2BAJA 3SQQA 2WTKC 3TNPC 2QR7A 3QGYA 4M12A 5DLSA 4YBKA 4ITJA 4MXYA 3CC6A 4KRCA 4GRBA 5HNIX 3KIOC 3ETAA 2XM8A 3COMA 4DFLA 1OPKA 4DEGA 2H8HA 1PXPA 3VS7A 5E8WA 3DXPA 1OGYA 3HUCA 3NUPA 3IS5A 3A7JA 4IC8A 4QP2A 3TKUA 4UMUA 1REKA 2H96A 1ATPE 5EI8A 4ZEGA 5HTBA 4FYNA 2IZSA 3DK7A 3DDPA 3FLSA 1GIHA 3R8MA 4FNXA 4X0MA 4V04A 2OF4A 3MA3A 2IW6A 4IDTA 3V6SA 3PY3A 3U8WA 4BDAA 3HAMA 1K3AA 2I0YA 3HV5A 4QT1A 4DLIA 3NLBA 3FZOA 4FG7A 4FSUA 2WFYA 3R9HA 3NIZA 4CXAA 4RQVA 4IADA 3QCSA 1H27A 4LM5A 4U42A 1W2FA 2EUFB 4HJOA 4RRVA 4JL9A 4W8DA 5CZHA 2XK6A 4QEBA 4JDHA 3A62A 2JIVA 1OL1A 3CPCA 3D7TB 3KVWA 3KULB 4MH7A 1DM2A 4G34A 4A9UA 3T9IA 3FI3A 2BDJA 2XJ2A 1XH4A 1XH9A 4O22A 5CVFA 3HV4A 5M53A 4FKQA 5JFWA 3NCZA 2XAMA 3LFDA 5HU3A 2AQXA 2ZOQA 3H9RA 1ZYDA 4Z9LA 1T45A 4BCPA 3L9MA 4C38A 3EFWA 4MWHA 4JMQA 4R3RA 2KTYA 5HD7A 1FMOE 1TQPA 3CJGA 2ZV8A 4BC6A 3KRWA 4J99A 4IM2A 4MNEB 3PXFA 4RJ5A 5CT7A 4BCHA 3UNKA 4PV0A 4M84A 2YAKA 2XNEA 3FSFA 4JNWA 3E93A 4FYOA 2VTRA 3EOCA 1URCA 3OBGA 2VO0A 1QPDA 3TV7A 4F9WA 3MPTA 3QA0A 2WTVA 4DH8A 2JAMA 1H00A 2J0KA 3QWKA 3MPMA 4CV9A 4D4RA 5FWKK 4ORKA 3LMIA 3DFAA 3R22A 4IJ9A 2VO7A 4ZTHA 5CU6A 3RVGA 3DQWA 3O8UA 4Y95A 3QD0A 2WMQA 3OBJA 5D9HA 1JKSA 1F5QA 1YDRE 1Z9XA 2PTKA 2CNQA 3QALE 4O0SA 4S2ZA 4C3PA 2BALA 2R64A 4A4LA 4BCQA 1J7UA 2VWVA 3U87A 3ORPA 4PMPA 2OLCA 2HZ0A 4MXXA 2VTJA 3VAPA 1YOLA 3HX4A 4C34A 1Y57A 4RIOA 4IX5A 4ERWA 4M68A 3QTIA 2CN8A 4D5KA 2I0EA 4R5YA 4DFUA 4XP2A 4DHJA 4ANNA 2C30A 1WAKA 3QCQA 1VJYA 3OW3A 4IZ7A 4WO5A 3R6XA 5HE2A 2B9FA 5AEPA 5CI6A 4CFXA 3DLSA 2H34A 3K54A 5EYDA 3FY2A 1SZMA 1ZYJA 2QO2A 5A3XA 4LV7A 4D55A 2G01A 5CSVA 4MX9A 5BQ0A 1BI7A 3W55A 2G2HA 2R3MA 2BIKB 1PMNA 4FV3A 4NZWB 4CVAA 4O7YA 4FVPA 1JQHA 2JKKA 4A9SA 2BHHA 1J91A 2ITNA 1FMKA 3E63A 4JLCA 1P14A 4EWHA 5HQ0A 1NT2A 4WIHA 2VO6A 3B2TA 4NWMA 1UWHA 3VBVA 2XALA 5E8VA 2C6IA 3UPZA 1WBSA 1ZYLA 3R83A 2QODA 3UE4A 1YW2A 2UZUE 2OF2A 1YWNA 3E8DA 5JRSA 3GQIA 3SW7A 5IQFA 1JOWB 4LL0A 1XQZA 2OIBA 2WOUA 2Y0AA 3AGMA 2EWAA 4DFXE 5CF5A 4RC4A 3LQ3A 5TKDA 3NNXA 4U44A 3RZBA 4DGGA 3OEZA 2J2IB 4R1VA 5C1QB 1DAWA 1YOMA 3F61A 2NYAA 2UZVA 1YDSE 2OWBA 2YM3A 3MY5A 3VF8A 3ULZA 5HICA 3V5QA 3OT3A 4L67A 4XG3A 5H2UA 4FGRA 5EDQA 4QYGA 4F09A 2BFXA 1XJDA 4W9XA 2YABA 1T46A 1XBBA 3ALOA 4KAOA 3RWPA 1H07A 4CV8A 3QLFA 3R9RA 3BHYA 3C4XA 2J6MA 3BEAA 2BHEA 4ZY6A 4N6ZA 3F5UA 5K0XA 2FYSA 3DB8A 4FV7A 3IPHA 3TDWA 3FXXA 3RGFA 4YMJA 4LGDA 4IAIA 5T68A 2HWOA 2R3IA 2VTOA 4FOCA 3FY0A 4GK2A 4AGDA 1WBTA 5CAQA 2R3OA 5B2KA 3GB2A 2UZDA 5KMOA 4XV1A 2QURA 3H4JA 4NIFA 4DITA 4II5A 4F6SA 4AW0A 3RMFA 1REJA 2HELA 3D5XA 4P5QA 3UIBA 3ALNA 1NVSA 3ZS5A 4EUTA 3D0EA 3Q52A 3PZHA 3QC4A 4GG5A 5I9UA 4B9DA 3AT4A 4F9BA 3W0RA 4CEGA 4YLJA 2CSNA 4BIBA 4O81A 5EFQA 2RGPA 2XNOA 4IXPA 1CKJA 1YOJA 3BU6A 4MBLA 5CAUA 4YZDA 2W7XA 4IAZA 5L2QA 3KCFA 5AA8A 4L42A 4FV9A 5IH5A 3OWLA 4Y83A 2Z02A 1R39A 3DAJA 1MRUA 4EOJA 4H36A 5CU4A 2E9OA 1IR3A 1SMHA 1OBDA 3BX5A 3P78A 3QUDA 2UZTA 5DWRA 4O7WA 4FTUA 4RPVA 2W1EA 4QTCA 4J97A 3HMNA 3F3VA 3ZUUA 4X21A 2Y4IB 5B0XA 4QMVA 1JPAA 3C7QA 2AUHA 4QMTA 2VTSA 3ITZA 4FI1A 4TWCA 2YZLA 4WG5A 5D7VA 3VHKA 3NVMB 4DGNA 4W4VA 3PLAE 3KMMA 4XG9A 3ULIA 4MWIA 3V04A 3ZZEA 3I0OA 4YJUA 3LQ8A 1QPCA 2CCIA 5AR7A 3BWJA 5FEQA 4XCUA 3R8VA 2X0GA 2E9VA 2F2CB 4YTCA 2EXCX 3D15A 3MN3A 4GW8A 1OIUA 4GU9A 5K5XA 3S2PA 5L6PA 1OIYA 4HGTA 2BKKA 1YWVA 2BZHB 2OIDA 3KRLA 4Y72A 2Z7SA 4Y5HA 4BHNA 5BVOA 3W0NA 4NSTA 4RVTA 2F2UA 4G6NA 4XS2A 1L3RE 2LGCA 3FE3A 2FUMA 3W2QA 4CFFA 2ITXA 4BDGA 1YRPA 3EYHA 4GSBA 5IMEA 1PW2A 1IRKA 2QLUA 4MXCA 4AE6A 4P90A 1ZARA 4KD1A 3I5ZA 4J52A 2WU7A 4BCKA 1UU7A 2ZVAA 4AP7A 1GY3A 4NCTA 2IO6A 4FZ7A 2J0LA 3VO3A 4XP0A 2PVKA 2CNUA 3EKNA 3DTWA 3DBFA 4I6FA 3DQXA 3CIKA 5BVDA 2H9VA 4AXFA 2ESMA 3BHUA 4MF1A 5FD2A 4IC7A 3RNIA 2VUWA 2X9EA 4JX7A 5AR3A 3TUCA 3E5AA 3QTZA 4E5AX 4RJ4A 2W17A 2R3JA 3Q6UA 3EQGA 3R1SA 4K33A 5EH0A 2HZIA 3RPYA 4DH7A 4CLIA 4XP3A 4MD8E 4EK5A 1M2PA 2FSOX 4M66A 3ATSA 2YM4A 3IGOA 2IG7A 4YPSA 3EQPA 3OD6X 2WMWA 3P7CA 4F1MA 4GKIA 1CSNA 4D1XA 4PTEA 4I3ZA 3UOLA 5J7HA 4QDVA 2RIOA 3GI3A 4QMNA 4DBXA 5BVKA 5F95A 4I6LA 3O5AA 3R01A 4K8AA 3HMIA 5J5SA 4O7LA 3MFTA 4AFJA 3R2YA 4RLLA 1H1SA 5KMNA 4S30A 3RAKA 2BMCA 3PZEA 2PVFA 3MVJA 4WRSA 3GU4A 3SG8A 3SOCA 5IQIA 1JNKA 4CFWA 1OKZA 4HNIA 4I0RA 2XIKA 3GC0A 2ERZE 3QZHA 3ZRLA 1UVRA 2OFVA 2WOTA 2HAKA 2OZAA 2H6DA 1WBWA 2W1HA 3C9WA 5EHLA 2XNNA 4FTLA 4QPMA 4XHKB 4LRKA 5KE0A 3ORNA 1GNGA 1UU3A 3HRCA 4QP6A 4AA0A 4FT5A 4D2RA 4QRCA 3F2NA 4BBEA 1BX6A 5E8UA 3A2CA 3CQWA 3IDPA 1PXMA 3R9NA 2ONLA 2GS7A 4XRJA 4M69B 4FEXA 1HCLA 4HZSA 3ZO3A 4QOXA 5IF1A 2Q83A 3VWAA 3WF8A 3RCDA 3QQFA 4L00A 2EXMA 1PXKA 1YI3A 3FDNA 4GK4A 4IB1A 4RLKA 3DNEA 2J0IA 3C4FA 2XMYA 5BUIA 2JDRA 4H1JA 5J8IA 4PP7A 3KVXA 4A06A 3PRFA 3SRVA 1YHWA 4ANMA 5E1SA 3FMNA 4J95A 5EK7A 4I94A 2O2UA 2UZWE 1GOLA 1ZXEA 3POOA 1Q8TA 3LFEA 3VJNA 3F3TA 1XBAA 2YM8A 1TQMA 2PZIA 1B6CB 2JDSA 2R7IA 3ZDUA 3VS6A 3CP9A 3CQEA 3WZUA 4BDHA 4DT8A 4BDKA 3PIYA 4GVAA 3UVQA 3NWWA 3KCKA 2R3PA 3OOGA 3F3UA 4LGHA 3JVRA 3F82A 2IJMA 3KMUA 4ZP5A 5IPJA 4YZMA 3IW5A 3UDSA 4CG9A 4BI2A 3CGFA 3M11A 1ZY4A 3PE1A 4NCTC 3W32A 4EK8A 2UVXA 5IH6A 5IUGA 4O6EA 3ZTXA 4NT4A 4BGGA 3NFFB 4PP9A 4DFYA 2HY81 5HCXA 3KQ7A 3LFFA 4H05A 3FPQA 1G5SA 2E9PA 4E26A 3PRIA 4E4MA 4AGWA 5H9BA 3CE3A 4CSVA 3VUTA 3CTQA 2R5TA 4K2RA 4C61A 3UOJA 2HCKA 2ZMDA 4FIEA 4FKLA 1I44A 3PLSA 3CQUA 5HBEA 3ACKA 3PE2A 1QCFA 4EH4A 3KXGA 4KS7A 5DG5A 4CYIA 4UY9A 3UC3A 4M0ZA 4NEUA 4JBOA