3D5WA

Crystal structure of a phosphorylated polo-like kinase 1 (plk1) catalytic domain in complex with adp.
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
287
structure length
284
Chain Sequence
KEIPDVLVDPRTMKRYMRGRFLGKGGFAKCYEITDMDTKEVFAGKVVPKSMLPHQKEKMSTEIAIHKSLDNPHVVGFHGFFEDDDFVYVVLEICRRRSLLELHKRRKAVTEPEARYFMRQTIQGVQYLHNNRVIHRDLKLGNLFLNDDMDVKIGDFGLATKIEFDGERKKLCGTPNYIAPEVLCKKGHSFEVDIWSLGCILYTLLVGKPPFETSCLKETYIRIKKNEYSVPRHINPVASALIRRMLHADPTLRPSVAELLTDEFFTSGYAPMRLPTSCLTVPPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Polo-like kinase 1
publication title Structures of the wild-type and activated catalytic domains of Brachydanio rerio Polo-like kinase 1 (Plk1): changes in the active-site conformation and interactions with ligands.
pubmed doi rcsb
source organism Danio rerio
total genus 77
structure length 284
sequence length 287
ec nomenclature ec 2.7.11.21: Polo kinase.
pdb deposition date 2008-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3d5wA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3d5wA01
1UNHA 3KA0A 2VO7A 3CBLA 3HRFA 3Q2JA 3W2QA 2EXEA 3NUNA 4I92A 4GFOA 2J51A 4O21A 2XM8A 5DT0A 1ZYDA 4UXQA 2OICA 4AFJA 5BVWA 3P86A 4JBOA 3LPBA 5ANJA 3SRVB 4AWIA 2WHBA 4ZK5A 3OMVA 2IVUA 2EVAA 3PY3A 3TZ7A 4R7IA 3KGAA 3O2MA 4F7LA 4YURA 3ZM4A 5EH0A 2BRNA 5GJDA 3LLTA 3WZUA 2IZSA 1KV1A 3IQ7A 3VBTA 3ZSIA 4DN5A 4JQEA 3IO7A 3KF4A 4FTAA 5HG5A 2CGWA 3NDMA 3LCTA 5JGAA 4Z7GA 4ZSGA 5I9WA 5JZJA 2VX3A 3ZYAA 4UWYA 3HX4A 1WBTA 5GIOE 3EWHA 4FV7A 4O6LA 3KVWA 3FY0A 3H9RA 2BDJA 5AM7A 4HPUE 2GNLA 4YJUA 1UA2A 3WZEA 1R0PA 2WTVA 3OCTA 3UTOA 3H0YA 4PV0A 3U9CA 3PJCA 4O2PA 3C7QA 4EOOA 2C0OA 2XIYA 3W18A 5CF8A 2YLEA 4JVGA 3IECA 4U43A 2VN9A 2CCHA 2OZAA 2J5EA 3BQCA 3BWFA 4C35A 3HEGA 1J7LA 4UALA 4FEWA 4IW0A 1YOJA 5FRIA 5IQFA 5CASA 3UODA 3S2PA 2F4JA 5AV4A 3F7ZA 2W7XA 5DMZA 1E1XA 3MVHA 2QO2A 1OIUA 4KIPA 3OXTA 4FE2A 2WTJA 3TWJA 4M15A 2FGIA 5GIPE 1FMKA 1ERKA 2RL5A 3NUUA 4FTOA 3WE8A 2PUPA 3ZO4A 5AAGA 4J95A 3LFAA 3LVPA 4PP9A 4XJ0A 2ZMCA 3RALA 3EHAA 4ZMFA 5CSHA 2VTOA 3SDJA 5J5TA 3IKAA 3NUYA 1WVYA 4WHZA 3MDYA 3UE4A 4YUQA 2LGCA 3MS9A 5FM2A 5HESA 4C3RA 4G6OA 3LCOA 4EH7A 2HWOA 3F5XA 5IQBA 3LXNA 2VWXA 4OTQA 3PA5A 4BCNA 3FZRA 4YHJA 4Y5QA 3BU3A 3R2YA 2HIWA 3JR1A 2EXCX 3PA3A 4DT9A 1SYKA 3B8RA 3COHA 5A14A 5HX8A 3D5VA 1DM2A 3FXWA 2F2CB 1A06A 3IDCA 3DFCB 4I20A 4QMPA 4ERKA 3UIUA 5M4FA 1Z9XA 3VRYA 5HIEA 4O0WA 5HU9A 2PVNA 4X3FA 4EZ7A 1H8FA 4C8BA 5AUTA 3TACA 3S95A 4C7TA 2X8IA 4UMRA 4E5WA 4ZMEA 2RKUA 5K3YA 4UWBA 4RJ7A 3C4EA 4ZTNA 2I0EA 1XH7A 4DFYA 5M55A 3MV5A 4X2NA 1GZOA 2C30A 2C5YA 3EN9A 3V01A 4FKTA 1JWHA 3QA0A 3RPSA 5AV3A 3C13A 4E4MA 1TKIA 5FTGA 2C6IA 5I3OA 3TNWA 3LHJA 3NX8A 4O0VA 3FMJA 2IJMA 4FZ7A 4G1WA 4UYAA 3U54A 3F2RA 3A99A 3CY3A 3ID6C 4I0RA 3VBYA 5AWMA 4LMUA 4CFVA 4QMTA 5IQIA 4XG3A 3RWQA 5AX9A 2GMXA 2HY81 4FV2A 3RM7A 1E9HA 5IMEA 4OTPA 5K0XA 3CIKA 5EKNA 2YM3A 2PHKA 4L9IA 3ELJA 1T45A 2G2FA 1OPJA 3AT4A 4J1RA 4QQCA 2KTYA 3MIAA 5LVLA 5AV2A 2CKOA 3BYSA 1W83A 4ZLOA 4Y73A 4JOAA 4DH5A 2GHGA 2XB7A 4PMMA 4CV8A 2P33A 2XK7A 4EH8A 4BZNA 1R1WA 3SC1A 3OBJA 3R22A 4BCOA 1OI9A 3K5UA 3R30A 5FBOA 3RZFA 3G15A 4G2FA 2JKKA 2E9OA 4FV0A 3BLHA 4XX9A 4FKUA 1OPKA 5TR6A 2I7QA 3EMGA 2CKQA 3EQGA 1WVXA 2IVTA 3KXXA 5A4CA 2YDIA 1H1RA 2J0IA 2IW8A 5I9ZA 2OH4A 3G6HA 3VUHA 3UOJA 2W1IA 5AUZA 4BYJA 4RIXA 4JX3A 3NCGA 4R5YA 3QRTA 2CGXA 1OBGA 3QXPA 5KMMA 3NRMA 3HMOA 3FC2A 4WNOA 3CY2A 3F3WA 4AN9A 3FI4A 4NU1A 3PY1A 5HCZA 2OZAB 1NVSA 3I6WA 2ITZA 2PULA 4FNWA 3BIZA 3ROCA 1IA8A 2XKCA 3TJCA 2BTRA 2RG5A 3P7BA 4F1TA 4O83A 3C0GA 2VTJA 2QLUA 3GC9A 1P4FA 2OWBA 3UOLA 3RHXA 3AD4A 2WKMA 5HBEA 4DH1A 4CZYB 1BX6A 2GS2A 3QQFA 4AT3A 2PMNX 2BZIB 2QOKA 2YCFA 3HV6A 4TWCA 3PJ3A 4C0TA 3V6RA 4FKSA 2JDOA 3ORKA 4JL9A 5KO1A 3TJDA 4EK8A 5BUEA 3FKLA 1FVRA 4G31A 1NXKA 3V5PA 4NEUA 1WCCA 1H26A 4D4RA 2P4IA 2XK9A 4MD8E 3VO3A 2JFMA 3A60A 5JQ5A 5F94A 4U41A 3EL7A 1W8CA 2X6DA 3HUCA 4TY1A 2JEDA 3UG2A 4AA0A 3HA6A 4FIIA 5ETFA 4R7BA 3A2CA 3DKOA 4IM0A 4MNEA 3MYGA 3UC4A 2QHMA 4EUTA 3FKNA 4M97A 5EI8A 3ZDUA 2UZNA 5G1XA 3OWPA 3NYXA 3DXQA 2BPMA 3R8MA 4XG4A 3AMAA 3PPKA 4DGMA 1B38A 4X3FB 2ETKA 3IGOA 4CMTA 4AGWA 4O0XA 3A8WA 3QGYA 4YZCA 3OF0A 1XBCA 3NVMB 1ND4A 2ITVA 4JAIA 5HG7A 4KUJA 1QPEA 3NCZA 2C6TA 1TQIA 2QR7A 3A7FA 4F9AA 4YHFA 3ALNA 1H25A 1Q4LA 4XYFA 5DN3A 2VO0A 4AZSA 1LPUA 2PMLX 2Z7QA 3A62A 5J7BA 5CENA 5J9LA 2Z7RA 5HCYA 4ZJIA 3LCSA 4AA5A 4IDTA 2VTRA 3VBXA 2VWIA 4OAUC 2C5VA 2W4OA 2V7AA 3FL4A 4MF1A 4IZAA 2DYLA 5IU2A 5D9HA 3MVMA 1XR1A 3OXIA 2UVXA 5DT4A 3UZPA 3WF9A 4TYJA 4TWPA 4JBQA 4NFNA 3NUAA 3F5UA 2CMWA 4FSTA 3CTQA 3ZBXA 4FZDB 2E9PA 2X81A 3ALOA 3ZBFA 3ZRLA 4RX9A 1Q5KA 2YWVA 2WTDA 5DLSA 1VJYA 3MSSA 4FEXA 2OO8X 3I4BA 4HGEA 1GZKA 3UO6A 3IW8A 4EUUA 3H30A 5DR9A 1FVVA 4ASXA 4BYIA 2W4JA 3ATSA 1JOWB 3NNUA 4YZNA 1ZOEA 4BCIA 4P90A 2GNGA 3BHYA 2B53A 5IA5A 1I44A 3OCBA 3EIDA 3KN5A 5F1ZA 3TNPC 1P2AA 4R3RA 4AXAA 1M2QA 2C68A 1Q41A 3Q9YA 2O8YA 1RDQE 3FJQE 5TO8A 1VYZA 1YDTE 5ANGA 3HA8A 4F65A 2WTKB 2PPQA 4RIXB 4AT4A 4I4EA 4E6AA 3UO5A 4FYNA 4AZTA 1XQZA 4QMZA 1KE9A 5TKDA 4ZP5A 4F6WA 5L8LA 5I9YA 3CEKA 3UOKA 1SNXA 4FG7A 1OM1A 4FTCA 4DEBA 4JR3A 3E8NA 5CVFA 3QHRA 1NVRA 2F2UA 5AUXA 3P7AA 5EOLA 1TQMA 2YM5A 3MH3A 4M68A 4TPTA 2C6MA 4HZRA 5ACKA 3C4XA 4XH6A 5J8IA 4F0GA 1MUOA 3MPMA 4DBNA 3E62A 1CSNA 3AGLA 4YC3A 3G9NA 4GG7A 2OJJA 4MD9E 4Y95A 3QRUA 2VZ6A 3QA8A 2O64A 3N51A 4K18A 2ZM3A 4LOOA 3C4CA 5BX0A 3VHEA 4KNBA 1ZZLA 3M1SA 4BFMA 2CCIA 2XYUA 2R3PA 4JT3A 1PKGA 2BAJA 1NVQA 1H4LA 2UW6A 4GFMA 3WIKA 4JQ8A 2X2MA 3FZ1A 4FG9A 4RC4A 4EK4A 2HAKA 4EL9A 3CD3A 1YHWA 4QPAA 3HMMA 2UW7A 2XNPA 2Y4IB 2C3IB 4X3JA 3RPRA 3U87A 3QTWA 4MNEB 4DGOA 2H6DA 2PSQA 4G5JA 2OG8A 2X9EA 2LAVA 5JKGA 5ANDA 2GNJA 3EFJA 5J7HA 3EYHA 2QG5A 4RWJA 3DGKA 5LCJA 3ROYA 3CQEA 1L3RE 3CP9A 4BTFA 3NYOA 5C26A 3BPRA 4GJ3A 1YWRA 2QLQA 3SW4A 2QOIA 2P3GX 2VWWA 5DEWA 5EK7A 3W16A 1H01A 3E3PA 3FMMA 5CEQA 3VS6A 3NNWA 5E8SA 4BDJA 1ZXEA 3R71A 3M11A 5E9EA 4FSZA 3FMLA 4S33A 5L3AA 3PRIA 3AG9A 4FX3A 3GB2A 3GI3A 4RQVA 2R64A 4I41A 3FQSA 3SXSA 3UGCA 3MA3A 3KRJA 3Q6WA 3UJGA 1R3CA 4GH2A 3CSVA 4ZY6A 3LCKA 2H34A 3LCDA 1OUYA 4RWKA 4CNHA 4F6SA 3FL5A 1FVTA 4YZBA 3DAKA 4MF0A 2JBOA 4PX6A 3CGOA 3OTVA 3JS2A 1H27A 3W33A 1PXMA 2W96B 4CKRA 1QPCA 1RW8A 4CTCA 3SG8A 3Q9XA 2DUVA 3MBLA 1JVPP 4U3YA 5JGDA 4XV9A 5ANOA 4BIDA 3CLYA 3NSZA 4LG4A 1P14A 2HK5A 2X6EA 3VBQA 4WUNA 3GVUA 3QUPA 4AGDA 2CGVA 4LGDA 4R1VA 3O96A 5H8GA 4IB3A 2WEVA 3TIZA 1Q8TA 4PMSA 4F7JA 1E1VA 5DRBA 1VR2A 2JFLA 2WZJA 3ORPA 4JBVA 3SOCA 3SA0A 2JIUA 4MNFA 4O96A 3W8QA 3E8EA 5E1SA 2J9MA 4WSYA 3ZOSA 4CGAA 3GU8A 5L2QA 4AE6A 4HYUA 2IPXA 3TXOA 2GFCA 5HI2A 3MTFA 4GW8A 4M69A 4GEOA 3DAJA 3QQJA 2EWAA 4D2RA 3VS2A 1BLXA 4PL5A 1JLUE 3E92A 3GENA 4BI0A 1ZYSA 4F08A 3L8VA 3BU6A 3QF9A 1M2RA 5HEZA 2YJSA 2ITQA 3U4UA 4AP7A 4DTAA 1SVHA 3QQHA 4YJOA 3L9NA 1W82A 4FG8A 3A7HA 2E9UA 4LRMA 5T3QA 4J8NA 2G01A 2W99B 3VNTA 2CDZA 4R1YA 3KXHA 5E8TA 2C5XA 3FSFA 3FLNC 4B7TA 2VTIA 5A54A 4AG8A 3FKOA 3W32A 1AD5A 1OL7A 2CPKE 2GQGA 3PUPA 3CQUA 2BKZA 2WTCA 4XP3A 3QD2B 4OT5A 3CC6A 3I7BA 3TKHA 5EQEA 3LM0A 2YCRA 3PIZA 4OBPA 4YJTA 3ZUTA 3BHVA 3OY3A 1ZOGA 2V5QA 3Q4UA 3JVSA 4ZAUA 2CLQA 3LE6A 1PXPA 2X7FA 3KMUA 3MH0A 2UZDA 4P5ZA 4Y72A 4C3FA 3RAWA 4A4OA 1M52A 1W0XC 3PVWA 4YMJA 3PLSA 2B4SB 2BAKA 3MJ1A 3PXYA 3EZRA 2P2HA 3VUIA 2WQOA 3PVBA 3MB7A 4N6ZA 4GRBA 3UPZA 4JS8A 5BVEA 4FT9A 3V8TA 3AQVA 1WFCA 4EH4A 4DFBA 2BZJA 2PWLA 3E7OA 1RE8A 4Z16A 4UX9A 4N0SA 4I0SA 3UVRA 3REPA 5IQAA 3PXZA 2WMVA 3E8CA 2GS7A 3G2FA 2C6DA 4MTAA 5CQWA 1Z5MA 3F66A 1YXSA 3KRRA 5KMKA 2JDTA 3DNDA 2W9ZB 5C8MA 4XP2A 1VZOA 2BTSA 5BVOA 2QO7A 3DT1A 3R7OA 4L01A 3AC2A 3M2WA 4CTBA 2OKRA 4AZFA 2VWUA 4AA4A 4QQJA 4A9UA 4O7LA 4HGSA 5AA9A 1H08A 4C34A 4G3DA 1FGKA 3QZHA 2ACXA 3FZOA 3BCEA 2JBPA 1XBBA 1YKRA 2YISA 3GCQA 4BCFA 3GCPA 5L8KA 4E4LA 5FUTA 4YJSA 2X2KA 3DTWA 5LQFA 3AD6A 4JRVA 4B8MA 1U46A 3O71A 4DF3A 3AT3A 3QALE 4NT4A 4BDFA 3MH2A 2QCSA 2YCQA 5FXSA 4AW1A 5E8YA 1M7NA 4RFYA 4WIHA 1U5QA 3F9NA 3CS9A 2X4ZA 2CNUA 1JKSA 4Q5HA 5BVDA 2OIBA 3ZTXA 2WTKC 3BBWA 5AP0A 3U9NA 4BCHA 2QURA 3R04A 1J1CA 4NW5A 5EM6A 2IZRA 4BHNA 3UDBA 1VEBA 3NIEA 3MA6A 4KABA 1JKKA 4TWNA 1XO2B 5CX9A 4KS8A 2ERZE 4UY9A 5JSMA 4YJNA 2WOTA 3QLGA 4S31A 4XBUA 1M7QA 2A1AB 3C4WA 4CKJA 5IZFA 3N4VA 2VV9A 2XMYA 1UV5A 4ANBA 3NW5A 3F5PA 4C4HA 5AP4A 2Q0BA 3E93A 3RZBA 3QL8A 4IAYA 4MQ1A 1OKVA 3P1AA 1YXVA 3PIYA 3NGAA 4ITJA 4TNDA 2BDWA 3LFCA 3PP1A 3O0GA 1G8AA 3FEGA 3LKMA 5IEXA 3QTRA 4EK6A 1PY5A 4M69B 3WOWA 2JLDA 3P08A 4FV8A 2DWBA 5AP2A 4EBVA 4EQCA 5BUJA 3K5VA 5D12A 4D5KA 3LJ0A 2XJ2A 3R01A 4G3GA 1OIYA 4BGHA 4L7SA 2PE0A 4TRLA 2YACA 2ZM1A 2FA2A 1KE7A 1V0OA 4A9SA 2XIKA 3MB6A 4IM3A 2NRYA 2Y9QA 2YA9A 3L9PA 4LGGA 5CU4A 5AP3A 4EK5A 4ZZNA 1ZARA 1J1BA 3HZTA 3DJ7A 4L6QA 4Q2AA 2XZSA 3CR0A 5AUVA 3F3ZA 4HNFA 4QP9A 5H3QA 3WYXA 3JY0A 3FMHA 4UWCA 4FSUA 5DA3A 3U4WA 1H24A 1YI4A 4PF4A 3R8PA 3ZZWA 4EOQA 1Z57A 3AC3A 4FUYA 1BMKA 1WBOA 4FKQA 3TV7A 1ZMWA 2VWZA 2ITOA 2UZBA 1RQQA 3RM6A 3PXRA 2PMOX 4AZWA 3PWYA 3VS4A 1LP4A 1PHKA 3KQ7A 5JMSA 4ZJJA 4OTWA 3MIYA 2VGOA 3EQBA 4R8QA 2J50A 4LV8A 5JK3A 4R5SA 5LMBA 2QKRA 2X7OA 1LR4A 4L7FA 5AADA 3R7GA 4UV0A 4EK3A 3LJ2A 4OW8A 4FSNA 4EQUA 4ZTQA 5HO8A 1U54A 3UQGA 2IWIA 2PZ5A 2WB8A 2ZDUA 2ZMDA 3AMYA 2B7AA 3ORLA 3PVGA 3LM5A 3ZXTA 5IUHA 4J97A 5HNGA 4V04A 4X0MA 2FH9A 5LVOA 2IVSA 4O1OA 1KSWA 2BCJA 3MN3A 3P9JA 2H96A 3EQDA 4EHVA 4W8EA 3O23A 3NLBA 4I4FA 4EWQA 4V0GA 2OXYA 2ERKA 4BKZA 5DOSA 5ITAA 1ZAOA 2XKEA 3M42A 3WZKA 2QD9A 3R7VA 4ITHA 2RSVA 3CPBA 5IKWA 4D2PA 3PDTA 5LMKC 3DXPA 4OTRA 1H1QA 3TI1A 3U55A 3LMGA 4TYHA 2J0KA 3NYVA 4NK9A 4WBOA 4YSMA 5E8WA 5K9IA 3N4TA 3EZVA 2YJRA 3TT0A 1NT2A 3ACKA 2QI8A 5ETCA 3EH9A 4L8MA 5KE0A 2JKMA 3HVCA 3QZGA 3RK5A 4E6CA 2BROA 4R6VA 5BMMA 2VTAA 4FL2A 3TV4A 2R3HA 3FBVA 5HIBA 2ZM4A 2BRBA 4GCJA 4E93A 4FIHA 4M8TA 4BTMA 4PMTA 2J4ZA 5M4UA 3FQEA 4EOSA 3VJOA 4EC8A 2HW6A 3DDQA 5D11A 3WF5A 3F3VA 3SOAA 3QKKA 5CEPA 4XG6A 5CI7A 2HCKA 3GEQA 4JXFA 1WBWA 2W5BA 1VYWA 2OJIA 5B0XA 4APPA 4BR3A 2YDKA 3COIA 3Q3BA 3R8VA 4RVMA 4XV3A 3LFNA 2VWYA 3EJ1A 3WI6A 4AE9A 5I9VA 4KA3A 3D83A 3PFQA 4B99A 2BRMA 4FK6A 4FYOA 4Y83A 1O6KA 4XEYA 4W9XA 2QC6A 4F7SA 4Z9LA 5AP6A 3V5WA 3HV4A 4ITIA 2AC3A 3Q53A 2UVZA 4ZSLA 4NFMA 3H9FA 2VTPA 5DWRA 4L43A 4DFZE 5ANIA 2C6EA 4FKWA 3OG7A 4YJRA 1R78A 1YW2A 3UVQA 4CFWA 4KIKA 3TUBA 3P0MA 4JX7A 2HZ0A 1WMKA 1BI8A 4FSQA 2X1NA 4H58A 4OBOA 5FLFA 4PRJA 2GCDA 2ITXA 4CFNA 4FTLA 3COMA 3F3TA 3FLZA 3MFRA 4GVAA 4BIEA 1XH4A 4HYHA 4FKRA 4IANA 3ORNA 3G9LX 3QRIA 4O27B 1PMVA 3SKCA 5M08A 3H4JA 4FK3A 2XJ0A 2JDSA 3EQCA 4GG5A 5DI1A 4XOYA 2C47A 1FGIA 4KIOA 2VAGA 2OFVA 4YNEA 5HO7A 3PJ1A 2C3JA 5JRSA 4TN6A 3OTUA 3IG7A 1QCFA 2GPHA 4AFEA 3R28A 1U4DA 3POZA 3ZO3A 3L9LA 4ZLYA 4GYIA 3DK7A 1DS5A 4YC8A 4I6BA 3RAHA 2YM7A 3KK8A 2RF9A 3QUDA 3QYWA 3TEIA 2OXXA 2HXQA 2IO6A 3PXFA 4KSQA 3VAPA 3JYAA 3RPYA 3EYGA 4OTFA 4AUAA 3F2AA 3TNHA 3GGFA 3ACJA 2A19B 5HKMA 3P4KA 4FGBA 4G6LA 5B7VA 3TTIA 4IC7A 2R3LA 3VQHA 4M67A 2XK6A 2IN6A 4RFMA 5HVYA 3R7YA 3VBWA 5GZ8A 4ZTMA 1TQPA 1BI7A 3O50A 2WMXA 2YIQA 3BYMA 3UIBA 4D0XA 4WNMA 5DFPA 1MQBA 4JR7A 3HRBA 3DBFA 1Q8YA 4BDBA 4BN1A 3OOMA 3VWAA 3HECA 4PDSA 4UXLA 5D7VA 2XIZA 1R39A 5CXZA 1U54B 3EOCA 5FEDA 4D58A 4QNYA 3QCXA 5CU2A 4F0IA 4KD1A 4FTKA 1S9JA 4L68A 4TYEA 3ZS5A 3LIJA 4O84A 4QMNA 3HP5A 3CTHA 2W5AA 3OCSA 4TZRA 5EG3A 5IQCA 3OWKA 2UW8A 3GCSA 4FNZA 3FHIA 1BYGA 4PL4A 5C1QB 3PJ8A 3G90X 5EYKA 5E8XA 3ZLYA 4C38A 4IJPA 4V0GB 2P0CA 3FMNA 3OROA 3BV2A 5FEQA 3TG1A 3D2KA 2ZB0A 3WBLA 4N70A 3RHKA 2PMIA 3EQIA 3H3CA 3OP5A 2B55A 2X39A 4FT7A 4JLCA 4G6NA 4XRJA 5ETIA 4AOIA 4G3EA 2W0JA 1OPLA 4C3PA 2YERA 3QTZA 4G9RA 3I79A 3IOKA 2WO6A 4TYHB 5CAQA 4ORKA 3LFSA 3EKNA 3OBGA 3UC3A 1FMOE 1OECA 1X8BA 3DJ5A 4MWIA 3DK3A 4A7CA 3FZSA 4RPVA 1URCA 4IB1A 1P4OA 4K1BA 3CGFA 3TN8A 2ITPA 2C1BA 3LXKA 4X21A 2HZ4A 3HL7A 1HOWA 2JC6A 3UP7A 4A07A 4CMOA 3MESA 2R0UA 3QUEA 3RCDA 4DGLC 2PVKA 4QMMA 3UMXA 5IDPA 1YOLA 5JGBA 2R3JA 3ERKA 4ZSAA 4G9CA 4CD0A 3RP9A 3MGYA 2XK4A 4GK3A 3DKCA 3RK7A 3F2NA 5K5NA 4NKAA 3JVRA 2BVAA 3D15A 5L4QA 3TDWA 3BLRA 4IAAA 1SVEA 4MEDA 4DT8A 2V62A 5I5ZA 2FSLX 5HTIA 4S32A 2REIA 5D7AA 2CJMA 3GCUA 3R1SA 3P5KA 5C27A 4FKGA 5HNBA 1Q3DA 1MQ4A 4EZ5A 1K9AA 2WMWA 3ETAA 3NYNA 3Q4CA 3TM0A 4EQMA 3E63A 3DLSA 2ZV9A 4KIKB 4UEUA 2XCHA 4D5HA 4LGHA 4TYIA 1SMHA 2Y0AA 4Z3VA 4B9DA 2I40A 3IW5A 3LMHA 3BRBA 3GQLA 2IVVA 3KCFA 3W10A 2PY3A 4QQ5A 5AAEA 4IB0A 3TDVA 4XG2A 3C51A 5ACBC 5HNIX 3OW3A 4W8DA 3O7LD 2GSFA 4QYEA 4CYJA 4I3ZA 4RJ4A 2XBAA 4ZTHA 4FIFA 2PVYA 4QP3A 4E5AX 2X4FA 3QCYA 3BEAA 3A7GA 1ZZ2A 1NA7A 3FUPA 3LJ1A 1F3MC 4YO6A 5DGZA 5A4TA 1F5QA 3PSDA 4ENYA 1XKKA 2WAJA 4HYIA 5A3XA 4EHGA 4E4XA 2WMSA 3QTXA 4ANLA 4TW9A 3RINA 2A27A 3VUKA 4DEIA 1XH8A 3CCNA 3V3VA 3ZH8A 3VHKA 1HCLA 2BALA 3GC0A 4PUZA 1YOMA 4CKIA 3FWQA 4YLJA 1R0EA 5CXHA 3TV6A 4BBMA 4NSTA 4J8MA 2WQEA 1UNLA 4QTAA 5A6NA 1Y8YA 5BYYA 1J7UA 1YHVA 2R5TA 3DTCA 3QAME 4IFCA 4G3CA 4QP6A 4YR8A 1QPJA 2CSNA 4EBWA 3QTQA 4V05A 2J90A 2WIPA 2PZIA 4EYMA 4F64A 3BELA 4WA9A 4XCUA 2W05A 1YXTA 5AR8A 4AT5A 1PYXA 3IW7A 1PJKA 3UIMA 2IW9A 4E8AA 3B2WA 4YZDA 3QHWA 3ITZA 5CZIA 4FGRA 5E1EA 5AX3A 4AU8A 4D2SA 3MH1A 1UKIA 2R3IA 5FDPA 3FMDA 4D2VA 5AR7A 2R3NA 3EQHA 2XK3A 2HXLA 1JSVA 4ZJVA 2GHMA 2GNFA 5CF4A 3VUMA 1G8SA 3CPCA 4EONA 4ZTLA 4MXCA 3VUGA 4RT7A 5EW8A 4AOJA 4FKOA 3ENHA 4JDKA 3UYSA 5HORA 4FR4A 4J52A 2R0IA 3G33A 3QGWA 3I60A 4GUEA 2VNWA 4AGUA 2J7TA 4FTMA 4R77A 5CU6A 2B0QA 5EYDA 3MWUA 5HD7A 1REJA 2C3KA 2WMUA 3EFKA 4IAFA 3W2CA 5LMKA 3VW6A 3WE4A 2YIYA 3FMKA 4F9YA 4LL0A 2OFUA 3R1QA 4I5HA 4EH2A 4C58A 3GU5A 4W4YA 2GU8A 1U5RA 3HUBA 1ZMVA 3Q4TA 4F7NA 4HW7A 4XLVA 3ZRMA 2XF0A 4FIEA 4EH3A 1ZY5A 1PKDA 4PL3A 4RIOA 4C59A 4ERWA 4IVAA 5CSVA 5JT2A 4DLIA 3SGCA 3DZQA 4FSYA 2H8HA 3R2BA 2GDOA 5DVRA 5A4LA 3VN9A 1H07A 2W1EA 5AEPA 2Y6OA 4WSQA 3R73A 3OEZA 3Q9WA 4I6QA 5IEVA 2XCKA 5M06A 2ITYA 1WZYA 2OF2A 3KULA 5EHYA 4E3CA 3BX5A 4EKLA 4YTHA 3W2RA 2FVDA 2A2AA 2BRHA 5L6PA 3V5JA 4AQCA 4BHZA 1JKLA 1PMUA 4NTSA 1FBNA 3QRJA 2O63A 2UZEA 4H36A 4M84A 4AN3A 4JIKA 5CAVA 3MJ2A 2Z60A 4RBLA 5KNJA 3RPVA 2F7ZE 1PXIA 3BGPA 3GXLA 3OVVA 2B9HA 1W7HA 2DS1A 4DTBA 4I6FA 5C03A 3R9OA 5L2WA 3CKWA 4AX8A 3D5UA 2YAKA 4PY1A 5HO6A 4QP1A 5LVPA 5A6OA 2DQ7X 2UZTA 2XRUA 3O51A 3G0FA 4U8ZA 3A7IA 3K3IA 2X8DA 4L67A 2HY0A 3AMBA 3QKLA 3ZLSA 3EFLA 4Z7HA 1UWHA 2RGPA 4I6HA 4QTBA 4OTIA 4BCJA 2RG6A 4J7BA 4FV1A 3MY1A 1Y6BA 3EN6A 3R9HA 3PE1A 5D10A 4TL0A 3BHTA 4FV9A 4EZ3A 4EKKA 5KHXA 4BZOA 3ZDIA 3ANQA 3DBDA 2QU6A 4U80A 4LOQA 4IDVA 4FEVA 5I9XA 4WNPA 2VTQA 1DAWA 4PTEA 4WG4A 3OT3A 3OXZA 4J96A 4YZ9A 4YSJA 3DQWA 2UW5A 1BKXA 2PK9A 3D2IA 1T46A 4FF8A 1KV2A 2F7EE 3BQRA 4KB8A 4PDPA 4RSSA 4ARKA 3HAMA 3QD0A 3ENMA 2PVFA 2VWBA 5DHJA 4OTDA 4ASDA 1K2PA 1Q8ZA 2XM9A 5F20A 3I81A 3KRLA 3WZJA 2VO3A 3VC4A 3HDMA 2VX1A 3ZU7A 4BCMA 2Z2WA 3LFBA 4FV5A 3Q96A 1O6YA 4MKCA 4M0YA 1OZ1A 5BVKA 2AYPA 4GT3A 5DYJA 4H3PA 2C6OA 4PPAA 4LFIA 4MQ2A 4FTRA 4IC8A 4AOTA 4DGGA 3DKFA 5JRQA 4CG8A 3GQIA 5IA3A 4FL1A 3S0OA 3TNIA 3PG1A 1Q97A 4FC0A 3POOA 5EQPA 4FV6A 3ZO1A 1O6LA 3JPVA 5I3RA 2E9NA 3LMIA 3DB6A 3F88A 2NP8A 4P4CA 2FSMX 5IA4A 3HNGA 4AAAA 1J7IA 3JXWA 3F3UA 4DLJA 4IZYA 3JY9A 4TWOA 2X0GA 3SHEA 1H00A 3RMFA 3CJFA 4L42A 3QFVA 4D4SA 1WVWA 3PRFA 5FTQA 3ULIA 1MRVA 2YEXA 4WNKA 5IEYA 3P7CA 1F0QA 1KUTA 3PP0A 4RX8A 4XV2A 2YHVA 5K4JA 4J98A 4F9WA 5C4KA 4F9CA 1GIIA 3LFDA 4KBKA 4L3PA 4YTFA 2RIOA 4QP8A 3R02A 4ZEGA 4DYMA 3I7CA 3UMWA 2ITTA 5AR3A 3QZFA 4TKSA 1NW1A 1LUFA 5IF1A 1HCKA 4HPTE 5DG5A 3MPTA 3R9RA 5B2MA 4ZS4A 2I1MA 5J87A 3E87A 4HZSA 3GU7A 4RMZA 2WIHA 3RBWA 3AXWA 3DFAA 3KN6A 4JG7A 3KFAA 4K11A 5JN2A 2C0TA 5KZ0A 1IG1A 4M12A 2YN8A 5CVGA 5CZHA 4HOKA 4RC3A 4V01A 4L52A 5HCXA 4OUCA 4YTIA 2EUFB 3KULB 2OXDA 1SVGA 4BDHA 4QMLA 4L53A 1Q8WA 5HE2A 2EB2A 4B4LA 3HMPA 5DRDA 4AW0A 3NMUF 4O38A 2QOBA 2VO6A 3G51A 4RVLA 4U42A 2UV2A 4MYGA 4QPMA 1YXUA 4EHZA 4F70A 3U6JA 3FI2A 2PUIA 4NM5A 4YBKA 3R9NA 4C2WA 5AMNA 3Q60A 4ZTSA 4ANMA 2VUWA 2XNEA 4MHAA 4DEAA 3RPOA 5A4QA 3E88A 4C33A 2GNHA 5FP5A 3QCSA 4FICA 2Y8OA 3V04A 2FSOX 2JDVA 2ZOQA 2R7IA 1IAHA 2IG7A 4K0YA 2CHLA 4YHTA 4M14A 4QOXA 2EXMA 5AIKA 3THBA 4QTDA 3IOPA 4IWDA 4HNIA 3QTIA 2ZJWA 1OL6A 2WGJA 4PPBA 3FLWA 4FZAB 3VW8A 4CQGA 4DHFA 5J79A 2IZUA 4ZSEA 5B2LA 5CEOA 3DBEA 4RVTA 4O7ZA 3RKBA 4O0YA 4Q5EA 2JIIA 1CM8A 5IG1A 4JBPA 4HJOA 3HGKA 3ZSGA 2UW9A 3SV0A 2R3OA 3DQXA 4I1ZA 3TKIA 3TCPA 2C5OA 4YTCA 4LI5A 4UMTA 2WTWA 1KOBA 4YNOA 4XV1A 5HBJA 3VF9A 2IW6A 5BYZA 4GT4A 4BIBA 1ZOHA 1JNKA 2R9SA 1MRUA 2PL0A 4O91A 5E7RA 2QNJA 5H8BA 3W2OA 5HVKA 3QD4A 4QD6A 3ZSHA 1OB3A 3ZC5A 3C4ZA 4GK4A 1Q61A 4U40A 2CGUA 4ALWA 4CRLA 5L6WL 2GQRA 4KAOA 3R63A 4KINA 4MCVA 3UZRA 5CT0A 4DAWA 5FP6A 5CT7A 4ACGA 3FMEA 1OKWA 4IB5A 4ID7A 4OGRA 4ACCA 5GZAA 2OW3A 3QZIA 4K2RA 5L2SA 2HWPA 2ETMA 3PG3A 4GKHA 4XNEA 4IX4A 5CLPA 3CQWA 3GU4A 4FV4A 1GZ8A 1PXNA 2BHEA 3HMNA 1PW2A 3NW6A 4RJ6A 4WO5A 4EYJA 4O7TA 2OJ9A 3EFWA 3SLSA 4QPSA 3LW0A 5CSXA 2F7XE 4WG3A 4LM5A 2YM6A 3UO4A 2O5KA 2AUHA 5FD2A 4I5PA 3KL8A 4FMQA 3UP2A 4EOKA 4F1MA 3T9TA 2PZRA 5H8EA 3FDNA 4C2VA 4DINA 5FG8A 4HVDA 3EL8A 4X2KA 5M44A 2B9FA 3BHHA 1GIJA 4FKPA 1FINA 1XJDA 3C50A 4I94A 4NJDA 4PTGA 5E8VA 4A9RA 5AA8A 1WBNA 3DA6A 2ZV7A 5D1JA 5CEMA 2OU7A 3F82A 3QRKA 4IE9A 4IFGA 3MTLA 4AF3A 3MY5A 4E26A 4BGGA 4K77A 3LQ8A 2GQSA 2WU6A 4FT5A 1BUHA 4QYHA 4YZMA 4FT3A 4DTKA 4YU2A 2PUNA 4N4SA 3P23A 4IH8A 1PMNA 4D28A 4N57A 4O86A 5HICA 1PXLA 3GT8A 3NZ0A 1YHSA 4QYFA 4RJ3A 1UU9A 2BILB 4NYEA 2X2LA 3NNXA 1CKIA 4LUDA 4OTHA 4JQ7A 3MFTA 2XNGA 2XNBA 4PQNA 5IA1A 1PRYA 3B2TA 5BVNA 3DB8A 4XG9A 5CVHA 4WG5A 3ZXZA 1M2PA 2V22A 3OY1A 3SX9A 2FB8A 3C4FA 4QMUA 5HOAA 2YLFA 3CD8A 2PYWA 5I9UA 4CFMA 3EB0A 4PTCA 5CI6A 3RI1A 4ENXA 4RLKA 4AS0A 4D2TA 2XRWA 3OWLA 3ZFMA 4EJ7A 2C6KA 3FC1X 5ETAA 4D1XA 4X6RA 4GU9A 1GOLA 5EW9A 5EYCA 4BDGA 5JEBA 4GSBA 4JJRA 2UW4A 3KREA 3MFSA 4U81A 5DH3A 2F9GA 2PE1A 2V0DA 3RAKA 3S3IA 2WQBA 4IZ7A 4WBBB 4FBXA 3R00A 2FYSA 5B2KA 3ORXA 2ZAZA 4FNXA 1L8TA 4E6DA 3AGMA 2HZIA 1H0VA 1ZYJA 3GC8A 3DXNA 4UN0C 5HTBA 4QP7A 4MBLA 2UW0A 4KBCA 2QOHA 3FI3A 5G6VA 3TZ8A 2H9VA 2XUUA 4E5BA 3ZFYA 3EN7A 4GS6A 5KZIA 2JIVA 2C1AA 1OITA 1GJOA 4RQKA 4D1SA 3UNJA 4FEQA 2XVDA 3D14A 3EN5A 3NS9A 4ZIMA 3TZ9A 4MBJA 3D94A 2J6MA 2VTNA 3DNEA 2C6LA 3O8PA 5TOZA 3W55A 4RZWA 4KKGA 5D41A 5FEEA 4QP2A 3O7LB 3OFMA 3Q04A 2I0HA 3I0QA 2YAAA 4P5QA 3OD6X 2J5FA 2PVHA 5IUIA 3ZLWA 4NW6A 5CNNA 3L1SA 3F6XA 5CU3A 5GHVA 2B54A 4WT6A 2QO9A 2QOFA 5IA0A 5E8UA 4E4NA 5GINE 2VTLA 4MD7E 4O22A 5TT7A 5A4EA 5HE0A 5M4CA 4ACDA 4A06A 1YDSE 3QQUA 4FIGA 3W2SA 3PXKA 1WBVA 2P55A 2W4KA 5AV1A 3W8LA 4USEA 3NWWA 4BVUA 5LJJA 4EEVA 3GBZA 2C5NA 4IIRA 3E3BX 1OKZA 3KXGA 4QYYA 4O7WA 3ULZA 5GJFA 4DA5A 4O6EA 4HGTA 3NW7A 5LCKA 4MK0A 4DBXA 4QT1A 5CTPA 5AM6A 5CSPA 3HMIA 4I93A 4YP8A 2OZOA 4EOLA 1Q8UA 2JDRA 4L3LA 4BDCA 5CY3A 4FEUA 5HLWA 2E2BA 2WQNA 5C01A 2QQ7A 3NIZA 4WD5A 4GK2A 4RC2A 4X2FA 4LOPA 1PMEA 2OGVA 3FYKX 3S1HA 1Y91A 4W9WA 2RFDA 4YC6A 3QD3A 3HAVA 3BEGA 4AN2A 2YZAA 2YIWA 3D5XA 4PMPA 4C4FA 1OIRA 3DOGA 4FTUA 3AC8A 4FSWA 2ITUA 2R4BA 1FQ1B 3SD0A 3QWKA 4MWHA 5KX8A 1Y57A 2PVMA 5DT3A 3LXLA 4O0UA 2R3FA 4X6QC 3VS0A 1IRKA 1H1SA 1OL2A 1UKHA 3QXOA 4N6YA 4YJQA 2YDJA 3RNIA 4O7YA 3TKUA 3SXRA 3KRWA 4RA4A 2BFYA 3DLZA 1KOAA 1PXKA 3R0TA 3KXMA 3NAXA 4MBIA 5BQ0A 4GU6A 4RGJA 5EI2A 4EI4A 2XH5A 5IUGA 3UG1A 4IX6A 2UVYA 5CWZA 5CEKA 1UWJA 3RJCA 2XIRA 2OF4A 3DPKA 3LFQA 4R7HA 5EI6A 2IZTA 4P2KA 2NPQA 5FWKK 3KK9A 5FXRA 2OBJA 2PZPA 1V0PA 3P78A 4TNBA 2XA4A 3ZHPC 4BI2A 4DEHA 4XMOA 3C1XA 4WOVA 1ZYCA 4IEBA 4QNAA 5J9ZA 3FXXA 4C02A 4RLLA 4U5JA 3EKKA 2OH0E 2XNMA 4MVFA 4NZWB 2BHHA 3PY0A 4NH1A 1UVRA 4NM7A 3G0EA 4FOBA 4XP0A 3T8OA 3DV3A 3PZEA 5HHWA 4BL1A 4IAKA 4FVRA 2W1CA 4LMNA 4UZDA 4DH8A 4FKIA 4J99A 3R1YA 4UYNA 3AC4A 3GOKA 4JG8A 4U0IA 3C5UA 3RTPA 4FTIA 4B0GA 4IHPA 2XEZA 4IBMA 4LL5A 4C37A 4KS7A 2A4LA 5FTOA 5EW3A 3KEXA 5EDPA 3ANRA 3EN4A 3LQ5A 4DFLA 4D9TA 4K33A 2J0MB 4X2JA 3MPAA 4JDIA 4QMXA 5AP5A 5K5XA 3OOGA 3AT2A 5CF5A 4S2ZA 3BLQA 4NIFA 4IX5A 3UBDA 3O8TA 2CLXA 1OL5A 2O3PA 4U9AA 4ZLZA 3AD5A 4G17A 3KKVA 3ZRKA 5DR6A 4TTHB 5IDNA 4CCUA 4G5PA 1IR3A 1LEWA 4HVIA 4BKJA 3FSKA 3VS1A 4FSMA 4OBQA 3FQHA 4CYIA 4EORA 1S9IA 3WF6A 1URWA 3QQLA 3VF8A 3ZLXA 5IH6A 3SG9A 4YJVA 4WUAA 3QQGA 4CT1A 4CFXA 3D5WA 4PPCA 1GIHA 1IEPA 4NCTC 5CAUA 3GCVA 5HG8A 5AR5A 2GFSA 2ETRA 2WFYA 4FODA 4GJ2A 5AR4A 2B1PA 5HLPA 5J9YA 2OK1A 5LWNA 2J2IB 1MRYA 5HU3A 3HLLA 3BI6A 4IM2A 3VS5A 1DI8A 4TXCA 3SW7A 2R7BA 4NUSA 5C8NA 1GAGA 4O82A 2JITA 4H39A 2OIQA 3DJ6A 3PPJA 3SXFA 4BB4A 4CMUA 1V1KA 3D4QA 4G16A 3K54A 2ZYBA 3JUHA 4K8AA 5DIAA 4ZXTA 4CZTA 5J5SA 4MXOA 4EOIA 5CQUA 1YI6A 5AP1A 4ANQA 4GMYA 4DCAA 2HYYA 4ZTRA 2R3RA 2W1FA 1IA9A 5C9CA 3D7TA 5IQEA 1YWVA 3Q6UA 1PYEA 2A0CX 2RFSA 4UB7A 4RZVA 5HVJA 3V6SA 4H1MA 4RX5A 1Q99A 4M3QA 4DFNA 1ZLTA 1OBDA 2XNOA 4GFGA 4NTTA 4ANNA 5LWMA 3UZTA 4QMYA 1ZMUA 3VJNA 2PTKA 4PDOA 1ZY4A 2PUUA 2NRUA 4CFFA 2XNNA 1PXOA 1QPDA 4XLIA 2WMBA 4BDDA 3S4QA 5KBQA 2B9JA 5TF9A 2GHLA 3OUKA 4L44A 5KMLA 5CS6A 5KKRC 3TUCA 4DFUA 5IQDA 4EC9A 5AP7A 4YPSA 3ZUUA 1H1PA 4CLIA 4OAVB 3GC7A 3QLFA 1OL1A 2YWPA 4CZUA 3R8ZA 2X8EA 4BWKA 1CKPA 4Y46A 1OIQA 1P5EA 5L8JA 4EOPA 2JD5A 1EH4A 3LFFA 4R3CA 5KMOA 2EU9A 5HG9A 4A4XA 3IK3A 4HVGA 3QX2A 3N9XA 4RWIA 4ZZOA 5KMIA 1CTPE 2G15A 2BIYA 4FL3A 4Y5HA 4OR5A 5M56A 2F49A 3TTJA 4HCUA 2ONLC 4KBAA 2WNTA 1SNUA 1CKJA 5CAPA 4U3ZA 1Q3WA 3QQKA 3R7UA 4KKHA 4W4VA 3V51A 2I0YA 3SAYA 4FSRA 3ZCLA 4QMOA 1JQHA 2B52A 1ATPE 2QOLA 5CANA 5CU0A 4RJ8A 4EOMA 4PDYA 3BZ3A 3UPXA 4FTJA 5JFSA 1U59A 2QVSE 3DS6A 4ASZA 2CN5A 3I1AA 4GUBA 1FOTA 3I5NA 3TL8A 1H28A 3CTJA 4CV9A 1XBAA 2YM4A 3OWJA 4J53A 5ANEA 5H9BA 5HLNA 3FE3A 2FUMA 3WARA 5HBHA 5GNKA 4F0FA 1XH5A 3LAUA 1OVEA 5EDRA 5M51A 4IX3A 3ET7A 4IAIA 4IVDA 4B6LA 5BMSA 3CE3A 4TT7A 3GUBA 3K3JA 3OC1A 3OT8A 4I0TA 4C4JA 5LXMA 3PSBA 5FDXA 1WBSA 4BWPA 4C36A 4NIFB 4BTKA 4BBFA 4KRDA 4CXAA 3OCGA 3P79A 3QU0A 3COKA 4CLJA 4B8LA 4IWPA 2QHNA 4FKLA 2RFEA 4HYSA 3L8XA 3RVGA 3F7WA 1KE8A 5H2UA 5J1VA 5AR2A 3V8WA 2XK8A 5IH4A 4BI1A 1UU3A 2B9IA 4FVQA 3UVPA 3FPMA 4GYGA 2C3LA 3R21A 2XIXA 4CSVA 2W1DA 1M14A 3HRCA 3FZPA 4BGQA 3PLAE 3R7IA 2UZOA 2VWVA 3NPCA 5AUUA 3A8XA 3U6HA 3A4PA 2G2HA 3FLYA 4GT5A 4RIWA 4UMPA 2G2IA 4JDHA 5ANKA 4ANSA 3QYZA 1GZNA 3AC1A 3I5ZA 4Q9SA 3G6GA 3LXPA 5LARA 2W17A 2Y4PA 3PIXA 4U6RA 3VS3A 3ZMMA 4FNYA 4ALVA 3A61A 5AJQA 2W1HA 4U45A 4DITA 4FZFB 1STCE 1XWSA 3WYYA 5F9EA 1BL7A 2VNYA 2YITA 4Q9ZA 3HV5A 2Y7JA 3MVJA 2WD1A 3UOHA 4EWHA 3R1NA 3D7TB 5E4HA 1GNGA 2QODA 3BWJA 4R3PA 3T9IA 4WRSA 2UZLA 4K9YA 1JAMA 2W1GA 3Q5ZA 4C57A 3RWPA 5JFXA 4C4GA 2G1TA 2R3GA 4CVAA 3BYVA 3FZTA 3OEFX 4I22A 4II5A 4DH3A 3KY2A 4M0ZA 2CKPA 2YM8A 3II5A 2ZDTA 2VTSA 5HZNA 5M09A 4QTCA 2CN8A 3QTSA 4JG6A 5LOHA 4UBAA 1SM2A 1O9UA 3TZMA 3UYTA 4NM3A 4CCBA 1PF8A 1Q62A 5DR2A 3CKXA 3V5TA 3IS5A 3OS3A 3Q32A 4NWMA 3R8LA 1REKA 2QKWB 3LZBA 4MXZA 3PA4A 5M07A 4G3FA 3KXNA 4EHEA 1XH6A 2Z02A 3NUXA 5EKOA 4M13A 3V8SA 4FOCA 3FLSA 4K6ZA 2OSCA 4RWLA 3R6XA 3QCQA 5M53A 3T3UA 3HDNA 3BYUA 4D4YA 3O17A 1SZMA 2YIRA 3PJ2A 4M66A 3W1FA 5F4NA 5FXQA 4HVHA 3QBNA 2WXVA 2WPAA 4BZDA 4O81A 3G5DA 5LMAA 5IMXA 4FTQA 4ACHA 2UZUE 3L9MA 2BAQA 5AUYA 3PE2A 3FLQA 3VVHA 3ZONA 2FSTX 3IDBA 2XEYA 3ZEPA 3D7ZA 2BUJA 3IW4A 1JSUA 3CXWA 4XBRA 2JKQA 4D1ZA 2NO3A 3F69A 5IA2A 5JH6A 1XHAA 3OW4A 5EM5A 3VUTA 1UU7A 2XS0A 4Y8DA 4RVKA 3KMMA 3KU2A 3QC4A 4AGCA 3PSCA 5F95A 2W9FB 5IQHA 3WIGA 4RJ5A 4BCQA 2C69A 1J3HA 4LYNA 4RA5A 3D0EA 3IW6A 4A4LA 5M4IA 3BGZA 4UZHA 4S30A 4YLKA 2UZVA 3MI9A 3Q4ZA 4G34A 5HX6A 3BBTB 4GV1A 5E91A 2QONA 4F9BA 4A9TA 4RRVA 2R3KA 4KKEA 4IAZA 2V7OA 4I23A 4XUFA 3EQFA 5LVMA 2SRCA 5JQ8A 2W5HA 3E5AA 4FIJA 4QMVA 3R7EA 4U7ZA 5EFQA 2UZWE 4LV5A 1CDKA 1WAKA 3BE9A 4S34A 4YJPA 2ZV2A 3FHRA 4O1PA 3V5LA 5DEYA 3ORMA 4QYGA 5DNRA 3PPZA 2R3QA 4F1OA 1YXXA 2XBJA 5DE2A 1OUKA 1J91A 2R3MA 3GNIB 3CJGA 5K4IA 3E64A 4YLLA 3VUDA 3QKMA 1ZRZA 2GNIA 2WQMA 2W06A 2YIXA 5EHOA 5L2IA 5FGKA 4USFA 5IISA 1IAJA 4CRSA 2Q83A 2JAVA 2VTMA 3ODZX 3ZC6A 2FO0A 4I5CA 4GVJA 5KUPA 2YFXA 4RIWB 3U8WA 4DGNA 4MXXA 4NCTA 4HCVA 4PWNA 5C8KA 5HGIA 2O2UA 1APME 5I4NA 3KB7A 2WU7A 1G5SA 2VTTA 3DBQA 2X9FA 3FPQA 5HTCA 4E6QA 2PE2A 5KMJA 1Q24A 5CALA 2Q0NA 4O7VA 2HZNA 2OLCA 3I0OA 1OMWA 4LQMA 1RJBA 4IVBA 4XG7A 5KBRA 3IGGA 2PVLA 2O65A 3N4UA 3O8UA 4IJ9A 4IZ5A 2P2IA 2WMTA 4CFUA 3Q5IA 4W4XA 5FM3A 1LEZA 4JNWA 3U6IA 4XS2A 4DE4A 3NUPA 5TE0A 4NM0A 4YPDA 5M57A 2XKDA 1YQJA 1G3NA 4O2ZA 4KIQA 3UNZA 5AAFA 5EDQA 1A48A 3A7JA 4GIIA 4CEGA 5JFVA 4BBEA 2PVRA 2VTHA 4BKYA 3A4OX 4DG0E 5IH5A 4H3QA 2OJFE 3ORZA 3PWDA 4JAJA 3FI8A 3KMWA 4LUEA 3NEWA 5HIDA 1GY3A 4FUXA 2BMCA 4FZ6A 1KWPA 4O0SA 1OKYA 2GTNA 3RAIA 2C4GA 4CG9A 1YVJA 2E9VA 2EB3A 3NUSA 3MVLA 4UMUA 2ZB1A 3ZM9A 1NY3A 3TNQB 4FT0A 1TVOA 2Z8CA 2CNQA 4LRJA 4RG0A 4I5MA 2PU8A 4C62A 4DCEA 1YWNA 4DC2A 3T3VA 2BZHB 3H0ZA 3L8SA 2I0VA 4QMQA 4NL0A 3W2PA 2BIKB 3ZZEA 2R2PA 3ZFXA 5EYMA 1W84A 4IMYA 1YDRE 4FI1A 4X7QA 3U51A 3BE2A 4C61A 5EHLA 4E7WA 2GS6A 3Q52A 1OGUA 3DAEA 3IONA 5L2TA 3BHUA 3DKGA 4BDAA 4D9UA 4DEEA 3ATTA 2ESMA 2XP2A 4JIAA 1WBPA 3HKOA 2PZYA 3ORIA 3OUNB 4JI9A 3LLAA 4GL9A 4RIYA 3GOPA 4BRXA 2Y6MA 4FKVA 4MXYA 1B39A 2WOUA 4MXAA 5E90A 3VIDA 1IASA 2ONLA 5EQYA 2RFNA 4OTGA 3C0IA 3BYOA 4U79A 5BYLA 1A9UA 4H3BA 3B8QA 4MH7A 2XJ1A 1I09A 3EQRA 4X3FC 4ASEA 3KC3A 4JRNA 5CF6A 3FYJX 3NNVA 2BR1A 4FKJA 4QMSA 4D55A 5AIRA 4BF2A 1H0WA 5EM7A 2WTIA 4BDEA 4KSPA 3HV7A 3PZHA 2WEIA 2CKEA 4QP4A 5CYIA 5GZ9A 3SVVA 1W98A 3BKBA 3KRXA 4CQEA 2VRXA 4J71A 1CMKE 3KF7A 2V55A 5A9UA 2ZVAA 2WMRA 1JSTA 3VULA 4RFZA 2XKFA 2WELA 4YGAA 2BRGA 4USDA 4AW2A 4BWXA 4Z55A 5CAOA 5ICPA 4F99A 4U97A 3NAYA 4HCTA 4IQ6A 3QTUA 3TUDA 1ZYLA 2BKKA 4ZS0A 3L8PA 1MP8A 1YI3A 3HV3A 4H1JA 1UU8A 2OJGA 5AUWA 5T6KA 3UIXA 5J1WA 3AOXA 4D2WA 5CSWA 2YZLA 2VGPA 2QOCA 2VX0A 3ODYX 3NR9A 5JFWA 2J0LA 5CNOA 5A46A 3H9OA 3WF8A 3OZ6A 4AACA 4XG8A 5AV0A 2W1ZA 4DEGA 5BVFA 2NNWB 2HENA 4E73A 4WKQA 3R83A 4F4PA 2WMAA 4UMQA 4W4WA 4BCGA 4FTTA 4ZY5A 1Y8GA 3KXZA 3KCKA 4EH9A 4IACA 4OT6A 2Z7LA 4DH7A 3K2LA 4D4VA 3DK6A 2ITNA 3SRVA 4L00A 3RK9A 4X2GA 4IADA 3LQ3A 5L6OA 1B6CB 4IWQA 2PVJA 4LRKA 4QRCA 1XH9A 1KE6A 4JDJA 3WILA 4DG2E 4HVSA 4R78A 1BL6A 3C5IA 4IWOA 4NJ3A 5BNJA 4BC6A 4ZSJA 5C4LA 3MFUA 2C0IA 4EH6A 2VD5A 4XOZA 4HGLA 4BCPA 3FXZA 1JPAA 3HYHA 4I24A 3DY7A 4F63A 2I6LA 4U44A 4FTNA 4O7SA 1ZWSA 1V0BA 4BCKA 4APCA 5KCVA 4FA2A 1UNGA 4BY9E 4BTJA 4Y85A 4QQTA 2QOOA 4H05A 4P7EA 3QWJA 5CEIA 4D0WA 3ORTA 5E92A 5K0KA 4FVPA 3R8UA 4XHKB 2YABA 4IVCA 2F57A 3E8DA 3VS7A 3MW1A 3Q2MA 4F09A 5KHWA 3UQFA 3LFEA 3QX4A 3AC5A 3C9WA 3ZEWA 1JKTA 2BDFA 5LVNA 4ONAA 4C4IA 2J0JA 4BDKA 2OI4X 5DBXA 4XRLA 3C0HA 3BV3A 5EM8A 2AC5A 3D9VA 3WZDA 4F6UA 1AGWA 5FBNC 1PXJA 3F61A 2QOQA 4L45A 3OHTA 3VQUA 3TIYA 4AZVA 5HQ0A 2X7GA 5KKRB 3DCVA 3LOKA 4BDIA 4C4EA 2JAMA 4FV3A 1JBPE 3PVUA 4ZZMA 2HELA 2ITWA 5GJGA 3UQCA 4A9YA 2BZKB 3PTGA 3RNYA 4CT2A 3E7VA 3IPHA 4EOJA 2KULA 4WRGA 1KE5A 5HD4A 4NKSA 5AFVA 5T68A 3R9DA 3UNKA 4RX7A 2JKOA 5HE3A 1YRPA 4L46A 4ZOGA 3VRZA 2QG7A 3SQQA 1AQ1A 4DFXE 4DEDA 4ZY4A 4GIHA 2UUEA 2VU3A 3FAAA 2Y4IC 3DDPA 3I6UA 4DG3E 4MX9A 3HP2A 4RIYB 4YO4A 3S00A 3DU8A 2YCSA 2BFXA 5KMNA 4ACMA 5DPVA 1QMZA 3EQPA 3H10A 3RGFA 2WMQA 3VBVA 2Z7SA 1K3AA 1QL6A 4OLIA 5EOBA 4IXPA 4KWPA 2HOGA 3QC9A 5JZNA 3V5QA 5BPYA 5BUIA 4QO9A 4E20A 2ZV8A 4L3JA 3ZO2A 2CNVA 4MAOA 3MY0A 5FQDC 4O0TA 2HW7A 5E8ZA 4KRCA 3GFEA 3GP0A 4YBJA 4PNIA 5IQGA 3KVXA 2O0UA 4AZEA 4O7RA 2OIDA 2UW3A 5I0BA 4EH5A 4QMWA 2G9XA 3DBCA 3RCJA 3IDPA 4TYGA 3BGQA 3WF7A 3NVKI 3BU5A 4M7IA 5J95A 3GFWA 4I21A 4O7NA 5IPJA 4GKIA 2JGZA 4EJNA 4PP7A 1Y6AA 5HE1A 1DAYA 4PNKA 4E1ZA 3FV8A 4AW5A 4O0RA 2QU5A 4ALUA 1M17A 3FY2A 4ANOA 4BICA 1FPUA 3ZUVA 3PYYA 2XYNA 2GTMA 3PXQA 2QR8A 1H1WA 3GU6A 3F5GA 4QTEA 1DI9A 3DZOA 3Q9ZA
chains in the Genus database with same CATH superfamily
1UNHA 3KA0A 2VO7A 3CBLA 3HRFA 3Q2JA 3W2QA 2EXEA 3NUNA 4I92A 4GFOA 2J51A 4O21A 2XM8A 5DT0A 1ZYDA 4UXQA 2OICA 4AFJA 5BVWA 3P86A 4JBOA 3LPBA 5ANJA 3SRVB 4AWIA 2WHBA 4ZK5A 3OMVA 2IVUA 2EVAA 3PY3A 3TZ7A 4R7IA 3KGAA 3O2MA 4F7LA 4YURA 3ZM4A 5EH0A 2BRNA 5GJDA 3LLTA 3WZUA 2IZSA 1KV1A 3IQ7A 3VBTA 3ZSIA 4DN5A 4JQEA 3IO7A 3KF4A 4FTAA 5HG5A 2CGWA 3NDMA 3LCTA 5JGAA 4Z7GA 4ZSGA 5I9WA 5JZJA 2VX3A 3ZYAA 4UWYA 3HX4A 1WBTA 5GIOE 3EWHA 4FV7A 4O6LA 3KVWA 3FY0A 3H9RA 2BDJA 5AM7A 4HPUE 2GNLA 4YJUA 1UA2A 3WZEA 1R0PA 2WTVA 3OCTA 3UTOA 3H0YA 4PV0A 3U9CA 3PJCA 4O2PA 3C7QA 4EOOA 3UDSA 2C0OA 2XIYA 3W18A 5CF8A 2YLEA 4JVGA 3IECA 4U43A 2VN9A 2CCHA 2OZAA 2J5EA 3BQCA 3BWFA 4C35A 3HEGA 1J7LA 4UALA 4FEWA 4IW0A 1YOJA 5FRIA 5IQFA 5CASA 3UODA 3S2PA 2F4JA 5AV4A 3F7ZA 2W7XA 5DMZA 1E1XA 3MVHA 2QO2A 1OIUA 4KIPA 3OXTA 4FE2A 2WTJA 3TWJA 4M15A 2FGIA 5GIPE 1FMKA 1ERKA 2RL5A 3NUUA 4FTOA 3WE8A 2PUPA 3ZO4A 5AAGA 4J95A 3LFAA 3LVPA 4PP9A 4XJ0A 2ZMCA 3RALA 3EHAA 4ZMFA 5CSHA 2VTOA 3SDJA 5J5TA 3IKAA 3NUYA 1WVYA 4WHZA 3MDYA 3UE4A 4YUQA 2LGCA 3MS9A 5FM2A 5HESA 4C3RA 4G6OA 3LCOA 4EH7A 2HWOA 3F5XA 5IQBA 3LXNA 2VWXA 4OTQA 3PA5A 4BCNA 3FZRA 4YHJA 4Y5QA 3BU3A 3R2YA 2HIWA 3JR1A 2EXCX 3PA3A 4DT9A 1SYKA 3B8RA 3COHA 5A14A 5HX8A 3D5VA 1DM2A 3FXWA 2F2CB 1A06A 3IDCA 3DFCB 4I20A 4QMPA 4ERKA 3UIUA 5M4FA 1Z9XA 3VRYA 5HIEA 4O0WA 5HU9A 2PVNA 4X3FA 4EZ7A 1H8FA 4C8BA 5AUTA 3TACA 3S95A 4C7TA 2X8IA 4UMRA 4E5WA 4ZMEA 2RKUA 5K3YA 4UWBA 4RJ7A 3C4EA 4ZTNA 2I0EA 1XH7A 4DFYA 5M55A 3MV5A 4X2NA 1GZOA 2C30A 2C5YA 3EN9A 3V01A 4FKTA 1JWHA 3QA0A 3RPSA 5AV3A 3C13A 4E4MA 1TKIA 5FTGA 2C6IA 5I3OA 3TNWA 3LHJA 3NX8A 4O0VA 3FMJA 2IJMA 4FZ7A 4G1WA 4UYAA 3U54A 3F2RA 3A99A 3CY3A 3ID6C 4I0RA 3VBYA 5AWMA 4LMUA 4CFVA 1XMMA 4QMTA 5IQIA 4XG3A 3RWQA 5AX9A 2GMXA 3TYKA 2HY81 4FV2A 3RM7A 1E9HA 5IMEA 4OTPA 5K0XA 3CIKA 5EKNA 2YM3A 2PHKA 4L9IA 3ELJA 1T45A 2G2FA 1OPJA 3AT4A 4J1RA 4QQCA 2KTYA 3MIAA 5LVLA 4I6LA 5AV2A 2CKOA 3BYSA 1W83A 4ZLOA 4Y73A 4JOAA 4DH5A 2GHGA 2XB7A 4PMMA 4CV8A 2P33A 2XK7A 4EH8A 4BZNA 1R1WA 3SC1A 3OBJA 3R22A 4BCOA 1OI9A 3K5UA 3R30A 5FBOA 3RZFA 3G15A 4G2FA 2JKKA 2E9OA 4FV0A 3BLHA 4XX9A 4FKUA 1OPKA 5TR6A 2I7QA 3EMGA 2CKQA 3EQGA 1WVXA 2IVTA 3KXXA 5A4CA 2YDIA 1H1RA 2J0IA 2IW8A 5I9ZA 2OH4A 3G6HA 3VUHA 3UOJA 2W1IA 5AUZA 4BYJA 4RIXA 4JX3A 3NCGA 4R5YA 3QRTA 2CGXA 1OBGA 3QXPA 5KMMA 3NRMA 3HMOA 3FC2A 4WNOA 3CY2A 3F3WA 4AN9A 3FI4A 4NU1A 3PY1A 5HCZA 2OZAB 1NVSA 3I6WA 2ITZA 2PULA 4FNWA 3BIZA 3ROCA 1IA8A 2XKCA 3TJCA 2BTRA 2RG5A 3P7BA 4F1TA 4O83A 3C0GA 2VTJA 2QLUA 3GC9A 1P4FA 2OWBA 3UOLA 3RHXA 3AD4A 2WKMA 5HBEA 4DH1A 3BL9A 4CZYB 1BX6A 2GS2A 3QQFA 4AT3A 2PMNX 2BZIB 2QOKA 2YCFA 3HV6A 4TWCA 3PJ3A 4C0TA 3V6RA 4FKSA 2JDOA 3ORKA 4JL9A 5KO1A 3TJDA 4EK8A 5BUEA 3FKLA 1FVRA 4G31A 1NXKA 3V5PA 4NEUA 1WCCA 1H26A 4D4RA 2P4IA 2XK9A 4MD8E 3VO3A 2JFMA 3A60A 5JQ5A 5F94A 4U41A 3EL7A 1W8CA 2X6DA 3HUCA 4TY1A 2JEDA 3UG2A 4AA0A 3HA6A 4FIIA 5ETFA 4R7BA 3A2CA 3DKOA 4IM0A 4MNEA 3MYGA 3UC4A 1VLRA 3BL7A 2QHMA 4EUTA 3FKNA 4M97A 5EI8A 3ZDUA 2UZNA 5G1XA 3OWPA 3NYXA 3DXQA 2BPMA 3R8MA 4XG4A 3AMAA 3PPKA 4DGMA 1B38A 4X3FB 2ETKA 3IGOA 4CMTA 4AGWA 4O0XA 3A8WA 3QGYA 4YZCA 3OF0A 2XAOA 1XBCA 3NVMB 1ND4A 1XMLA 2ITVA 4JAIA 5HG7A 4KUJA 1QPEA 3NCZA 2C6TA 4AXCA 1TQIA 2QR7A 3A7FA 4F9AA 4YHFA 3ALNA 1H25A 1Q4LA 4XYFA 5DN3A 2VO0A 4AZSA 1LPUA 2PMLX 2Z7QA 3A62A 5J7BA 5CENA 5J9LA 2Z7RA 5HCYA 4ZJIA 3LCSA 4AA5A 4IDTA 2VTRA 3VBXA 2VWIA 4OAUC 2C5VA 2W4OA 2V7AA 3FL4A 4FRFA 4MF1A 4IZAA 2DYLA 5IU2A 5D9HA 3MVMA 1XR1A 3OXIA 2UVXA 5DT4A 3UZPA 3WF9A 4TYJA 4TWPA 4JBQA 4NFNA 3NUAA 3F5UA 2CMWA 4FSTA 3CTQA 3ZBXA 4FZDB 2E9PA 2X81A 3ALOA 3ZBFA 3ZRLA 4RX9A 1Q5KA 2YWVA 2WTDA 5DLSA 1VJYA 3MSSA 4FEXA 2OO8X 3I4BA 4HGEA 1GZKA 3UO6A 3IW8A 4EUUA 3H30A 5DR9A 1FVVA 4ASXA 4BYIA 2W4JA 3ATSA 1JOWB 3NNUA 4YZNA 1ZOEA 4BCIA 4P90A 2GNGA 3BHYA 2B53A 5IA5A 1I44A 3OCBA 3EIDA 3KN5A 5F1ZA 3TNPC 3W0MA 1P2AA 4R3RA 4AXAA 1M2QA 2C68A 1Q41A 3Q9YA 2O8YA 1RDQE 3FJQE 5TO8A 1VYZA 1YDTE 5ANGA 3HA8A 4F65A 2WTKB 2PPQA 4RIXB 4AT4A 4I4EA 4E6AA 3UO5A 4FYNA 4AZTA 1XQZA 4QMZA 1KE9A 5TKDA 4ZP5A 4F6WA 5L8LA 5I9YA 3CEKA 3UOKA 1SNXA 4FG7A 1OM1A 4FTCA 4DEBA 4JR3A 3E8NA 5CVFA 3QHRA 1NVRA 2F2UA 5AUXA 3P7AA 5EOLA 1TQMA 2YM5A 3MH3A 4M68A 4TPTA 2C6MA 4HZRA 5ACKA 3C4XA 4XH6A 5J8IA 4F0GA 1MUOA 3MPMA 4DBNA 3E62A 1CSNA 3AGLA 4YC3A 3G9NA 4GG7A 2OJJA 4MD9E 4Y95A 3QRUA 2VZ6A 3QA8A 2O64A 3N51A 4K18A 2ZM3A 4LOOA 3C4CA 5BX0A 3VHEA 4KNBA 1ZZLA 3M1SA 4BFMA 2CCIA 2XYUA 2R3PA 4JT3A 1PKGA 2BAJA 1NVQA 1H4LA 2UW6A 4GFMA 3WIKA 4JQ8A 2X2MA 3FZ1A 4FG9A 4RC4A 4EK4A 2HAKA 4EL9A 3CD3A 1YHWA 4QPAA 3HMMA 2UW7A 2XNPA 2Y4IB 2C3IB 4X3JA 3RPRA 3U87A 3QTWA 4MNEB 4DGOA 2H6DA 2PSQA 4G5JA 2OG8A 2X9EA 2LAVA 5JKGA 5ANDA 2GNJA 3EFJA 5J7HA 3EYHA 2QG5A 4RWJA 3DGKA 5LCJA 3ROYA 3CQEA 1L3RE 3CP9A 4BTFA 3NYOA 5C26A 3BPRA 4GJ3A 1YWRA 2QLQA 3SW4A 2QOIA 2P3GX 2VWWA 5DEWA 5EK7A 3W16A 1H01A 3E3PA 3FMMA 5CEQA 3VS6A 3NNWA 5E8SA 4BDJA 1ZXEA 3R71A 3M11A 5E9EA 4FSZA 3FMLA 4S33A 5L3AA 3PRIA 3AG9A 4FX3A 3GB2A 3GI3A 4RQVA 2R64A 4I41A 3FQSA 3SXSA 3UGCA 3MA3A 3KRJA 3Q6WA 3UJGA 1R3CA 4GH2A 3CSVA 4ZY6A 3LCKA 2H34A 3LCDA 1OUYA 4RWKA 4CNHA 4F6SA 3FL5A 1FVTA 4YZBA 3DAKA 4MF0A 2JBOA 4PX6A 3CGOA 3OTVA 3JS2A 1H27A 3W33A 1PXMA 2W96B 4CKRA 1QPCA 1RW8A 4CTCA 3SG8A 3Q9XA 2DUVA 3MBLA 1JVPP 4U3YA 5JGDA 4XV9A 5ANOA 4BIDA 3CLYA 3NSZA 4LG4A 1P14A 2HK5A 2X6EA 3VBQA 4WUNA 3GVUA 3QUPA 4AGDA 2CGVA 4LGDA 4R1VA 3O96A 5H8GA 4IB3A 2WEVA 3TIZA 1Q8TA 4PMSA 4F7JA 1E1VA 5DRBA 1VR2A 2JFLA 2WZJA 3ORPA 4JBVA 2NYAA 3SOCA 3SA0A 2JIUA 4MNFA 4O96A 3W8QA 3E8EA 5E1SA 2J9MA 4WSYA 3ZOSA 4CGAA 3GU8A 5L2QA 4AE6A 4HYUA 2IPXA 3TXOA 2GFCA 5HI2A 3MTFA 4GW8A 4M69A 4GEOA 3DAJA 3QQJA 2EWAA 4D2RA 3VS2A 1BLXA 4PL5A 1JLUE 3E92A 3GENA 4BI0A 1ZYSA 4F08A 3L8VA 3BU6A 3QF9A 1M2RA 5HEZA 2YJSA 2ITQA 3U4UA 4AP7A 4DTAA 1SVHA 3QQHA 4YJOA 3L9NA 1W82A 4FG8A 3A7HA 2E9UA 4LRMA 5T3QA 4J8NA 2G01A 2W99B 3VNTA 2CDZA 4R1YA 3KXHA 5E8TA 2C5XA 4DDIA 3FSFA 3FLNC 4DHJA 4B7TA 2VTIA 5A54A 3PFYA 4AG8A 3FKOA 3W32A 1AD5A 1OL7A 2CPKE 2GQGA 3PUPA 3CQUA 2BKZA 2WTCA 4XP3A 3QD2B 4OT5A 3CC6A 3I7BA 3TKHA 5EQEA 3LM0A 2YCRA 3PIZA 4OBPA 4YJTA 3ZUTA 3BHVA 3OY3A 1ZOGA 2V5QA 3Q4UA 3JVSA 4ZAUA 2CLQA 3LE6A 1PXPA 2X7FA 3KMUA 3MH0A 2UZDA 4P5ZA 4Y72A 4C3FA 3RAWA 4A4OA 1M52A 1W0XC 3PVWA 4YMJA 3PLSA 2B4SB 2BAKA 3MJ1A 3PXYA 3EZRA 2P2HA 3VUIA 2WQOA 3PVBA 3MB7A 4N6ZA 4GRBA 3UPZA 4JS8A 5BVEA 4FT9A 3V8TA 3AQVA 1WFCA 4DDGA 4EH4A 4DFBA 2BZJA 2PWLA 3E7OA 1RE8A 4Z16A 4UX9A 4N0SA 4I0SA 3UVRA 3REPA 5IQAA 3PXZA 2WMVA 3E8CA 2GS7A 3G2FA 2C6DA 4MTAA 5CQWA 1Z5MA 3F66A 1YXSA 3KRRA 5KMKA 2JDTA 3DNDA 2W9ZB 5C8MA 4XP2A 1VZOA 2BTSA 5BVOA 2QO7A 3DT1A 3R7OA 4L01A 3AC2A 3M2WA 4CTBA 2OKRA 4AZFA 2VWUA 4AA4A 4QQJA 4A9UA 4O7LA 4HGSA 5AA9A 1H08A 4C34A 4G3DA 1FGKA 3QZHA 2ACXA 3FZOA 3BCEA 2JBPA 1G8JA 1XBBA 1YKRA 2YISA 3GCQA 4BCFA 3GCPA 5L8KA 4E4LA 5FUTA 4YJSA 2X2KA 3DTWA 5LQFA 3AD6A 4JRVA 4B8MA 1U46A 3O71A 4DF3A 3AT3A 3QALE 4NT4A 4BDFA 3MH2A 2QCSA 2YCQA 5FXSA 4AW1A 5E8YA 1M7NA 4RFYA 4WIHA 1U5QA 3F9NA 3CS9A 2X4ZA 2CNUA 1JKSA 4Q5HA 5BVDA 2OIBA 3ZTXA 2WTKC 3BBWA 5AP0A 3U9NA 4BCHA 2QURA 3R04A 1J1CA 4NW5A 5EM6A 2IZRA 4BHNA 3UDBA 1VEBA 3NIEA 3MA6A 4KABA 1JKKA 4TWNA 1XO2B 5CX9A 4KS8A 2ERZE 4UY9A 5JSMA 4YJNA 2WOTA 3QLGA 4S31A 4XBUA 1M7QA 2A1AB 3C4WA 4CKJA 5IZFA 3N4VA 2VV9A 2XMYA 1UV5A 4ANBA 3W0RA 3NW5A 3F5PA 4C4HA 5AP4A 2Q0BA 3E93A 3RZBA 3QL8A 4IAYA 4MQ1A 1OKVA 3P1AA 1YXVA 3PIYA 3NGAA 4ITJA 4TNDA 2BDWA 3LFCA 3PP1A 3O0GA 1G8AA 1ST4A 3FEGA 3LKMA 5IEXA 3QTRA 4EK6A 1PY5A 4M69B 3WOWA 2JLDA 3P08A 4FV8A 2DWBA 5AP2A 4EBVA 4EQCA 5BUJA 3K5VA 5D12A 4D5KA 3LJ0A 2XJ2A 3R01A 4G3GA 1OIYA 4BGHA 4L7SA 2PE0A 4TRLA 2YACA 2ZM1A 2FA2A 1KE7A 1V0OA 4A9SA 2XIKA 3MB6A 4IM3A 2NRYA 2Y9QA 2YA9A 3L9PA 4LGGA 5CU4A 5AP3A 4EK5A 4ZZNA 1ZARA 4FJVA 1J1BA 3HZTA 3DJ7A 4L6QA 4Q2AA 2XZSA 3CR0A 5AUVA 3F3ZA 4HNFA 2A98A 4QP9A 5H3QA 3WYXA 3JY0A 3FMHA 4UWCA 4FSUA 5DA3A 3U4WA 1H24A 1YI4A 4PF4A 3R8PA 3ZZWA 4EOQA 1Z57A 3AC3A 4FUYA 1BMKA 1WBOA 4FKQA 3TV7A 4MUQA 1ZMWA 2VWZA 2ITOA 2UZBA 3PUFC 1RQQA 3RM6A 3PXRA 2PMOX 4AZWA 3PWYA 3VS4A 1LP4A 1PHKA 3KQ7A 5JMSA 4ZJJA 4OTWA 3MIYA 2VGOA 3EQBA 4R8QA 2J50A 4LV8A 5JK3A 4R5SA 5LMBA 2QKRA 2X7OA 1LR4A 4L7FA 5AADA 3R7GA 4UV0A 4EK3A 3LJ2A 4OW8A 4FSNA 4EQUA 4ZTQA 5HO8A 2AEGA 1U54A 3UQGA 2IWIA 2PZ5A 2WB8A 2ZDUA 2ZMDA 3AMYA 2B7AA 3ORLA 3PVGA 3LM5A 3ZXTA 5IUHA 4J97A 5HNGA 4V04A 4X0MA 2FH9A 5LVOA 2IVSA 4O1OA 1KSWA 2BCJA 3MN3A 3P9JA 2H96A 3EQDA 4EHVA 4W8EA 3O23A 3NLBA 4I4FA 4EWQA 4V0GA 2OXYA 2ERKA 4BKZA 5DOSA 5ITAA 1ZAOA 2XKEA 3M42A 3WZKA 2QD9A 3R7VA 4ITHA 2RSVA 3CPBA 5IKWA 4D2PA 3PDTA 5LMKC 3DXPA 4OTRA 1H1QA 3BLAA 3TI1A 3U55A 3LMGA 4TYHA 2J0KA 3NYVA 4NK9A 4WBOA 4YSMA 5E8WA 5K9IA 3N4TA 3EZVA 2YJRA 3TT0A 2IF8A 3ACKA 1NT2A 2QI8A 5ETCA 3EH9A 4L8MA 5KE0A 2JKMA 3HVCA 3W0PA 3QZGA 3RK5A 4E6CA 2BROA 4R6VA 5BMMA 2VTAA 4FL2A 3TV4A 2R3HA 3FBVA 5HIBA 2ZM4A 2BRBA 4GCJA 4E93A 4FIHA 4M8TA 4BTMA 4PMTA 2J4ZA 5M4UA 3FQEA 4EOSA 3VJOA 4EC8A 2HW6A 3DDQA 5D11A 3WF5A 3F3VA 3SOAA 3QKKA 5CEPA 4XG6A 5CI7A 2HCKA 3GEQA 4JXFA 1WBWA 2W5BA 1VYWA 2OJIA 5B0XA 4APPA 3W0OA 2YDKA 4BR3A 3COIA 3Q3BA 3R8VA 4RVMA 4XV3A 3LFNA 2VWYA 3EJ1A 3WI6A 4AE9A 5I9VA 4KA3A 3D83A 3PFQA 4B99A 2BRMA 4FK6A 4FYOA 4Y83A 1O6KA 4XEYA 4W9XA 2QC6A 4F7SA 4Z9LA 5AP6A 3V5WA 3HV4A 4ITIA 2AC3A 3Q53A 2UVZA 4ZSLA 4NFMA 3H9FA 2VTPA 5DWRA 4L43A 4DFZE 5ANIA 2C6EA 4FKWA 3OG7A 4YJRA 1R78A 1YW2A 3UVQA 4CFWA 4KIKA 3TUBA 3P0MA 4JX7A 2HZ0A 1WMKA 1BI8A 4FSQA 2X1NA 4H58A 4OBOA 5FLFA 4PRJA 2GCDA 2ITXA 4CFNA 4O4DA 4FTLA 3COMA 3F3TA 3FLZA 3MFRA 4GVAA 4BIEA 1XH4A 4HYHA 4FKRA 4IANA 3ORNA 3G9LX 3QRIA 4O27B 1PMVA 3SKCA 5M08A 3H4JA 4FK3A 2XJ0A 2JDSA 3EQCA 4GG5A 5DI1A 4XOYA 2C47A 1FGIA 4KIOA 2VAGA 2OFVA 4YNEA 5HO7A 3PJ1A 2C3JA 5JRSA 4TN6A 3OTUA 3IG7A 1QCFA 2GPHA 4AFEA 3R28A 1U4DA 3POZA 3ZO3A 3L9LA 4ZLYA 4GYIA 3DK7A 1DS5A 4YC8A 4I6BA 3RAHA 2YM7A 3KK8A 2RF9A 3QUDA 3QYWA 3TEIA 2OXXA 2HXQA 2IO6A 3PXFA 4KSQA 3VAPA 3JYAA 3RPYA 3EYGA 4OTFA 4AUAA 3F2AA 3TNHA 3GGFA 3ACJA 2A19B 5HKMA 3P4KA 4FGBA 4G6LA 5B7VA 3TTIA 4IC7A 2R3LA 3VQHA 4M67A 2XK6A 2IN6A 4RFMA 5HVYA 3R7YA 3VBWA 5GZ8A 1G8KA 4ZTMA 1TQPA 1BI7A 3O50A 2WMXA 2YIQA 3BYMA 3UIBA 4D0XA 4WNMA 5DFPA 1MQBA 4JR7A 3HRBA 3DBFA 1Q8YA 1W2DA 4BDBA 4BN1A 3OOMA 3VWAA 3HECA 4PDSA 4UXLA 5D7VA 2XIZA 1R39A 5CXZA 4QEBA 1U54B 3EOCA 5FEDA 4D58A 4QNYA 3QCXA 5CU2A 4F0IA 4KD1A 4FTKA 1S9JA 4L68A 4TYEA 3ZS5A 3LIJA 4O84A 4QMNA 3HP5A 3CTHA 2W5AA 3OCSA 4TZRA 5EG3A 5IQCA 3OWKA 2UW8A 3GCSA 4FNZA 3FHIA 1BYGA 4PL4A 5C1QB 3PJ8A 3G90X 5EYKA 5E8XA 3ZLYA 4C38A 4IJPA 4V0GB 2P0CA 3FMNA 3OROA 3BV2A 5FEQA 3TG1A 3D2KA 2ZB0A 3WBLA 4N70A 3RHKA 2PMIA 3EQIA 3H3CA 3OP5A 2B55A 2X39A 4FT7A 4JLCA 4G6NA 4XRJA 5ETIA 4AOIA 4G3EA 2W0JA 1OPLA 4C3PA 2YERA 3QTZA 4G9RA 3I79A 3IOKA 2WO6A 4TYHB 5CAQA 4ORKA 3LFSA 3EKNA 3OBGA 3UC3A 1FMOE 1OECA 1X8BA 3DJ5A 4MWIA 3DK3A 4A7CA 3FZSA 4RPVA 1URCA 4IB1A 1P4OA 4K1BA 3CGFA 3TN8A 2ITPA 2C1BA 3LXKA 4X21A 2HZ4A 3HL7A 1HOWA 2JC6A 3UP7A 4A07A 4CMOA 3MESA 2R0UA 3QUEA 3RCDA 4DGLC 2PVKA 4QMMA 3UMXA 5IDPA 1YOLA 5JGBA 2R3JA 3ERKA 4ZSAA 4G9CA 4CD0A 3RP9A 3MGYA 2XK4A 3O5AA 4GK3A 3DKCA 3RK7A 3F2NA 5K5NA 4NKAA 3JVRA 2BVAA 3D15A 5L4QA 3TDWA 3BLRA 4IAAA 1SVEA 4MEDA 4DT8A 2V62A 5I5ZA 1W2FA 2FSLX 5HTIA 4S32A 2REIA 5D7AA 2CJMA 3GCUA 3R1SA 3P5KA 5C27A 4FKGA 5HNBA 1Q3DA 1MQ4A 4EZ5A 1K9AA 2WMWA 3ETAA 3NYNA 3Q4CA 3TM0A 4EQMA 3E63A 3DLSA 2ZV9A 4KIKB 4UEUA 2XCHA 4O4CA 4D5HA 4LGHA 4TYIA 1SMHA 2Y0AA 4Z3VA 4B9DA 2I40A 3IW5A 3LMHA 3BRBA 3GQLA 2IVVA 3KCFA 3W10A 2PY3A 4QQ5A 5AAEA 4IB0A 3TDVA 4XG2A 3C51A 5ACBC 5HNIX 3OW3A 4W8DA 3O7LD 2GSFA 4QYEA 4CYJA 4I3ZA 4RJ4A 2XBAA 4ZTHA 4FIFA 2PVYA 3ML1A 4QP3A 4E5AX 2X4FA 3QCYA 3BEAA 3A7GA 1ZZ2A 1NA7A 3FUPA 3LJ1A 1F3MC 4YO6A 5DGZA 5A4TA 1F5QA 3PSDA 4ENYA 1XKKA 2WAJA 4HYIA 5A3XA 4EHGA 4E4XA 2WMSA 3QTXA 4ANLA 4TW9A 3RINA 2A27A 3VUKA 4DEIA 1XH8A 3CCNA 3V3VA 3ZH8A 3VHKA 1HCLA 2BALA 3GC0A 4PUZA 1YOMA 4CKIA 3FWQA 4YLJA 1R0EA 5CXHA 3TV6A 4BBMA 4NSTA 4J8MA 2WQEA 1UNLA 4QTAA 5A6NA 1Y8YA 5BYYA 1J7UA 1YHVA 2R5TA 3DTCA 3QAME 4IFCA 4G3CA 4QP6A 4YR8A 1QPJA 2CSNA 4EBWA 3QTQA 4V05A 2J90A 2WIPA 2PZIA 4EYMA 4F64A 3BELA 4WA9A 4XCUA 2W05A 1YXTA 5AR8A 4AT5A 1PYXA 3IW7A 1PJKA 3AKKA 3UIMA 2XALA 2IW9A 4E8AA 3B2WA 4YZDA 4QDEA 3QHWA 3ITZA 5CZIA 4FGRA 5E1EA 5AX3A 4AU8A 4D2SA 3MH1A 1UKIA 2R3IA 5FDPA 3FMDA 4D2VA 5AR7A 2R3NA 3EQHA 2XK3A 2HXLA 1JSVA 4ZJVA 2GHMA 2GNFA 5CF4A 3VUMA 1G8SA 3CPCA 4EONA 4ZTLA 4MXCA 3VUGA 4RT7A 5EW8A 4AOJA 4FKOA 3ENHA 4JDKA 3UYSA 5HORA 4FR4A 4J52A 2R0IA 3G33A 3QGWA 3I60A 4GUEA 2VNWA 4AGUA 2J7TA 4FTMA 4R77A 5CU6A 2B0QA 5EYDA 3MWUA 5HD7A 1REJA 2C3KA 2WMUA 3EFKA 4IAFA 3W2CA 5LMKA 3VW6A 3WE4A 2YIYA 3FMKA 4F9YA 4LL0A 2OFUA 3R1QA 4I5HA 4EH2A 4C58A 3GU5A 4W4YA 2GU8A 1U5RA 3HUBA 1ZMVA 3Q4TA 4F7NA 4HW7A 4XLVA 3ZRMA 2XF0A 4FIEA 4EH3A 1ZY5A 1PKDA 4PL3A 4RIOA 4C59A 4ERWA 4IVAA 5CSVA 5JT2A 4DLIA 3SGCA 3DZQA 4FSYA 2H8HA 3R2BA 2GDOA 5DVRA 5A4LA 3VN9A 1H07A 2W1EA 5AEPA 2Y6OA 4WSQA 3R73A 3OEZA 3Q9WA 4I6QA 5IEVA 2X0QA 2XCKA 5M06A 2ITYA 1WZYA 2OF2A 3KULA 5EHYA 4E3CA 3BX5A 4EKLA 4YTHA 3W2RA 2FVDA 2A2AA 2BRHA 5L6PA 3V5JA 4AQCA 4BHZA 1JKLA 1PMUA 4NTSA 1FBNA 1OGYA 4AXDA 3QRJA 2O63A 2UZEA 4H36A 4M84A 3W0SA 4AN3A 4JIKA 5CAVA 3MJ2A 2Z60A 4RBLA 5KNJA 3RPVA 2F7ZE 1PXIA 3BGPA 3GXLA 3OVVA 2B9HA 1W7HA 2DS1A 4DTBA 4I6FA 5C03A 3R9OA 5L2WA 3CKWA 4AX8A 3D5UA 2YAKA 4PY1A 5HO6A 4QP1A 5LVPA 2XARA 5A6OA 2DQ7X 2UZTA 2XRUA 3O51A 3G0FA 4U8ZA 3A7IA 3K3IA 2X8DA 4L67A 2HY0A 3AMBA 3QKLA 3ZLSA 3EFLA 4Z7HA 1UWHA 2RGPA 4I6HA 4QTBA 4OTIA 4BCJA 2RG6A 4J7BA 4FV1A 3MY1A 1Y6BA 3EN6A 3R9HA 3PE1A 5D10A 4TL0A 3BHTA 4FV9A 4EZ3A 4EKKA 5KHXA 4BZOA 3ZDIA 3ANQA 3DBDA 2QU6A 4U80A 4LOQA 4IDVA 4FEVA 5I9XA 4WNPA 2VTQA 1DAWA 4PTEA 4WG4A 3OT3A 3OXZA 4J96A 4YZ9A 4YSJA