3D5WA

Crystal structure of a phosphorylated polo-like kinase 1 (plk1) catalytic domain in complex with adp.
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
287
structure length
284
Chain Sequence
KEIPDVLVDPRTMKRYMRGRFLGKGGFAKCYEITDMDTKEVFAGKVVPKSMLPHQKEKMSTEIAIHKSLDNPHVVGFHGFFEDDDFVYVVLEICRRRSLLELHKRRKAVTEPEARYFMRQTIQGVQYLHNNRVIHRDLKLGNLFLNDDMDVKIGDFGLATKIEFDGERKKLCGTPNYIAPEVLCKKGHSFEVDIWSLGCILYTLLVGKPPFETSCLKETYIRIKKNEYSVPRHINPVASALIRRMLHADPTLRPSVAELLTDEFFTSGYAPMRLPTSCLTVPPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Polo-like kinase 1
publication title Structures of the wild-type and activated catalytic domains of Brachydanio rerio Polo-like kinase 1 (Plk1): changes in the active-site conformation and interactions with ligands.
pubmed doi rcsb
source organism Danio rerio
molecule tags Transferase
total genus 77
structure length 284
sequence length 287
ec nomenclature ec 2.7.11.21: Polo kinase.
pdb deposition date 2008-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3d5wA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3d5wA01
2OW3A 5K5NA 1W82A 3GCVA 1JSVA 3OCSA 3PSDA 4MCVA 4TWNA 4RMZA 4X21A 5FGKA 3EZVA 2OZOA 3I5NA 1YHSA 3Q2MA 4F9YA 5JKGA 1UWHA 1JWHA 5C8NA 3IK3A 4O6EA 1LUFA 5EW8A 5CU0A 1JBPE 2G1TA 1NY3A 4XCUA 3OTUA 4F4PA 2OF2A 4EH9A 4XG7A 4E6CA 3R8PA 3F5PA 5KBQA 3AC4A 4D2PA 4UWBA 4QTDA 2YCRA 1GIHA 2QOQA 4F08A 4ZJIA 4QMMA 4ANQA 3U55A 1U54A 5FRIA 5KMLA 5IG1A 4UZDA 4C2WA 1PYEA 4QRCA 1JLUE 1H00A 1G8AA 2XYNA 2B4SB 3KCKA 4L01A 1WZYA 5ACBC 2ZV7A 3F7WA 1E1VA 3PJ3A 4F0FA 4ZLZA 4JQEA 5J9LA 4FTTA 2WMVA 5CNNA 2F7EE 3GC9A 3D5VA 4IE9A 5C9CA 3UGCA 4AOIA 5AUTA 5IQCA 5IQDA 2UUEA 5ACKA 4DA5A 3P79A 4EH8A 3OMVA 2I6LA 2GNLA 2EXEA 2OIBA 3HUCA 2QHMA 4FVPA 5HBEA 3V5JA 4HVHA 5AUYA 3GUBA 1Q8UA 3E3PA 4FSUA 4BGQA 5CXHA 2RSVA 3G90X 5BQ0A 4FSTA 4A4LA 3LFAA 3C4ZA 5F94A 2GNJA 4FG7A 3WZUA 4ALVA 5BPYA 3NCZA 1SVGA 4YTFA 5HTIA 3UMWA 2VTAA 5HCYA 2VWZA 5HE3A 3TTJA 2VTQA 3HA8A 3HEGA 3ZLXA 3QWKA 5BVDA 3DDQA 3BBWA 3O23A 2Y8OA 3QQKA 4AU8A 2C6OA 4XJ0A 2B52A 3MPTA 5IA0A 4QT1A 4FA2A 3MTLA 4FK3A 2BROA 3LXNA 4FTCA 2JGZA 4G3GA 3HA6A 4MWHA 4ZS0A 3PJ2A 3P7CA 1IRKA 3VF8A 3PPJA 3VUMA 1TQIA 3IGOA 2RGPA 3D94A 1YI3A 3REPA 3IW6A 5EM5A 4TYJA 3KN5A 3NDMA 2HAKA 1AQ1A 2QU5A 5A6OA 3NSZA 3OS3A 4U7ZA 4I5CA 4RIXA 1O9UA 2WMWA 4O1PA 3QCSA 3L9MA 2PHKA 4IB0A 5ANKA 3QALE 3DBFA 3DQXA 5DEWA 4A4OA 2ITQA 3BEGA 4ACHA 3ALNA 3C0IA 3C4XA 3R9HA 3BYSA 2VO7A 4FOCA 4NFMA 5F1ZA 5C26A 1H8FA 3A62A 4YLLA 4O86A 3A7IA 4CZYB 5FDPA 4FT7A 2B7AA 3EQPA 1ZXEA 3IG7A 2YM6A 4B6LA 5IEYA 5A6NA 5IQAA 5BYLA 3HDMA 5CS6A 3ZSHA 1P2AA 2YM3A 4YJUA 2QOFA 2BZHB 2VZ6A 2F9GA 4QYFA 4C58A 4E73A 1YWVA 4N4SA 1ZMUA 4RWIA 3F3WA 4MNFA 2O2UA 3FQHA 1BYGA 3U51A 3ET7A 2BAQA 2JFMA 2Z7QA 3FLWA 3ORXA 5EKOA 2QO9A 4WG3A 4R3PA 2R3NA 2QVSE 2GNIA 2HYYA 4QMLA 4F64A 4XBRA 5AP2A 3H10A 4GH2A 3TT0A 4ARKA 4LFIA 3FHRA 3KY2A 4RBLA 2IG7A 4TWPA 4AW1A 3DFAA 2BR1A 2C47A 3DDPA 4M97A 4ZSEA 4EKKA 3CTHA 5IU2A 4BVUA 4IBMA 3FLQA 1ZYDA 4QP6A 2VTRA 3M2WA 3ZOSA 3BZ3A 3JUHA 3BGPA 4QMPA 5LQFA 4O82A 1APME 4BTKA 4TYHA 3VUIA 3LMHA 3P78A 2H9VA 1UNLA 4RIXB 2UZOA 1HCLA 4FTOA 4HCTA 1YXUA 3EFLA 5E8UA 1DAYA 1RJBA 3T9TA 3SA0A 1Q62A 4CKIA 2JBOA 1OVEA 2Z7RA 1H1QA 2PVHA 3QRKA 2YEXA 3LQ5A 3NWWA 3W33A 2X4FA 4LMUA 4WUAA 4D9UA 2OIDA 3FYJX 3WIGA 2YIWA 4FEQA 3FZSA 4XOYA 2VGOA 3ZO2A 4YU2A 3KVXA 1XBCA 1H26A 1LR4A 2ZMCA 3UVPA 4CQGA 2X81A 5LWMA 1YI6A 4FSYA 4BWKA 5BNJA 4FEUA 2WB8A 3QTSA 3E92A 5G6VA 4PPCA 4DTAA 2JC6A 5J5TA 3FLNC 4G1WA 1ZLTA 2HY0A 3A4OX 4IB3A 3GC8A 2X7FA 3A60A 3UBDA 3VRYA 4QTEA 1YOJA 2XJ1A 3FUPA 1YKRA 1FGKA 2OK1A 4OT5A 1PMNA 3TM0A 1GNGA 4CSVA 4FTJA 5J9YA 2I0YA 3K54A 5DWRA 2WNTA 3ORPA 2Y6MA 4LG4A 3I79A 3GFWA 1Z9XA 5CX9A 4ZSGA 3SDJA 4CV9A 5CASA 4GL9A 3IO7A 5K0XA 4O0YA 3R7GA 1YDRE 3M42A 3HYHA 3KULA 2Y9QA 2VTPA 3ELJA 4AUAA 4TYHB 3C50A 1ZZ2A 3D9VA 3EN5A 3PPKA 2X2LA 1BX6A 4OTHA 4IJPA 4AXAA 5J7BA 5KHWA 3EFWA 3WYXA 2VWIA 3FZPA 1JKSA 1PYXA 3RCJA 4X3FA 4IZ7A 3V6SA 4W8EA 3IW4A 3BRBA 3F61A 2VWUA 4LV5A 5DOSA 4CYJA 2CNQA 3FYKX 4DG0E 2OZAA 1R0PA 3SW4A 3UPZA 3QLFA 3GFEA 5E8TA 3I6UA 3DTCA 1DI9A 3O17A 4PF4A 2WHBA 4X2FA 2PVFA 3DT1A 5F20A 5EKNA 1OIYA 2PVMA 3M11A 4FKJA 3MPAA 4CCUA 4FZ7A 3QD0A 3G0FA 1IG1A 3Q5IA 2R3HA 3NMUF 3NVKI 4YJNA 4U3ZA 4EOSA 3ENHA 3UIMA 3G0EA 3ZLWA 3C13A 1WFCA 4XX9A 3FLSA 3VIDA 3FMNA 3DZOA 4BDKA 5I4NA 2EVAA 4YJRA 5IUHA 4AACA 2ZOQA 3DAJA 2X2KA 3UVRA 3L8XA 5HG9A 3NVMB 2Y4IB 2YM7A 5EI2A 4CKJA 5M4FA 3FI8A 3OY1A 4E8AA 1WBNA 4HPTE 3UC3A 4TT7A 2F57A 4YP8A 5GNKA 4EHEA 5DNRA 2PVKA 3QA8A 4KINA 3ZFMA 3U8WA 4BDIA 2WTCA 2XIXA 3AC1A 3KULB 1SVEA 3TUBA 2C6TA 3PG3A 3R7YA 3BU6A 4ITHA 4UYAA 1OPJA 3FEGA 3DK7A 4LOOA 5I5ZA 3MB7A 4AE9A 1WVWA 2BMCA 2JIIA 2UZDA 4JIKA 2PULA 3PYYA 5EQPA 3RAWA 5TR6A 2CGUA 1CKIA 1KE5A 3QHWA 5HVKA 4N6ZA 2BUJA 2GHGA 2QURA 4LUDA 1ZOEA 4X3FB 3L9NA 3ZC5A 4F7SA 2JDTA 5HD4A 1IA8A 3IOKA 1RE8A 3UDBA 3V5WA 1GAGA 4KS8A 3U54A 2PMIA 2OZAB 4K18A 3CJGA 4GCJA 3R7IA 3WZJA 2XNMA 2BRMA 4WHZA 3QCXA 2W1GA 3R83A 3DB6A 4K9YA 4K6ZA 1Q4LA 2XM9A 2ZM1A 3OUNB 5CANA 2PWLA 4FNXA 1PHKA 3ROCA 1G3NA 4AX8A 2ZVAA 3PE2A 3BQRA 4FZDB 4WSQA 4XV1A 3Q4ZA 4E1ZA 4E4XA 4M69A 5LOHA 4QOXA 4P5ZA 2PZIA 2CN8A 3Q52A 4MBLA 4ZP5A 3SQQA 4DG2E 4IACA 2BHHA 3C9WA 1UA2A 3MW1A 5AP6A 3BWFA 4PNKA 4F9CA 4R7BA 3DAKA 2WMXA 4HNIA 4LRKA 3E64A 3PSBA 5IDPA 2XK4A 4L3PA 1PRYA 2P3GX 3FJQE 4YJSA 4J99A 4J95A 3E8CA 3E8NA 4KB8A 3CTQA 3QQJA 4L9IA 3A7GA 3CGOA 4ZK5A 5DT4A 4E4MA 5BMSA 3R2BA 4DEAA 3HMMA 4L67A 1QCFA 3BGQA 4WNPA 4C4FA 2X8DA 3P7BA 3MA6A 3UQFA 3H9RA 2V7OA 4ACCA 4F6UA 4E6AA 2BZIB 4KRDA 3COHA 5E7RA 2A4LA 2C0OA 4USDA 3QX2A 3LCOA 4JQ7A 4G3FA 5AR2A 4YTCA 4FC0A 3ZFXA 4DCAA 3L8SA 5BVEA 5EHYA 1OKZA 2VNYA 5J87A 2RG6A 3R1NA 3Q96A 4FNZA 1URCA 1H1RA 4L3LA 1OL5A 4DGLC 1J7IA 4M13A 4U3YA 1UKHA 4QMUA 1AGWA 4B9DA 3FL5A 2BFYA 4G6NA 4FIIA 2X1NA 4ASDA 4FX3A 2R4BA 3EYHA 4NW6A 1XBBA 5E8WA 2BDJA 4QQTA 4ZY5A 3S2PA 3JS2A 3CS9A 3HV5A 3OCBA 4I24A 4NKAA 4D2TA 3C0GA 4D4SA 1J91A 3MGYA 4AT4A 3JR1A 2AC3A 5TT7A 4UX9A 3QTRA 4M69B 3RK7A 3UIXA 1T46A 4MVFA 1U59A 2PVLA 4I23A 3W2OA 4CMUA 3PJ1A 3R28A 5EW3A 4YZCA 4GYIA 4V01A 4XG2A 5FP5A 1GIIA 4HCUA 5HGIA 4U5JA 4XBUA 4F63A 4L8MA 2VWXA 4U42A 5CU6A 5DHJA 5CSWA 5ANJA 3ZUUA 2Q0BA 3F2NA 4I4FA 4I93A 3ZRKA 4WBBB 2V5QA 4L3JA 3ZXZA 5CF6A 3ALOA 4MF1A 4CRSA 4MH7A 5CU3A 3DLZA 3HECA 4AS0A 3I0OA 5FG8A 4DFXE 3BHVA 1SM2A 5CEOA 4O81A 5CYIA 3PJCA 2FSMX 3QUPA 5I9UA 3DZQA 1J1CA 3KU2A 2ZMDA 2HW6A 4AG8A 2ZDTA 4BDDA 5JK3A 3TL8A 1MRUA 4K8AA 2I0EA 2PTKA 4Y72A 4YBJA 4J8NA 4AGWA 4AWIA 4DCEA 1TQMA 4D1SA 5JZNA 5J8IA 5I9VA 2KTYA 3V01A 4CFNA 3IDPA 3JVRA 4YLKA 5A4EA 4HNFA 3O51A 1WBTA 1FOTA 2PZRA 4P90A 2HIWA 3VBWA 3U4WA 2CGVA 4D58A 3NW6A 5LVMA 4KWPA 1E1XA 1OM1A 4IAFA 2C0TA 4JG6A 2W05A 3ZEPA 5DT0A 1KUTA 2BAKA 3DBEA 5EQYA 3PWDA 4ZOGA 5HQ0A 3AMYA 4PQNA 4IDTA 3ZTXA 3AC2A 3RPVA 3PY1A 3EN7A 4NCTC 4MD7E 4AF3A 1YRPA 4ZIMA 3I1AA 4NK9A 1QPCA 1WVXA 1ZY5A 2W5HA 4TY1A 3SD0A 1MRYA 4ZTMA 3Q3BA 4D2SA 3L9PA 5H9BA 4H1MA 3EYGA 1TKIA 3EFJA 4F9AA 1Q97A 3KXXA 4K1BA 5HEZA 2YABA 5HI2A 5LVNA 3QQUA 5IA3A 4ZMEA 2Y0AA 4D4RA 5CAOA 3NPCA 5AFVA 3OZ6A 4XS2A 3DKGA 4QMTA 4IB5A 4RX5A 5IH5A 5ITAA 4MXOA 4ZLYA 1W7HA 2QLQA 3A61A 4QMNA 4YSMA 4AZSA 2JFLA 5HNGA 2BTRA 4S33A 2BDFA 2E9NA 1M2PA 5J9ZA 4EWQA 4ZEGA 3R30A 4FYOA 5AP3A 5AMNA 4BN1A 2RF9A 3NYXA 4UXQA 5A9UA 2J51A 3PA5A 3TXOA 2EB3A 4FVQA 4QTAA 5EYCA 2XCKA 5A14A 4O7SA 3D2IA 3LLAA 3DCVA 3ZZEA 3QQHA 3OY3A 3R8VA 3BE9A 4XRLA 2B9IA 4NH1A 4ENXA 1QMZA 2W7XA 4A4XA 5FBOA 3BHUA 4FIGA 3AC3A 1GZKA 2Z2WA 3R63A 3RCDA 1YOLA 4O38A 5DEYA 5KX8A 3LJ2A 4ANOA 3QFVA 3D15A 3JXWA 3ODZX 4BTMA 4G2FA 5AAEA 5M06A 2JDVA 4QPAA 3IW8A 2XK7A 2YAKA 3DXNA 3BIZA 3F6XA 3W8QA 4ANLA 4IVBA 1AD5A 3OWPA 5LCJA 5FP6A 5JGAA 3FI2A 2WQEA 3VBVA 2BCJA 2FUMA 4IMYA 4FTNA 3T8OA 5IA2A 5FD2A 2OXYA 5EH0A 4U43A 3MFRA 4JBQA 1MP8A 1QL6A 2ITYA 2X4ZA 3ENMA 4MXAA 1Q8WA 1ZOHA 2GNGA 2PZPA 3NZ0A 4I41A 2XF0A 4UZHA 4TKSA 4A07A 2R3LA 3WZEA 4C3FA 3MB6A 3CD3A 1RQQA 3VC4A 5EDQA 4S2ZA 5JQ8A 2IZUA 3TTIA 5KMOA 2GQRA 1UU7A 3QD2B 4HZSA 4B99A 4A06A 1V0OA 2X8EA 4JR3A 2WMUA 4EH6A 1P4FA 5CF8A 4JQ8A 2VNWA 3L8PA 2YITA 1Q5KA 4G3CA 3BQCA 2WEIA 4YSJA 5A4QA 2XVDA 5M55A 3PIYA 3RM6A 3ZSGA 4ACMA 4M15A 2DUVA 1SYKA 3FMDA 2B55A 1KE7A 4CFVA 3VHEA 4AZWA 2XKEA 4KUJA 3HP5A 4AP7A 4R5SA 3GCSA 4EK3A 3VUTA 4O7RA 3UZRA 2YM8A 5AIKA 3MFSA 5CEIA 4QMXA 4PDPA 2LAVA 2WMSA 3FC2A 4EZ5A 5IMXA 2GQSA 3PVGA 4XNEA 3A4PA 4O21A 2UZWE 1KWPA 3AT4A 3KK9A 4YC6A 3BWJA 4PWNA 2UVXA 3QTIA 4LUEA 5D7VA 3CBLA 4FV1A 3U4UA 2IVUA 3CIKA 4NYEA 2Z60A 3TACA 3TWJA 4KABA 3W2RA 4C33A 4XH6A 4MF0A 2OLCA 3E7OA 4QMVA 2ZM3A 2BRGA 3DJ7A 1Q24A 2FGIA 2HXLA 3KMUA 3OXZA 3VF9A 4XHKB 1JSTA 1U46A 2PVJA 3LHJA 3LXKA 4NIFB 3ZO3A 3SW7A 4BF2A 3ORNA 2XJ0A 1FQ1B 3DGKA 3FMHA 3S4QA 4FBXA 4QMQA 3NW7A 2FVDA 2HK5A 1XR1A 2IWIA 5CZHA 3R8LA 3NW5A 4B8LA 2CMWA 3WZDA 4GJ2A 3P86A 1V0PA 4H1JA 1WCCA 3BLHA 4M0ZA 5CY3A 3NRMA 4FL3A 4EOJA 4PP7A 3GP0A 4FKIA 2W96B 4S34A 2GHLA 3IQ7A 3Q9ZA 3R7OA 4UN0C 4O91A 3ATSA 3NS9A 5FEQA 3RINA 3PXRA 4I20A 4Y73A 4BC6A 3SKCA 3KREA 2HZIA 5CAUA 3QAME 4II5A 5KZIA 4RVMA 5FM3A 2G15A 1OI9A 4F09A 5EW9A 4IWOA 3UOHA 4XG8A 4JX7A 4ZLOA 2G9XA 5CLPA 1W8CA 4L00A 5HE1A 5HVYA 1ATPE 2AYPA 5IEVA 2HZ0A 3G9NA 1PKDA 5L2WA 1OL6A 1B6CB 2ONLA 4E26A 5HIDA 4AA4A 3RAHA 2OI4X 2RFNA 4ZMFA 3U6HA 5HZNA 2QKWB 3AT2A 4RPVA 2XK8A 4F70A 3R6XA 3PUPA 4RQKA 2W9FB 4LL0A 1SNUA 5IQEA 2J2IB 1XH6A 3IOPA 2OBJA 1H1PA 2F2CB 3LAUA 3PJ8A 3QRUA 3P23A 4RVLA 4C35A 3QZFA 3EQFA 4D5HA 4DEHA 4V0GB 1PXMA 3QZIA 4YHJA 3DBQA 5HO8A 3QC9A 3MESA 5ETCA 3WILA 3DA6A 3KL8A 4NCTA 3TNPC 4CVAA 5L4QA 4EH2A 3HAVA 1PJKA 5IQFA 4CG8A 3EQBA 4IW0A 3RNIA 3O8UA 5DFPA 4TYIA 1PKGA 4RC2A 2CDZA 5EI8A 2W1HA 2VO0A 5KKRC 3F2RA 5HD7A 3NAYA 3OUKA 4RA4A 3VUHA 2O64A 4FGBA 2RIOA 5F9EA 1YXTA 2JKMA 4GT5A 5IA1A 2C6MA 3RK9A 2NRUA 4IX6A 4JNWA 3GQLA 4C37A 5CALA 1EH4A 1FVVA 2UW5A 4GG7A 4XUFA 5FXQA 5IMEA 2WMRA 1JQHA 5H8GA 2NNWB 4H05A 4C4EA 2JLDA 5CSHA 4G5PA 3HRBA 2BDWA 4QMYA 5CU4A 2GCDA 2C3IB 1VYZA 5CAVA 5E4HA 4I5MA 2HWPA 2QD9A 1YHWA 5I0BA 2ITUA 3PE1A 1GZOA 5HE0A 4F7LA 4ERKA 4NM7A 3GCPA 4FV0A 4X2JA 4JJRA 5AUUA 3QZHA 2R7BA 4RFZA 4M68A 4R7IA 5E8ZA 4G3DA 4MD9E 1OZ1A 4Y46A 2UVZA 3LM5A 3RALA 4PDYA 3LCTA 4DLIA 5BX0A 2Y4IC 4QQCA 5EM8A 4TWCA 3HV3A 4NTTA 3F3TA 2YLFA 3HMOA 3OOGA 4FKGA 3TZ8A 5AADA 3II5A 3G6GA 2VWYA 4YZDA 2BILB 5LVLA 3AGLA 3RHKA 4FNWA 4DFZE 2WTJA 3PPZA 3QL8A 1KE9A 4UMUA 2YWVA 2VD5A 4A9TA 5CSVA 3GC0A 2OJGA 5AP1A 4X3FC 4JOAA 2ETMA 4YJVA 3WE8A 1J3HA 4BDBA 3LQ8A 4BIEA 5AV4A 4RJ8A 2PVNA 3RPSA 4EL9A 3C7QA 4O0VA 2YZLA 2OJFE 2X7OA 5L8JA 1FPUA 4EOPA 4N0SA 2OXDA 3U6IA 5BMMA 4CGAA 5M44A 4C3RA 1LEZA 5HIEA 4TW9A 2BVAA 3CLYA 1OMWA 3DB8A 4AN9A 5L2SA 2QOOA 4BCKA 4RJ7A 4BY9E 4KBAA 3FMEA 4EHZA 3JY9A 4IC8A 5K4IA 3QCQA 3PVWA 3MY0A 3TNWA 2C5OA 5JGBA 5JEBA 3EKKA 3OROA 3DFCB 1A48A 3OF0A 3H30A 2Y4PA 3AXWA 4N6YA 4ZTQA 4M8TA 3NYVA 2C3JA 3VJNA 3RZBA 3MH2A 4J1RA 3N4VA 3RTPA 3AD5A 3QRIA 4Y83A 3DPKA 4U81A 5GIPE 4KBKA 4JG7A 3VUGA 2XA4A 1OL7A 2A0CX 2O3PA 3KMMA 4HVSA 3KRLA 2QOBA 3F3UA 4FIJA 4IAAA 3MH1A 4KSQA 4BCJA 4DLJA 5C4LA 1FINA 4XG3A 3BU3A 2QODA 4HGLA 2UW8A 3V8SA 3L8VA 1KSWA 1ERKA 5E8XA 3ACKA 3H0ZA 3QUDA 3NEWA 2PMLX 4HOKA 1Q3DA 5AV2A 2XKCA 3DV3A 2W1ZA 5TE0A 1OBGA 3NIZA 2XK6A 1ZMVA 3E87A 3PP0A 3GCQA 4FKTA 2YIRA 3MH0A 5AX3A 2VX0A 2PMOX 3MYGA 2C5YA 4LYNA 3S3IA 4M0YA 4ACDA 4BI2A 3IGGA 3SOAA 5JFWA 4FZFB 5HU3A 4ZXTA 3V3VA 3FXWA 4DN5A 4O96A 4ANMA 2XM8A 3EWHA 4FSMA 3PXFA 3SHEA 3ACJA 1QPJA 4MD8E 3HV6A 2C6EA 4C7TA 4I3ZA 5B0XA 4DEGA 4UMRA 2QOKA 3A99A 3G6HA 4OGRA 4QYGA 2CN5A 4XLVA 4XP2A 4WNKA 3UTOA 2GU8A 4XEYA 2W9ZB 4RVKA 3G33A 3OXTA 4Q9ZA 3MVJA 3TUCA 5JSMA 3W2QA 1PF8A 3PFQA 4EZ7A 3BYUA 1XHAA 3DJ5A 4QTBA 5K0KA 3I7CA 4FIHA 3TZ7A 2NPQA 2W1IA 4IC7A 3DY7A 4IVAA 2I0VA 2IZRA 2BAJA 3EQDA 5FQDC 3ZDUA 4CNHA 3WF6A 4PTEA 2R0IA 2VUWA 4OBOA 3QGWA 3JYAA 2JAMA 3AOXA 4MQ1A 2JKKA 3LPBA 1FVRA 4PTGA 3TKHA 3P9JA 3RKBA 3QTUA 3RAKA 3OBJA 1H24A 2NP8A 3D5WA 2GNFA 3E63A 5CT7A 4GU6A 2EXMA 3BGZA 2G2HA 4J53A 2WO6A 3KXZA 3QC4A 4UB7A 4BYIA 4Z7HA 4ZTSA 4YO4A 4GMYA 4O7YA 4K77A 5HTBA 2F7XE 2W4JA 3I4BA 4GK4A 3LCSA 1GZ8A 2W1FA 3LMGA 3MIAA 1ZY4A 5BVNA 4O0RA 2J5EA 4H3PA 4J7BA 3FSKA 1JKLA 5F4NA 5HESA 3C1XA 4BCPA 5M53A 3LFBA 4L7SA 3LXLA 4ZY4A 3S1HA 3R22A 3EHAA 4RJ6A 5ANOA 2VTHA 4KIKA 4BBFA 3SAYA 3NNUA 4E5WA 4G17A 4N70A 4WO5A 3EIDA 4EK8A 4IWDA 3OP5A 2R3PA 4U44A 4GT3A 4XG9A 5EYMA 2XP2A 4BRXA 5HOAA 3R9OA 3BKBA 4XV9A 4RVTA 3BELA 2C30A 4LOQA 3Q32A 3UP7A 3R7VA 5AAGA 4IZAA 5B2LA 3SG9A 3QYWA 2A2AA 4JX3A 3VO3A 2QO2A 2PYWA 2WMAA 2CKEA 2XRUA 4ZSAA 4GK2A 3OW3A 1QPDA 3NNVA 3OCGA 3E5AA 4E7WA 4F1OA 3V51A 3R73A 2XNGA 4EUTA 3RK5A 3IW7A 3UO4A 1CSNA 5FTQA 3OOMA 2ZB1A 3QKKA 4MAOA 3MJ1A 2FA2A 4RQVA 1YWNA 4CKRA 2XK9A 3Q6UA 4D9TA 4JRNA 4YJQA 3HVCA 5HNIX 5AA8A 1R1WA 3FY2A 4O7NA 5D12A 3EQCA 1ZMWA 3ZO1A 1OKWA 1XWSA 2OFUA 4HPUE 3QXPA 4CTCA 5AUVA 1G8SA 4YJTA 4P2KA 4NTSA 4IFGA 2W1EA 3MTFA 3GU6A 4JIAA 2XH5A 2HY81 2GDOA 3FLZA 4JAIA 4PMTA 4BCGA 3BHTA 5KKRB 2VO6A 4O83A 3ANRA 1PXPA 4KIKB 4L45A 1A06A 4O0TA 2VRXA 3OHTA 3PVUA 3VRZA 4DH3A 4R3CA 3O50A 4X2NA 4ITIA 4DBNA 3U6JA 4FEVA 1Q99A 3RZFA 2O5KA 4LGHA 4ZTLA 4JDJA 3MN3A 4RJ3A 2IW8A 3MPMA 3MA3A 5EOBA 4OTFA 3HZTA 3WF7A 2WMQA 3CR0A 3NNXA 4BCQA 3ZDIA 1M52A 3VVHA 1OIQA 3UQCA 2ZM4A 4HZRA 4OTPA 5HVJA 2R3RA 4DEBA 5KMKA 5HKMA 2PE0A 4X0MA 4DITA 3LJ0A 3MVLA 2X9EA 4O6LA 4X2KA 4CRLA 1M17A 4IVDA 5AR4A 4QP8A 4BCMA 3SXFA 3C5UA 3DBDA 3R2YA 3W2CA 1MQBA 1H08A 2JKQA 3KXGA 2XBAA 1KOAA 4HYHA 3ATTA 3MFUA 4H39A 4HYSA 4HVIA 4ALUA 4C57A 2ACXA 2V55A 5HBJA 4PRJA 3POOA 3OVVA 3KB7A 2R3MA 5TO8A 3IECA 3VAPA 3I60A 5E92A 2PSQA 4RSSA 3T3UA 1IA9A 3QTXA 2JDSA 4GUEA 3EQRA 2C69A 3VHKA 3ZUTA 5C8MA 4C0TA 2BRNA 4BDHA 3UNJA 3DBCA 4ZSJA 4YC8A 4C62A 2XEZA 5CU2A 4AT5A 4CZTA 4IAYA 1ZYJA 4BDJA 2CKQA 4UV0A 4RFYA 1FMKA 2CCHA 3W2PA 4AW2A 1H28A 3TDVA 2E9VA 3GOPA 4O27B 5HO6A 2X2MA 4F9BA 3EN6A 3L9LA 4LV8A 1YXVA 2GQGA 4DFNA 2QOHA 1U5RA 2XB7A 3COMA 3EQIA 4KKEA 4LGGA 5CVHA 4WT6A 4U45A 5BUEA 2C4GA 2X39A 4NU1A 1BLXA 4JBOA 3MVMA 4LGDA 3SLSA 3QD4A 2VTIA 4I5PA 4NM3A 5DPVA 1VEBA 3I81A 4FK6A 4S31A 5JFXA 1XH4A 2W5AA 5ETAA 3TN8A 3EQGA 3VQHA 5M51A 3LFDA 5HCZA 3KEXA 1K2PA 3ULZA 5AJQA 5E8YA 3QTWA 3I7BA 5HHWA 5CEPA 4MNEA 3R21A 4YTIA 2XNEA 3S95A 5AP7A 4MXYA 3F66A 4PMMA 4YPDA 4PL4A 4RJ4A 5CENA 3ZH8A 1RDQE 4DC2A 4KSPA 3U9CA 2ERZE 5DYJA 2VU3A 2I7QA 4CLIA 4TTHB 4AW0A 4YR8A 1Q8TA 1REKA 2WQNA 4FR4A 3QF9A 3A7JA 3KRRA 2X7GA 4OBPA 4ZTRA 3QKMA 3WF8A 3QWJA 2C6LA 2UZTA 4IH8A 5KNJA 4JI9A 2OSCA 4DT8A 1GIJA 3QKLA 4CQEA 2WOTA 2VTMA 4YJPA 3SC1A 3CY2A 3KMWA 4WSYA 4KRCA 4U40A 4I6FA 4PPAA 3TJDA 2XRWA 4MEDA 3HGKA 2B9HA 3AT3A 4IAKA 4LL5A 5IQGA 1B39A 3CP9A 4WG5A 4DH5A 3Q5ZA 5GIOE 2WAJA 2WU7A 1PXKA 4IZYA 1OIUA 3SOCA 3R1QA 2J4ZA 3DAEA 5HBHA 5GINE 4E5AX 4IWQA 4PX6A 4RZVA 2XNNA 3EFKA 4AE6A 4LMNA 2CNVA 5CSXA 1Q41A 3L1SA 4BICA 4YUQA 2V7AA 3BPRA 4YJOA 3UVQA 4DGMA 4FEXA 3OT3A 2JBPA 2VAGA 4MNEB 2YERA 4R1VA 3BLRA 3KK8A 3RWQA 2WMBA 2P2IA 2ZAZA 3DU8A 1W0XC 4H36A 3TJCA 4CFXA 5JN2A 1JOWB 4FF8A 1UNHA 4HYUA 2OJ9A 2WOUA 3UYTA 3BX5A 2QG7A 5K9IA 4D4YA 4D5KA 2ZV2A 3A7FA 4CV8A 2QOLA 3EL7A 2ONLC 4O1OA 3W1FA 4BZDA 3QCYA 2B9FA 3LFCA 3CPBA 3EB0A 4EQUA 5AAFA 5FDXA 2C0IA 3CKWA 3PXYA 3VUKA 4HJOA 3FMLA 4MBJA 2XBJA 5CAQA 5KO1A 2SRCA 5L6PA 3FMMA 3MS9A 5M4UA 2HCKA 4YGAA 5KZ0A 2CJMA 5EK7A 4QD6A 1YDSE 3F82A 3UIUA 3UIBA 1PY5A 2PZ5A 2UW0A 3EZRA 1K9AA 2VTSA 2G2IA 3NR9A 2XNBA 4C38A 3NAXA 1J7UA 1UVRA 2WFYA 4BTFA 2YDJA 3RGFA 4I92A 4DEEA 3KF4A 2RG5A 3D5UA 3TV7A 4FTMA 2P2HA 3AD6A 5C01A 4UEUA 3MI9A 4EH7A 3FZRA 4K0YA 3VBQA 4Y5HA 2BIYA 3F69A 3TV6A 4NWMA 4FOBA 5ANDA 4YURA 1OPLA 3O7LD 2O65A 1Q3WA 3EN9A 1URWA 3P7AA 1X8BA 3PLSA 1H0WA 4LM5A 5AUWA 5JGDA 4FKWA 2ZV8A 3ZFYA 3PTGA 4M7IA 3FLYA 5LVOA 3KCFA 5HG5A 4O7LA 4DFLA 2CPKE 4IXPA 3KXNA 3R8MA 3VBYA 4ZZOA 3R01A 4IADA 3OW4A 3RPRA 4D2VA 4F6SA 2GNHA 1O6YA 4FE2A 3K2LA 3H3CA 3RM7A 3S00A 4Q5HA 5LCKA 2QG5A 3OWKA 1KE6A 4FTKA 4KD1A 4FVRA 1XH9A 3E93A 4DHFA 4ZAUA 3DOGA 3I6WA 3TDWA 4OAUC 2JKOA 4I22A 3FMJA 3AC5A 3VW6A 5H8BA 2CNUA 4IX5A 1J7LA 4RC3A 1XH8A 4RC4A 4BDAA 3FXZA 4AGDA 4CYIA 3WBLA 2BRBA 3P5KA 4EUUA 2HWOA 4JG8A 4AA5A 3HAMA 1Y57A 4B0GA 3K5UA 2UZLA 2ZYBA 4G9RA 4Y95A 5DBXA 2YACA 5L2QA 4AZEA 2XCHA 1WMKA 3MH3A 1NVQA 2YJRA 2RKUA 2V22A 4GK3A 3UG2A 3KA0A 4QYHA 4BKJA 2UW3A 5M09A 2OWBA 3FMKA 2ITOA 4UYNA 3EMGA 4E5BA 4O7VA 5JZJA 4C4HA 4TZRA 4DFYA 4GEOA 4QPMA 2GS2A 4QNYA 5IDNA 5KUPA 4J71A 4GV1A 5C4KA 2YAAA 2XUUA 2WMTA 2A1AB 3GI3A 2XYUA 5M07A 2VX3A 2R3IA 3RPOA 3EJ1A 4U41A 1ZZLA 4DTKA 4I0RA 4YLJA 4NIFA 3I0QA 4F7NA 4O0XA 3ZS5A 3FQEA 1XJDA 4OUCA 3EN4A 3QX4A 3WOWA 2B0QA 5ANGA 3KRWA 2VV9A 2XKDA 4GJ3A 1R39A 2O63A 4BCIA 5FWKK 1MUOA 3HRFA 3D2KA 4EH5A 3ODYX 5J95A 3LMIA 5D7AA 1JKKA 4M12A 3W55A 5GZ8A 3GT8A 1XBAA 3KF7A 4S32A 5ETIA 4EOMA 4FKPA 3FKLA 4CEGA 3R1YA 2RFEA 5FUTA 2JIUA 4MXCA 4JT3A 2C68A 4OTIA 4V05A 2W17A 4Q9SA 3N4TA 1NA7A 3MY1A 2PUNA 4UBAA 2UZUE 3LCDA 4TWOA 3V8TA 3OTVA 3ZUVA 1PXJA 2LGCA 3ORZA 4J52A 2OXXA 4BCOA 5CF5A 2BZJA 2REIA 2GSFA 3ERKA 1CM8A 2E9PA 5AM6A 1WBSA 3DTWA 1YHVA 4RIOA 3E7VA 1T45A 3ORLA 4X6RA 5DG5A 4DBXA 1WBPA 3D14A 4FT5A 4O7ZA 3V5TA 4GFGA 3T3VA 3VS1A 5EDPA 1DS5A 4ASXA 4B7TA 5B7VA 2WTVA 5DMZA 3M1SA 4G16A 5CQWA 4GIIA 3ZMMA 3HMPA 3ZLSA 4V0GA 3KQ7A 4AA0A 4GKHA 4RGJA 3UQGA 5GJDA 3QLGA 1OB3A 3ITZA 2P0CA 3EH9A 2WZJA 2XIRA 5C1QB 3C4EA 1O6KA 3UPXA 4E3CA 3QBNA 3RPYA 3RWPA 5KBRA 4FKQA 2VWBA 1FVTA 5BYYA 2VTJA 4CMTA 1UNGA 3OCTA 4FSQA 3RVGA 1MRVA 2R3FA 1SMHA 5CEQA 4OR5A 3UZPA 3O8TA 5C8KA 2OGVA 1RW8A 2UW6A 4IANA 5AUXA 1XH7A 3ZBXA 4BIDA 4OTWA 3DLSA 4WD5A 3BHHA 3FY0A 3QGYA 4R7HA 4ZTHA 4D1ZA 4E4LA 3HRCA 3NLBA 3ORIA 3G9LX 3SXSA 2AUHA 3W8LA 2WPAA 4QP4A 3HLLA 3I5ZA 3OBGA 4U6RA 5BVKA 3VWAA 2KULA 4L68A 5D41A 5M57A 4JDHA 4I94A 2XZSA 1GY3A 2XIYA 4R8QA 4ZJJA 3WZKA 4EOOA 4F7JA 4JBVA 4HGTA 4AFJA 4GSBA 5CVGA 4EBWA 2PUUA 4EH3A 5CF4A 2P55A 4Z16A 3QU0A 4RIYA 3FV8A 3WYYA 2QU6A 2I1MA 2FB8A 3IS5A 5J1WA 5CTPA 2B9JA 3A8WA 2NO3A 2VTOA 3EQHA 3QZGA 4IM2A 5HNBA 3WF5A 3TKIA 4LRMA 5A3XA 3FBVA 4D2WA 4L7FA 4NUSA 4X2GA 3O96A 5D9HA 2EB2A 4GS6A 4L44A 3C0HA 1WBOA 3NUXA 2HZ4A 2J7TA 3Q4CA 4GT4A 4XP3A 3RBWA 3NIEA 5L2IA 1YOMA 1TVOA 2R2PA 3E62A 4KIQA 3G15A 4I21A 3TCPA 5LWNA 1J1BA 4L43A 3UOLA 2IW6A 5AR8A 3B2TA 4WRGA 5EI6A 4RIWB 3N4UA 2ZV9A 3PIZA 3SG8A 4CG9A 5HX6A 4W4WA 5BUJA 3RI1A 3MJ2A 4KIOA 1XO2B 4FZAB 3O2MA 1YXSA 3NUAA 5CEKA 2Z02A 3GVUA 3R0TA 4CZUA 5CSPA 1P4OA 4QYEA 2H96A 4Q2AA 2P33A 5DIAA 3GC7A 4CFWA 2JDRA 3A7HA 5L6WL 2R5TA 4E4NA 4HVDA 3HV4A 4I6HA 4CCBA 1VJYA 2OO8X 2WTKB 5H2UA 4AOTA 3MFTA 3SGCA 4XG4A 5E91A 1OPKA 4D28A 2EUFB 5ETFA 4RIYB 4OW8A 3ZXTA 3R02A 4B8MA 5E8VA 1XQZA 1KOBA 4Z9LA 4PMPA 5LARA 1OKVA 4MYGA 3N51A 3GCUA 4AW5A 2YDKA 2Q83A 3Q6WA 4L46A 4NZWB 1YWRA 3QUEA 4ALWA 3W16A 3HMNA 4FSNA 3VS6A 4Z3VA 3CGFA 2C3KA 3C4FA 4BDCA 4QMSA 4EQCA 2XIKA 2PY3A 2UZEA 4YHFA 5CVFA 3NUSA 1U4DA 4UALA 4WA9A 2PUPA 3AMAA 1YVJA 3OT8A 3FL4A 5BUIA 3ORMA 4JXFA 1XH5A 3PA3A 3CJFA 3V5QA 3VBXA 3V5LA 4MBIA 3OWJA 3PY0A 3CQEA 4WKQA 4YZBA 4NL0A 1S9JA 2GTMA 2CCIA 2DWBA 1VZOA 3BBTB 2J0LA 2QHNA 3FI4A 3FZOA 3E88A 4XV2A 5CI6A 5GJGA 4ERWA 3UOKA 2H8HA 3GOKA 5TF9A 4EH4A 4ID7A 4TL0A 3AQVA 2ITZA 5HLNA 2YCFA 4FV3A 4FV9A 4G3EA 2ETRA 4EK6A 2I40A 4O2ZA 4WBOA 5HIBA 4DYMA 5AA9A 5JFSA 3IDBA 4G9CA 5H8EA 3CQUA 4OTGA 2YCQA 1TQPA 4QMOA 4A9SA 4D0WA 1BKXA 5LMKC 3MWUA 5HO7A 2DQ7X 4W9XA 5H3QA 1DI8A 1JNKA 4FT3A 4LRJA 3P08A 2WQMA 3VS3A 5JRQA 3OD6X 2HXQA 5A54A 4O0UA 3LJ1A 3RAIA 3U9NA 1I09A 3D7TA 4G31A 2GHMA 4BFMA 5K5XA 2Z7SA 5JRSA 3VJOA 3W32A 3MSSA 2O8YA 1PMVA 5JT2A 4GYGA 3O7LB 4E93A 2PMNX 3UE4A 4FT9A 4F0GA 4OTQA 1BUHA 3Q9YA 1VYWA 4Q5EA 4DEDA 1NXKA 3EOCA 4U79A 1NW1A 1H1WA 4DINA 4K11A 5CAPA 4XRJA 3K3IA 3LVPA 4MQ2A 4XYFA 4RWKA 4FKVA 4EWHA 2YIXA 1YDTE 3GGFA 4IAZA 4IEBA 3QHRA 2R7IA 4EHGA 5HU9A 4ZSLA 3ZRMA 4RT7A 1M7QA 3U87A 4F65A 5EYDA 3LFQA 2V62A 4FSRA 2PL0A 3QRJA 5TKDA 5HORA 5D10A 2EWAA 2OICA 4DTBA 4D55A 1R78A 2XKFA 3SV0A 4FV7A 4GW8A 3LKMA 3H9FA 2WIPA 3IONA 3QTQA 3S0OA 4OLIA 4IX3A 4IM0A 3PIXA 2FSLX 2W5BA 4NSTA 3GU8A 3Q04A 3Q60A 2G01A 2QR8A 1P14A 4YTHA 4DAWA 3MIYA 3Q4TA 4F99A 3NX8A 4PP9A 2IO6A 3R00A 2OJIA 4QQ5A 4S30A 3D5XA 2YCSA 4FV6A 4NFNA 1UV5A 3W18A 3VBTA 4PL3A 5CXZA 3KRXA 5C03A 3AGMA 4JLCA 3VS2A 5FXSA 4BR3A 1G5SA 3PLAE 4FKRA 3ZM4A 5JFVA 5KE0A 1U54B 2OKRA 3D7TB 5EDRA 2C6KA 3UZTA 5I3OA 3DQWA 3RJCA 4KKGA 4TNBA 1R3CA 2CSNA 4EK4A 3ZO4A 4QTCA 2BTSA 4MXZA 4YO6A 2CGWA 4D2RA 3FKNA 5C27A 4FYNA 5AEPA 5J79A 4IIRA 4O2PA 3BHYA 3CQWA 4NM5A 4BCFA 1B38A 5IUIA 3W2SA 4FODA 4OTRA 2IN6A 1H0VA 2Z8CA 3BLQA 4BB4A 3DKFA 4C4JA 3BU5A 5IA4A 4IQ6A 4ENYA 5EHOA 2C5XA 1UKIA 1Q61A 3BCEA 4FTUA 4OTDA 5LJJA 2HZNA 4CT2A 3R8ZA 4FV4A 4ZTNA 1GJOA 1XKKA 3NGAA 2W0JA 5DA3A 3VS4A 4FICA 3FC1X 3FPMA 4FIEA 2QLUA 2WD1A 4HCVA 3TEIA 2GS6A 2UW4A 1REJA 2FYSA 2ITWA 2VN9A 2VTNA 3KRJA 4FMQA 4GFOA 4HGSA 3RHXA 3TIYA 4A9YA 5E90A 4AZVA 3ANQA 4EHVA 2XMYA 3UODA 4AGUA 3AMBA 4G34A 3OEZA 3E3BX 3R9RA 4YZNA 4PY1A 5CQUA 4QP3A 4USEA 5DT3A 1L3RE 1IASA 3CC6A 5A4CA 4V04A 4XG6A 5I9WA 2XJ2A 3CPCA 4Y5QA 1CKJA 5AR5A 5LXMA 1CDKA 2WELA 2ITXA 4RWJA 3GU7A 4UMQA 4JDIA 4NJDA 5T6KA 5B2MA 4TPTA 1H4LA 4FKOA 4I0TA 3KKVA 2RL5A 4GRBA 4XMOA 3FZ1A 4EJNA 3GBZA 3NUNA 4RRVA 2ZJWA 4UXLA 2VGPA 2DYLA 1O6LA 2H34A 2GFSA 1BMKA 3C51A 2W06A 3DKOA 3MDYA 2UW7A 5HLWA 3E8EA 4JS8A 1KE8A 1OGUA 5IQBA 3K5VA 4TXCA 2H6DA 3QQFA 5DH3A 3DXPA 2W1DA 2O0UA 1E9HA 4M3QA 4G6OA 2BALA 2P4IA 1OL1A 5AR7A 4GFMA 5FM2A 3BE2A 1UWJA 4CMOA 5DR9A 1SZMA 2OJJA 1S9IA 5AV1A 1CKPA 1H01A 3OFMA 4EC8A 4XOZA 4NKSA 5KMNA 2CKOA 1WAKA 4F0IA 3ETAA 4K33A 4JDKA 4P7EA 2ZDUA 4R1YA 4C61A 2J0IA 5FTOA 5LMAA 3COKA 3VN9A 2C6IA 4PPBA 4QP9A 4UWCA 2ITPA 3OC1A 5DGZA 4D1XA 3HUBA 3LZBA 4ZZNA 3R9NA 2F7ZE 4U9AA 4O0SA 5E1EA 5JH6A 2QI8A 5EM6A 2YN8A 4GG5A 3FAAA 4IAIA 3SXRA 5EFQA 5KCVA 5AP4A 5DRDA 4EOQA 3TNHA 3WE4A 3HV7A 3COIA 4BZOA 4K2RA 1W84A 2E9UA 4KBCA 2YA9A 4ANBA 5CI7A 1IR3A 3QXOA 3ZRLA 5FTGA 3KXMA 4XLIA 4FIFA 4BTJA 2YJSA 3HDNA 3LM0A 1JPAA 2QOCA 3F9NA 4CFFA 4YNOA 3T9IA 4BWXA 1BI8A 3O0GA 5LMKA 4QQJA 4DE4A 4EONA 4W8DA 2R0UA 3HNGA 4WNOA 4AAAA 3DJ6A 3BI6A 2PE2A 3Q9XA 2R3OA 4RX8A 4CTBA 5HG8A 3IDCA 3PA4A 5CEMA 3F5UA 3FSFA 1ZOGA 1IAHA 4HW7A 2YIYA 2QONA 3NNWA 3PZEA 1BL7A 4FNYA 4AOJA 4C4IA 5L8KA 2A27A 4DH8A 3KC3A 3IKAA 2VTLA 3R71A 4ITJA 1OL2A 1JSUA 1CMKE 4H58A 3ZU7A 4DEIA 3FWQA 5IF1A 4LI5A 4JBPA 3FHIA 4YHTA 1OIRA 3B2WA 5ANIA 3UNZA 5L3AA 2VO3A 3PY3A 3THBA 1M14A 2ERKA 2UZVA 3JPVA 3TKUA 3HMIA 4FZ6A 4EZ3A 4J96A 4HVGA 4GIHA 3DK3A 2J0KA 2CHLA 3HKOA 4W4VA 3OG7A 2WQBA 3WF9A 5A4TA 5A46A 3UNKA 2XNPA 1CTPE 2BZKB 2C5VA 3GEQA 1ZWSA 3Q9WA 4U0IA 4UY9A 3ZC6A 4BCNA 4JRVA 2BHEA 2C3LA 4GVAA 2WEVA 2Y6OA 3LFFA 4DH7A 4JVGA 4R78A 1WBWA 5DR6A 5HCXA 5AV0A 4I5HA 2FO0A 3KN6A 3UO6A 2YHVA 5GHVA 2C6DA 5L8LA 2CLQA 4CXAA 1M7NA 2Q0NA 3NCGA 3R7EA 4EBVA 2OF4A 4IDVA 5E8SA 2QC6A 4PMSA 1W83A 1UU8A 5I9XA 3F5XA 3VS5A 3OEFX 2NRYA 2DS1A 3E8DA 5GJFA 3TIZA 2CKPA 3BV2A 4KNBA 5DVRA 4BKYA 3Q2JA 4IX4A 3PVBA 1YQJA 2V0DA 3G51A 5L6OA 3VS0A 3EL8A 4I0SA 4D4VA 1NT2A 5HE2A 3LCKA 4TYEA 3UC4A 3SRVA 1F5QA 3ZHPC 5I3RA 5JQ5A 1V0BA 1OITA 1SNXA 4F9WA 1ND4A 4W4XA 3CEKA 3DKCA 3F3ZA 1IAJA 2R3JA 3LFEA 2F2UA 3MBLA 3UP2A 3ZYAA 4UMPA 1PXOA 1LP4A 3FI3A 2WQOA 4QP2A 5HICA 5FBNC 5T68A 3RNYA 4E6QA 4FTRA 5FEEA 2QKRA 3GQIA 4OT6A 5EOLA 2GS7A 2HENA 4H3QA 3UYSA 4AFEA 5DE2A 4JR7A 1YW2A 4MHAA 3KVWA 1JAMA 2QNJA 4NEUA 5J5SA 4O7TA 4J97A 2YZAA 3A8XA 2XIZA 3BV3A 3GU4A 3CSVA 3R1SA 4I1ZA 4IJ9A 4L52A 4EYMA 3AD4A 3G5DA 2HOGA 2IVSA 3VNTA 1OUYA 5DRBA 4I6QA 5K3YA 2OU7A 4C59A 4DGGA 3FE3A 1F3MC 4DGNA 2R3KA 1DM2A 1LPUA 4X7QA 3G2FA 3RMFA 4GKIA 2VWVA 4BDGA 1ZARA 2WGJA 2W4OA 2GTNA 2BRHA 4O22A 1MQ4A 4BBEA 4BGHA 5KMIA 5M08A 3A2CA 5CWZA 4LOPA 5IQHA 1PXIA 5CZIA 4PDSA 1UU3A 4M67A 4FTLA 1OECA 4WNMA 3ZLYA 4IHPA 4FTIA 5I9ZA 3FPQA 4A9UA 2J5FA 4MK0A 4J98A 5FXRA 2XK3A 3SRVB 4UMTA 2W1CA 3V6RA 4DF3A 4NT4A 2AC5A 3PXQA 4MKCA 4EQMA 2QO7A 4C8BA 3UJGA 2ETKA 2B1PA 4TN6A 2WKMA 1KV1A 3TUDA 4HGEA 4ASEA 2OIQA 5AUZA 3PDTA 1F0QA 3D83A 3GXLA 2WTKC 4E6DA 4B4LA 2J50A 5HX8A 4CFUA 4R77A 3MV5A 2OH4A 4CLJA 3ZM9A 2JAVA 4U8ZA 5AIRA 4EORA 1H27A 3PWYA 3F3VA 2R9SA 3CTJA 3IPHA 1UU9A 3CXWA 5AV3A 1GZNA 4RX7A 1HOWA 4BGGA 1PXLA 4L6QA 5AP5A 1R0EA 4FT0A 5I9YA 5B2KA 3QYZA 5J1VA 2RFDA 3BYVA 5TOZA 5FLFA 4AGCA 2PU8A 1FMOE 3F88A 3NYOA 2ZB0A 4YNEA 2PZYA 5E9EA 1FGIA 1WVYA 1SVHA 2GFCA 5IKWA 5IH6A 4ACGA 2CGXA 4DGOA 3BYOA 5AM7A 1Y8YA 2C1BA 3P4KA 2YISA 4MWIA 2J6MA 4USFA 4U80A 2PVRA 1P5EA 4EOIA 5L2TA 4X6QC 2Z7LA 3CD8A 4BI0A 4R3RA 5IH4A 1OBDA 4DFBA 4Y8DA 3FDNA 4JL9A 3OXIA 3PG1A 3F5GA 3PRIA 4WRSA 4RLKA 3DNEA 2R64A 2ESMA 2YM5A 4F1MA 3DNDA 2ITNA 4QO9A 4YPSA 3BYMA 2CLXA 1HCKA 3H4JA 2J0JA 3KFAA 4FL1A 4U97A 3LW0A 3QA0A 4FSWA 4RZWA 3VS7A 3SVVA 2RFSA 2JITA 2VWWA 3DXQA 4G5JA 5FEDA 3ZONA 2YM4A 3GENA 5F95A 4A9RA 4WIHA 4BDEA 3FQSA 3C4WA 4C2VA 2WU6A 1BI7A 4EC9A 4HYIA 3DS6A 4NM0A 4H3BA 3KXHA 3IW5A 4PV0A 1FBNA 1YI4A 5CNOA 2YFXA 4QNAA 3V8WA 1A9UA 2YIQA 4FTAA 5AX9A 3HL7A 5LMBA 4I4EA 3QQGA 2A19B 4AN2A 4DG3E 2QR7A 2XNOA 4P4CA 2E2BA 2FH9A 4W9WA 4BDFA 4LQMA 5AR3A 4BHNA 2I0HA 3ORTA 5IEXA 4ASZA 1BL6A 4NW5A 5GZAA 5E1SA 2HELA 3ORKA 4BZNA 2OG8A 1NVRA 1QPEA 2X6DA 4PL5A 3P1AA 2UVYA 5KMJA 1VR2A 3QRTA 2Y7JA 3LLTA 1Z5MA 3EKNA 2X9FA 3KGAA 5IQIA 4EYJA 3R8UA 3Q4UA 4AZTA 3NUUA 2J90A 4C3PA 4RG0A 3HX4A 4EI4A 2C5NA 3NUYA 2R3QA 3O8PA 3PRFA 4EJ7A 1U5QA 4F6WA 3F2AA 5BVWA 4XP0A 5D1JA 3W10A 2UW9A 2C1AA 4FI1A 2WTIA 1K3AA 4M66A 5GZ9A 4IFCA 3B8RA 4NJ3A 4FTQA 4RX9A 3LQ3A 3R7UA 2W99B 2QOIA 3F7ZA 4FV8A 1Q8YA 4Z7GA 3TZ9A 3H9OA 4MXXA 4AZFA 1NVSA 5LVPA 4BKZA 4C02A 3WARA 4FSZA 5DN3A 4L53A 1JKTA 1I44A 5ICPA 4FKLA 1ZYSA 4O84A 4EEVA 5J7HA 3K3JA 2B54A 3FKOA 2J0MB 4N57A 1DAWA 3Q53A 3LFNA 5KMMA 3VULA 1GOLA 4MTAA 2IZTA 4AN3A 1Y91A 3LFSA 4E20A 5BVOA 3PXKA 2E9OA 4Z55A 3CE3A 3RP9A 2IZSA 4FG8A 3JY0A 3LXPA 4FUXA 4IVCA 3R04A 2ITVA 5DLSA 4QPSA 4BIBA 2PUIA 4BCHA 3HP2A 2G2FA 2IPXA 3O71A 4DH1A 4QP1A 3LE6A 5A4LA 4JAJA 5DI1A 3VW8A 4AT3A 2JD5A 3V5PA 4YMJA 4ORKA 4PNIA 1M2RA 3FZTA 2JIVA 2WXVA 2YLEA 3D0EA 3PP1A 3TI1A 3UMXA 2ITTA 3VQUA 3ZSIA 5M4CA 2X0GA 3B8QA 4APPA 5HTCA 4Y85A 2X8IA 2PPQA 5T3QA 1H07A 2BFXA 4RIWA 5HLPA 4O0WA 1ZAOA 2UV2A 1Y8GA 4ANSA 3AC8A 4FL2A 4FKUA 2YDIA 4KA3A 4WG4A 3PXZA 3R9DA 3TG1A 2QCSA 3C4CA 1PMUA 4TNDA 3WIKA 4M84A 4W4YA 3LOKA 4FV2A 4R6VA 2IVTA 2VTTA 2WIHA 4YBKA 2JDOA 4KAOA 2PVYA 3D4QA 4PUZA 3ID6C 2BKZA 4YC3A 3TNQB 1Y6AA 1Z57A 4FKSA 4C36A 4ONAA 4RLLA 1M2QA 5IPJA 4C4GA 4AQCA 4ZS4A 4D0XA 2IW9A 5KHXA 4RA5A 2PE1A 4ZJVA 2F49A 3NYNA 4G6LA 4EOLA 4OBQA 4BWPA 3FXXA 1ZYCA 2IVVA 2JEDA 4QMZA 4IZ5A 2OFVA 3D7ZA 1OKYA 3PSCA 4F1TA 5M4IA 1ZYLA 4PTCA 2J9MA 4TRLA 5M56A 2EU9A 1V1KA 3JVSA 3POZA 3QTZA 1ZRZA 4RFMA 4BBMA 3N9XA 4I6BA 4XV3A 5BVFA 4M14A 3CY3A 3MVHA 5IISA 3PZHA 3UO5A 4BYJA 4KS7A 3VUDA 2BIKB 3QQLA 2B53A 3ZZWA 3TV4A 4FEWA 5AWMA 3CCNA 4CT1A 2PK9A 2R3GA 4FUYA 4QYYA 2OH0E 4RJ5A 2X6EA 3DK6A 2UZNA 3GNIB 4C34A 5HG7A 2HW7A 3WI6A 4EOKA 2BPMA 4GU9A 4FG9A 5G1XA 2QQ7A 5BYZA 4YZMA 3TZMA 2UZBA 3ZBFA 3C5IA 3BEAA 3GB2A 5AP0A 5EG3A 1Q8ZA 4O7WA 1L8TA 4ZZMA 3SX9A 3ZCLA 5K4JA 3UG1A 4FV5A 4PDOA 4X3JA 1W98A 3QD3A 2YWPA 3TNIA 2WTWA 4ANNA 4QP7A 4GUBA 3AG9A 1JVPP 3NUPA 4P5QA 1STCE 4OAVB 2BKKA 2FSOX 4KKHA 5EYKA 4UWYA 4CD0A 1H25A 2W4KA 2GMXA 1PW2A 4J8MA 4L42A 5IZFA 4IM3A 3UOJA 1IEPA 4RWLA 3GU5A 5IUGA 1YXXA 5D11A 5IA5A 4TYGA 4QMWA 1Y6BA 3H0YA 3MY5A 5EQEA 4DT9A 1PXNA 4CFMA 4R5YA 1LEWA 1PMEA 1WBVA 2IJMA 4KIPA 3V04A 3ROYA 2XEYA 5EHLA 4WUNA 5JMSA 2F4JA 4ZY6A 4DFUA 1OUKA 2WTDA 2FSTX 4MX9A 4FGRA 2GPHA 4A7CA 5DR2A 2XS0A 4APCA 5CT0A 5EM7A 1KV2A 4EK5A 1H1SA 4BI1A 4YZ9A 3P0MA 2EXCX 3OWLA 4IB1A 4WOVA 4BHZA 4IWPA 3ULIA 2VX1A 3LIJA 3CKXA 5ANEA 3ZEWA 4GVJA 4EKLA 4BL1A
chains in the Genus database with same CATH superfamily
2OW3A 5K5NA 1W82A 3GCVA 1JSVA 3OCSA 3PSDA 4MCVA 4TWNA 4RMZA 4X21A 5FGKA 3EZVA 2OZOA 3I5NA 1YHSA 3Q2MA 1G8KA 4F9YA 5JKGA 1UWHA 1JWHA 5C8NA 3IK3A 4O6EA 1LUFA 5EW8A 5CU0A 1JBPE 2G1TA 1NY3A 4XCUA 3OTUA 4F4PA 2OF2A 4EH9A 4XG7A 4E6CA 3R8PA 4LV7A 3F5PA 5KBQA 3AC4A 4D2PA 4UWBA 4QTDA 2YCRA 1GIHA 2QOQA 4F08A 4ZJIA 4QMMA 4ANQA 3U55A 1U54A 5FRIA 5KMLA 5IG1A 4UZDA 4C2WA 1PYEA 4QRCA 1JLUE 1H00A 1G8AA 2XYNA 2B4SB 3KCKA 4L01A 1WZYA 5ACBC 2ZV7A 1XMLA 3F7WA 1E1VA 3PJ3A 4F0FA 4ZLZA 4JQEA 5J9LA 4FTTA 2WMVA 5CNNA 2F7EE 3GC9A 3D5VA 4IE9A 5C9CA 3UGCA 4AOIA 5AUTA 5IQCA 5IQDA 4FJVA 2UUEA 5ACKA 4DA5A 3P79A 4EH8A 3OMVA 2I6LA 2GNLA 2EXEA 2OIBA 3HUCA 2QHMA 4FVPA 5HBEA 3V5JA 4HVHA 5AUYA 3GUBA 1Q8UA 3E3PA 4FSUA 4BGQA 5CXHA 2RSVA 3G90X 5BQ0A 4FSTA 4A4LA 3LFAA 3C4ZA 5F94A 2GNJA 4FG7A 3WZUA 4ALVA 5BPYA 3NCZA 1SVGA 4YTFA 5HTIA 3UMWA 3KIOC 3W0SA 2VTAA 4O4FA 5HCYA 2VWZA 5HE3A 3TTJA 2VTQA 3HA8A 3HEGA 3ZLXA 3QWKA 5BVDA 3DDQA 3BBWA 3O23A 2Y8OA 3QQKA 4AU8A 1ST0A 2C6OA 4XJ0A 2B52A 3MPTA 5IA0A 4QT1A 4FA2A 3MTLA 4FK3A 2BROA 3LXNA 4FTCA 2JGZA 4G3GA 3HA6A 4MWHA 4ZS0A 3PJ2A 3P7CA 1IRKA 3VF8A 3PPJA 3VUMA 1TQIA 3IGOA 2RGPA 3D94A 1YI3A 3REPA 3IW6A 5EM5A 4TYJA 3KN5A 3NDMA 2HAKA 1AQ1A 2QU5A 5A6OA 3NSZA 3OS3A 4U7ZA 4I5CA 4RIXA 1O9UA 2WMWA 4O1PA 3QCSA 3L9MA 2PHKA 4IB0A 5ANKA 3QALE 3DBFA 3DQXA 5DEWA 4A4OA 2ITQA 3BEGA 4ACHA 3ALNA 3C0IA 3C4XA 3R9HA 3BYSA 2VO7A 4FOCA 4NFMA 5F1ZA 5C26A 1H8FA 3A62A 4YLLA 4O86A 3A7IA 4CZYB 5FDPA 4FT7A 2B7AA 3EQPA 1ZXEA 3IG7A 2YM6A 4B6LA 5IEYA 5A6NA 5IQAA 5BYLA 3HDMA 5CS6A 3ZSHA 1P2AA 2YM3A 4YJUA 2QOFA 2BZHB 2VZ6A 2F9GA 4QYFA 4C58A 4E73A 1YWVA 4N4SA 1ZMUA 4RWIA 3F3WA 4MNFA 2O2UA 3FQHA 1BYGA 3U51A 3ET7A 2BAQA 2JFMA 2Z7QA 3FLWA 3ORXA 5EKOA 2QO9A 4WG3A 4R3PA 2R3NA 2QVSE 2GNIA 2HYYA 4QMLA 4F64A 4XBRA 5AP2A 3H10A 4GH2A 3TT0A 4ARKA 4LFIA 3FHRA 3KY2A 4RBLA 2IG7A 4TWPA 4AW1A 3DFAA 2BR1A 2C47A 3DDPA 4M97A 4ZSEA 4EKKA 3CTHA 5IU2A 4BVUA 4IBMA 3FLQA 1ZYDA 4QP6A 2VTRA 3M2WA 3ZOSA 3BZ3A 3JUHA 3BGPA 4QMPA 5LQFA 4O82A 1APME 4BTKA 4TYHA 3VUIA 3LMHA 3P78A 3TMOA 2H9VA 1UNLA 4RIXB 2UZOA 1HCLA 4FTOA 4HCTA 1YXUA 3EFLA 5E8UA 1DAYA 1RJBA 3T9TA 3SA0A 1Q62A 4CKIA 2JBOA 1OVEA 2Z7RA 1H1QA 2PVHA 3W0MA 3QRKA 2YEXA 3LQ5A 3NWWA 3W33A 2X4FA 4LMUA 4WUAA 4D9UA 2OIDA 3FYJX 3WIGA 2YIWA 4FEQA 3FZSA 4XOYA 2VGOA 3ZO2A 4YU2A 4QEBA 3KVXA 1XBCA 1H26A 1LR4A 2ZMCA 3UVPA 4CQGA 2X81A 5LWMA 1YI6A 4FSYA 4BWKA 5BNJA 4FEUA 2WB8A 3QTSA 3E92A 5G6VA 4PPCA 4DTAA 2JC6A 5J5TA 3FLNC 4G1WA 1ZLTA 2HY0A 3A4OX 4IB3A 3GC8A 2X7FA 3A60A 3UBDA 3VRYA 4QTEA 1YOJA 2XJ1A 3FUPA 1YKRA 2XALA 1FGKA 2OK1A 4OT5A 1PMNA 3TM0A 1GNGA 4CSVA 4FTJA 5J9YA 2I0YA 3K54A 5DWRA 2WNTA 3ORPA 2Y6MA 4LG4A 3I79A 3GFWA 1Z9XA 5CX9A 4ZSGA 3SDJA 4CV9A 5CASA 4GL9A 3IO7A 5K0XA 4O0YA 3R7GA 1W2FA 1YDRE 3HYHA 3KULA 2Y9QA 2VTPA 3M42A 3ELJA 4AUAA 4TYHB 3C50A 1ZZ2A 3D9VA 3EN5A 3PPKA 2X2LA 1BX6A 4OTHA 4IJPA 4AXAA 5J7BA 5KHWA 3EFWA 3WYXA 2VWIA 3FZPA 1JKSA 1PYXA 3RCJA 4X3FA 4IZ7A 3V6SA 4W8EA 3IW4A 3BRBA 3F61A 2VWUA 4LV5A 5DOSA 4CYJA 2CNQA 3FYKX 4DG0E 2OZAA 1R0PA 3SW4A 3UPZA 3QLFA 3GFEA 5E8TA 3I6UA 3DTCA 1DI9A 3O17A 4PF4A 2WHBA 4X2FA 2PVFA 3DT1A 5F20A 5EKNA 1OIYA 2PVMA 3M11A 4FKJA 3MPAA 4CCUA 3PFYA 4FZ7A 3QD0A 3G0FA 1IG1A 3Q5IA 2R3HA 3NMUF 3NVKI 4YJNA 4U3ZA 4EOSA 3ENHA 3UIMA 3G0EA 3ZLWA 3C13A 1WFCA 4XX9A 3FLSA 3VIDA 3FMNA 3DZOA 4BDKA 5I4NA 2EVAA 4YJRA 5IUHA 4AACA 2ZOQA 3DAJA 2X2KA 3UVRA 3L8XA 5HG9A 3NVMB 2Y4IB 2YM7A 5EI2A 4CKJA 5M4FA 3FI8A 3OY1A 4E8AA 1WBNA 4HPTE 3UC3A 4TT7A 2F57A 4YP8A 5GNKA 4EHEA 5DNRA 3BL7A 2PVKA 3QA8A 4KINA 3ZFMA 3U8WA 4BDIA 2WTCA 2XIXA 3AC1A 3KULB 1SVEA 3TUBA 2C6TA 3PG3A 3R7YA 3BU6A 4ITHA 4UYAA 1OPJA 3FEGA 3DK7A 4LOOA 5I5ZA 3MB7A 4AE9A 1WVWA 2BMCA 2JIIA 2AEGA 2UZDA 4JIKA 2PULA 3PYYA 5EQPA 3RAWA 5TR6A 2CGUA 1CKIA 1KE5A 3QHWA 5HVKA 4N6ZA 2BUJA 2GHGA 2QURA 4LUDA 1ZOEA 4X3FB 3L9NA 3ZC5A 4F7SA 2JDTA 5HD4A 1IA8A 3IOKA 1RE8A 3UDBA 3V5WA 1GAGA 4KS8A 3U54A 2PMIA 2OZAB 4K18A 3CJGA 4GCJA 3R7IA 3WZJA 2XNMA 2BRMA 4WHZA 3QCXA 2W1GA 3R83A 3DB6A 4K9YA 4K6ZA 1Q4LA 2XM9A 2ZM1A 3OUNB 5CANA 2PWLA 4FNXA 1PHKA 3ROCA 1G3NA 4AX8A 2ZVAA 3PE2A 3BQRA 4FZDB 4WSQA 4XV1A 3Q4ZA 4E1ZA 4E4XA 4M69A 5LOHA 4QOXA 4P5ZA 2PZIA 2CN8A 3Q52A 4MBLA 4ZP5A 3SQQA 4DG2E 4IACA 2BHHA 3C9WA 1UA2A 3MW1A 5AP6A 3BWFA 4PNKA 4F9CA 4R7BA 3DAKA 2WMXA 4HNIA 4LRKA 3E64A 3PSBA 5IDPA 2XK4A 4L3PA 1PRYA 2P3GX 3FJQE 4YJSA 4J99A 4J95A 3E8CA 3E8NA 4KB8A 3CTQA 3QQJA 4L9IA 3A7GA 3CGOA 4ZK5A 5DT4A 4E4MA 5BMSA 3R2BA 3NFFB 4DEAA 3HMMA 4L67A 1QCFA 3BGQA 4WNPA 4C4FA 2X8DA 3P7BA 3MA6A 3UQFA 3H9RA 2V7OA 4ACCA 4F6UA 4E6AA 2BZIB 4KRDA 3COHA 5E7RA 2A4LA 2C0OA 4USDA 3QX2A 3LCOA 4JQ7A 4G3FA 5AR2A 4YTCA 4FC0A 3ZFXA 4AXFA 3L8SA 5BVEA 5EHYA 1OKZA 2VNYA 5J87A 2RG6A 3R1NA 3Q96A 4FNZA 1URCA 1H1RA 4L3LA 1OL5A 4DGLC 1J7IA 4M13A 4U3YA 1UKHA 4QMUA 1AGWA 4B9DA 3FL5A 2BFYA 4G6NA 4FIIA 2X1NA 4ASDA 4FX3A 2R4BA 3EYHA 4NW6A 1XBBA 5E8WA 2BDJA 4QQTA 4ZY5A 3S2PA 3JS2A 3CS9A 3HV5A 3OCBA 4I24A 4NKAA 4D2TA 3C0GA 4D4SA 1J91A 3MGYA 4AT4A 3JR1A 2AC3A 5TT7A 4UX9A 3QTRA 4M69B 3RK7A 3UIXA 1T46A 4MVFA 1U59A 2PVLA 4I23A 3W2OA 4CMUA 3PJ1A 3R28A 5EW3A 4YZCA 4GYIA 4V01A 4XG2A 5FP5A 1GIIA 4HCUA 5HGIA 4U5JA 4XBUA 4F63A 4L8MA 2VWXA 4U42A 5CU6A 5DHJA 5CSWA 5ANJA 3ZUUA 2Q0BA 3F2NA 4I4FA 4I93A 3ZRKA 4WBBB 2V5QA 4L3JA 3ZXZA 5CF6A 3ALOA 4MF1A 4CRSA 4MH7A 5CU3A 3DLZA 3HECA 4AS0A 3I0OA 5FG8A 4DFXE 3BHVA 1SM2A 5CEOA 4O81A 5CYIA 3PJCA 2FSMX 3QUPA 5I9UA 3DZQA 1J1CA 3KU2A 2ZMDA 2HW6A 4AG8A 2ZDTA 4BDDA 5JK3A 3TL8A 1MRUA 4K8AA 2I0EA 2PTKA 4Y72A 4YBJA 4J8NA 4AGWA 4AWIA 4DCEA 1TQMA 4D1SA 5JZNA 5J8IA 5I9VA 2KTYA 3V01A 4CFNA 3UDTA 3IDPA 3JVRA 4YLKA 5A4EA 4HNFA 3O51A 1WBTA 1FOTA 2PZRA 4P90A 2HIWA 3VBWA 3U4WA 2CGVA 4D58A 3NW6A 5LVMA 4KWPA 1E1XA 1OM1A 4IAFA 2C0TA 4JG6A 2W05A 3ZEPA 5DT0A 1KUTA 2BAKA 3DBEA 5EQYA 3PWDA 4ZOGA 5HQ0A 3AMYA 4PQNA 4IDTA 3ZTXA 3AC2A 3RPVA 3PY1A 3EN7A 4NCTC 4MD7E 4AF3A 1YRPA 4ZIMA 3I1AA 4NK9A 1QPCA 3AKJA 1WVXA 1ZY5A 2W5HA 4TY1A 3SD0A 1MRYA 4ZTMA 3Q3BA 4D2SA 3L9PA 5H9BA 4H1MA 1XMMA 3EYGA 1TKIA 3EFJA 4F9AA 1Q97A 3KXXA 4K1BA 5HEZA 2YABA 5HI2A 5LVNA 3QQUA 5IA3A 4ZMEA 2Y0AA 4D4RA 5CAOA 3NPCA 5AFVA 3OZ6A 4XS2A 3DKGA 4QMTA 4IB5A 4RX5A 5IH5A 5ITAA 4MXOA 4ZLYA 1W7HA 2QLQA 3A61A 4QMNA 4YSMA 4AZSA 2JFLA 5HNGA 2BTRA 4S33A 2BDFA 2E9NA 1M2PA 5J9ZA 4EWQA 4ZEGA 3R30A 4FYOA 5AP3A 5AMNA 4BN1A 2RF9A 3NYXA 4UXQA 5A9UA 2J51A 3PA5A 3TXOA 2EB3A 4FVQA 4QTAA 5EYCA 2XCKA 5A14A 4O7SA 3D2IA 3LLAA 3DCVA 3ZZEA 3QQHA 3OY3A 3R8VA 4DDIA 3BE9A 4XRLA 2B9IA 4NH1A 4ENXA 1QMZA 2W7XA 4A4XA 5FBOA 3BHUA 4FIGA 3AC3A 1GZKA 2Z2WA 3R63A 3RCDA 1YOLA 4O38A 3UDZA 5DEYA 5KX8A 3LJ2A 4ANOA 3QFVA 3D15A 3JXWA 3ODZX 4BTMA 4G2FA 5AAEA 5M06A 2JDVA 4QPAA 3IW8A 2XK7A 2YAKA 3DXNA 3BIZA 3F6XA 3W8QA 4ANLA 4IVBA 1AD5A 3OWPA 5LCJA 5FP6A 1OGYA 5JGAA 3FI2A 2WQEA 3VBVA 3W0QA 2BCJA 2FUMA 4IMYA 4FTNA 3T8OA 5IA2A 5FD2A 2OXYA 5EH0A 4U43A 3MFRA 4JBQA 1MP8A 1QL6A 2ITYA 2X4ZA 3ENMA 4MXAA 1Q8WA 1ZOHA 2GNGA 2PZPA 3NZ0A 4I41A 2XF0A 4UZHA 4TKSA 4A07A 2R3LA 4O4CA 3WZEA 4C3FA 3MB6A 3CD3A 1RQQA 3VC4A 5EDQA 4S2ZA 5JQ8A 2IZUA 3TTIA 5KMOA 2GQRA 1UU7A 3QD2B 4HZSA 4B99A 3AKKA 4A06A 1V0OA 2X8EA 4JR3A 2WMUA 4EH6A 1P4FA 5CF8A 4JQ8A 2VNWA 3L8PA 2YITA 1Q5KA 4G3CA 3BQCA 2WEIA 4YSJA 5A4QA 2XVDA 5M55A 3PIYA 3RM6A 3ZSGA 4ACMA 4M15A 2DUVA 1SYKA 3FMDA 2B55A 1KE7A 4CFVA 3VHEA 4AZWA 2XKEA 4KUJA 3HP5A 4AP7A 4R5SA 3GCSA 4EK3A 3VUTA 4O7RA 3UZRA 2YM8A 5AIKA 3MFSA 5CEIA 4QMXA 4PDPA 2LAVA 2WMSA 3FC2A 4EZ5A 5IMXA 2GQSA 3PVGA 4XNEA 3A4PA 4O21A 2UZWE 1KWPA 3AT4A 3KK9A 4YC6A 3BWJA 4PWNA 2UVXA 3QTIA 4LUEA 5D7VA 3CBLA 4FV1A 3U4UA 2IVUA 3CIKA 4NYEA 2Z60A 3TACA 3TWJA 4KABA 3W2RA 4C33A 4XH6A 4MF0A 2OLCA 3E7OA 4QMVA 2ZM3A 2BRGA 3DJ7A 1Q24A 2FGIA 2HXLA 3KMUA 3OXZA 3VF9A 4XHKB 1JSTA 1U46A 2PVJA 3LHJA 3LXKA 4NIFB 3ZO3A 3SW7A 4BF2A 3ORNA 2XJ0A 1FQ1B 3DGKA 3FMHA 3S4QA 4FBXA 4QMQA 3NW7A 2FVDA 2HK5A 1XR1A 2IWIA 5CZHA 3R8LA 3NW5A 4B8LA 2CMWA 3WZDA 4GJ2A 3P86A 1V0PA 4H1JA 1WCCA 3BLHA 4M0ZA 5CY3A 3NRMA 4FL3A 4EOJA 4PP7A 3GP0A 4FKIA 2W96B 4S34A 2GHLA 3IQ7A 3Q9ZA 3R7OA 4UN0C 4O91A 3ATSA 3NS9A 5FEQA 3RINA 3PXRA 4I20A 4Y73A 4BC6A 3SKCA 3KREA 2HZIA 5CAUA 3QAME 4II5A 5KZIA 4RVMA 5FM3A 2G15A 1OI9A 4F09A 5EW9A 3W0RA 4IWOA 3UOHA 4XG8A 4JX7A 4ZLOA 2G9XA 5CLPA 1W8CA 4L00A 5HE1A 2IF8A 1ATPE 5HVYA 2AYPA 5IEVA 2HZ0A 3G9NA 1PKDA 5L2WA 1OL6A 1B6CB 2ONLA 4E26A 5HIDA 4AA4A 3RAHA 2OI4X 2RFNA 4ZMFA 3U6HA 5HZNA 2QKWB 3AT2A 4RPVA 2XK8A 4F70A 3R6XA 3PUPA 4RQKA 2W9FB 4LL0A 1SNUA 5IQEA 2J2IB 1XH6A 3IOPA 2OBJA 1H1PA 2F2CB 3LAUA 3PJ8A 3QRUA 3P23A 4RVLA 4C35A 3QZFA 3EQFA 4D5HA 4DEHA 4V0GB 1PXMA 3QZIA 4YHJA 3DBQA 5HO8A 3QC9A 3MESA 5ETCA 3WILA 3DA6A 3KL8A 4NCTA 3TNPC 4CVAA 5L4QA 4EH2A 3HAVA 1PJKA 5IQFA 4CG8A 3EQBA 4IW0A 3RNIA 3O8UA 5DFPA 4TYIA 1PKGA 4RC2A 2CDZA 5EI8A 2W1HA 2VO0A 5KKRC 3F2RA 5HD7A 3NAYA 3OUKA 4RA4A 3VUHA 2O64A 4FGBA 2RIOA 5F9EA 1YXTA 2JKMA 4GT5A 5IA1A 2C6MA 3RK9A 2NRUA 4IX6A 4JNWA 3GQLA 4C37A 5CALA 1EH4A 1FVVA 2UW5A 4GG7A 4XUFA 5FXQA 5IMEA 2WMRA 1JQHA 5H8GA 2NNWB 4H05A 4C4EA 2JLDA 5CSHA 4G5PA 3HRBA 2BDWA 4QMYA 5CU4A 2GCDA 2C3IB 1VYZA 5CAVA 5E4HA 4I5MA 2HWPA 2QD9A 1YHWA 5I0BA 2ITUA 3PE1A 1GZOA 5HE0A 4F7LA 4ERKA 4NM7A 3GCPA 4FV0A 4X2JA 4JJRA 5AUUA 3QZHA 2R7BA 4RFZA 4M68A 4R7IA 5E8ZA 4G3DA 4MD9E 1OZ1A 4Y46A 2UVZA 3LM5A 3RALA 3ML1A 4PDYA 3LCTA 4DLIA 5BX0A 2Y4IC 4QQCA 5EM8A 4TWCA 3HV3A 4NTTA 3F3TA 2YLFA 3HMOA 3OOGA 4FKGA 3TZ8A 5AADA 3II5A 3G6GA 2VWYA 4YZDA 2BILB 5LVLA 3AGLA 3RHKA 4FNWA 3BL9A 4DFZE 2WTJA 3PPZA 3QL8A 1KE9A 4UMUA 2YWVA 2VD5A 4A9TA 5CSVA 3GC0A 2OJGA 3NFGB 5AP1A 4X3FC 4JOAA 2ETMA 4YJVA 3WE8A 1J3HA 4BDBA 3LQ8A 4BIEA 5AV4A 4DHIB 4RJ8A 2PVNA 3RPSA 4EL9A 3C7QA 4O0VA 2XAOA 2YZLA 2OJFE 2X7OA 5L8JA 1FPUA 4EOPA 4N0SA 2OXDA 3U6IA 5BMMA 4CGAA 5M44A 4C3RA 1LEZA 2XAMA 5HIEA 4TW9A 2BVAA 3CLYA 1OMWA 3DB8A 4AN9A 5L2SA 2QOOA 4BCKA 4RJ7A 4BY9E 4KBAA 3FMEA 4EHZA 3JY9A 4IC8A 5K4IA 3QCQA 3PVWA 3MY0A 3TNWA 2C5OA 5JGBA 5JEBA 3EKKA 3OROA 3DFCB 1A48A 3OF0A 3H30A 2Y4PA 3AXWA 4N6YA 4ZTQA 4M8TA 3NYVA 2C3JA 3VJNA 3RZBA 3MH2A 4J1RA 3N4VA 3RTPA 3AD5A 3QRIA 4Y83A 3DPKA 4U81A 5GIPE 4KBKA 4JG7A 3VUGA 2XA4A 1OL7A 2A0CX 2O3PA 3KMMA 4HVSA 3KRLA 2QOBA 3F3UA 4FIJA 4IAAA 3MH1A 4KSQA 4BCJA 4DLJA 5C4LA 1FINA 4XG3A 3BU3A 2QODA 4HGLA 2UW8A 3V8SA 3L8VA 1KSWA 1ERKA 5E8XA 3ACKA 3H0ZA 3QUDA 3NEWA 2PMLX 4HOKA 1Q3DA 3BLAA 5AV2A 2XKCA 1VLRA 3DV3A 2W1ZA 5TE0A 1OBGA 3NIZA 2XK6A 1ZMVA 3E87A 3PP0A 3GCQA 4FKTA 2YIRA 3MH0A 5AX3A 2VX0A 2PMOX 3MYGA 2C5YA 4LYNA 3S3IA 4M0YA 4ACDA 4BI2A 3IGGA 3SOAA 5JFWA 1ST4A 4FZFB 5HU3A 4ZXTA 3V3VA 3FXWA 4DN5A 4O96A 4ANMA 2XM8A 3EWHA 4FSMA 2IEWA 3PXFA 3SHEA 3ACJA 1QPJA 4MD8E 3HV6A 2C6EA 4C7TA 4I3ZA 5B0XA 4DEGA 4UMRA 2QOKA 3A99A 3G6HA 4OGRA 4QYGA 2CN5A 4XLVA 4XP2A 4WNKA 3UTOA 2GU8A 4XEYA 2W9ZB 4RVKA 3G33A 3OXTA 4Q9ZA 3MVJA 3TUCA 5JSMA 3W2QA 1PF8A 3PFQA 4EZ7A 3BYUA 1XHAA 3DJ5A 4QTBA 5K0KA 2A98A 3I7CA 4FIHA 3TZ7A 2NPQA 2W1IA 4IC7A 3DY7A 4IVAA 2I0VA 2IZRA 2BAJA 3EQDA 5FQDC 3ZDUA 4CNHA 3WF6A 4PTEA 2R0IA 2VUWA 4OBOA 3QGWA 3JYAA 2JAMA 3AOXA 4MQ1A 2JKKA 3LPBA 1FVRA 4PTGA 3TKHA 3P9JA 3RKBA 3QTUA 3RAKA 3OBJA 1H24A 2NP8A 3D5WA 2GNFA 3E63A 5CT7A 4GU6A 2EXMA 3BGZA 2G2HA 4J53A 2WO6A 3KXZA 3QC4A 4UB7A 4BYIA 4Z7HA 4ZTSA 4YO4A 4GMYA 4O7YA 4K77A 5HTBA 2F7XE 2W4JA 3I4BA 4GK4A 3LCSA 1GZ8A 2W1FA 3LMGA 3MIAA 1ZY4A 5BVNA 4O0RA 2J5EA 4H3PA 4J7BA 3FSKA 1JKLA 5F4NA 5HESA 3C1XA 4BCPA 5M53A 3LFBA 4L7SA 3LXLA 4ZY4A 3S1HA 3R22A 3EHAA 4RJ6A 5ANOA 2VTHA 4KIKA 4BBFA 3SAYA 3NNUA 4E5WA 4G17A 4N70A 4WO5A 3EIDA 4EK8A 4IWDA 3OP5A 2R3PA 4U44A 4GT3A 4XG9A 5EYMA 2XP2A 4BRXA 3PUFC 5HOAA 3R9OA 3BKBA 4XV9A 4RVTA 3BELA 2C30A 4LOQA 3Q32A 3UP7A 3R7VA 5AAGA 4IZAA 5B2LA 3SG9A 3QYWA 2A2AA 4JX3A 3VO3A 2QO2A 2PYWA 2WMAA 2CKEA 2XRUA 4ZSAA 4GK2A 3OW3A 1QPDA 3NNVA 3OCGA 3E5AA 4E7WA 4F1OA 3V51A 3R73A 2XNGA 4EUTA 3RK5A 3IW7A 3UO4A 1CSNA 5FTQA 3OOMA 5BV3A 2ZB1A 3QKKA 4MAOA 3MJ1A 2FA2A 4RQVA 1YWNA 4CKRA 2XK9A 3Q6UA 4D9TA 4JRNA 4YJQA 3HVCA 5HNIX 5AA8A 1R1WA 3FY2A 4O7NA 5D12A 3EQCA 3TYKA 1ZMWA 3ZO1A 1OKWA 1XWSA 2OFUA 4HPUE 3QXPA 4CTCA 5AUVA 1G8SA 4YJTA 4P2KA 4NTSA 4IFGA 2W1EA 3MTFA 3GU6A 4JIAA 2XH5A 2HY81 2GDOA 3FLZA 4JAIA 4PMTA 4BCGA 3BHTA 5KKRB 2VO6A 4O83A 3ANRA 1PXPA 4KIKB 4L45A 1A06A 4O0TA 2VRXA 3OHTA 3PVUA 3VRZA 1TFFA 4DH3A 4R3CA 3O50A 4X2NA 4ITIA 4DBNA 3U6JA 4FEVA 1Q99A 3RZFA 2O5KA 4LGHA 4ZTLA 4JDJA 3MN3A 4RJ3A 2IW8A 3MPMA 3MA3A 5EOBA 4OTFA 3HZTA 3WF7A 2WMQA 3CR0A 3NNXA 4BCQA 3ZDIA 1M52A 3VVHA 1OIQA 3UQCA 2ZM4A 4HZRA 4OTPA 5HVJA 2R3RA 4DEBA 5KMKA 5HKMA 2PE0A 4X0MA 4DITA 3LJ0A 3MVLA 2X9EA 4O6LA 4X2KA 4CRLA 1M17A 4IVDA 5AR4A 4QP8A 4BCMA 3SXFA 3C5UA 3DBDA 3R2YA 3W2CA 1MQBA 2XANA 1H08A 2JKQA 3P5JC 3KXGA 2XBAA 1KOAA 4HYHA 3ATTA 3MFUA 4H39A 4HYSA 4HVIA 4ALUA 4C57A 2ACXA 2V55A 5HBJA 4PRJA 3POOA 3OVVA 3KB7A 2R3MA 5TO8A 3IECA 3VAPA 3I60A 5E92A 2PSQA 4RSSA 3T3UA 1IA9A 3QTXA 2JDSA 4GUEA 3EQRA 2C69A 3VHKA 3ZUTA 5C8MA 4C0TA 2BRNA 4BDHA 3UNJA 3DBCA 4ZSJA 4YC8A 4C62A 2XEZA 5CU2A 4AT5A 4CZTA 4IAYA 1ZYJA 4BDJA 2CKQA 4UV0A 4RFYA 1FMKA 2CCHA 3W2PA 4AW2A 1H28A 3TDVA 2E9VA 3GOPA 4O27B 5HO6A 2X2MA 4F9BA 3EN6A 3L9LA 4LV8A 1YXVA 2GQGA 4DFNA 2QOHA 1U5RA 2XB7A 3COMA 3EQIA 4KKEA 4LGGA 5CVHA 4WT6A 4U45A 5BUEA 2C4GA 2X39A 4NU1A 1BLXA 4JBOA 3MVMA 4LGDA 3SLSA 3QD4A 2VTIA 4I5PA 4NM3A 5DPVA 1VEBA 3I81A 4FK6A 4S31A 5JFXA 1XH4A 2W5AA 5ETAA 3TN8A 3EQGA 3VQHA 5M51A 3LFDA 5HCZA 3KEXA 1K2PA 3ULZA 5AJQA 5E8YA 3QTWA 3I7BA 5HHWA 5CEPA 4MNEA 3R21A 4YTIA 2XNEA 3S95A 5AP7A 4MXYA 3F66A 4PMMA 4YPDA 4PL4A 4RJ4A 5CENA 3ZH8A 1RDQE 4DC2A 4KSPA 3U9CA 2ERZE 5DYJA 2VU3A 2I7QA 4CLIA 4TTHB 4AW0A 4YR8A 1Q8TA 1REKA 2WQNA 4FR4A 3QF9A 3A7JA 2X0PA 3KRRA 2X7GA 4OBPA 4ZTRA 3QKMA 3WF8A 3QWJA 2C6LA 2UZTA 4IH8A 5KNJA 4JI9A 2OSCA 4DT8A 1GIJA 3QKLA 4CQEA 4LDTA 2WOTA 2VTMA 4YJPA 3SC1A 3CY2A 3KMWA 4WSYA