3CP9A

Crystal structure of the vegfr2 kinase domain in complex with a pyridone inhibitor
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
312
structure length
288
Chain Sequence
AERLPYDASKWEFPRDRLKLGKPLQVIEADAFGIDKTATCRTVAVKMLKEGATHSEHRALMSELKILIHIGHHLNVVNLLGACTKPGGPLMVITEFCKFGNLSTYLRSKRNEFVPYKVAPEDLYKDFLTLEHLICYSFQVAKGMEFLASRKCIHRDLAARNILLSEKNVVKICDFGLPLKWMAPETIFDRVYTIQSDVWSFGVLLWEIFSLGASPYPGVKIDEEFCRRLKEGTRMRAPDYTTPEMYQTMLDCWHGEPSQRPTFSELVEHLGNLLQANAQQDRHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Vascular endothelial growth factor receptor 2
publication title Discovery of Aryl Aminoquinazoline Pyridones as Potent, Selective, and Orally Efficacious Inhibitors of Receptor Tyrosine Kinase c-Kit.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 96
structure length 288
sequence length 312
chains with identical sequence B
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2008-03-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3cp9A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3cp9A01
3Q9ZA 4DCAA 4DEHA 2Z7SA 3IOKA 1QPJA 5EM5A 3NYNA 3VHEA 5M4CA 3JUHA 2C1AA 5KHXA 3V5TA 3CQWA 4O7LA 3PUPA 4G2FA 4YJPA 1XBBA 4XP2A 3NLBA 4FI1A 2DUVA 5ETFA 4ZS0A 4X2GA 3RPSA 3S3IA 1H25A 4I6QA 2DWBA 2OH4A 4KA3A 3OW4A 3ORIA 4B8MA 3OXIA 4IAFA 4IWDA 4E4NA 3EL8A 4YHFA 3NDMA 4OBQA 4AP7A 4OTIA 4DEDA 5A6NA 4QYGA 3NUUA 2WOUA 3BV2A 2OWBA 4BCMA 3KQ7A 4L44A 3JS2A 4D2RA 5C26A 3GC7A 2J4ZA 5CF8A 3BE9A 4E6AA 4RSSA 2BTRA 4O81A 3VF8A 3QLFA 4GT4A 4MX9A 4PWNA 2VV9A 4E4MA 3V5PA 4RC2A 2DYLA 3BIZA 2P55A 3MSSA 5GJGA 5AA9A 4NM0A 5IA0A 3U6JA 1GY3A 5J9ZA 4QQCA 4NWMA 4WRSA 4CFFA 3ATSA 3LMHA 1ZZLA 3IW4A 4EOIA 4IXPA 2GS7A 3AD6A 4GKIA 2PMLX 5FLFA 4QMVA 3VBVA 4QTCA 4BKYA 3QKKA 3GU4A 4OAUC 2C1BA 1CTPE 2YCRA 4LL0A 4MXXA 4DHFA 1YXSA 4FTLA 5BVNA 5IG1A 2VWIA 3HUCA 3KFAA 3NX8A 3W2PA 4BDJA 2V7OA 4FGRA 5DNRA 4I93A 4JAJA 4APCA 2PVKA 4IAKA 4R5SA 5JK3A 3HMOA 4I4EA 1MQBA 1XQZA 4V05A 2JBPA 3QU0A 5CU4A 2B9HA 2WEIA 2WQNA 1JSUA 1PJKA 2HYYA 3UQFA 1GZ8A 2PVHA 1OI9A 1P2AA 3EQPA 3LCOA 4RFMA 3MWUA 2WMAA 4NFMA 3BBWA 3P08A 4WG5A 4M66A 2HIWA 3HYHA 3EB0A 4JQ7A 2C3IB 4TT7A 5L2SA 1RE8A 4MBIA 4UN0C 3LKMA 5DEWA 4FNXA 4CKJA 3RZBA 5AP1A 3SOAA 3LCKA 3BBTB 3H30A 2OJFE 1DS5A 2VRXA 2RIOA 4L6QA 4IZ5A 4O0UA 5JZNA 3VJNA 3P7AA 4R5YA 4FC0A 2X9EA 2YITA 2Z8CA 3D2IA 4IX3A 3WYXA 4CT1A 5ETCA 5ACBC 2XK7A 1OL5A 4FV0A 2GDOA 3GEQA 3NYOA 4AA4A 4QYEA 5JFXA 4B6LA 5CXZA 2A27A 4AW5A 1I09A 2R5TA 5HNBA 1YW2A 4I20A 4DN5A 3QALE 4LUDA 1YI4A 3E8NA 3ODYX 2YAAA 3NMUF 4IB5A 4FTNA 3RKBA 4IM0A 2YCSA 3N9XA 2AC5A 1KWPA 3LFDA 2BIKB 4QMNA 4OLIA 5E8YA 3NNXA 2J9MA 4UYAA 3R9HA 2QOKA 2R3PA 4CD0A 3UOJA 3RHXA 2VTLA 4MWHA 2NRYA 1OUYA 2QOBA 4FIGA 4J7BA 1UU7A 3KRJA 3M42A 3RAWA 3QA8A 4ERKA 2CSNA 4DTBA 1OPKA 3OS3A 4M69B 5BPYA 3BRBA 4WT6A 1W0XC 3AT4A 3FKOA 4U0IA 1PMNA 3DFAA 4G16A 4FKSA 4EC8A 2R64A 4E3CA 3M11A 1GZKA 5F9EA 5KMMA 3TUCA 4CEGA 2B54A 2F4JA 4CTCA 3M1SA 5G1XA 3MPAA 3WF9A 3PPJA 4QNYA 5A9UA 3HV5A 3HVCA 3IGOA 2QC6A 4ZIMA 1Z57A 4YURA 2BAQA 5DOSA 3TG1A 4EYJA 2BZKB 1PMVA 5FM2A 4PDYA 4GEOA 4TN6A 3SRVA 4BN1A 2JDSA 2NPQA 3DA6A 4HGLA 3GCQA 4I6FA 3QA0A 2XBJA 3COIA 4BCIA 1XR1A 2F49A 1BX6A 4BHZA 2XK4A 3BYUA 2J7TA 3FZRA 3FMJA 4KRCA 4XRLA 5HICA 2IJMA 4K2RA 5FP5A 1UV5A 4OTWA 3WI6A 4ALWA 1XH5A 1Y57A 2VWBA 1PMEA 4O91A 4BFMA 3TZMA 5E8UA 5D41A 5KZIA 4EONA 5HX8A 3P86A 2B7AA 2J90A 3SXFA 4CG8A 4ZZMA 4A7CA 2QHMA 3AC8A 2RKUA 3AMYA 4J8MA 4M7IA 5EK7A 3MGYA 1NVRA 3CY2A 3OCTA 5IA4A 3NEWA 2BUJA 4E6DA 3PPKA 1M52A 4QP2A 5CTPA 3MJ1A 4EQUA 4R7IA 3KN5A 5CZIA 4BDGA 3EQFA 3QGYA 4FTAA 4FZ6A 4CFXA 5JGAA 5B2KA 2VNWA 1XH7A 3V8WA 4WSYA 3UNJA 4OT6A 3EKNA 1XH4A 3C4FA 4WA9A 3C9WA 4BWXA 1ZYLA 2Y4PA 2PE0A 3OF0A 3UNKA 4IAAA 5J9YA 3CQUA 2RFEA 2ZMCA 5FXSA 2R7IA 4RX8A 2VO6A 4XV1A 2NRUA 4NM3A 2WTIA 3BU3A 4Y5HA 4X3FC 5IA3A 5JFVA 4A9RA 3C7QA 4LG4A 4PRJA 2CGXA 2GQGA 4YZCA 3UJGA 4DCEA 3D5WA 1YOJA 2ETRA 5HU3A 3Q5ZA 4X0MA 4GJ2A 2HY0A 3P23A 4QD6A 3DPKA 3F88A 3MB7A 4YNOA 4FV1A 5CT0A 5KZ0A 3VUIA 4KS7A 4F9YA 4N70A 2YM8A 3BGZA 1A9UA 5LVLA 3CGFA 1VEBA 5L2IA 3EMGA 4D1XA 3R22A 2YM4A 2PY3A 4LOPA 1NT2A 4ZZNA 4GUBA 3WF6A 4D0WA 3KMUA 5CANA 4DFXE 5FEQA 3AC1A 5T68A 5TT7A 3DAJA 4U5JA 4IWOA 4FA2A 2BMCA 2W1ZA 4OTRA 5DVRA 3GFWA 4BTFA 1IG1A 4YPDA 4EH4A 4FKGA 4DH3A 3U51A 3P5KA 4G1WA 3DNDA 4TPTA 2HZ0A 3R8MA 4D0XA 3SLSA 3C1XA 3H9OA 5HZNA 3FMKA 4IQ6A 2R3RA 4FK6A 5CAQA 4XX9A 4NUSA 3FEGA 1AGWA 4Q9ZA 2VWXA 3MDYA 3IW5A 4RJ6A 3VUGA 4CLIA 1WMKA 4K18A 2F7ZE 5CNNA 3KRXA 3PJ2A 2YIXA 3LE6A 4BDAA 2CDZA 4UWYA 1XJDA 3UZTA 4WRGA 4JS8A 5EM6A 2WZJA 5HHWA 3ZZEA 3R7UA 4XOZA 2XCKA 3HV6A 4DA5A 3K5VA 1CMKE 2BR1A 5LARA 2GS6A 3E8CA 5ANJA 4ASZA 5BVFA 2QONA 3D7ZA 2G9XA 4JDHA 5KMKA 3DS6A 5JFWA 1YWRA 4NM5A 1OIRA 4D58A 4XG3A 1P14A 4K1BA 3Q53A 4UMQA 3QCYA 1DI9A 4MQ2A 4AT5A 2YAKA 3ORXA 2GHMA 4BIDA 3E7OA 3C4WA 2ZM1A 2OZAA 4DAWA 4I92A 5GHVA 2YLEA 3PE1A 5AR8A 2OXYA 4IAYA 4JQ8A 4XG6A 3LIJA 1G8AA 2H9VA 5IU2A 3DTWA 1Q8UA 4FV3A 2UZLA 3MIYA 3NNVA 4BI2A 3WIGA 5CLPA 4ANMA 5KNJA 5DHJA 3DV3A 3PJCA 3LFSA 2JDTA 5CEIA 2RG5A 3BX5A 3EZRA 3PZHA 4Y46A 3FMLA 4J71A 4KINA 4Q5EA 1MUOA 4XMOA 5CI6A 4BDIA 4F08A 4H1MA 3PLSA 5AAEA 4EOJA 5EW3A 1SVHA 5AP6A 5M56A 2XNEA 1ZMWA 5FGKA 1U4DA 4LL5A 4FV7A 3UE4A 3CKWA 4I21A 3UG1A 4D4VA 3OW3A 2Q0BA 2HZ4A 2PHKA 4DE4A 3MY5A 4FG8A 4EWHA 4DGOA 2IG7A 3IQ7A 4Z9LA 4Y85A 3EFKA 1ZAOA 2X8EA 3KGAA 1NXKA 2PUUA 3A61A 3QXOA 4N6ZA 4GU6A 2ITXA 4RIOA 1YHSA 1SNXA 3VRZA 3UO5A 3MI9A 4YUQA 2I0VA 5ANEA 3DFCB 3ZEPA 4G3DA 4Y95A 3IDPA 2VWUA 3GB2A 4OGRA 4PF4A 5EH0A 3IECA 4MXAA 5BYZA 3ZC6A 3UZPA 4F6SA 1SM2A 3AMAA 2I6LA 3FLSA 5AR5A 5I3RA 5BUIA 3QTXA 2CPKE 2X8IA 5IA1A 3ITZA 4L46A 3BELA 1IEPA 3NYXA 3OWPA 4J1RA 4GRBA 2C3JA 3RCJA 5J5SA 5L6OA 1RDQE 5HG8A 5FXRA 3LOKA 4IM2A 2GMXA 3PG1A 4RBLA 5IISA 2X4ZA 3IGGA 3BU6A 3NPCA 3SAYA 4C0TA 4TY1A 4Z7HA 3DKFA 4FKLA 4RJ5A 3KXGA 4LRJA 4MNFA 3ZDUA 2WNTA 3PXKA 4MXYA 4EBWA 2W06A 4FZAB 1PYEA 3D4QA 4A9YA 1UNLA 4RX7A 3D0EA 1WFCA 1B38A 2REIA 3TWJA 3HRBA 3JY9A 3LW0A 4FTCA 2C6TA 4GK2A 4XG7A 5D7VA 5I3OA 3NUNA 4AG8A 5L6PA 3DLZA 4JIKA 5L8JA 3TT0A 5IH5A 2GNFA 2BRHA 4BDEA 3GU6A 3VF9A 2BRGA 2X2LA 3DB6A 4BCHA 5CSXA 1KV1A 5K5NA 3QUEA 3PPZA 1FVRA 1WVXA 3TUDA 3GP0A 4QMTA 4FL2A 4RIYA 5AP4A 2JAVA 3EZVA 3ZZWA 5LJJA 3IO7A 1YI6A 4FV2A 4FSNA 4O0YA 1R0EA 5IDPA 3LHJA 3DQWA 1FVVA 2YLFA 3U4WA 3MH2A 2XB7A 4TZRA 2JDVA 4FX3A 1J91A 3E3PA 4YJNA 3PLAE 3E8EA 3QRJA 4FEWA 5LCKA 4CKIA 2V0DA 4RT7A 4MQ1A 4QRCA 3R2YA 2C5NA 3GC9A 4ITHA 4IVDA 4O0WA 5HESA 3AD5A 4FT3A 2QKWB 2WTKC 3ZXZA 4FTUA 4CQGA 2GCDA 1S9IA 3CE3A 3ORNA 3MJ2A 2XK9A 3UMXA 4DC2A 4FYNA 5K0XA 4ANSA 4QO9A 2Y6MA 3LLAA 2GNHA 4O83A 1UWHA 5AWMA 4XH6A 4AOTA 2R3FA 5AUYA 2CJMA 4N0SA 3U9NA 1RJBA 4FUXA 4CQEA 3T9TA 5E9EA 3VUTA 3VS3A 2UZVA 3N4UA 2OG8A 5KBQA 2JD5A 4M84A 5BMMA 1E1VA 5BYYA 2W05A 3PVWA 3QL8A 4NEUA 2WMVA 2VZ6A 5D1JA 3F2RA 3V6SA 1PHKA 2BCJA 2CLQA 2PZRA 3EL7A 4JQEA 3PJ8A 3R8VA 4PPBA 5JGBA 3FKLA 4EH6A 3DXQA 2UZBA 2GHLA 4ZY5A 4WBBB 2FVDA 4C33A 2W4OA 4MHAA 4TYHB 4EOPA 4FEUA 4TXCA 4MWIA 2VTSA 3D2KA 5IH4A 4FSWA 5J9LA 1CKPA 4UALA 3EJ1A 4EH5A 2QO7A 3FMDA 3FLZA 2C4GA 4EC9A 4J95A 4EYMA 3ZFYA 4FTKA 4HGSA 2F7EE 3GQLA 2XK3A 2XNOA 5D10A 3MN3A 3DLSA 2IW8A 3FC1X 4PPCA 5E1SA 5J79A 2XKDA 4O7RA 3EN5A 4FSUA 4F1OA 5J87A 5KE0A 4RJ8A 4IB3A 4NM7A 2C6MA 4FV8A 4V0GA 5AV4A 3FUPA 4RWLA 1Q3WA 2ITZA 3NUXA 4NTTA 5EM7A 4EOLA 3NW7A 4GK4A 4TYHA 4ITIA 4W4YA 4C62A 5AIRA 3GT8A 4J52A 1PYXA 2Z2WA 4JG8A 3DKCA 1K3AA 2JC6A 5DE2A 5EW9A 2YEXA 3T3UA 3WBLA 3R30A 4TTHB 3C4CA 1Q8ZA 3HA8A 5CF4A 4AU8A 1Q8TA 2BKKA 2F9GA 2OF2A 2GU8A 4EL9A 4FR4A 4BDFA 3OCBA 4C58A 3KULB 3ZLSA 5DRBA 2X6EA 2VTAA 5ITAA 1XHAA 4GCJA 2XCHA 3CJGA 4PNKA 3QWJA 3PG3A 2VTIA 2UZEA 4TRLA 1TQPA 1R39A 4PTGA 2X7GA 3DQXA 5BVOA 2IVTA 3C0HA 5I9XA 5GJDA 1ZZ2A 3MYGA 4NKAA 4C2WA 4P7EA 2PVJA 3TKIA 4BKJA 3UC4A 2XIKA 4D2SA 2JAMA 1WBTA 5HORA 3RPYA 4F9WA 1QPDA 3AC3A 4R3CA 1OBDA 2QOIA 1H8FA 3QF9A 4RFZA 1OL1A 4G9CA 3OUNB 3COKA 4ANQA 3CSVA 3D7TA 3A7GA 4C4GA 1HOWA 3F9NA 4KSPA 3V8SA 3H10A 4NCTC 3QTIA 4G31A 2PVRA 1UA2A 3TEIA 4CZYB 2XIXA 3ZSGA 3MPTA 4HOKA 4ALUA 4IB0A 3KY2A 4OTFA 3F5GA 3L9PA 5KMNA 2VGPA 2R3LA 3G0EA 3AD4A 5ANDA 3W18A 3ID6C 3DK3A 4KIPA 4QMUA 3ZRLA 5C4LA 4AW1A 4QP8A 4TYEA 1ZWSA 4AA5A 1OPJA 5HI2A 1ZOHA 3V51A 2P33A 2V55A 3TUBA 3IG7A 2HK5A 1SNUA 2XEZA 2NO3A 3NCZA 5E8VA 3BPRA 2PMNX 4IFGA 3EFJA 4GYIA 3MTLA 4KAOA 4DT8A 2JDRA 4JR3A 1X8BA 4ENYA 4JDKA 1H00A 4CCUA 3HNGA 4FG9A 5M07A 1J7LA 2VWYA 4E5BA 4HGEA 4EH8A 4EOQA 3OWJA 1APME 3H9RA 4ZTNA 3OROA 5AJQA 4HZSA 2YCQA 3CEKA 4YLLA 3UOKA 4GFOA 3RNIA 5M06A 4QMZA 3MY1A 3K3IA 4XJ0A 1PY5A 2G2HA 3WARA 2WMWA 5EI8A 1REJA 3EQHA 4XBUA 1ZARA 4E1ZA 2GNJA 2C6LA 2UUEA 5CXHA 1H0WA 4QMOA 3R1SA 5F20A 3ZUUA 4A9SA 3GU7A 3U55A 2C68A 5AAGA 4AT3A 4RC3A 2PE1A 2VX0A 5AMNA 4K6ZA 5AUWA 2GNGA 3ET7A 2C6DA 4G5PA 1IA8A 3A62A 3GENA 4EH9A 2QO9A 4S31A 1P5EA 3RPOA 4LI5A 4PMSA 4PDSA 5M51A 2J51A 4FIEA 4HVDA 3DCVA 3MBLA 3F5PA 2R4BA 3PJ3A 5HIBA 2VWVA 1ERKA 4FZ7A 4GVJA 3P78A 3QGWA 4MH7A 4I1ZA 4PTEA 3FY2A 4Y72A 3WZDA 3ZDIA 3QC9A 4RRVA 5EW8A 1A48A 2FB8A 2YACA 5CU2A 4RVTA 4YJRA 4MCVA 2EXEA 2RGPA 1UU9A 2FSMX 3KCKA 3QUPA 1Q8YA 2E9UA 1KV2A 2WMUA 1WBVA 2OF4A 4CFNA 1YDRE 3QCXA 2XVDA 4X2KA 5J1WA 2GTMA 3DBCA 4HNIA 1PXPA 5CEKA 4FKRA 3UDBA 4F63A 4DG0E 2XNMA 4FEQA 4WNOA 2XP2A 5HG7A 5HTCA 1BYGA 5DIAA 2RFNA 4CKRA 2F2UA 5C8NA 4QP9A 5LXMA 3OHTA 4IACA 3OEFX 3SV0A 1M7NA 2IN6A 4RWKA 4H1JA 3F3ZA 4PUZA 4EZ7A 4K0YA 2R7BA 2WQEA 3NAYA 5JSMA 1M7QA 5EKOA 4KKEA 1OVEA 3PXYA 4BYIA 5IQBA 1CSNA 3FJQE 4ZTRA 5IDNA 3DJ5A 1KE7A 2G01A 4FTQA 2W1HA 4KSQA 4EOSA 5HX6A 4YO6A 3WZJA 1DM2A 3DBEA 4WUAA 2R3NA 3HX4A 4BWKA 3FSKA 3KMWA 3O7LD 5AUZA 5CSWA 3FZPA 4JT3A 3H9FA 2QI8A 3GBZA 4JVGA 3PSCA 4UMPA 2XMYA 3E92A 1E9HA 3Q52A 4RVMA 4GMYA 2UW7A 2CNVA 3TNPC 3DU8A 3EQCA 3U87A 5AP2A 3JYAA 4FSZA 1JKSA 4H58A 3GVUA 2H96A 5AR4A 2ITVA 1H1WA 4MF1A 2OICA 5FEDA 4QMXA 5KMIA 3BHTA 3JVRA 2UW9A 2B9FA 3HRFA 3G9LX 3C0GA 5T6KA 2CCHA 3P7BA 3PFQA 4KNBA 5E90A 2B9IA 3KB7A 4FSRA 4NYEA 3RM6A 4NZWB 4IC8A 1JBPE 2YA9A 3UO6A 4BYJA 3R8UA 4CGAA 3BLQA 1U5QA 3QYZA 5CNOA 3ZRKA 5M4FA 4E6CA 1JKKA 1JQHA 4TWPA 3W8LA 2XJ0A 5HG5A 3SC1A 3A7JA 2PMIA 3ZM4A 1TVOA 4AGDA 3JXWA 3MA3A 4R3PA 2KTYA 2AUHA 3S0OA 5IQEA 4NJDA 2VTRA 5A4EA 1G3NA 2CCIA 2Y9QA 4FZDB 5BVEA 5EDQA 4HVHA 4FEXA 4EUTA 2OK1A 3NIZA 2C5YA 2VTQA 2YIWA 4IZ7A 2YJSA 5ICPA 3TXOA 4O84A 3HMMA 5E91A 3I1AA 4YHJA 2X2MA 1ZXEA 2W1CA 4NSTA 3MTFA 4QPAA 2G1TA 2HY81 1WBOA 3Q32A 3ZO1A 2ZB1A 2OGVA 3F2AA 1TQMA 2HWPA 2AC3A 3G5DA 2VD5A 3UNZA 4ASEA 4XG4A 1J7UA 1PXOA 3QBNA 3FXXA 4M3QA 5K4IA 2J0IA 2V5QA 4C3FA 3K3JA 1ZMVA 4USFA 3UVRA 1M14A 4USDA 1YKRA 4ZXTA 3BQCA 1FOTA 2Q83A 3ROYA 4C57A 2J0MB 4O0VA 2P2HA 3AXWA 5KBRA 1UKHA 4E6QA 5C9CA 5AM6A 3K54A 3V04A 1NVSA 4D2PA 4EBVA 3HP2A 4IX5A 4U79A 2CNQA 5DWRA 2J0KA 4FYOA 4XP0A 3DZOA 5EYCA 4AFJA 4EH7A 3MB6A 4V04A 5LMKA 4BICA 3R9RA 2HZNA 4BZDA 4CFMA 2GFSA 2YISA 1CM8A 4M14A 4OAVB 4X3JA 1P4OA 4I6BA 3PZEA 3L8PA 4YO4A 1M2PA 4QP6A 2UW0A 4WNPA 4HJOA 3E63A 3FMHA 3PY1A 4L8MA 4FKWA 4P2KA 4W8EA 4D5HA 4U9AA 1U54B 3UIBA 3L9MA 4B9DA 3FLNC 3Q9XA 3FHIA 3RP9A 3KEXA 3DNEA 2BDFA 3UOHA 2RG6A 3GQIA 2WU6A 3BI6A 2IVVA 1URCA 4W4WA 4MNEB 5HO7A 3IK3A 4FE2A 1EH4A 3B8QA 2WTWA 3RMFA 2XM9A 2ONLA 3EIDA 4F0FA 2E9PA 1YDSE 1YDTE 3BZ3A 4KBCA 2VGOA 2FYSA 3ZTXA 5H9BA 1XWSA 3UIUA 5CAUA 5E92A 3KKVA 2X39A 4M15A 1OKWA 5CSVA 3RK9A 3HMNA 5FD2A 4FTMA 2YIQA 2ITNA 3FQSA 2PVFA 1U54A 4I6HA 1Z9XA 4FNWA 3HDNA 4UBAA 5IH6A 3TDWA 2JIIA 3IKAA 4UZDA 3F7WA 3LFFA 4BZOA 4K11A 4ACCA 4FVRA 4AGWA 2OXXA 5CAOA 5H2UA 1L3RE 2QOOA 3AQVA 1ZRZA 4FZFB 4X6QC 4AGUA 4EOOA 3R8PA 4U6RA 3W16A 2EWAA 5K4JA 3FV8A 4KKHA 3CCNA 3TIYA 4BTMA 1XH8A 3AOXA 4C36A 1U5RA 3NR9A 4X7QA 2O8YA 4QMLA 2WOTA 5EDRA 3C51A 5JKGA 3R7YA 4QMSA 5G6VA 3F3UA 3UMWA 3I7BA 3KF7A 1YRPA 3KRLA 3TI1A 3R04A 4F6UA 4EJ7A 2WTVA 3G51A 4M69A 4FKTA 4K33A 4QPSA 4O7TA 3ZM9A 1DAWA 3D14A 3KC3A 1OITA 1F5QA 2JDOA 4FSYA 4J98A 2ERZE 5GNKA 1YXTA 3K5UA 2PZ5A 1ZY5A 1YWNA 3R2BA 2R0IA 2XJ1A 3RHKA 3DAKA 4RX5A 5IMEA 3F61A 3AC2A 4ACHA 3SW7A 4I24A 4RVKA 5TOZA 5EQPA 3BLHA 4HW7A 2YWVA 4XBRA 4EK8A 5LWMA 3U6IA 3BEAA 4O7VA 3MH1A 4OBPA 5J1VA 3QZIA 4O38A 4OTHA 4RZVA 4HNFA 3TZ8A 4KD1A 1XBAA 1Q61A 2WHBA 4FV4A 4BDHA 3NVKI 4ZY4A 3TIZA 3EQIA 1WVYA 4ASDA 2W17A 3R8ZA 3ULZA 5TF9A 3NNUA 4BI0A 2PUIA 4C4FA 4P5QA 3F2NA 4QMYA 3M2WA 4MXCA 4FIIA 5AP3A 5EHYA 3UIXA 5IUHA 2ZMDA 5C8KA 4ZJVA 5IQHA 5IKWA 2ZAZA 3FZOA 3OTVA 4KRDA 4G34A 1YVJA 2WKMA 1CKIA 2UZOA 3KMMA 2YWPA 2VTPA 2WFYA 5HLNA 4DEBA 4TYJA 4NU1A 1H07A 2R3HA 3PY3A 5FRIA 3O51A 3VRYA 2BFXA 4BGQA 4D1ZA 3TKHA 5B2LA 2WMSA 3A60A 3Q5IA 3LXKA 3HZTA 5IMXA 1FINA 3BQRA 1PMUA 4LOQA 1ZOGA 2QU5A 4L52A 4ONAA 4AN9A 2FSOX 3ATTA 2CKPA 4EHGA 4GK3A 1IAHA 2HXQA 3PWYA 4M12A 2WIPA 1O6KA 2DS1A 1RW8A 3ERKA 4JG6A 3FPQA 5LWNA 4RWIA 5FG8A 2VNYA 5DT4A 4EK4A 3ZSIA 5ANOA 1OB3A 5L2TA 3KRWA 3QD3A 2ITQA 3I79A 1T45A 4B4LA 4FKJA 3MVMA 1W83A 2GSFA 1JPAA 3BYOA 4O22A 4LRKA 4WKQA 3U4UA 2BHEA 2WU7A 3DOGA 3IW8A 3VS0A 4PMMA 3SW4A 5IQDA 3GU5A 4WBOA 2FUMA 2XKEA 3D15A 4HPTE 5HKMA 4OR5A 3VNTA 4BY9E 4BCQA 3E3BX 2PSQA 2YM3A 2YERA 1JKTA 3DZQA 5C1QB 3FMMA 4TWCA 3II5A 4QMMA 3W8QA 2ERKA 5IEYA 5KMJA 1NY3A 2R3KA 3HUBA 5DEYA 4BGHA 3JVSA 3NUSA 2PZYA 1OM1A 4XP3A 5KHWA 4NL0A 1YOLA 2XH5A 3BU5A 5GIOE 4WHZA 5FBOA 4CFUA 2BAKA 2J0JA 2ZYBA 3DDPA 3GU8A 4ZEGA 3HRCA 2OJGA 4BCNA 4DBXA 1LEWA 2EXCX 5K5XA 2OIQA 3MVJA 4CXAA 4ZK5A 4JRVA 3O71A 3TJDA 3VVHA 4ZSEA 1LP4A 2BAJA 1FMOE 5L2QA 4E20A 3ALNA 3NIEA 3O7LB 3P4KA 3Q6UA 4KIKB 4EZ3A 5I9WA 2WQBA 5GINE 3MV5A 2H34A 3Q2JA 1XH6A 5M55A 3N4VA 2QOFA 3FY0A 3PXZA 4CV9A 2W9FB 3PSDA 1UKIA 1BKXA 2BFYA 4AW2A 3E62A 3C5UA 4YZDA 2WQOA 3PXFA 4MTAA 5IQGA 3FDNA 3WF5A 2PL0A 4GIIA 2ZVAA 3F7ZA 4B0GA 3H3CA 4U43A 5D12A 2YDKA 3BHHA 5CY3A 5JGDA 3BKBA 3AGLA 4DTKA 4UMTA 2BTSA 4GSBA 5EHLA 2QOLA 3R7IA 4G6LA 3ZU7A 4L67A 1CDKA 5KO1A 5M53A 5DG5A 2PE2A 3EQGA 3PVGA 4KIKA 4D28A 3ZLXA 5CVHA 2FGIA 4S34A 2UV2A 1BL6A 2QQ7A 2YM7A 3FL4A 4KS8A 4ZTLA 1MRYA 3CD3A 4IVBA 1M17A 3ZONA 5A46A 4I22A 1VJYA 3R9OA 5IZFA 4C4IA 3QTRA 1S9JA 4XHKB 3LCSA 2WMXA 3G6HA 4FOCA 2WMRA 5JQ5A 1WCCA 2OI4X 4CMUA 3FXZA 3BCEA 3F82A 4RVLA 4PDPA 3IS5A 4RJ4A 5DMZA 3AT3A 3SOCA 3EQBA 4ANLA 5DT3A 3QXPA 4IAIA 4QP7A 3GCUA 1FPUA 4FTOA 2WTJA 2ZOQA 3OBGA 3ORZA 3PY0A 4JIAA 4LGDA 5EQYA 2PK9A 3SX9A 3VN9A 4D9UA 5AR7A 3GFEA 1GAGA 3OWLA 3UODA 1V1KA 1Q3DA 2W96B 3RNYA 5AADA 3SQQA 4Y83A 5IQAA 2E9OA 4YBKA 4JDJA 4AZSA 2R3JA 2XIYA 1ZY4A 3O8TA 4FT5A 2C5OA 4MD9E 5GJFA 5HE2A 4A4OA 4BGGA 2RFSA 5IPJA 2CN5A 4FTIA 3GNIB 2XNNA 3MESA 1OIUA 4EQMA 4RX9A 3QD2B 2JIUA 1IRKA 4LV8A 2R3OA 3T9IA 3GGFA 3CS9A 2YN8A 2XIZA 2ZJWA 2XYUA 3OUKA 5CALA 2LAVA 1YI3A 4YZBA 2HZIA 3KVXA 3FQEA 2YHVA 3DB8A 4U97A 3QQJA 3QTSA 4XCUA 3PXQA 4C35A 3U6HA 2EXMA 4DEAA 3EFLA 3ULIA 4FVQA 5B2MA 1Y8GA 2YM5A 4C34A 4IE9A 5L8LA 4RFYA 4EH2A 3LM0A 5LMBA 3HV7A 2W1FA 3MFUA 5LCJA 3OZ6A 2RL5A 2XYNA 2ZDUA 3V5QA 2H6DA 3F3TA 4QTBA 1URWA 4GYGA 5KX8A 4FMQA 3NYVA 4GL9A 4FKOA 1V0PA 2UZNA 4FTTA 5CZHA 4IW0A 3VUMA 3LAUA 4F70A 4TNBA 4YJUA 4L3PA 4YU2A 4YJVA 3QHWA 3R8LA 3LMIA 4UYNA 4BHNA 4BR3A 2BVAA 4XUFA 4B8LA 3A99A 2GQRA 3SG8A 5F95A 1ZYCA 3UO4A 2QCSA 3CLYA 5L2WA 3QWKA 5K3YA 3QCQA 4UWCA 3MH0A 5BNJA 3VBWA 4PV0A 4CYJA 4J97A 5BUJA 4M13A 4IEBA 5KUPA 3ORTA 2ZV7A 2CKQA 3UTOA 1U46A 2ETMA 2J5FA 2ZM4A 5FBNC 1MQ4A 3IW6A 2HWOA 2C0IA 4KKGA 4R6VA 2IW6A 3IDCA 4YTIA 5E8TA 4I3ZA 4DH1A 3OOGA 4QYHA 5A3XA 3DK6A 4BVUA 3Q96A 5EYDA 5HVKA 2R0UA 4IZYA 4UV0A 4QMQA 4CV8A 3DAEA 5HO8A 4DH5A 3ZFXA 2G15A 2EB3A 4QP4A 3VS5A 4F64A 2FA2A 3C4ZA 4O0RA 5EQEA 3COHA 2R3IA 4BCGA 4FG7A 4BKZA 1AQ1A 2XJ2A 3BYVA 4U3YA 2WD1A 5HCZA 4I5CA 5JFSA 4AXAA 3CKXA 2QLQA 3KA0A 3UPXA 5A14A 3CR0A 5JEBA 1FMKA 3IOPA 3ZH8A 5C8MA 2W0JA 5AUTA 2PUNA 4ACMA 1UWJA 2J5EA 5HBEA 3SXRA 4DGLC 3TJCA 1JWHA 4IM3A 3WOWA 4BCFA 4BWPA 3IDBA 3BV3A 2O2UA 4EORA 2UW4A 2UVXA 4IVAA 3C5IA 4GT5A 1GJOA 2CGUA 4X6RA 4C8BA 1ATPE 4CSVA 1SZMA 2BRBA 3C4EA 4OTPA 3LXNA 5DFPA 5H8EA 4HVGA 4U40A 4Z7GA 1JLUE 3KK9A 4OW8A 4R7BA 4L45A 4G9RA 2I0YA 2B52A 4H36A 3BEGA 2P3GX 3C0IA 3E87A 3VS1A 4WSQA 1OKVA 3DBFA 1IR3A 2EU9A 5EFQA 3HKOA 1OBGA 3ZO3A 4EH3A 3FXWA 4G17A 2VO3A 3CTHA 3LXPA 3QRIA 4D4YA 4BTKA 2O0UA 5KMLA 5CYIA 5BVKA 2RF9A 4JG7A 3ENHA 3OVVA 3Q4ZA 3PDTA 4C4EA 1BLXA 1VZOA 4I0RA 3IPHA 4ITJA 2I7QA 3UQCA 4ZLOA 4W9XA 4YSMA 5E1EA 1SMHA 2J0LA 3HECA 4L7SA 4GH2A 4O27B 4Y5QA 2BRNA 5EYMA 3RK5A 4A06A 4BL1A 4FICA 5L8KA 2OLCA 2CGWA 1H26A 4M97A 3GCSA 4BIEA 3QZGA 2FO0A 4E5AX 3G90X 3PRIA 4B99A 3VBQA 3RALA 5A4QA 3LFBA 3A7FA 3LQ8A 4MXZA 4C61A 5L3AA 5J7HA 5GIPE 3UGCA 4J96A 1YQJA 1V0OA 4BTJA 2XKCA 5DBXA 5IA5A 4F7JA 3E5AA 3EN4A 5HOAA 4GS6A 1B6CB 3OCGA 3LPBA 1NA7A 3P7CA 4QTDA 1ZMUA 3R1YA 3ZSHA 3QYWA 1OECA 4EKKA 4TL0A 3VUDA 3CJFA 3O50A 1YHWA 4CMOA 3FI4A 3RWQA 4TWOA 3DBQA 2WTDA 2EVAA 4GV1A 2OKRA 3RAHA 3ROCA 4PY1A 2E9NA 5DR2A 3V5WA 3ZEWA 3ZYAA 4BCPA 4D55A 4DYMA 5BYLA 2WQMA 3KULA 4TKSA 2YIYA 4DLJA 3KF4A 2C6KA 3MH3A 2X1NA 4PL3A 1R3CA 4X2NA 5C01A 2XUUA 4ALVA 3QKLA 2UZDA 4PDOA 1HCLA 4F99A 4MEDA 4H39A 3Q4TA 4FTJA 2VAGA 3WZKA 3P1AA 4Q9SA 1GOLA 3G15A 2NNWB 2Z7RA 3HAMA 3Q4UA 4ZOGA 2KULA 5HBHA 4F6WA 5HTBA 5IUGA 5E8XA 5AUVA 3FI3A 2CHLA 4PMTA 1JAMA 5LOHA 2OJ9A 3ANRA 4WG3A 3RZFA 4UX9A 3DDQA 2WB8A 4F4PA 2QVSE 5E4HA 3RGFA 3ZBXA 2CGVA 1GZNA 2HXLA 5FQDC 2JFLA 2CKEA 2B9JA 3D9VA 2XNGA 4UB7A 2BROA 3W1FA 2PPQA 2UW6A 5A4LA 3EWHA 4W4XA 3THBA 5E8WA 4BCOA 3UQGA 3QQUA 3N4TA 3NUAA 4ACDA 3FLYA 4O2ZA 4J53A 2HAKA 4YTHA 3O96A 3REPA 1XKKA 4EK5A 1WBWA 1OIQA 4RJ3A 3BLRA 2A1AB 3F6XA 1U59A 4IBMA 4IX4A 4C02A 4C59A 3VHKA 5DYJA 5M08A 4M8TA 4U81A 3RBWA 1TQIA 4BRXA 4F0IA 3EN7A 1Q8WA 5AR3A 3VJOA 3OY3A 2JFMA 4O7WA 3HGKA 1BUHA 2XKFA 3RJCA 1WAKA 2Y8OA 4CZTA 5I5ZA 4FK3A 4JX3A 4YZ9A 5BX0A 4XOYA 2WPAA 4BF2A 3TDVA 5AV0A 3ORMA 3QQKA 4YNEA 4H3PA 4EQCA 2PTKA 4LGHA 2XS0A 1MP8A 3NSZA 4TNDA 1ZYDA 3VS7A 3O23A 4XV3A 5KKRC 5ANIA 3LJ1A 4FTRA 4YLKA 4R1YA 4RQVA 4CRSA 4ARKA 5J7BA 2YM6A 2JITA 3DKGA 4HYUA 3TNHA 4PP7A 3F3VA 3O8PA 3OC1A 3PIXA 3UVQA 1W98A 3LFCA 3ZCLA 4R8QA 3VWAA 3C50A 4CCBA 4EWQA 4UMUA 5IQCA 4O0XA 4JLCA 4OT5A 1IASA 3RAKA 4UMRA 5AP7A 3D94A 5DGZA 4ZSLA 4BZNA 2ITWA 4O7NA 4FL3A 1Y6BA 3UOLA 3FE3A 2B0QA 4MVFA 2CKOA 3OT8A 2NP8A 1BI7A 2QU6A 1OL6A 2JKQA 1A06A 2I0HA 2XK8A 3CGOA 3EQRA 4JX7A 4EOMA 2IZSA 3KXMA 3NRMA 3ORKA 3P0MA 2YJRA 4G6NA 5CU6A 5DH3A 4H3BA 3GC0A 2BIYA 5I9UA 2I40A 5FXQA 4FIHA 1LEZA 4Z55A 3VC4A 3R0TA 3UYTA 3CP9A 3FI2A 3KL8A 2O65A 4S2ZA 2IWIA 3D83A 4L42A 2XF0A 3POOA 2Z02A 4E4XA 4QYYA 4YP8A 1FQ1B 2I1MA 5IF1A 4JNWA 2BKZA 2E9VA 4YC3A 1NW1A 2PVMA 2HW7A 5FM3A 4FGBA 3R9NA 4E8AA 2XRWA 1OUKA 4XEYA 5CENA 2R3GA 4W9WA 4ZP5A 1WBNA 3FPMA 4QMWA 4FT9A 1Q24A 5HE1A 4AF3A 2PUPA 3FAAA 4JBOA 4RJ7A 2BALA 3B2WA 1UNGA 3D5VA 2C0OA 4I41A 4BB4A 1PW2A 4ANOA 2JKOA 3KU2A 5TR6A 4L53A 1LUFA 2QOHA 4BDKA 4NTSA 3GOPA 4D1SA 1WBPA 2A19B 1H0VA 3FBVA 5TE0A 2VUWA 5JQ8A 3LZBA 3E64A 5AM7A 2YZLA 4EHZA 4MBJA 4U3ZA 3FWQA 4BCJA 4AGCA 4L00A 2W5BA 3VS6A 5BMSA 3W2CA 3QUDA 2BPMA 1I44A 5DI1A 3L8VA 2YABA 2B53A 2BRMA 5A54A 2C47A 4IZAA 1STCE 4ZTHA 3GXLA 5I0BA 4K77A 3TV7A 2UZWE 4C3RA 5L4QA 4ZLYA 3KVWA 1Q97A 1YXVA 3Q2MA 2ZB0A 4C4HA 1H28A 1KOBA 4AFEA 3ACJA 3ORLA 4E5WA 3EHAA 1YXUA 2BZHB 2ITUA 1XBCA 1LR4A 1QMZA 2R3MA 3ENMA 3A7HA 3F5UA 2Y4IC 3ACKA 1OGUA 3MFTA 4UXQA 5JRSA 5CEMA 1H1PA 2ZV2A 1W82A 2GHGA 5CQUA 4ZTQA 5DLSA 4JAIA 4R1VA 4F7SA 2BZIB 5HO6A 3ZUTA 4DGNA 4KBAA 2VTMA 4HVIA 4B7TA 1F0QA 5JZJA 4E73A 4H05A 4U42A 4ID7A 4F9AA 3OOMA 3NWWA 5AV1A 3CTQA 4HCUA 4MYGA 3R9DA 3WZUA 1ZYSA 4IFCA 5KCVA 1JKLA 3MY0A 3KN6A 1OIYA 3Q04A 2VWZA 3TCPA 4ACGA 2G2FA 5M09A 1PXLA 5GZ8A 3N51A 5CVGA 4CMTA 2SRCA 3G0FA 1PXIA 3WE8A 2IO6A 3HDMA 5M4IA 3DBDA 3KXHA 5TO8A 4LOOA 2WMBA 4WOVA 4BIBA 3ZS5A 3ZO2A 4J8NA 4FBXA 3PTGA 2IZRA 3AMBA 3BHVA 1UVRA 3Q3BA 5I9ZA 4AOJA 5A6OA 3R02A 1UU3A 5B0XA 3NAXA 5K9IA 3L8XA 4CYIA 1VYZA 3FSFA 1YWVA 2C0TA 3B2TA 3RINA 3QTUA 4PQNA 3GOKA 4QYFA 4A4LA 4C4JA 5A4TA 5L6WL 4QP3A 4O21A 4DH7A 3I0QA 1H27A 3TV6A 2HENA 2UVYA 4Q2AA 5AFVA 5AV2A 2QKRA 5HE0A 3WF8A 3V8TA 1UNHA 4O0SA 2BZJA 2PYWA 2WMQA 4DEEA 5E8ZA 3NVMB 3MIAA 4DFUA 4FT7A 3KK8A 1OKZA 3WIKA 4P90A 4DFLA 4JBQA 4JDIA 3O0GA 3OCSA 3JR1A 4DFZE 3ZLYA 2XK6A 1DI8A 4O82A 5EI2A 1K9AA 3H0ZA 3JPVA 3PXRA 3T8OA 5AA8A 3KRRA 4QTEA 2B1PA 4BDDA 2VX3A 2G2IA 4FUYA 4YPSA 1RQQA 3PA3A 2RSVA 4ZS4A 1SYKA 1JOWB 4PP9A 5FWKK 4DG3E 3R28A 4LUEA 3LMGA 4X3FB 4UZHA 1QL6A 3OBJA 3V5JA 5HIEA 2IPXA 5BUEA 4RGJA 4RZWA 1TKIA 2WXVA 3I4BA 3OG7A 5HD7A 3L9LA 4BDBA 4A07A 2OXDA 3SD0A 4A4XA 3ALOA 3COMA 3JY0A 3HMIA 4L01A 5ACKA 2BDJA 3ZMMA 4M0ZA 2YFXA 4I0TA 3Q9YA 4NIFB 3VAPA 3QTWA 2VTOA 4YC6A 3S2PA 4YTCA 4GG7A 5EOBA 3TTIA 4MNEA 3HLLA 3HP5A 3LFQA 4CG9A 4FV5A 4YMJA 3BYMA 1DAYA 1R1WA 4MD8E 3RPVA 3LQ3A 5FDXA 1W84A 5HEZA 5HQ0A 4EHVA 4IDTA 3NUYA 3L9NA 3VBTA 3BE2A 5HCXA 3SRVB 3HA6A 2Y6OA 4ZTMA 1K2PA 3P9JA 3SG9A 4AE9A 5LMKC 2VWWA 4ZAUA 4X3FA 2DQ7X 5KMOA 2OIDA 1WZYA 2J50A 4XG9A 5H8GA 5LMAA 4LGGA 2WEVA 4AE6A 4OUCA 2AYPA 2HOGA 1OPLA 4FKQA 3WYYA 4E93A 4GUEA 4S32A 4NIFA 5FP6A 4JOAA 5EOLA 3DT1A 4YTFA 4HYHA 2BHHA 1Q99A 3UC3A 4QMPA 5CU0A 3BGPA 2PZPA 4JI9A 4WUNA 2IVSA 3TTJA 3ZBFA 4DEGA 3PIYA 2QG5A 2CN8A 3VS4A 4G6OA 4KIOA 3R7VA 4AAAA 1KE9A 5FTOA 5HVYA 2OW3A 1B39A 3HEGA 3V5LA 3CTJA 5F1ZA 5CWZA 3KCFA 1PXJA 2Q0NA 3QLGA 2YDJA 4D4RA 2QO2A 2A2AA 3ZRMA 5EG3A 4P5ZA 4FIFA 4ZLZA 2VO7A 1WBSA 4GFMA 4P4CA 5HNGA 1YXXA 1V0BA 2ONLC 4XNEA 4IJPA 4AWIA 1VR2A 4IVCA 1MRVA 5LVPA 5C4KA 4WNMA 4EUUA 1UU8A 5DRDA 4F7LA 3BHUA 3P79A 3G9NA 3W2OA 4U8ZA 2W1GA 4EZ5A 3BGQA 4BBEA 1GIHA 5CSPA 3QQFA 4EI4A 2X0GA 3HAVA 3OFMA 3R7GA 5EI6A 3W32A 3I7CA 3SDJA 3U8WA 2OFUA 3GCVA 4O0TA 3FYKX 4O1OA 1WVWA 2W4KA 2C3LA 3DJ7A 2HW6A 4W8DA 5HVJA 1M2RA 5IQFA 3NNWA 2PVLA 4ZJIA 4NT4A 4KBKA 4CLJA 4LFIA 4CFWA 1Y8YA 1Y6AA 4OTGA 4YZMA 4AA0A 4FNYA 1VYWA 4LMNA 2VTNA 3W2SA 3ZUVA 4WO5A 1O6LA 2VX1A 3QD0A 4DH8A 4FNZA 4FOBA 1F3MC 1PKGA 2C6IA 3ZFMA 4EKLA 1QPCA 1PF8A 3W10A 2WMTA 5IEXA 3MFRA 4IADA 4LYNA 4AN2A 4F1MA 3LJ2A 4O7YA 3QX4A 1OL7A 3PRFA 2YDIA 1G8SA 3TN8A 1HCKA 2GNIA 3BYSA 3TNIA 3UP2A 4Z3VA 2IW9A 3D5UA 3HV4A 4AOIA 4QQJA 2OZOA 3F5XA 2F7XE 3R7OA 4RIXB 2GS2A 3RPRA 4E7WA 4YJQA 1ND4A 3VQHA 1J7IA 1JSVA 4UEUA 4O6LA 3UPZA 3TZ7A 2F57A 4FV6A 4U41A 2GNLA 3KXXA 2XZSA 1Q5KA 1Q41A 2P0CA 4MK0A 5JT2A 4JRNA 1Q4LA 2IVUA 2VO0A 1FBNA 4KWPA 4O1PA 3VO3A 1JSTA 3TL8A 3T3VA 3LFNA 3ZO4A 3S4QA 1XH9A 5E7RA 4E4LA 4DG2E 1J1BA 3A4OX 4AS0A 3BWFA 5CEPA 2PULA 4RIXA 3PSBA 1FVTA 2OZAB 4MBLA 4QQ5A 2GPHA 3TV4A 4ORKA 5I9VA 2QG7A 2X7OA 4NW6A 4JBPA 4QT1A 3QHRA 5JH6A 1OMWA 4CFVA 3S1HA 5DR6A 4F9BA 4L3JA 3LFAA 3Q6WA 4ENXA 3HL7A 4PX6A 3I6WA 1G5SA 2WTCA 2QOCA 1NVQA 4M0YA 4AUAA 2UZTA 4R3RA 4AZVA 2IZTA 3G33A 1M2QA 4YJSA 5I9YA 3V3VA 3CXWA 4NW5A 2P2IA 3RTPA 3QCSA 2Y7JA 4YSJA 3PA5A 4RIWB 4JL9A 3EQDA 4F7NA 3NW5A 3L1SA 4RG0A 2YIRA 4DITA 3W55A 3SVVA 4X21A 5CSHA 2PWLA 2OU7A 2ZM3A 3G2FA 3UP7A 2W99B 3LXLA 4QPMA 3ORPA 4IC7A 2QNJA 5F94A 4R77A 1E1XA 2W9ZB 4HGTA 3RWPA 3OT3A 4OTDA 5DN3A 2WTKB 1KOAA 2C6OA 3HMPA 2X8DA 3EYHA 5EYKA 2CNUA 2QR8A 5EM8A 4ZMEA 2C3KA 5AR2A 3FMNA 4RWJA 5M4UA 1AD5A 3DJ6A 3QC4A 3C13A 4IIRA 5HCYA 1O9UA 5CS6A 5HE3A 4IAZA 4DLIA 4F09A 2QURA 1R78A 2LGCA 4UWBA 4IH8A 3MPMA 2OO8X 4RIWA 1REKA 3QX2A 4BBFA 2XNBA 4C3PA 4PNIA 3VIDA 1KE5A 3QZHA 5CT7A 4AZEA 4TYGA 2OFVA 3LQ5A 3QTZA 4XG8A 3FLQA 2B4SB 5CI7A 4YHTA 3HV3A 5GZ9A 3AC4A 5BQ0A 4C2VA 2IZUA 2W1EA 3S00A 1IA9A 3QQHA 1KE6A 4ERWA 4JJRA 2QD9A 2WAJA 3POZA 3BWJA 2X9FA 4XS2A 3W33A 5ETIA 5IEVA 5D9HA 4XRJA 2XNPA 3FHRA 4IHPA 4U44A 4UY9A 3L8SA 3DKOA 3K2LA 3KXZA 3R21A 4QTAA 3AT2A 1FGKA 1OZ1A 1LPUA 4GVAA 4N6YA 2JIVA 2R9SA 5AUUA 4ZJJA 4L9IA 4ASXA 1FGIA 2PVYA 5AP0A 3CY3A 5LVOA 4OBOA 3RCDA 4GJ3A 4K8AA 2B55A 3FLWA 1H08A 4D4SA 4PTCA 2X6DA 4JR7A 4RIYB 4CZUA 4HZRA 3SXSA 3DK7A 5CAPA 4XV9A 3R7EA 4IX6A 3VQUA 2ITPA 3GCPA 2EUFB 4YC8A 3E8DA 3NGAA 4FODA 4QQTA 2Z60A 2VTJA 3E7VA 5DPVA 4HCVA 4A9UA 1SVGA 4YJOA 3EFWA 5IA2A 1H1QA 4ZMFA 3FZTA 5ANKA 3MFSA 2Z7LA 5FDPA 2FH9A 4K9YA 2W5HA 4BCKA 2YZAA 4L43A 3ZXTA 4DINA 4CVAA 4GKHA 4APPA 3GUBA 3FL5A 4FSQA 3UYSA 3NCGA 4L68A 4TWNA 2RFDA 1BMKA 3FMEA 4G5JA 3E88A 1H4LA 2WIHA 4RA4A 2P4IA 2OJIA 2ITYA 4FSMA 3CIKA 1BI8A 4D2VA 3NS9A 4L3LA 2PMOX 3DXNA 4LRMA 4YBJA 3LCTA 3PVBA 3UZRA 2VTHA 4AZWA 4EOKA 5HIDA 5AV3A 4RQKA 5M44A 4XV2A 5CEQA 4AQCA 2C30A 3FYJX 3I5ZA 1KE8A 4FF8A 3VS2A 4AW0A 5AAFA 2ETKA 3LLTA 4BDCA 4DBNA 3U9CA 3VBYA 3LM5A 4HCTA 3W2QA 4R78A 5C27A 4USEA 2JBOA 3KREA 3PA4A 4FKUA 3BHYA 3LCDA 4MXOA 5CAVA 3RI1A 1PXKA 2W5AA 4FL1A 3S95A 3WZEA 1OKYA 2J6MA 3GI3A 2ESMA 2XIRA 3ANQA 3R71A 4GFGA 4YGAA 4AN3A 3V01A 3U54A 2W1IA 4BBMA 4NH1A 4ZSJA 3D5XA 3FKNA 3FZSA 3QRKA 4PL4A 4S33A 5CU3A 4EEVA 3EKKA 5FUTA 5IQIA 4EHEA 4O86A 3SGCA 5CF6A 2W4JA 3O2MA 4RA5A 3R6XA 2VN9A 4H3QA 3O8UA 1R0PA 2X81A 2CMWA 3PJ1A 3NZ0A 4V0GB 1H1SA 1PKDA 1T46A 3H0YA 4FIJA 3F69A 3EH9A 4ZSGA 3DY7A 3I6UA 2J2IB 2FSTX 2V7AA 3WILA 2EB2A 2OSCA 5LVNA 2PZIA 1Q62A 1H24A 2X2KA 2BDWA 4NCTA 5JMSA 4XYFA 3EYGA 1GIIA 3QFVA 5EKNA 2GTNA 4O96A 3QQGA 5CASA 3CBLA 2UZUE 4RMZA 5ANGA 3ZLWA 3TM0A 3DXPA 3TNQB 3CQEA 4G3GA 3RAIA 5J5TA 4EK3A 2R3QA 4HYIA 4II5A 2UW5A 2WO6A 5AUXA 3LFEA 2XBAA 2HCKA 4DFYA 4HPUE 4G3CA 3WF7A 4F9CA 3FI8A 2C6EA 3WE4A 4PPAA 2A4LA 4G3FA 4JXFA 4WNKA 2X4FA 4F65A 5HU9A 3LJ0A 5FTGA 5FTQA 5A4CA 3OD6X 4UXLA 2UW3A 5CX9A 4Q5HA 3QKMA 3V6RA 1YHVA 3NUPA 1OL2A 4RPVA 5HG9A 2BILB 1GZOA 2OH0E 3EOCA 5LVMA 2Z7QA 2JKKA 2Y0AA 3A4PA 3KXNA 4HYSA 1CKJA 1SVEA 3H4JA 4S30A 3TNWA 4F1TA 5IUIA 1Z5MA 3R83A 1J3HA 3SKCA 3PYYA 3ZHPC 5AX3A 4GIHA 3AG9A 4YZNA 2UVZA 3QRTA 3LVPA 3Q9WA 4O2PA 4NFNA 4CRLA 4F0GA 2ITOA 2W7XA 3CPBA 2V22A 4AACA 2JEDA 3W2RA 4D9TA 3VW6A 3D7TB 4XLIA 5FEEA 4C38A 5HLWA 1W7HA 5DT0A 4GT3A 4BI1A 4O7ZA 4FKIA 3OP5A 4I0SA 3FZ1A 4IB1A 4WIHA 4C37A 5CF5A 5JN2A 5KKRB 3RM7A 3OXTA 2ACXA 3TKUA 4DTAA 1QCFA 2C5VA 3IONA 3OWKA 4G3EA 4R7HA 3RK7A 4PMPA 3R63A 3GC8A 2I0EA 4Y73A 4AZTA 3QAME 5DA3A 4E26A 3ZC5A 3QQLA 2GQSA 2QLUA 3Q4CA 5E8SA 3AC5A 2UW8A 3VW8A 4BC6A 2OBJA 3PP1A 4CNHA 4RC4A 4M67A 3MA6A 1ZOEA 4C7TA 4NKSA 4WD5A 4FT0A 1W8CA 4X2JA 4PL5A 1PXMA 1BL7A 3I5NA 2C5XA 4W4VA 5K0KA 4XLVA 4A9TA 4ZY6A 5B7VA 3VBXA 4N4SA 2X7FA 3NW6A 2QHNA 3PVUA 5H8BA 3MS9A 4ANNA 2XEYA 2JGZA 2ZV8A 3A2CA 3VULA 4FSTA 5AEPA 1PRYA 3I60A 4DF3A 4D2TA 2O3PA 2XA4A 3QD4A 3OEZA 2HELA 4KUJA 3ETAA 4KB8A 5M57A 1JVPP 2FSLX 3A8XA 4TW9A 4I5MA 1YOMA 2W1DA 4IMYA 4MF0A 4YLJA 5JRQA 4ZZOA 4RLKA 3MVHA 3CC6A 3OTUA 2OIBA 3PE2A 2ZV9A 4U45A 3PIZA 5EDPA 1PXNA 3PWDA 3IW7A 5BVDA 4LV5A 3MW1A 5EHOA 3FC2A 2JKMA 5T3QA 4N57A 2XRUA 3F66A 3DGKA 3QTQA 5J95A 2ITTA 1GIJA 4MD7E 2E2BA 4FEVA 4LM5A 4LQMA 3E93A 4JBVA 2R2PA 2QOQA 5D11A 1IAJA 2C69A 5TKDA 4V01A 2O64A 3F3WA 4U80A 3OXZA 4ANBA 3A8WA 4I23A 4X2FA 4DEIA 4I5PA 3UVPA 3DTCA 1H1RA 2F2CB 2O5KA 4IJ9A 4YR8A 4O6EA 3R00A 4CTBA 3R01A 3EN9A 4DFBA 4IWPA 3TZ9A 3SA0A 4GG5A 1ZLTA 3UIMA 5H3QA 5LQFA 4YJTA 5D7AA 5ETAA 2JLDA 4EJNA 3Q60A 3QRUA 4IDVA 4ZTSA 4AT4A 4L7FA 4QNAA 4QP1A 3ELJA 3RVGA 3OMVA 4MKCA 4GW8A 3R1QA 5HNIX 4O7SA 2Y4IB 5DR9A 3MVLA 3ZOSA 2XM8A 2YCFA 3G6GA 4OTQA 4U7ZA 4WG4A 2VU3A 3UG2A 4AX8A 1Y91A 5AIKA 4IWQA 2WELA 4J99A 5J8IA 5HBJA 3R1NA 1J1CA 2PVNA 3I81A 1JNKA 4ZSAA 4QOXA 5AX9A 4EK6A 4Z16A 3UBDA 4Y8DA 2CLXA 3SHEA 2O63A 2H8HA 4DT9A 3R73A 2A0CX 4KABA 1XO2B 3QZFA 4M68A 4KIQA 5HLPA 3VUHA 1KSWA 2QODA 2VTTA 2WGJA 4MAOA 1O6YA 5AP5A 5GZAA 4DGGA 5CVFA 2OJJA 1QPEA 5I4NA 2V62A 5CEOA 5HGIA 3CD8A 3EN6A 4D5KA 4NK9A 5C03A 2QR7A 4NJ3A 1P4FA 4I94A 2PU8A 1ZYJA 5HD4A 3CPCA 4DFNA 4IANA 3B8RA 3OY1A 4LMUA 1H01A 3FQHA 4FKVA 4AZFA 3AGMA 2ZDTA 4FV9A 5F4NA 4GU9A 3ODZX 3C4XA 4XG2A 1KUTA 5HTIA 4RLLA 5BVWA 1MRUA 3PP0A 3VUKA 4I4FA 3TACA 2GFCA 4CT2A 4HVSA 4D2WA 4I5HA 4TYIA 5CQWA 3I0OA 3O17A 4FVPA 3A7IA 4DGMA 4FKPA 1GNGA 1L8TA
chains in the Genus database with same CATH superfamily
3Q9ZA 4DCAA 4DEHA 2Z7SA 3IOKA 1QPJA 5EM5A 3NYNA 3VHEA 5M4CA 3JUHA 2C1AA 5KHXA 3V5TA 3CQWA 4O7LA 3PUPA 4G2FA 4YJPA 1XBBA 4XP2A 3AKJA 3NLBA 4FI1A 2DUVA 5ETFA 4ZS0A 4X2GA 3RPSA 3S3IA 1H25A 3UDZA 4I6QA 2DWBA 2OH4A 4KA3A 3OW4A 3ORIA 4B8MA 3OXIA 4IAFA 4IWDA 4E4NA 3EL8A 4YHFA 3NDMA 4OBQA 4AP7A 4OTIA 4DEDA 5A6NA 4QYGA 3NUUA 2WOUA 3BV2A 2OWBA 4O4DA 4BCMA 3KQ7A 4L44A 3JS2A 4D2RA 5C26A 3GC7A 2J4ZA 5CF8A 3BE9A 4E6AA 4RSSA 2BTRA 4O81A 3VF8A 3QLFA 4GT4A 4MX9A 4PWNA 2VV9A 4E4MA 3V5PA 4RC2A 2DYLA 3BIZA 2P55A 3MSSA 5GJGA 5AA9A 4NM0A 5IA0A 3U6JA 1GY3A 5J9ZA 4QQCA 4NWMA 4WRSA 4CFFA 3ATSA 3LMHA 1ZZLA 3IW4A 4EOIA 4IXPA 2GS7A 3AD6A 4GKIA 2PMLX 5FLFA 4QMVA 3VBVA 4QTCA 4BKYA 3QKKA 3GU4A 4OAUC 2C1BA 1CTPE 2YCRA 4LL0A 4MXXA 4DHFA 1YXSA 4FTLA 5BVNA 5IG1A 4AXEA 2VWIA 3HUCA 3KFAA 3NX8A 3W2PA 4BDJA 2V7OA 4FGRA 5DNRA 4I93A 4JAJA 4APCA 2PVKA 4IAKA 4R5SA 5JK3A 3HMOA 4I4EA 1MQBA 1XQZA 4V05A 2JBPA 3QU0A 5CU4A 2B9HA 2WEIA 2WQNA 1JSUA 1PJKA 2HYYA 3UQFA 1GZ8A 2PVHA 1OI9A 1P2AA 3EQPA 3LCOA 4RFMA 3MWUA 2WMAA 4NFMA 3BBWA 3P08A 4WG5A 4M66A 2HIWA 3HYHA 3EB0A 4JQ7A 2C3IB 4TT7A 5L2SA 1RE8A 4MBIA 4UN0C 3LKMA 5DEWA 4FNXA 4CKJA 3RZBA 5AP1A 3SOAA 3LCKA 3BBTB 3W0NA 3H30A 2OJFE 1DS5A 2VRXA 2RIOA 4L6QA 4IZ5A 4O0UA 5JZNA 3VJNA 3P7AA 4R5YA 4FC0A 2X9EA 2YITA 2Z8CA 3D2IA 4IX3A 3WYXA 4CT1A 5ETCA 5ACBC 2XK7A 1OL5A 4FV0A 2GDOA 3GEQA 3NYOA 4AA4A 4QYEA 5JFXA 4B6LA 5CXZA 2A27A 4AW5A 1I09A 2R5TA 5HNBA 1YW2A 4I20A 4DN5A 3QALE 4LUDA 1YI4A 3E8NA 3ODYX 2YAAA 3NMUF 4IB5A 4FTNA 3RKBA 4IM0A 2YCSA 3N9XA 2AC5A 1KWPA 3LFDA 2BIKB 4QMNA 4OLIA 5E8YA 3NNXA 2J9MA 4UYAA 3R9HA 2QOKA 2R3PA 4CD0A 3UOJA 3RHXA 2VTLA 4MWHA 2NRYA 1OUYA 2QOBA 4FIGA 4J7BA 1UU7A 3KRJA 3M42A 3RAWA 3QA8A 4ERKA 2CSNA 4DTBA 1OPKA 3OS3A 4M69B 5BPYA 3BRBA 4WT6A 1W0XC 3AT4A 3FKOA 4U0IA 1PMNA 3DFAA 4G16A 3LMIA 4FKSA 4EC8A 2R64A 3P5JC 4E3CA 3M11A 1GZKA 5F9EA 5KMMA 3TUCA 4CEGA 2B54A 2F4JA 3NFGB 4CTCA 3M1SA 5G1XA 3MPAA 3WF9A 3PPJA 4QNYA 5A9UA 3HV5A 3HVCA 3IGOA 2QC6A 4ZIMA 1Z57A 4YURA 2BAQA 5DOSA 3TG1A 4EYJA 2BZKB 1PMVA 5FM2A 4PDYA 4GEOA 4TN6A 3SRVA 4BN1A 2JDSA 2NPQA 3DA6A 4HGLA 3GCQA 4I6FA 3QA0A 2XBJA 3COIA 4BCIA 1XR1A 2F49A 1BX6A 4BHZA 2XK4A 3BYUA 2J7TA 3FZRA 3FMJA 4KRCA 4XRLA 5HICA 2IJMA 4K2RA 5FP5A 1UV5A 4OTWA 3WI6A 4ALWA 1XH5A 1Y57A 2VWBA 1PMEA 4O91A 4BFMA 3TZMA 5E8UA 5D41A 5KZIA 4EONA 5HX8A 3P86A 2B7AA 2J90A 3SXFA 4CG8A 4ZZMA 4A7CA 2QHMA 3AC8A 2RKUA 3AMYA 4J8MA 4M7IA 5EK7A 3MGYA 1NVRA 3CY2A 3OCTA 5IA4A 3NEWA 2BUJA 4E6DA 3PPKA 1M52A 4QP2A 5CTPA 3MJ1A 4EQUA 4R7IA 3KN5A 5CZIA 4BDGA 3EQFA 3QGYA 4FTAA 4FZ6A 4CFXA 5JGAA 5B2KA 2VNWA 1XH7A 3V8WA 4WSYA 3UNJA 4OT6A 3EKNA 1XH4A 3C4FA 4WA9A 3C9WA 4BWXA 1ZYLA 2Y4PA 2PE0A 3OF0A 3UNKA 4IAAA 5J9YA 3CQUA 2RFEA 2ZMCA 5FXSA 2R7IA 4RX8A 2VO6A 4XV1A 2NRUA 4NM3A 2WTIA 3BU3A 4Y5HA 4X3FC 5IA3A 5JFVA 4A9RA 3C7QA 4LG4A 4PRJA 2CGXA 2GQGA 4YZCA 3UJGA 4DCEA 3D5WA 1YOJA 2ETRA 5HU3A 3Q5ZA 4X0MA 4GJ2A 2HY0A 3P23A 4QD6A 3DPKA 2XANA 3F88A 3MB7A 4YNOA 4FV1A 5CT0A 5KZ0A 3VUIA 4KS7A 4F9YA 4N70A 2YM8A 3BGZA 1A9UA 5LVLA 3CGFA 1VEBA 5L2IA 3EMGA 4D1XA 3R22A 2YM4A 2PY3A 4LOPA 1NT2A 4ZZNA 4GUBA 3WF6A 4D0WA 3KMUA 5CANA 4DFXE 5FEQA 3AC1A 5T68A 5TT7A 3DAJA 4U5JA 4IWOA 4FA2A 2BMCA 2W1ZA 4OTRA 5DVRA 3GFWA 4BTFA 1IG1A 4YPDA 1VLRA 4EH4A 4FKGA 4DH3A 3U51A 3P5KA 4G1WA 3DNDA 4TPTA 2HZ0A 3R8MA 4D0XA 3SLSA 3C1XA 3H9OA 5HZNA 3FMKA 4IQ6A 2R3RA 4FK6A 5CAQA 4XX9A 4NUSA 3FEGA 1AGWA 4Q9ZA 2VWXA 3MDYA 3IW5A 4RJ6A 3VUGA 4CLIA 1WMKA 4K18A 2F7ZE 5CNNA 3KRXA 3PJ2A 2YIXA 3LE6A 4BDAA 2CDZA 4UWYA 1XJDA 3UZTA 4WRGA 4JS8A 5EM6A 2WZJA 5HHWA 3ZZEA 3R7UA 4XOZA 2XCKA 3HV6A 4DA5A 3K5VA 1CMKE 2BR1A 5LARA 2GS6A 3E8CA 5ANJA 4ASZA 5BVFA 2QONA 3D7ZA 2G9XA 4JDHA 5KMKA 3DS6A 5JFWA 1YWRA 4NM5A 1OIRA 4D58A 4XG3A 1P14A 4K1BA 3Q53A 4UMQA 3QCYA 1DI9A 4MQ2A 4AT5A 2YAKA 3ORXA 2GHMA 4BIDA 3E7OA 3C4WA 2ZM1A 2OZAA 4DAWA 4I92A 5GHVA 2YLEA 3PE1A 5AR8A 2OXYA 4IAYA 4JQ8A 4XG6A 3LIJA 1G8AA 2H9VA 5IU2A 3DTWA 1Q8UA 4FV3A 2UZLA 3MIYA 3NNVA 4BI2A 3WIGA 5CLPA 4ANMA 5KNJA 5DHJA 3DV3A 3PJCA 3LFSA 2JDTA 5CEIA 2RG5A 3BX5A 3EZRA 3PZHA 4Y46A 3FMLA 4J71A 4KINA 4Q5EA 1MUOA 4XMOA 5CI6A 4BDIA 4F08A 2XARA 4H1MA 3PLSA 5AAEA 4EOJA 5EW3A 1SVHA 5AP6A 5M56A 2XNEA 1ZMWA 5FGKA 1U4DA 4LL5A 4FV7A 3UE4A 3CKWA 4I21A 3UG1A 4D4VA 3OW3A 2Q0BA 2HZ4A 2PHKA 4DE4A 3MY5A 4FG8A 4EWHA 4DGOA 2IG7A 3IQ7A 4Z9LA 4Y85A 3EFKA 1ZAOA 2X8EA 3KGAA 1NXKA 2PUUA 3A61A 3QXOA 4N6ZA 4GU6A 2ITXA 4RIOA 1YHSA 1SNXA 3VRZA 3UO5A 3MI9A 4YUQA 2I0VA 5ANEA 3DFCB 3ZEPA 1XMMA 4G3DA 4Y95A 3IDPA 2VWUA 3GB2A 4OGRA 4PF4A 5EH0A 3IECA 4MXAA 5BYZA 3ZC6A 3UZPA 4F6SA 1SM2A 3AMAA 2I6LA 3FLSA 5AR5A 5I3RA 5BUIA 3QTXA 4AXDA 2CPKE 2X8IA 5IA1A 3ITZA 4L46A 3BELA 1IEPA 3NYXA 3OWPA 4J1RA 4GRBA 2C3JA 3RCJA 5J5SA 5L6OA 1RDQE 5HG8A 5FXRA 3LOKA 4IM2A 2GMXA 3PG1A 4RBLA 5IISA 2X4ZA 3IGGA 3BU6A 3NPCA 3SAYA 4C0TA 4TY1A 4Z7HA 3DKFA 4FKLA 4RJ5A 3KXGA 4LRJA 4MNFA 3ZDUA 2WNTA 3PXKA 4MXYA 4EBWA 2W06A 4FZAB 1PYEA 3D4QA 4A9YA 1UNLA 4RX7A 3D0EA 1WFCA 1B38A 2REIA 3TWJA 3HRBA 3JY9A 3LW0A 4FTCA 2C6TA 4GK2A 4XG7A 5D7VA 5I3OA 3NUNA 4AG8A 5L6PA 3DLZA 4JIKA 5L8JA 3TT0A 5IH5A 2GNFA 2BRHA 4BDEA 3GU6A 3VF9A 2BRGA 2X2LA 3DB6A 4BCHA 5CSXA 1KV1A 5K5NA 3QUEA 3PPZA 1FVRA 4AQKA 1WVXA 3TUDA 3GP0A 4QMTA 4FL2A 4RIYA 5AP4A 2JAVA 3EZVA 3ZZWA 5LJJA 3IO7A 1YI6A 4FV2A 4FSNA 4O0YA 1R0EA 5IDPA 3LHJA 3DQWA 1FVVA 2YLFA 3U4WA 3MH2A 2XB7A 4TZRA 2JDVA 4FX3A 1J91A 3E3PA 4YJNA 3PLAE 3E8EA 3QRJA 4FEWA 5LCKA 4BJJA 4CKIA 2V0DA 4RT7A 4MQ1A 4QRCA 3R2YA 2C5NA 3GC9A 4ITHA 4IVDA 4O0WA 5HESA 3AD5A 4FT3A 2QKWB 2WTKC 3ZXZA 4FTUA 4CQGA 2GCDA 1S9IA 3CE3A 3ORNA 3MJ2A 2XK9A 3UMXA 4DC2A 4FYNA 1XMLA 5K0XA 4ANSA 4QO9A 2Y6MA 3KIOC 3LLAA 2GNHA 4O83A 1UWHA 5AWMA 4XH6A 4AOTA 2R3FA 5AUYA 2CJMA 4N0SA 3U9NA 1RJBA 4FUXA 4CQEA 3T9TA 5E9EA 3VUTA 3VS3A 2UZVA 3N4UA 2OG8A 5KBQA 2JD5A 4M84A 5BMMA 1E1VA 5BYYA 2W05A 3PVWA 3QL8A 4NEUA 2WMVA 2VZ6A 5D1JA 3F2RA 3V6SA 1PHKA 2BCJA 2CLQA 2PZRA 3EL7A 4JQEA 3PJ8A 3R8VA 4PPBA 5JGBA 3FKLA 4EH6A 3DXQA 2UZBA 2GHLA 4ZY5A 4WBBB 2FVDA 4C33A 2W4OA 4MHAA 4TYHB 4EOPA 4FEUA 4TXCA 4MWIA 2VTSA 3D2KA 5IH4A 4FSWA 5J9LA 1CKPA 4UALA 3EJ1A 4EH5A 2QO7A 3FMDA 3FLZA 2C4GA 4EC9A 4J95A 4EYMA 3ZFYA 4FTKA 4HGSA 2F7EE 3GQLA 2XK3A 2XNOA 5D10A 3MN3A 3DLSA 2IW8A 3FC1X 4PPCA 5E1SA 5J79A 2XKDA 4O7RA 3EN5A 4FSUA 4F1OA 5J87A 5KE0A 4RJ8A 4IB3A 4NM7A 2C6MA 4FV8A 4V0GA 5AV4A 3FUPA 4RWLA 1Q3WA 2ITZA 3NUXA 4NTTA 5EM7A 4EOLA 3NW7A 4GK4A 4TYHA 4ITIA 4W4YA 4C62A 5AIRA 4F78A 3GT8A 4J52A 1PYXA 2Z2WA 4JG8A 1ST0A 3DKCA 1K3AA 2JC6A 5DE2A 5EW9A 2YEXA 3T3UA 3WBLA 3R30A 4TTHB 3C4CA 1Q8ZA 3HA8A 5CF4A 4AU8A 1Q8TA 2BKKA 2F9GA 2OF2A 2GU8A 4EL9A 4FR4A 4BDFA 3OCBA 4C58A 3KULB 3ZLSA 5DRBA 2X6EA 2VTAA 5ITAA 1XHAA 4GCJA 2XCHA 3CJGA 4PNKA 3QWJA 3PG3A 2VTIA 2UZEA 4TRLA 1TQPA 1R39A 4PTGA 2X7GA 3DQXA 5BVOA 2IVTA 3C0HA 5I9XA 5GJDA 1ZZ2A 3MYGA 4NKAA 4C2WA 4P7EA 2PVJA 3TKIA 4BKJA 3UC4A 2XIKA 4D2SA 2JAMA 1WBTA 5HORA 3RPYA 4F9WA 1QPDA 3AC3A 4R3CA 1OBDA 2QOIA 1H8FA 3QF9A 4RFZA 4MUQA 1OL1A 4G9CA 3OUNB 3COKA 4ANQA 3CSVA 3D7TA 3A7GA 4C4GA 1HOWA 3F9NA 4KSPA 3V8SA 3H10A 4NCTC 3QTIA 4G31A 2PVRA 1UA2A 3TEIA 4CZYB 2XIXA 3ZSGA 3MPTA 4HOKA 4ALUA 4IB0A 3KY2A 4OTFA 3F5GA 3L9PA 5KMNA 2VGPA 2R3LA 3G0EA 3AD4A 5ANDA 3W18A 3ID6C 3DK3A 4KIPA 4QMUA 3ZRLA 5C4LA 4AW1A 4QP8A 4TYEA 1ZWSA 4AA5A 1OPJA 5HI2A 1ZOHA 3V51A 2P33A 2V55A 3TUBA 3IG7A 2HK5A 1SNUA 2XEZA 2NO3A 3NCZA 5E8VA 3BPRA 2PMNX 4IFGA 3EFJA 4GYIA 3MTLA 4KAOA 4DT8A 2JDRA 4JR3A 1X8BA 4ENYA 4JDKA 1H00A 4CCUA 3HNGA 4FG9A 5M07A 1J7LA 2VWYA 4E5BA 4HGEA 4EH8A 4EOQA 3OWJA 1APME 3H9RA 4ZTNA 3OROA 5AJQA 4HZSA 2YCQA 3CEKA 4YLLA 3UOKA 4GFOA 3RNIA 5M06A 4QMZA 3MY1A 3K3IA 4XJ0A 1PY5A 2G2HA 3WARA 2WMWA 5EI8A 1REJA 3EQHA 4XBUA 1ZARA 4E1ZA 2GNJA 2C6LA 2XAMA 2UUEA 5CXHA 1H0WA 4QMOA 3R1SA 5F20A 3ZUUA 4A9SA 3GU7A 3U55A 2C68A 5AAGA 4AT3A 4RC3A 2PE1A 2VX0A 5AMNA 4K6ZA 5AUWA 2GNGA 3ET7A 2C6DA 4G5PA 1IA8A 3A62A 3GENA 4EH9A 2QO9A 4S31A 1P5EA 3RPOA 4LI5A 4PMSA 4PDSA 5M51A 2J51A 4FIEA 4HVDA 3DCVA 3MBLA 3F5PA 2R4BA 3PJ3A 5HIBA 2VWVA 1ERKA 4FZ7A 4GVJA 3P78A 3QGWA 4MH7A 4I1ZA 4PTEA 3FY2A 4Y72A 3WZDA 3ZDIA 3QC9A 4RRVA 5EW8A 1A48A 2FB8A 2YACA 5CU2A 4RVTA 4YJRA 4MCVA 2EXEA 2RGPA 1UU9A 2FSMX 3KCKA 3QUPA 1Q8YA 2E9UA 1KV2A 2WMUA 1WBVA 2OF4A 4CFNA 1YDRE 3QCXA 2XVDA 4X2KA 5J1WA 2GTMA 3DBCA 4HNIA 1PXPA 5CEKA 4FKRA 3UDBA 4F63A 4DG0E 2XNMA 4FEQA 4WNOA 2XP2A 5HG7A 5HTCA 1BYGA 5DIAA 2RFNA 4CKRA 2F2UA 5C8NA 4QP9A 5LXMA 3OHTA 4IACA 3OEFX 3SV0A 1M7NA 2IN6A 4RWKA 4H1JA 3F3ZA 4PUZA 4EZ7A 4K0YA 2R7BA 2WQEA 3NAYA 5JSMA 1M7QA 5EKOA 4KKEA 1OVEA 3PXYA 4BYIA 5IQBA 1CSNA 3FJQE 4ZTRA 5IDNA 3DJ5A 1KE7A 2G01A 4FTQA 2W1HA 4KSQA 4EOSA 5HX6A 4YO6A 3WZJA 1DM2A 3DBEA 4WUAA 2R3NA 3HX4A 4BWKA 3FSKA 3KMWA 3O7LD 5AUZA 5CSWA 3FZPA 4JT3A 3H9FA 2QI8A 3GBZA 4JVGA 3PSCA 4UMPA 2XMYA 3E92A 1E9HA 3Q52A 4RVMA 4GMYA 2UW7A 3TYKA 2CNVA 3TNPC 3DU8A 3EQCA 3U87A 5AP2A 3JYAA 4FSZA 1JKSA 4H58A 3GVUA 2H96A 5AR4A 2ITVA 1H1WA 4MF1A 2OICA 5FEDA 4QMXA 5KMIA 3BHTA 3JVRA 2UW9A 2B9FA 3HRFA 3G9LX 3C0GA 5T6KA 2CCHA 3P7BA 3PFQA 4KNBA 5E90A 2B9IA 3KB7A 4FSRA 4NYEA 3RM6A 4NZWB 4IC8A 1JBPE 2YA9A 3UO6A 4BYJA 3R8UA 4CGAA 3BLQA 1U5QA 3QYZA 5CNOA 3ZRKA 5M4FA 3AKKA 4E6CA 1JKKA 1JQHA 4TWPA 3W8LA 2XJ0A 5HG5A 3SC1A 3A7JA 2PMIA 3ZM4A 1TVOA 4AGDA 3JXWA 3MA3A 4R3PA 2KTYA 2AUHA 3S0OA 5IQEA 4NJDA 2VTRA 5A4EA 1G3NA 2CCIA 2Y9QA 4FZDB 5BVEA 5EDQA 4HVHA 4FEXA 4EUTA 2OK1A 2X0PA 2C5YA 2VTQA 2YIWA 3NIZA 4IZ7A 2YJSA 5ICPA 3TXOA 4O84A 3HMMA 5E91A 3I1AA 4YHJA 2X2MA 1ZXEA 2W1CA 4NSTA 3MTFA 4QPAA 2G1TA 2HY81 1WBOA 3Q32A 3ZO1A 2ZB1A 2OGVA 3F2AA 1TQMA 2HWPA 2AC3A 3G5DA 2VD5A 3UNZA 4ASEA 4XG4A 1J7UA 1PXOA 3QBNA 3FXXA 4M3QA 5K4IA 2J0IA 2V5QA 4C3FA 3K3JA 1ZMVA 4USFA 3UVRA 1M14A 4USDA 1YKRA 4ZXTA 3BQCA 1FOTA 2Q83A 3ROYA 4C57A 4I6LA 2J0MB 4O0VA 2P2HA 3AXWA 5KBRA 1UKHA 4E6QA 5C9CA 5AM6A 3K54A 3V04A 1NVSA 4D2PA 4EBVA 3HP2A 4IX5A 4U79A 2CNQA 5DWRA 2J0KA 4FYOA 4XP0A 3DZOA 5EYCA 4AFJA 4EH7A 3MB6A 4V04A 5LMKA 4BICA 3R9RA 2HZNA 4BZDA 4CFMA 2GFSA 2YISA 1CM8A 4M14A 4OAVB 4X3JA 1P4OA 4I6BA 3PZEA 3L8PA 4YO4A 1M2PA 4QP6A 2UW0A 4WNPA 4HJOA 3E63A 3FMHA 3PY1A 4L8MA 4FKWA 4P2KA 4W8EA 4D5HA 4U9AA 1U54B 3UIBA 3L9MA 4B9DA 3FLNC 3Q9XA 3FHIA 3RP9A 3KEXA 3DNEA 2BDFA 3UOHA 2RG6A 3GQIA 2WU6A 3BI6A 2IVVA 1URCA 4W4WA 4MNEB 5HO7A 3IK3A 4FE2A 1EH4A 3B8QA 2WTWA 3RMFA 2XM9A 2ONLA 3EIDA 4F0FA 2E9PA 1YDSE 1YDTE 3BZ3A 4KBCA 2VGOA 2FYSA 3ZTXA 5H9BA 1XWSA 3UIUA 5CAUA 3BLAA 5E92A 3KKVA 2X39A 4M15A 1OKWA 5CSVA 3RK9A 3HMNA 5FD2A 4FTMA 2YIQA 2ITNA 3FQSA 2PVFA 1U54A 4I6HA 1Z9XA 4FNWA 3HDNA 4UBAA 5IH6A 3TDWA 2JIIA 3IKAA 4UZDA 3F7WA 3LFFA 2IEWA 4BZOA 4K11A 4ACCA 4FVRA 4AGWA 2OXXA 5CAOA 5H2UA 1L3RE 2QOOA 3AQVA 1ZRZA 4FZFB 4X6QC 4AGUA 4EOOA 3R8PA 4U6RA 3W16A 2EWAA 5K4JA 3FV8A 4KKHA 3CCNA 3TIYA 4BTMA 1XH8A 3AOXA 4C36A 1U5RA 3NR9A 4X7QA 2O8YA 4AXFA 4QMLA 2WOTA 5EDRA 3C51A 5JKGA 3R7YA 4QMSA 5G6VA 3F3UA 3UMWA 3I7BA 3KF7A 1YRPA 3KRLA 3TI1A 3R04A 4F6UA 4EJ7A 2WTVA 3G51A 4M69A 4FKTA 4K33A 4QPSA 4O7TA 3ZM9A 1DAWA 3D14A 3KC3A 1OITA 1F5QA 2JDOA 4FSYA 4J98A 2ERZE 5GNKA 1YXTA 3K5UA 2PZ5A 1ZY5A 1YWNA 3R2BA 2R0IA 2XJ1A 3RHKA 3DAKA 4RX5A 5IMEA 3F61A 3AC2A 4ACHA 3SW7A 4I24A 4RVKA 5TOZA 5EQPA 2X0OA 3BLHA 4HW7A 2YWVA 4XBRA 4EK8A 5LWMA 3U6IA 3BEAA 4O7VA 3MH1A 4OBPA 5J1VA 3QZIA 4O38A 4OTHA 4RZVA 4HNFA 3TZ8A 4KD1A 1XBAA 1Q61A 2WHBA 4FV4A 4BDHA 3NVKI 4ZY4A 3O5AA 3TIZA 3EQIA 1WVYA 4ASDA 2W17A 3R8ZA 3ULZA 5TF9A 3NNUA 4BI0A 2PUIA 4C4FA 4P5QA 3F2NA 4QMYA 3M2WA 4MXCA 4FIIA 5AP3A 5EHYA 3UIXA 5IUHA 2ZMDA 5C8KA 4ZJVA 4QDEA 5IQHA 5IKWA 2ZAZA 3FZOA 1W2DA 3OTVA 4KRDA 4G34A 1YVJA 2WKMA 1CKIA 2UZOA 3KMMA 2YWPA 2VTPA 2WFYA 5HLNA 4DEBA 4TYJA 4NU1A 1H07A 2R3HA 3PY3A 5FRIA 3O51A 3VRYA 2BFXA 4BGQA 4D1ZA 3TKHA 5B2LA 2WMSA 3A60A 3Q5IA 3LXKA 3HZTA 5IMXA 1FINA 3BQRA 1PMUA 4LOQA 1ZOGA 2QU5A 4L52A 4ONAA 4AN9A 2FSOX 3ATTA 2CKPA 4EHGA 4GK3A 1IAHA 2HXQA 3PWYA 4M12A 2WIPA 1O6KA 2DS1A 1RW8A 3ERKA 4JG6A 3FPQA 5LWNA 4JMQA 4RWIA 5FG8A 2VNYA 5DT4A 4EK4A 3ZSIA 5ANOA 1OB3A 5L2TA 3KRWA 3QD3A 2ITQA 3I79A 1T45A 4B4LA 4FKJA 3MVMA 1W83A 2GSFA 1JPAA 3BYOA 4O22A 4LRKA 4WKQA 3U4UA 2BHEA 2WU7A 3DOGA 3IW8A 3VS0A 4PMMA 3SW4A 5IQDA 3GU5A 4WBOA 2FUMA 2XKEA 3D15A 4HPTE 5HKMA 4OR5A 3VNTA 4BY9E 4BCQA 3E3BX 2PSQA 2YM3A 2YERA 1JKTA 3DZQA 5C1QB 3FMMA 4TWCA 3II5A 4QMMA 3W8QA 2ERKA 5IEYA 5KMJA 1NY3A 2R3KA 3HUBA 5DEYA 4BGHA 3JVSA 3NUSA 2PZYA 1OM1A 4XP3A 5KHWA 4NL0A 1YOLA 2XH5A 3BU5A 5GIOE 4WHZA 5FBOA 4CFUA 2BAKA 2J0JA 2ZYBA 3DDPA 3GU8A 4ZEGA 3HRCA 4DDIA 2OJGA 4BCNA 4DHIB 4DBXA 1LEWA 2EXCX 5K5XA 2OIQA 3MVJA 4CXAA 4ZK5A 4JRVA 3O71A 3TJDA 3VVHA 4ZSEA 1LP4A 2BAJA 1FMOE 5L2QA 4E20A 3W0PA 3ALNA 3NIEA 3O7LB 3P4KA 3Q6UA 4KIKB 4EZ3A 5I9WA 2WQBA 5GINE 3MV5A 2H34A 3Q2JA 1XH6A 5M55A 3N4VA 2QOFA 3FY0A 3PXZA 4CV9A 2W9FB 3PSDA 1UKIA 1BKXA 2BFYA 4AW2A 3E62A 3C5UA 4YZDA 2WQOA 3PXFA 4MTAA 5BV3A 5IQGA 3FDNA 3WF5A 2PL0A 4GIIA 2ZVAA 3F7ZA 4B0GA 3H3CA 4U43A 5D12A 2YDKA 3BHHA 5CY3A 5JGDA 3BKBA 3AGLA 4DTKA 4UMTA 2BTSA 4GSBA 5EHLA 2QOLA 3R7IA 4G6LA 3ZU7A 4L67A 1CDKA 5KO1A 5M53A 5DG5A 2PE2A 3EQGA 3PVGA 4KIKA 4D28A 3PFYA 3ZLXA 5CVHA 2FGIA 4S34A 2UV2A 1BL6A 2QQ7A 2YM7A 3FL4A 4KS8A 4O4BB 1MRYA 3CD3A 4IVBA 1M17A 4ZTLA 3ZONA 5A46A 4I22A 1VJYA 3R9OA 5IZFA 4C4IA 3AKLA 3QTRA 1S9JA 4XHKB 3LCSA 2WMXA 3G6HA 4FOCA 2WMRA 5JQ5A 1WCCA 2OI4X 4CMUA 3FXZA 3BCEA 3F82A 4RVLA 4PDPA 1ST4A 3IS5A 4RJ4A 5DMZA 3AT3A 3SOCA 3EQBA 4ANLA 5DT3A 3QXPA 4IAIA 4QP7A 3GCUA 1FPUA 4FTOA 2WTJA 2ZOQA 3OBGA 3ORZA 3PY0A 4JIAA 4LGDA 5EQYA 2PK9A 3SX9A 3VN9A 4D9UA 5AR7A 3GFEA 1GAGA 3OWLA 3UODA 1V1KA 1Q3DA 2W96B 3RNYA 5AADA 3SQQA 4Y83A 5IQAA 2E9OA 4YBKA 4JDJA 4AZSA 2R3JA 2XIYA 1ZY4A 3O8TA 4FT5A 2C5OA 4MD9E 5GJFA 5HE2A 4A4OA 4BGGA 2RFSA 5IPJA 2CN5A 4FTIA 3GNIB 2XNNA 3MESA 1OIUA 4EQMA 4RX9A 3QD2B 2JIUA 3W0SA 1IRKA 4LV8A 2R3OA 3T9IA 3GGFA 3CS9A 2YN8A 2XIZA 2ZJWA 2XYUA 3OUKA 5CALA 2LAVA 1YI3A 4YZBA