3CP9A

Crystal structure of the vegfr2 kinase domain in complex with a pyridone inhibitor
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
312
structure length
288
Chain Sequence
AERLPYDASKWEFPRDRLKLGKPLQVIEADAFGIDKTATCRTVAVKMLKEGATHSEHRALMSELKILIHIGHHLNVVNLLGACTKPGGPLMVITEFCKFGNLSTYLRSKRNEFVPYKVAPEDLYKDFLTLEHLICYSFQVAKGMEFLASRKCIHRDLAARNILLSEKNVVKICDFGLPLKWMAPETIFDRVYTIQSDVWSFGVLLWEIFSLGASPYPGVKIDEEFCRRLKEGTRMRAPDYTTPEMYQTMLDCWHGEPSQRPTFSELVEHLGNLLQANAQQDRHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords Vascular endothelial growth factor receptor 2
publication title Discovery of Aryl Aminoquinazoline Pyridones as Potent, Selective, and Orally Efficacious Inhibitors of Receptor Tyrosine Kinase c-Kit.
pubmed doi rcsb
source organism Homo sapiens
total genus 96
structure length 288
sequence length 312
chains with identical sequence B
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2008-03-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3cp9A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3cp9A01
3E7VA 3G9LX 3WIKA 4FIFA 5E8ZA 3R9OA 4IX3A 3R7YA 2XP2A 2X39A 3ENHA 4MD8E 1S9JA 3EIDA 2CN8A 1J7UA 4EH4A 3DLSA 3AMAA 3QTIA 3NUXA 3VF9A 3QALE 3S4QA 3VAPA 5A4LA 2XYUA 5CTPA 3KGAA 3M42A 3BLHA 3ZUVA 3S1HA 3HMIA 4IZ7A 4E8AA 1Y91A 3IG7A 2UZNA 5LVLA 4I23A 5EHLA 2W06A 4FICA 1BL7A 2C6MA 4UMUA 3OWLA 4DINA 5IZFA 3NNWA 3KXHA 3BU6A 4FG7A 5J87A 4HYHA 2EWAA 5D9HA 3PPJA 5KMKA 2Z7RA 1F0QA 3VUIA 2RG6A 4G16A 3QHWA 4ACHA 4IM3A 3PXFA 4EOLA 3NYXA 2VWVA 3QD3A 2RIOA 2YCQA 3TACA 3LMGA 3ZSIA 5HTBA 1JQHA 4MXOA 3UVPA 3DQWA 1PJKA 3IGOA 2VWIA 5T6KA 3B8RA 4RWLA 2ITYA 4TN6A 2DWBA 4U3ZA 2GFCA 4F7LA 5L6OA 5LMKA 4O84A 4DBNA 2BKZA 1FVVA 4BR3A 3P86A 2YZLA 4C62A 3FLWA 4JXFA 3E87A 4QMYA 3KEXA 4AF3A 3F2RA 2VTLA 4HCVA 3G9NA 5C4KA 3FC2A 4EK6A 3KXNA 3U4UA 3QYZA 2GSFA 4L01A 3SRVB 3GCQA 4KIPA 4G3GA 5IQIA 3L9PA 5DRBA 5GJFA 3EFJA 3R2BA 4FSWA 3D0EA 3C4FA 3RNYA 1KSWA 4XV2A 3ZXZA 4IVAA 5IA4A 3ODYX 3Q2JA 4FG8A 4RZVA 2WTKC 2GQGA 2PSQA 3CCNA 2BR1A 3H10A 4I6HA 4IB1A 2X81A 4YZDA 5CY3A 3TJCA 1REKA 4UZDA 3L8SA 3W33A 5C8KA 4DT9A 3KXGA 5A6NA 4P7EA 4EOOA 1HCKA 4F9AA 3NVKI 5KHWA 2YLEA 2WTVA 2GNGA 1H8FA 5CVGA 2YM4A 3ROYA 4MNEB 4DFUA 3DNEA 4ZEGA 4AFJA 2PMNX 2JD5A 3OT8A 4G2FA 3HECA 4NK9A 3VRZA 1M2PA 3K2LA 3G51A 1XR1A 1LEWA 5AUYA 4U6RA 4UMPA 2EU9A 4RLKA 5FTGA 5HVJA 3GOPA 4EH6A 5J5SA 2BZKB 4BCPA 3P4KA 3QX4A 3ZLYA 2OFUA 4M3QA 2QURA 4OLIA 5HBHA 1H0VA 3TV7A 4RJ8A 3TTIA 3NAYA 3TZ9A 2QLQA 2QOLA 1BUHA 4IW0A 4M67A 2W5HA 2QC6A 1E1VA 2ZB0A 1G8SA 2AUHA 3OXIA 4O6EA 1V1KA 3SRVA 4UZHA 2AYPA 3KULB 4MVFA 3VIDA 2GTNA 4EH2A 4FKVA 3UBDA 1CTPE 3MYGA 4UX9A 5HG7A 3ALOA 4PMTA 1YWRA 4S30A 3PJ1A 4I24A 4D0WA 3VRYA 4CZTA 4LMNA 4FKRA 3BGPA 5KKRB 2YDKA 1PXJA 4FZAB 4LOPA 2HK5A 3VBWA 4DH1A 5I9WA 4C33A 4I4FA 2XRWA 3BPRA 4ZSGA 2PZIA 2VWBA 2A0CX 3TNPC 3I6UA 3OWJA 4FV9A 4BCNA 4F4PA 4J99A 1UU7A 4TYHB 3VUMA 4O0RA 5KMMA 2O5KA 3DTWA 4AZFA 4I1ZA 4FEWA 2QD9A 2UVZA 4OT6A 4FKPA 1W84A 3NIEA 2P2HA 4RA4A 3R9DA 3RCJA 3NRMA 4DLIA 5IA0A 2C6IA 4C35A 1WBVA 1WFCA 1HCLA 4LV8A 4XLIA 4NJDA 4UWBA 3F3UA 3AC8A 3MB6A 4DFNA 2QHNA 3IDBA 3KF4A 4KBAA 4FEQA 2YISA 4WG4A 3O71A 3FWQA 3AGMA 4OTHA 4TYGA 3H9FA 2RKUA 2VD5A 4ZZMA 4G1WA 4I4EA 1STCE 3HV5A 3CQEA 4KKHA 3LCTA 3V5WA 5JGBA 4EJ7A 4QMZA 4C02A 2JKKA 2Z7SA 2NNWB 2ITVA 3ZLSA 1WBSA 2EXCX 1URCA 2IVSA 3MA3A 3QGYA 2XB7A 4RC2A 5HU9A 3O51A 3E64A 3LM5A 5HNIX 3WF5A 5IQHA 3HKOA 4PL4A 4AAAA 3R7UA 1FBNA 1SNUA 3RMFA 3ORZA 4L67A 1M7NA 4IJPA 3N51A 3FE3A 3WZKA 1JKKA 3RHKA 3EZRA 4RFZA 3GQIA 3DPKA 3RAHA 3FLYA 3TV6A 4BKYA 2F49A 5BVNA 2XK3A 5CX9A 1W98A 3MS9A 3UPXA 4QOXA 3BRBA 3UMWA 4UYNA 4ZY5A 5AA8A 1IG1A 4JDIA 4R78A 4G34A 4U44A 4G6OA 1PMUA 4AW5A 3ZEPA 3HA6A 2JIUA 4RVMA 3RI1A 3UOHA 3UTOA 3QCYA 5L8KA 5HD7A 4G9RA 2IVTA 4FKJA 2UW0A 5DBXA 1F3MC 1OIUA 3G90X 4LOOA 4NEUA 2BFXA 4X2JA 4RWKA 2JAMA 3ZFMA 3DKOA 4WD5A 4F7NA 4YU2A 1YHVA 3MFTA 1KV2A 5JRSA 1KE5A 5BPYA 3U55A 1PXKA 3CEKA 5HE1A 4D1XA 4UWCA 3MESA 2NRYA 4MBIA 5FBOA 3GU8A 4AZSA 2RFEA 1SVHA 4U41A 3E8CA 4I0TA 4BTKA 2B9HA 4KKGA 5LWNA 1FQ1B 2P2IA 4I5CA 5JFXA 3Q9XA 4FL1A 2OXXA 5DN3A 3GBZA 1WZYA 5E8WA 4BB4A 4LRMA 1OPKA 3ZYAA 3PFQA 2WOTA 3F2AA 3ELJA 3CGFA 4DFYA 5CF4A 4O0VA 4A9UA 1XBCA 1ZWSA 2BRMA 3E8DA 3V51A 4J7BA 3K3IA 5K3YA 4LRKA 2IZUA 4L46A 4XV3A 1NXKA 5FXRA 3IGGA 3QC4A 5GNKA 3RM6A 2QI8A 4IAZA 3ROCA 5IISA 3WYXA 4YR8A 2I0YA 2VO3A 3MGYA 5DGZA 2YWPA 4U8ZA 5M4CA 5A4EA 1FVRA 2W17A 4BZDA 4DEIA 4DBXA 3FY0A 4R7HA 4O7YA 3VS6A 3KXXA 3PY3A 2C5OA 3PVWA 1DI9A 2O8YA 4RA5A 4PL5A 5BUEA 3ATTA 2HZ0A 3R83A 4ITHA 2JLDA 1ERKA 1OL7A 4U0IA 5FD2A 4LFIA 4Q2AA 4O1OA 5AWMA 2HY81 1OL2A 5D41A 4H3PA 2QR8A 2OXYA 4O7RA 4JG6A 3ZZEA 4CTCA 3LM0A 2OO8X 3RVGA 3KMWA 4WBOA 4L43A 2ITUA 2XVDA 4O22A 4ZSEA 4QMXA 3GU4A 3OWPA 4E3CA 3G0FA 4V05A 4I94A 2WZJA 4RLLA 4JR7A 2ZOQA 4FNZA 3RWQA 2OLCA 5CSWA 3UZPA 4O7SA 3VVHA 2OZAA 4YJRA 4OTDA 5EFQA 4EWQA 5AAEA 4MX9A 1Q97A 4FIGA 4ZTMA 4MCVA 1UV5A 3T3UA 2XK4A 4YO6A 5CLPA 5AUWA 3VBYA 1GZKA 1Q24A 3DBEA 2UW4A 3TN8A 2JKMA 2CCHA 4BDKA 3MB7A 3LMIA 5E8SA 5IH5A 2RFDA 3KKVA 2FSOX 3R30A 4BGQA 4EOKA 3VBTA 5KX8A 4FSYA 4PDYA 3HV3A 3ZO4A 4C8BA 1UNHA 4G3EA 2VX0A 3R22A 4QT1A 4O81A 2V0DA 4GG7A 4QMUA 4W9XA 4RC3A 4YHTA 5HCYA 4QTCA 3RAIA 4OAVB 5EW8A 4RIOA 1XH4A 2XCKA 4KINA 5CSXA 4D0XA 2REIA 1VYZA 4ZTQA 3VQHA 3F5PA 3F5GA 4CMOA 3N9XA 3ZLWA 2HXLA 5HCXA 1PY5A 4DA5A 3DTCA 4W9WA 4D55A 3AT2A 3O8UA 2VX1A 3RZFA 3MFSA 2OIQA 4Y95A 4AG8A 2HXQA 4TT7A 1H27A 2OH0E 4GYIA 4OT5A 4A9SA 3PJCA 4TNBA 4EBVA 3D5WA 4FIEA 5C8NA 1NW1A 1KE7A 1T46A 4QP9A 4BCMA 3NS9A 4DN5A 3PG1A 2OJIA 4AU8A 2B9JA 1TQPA 2O64A 3C9WA 4RT7A 4AZEA 4BTMA 2C68A 3D94A 1LP4A 3FQEA 2PMIA 4TWOA 4D2PA 5J7HA 5M07A 4CG8A 3OCGA 3QRJA 3QQFA 2HELA 3HV6A 3OY3A 4AA0A 5KBQA 5IG1A 2PULA 4L9IA 3SGCA 4MXXA 2BALA 4KB8A 4O0XA 2WEVA 3PWDA 4C61A 1Q3WA 4CFWA 4FT5A 3U8WA 2IVUA 3DK3A 4BDEA 2XNOA 4MYGA 2VV9A 2R9SA 3PPKA 4UMTA 2YCRA 3W2SA 5IEYA 1VYWA 3EFLA 5E4HA 3HVCA 2DUVA 3OHTA 2HY0A 3EN6A 1V0PA 2YIWA 5DPVA 4O82A 3FHRA 5HZNA 3CC6A 4S33A 2CNVA 4F09A 3KN5A 3QCQA 2XIKA 5FLFA 1MRVA 5A4TA 3EN9A 4FKGA 3MFUA 2R5TA 2YAAA 4WUNA 4BHNA 2OK1A 4K9YA 4A4XA 4IB3A 2PVHA 2QOFA 4PDPA 3AMYA 4J96A 5DH3A 3ZU7A 4DG0E 4GH2A 3GOKA 5CI7A 1VEBA 3W2RA 4EQCA 4E93A 4BTJA 5KMOA 2PVKA 4RQVA 4AW1A 3F9NA 3KA0A 3EQRA 3OMVA 5EDPA 5KUPA 2PE0A 2WIHA 3QWKA 4YMJA 4E4NA 3KREA 5ANOA 3CIKA 5EYMA 2JKQA 3R8UA 2WOUA 2Z60A 3DDPA 2PMLX 4FSNA 1OUYA 4DAWA 4N6ZA 4XEYA 4XS2A 4KNBA 3LCOA 4PV0A 3VBVA 2B52A 4J8NA 3NWWA 5DVRA 2OG8A 3KC3A 4CKRA 3B8QA 3RPVA 5AADA 1O6KA 2XYNA 3IECA 4BKJA 3GB2A 2R2PA 1M52A 4QQTA 4QP6A 5DYJA 4FV7A 3WBLA 3DKGA 1DM2A 3DGKA 4V04A 3NLBA 5H2UA 3ULZA 4M84A 4QPMA 3LCSA 3R2YA 4JRVA 4CFFA 4MQ2A 2I0EA 4XYFA 3C50A 3PE1A 2A19B 2Q0BA 4CFMA 4USEA 4DE4A 3DCVA 4I20A 4FKQA 3OBJA 4QP4A 3TG1A 1Q99A 4K6ZA 4FBXA 4X3JA 2R3GA 4E6AA 3COKA 3EB0A 2B53A 3UG2A 2XZSA 1YXXA 2CDZA 2PTKA 3P7BA 4EK4A 1W82A 4EZ5A 2BIKB 4EZ7A 1UU3A 5G6VA 2X7OA 3CBLA 5IKWA 4KKEA 4PL3A 3SKCA 5JH6A 3FJQE 5KO1A 3QZGA 2CGUA 3KU2A 4YC8A 1H08A 5DR6A 4IM0A 4Y73A 4QMQA 5AR8A 4EKKA 2YFXA 4YSMA 2OICA 2W7XA 4DTBA 3QTUA 2ZMCA 3MVMA 4UBAA 4QMMA 2E9VA 3PJ3A 4EH7A 2Y6MA 3HL7A 3NSZA 3TUDA 3ZRKA 1W7HA 4NL0A 3DU8A 3H9RA 3BX5A 5M4FA 4EHGA 4J97A 3V6RA 3A61A 4K2RA 1U54B 4M69B 4FK6A 2QNJA 4FZ7A 5CEQA 5CANA 4IDTA 4Q9SA 2C47A 2VTIA 3SXFA 5BYLA 3Q5IA 4KS8A 1UU9A 2J9MA 3ACKA 1ZMVA 4G5PA 2QO9A 5EK7A 1XKKA 4GV1A 4RX8A 2G1TA 3UYTA 4P5QA 1UNLA 4AW0A 2VNYA 2CMWA 4O0TA 5AIRA 4GMYA 1DI8A 3QAME 3MFRA 3QKMA 5K0KA 4FTKA 3GFWA 3QL8A 4BCKA 3AT3A 1O9UA 2R3PA 3CS9A 3DB8A 3MVHA 3MY1A 4NCTC 4OW8A 4C57A 3IOKA 3Q6UA 4EOJA 4HVHA 4ZZOA 3BU3A 3GGFA 3RGFA 2WMTA 1O6YA 4HVGA 3VS3A 4S2ZA 4LGDA 1Q41A 3VS2A 3A8WA 4MWHA 5K4IA 4B4LA 3I1AA 2X6EA 5J79A 4ASZA 2WNTA 4C2WA 5DOSA 1LR4A 3DBFA 2J50A 5HQ0A 3KRLA 5AV2A 1U54A 4M69A 4UYAA 1WCCA 4WNPA 2WIPA 4G6LA 5IDNA 3HGKA 3PLSA 4FL2A 3RZBA 2A1AB 4L44A 3HV7A 2XNMA 5CWZA 3ORXA 2BIYA 4QTBA 2Y0AA 3FUPA 3MW1A 4CFXA 3NNUA 3RPYA 2WEIA 3F3VA 5IQDA 1M14A 2YAKA 4MK0A 2JFLA 4ALWA 4R1VA 3WE8A 1RQQA 3ANQA 3PA4A 2NO3A 3ZO1A 2HWPA 4C4GA 2EVAA 2GS2A 3I60A 4MXAA 2PK9A 4IAIA 5HLPA 3R8PA 2FB8A 3VULA 2XIRA 2YJSA 4GT4A 4ITIA 3DBCA 2V55A 4GT5A 3RK7A 4QQ5A 2AC3A 1URWA 2JAVA 4DCAA 3D15A 4YJSA 3C5IA 3Q2MA 2FYSA 2UW9A 3U51A 3R0TA 1UWJA 1GZOA 4F9YA 4E6DA 4KUJA 4JDKA 4QTEA 2RL5A 1OVEA 2VGPA 5D10A 3OCTA 3SQQA 4OTGA 4JI9A 2ZM3A 2V5QA 2W1FA 4N0SA 3NCGA 4F65A 4HNFA 2PVMA 3UG1A 4AUAA 2C4GA 5JMSA 3QCSA 5GJDA 1G3NA 4PDSA 4FTMA 3KF7A 3CQUA 2YDIA 4EOQA 2W5AA 2JBPA 3FY2A 4GRBA 2E2BA 4A7CA 1M17A 3FMDA 5L6WL 4KBKA 4QNYA 3PWYA 4YHFA 3IS5A 4C3PA 2PE1A 4O38A 5DT0A 1L3RE 3IONA 4EL9A 5B2LA 5I4NA 4JL9A 3ATSA 3UPZA 2DS1A 3AQVA 5TR6A 1JSVA 5CAQA 4HCTA 3LCDA 4ERWA 2ZMDA 5FEQA 4GCJA 4Z7GA 3TUCA 1KE6A 4W8DA 1UA2A 5B0XA 3GFEA 2R3FA 3UIUA 3LKMA 5GIOE 1PXPA 4C34A 4DT8A 5HTIA 5EH0A 4WNKA 1H1PA 4DFXE 3PXQA 4L3PA 3FSKA 3QTWA 1PYXA 4FZDB 4GW8A 3LQ5A 2BDFA 3BLQA 2O0UA 3U54A 2J0MB 3LHJA 4NZWB 5J9ZA 5J95A 2QOOA 4M97A 3IOPA 5CQUA 3R7EA 4N57A 4BDHA 4ZY4A 3DZOA 2PZPA 3FI2A 4RX7A 5HG8A 3FXZA 4C0TA 5BNJA 5C4LA 4PMSA 2JIIA 4YTHA 3GQLA 3GXLA 5JZNA 3OOMA 4CLJA 5KBRA 4W8EA 5D1JA 2BPMA 3EFWA 5C01A 3Q4ZA 5I0BA 4NIFA 4BDIA 2C6LA 2X9FA 5G1XA 1Y8GA 4EKLA 1J3HA 1XBAA 2HIWA 4LUEA 2WMQA 1BX6A 4LV5A 3MPMA 4U81A 4WRSA 3U9NA 4CSVA 3A7JA 4NUSA 2I0HA 5HKMA 4CCBA 2QU6A 5E8XA 1PXNA 3GVUA 4AT4A 3HNGA 4D5HA 4YLKA 2LGCA 3PIYA 5BMMA 5AA9A 4HZRA 2BUJA 4IHPA 2HYYA 1Q5KA 4I6QA 3REPA 4LG4A 4IAFA 5T68A 3TKHA 3ZBFA 5BYYA 1H1WA 2VTHA 3CR0A 4DG3E 2YM6A 3ZZWA 4GU9A 3TEIA 5J1WA 2WGJA 3OROA 3CQWA 4YNOA 4ZTSA 3UZTA 5EG3A 2QU5A 5HO8A 2XBAA 5LOHA 4JS8A 4BDAA 4NKSA 2R3KA 2BHEA 4USDA 2XJ1A 3D7ZA 1FGIA 3Q04A 4AFEA 3OXTA 3HAVA 1W83A 4EYMA 3EZVA 1E9HA 1WAKA 2RSVA 2FH9A 2OFVA 3RAKA 2VTMA 5CSVA 2X1NA 4X6QC 1FGKA 3QCXA 4AOJA 4F7JA 5EM5A 3NIZA 4YJNA 3RWPA 3ZHPC 4AACA 4L3JA 3P23A 4F0GA 2YERA 2C5XA 4S34A 4DLJA 4FV5A 3NMUF 1ZYDA 3WF8A 4EORA 3QU0A 2LAVA 3NUAA 1PYEA 3P7CA 4J95A 3BEAA 4U79A 5CXZA 5F4NA 1CMKE 4MTAA 4R77A 2GNJA 3FHIA 3OF0A 2WTCA 3VNTA 4K0YA 4D4VA 2NP8A 3GCSA 4FTQA 4TYIA 1UU8A 5HTCA 5LJJA 4EOPA 5FTQA 3Q4TA 2YJRA 5CI6A 2V22A 3FC1X 5AP4A 3OCBA 4U45A 2XNNA 4FV2A 3EJ1A 2XA4A 4L7FA 4ZZNA 5K5NA 3OS3A 2ITXA 3ZM4A 3NYNA 3FYKX 4CQGA 4EOSA 2PYWA 3E8NA 3OXZA 3QUEA 3R6XA 2CCIA 3CE3A 4PQNA 4RWIA 4IZYA 2WTJA 4D2RA 3A4PA 4X3FB 1OPLA 4EHVA 1UWHA 3FKOA 3AC3A 4EEVA 3P9JA 3PRIA 3EH9A 3DKCA 1VR2A 4MWIA 5GHVA 5DMZA 3AT4A 3WARA 3AD4A 4NW5A 2UZEA 2XKFA 3F7ZA 4BGGA 5IQAA 3CTJA 4FVPA 5M51A 4Y5HA 3CPCA 1ZY4A 2YCFA 4QP1A 5A54A 1SZMA 2VWXA 4KIQA 2O65A 5TKDA 4IAKA 4XG6A 4FTRA 4YBJA 3OY1A 3BZ3A 4U9AA 5E8YA 4EQMA 4F0IA 4ZY6A 4BN1A 4NFNA 4FEVA 2VUWA 4IFGA 3C4EA 4ZS0A 4GUEA 2CPKE 2XCHA 3K5VA 3KRRA 4CGAA 2BRNA 3PPZA 1ZOGA 4M15A 2HOGA 3ZRMA 1OKZA 4QPAA 1R0EA 5EM6A 4AA4A 3RM7A 5F20A 4MF0A 5ETFA 1CDKA 3A99A 4IJ9A 4XG7A 2YN8A 4GK2A 2GFSA 3FDNA 4XG4A 3ORLA 4O0YA 5AP3A 4E6QA 1YI4A 2QOCA 4IAAA 4IZAA 4X3FA 2QHMA 2OW3A 2VO0A 2PZ5A 3F61A 4I5MA 2Y6OA 4RFMA 4YZBA 4AZTA 4A06A 3EYHA 2XEZA 5FDXA 2OGVA 4ACCA 3IW8A 4Z7HA 3S3IA 3T9IA 1SNXA 5K5XA 3U9CA 3ZUUA 3A60A 3B2TA 5FXQA 3UQGA 4ANBA 3ZFYA 3ZOSA 4QYHA 4L53A 3FLSA 3SXRA 3ZDUA 4G17A 1BKXA 4C7TA 5CF5A 4FTCA 3BHYA 3BELA 2C30A 3QLFA 4EYJA 3SG8A 1WVYA 2R3LA 4MD7E 5JSMA 4J71A 3GCUA 3G2FA 4D1ZA 3LW0A 4E5BA 1GOLA 3DJ6A 4GUBA 3UJGA 1CM8A 3GC7A 3JY0A 2BRHA 3E8EA 2F57A 2VTQA 3DV3A 4UEUA 4XHKB 3WF6A 3HRBA 1VZOA 4FTUA 3ODZX 4IM2A 4HYIA 1YDSE 4NCTA 3MJ1A 1PXLA 4YJVA 4LL0A 3LXPA 5HESA 1MUOA 3EQDA 3GCPA 4RIXA 1WBTA 3R00A 2PU8A 4BCGA 5ANGA 3WZJA 2OU7A 2WO6A 5IU2A 5HOAA 2IZRA 1LPUA 4MAOA 5BVFA 5AV3A 5B2MA 2G15A 2YZAA 4LYNA 4UALA 1E1XA 1JNKA 1OMWA 3GT8A 3UIBA 4E5WA 1F5QA 4C3RA 3GEQA 4LOQA 4CMUA 2Y8OA 3KK8A 2UZLA 3AD6A 3FMJA 3R1SA 2YM7A 3P7AA 3HP5A 2C5YA 4L68A 4QYFA 5JN2A 5AR3A 2WQNA 4YZNA 5AP1A 1ZMWA 4GSBA 2YHVA 2F9GA 3MN3A 3O17A 4AOTA 4JAIA 5TOZA 3W16A 4IXPA 2V62A 5CU6A 1H26A 3E92A 2QO7A 3OT3A 3R9HA 3RK9A 4JBVA 1JKTA 5CT0A 2PUPA 2NRUA 3IK3A 4APCA 5E8TA 4DEHA 3R7GA 2YIQA 3FYJX 3TXOA 2UVYA 4K11A 4NYEA 2OJGA 2I7QA 5IPJA 5FP5A 2QVSE 4HYSA 3F82A 5HEZA 5E9EA 5HX8A 2YWVA 4ZAUA 2X4ZA 2O2UA 2VO7A 2CKPA 4F64A 1OKYA 4BFMA 5IMXA 3Q5ZA 2WMBA 4P2KA 4FKIA 5JEBA 5IQCA 3F3ZA 3TDWA 2WAJA 4HNIA 5DHJA 2BZHB 2BVAA 3Q53A 5FEDA 4JT3A 4Y5QA 3DBQA 5CENA 3F3TA 5L3AA 4XH6A 5CZHA 5E90A 3B2WA 5KMNA 3ORTA 4U42A 3CKWA 4DEDA 1G8AA 5HVYA 5EYCA 2R3IA 3CJFA 3C5UA 3C4ZA 4FX3A 1Z5MA 3F3WA 2F7XE 3EQHA 4OBQA 3NX8A 4S32A 5C03A 5FDPA 2RFNA 2CNQA 4FOBA 5J8IA 4O7NA 1TVOA 3A4OX 4TZRA 2JGZA 1OL6A 4YJOA 4IWPA 3EL8A 5IQEA 2C0TA 4S31A 3R21A 1NVRA 3RALA 3MIYA 2VU3A 4YURA 3TM0A 4P5ZA 1QPCA 1J1CA 4H39A 4YP8A 3ZFXA 3ZO3A 5L4QA 5AM7A 5IUHA 4R7IA 4I6BA 4GT3A 4FG9A 2H8HA 4RPVA 4XG2A 3T3VA 4ERKA 5JQ5A 4JJRA 5KCVA 4BWKA 4QP7A 5GZAA 3D5VA 2OSCA 3WIGA 4BRXA 3COIA 4I0RA 2BHHA 3FZ1A 3II5A 4E4MA 5BVOA 3F5UA 4I21A 4OBOA 2R64A 1U59A 1J91A 2GHLA 1R3CA 5AX3A 2ZB1A 3NUUA 4KSPA 3QD2B 4PNIA 2JDVA 4O7VA 5CYIA 4IFCA 3PXKA 3PVGA 5CEPA 3OG7A 1CSNA 3LPBA 4O2PA 1Q8WA 4QMSA 5JGDA 3NVMB 4XRLA 4PX6A 1XBBA 3G0EA 3PIZA 1QPEA 2I0VA 3C0GA 4KBCA 4W4VA 4YJQA 3QKLA 5I9UA 4E26A 2PVNA 1DAWA 2VX3A 4DFZE 3W2PA 5E92A 2XKDA 3F7WA 3TCPA 3UIMA 4YZ9A 4CVAA 2C6OA 4CFNA 3UVQA 5DLSA 2YITA 4AA5A 2ZV7A 1ATPE 2W1DA 4MH7A 4ASDA 3U87A 4CMTA 3BV2A 1Q4LA 3JXWA 3NUNA 4D1SA 2GPHA 3GNIB 4NSTA 2X6DA 4YC6A 4AT3A 3KQ7A 4HYUA 5LCJA 1Q62A 4RJ3A 3OW3A 3LFBA 5M06A 2PY3A 5DIAA 2OZAB 1YI3A 2HW6A 4NU1A 2PE2A 1G5SA 3M2WA 3D83A 1JVPP 3S2PA 3W2CA 4H1MA 1OITA 2WPAA 4TWCA 3KRWA 1RW8A 3EQCA 5AP5A 5IH4A 4BZNA 3DT1A 3IDPA 4D5KA 3LFNA 4QP8A 1AGWA 2P0CA 3FBVA 5K9IA 3P1AA 2ZV9A 2XNPA 2VTSA 3ZBXA 3QBNA 3KMMA 3MY0A 4JX7A 3A7FA 3QQKA 5FXSA 5A4CA 3GU5A 5GZ8A 3OC1A 3M11A 1IRKA 4PNKA 1GZNA 3CD8A 1SMHA 1YHWA 2RG5A 1ZMUA 2W99B 3DZQA 4IACA 3MH0A 5CXHA 4I22A 3THBA 3OWKA 3C51A 4YTFA 3JY9A 1PF8A 4BVUA 3UVRA 3P0MA 4C4FA 3BGZA 3Q9ZA 4BBFA 3V3VA 2C3KA 3PG3A 1U5RA 4FR4A 3CKXA 1PXMA 5AR2A 4O91A 2OIDA 2FVDA 5EHYA 3C13A 2WTIA 3V04A 5BUJA 2QKWB 2WXVA 4NT4A 4CRLA 4L00A 4DH7A 1YOLA 2WKMA 2VRXA 2XM9A 3D9VA 1K3AA 3LFEA 5I3OA 4C3FA 4BYJA 2Y4IC 4FZFB 1KWPA 1KOAA 3PP1A 5EDQA 4QRCA 4O1PA 1YWVA 5F1ZA 5IUIA 4ZK5A 4FNXA 4LM5A 3FZOA 1L8TA 1IR3A 2CKOA 5H8EA 4FKWA 4I6FA 5JFSA 4WG3A 4ZXTA 2WTKB 3QF9A 2UW7A 4K8AA 3RKBA 3FQSA 4R8QA 4NJ3A 2CKQA 5LCKA 4A9TA 2B9IA 4O0SA 2C3LA 2OZOA 4C4HA 3UQFA 1GJOA 4L52A 5LQFA 2WU7A 3OW4A 2QOIA 4QNAA 3TZMA 3VW6A 3BWFA 3BWJA 5HI2A 4A9RA 4F7SA 3UNZA 5KMIA 5L6PA 2WQMA 1ZYJA 5AAFA 4H58A 4BTFA 3SOCA 1MQ4A 3NPCA 1H25A 1OIQA 4NM5A 2QOQA 5HHWA 3ZUTA 3DY7A 4R6VA 4CTBA 2W05A 1A9UA 3BYOA 3FMMA 2FUMA 1TQIA 1A48A 4YJPA 4H3BA 4IEBA 4RMZA 5IQBA 3AOXA 4FGBA 4LQMA 3WILA 3UMXA 5C9CA 3CY2A 4XBRA 3MTFA 1RE8A 3VQUA 4MF1A 4QPSA 2UZDA 3BI6A 1DS5A 3EQIA 3P79A 1R0PA 2G2HA 4XG3A 4ZMFA 2F4JA 3MJ2A 4FNYA 4ZTLA 4KS7A 4BDBA 4YLLA 2BTRA 4WRGA 1PHKA 2YLFA 3SA0A 5HORA 4PTCA 4M0YA 5K0XA 4GIIA 3LXLA 4OTQA 3NUPA 2XIZA 3GENA 4FUYA 2H96A 3TKUA 2GU8A 2OWBA 3IPHA 2XIXA 2GHMA 3V6SA 4G3DA 3G5DA 5HIDA 4XOYA 5DFPA 4CT2A 4HVSA 2OXDA 5JZJA 2XK9A 5GJGA 4WA9A 3BHVA 5AP2A 1CKIA 3PLAE 1YDRE 4YSJA 4X0MA 3P08A 2VAGA 3NDMA 4FTAA 1H24A 5CU4A 5HIBA 2W9FB 5AP0A 2GCDA 2E9NA 5CU2A 4M14A 4IWOA 1PMVA 5AV1A 5CEIA 1J7LA 2I1MA 4EK3A 4E6CA 4ENXA 3BBTB 3F5XA 4FKLA 3BU5A 4LUDA 2ITQA 1XH7A 1JSUA 2H9VA 4OUCA 1I44A 3BYVA 2ONLC 3FSFA 4Y46A 2W1HA 4BDDA 5K4JA 3JR1A 3KRJA 3P5KA 4ANOA 5HE3A 4F9BA 4FKOA 2EB3A 4XBUA 5E8UA 4RJ5A 4C58A 4AN2A 4DEGA 5EKOA 2QCSA 2H34A 4IWQA 2J7TA 4XJ0A 5KE0A 3VUKA 4CZUA 5LARA 3R7IA 4O83A 3V5LA 4XOZA 3PDTA 3TNIA 4PWNA 1XH6A 2J2IB 4DGMA 3BIZA 4JLCA 5LMAA 3HMMA 3S0OA 3Q52A 1XO2B 4EH5A 2VWWA 4W4YA 2VN9A 1K2PA 4DHFA 2DYLA 3FKNA 3DJ7A 2PUUA 2PVRA 5EQYA 3ALNA 3HEGA 1YQJA 1OPJA 2UUEA 2C3IB 2Z2WA 4JG7A 4RIWA 4BICA 4OAUC 1K9AA 5AR7A 3R71A 2WD1A 1U5QA 4XV1A 3VS1A 4ZSJA 2B55A 5AUTA 3LJ1A 4DH8A 2A27A 2CGWA 4MBJA 4ZSLA 1APME 4WG5A 4FV1A 2BRBA 4JDJA 5L2TA 2C6EA 3D2IA 3H0YA 5FM2A 4FT0A 4GFMA 5HO7A 2X8DA 2GTMA 1ZOEA 4RJ6A 2SRCA 3CY3A 5IA3A 1FVTA 1ZYCA 4ASXA 1OKWA 4QMTA 4M0ZA 4X21A 5E7RA 4CKJA 2WU6A 4UB7A 3VWAA 4Q9ZA 3WE4A 3C1XA 3DXQA 3WZDA 3G6HA 2PHKA 3VS5A 4I5PA 3QWJA 2E9OA 1YWNA 2EUFB 2ERZE 3BYUA 4FGRA 3VUGA 1YOMA 3IDCA 3W10A 4PMMA 2YDJA 2ITPA 4BDJA 1OL5A 1GNGA 5HBJA 4HGTA 5F9EA 3VO3A 5KZ0A 5HE0A 4C4JA 3QGWA 2PMOX 4BI0A 2JITA 3LFFA 3WZUA 2HZNA 2YIRA 2BTSA 4HGLA 3SAYA 4FMQA 4H1JA 4PPAA 2FSTX 5IA1A 1BLXA 3UC4A 2GQSA 1XHAA 2I40A 3LE6A 4G5JA 4UXQA 3PY1A 3QRUA 1XWSA 4QD6A 3BE9A 3RHXA 4EC8A 2EXEA 2F2UA 3DQXA 3LZBA 4LI5A 3VBQA 4XG8A 2QO2A 2UZUE 5BVKA 3O23A 1PW2A 4IANA 3ORKA 4FTLA 4UMQA 3EHAA 4C36A 4HGSA 4RC4A 3AG9A 4NM3A 2WHBA 2BAKA 4TRLA 4GVJA 4TWNA 2CSNA 5JT2A 4JRNA 2QODA 4KRCA 2W96B 4AGCA 4WO5A 2V7AA 2X7FA 2XIYA 2X8IA 3JYAA 3QRIA 4UY9A 4X2KA 1M2RA 4OTWA 1MRUA 2JFMA 3QA8A 2YACA 4NM7A 2WB8A 5BVEA 3U6JA 4X2NA 2R3QA 5HCZA 5A46A 5BVDA 5EI6A 1IAHA 3PXRA 5BMSA 1PMEA 2ZVAA 3PJ8A 4WKQA 4FV8A 2IW9A 4MNFA 4O7ZA 3LCKA 3QYWA 3A8XA 2ETKA 4FE2A 4APPA 2XBJA 3TIYA 2E9PA 3TZ7A 5E1EA 3ZH8A 3LXNA 4NIFB 3CXWA 4BCQA 1ZARA 3HLLA 3QTRA 2WMVA 1JPAA 4LRJA 3UO4A 3D7TA 2XKCA 4QO9A 4H3QA 3TJDA 3A7HA 5LWMA 4R1YA 3DLZA 4RVLA 2HWOA 4O21A 1B6CB 2WMWA 4R5SA 4U3YA 2XK8A 4UMRA 2I6LA 3PVUA 3MDYA 5JGAA 4IX5A 4UXLA 2GNHA 1Y8YA 3GU7A 4GK3A 4LMUA 3UOLA 4BDCA 3Q60A 5A3XA 2XJ0A 1P14A 1NY3A 4AE6A 5ANDA 3PJ2A 2WTWA 5L2WA 3UOJA 4E7WA 5IEVA 5KKRC 3A7GA 3E3PA 3RPRA 3U4WA 4FSQA 4D4YA 3HMNA 3QQJA 3L9NA 3TUBA 3CPBA 4TYEA 1H0WA 4IVDA 4DH5A 4FV6A 5AUVA 1ND4A 4XNEA 3FMKA 4QYEA 4HCUA 1OBDA 3HAMA 1WBWA 5LXMA 1CKPA 4JG8A 2F2CB 2C5NA 3TTJA 1YXVA 2C0OA 3DXNA 3R8LA 4QMPA 4FA2A 3E7OA 4EH3A 1U4DA 1B38A 4E1ZA 2WMAA 4EH8A 3SW4A 4BWPA 3KCFA 2A2AA 3N4VA 2IW8A 4TY1A 4FKTA 3O7LD 4Y72A 5KHXA 4CD0A 3QLGA 3BKBA 2VTJA 3LLTA 2B4SB 2J5FA 4FTNA 3UDBA 2BZIB 5DEWA 1MQBA 2OH4A 1GIIA 4NKAA 2XK7A 3VS7A 2IN6A 3MIAA 3IQ7A 3DS6A 4U43A 4X7QA 5FGKA 2Q83A 3HMPA 2ITWA 4ITJA 3QTXA 1JBPE 1M7QA 5CAUA 1R78A 3FXWA 4KIKA 3LFDA 4DGGA 3KXMA 4F63A 3I7BA 3K5UA 5F94A 4F08A 1IA9A 5DT3A 4CXAA 3OTVA 2IZSA 3AC1A 1QPJA 3QQUA 3TL8A 1T45A 3SDJA 4WNOA 3UNJA 3BEGA 3QHRA 4BDGA 3ZO2A 3UNKA 2BZJA 3D4QA 4BDFA 5EI2A 4TW9A 4ANMA 5EDRA 4AQCA 2J0JA 4YJUA 4FTIA 4RIYA 4BYIA 4E5AX 4JDHA 2JDOA 2WQOA 4AW2A 2VO6A 1Z9XA 5L8JA 1KV1A 3H9OA 2V7OA 3BYSA 3HDNA 3PIXA 3S00A 3PXYA 4TNDA 2KTYA 4PP7A 5C27A 4M13A 4RFYA 3N4TA 1IASA 1UVRA 1IEPA 2W1GA 4FI1A 3R8ZA 3IW4A 5CSPA 3C4WA 5EHOA 4KAOA 2ONLA 4XX9A 3DDQA 2IPXA 4GG5A 3CGOA 3CD3A 1BMKA 2FSLX 3RK5A 4BZOA 2CLXA 4B7TA 4FOCA 5ANJA 2C1BA 5EM7A 2C1AA 3V5TA 3AMBA 3CTQA 3F66A 3O2MA 3SXSA 4ZLOA 2HENA 4HZSA 4ACGA 5IA2A 4MHAA 4U80A 3FLQA 3IKAA 1REJA 5TE0A 3T8OA 1CKJA 2C6KA 1QL6A 4DGNA 3DAKA 5B7VA 4RRVA 4WIHA 4BF2A 4F6WA 4CCUA 5AUZA 1Q8UA 3GU6A 1SM2A 5HICA 2X9EA 1WBPA 1ZZ2A 3EN4A 3HYHA 5E91A 1NVSA 4GK4A 3D5XA 3MPTA 4FIJA 4UV0A 3ZLXA 3ZONA 5LVOA 3SVVA 4JBQA 3SC1A 4QYYA 3C4XA 3PSBA 1RJBA 1SYKA 5FEEA 2QOBA 3E62A 3FMEA 4AWIA 4DEBA 4ZJJA 3TDVA 2WTDA 4RQKA 5AUUA 2Z8CA 3FZTA 3L1SA 4FIIA 2IWIA 1WBOA 1GAGA 3RNIA 4L3LA 1A06A 1HOWA 4FV0A 4QMVA 3OP5A 3R63A 3V8SA 3R28A 3DXPA 4RIXB 4F1TA 5IF1A 3LJ0A 3EQGA 5JFVA 4QP2A 1YI6A 3F88A 4OTIA 2GS6A 3EYGA 2CGXA 1P4FA 5AV0A 3BBWA 4EZ3A 3O50A 1Y57A 4RGJA 1Q61A 4D28A 3NGAA 4FF8A 5HG5A 4F9WA 3LFSA 3WZEA 5IQFA 1Q8ZA 4AN9A 4FEXA 1XH9A 3BCEA 3VF8A 4IX4A 3FPQA 4IADA 3MI9A 3KMUA 3O8TA 4QQCA 3RPOA 3L8VA 5ETIA 3POZA 4LGGA 1ZY5A 4IH8A 4ACDA 4KIOA 1UKHA 2QG7A 5CF6A 4O7WA 3COMA 4DF3A 2WMRA 4EJNA 2Z7LA 2GQRA 5DT4A 1YDTE 2WFYA 3MPAA 3DBDA 5AV4A 2C69A 4YZCA 3I4BA 4YJTA 3ULIA 4EI4A 1NVQA 1OL1A 2OIBA 5LVNA 5KMJA 1AD5A 1JKLA 1GIJA 3NW6A 5ACBC 4UN0C 5TO8A 4K18A 2XNEA 4IVBA 5ANEA 3ZS5A 4WSQA 5FM3A 3R7OA 5KMLA 2ZAZA 5M08A 4HPTE 3FZRA 3MA6A 3LAUA 5CEMA 4U97A 3DKFA 4R3CA 4R7BA 1OGUA 2ITNA 2X2MA 3DK6A 4FIHA 4Y8DA 5LMBA 5AFVA 2UVXA 2ZDUA 5H3QA 4QYGA 3RCDA 1H4LA 5J1VA 2Y7JA 3GP0A 2W0JA 4U40A 3SHEA 3VUDA 3I0OA 4I92A 5HLNA 2O63A 2XMYA 3EQFA 4KA3A 3ZDIA 5CVHA 3DFAA 3QZHA 1EH4A 3ORIA 4RBLA 5H9BA 5J7BA 3FLZA 5CASA 2H6DA 2QONA 3NCZA 4MBLA 3EL7A 2CKEA 3JUHA 4JBOA 4V01A 3TI1A 1Z57A 2XKEA 4WOVA 4BCHA 5EI8A 3BHUA 1JOWB 3KB7A 3OVVA 3I5NA 4IMYA 5FQDC 4HVDA 5CS6A 3UZRA 4C4EA 1OBGA 3ID6C 3KL8A 1WVXA 2JDSA 3ZC6A 4P90A 3FXXA 4MNEA 4WUAA 2JDRA 5DEYA 4FODA 1WMKA 2UZVA 3IW5A 3LQ8A 4FSRA 5D7AA 5AP6A 4EWHA 4OTPA 2PVFA 1YKRA 4LL5A 4KSQA 4V0GB 3VS0A 2C6TA 3EWHA 3OEFX 5DI1A 5C26A 5JFWA 2GHGA 3NW7A 3O7LB 5JKGA 4W4WA 1M2QA 4H36A 3BYMA 3HUCA 5DNRA 3ZXTA 1B39A 2WQEA 5AR5A 3ZM9A 1YXSA 2KULA 5M55A 5BYZA 3PXZA 5CAOA 4PTEA 3IW7A 2GNFA 4WSYA 5CALA 4J8MA 5DR2A 1ZZLA 4CLIA 2CGVA 2QR7A 3LIJA 3OTUA 3QZIA 4YBKA 4CYJA 4RX5A 1GY3A 4ORKA 3LQ3A 3FMNA 2Y9QA 3NZ0A 3PA3A 3UP7A 5CU0A 3KULA 4H05A 1BYGA 4CYIA 5T3QA 2OBJA 4JNWA 4BBEA 2QKRA 2JDTA 2JEDA 3R1YA 4OGRA 5EW3A 4AX8A 5FBNC 3TZ8A 2UW3A 4NH1A 2UZBA 4KRDA 3QQHA 1IA8A 2YIXA 4GL9A 5ACKA 4D58A 4D9TA 4TYHA 5FWKK 1WVWA 2XJ2A 3DNDA 3MV5A 3OUKA 3V8TA 2IVVA 4DC2A 2R0IA 3OCSA 4GJ3A 5CSHA 4NTSA 3E63A 5JQ8A 4V0GA 2C3JA 4R5YA 4BI1A 1YXTA 2RFSA 4DGLC 1QCFA 2ERKA 3NW5A 3JS2A 2AC5A 3NYOA 4FT3A 3HUBA 4OR5A 1OIRA 4AN3A 2WELA 5D11A 3ZMMA 5M09A 3WI6A 2R3OA 5EW9A 3TNQB 3BLRA 4K77A 4NM0A 2P33A 4ZTNA 3V5PA 3SG9A 3A62A 4J53A 4D2TA 3ERKA 1H00A 2GS7A 3FI3A 4ZJVA 4Z16A 4O0UA 4D9UA 4L45A 2Q0NA 4CRSA 4WHZA 3MVLA 2VWUA 3V5QA 2R4BA 4DEAA 1VJYA 3AC2A 4M8TA 4JX3A 5HIEA 4GFGA 1TKIA 4BY9E 3PRFA 2XM8A 2CJMA 3JVSA 4FKUA 3A7IA 5DR9A 4D2VA 4FUXA 2HCKA 4EBWA 1PRYA 3G33A 3ZEWA 2P3GX 2HW7A 4TYJA 4X6RA 4O7TA 4FZ6A 2R3RA 4CZYB 3KXZA 2YA9A 3TV4A 2VTPA 3ANRA 5IH6A 3L8XA 1OB3A 2CN5A 4F1OA 3BE2A 3TWJA 3LFAA 3C0IA 4ZS4A 4AOIA 4DH3A 1NA7A 3QC9A 3C7QA 2CLQA 3CJGA 5EM8A 4IWDA 3R8MA 1BI8A 5LVPA 2HZ4A 4TXCA 2W9ZB 4J52A 4F9CA 2BRGA 3IW6A 4DITA 2YIYA 3OZ6A 4IIRA 4BL1A 4FTJA 5IDPA 5HG9A 4QMWA 3W18A 4M12A 2IJMA 2F7EE 3K3JA 2OJ9A 3I0QA 3PZEA 3VHEA 4X2FA 2XH5A 3C0HA 3KFAA 1PXIA 4F1MA 4DTAA 2PZYA 1YVJA 2VTOA 4WNMA 2DQ7X 3G6GA 4IC8A 3PSCA 3KCKA 4FL3A 4B8MA 4F6SA 2PZRA 3ZSHA 5BVWA 4ZLYA 1BI7A 2X0GA 3DOGA 1WBNA 3RBWA 4EUUA 4N6YA 5AMNA 2B7AA 4AGUA 3R9RA 4CKIA 1FPUA 2EXMA 1ZAOA 3LFCA 5AJQA 4D2WA 3KVWA 2BDJA 5EYDA 5I9VA 3V8WA 5IEXA 4E20A 3KY2A 3LVPA 1P4OA 4EH9A 3NR9A 4C2VA 4ZTHA 2UW5A 2G2IA 3GC0A 5TT7A 4HPUE 1X8BA 3LJ2A 4RVTA 5FG8A 3BQRA 3WF7A 2PWLA 4CFVA 3IO7A 2J0IA 5HLWA 4L8MA 4RWJA 2JIVA 2X2LA 2XUUA 4EOMA 5ETCA 3UGCA 4E4LA 3ET7A 5CAPA 4CFUA 2YEXA 3H30A 4G3FA 4M66A 5TF9A 5DA3A 3FZPA 3GUBA 4F99A 2OKRA 4RZWA 2OF4A 3UYSA 4BCIA 2W1CA 5ETAA 3RP9A 4ID7A 4F0FA 4A4LA 2HAKA 4JR3A 5A4QA 4GKIA 5CNOA 4GFOA 1XQZA 2X4FA 5CZIA 4DG2E 3G15A 2PVLA 2P55A 3BGQA 3R1QA 3K54A 4ENYA 5D12A 5CVFA 2B1PA 4XP0A 1LUFA 2OJFE 3QFVA 5FUTA 2ETMA 3SOAA 4XMOA 4Y83A 5CT7A 3DAEA 4IB5A 3F6XA 3FQHA 3MVJA 3COHA 4MEDA 4QMOA 3ZSGA 4ANSA 1Y6AA 4USFA 3QZFA 4MQ1A 4E4XA 2F7ZE 2ESMA 2R3HA 3I81A 3SV0A 4ANQA 2X2KA 4CV9A 2UW6A 5AUXA 5E8VA 4FV3A 4MXYA 5HD4A 3QTQA 4YHJA 3F69A 4XG9A 3RINA 3VUHA 3QRTA 5C8MA 3T9TA 5AIKA 4BCJA 4J1RA 4C38A 4JQ7A 2EB2A 4M68A 4EHZA 5GINE 4Q5HA 4GS6A 5DRDA 4A9YA 4HVIA 3H3CA 3HZTA 1JLUE 4BWXA 2BKKA 3TNWA 2BCJA 3OFMA 4Z55A 2YM3A 1JAMA 3FL4A 2OI4X 2VTNA 4G3CA 4GVAA 3ZCLA 1ZRZA 1I09A 2YM8A 3TIZA 4GYGA 4OTFA 4FTTA 2ZM4A 4N4SA 4J98A 3SX9A 4ALUA 3HX4A 4WBBB 3HMOA 3ZRLA 3W8QA 5L2IA 3HDMA 4HW7A 1QPDA 4FNWA 4OBPA 3HV4A 1KE9A 4EQUA 3EN5A 3AD5A 5M4IA 4G9CA 3UQCA 3UE4A 1XJDA 2XEYA 4AE9A 5IQGA 4JQEA 3ORPA 3KVXA 3QTSA 3ETAA 1J1BA 2WMUA 1XH8A 2W5BA 4FSZA 2ZJWA 5HO6A 4AGWA 5A14A 4BKZA 3LMHA 5CQWA 5M53A 3PP0A 2NPQA 3VW8A 4RIWB 5IMEA 1V0BA 3JPVA 1Q3DA 3KK9A 1R1WA 1YXUA 3PZHA 3QD0A 3QQLA 4XV9A 4ZOGA 4XRJA 5AX9A 2QG5A 3W55A 3LFQA 3BHTA 4EK5A 3EN7A 2WMSA 2XRUA 4O0WA 3VN9A 3LXKA 4HOKA 3NAXA 4RSSA 5CU3A 5D7VA 2Z02A 4FSUA 4TTHB 4RJ7A 5M57A 4JVGA 3O8PA 3D2KA 4DGOA 4KABA 2VTTA 1DAYA 5I3RA 3VC4A 2W1EA 4XLVA 4YUQA 2XNGA 2PVYA 3HA8A 3O0GA 5A9UA 1H07A 4PP9A 1KOBA 3FLNC 4I0SA 5IA5A 4B6LA 4IB0A 4B0GA 2ZM1A 4CEGA 1YW2A 2BMCA 3AXWA 3QUDA 4NFMA 4DTKA 4EK8A 4Y85A 3DK7A 5AAGA 4PUZA 3DA6A 2OJJA 3I5ZA 3OUNB 4B8LA 3UO5A 2R3NA 3R73A 4QTAA 2PUNA 1FMKA 4LGHA 3W32A 2JC6A 4AS0A 1AQ1A 1FINA 2GNLA 2X8EA 4AZVA 3UIXA 4BIBA 4DYMA 3ENMA 3AC5A 4MXZA 4FYOA 4O6LA 3W8LA 1ZOHA 1S9IA 2UV2A 4P4CA 3I6WA 2BAJA 4OTRA 2VWZA 3VJNA 3EQBA 3MH2A 4D4SA 4ZLZA 3EMGA 2R7BA 2XF0A 3L8PA 2G9XA 4GJ2A 2B54A 4ANLA 2P4IA 3QXOA 2Z7QA 4YPSA 3GC8A 3E3BX 1JKSA 4IE9A 4JIKA 4W4XA 4QQJA 4BBMA 4C37A 3UC3A 4EHEA 5KNJA 1H01A 2FGIA 5DWRA 2Y4PA 5H8BA 1UKIA 3D5UA 3AC4A 3F2NA 4L6QA 3EOCA 3A2CA 3DFCB 5A6OA 1P5EA 3HRFA 2PVJA 4R3RA 5H8GA 5EKNA 3BV3A 4BCFA 2QLUA 5B2KA 5LMKC 4FVQA 4MD9E 2J6MA 1H1RA 2ZV8A 4IQ6A 4ARKA 2QQ7A 4NTTA 4X3FC 5C1QB 2ZDTA 5EQPA 5LVMA 3FEGA 2O3PA 5HBEA 1TQMA 2BILB 2YABA 3QKKA 4NWMA 4FV4A 5FTOA 1FMOE 1MP8A 3UO6A 4B99A 4PF4A 1LEZA 4A4OA 4PRJA 2ITTA 3CTHA 4TKSA 1OM1A 2BFYA 2RF9A 2ZYBA 1R39A 3FMHA 4KWPA 4ONAA 3LOKA 3E5AA 3GC9A 4II5A 1OECA 1QMZA 2XK6A 3FMLA 3FPMA 3OD6X 4FYNA 4B9DA 3MTLA 4CNHA 4JIAA 4DFLA 5AEPA 3CSVA 2PL0A 5JK3A 4FT7A 3BHHA 4ZJIA 2UZTA 4BCOA 4FKSA 4D2SA 3EFKA 2UZOA 3EKKA 2J4ZA 4PPCA 3FZSA 5L2SA 4YLJA 3R01A 4QTDA 2PUIA 4RJ4A 4BIDA 3PY0A 3VHKA 1PXOA 2W1ZA 1OI9A 3PUPA 4ALVA 4O7LA 1NT2A 2VTAA 1SVGA 2XS0A 1W8CA 3QUPA 3WF9A 2B0QA 4FEUA 3D7TB 4BI2A 3MSSA 3UODA 4ZMEA 2UZWE 4BC6A 3GI3A 3I7CA 4NW6A 5E1SA 3MH3A 4F6UA 3Q9WA 4O2ZA 3V01A 2BDWA 3VS4A 3LLAA 4G6NA 3E88A 3QTZA 4QP3A 4JOAA 3C4CA 2CHLA 4QMLA 5I9ZA 1GIHA 3MH1A 4MKCA 5I9XA 2G2FA 3OBGA 4CQEA 1J7IA 4ACMA 4N70A 2VTRA 4AZWA 4CT1A 3Q96A 4ZTRA 4F70A 2RGPA 1W0XC 2Y4IB 3WYYA 1BL6A 1ZXEA 3O96A 4YZMA 1O6LA 2A4LA 4YC3A 1RDQE 2BAQA 5CF8A 4IDVA 2R7IA 5HGIA 3FV8A 5HNBA 3FKLA 4C59A 5CAVA 3SD0A 5EOBA 3H0ZA 3VUTA 4AGDA 4EUTA 5M4UA 2W4KA 2FO0A 3M1SA 3ACJA 3Q6WA 3RAWA 3QX2A 2E9UA 2OF2A 2GMXA 3PA5A 4AXAA 4C4IA 3SW7A 3FAAA 2J51A 3QD4A 5KZIA 2ITOA 3TKIA 3QXPA 3KN6A 2ZV2A 4XUFA 2ACXA 2WQBA 4E73A 3N4UA 5EYKA 4GU6A 1Q8TA 3NEWA 3R7VA 4ZIMA 3W2QA 5ICPA 2YCSA 5HVKA 3ZC5A 1UNGA 4UWYA 2R0UA 3L9LA 4WT6A 5EOLA 5HX6A 3L9MA 4CV8A 4I5HA 2VNWA 4AP7A 1V0OA 2W4JA 3NUSA 3AGLA 4IAYA 2VZ6A 3DAJA 4TPTA 2JBOA 2X7GA 4FSMA 3Q32A 2YM5A 1ZYSA 1ZLTA 3QA0A 4PPBA 3NNVA 4FK3A 4EONA 4GKHA 4GIHA 4FC0A 4XP2A 4YGAA 5J9LA 4KIKB 4RVKA 4FSTA 5BX0A 5AR4A 1Y6BA 3UP2A 3PYYA 2J0LA 5CNNA 1U46A 3GCVA 3E93A 1IAJA 1JWHA 2QOHA 2XNBA 1OIYA 3ORNA 2J0KA 3PE2A 4I41A 4M7IA 4R3PA 5HU3A 2BROA 4IX6A 4XP3A 5BQ0A 3I79A 5DE2A 4JBPA 3NYVA 3ORMA 3QRKA 5DG5A 2PPQA 2FA2A 3D14A 1YOJA 4HGEA 4GEOA 4IVCA 5JRQA 2R3JA 3Q4CA 4L7SA 4YNEA 4A07A 4RIYB 1H1SA 3R8VA 5L8LA 4ASEA 4CG9A 1PKGA 3CLYA 2IZTA 1KE8A 4BGHA 1H28A 5I5ZA 3NUYA 4K33A 2ETRA 3CP9A 4PY1A 5AM6A 5AP7A 2B9FA 4DEEA 4YTIA 4EOIA 2GDOA 3TT0A 3FI4A 5CEKA 4MXCA 4O27B 5J9YA 1ZYLA 2C0IA 2G01A 2GNIA 4XCUA 3OOGA 3S95A 1SVEA 4ANNA 3EKNA 2IG7A 3PVBA 3DJ5A 4RG0A 2JKOA 4YTCA 4PTGA 3MBLA 4K1BA 2W1IA 3WOWA 3P78A 5M56A 5FRIA 2IW6A 3RPSA 4D4RA 2HZIA 5CEOA 5BUIA 3ZTXA 4QMNA 4Z3VA 3Q3BA 1P2AA 5GIPE 3DB6A 3H4JA 4YPDA 4I3ZA 3TNHA 5I9YA 3V5JA 5FP6A 5J5TA 2WMXA 4PDOA 3BQCA 5L2QA 1OKVA 4TWPA 4KD1A 4U7ZA 5F95A 3R04A 3NNXA 1PKDA 4DCEA 4TL0A 4IBMA 4IC7A 3FI8A 3JVRA 4FT9A 4IZ5A 3RJCA 1YRPA 3POOA 3PSDA 4FTOA 4X2GA 3MWUA 5EQEA 2QOKA 3U6IA 5IUGA 5GZ9A 1PMNA 2UW8A 1H1QA 3Q9YA 2W4OA 4JQ8A 5HNGA 1Q8YA 3R1NA 3EQPA 2ITZA 4YO4A 4Z9LA 4Q5EA 2J90A 5ANIA 4ZSAA 2C5VA 3QQGA 4I93A 4JAJA 3W2OA 4EC9A 1OZ1A 2J5EA 4ZP5A 5HE2A 4PMPA 2VWYA 3MY5A 4G31A 4O86A 3SLSA 5ANKA 3PTGA 2FSMX 4BHZA 1XH5A 3VBXA 3VJOA 2IO6A 3KRXA 4U5JA 1FOTA 1JSTA 1YHSA 3OEZA 3R02A 4BIEA 3Q4UA 4AT5A 5M44A 1KUTA 2CNUA 1MRYA 2VGOA 4DFBA 3U6HA 1GZ8A 2C6DA 2R3MA 3UOKA 4RX9A 3FL5A 3HRCA 3ITZA 5ITAA 3R9NA 3W1FA 3HP2A 4L42A 4HJOA 4O96A 3RTPA 4FVRA 1OUKA
chains in the Genus database with same CATH superfamily
3E7VA 3G9LX 2AQXA 4FIFA 3WIKA 5E8ZA 3R9OA 4IX3A 3R7YA 2XP2A 2XARA 2X39A 3ENHA 4MD8E 1S9JA 3EIDA 2CN8A 1J7UA 4EH4A 3DLSA 3AMAA 3QTIA 3NUXA 3VF9A 3QALE 3S4QA 3VAPA 5A4LA 2XYUA 5CTPA 3KGAA 3M42A 3BLHA 3ZUVA 3S1HA 3HMIA 4IZ7A 4E8AA 1Y91A 3IG7A 2UZNA 5LVLA 4I23A 5EHLA 2W06A 4FICA 1BL7A 2C6MA 4UMUA 3OWLA 4DINA 5IZFA 3NNWA 3KXHA 3BU6A 4FG7A 5J87A 4HYHA 2EWAA 5D9HA 3PPJA 5KMKA 2Z7RA 1F0QA 3VUIA 2RG6A 4G16A 3QHWA 4ACHA 4IM3A 3PXFA 4EOLA 3NYXA 2VWVA 3QD3A 2RIOA 2YCQA 3TACA 3LMGA 3ZSIA 1XMMA 5HTBA 4LDTA 4MUQA 1JQHA 4MXOA 3UVPA 3DQWA 1PJKA 3IGOA 2VWIA 5T6KA 3B8RA 4RWLA 2ITYA 4TN6A 2DWBA 4U3ZA 2GFCA 4F7LA 5L6OA 5LMKA 4O84A 4DBNA 2BKZA 1FVVA 4BR3A 3P86A 2YZLA 4C62A 3FLWA 4JXFA 3E87A 4QMYA 3KEXA 4AF3A 3F2RA 2VTLA 4HCVA 3G9NA 5C4KA 3FC2A 4EK6A 3KXNA 3U4UA 3QYZA 2GSFA 4L01A 3SRVB 3GCQA 4KIPA 4G3GA 5IQIA 3L9PA 5DRBA 5GJFA 3EFJA 3R2BA 4FSWA 3D0EA 3C4FA 3RNYA 1KSWA 4XV2A 3ZXZA 4IVAA 5IA4A 3ODYX 3Q2JA 4FG8A 4RZVA 2WTKC 2GQGA 2PSQA 3CCNA 2BR1A 3H10A 4I6HA 4IB1A 2X81A 4YZDA 5CY3A 3TJCA 3W0SA 1REKA 4UZDA 3L8SA 3W33A 5C8KA 4DT9A 3KXGA 5A6NA 4P7EA 4EOOA 1HCKA 4F9AA 3NVKI 5KHWA 2YLEA 2WTVA 2GNGA 1H8FA 5CVGA 2YM4A 3ROYA 4MNEB 4DFUA 3DNEA 4ZEGA 4AFJA 2PMNX 2JD5A 3OT8A 4G2FA 3HECA 4NK9A 3VRZA 1M2PA 3K2LA 3G51A 1XR1A 1LEWA 5AUYA 4U6RA 4UMPA 2EU9A 4RLKA 5FTGA 5HVJA 3GOPA 4EH6A 5J5SA 2BZKB 4BCPA 3P4KA 3QX4A 3ZLYA 2OFUA 4M3QA 2QURA 4OLIA 5HBHA 1H0VA 3TV7A 4RJ8A 3TTIA 3NAYA 3TZ9A 2QLQA 2QOLA 1BUHA 4IW0A 4M67A 2W5HA 2QC6A 1E1VA 2ZB0A 1G8SA 2AUHA 3OXIA 4O6EA 1V1KA 3SRVA 4UZHA 2AYPA 4AXDA 3KULB 4MVFA 3VIDA 2GTNA 4EH2A 4FKVA 3UBDA 1CTPE 3MYGA 4UX9A 5HG7A 3ALOA 4PMTA 1YWRA 4S30A 3PJ1A 4I24A 4D0WA 3VRYA 4CZTA 4LMNA 4FKRA 3BGPA 5KKRB 2YDKA 1PXJA 3TMOA 4FZAB 4LOPA 2HK5A 3VBWA 4DH1A 5I9WA 4C33A 4I4FA 2XRWA 3BPRA 4ZSGA 2PZIA 2VWBA 2A0CX 3TNPC 3I6UA 3OWJA 4FV9A 4BCNA 4F4PA 4J99A 1UU7A 4TYHB 3VUMA 4O0RA 5KMMA 2O5KA 3DTWA 4AZFA 4I1ZA 4FEWA 2QD9A 2UVZA 4OT6A 4FKPA 1W84A 3NIEA 2P2HA 4RA4A 3R9DA 3RCJA 3NRMA 4DLIA 5IA0A 2C6IA 4C35A 1WBVA 1WFCA 1HCLA 4LV8A 4XLIA 4NJDA 4UWBA 3F3UA 3AC8A 3MB6A 4DFNA 2QHNA 3IDBA 3KF4A 4KBAA 4FEQA 2YISA 4WG4A 3O71A 3FWQA 3AGMA 4OTHA 4TYGA 3H9FA 2RKUA 2VD5A 4ZZMA 3UDZA 4G1WA 4I4EA 1STCE 3HV5A 3CQEA 4KKHA 3BLAA 3LCTA 3V5WA 5JGBA 4EJ7A 4QMZA 4C02A 2JKKA 2Z7SA 2NNWB 2ITVA 3ZLSA 1WBSA 2EXCX 1URCA 2IVSA 3MA3A 3QGYA 2XB7A 4RC2A 5HU9A 3O51A 3E64A 3LM5A 5HNIX 3WF5A 5IQHA 3HKOA 4PL4A 4AAAA 4QDVA 3R7UA 1FBNA 1SNUA 3RMFA 3ORZA 4L67A 1M7NA 4IJPA 3N51A 3FE3A 3WZKA 1JKKA 3RHKA 3EZRA 4RFZA 3GQIA 3DPKA 3RAHA 3FLYA 3TV6A 4BKYA 2F49A 5BVNA 2XK3A 5CX9A 1W98A 3MS9A 3UPXA 4QOXA 3BRBA 3UMWA 4UYNA 4ZY5A 5AA8A 1IG1A 4JDIA 4R78A 4G34A 4U44A 4G6OA 1PMUA 4AW5A 3ZEPA 3HA6A 2JIUA 4RVMA 3RI1A 3UOHA 3UTOA 3QCYA 5L8KA 5HD7A 4G9RA 2IVTA 4FKJA 2UW0A 5DBXA 1F3MC 1OIUA 3G90X 4LOOA 2X0PA 2BFXA 4NEUA 4RWKA 2JAMA 4X2JA 3DKOA 4WD5A 3ZFMA 4F7NA 1YHVA 3MFTA 4YU2A 1KV2A 5JRSA 1KE5A 5BPYA 3U55A 1PXKA 3CEKA 5HE1A 4D1XA 4UWCA 3MESA 2NRYA 4MBIA 5FBOA 3GU8A 4AZSA 2RFEA 1SVHA 4U41A 3E8CA 4I0TA 4BTKA 2B9HA 4DHJA 4KKGA 5LWNA 1FQ1B 2P2IA 1XMLA 4I5CA 5JFXA 3Q9XA 4FL1A 2OXXA 5DN3A 3GBZA 1WZYA 5E8WA 4BB4A 4LRMA 1OPKA 3ZYAA 3PFQA 2WOTA 3F2AA 3ELJA 3CGFA 4DFYA 5CF4A 4O0VA 4A9UA 1XBCA 1ZWSA 2BRMA 3E8DA 3V51A 4J7BA 3K3IA 5K3YA 4LRKA 2IZUA 4L46A 4XV3A 1NXKA 5FXRA 3IGGA 3QC4A 5GNKA 3RM6A 2QI8A 4IAZA 3ROCA 5IISA 3WYXA 4YR8A 2I0YA 2VO3A 3MGYA 5DGZA 2YWPA 4U8ZA 5M4CA 5A4EA 1FVRA 2W17A 4BZDA 4DEIA 4DBXA 3FY0A 4R7HA 4O7YA 3VS6A 3KXXA 3PY3A 2C5OA 3PVWA 1DI9A 2O8YA 4RA5A 4PL5A 5BUEA 3ATTA 2HZ0A 3R83A 4ITHA 2JLDA 1ERKA 1OL7A 4U0IA 5FD2A 4LFIA 4Q2AA 4O1OA 5AWMA 2HY81 1OL2A 5D41A 4H3PA 2QR8A 2OXYA 4O7RA 4JG6A 3ZZEA 4CTCA 3LM0A 2OO8X 3RVGA 3KMWA 4WBOA 4L43A 2ITUA 2XVDA 4O22A 4ZSEA 4QMXA 3GU4A 3OWPA 4E3CA 3G0FA 4V05A 4I94A 2WZJA 4RLLA 4JR7A 2ZOQA 4FNZA 3RWQA 2OLCA 2IEWA 5CSWA 3UZPA 4O7SA 3VVHA 2OZAA 4YJRA 4OTDA 5EFQA 4EWQA 5AAEA 4BJJB 4MX9A 2XAMA 1Q97A 4FIGA 4ZTMA 4MCVA 1UV5A 3T3UA 2XK4A 4YO6A 5CLPA 5AUWA 3VBYA 1GZKA 1Q24A 3DBEA 2UW4A 3TN8A 2JKMA 2CCHA 4BDKA 3MB7A 3LMIA 5E8SA 5IH5A 2RFDA 3KKVA 2FSOX 3R30A 4BGQA 4EOKA 3VBTA 5KX8A 4FSYA 4PDYA 3HV3A 3ZO4A 4C8BA 1UNHA 4G3EA 2VX0A 3R22A 4QT1A 4O81A 2V0DA 4GG7A 4QMUA 4W9XA 4RC3A 4YHTA 5HCYA 4QTCA 3RAIA 4OAVB 5EW8A 4RIOA 1XH4A 2XCKA 4KINA 5CSXA 4D0XA 2REIA 1VYZA 4ZTQA 3VQHA 3F5PA 3F5GA 4CMOA 3N9XA 3ZLWA 2HXLA 5HCXA 1PY5A 4DA5A 3DTCA 4W9WA 4D55A 3AT2A 3O8UA 2VX1A 3RZFA 3MFSA 2OIQA 4Y95A 4AG8A 2HXQA 4TT7A 1H27A 2OH0E 4GYIA 4OT5A 4A9SA 3PJCA 4TNBA 4EBVA 3D5WA 4FIEA 5C8NA 1NW1A 1KE7A 1T46A 4QP9A 4BCMA 3NS9A 4DN5A 3PG1A 2OJIA 4AU8A 2B9JA 1TQPA 2O64A 3C9WA 4RT7A 4AZEA 4BTMA 2C68A 3D94A 1LP4A 3FQEA 2PMIA 4TWOA 4D2PA 5J7HA 5M07A 4CG8A 3OCGA 3QRJA 3QQFA 2HELA 3HV6A 3OY3A 4AA0A 5KBQA 5IG1A 2PULA 4L9IA 3SGCA 4MXXA 2BALA 4KB8A 4O0XA 2WEVA 3PWDA 4C61A 3UDSA 1Q3WA 4CFWA 4FT5A 3U8WA 2IVUA 3DK3A 4BDEA 2XNOA 4MYGA 2VV9A 2R9SA 3PPKA 4UMTA 2YCRA 3W2SA 5IEYA 1VYWA 3EFLA 5E4HA 3HVCA 2DUVA 3OHTA 2HY0A 3EN6A 1V0PA 2YIWA 5DPVA 4O82A 3FHRA 5HZNA 3CC6A 4S33A 2CNVA 4F09A 4F78A 3KN5A 3QCQA 2XIKA 5FLFA 1MRVA 5A4TA 3EN9A 4FKGA 3MFUA 2R5TA 2YAAA 4WUNA 4BHNA 2OK1A 4K9YA 4A4XA 4IB3A 2PVHA 2QOFA 4PDPA 3AMYA 4J96A 5DH3A 3ZU7A 4DG0E 3W0OA 4GH2A 3GOKA 5CI7A 1VEBA 3W2RA 4EQCA 4E93A 4BTJA 5KMOA 2PVKA 4RQVA 4AW1A 3F9NA 3KA0A 3EQRA 3OMVA 5EDPA 5KUPA 2PE0A 2WIHA 3QWKA 4YMJA 4E4NA 3KREA 5ANOA 3CIKA 5EYMA 2JKQA 3R8UA 2WOUA 1G8KA 2Z60A 3DDPA 2PMLX 4FSNA 1OUYA 4DAWA 4N6ZA 4XEYA 4XS2A 4KNBA 3LCOA 4PV0A 3VBVA 2B52A 4J8NA 3NWWA 5DVRA 2OG8A 3KC3A 4CKRA 3B8QA 3RPVA 5AADA 1O6KA 2XYNA 3IECA 4BKJA 3GB2A 2R2PA 4AAYA 1M52A 4QQTA 4QP6A 5DYJA 4FV7A 3WBLA 3DKGA 1DM2A 3DGKA 4V04A 3NLBA 5H2UA 3ULZA 4M84A 4QPMA 3LCSA 3R2YA 4JRVA 4CFFA 4MQ2A 2I0EA 4XYFA 3C50A 3PE1A 2A19B 2Q0BA 4CFMA 4USEA 4DE4A 3DCVA 4I20A 4FKQA 3OBJA 4QP4A 3TG1A 1Q99A 4K6ZA 4FBXA 4X3JA 2R3GA 4E6AA 3COKA 3EB0A 2B53A 3UG2A 2XZSA 1YXXA 2CDZA 2PTKA 3P7BA 4EK4A 1W82A 4EZ5A 2BIKB 4EZ7A 1UU3A 5G6VA 2X7OA 3CBLA 5IKWA 4KKEA 4PL3A 3SKCA 5JH6A 3FJQE 5KO1A 3QZGA 2CGUA 3KU2A 4YC8A 1H08A 5DR6A 4IM0A 4Y73A 4QMQA 5AR8A 4EKKA 2YFXA 4YSMA 2OICA 2W7XA 4DTBA 3QTUA 2ZMCA 3MVMA 4UBAA 4QMMA 2E9VA 3PJ3A 4EH7A 2Y6MA 4FRFA 3HL7A 3NSZA 3TUDA 3ZRKA 1W7HA 4NL0A 3DU8A 3H9RA 3BX5A 5M4FA 4EHGA 4J97A 3V6RA 3A61A 4K2RA 1U54B 4M69B 4FK6A 2QNJA 4FZ7A 5CEQA 5CANA 4IDTA 4Q9SA 2C47A 2VTIA 3SXFA 5BYLA 3Q5IA 4KS8A 1UU9A 2J9MA 3ACKA 1ZMVA 4G5PA 3NFFB 2QO9A 5EK7A 1XKKA 4GV1A 4RX8A 2G1TA 3UYTA 4P5QA 1UNLA 4AW0A 2VNYA 2CMWA 4O0TA 5AIRA 4GMYA 1DI8A 3QAME 3MFRA 3QKMA 5K0KA 4FTKA 3GFWA 3QL8A 4BCKA 3AT3A 1O9UA 2R3PA 3CS9A 3DB8A 3MVHA 3MY1A 4NCTC 4OW8A 4C57A 3IOKA 3Q6UA 4EOJA 4HVHA 4ZZOA 3BU3A 3GGFA 3RGFA 2WMTA 1O6YA 4HVGA 3VS3A 4S2ZA 4LGDA 1Q41A 3VS2A 3A8WA 4MWHA 5K4IA 4B4LA 3I1AA 2X6EA 5J79A 4ASZA 2WNTA 4C2WA 5DOSA 1LR4A 3DBFA 2J50A 5HQ0A 3KRLA 5AV2A 1U54A 4M69A 4UYAA 1WCCA 4WNPA 2WIPA 4G6LA 5IDNA 1TZDA 3HGKA 3PLSA 4FL2A 3RZBA 2A1AB 4L44A 3HV7A 2XNMA 5CWZA 3ORXA 2BIYA 4QTBA 2Y0AA 3FUPA 3MW1A 4CFXA 3NNUA 3RPYA 2WEIA 3F3VA 5IQDA 1M14A 2YAKA 4MK0A 2JFLA 4ALWA 4R1VA 3WE8A 1RQQA 3ANQA 3PA4A 2NO3A 3ZO1A 2HWPA 4C4GA 2EVAA 2GS2A 3I60A 4MXAA 2PK9A 4IAIA 5HLPA 3R8PA 2FB8A 3VULA 2XIRA 2YJSA 4GT4A 4ITIA 3DBCA 2V55A 4GT5A 3RK7A 4QQ5A 2AC3A 1URWA 2JAVA 4DCAA 3D15A 4YJSA 3C5IA 3Q2MA 2FYSA 2UW9A 3U51A 3R0TA 1UWJA 1GZOA 4F9YA 4E6DA 4KUJA 4JDKA 4QTEA 2RL5A 1OVEA 2VGPA 5D10A 3OCTA 3SQQA 4OTGA 4JI9A 2ZM3A 2V5QA 2W1FA 4N0SA 3NCGA 4F65A 4HNFA 2PVMA 3UG1A 4AUAA 2C4GA 5JMSA 3QCSA 5GJDA 1G3NA 4PDSA 4FTMA 3KF7A 3CQUA 2YDIA 4EOQA 2W5AA 2JBPA 3FY2A 4GRBA 4O4CA 2E2BA 4A7CA 1M17A 3FMDA 5L6WL 4KBKA 4QNYA 3PWYA 4YHFA 3IS5A 4C3PA 2PE1A 4O38A 5DT0A 3VONA 1L3RE 3IONA 4EL9A 4AXEA 5B2LA 5I4NA 4JL9A 3ATSA 3UPZA 2DS1A 3AQVA 5TR6A 1JSVA 5CAQA 4HCTA 3LCDA 4ERWA 2ZMDA 5FEQA 4GCJA 4Z7GA 3TUCA 1KE6A 4W8DA 1UA2A 3P5JC 5B0XA 3GFEA 2R3FA 3UIUA 3LKMA 5GIOE 1PXPA 4C34A 4DT8A 5HTIA 5EH0A 4WNKA 1H1PA 4DFXE 3PXQA 4L3PA 3FSKA 3QTWA 1PYXA 4FZDB 4GW8A 3LQ5A 2BDFA 3BLQA 2O0UA 2A98A 2J0MB 3LHJA 4NZWB 5J9ZA 5J95A 2QOOA 4M97A 3U54A 3IOPA 5CQUA 3R7EA 2XANA 4N57A 4BDHA 4ZY4A 3DZOA 2PZPA 3FI2A 4RX7A 5HG8A 3FXZA 4C0TA 5BNJA 5C4LA 4PMSA 2JIIA 4YTHA 3GQLA 3GXLA 5JZNA 3OOMA 4CLJA 5KBRA 4W8EA 5D1JA 2XALA 2BPMA 3EFWA 5C01A 3Q4ZA 5I0BA 4NIFA 4BDIA 2C6LA 2X9FA 5G1XA 1Y8GA 4EKLA 1J3HA 1XBAA 2HIWA 4LUEA 2WMQA 1BX6A 4LV5A 3MPMA 4U81A 4WRSA 3U9NA 4CSVA 3A7JA 4NUSA 2I0HA 5HKMA 4CCBA 2QU6A 5E8XA 1PXNA 3GVUA 4AT4A 3HNGA 4D5HA 4YLKA 2LGCA 3PIYA 5BMMA 5AA9A 4HZRA 2BUJA 4IHPA 2HYYA 1Q5KA 4I6QA 3REPA 4LG4A 4IAFA 5T68A 3TKHA 3ZBFA 5BYYA 1H1WA 2VTHA 3CR0A 4DG3E 2YM6A 3ZZWA 4GU9A 3TEIA 5J1WA 2WGJA 3OROA 3CQWA 4YNOA 4ZTSA 3UZTA 5EG3A 2QU5A 5HO8A 2XBAA 5LOHA 4JS8A 4BDAA 4NKSA 2R3KA 2BHEA 4USDA 2XJ1A 3D7ZA 1FGIA 3Q04A 4AFEA 3OXTA 3HAVA 1W83A 4EYMA 3EZVA 1E9HA 1WAKA 2RSVA 2FH9A 2OFVA 3RAKA 2VTMA 5CSVA 2X1NA 4X6QC 1FGKA 3QCXA 4AOJA 4F7JA 3BL9A 5EM5A 3NIZA 4YJNA 3RWPA 3ZHPC 4AACA 4L3JA 3P23A 4F0GA 2YERA 2C5XA 4S34A 4DLJA 4FV5A 3NMUF 1ZYDA 3WF8A 4EORA 3QU0A 2LAVA 3NUAA 1PYEA 3P7CA 4J95A 3BEAA 4U79A 5CXZA 5F4NA 1CMKE 4MTAA 4R77A 2GNJA 3FHIA 3OF0A 2WTCA 3VNTA 4K0YA 4D4VA 2NP8A 3GCSA 4FTQA 4TYIA 1UU8A 5HTCA 5LJJA 4EOPA 5FTQA 3Q4TA 2YJRA 5CI6A 2V22A 3FC1X 5AP4A 3OCBA 4U45A 2XNNA 4FV2A 3EJ1A 2XA4A 4L7FA 4ZZNA 5K5NA 3OS3A 2ITXA 3ZM4A 3NYNA 3FYKX 4CQGA 4EOSA 2PYWA 3E8NA 3OXZA 3QUEA 3R6XA 2CCIA 3CE3A 4PQNA 4RWIA 4IZYA 2WTJA 4D2RA 3A4PA 4X3FB 1OPLA 4EHVA 1UWHA 3FKOA 3AC3A 4EEVA 3P9JA 3PRIA 3EH9A 3DKCA 1VR2A 4MWIA 5GHVA 5DMZA 3AT4A 3WARA 3W0PA 3AD4A 4NW5A 2UZEA 2XKFA 3F7ZA 4BGGA 5IQAA 3CTJA 4FVPA 5M51A 4Y5HA 3CPCA 1ZY4A 2YCFA 4QP1A 5A54A 1SZMA 2VWXA 4KIQA 2O65A 5TKDA 4IAKA 4XG6A 4FTRA 4YBJA 3OY1A 3BZ3A 4U9AA 5E8YA 4EQMA 4F0IA 4ZY6A 4BN1A 4NFNA 4FEVA 2VUWA 4IFGA 1OGYA 3C4EA 4ZS0A 4GUEA 2CPKE 2XCHA 3K5VA 3KRRA 4CGAA 2BRNA 3PPZA 1ZOGA 4M15A 1TFFA 2HOGA 3ZRMA 1OKZA 4QPAA 1R0EA 5EM6A 4AA4A 3RM7A 5F20A 4MF0A 5ETFA 1CDKA 3A99A 4IJ9A 4XG7A 2YN8A 4GK2A 2GFSA 3FDNA 4XG4A 3ORLA 4O0YA 5AP3A 4E6QA 1YI4A 2QOCA 4IAAA 4IZAA 4X3FA 2QHMA 2OW3A 2VO0A 2PZ5A 3F61A 4I5MA 2Y6OA 4RFMA 4YZBA 4AZTA 4A06A 3EYHA 2XEZA 5FDXA 2OGVA 4ACCA 3IW8A 4Z7HA 3S3IA 3T9IA 1SNXA 5K5XA 3U9CA 3ZUUA 3A60A 3B2TA 5FXQA 3UQGA 4ANBA 3ZFYA 3ZOSA 4QYHA 4L53A 3FLSA 3SXRA 3ZDUA 4G17A 1BKXA 4C7TA 5CF5A 4FTCA 3BHYA 3BELA 2C30A 3QLFA 4EYJA 3SG8A 1WVYA 2R3LA 4MD7E 5JSMA 3W0NA 4J71A 3GCUA 3G2FA 4D1ZA 3LW0A 4E5BA 1GOLA 3DJ6A 4GUBA 3UJGA 1CM8A 3GC7A 3JY0A 2BRHA 3E8EA 2F57A 2VTQA 3DV3A 4UEUA 4XHKB 3WF6A 3HRBA 1VZOA 4FTUA 3ODZX 4IM2A 4HYIA 1YDSE 4NCTA 3MJ1A 1PXLA 4YJVA 4LL0A 3LXPA 5HESA 1MUOA 3EQDA 3GCPA 4RIXA 1WBTA 3R00A 2PU8A 4BCGA 5ANGA 3WZJA 2OU7A 2WO6A 5IU2A 5HOAA 2IZRA 1LPUA 4MAOA 5BVFA 5AV3A 5B2MA 2G15A 2YZAA 4LYNA 4UALA 1E1XA 1JNKA 1OMWA 3GT8A 3UIBA 4E5WA 1F5QA 4C3RA 3GEQA 4LOQA 4CMUA 2Y8OA 3KK8A 2UZLA 3AD6A 3FMJA 3R1SA 2YM7A 3P7AA 3HP5A 2C5YA 4L68A 4QYFA 5JN2A 5AR3A 2WQNA 4YZNA 5AP1A 2ZFYA 1ZMWA 4GSBA 2YHVA 2F9GA 3MN3A 3O17A 4AOTA 4JAIA 5TOZA 3W16A 4IXPA 2V62A 5CU6A 1H26A 3E92A 2QO7A 3OT3A 3R9HA 3RK9A 4JBVA 1JKTA 5CT0A 2PUPA 2NRUA 3IK3A 4APCA 5E8TA 4DEHA 3R7GA 2YIQA 3FYJX 3TXOA 2UVYA 4K11A 4NYEA 2OJGA 2I7QA 5IPJA 5FP5A 2QVSE 4HYSA 3F82A 5HEZA 3BL7A 5HX8A 2YWVA 4ZAUA 2X4ZA 2O2UA 2VO7A 2CKPA 4F64A 1OKYA 4FJVA 4BFMA 5IMXA 3Q5ZA 2WMBA 4P2KA 4FKIA 5JEBA 5IQCA 3F3ZA 3TDWA 1ST4A 2WAJA 4HNIA 5DHJA 2BZHB 2BVAA 3Q53A 5FEDA 4JT3A 4Y5QA 3DBQA 5CENA 3F3TA 5L3AA 4XH6A 5CZHA 5E90A 3B2WA 5KMNA 4I6LA 3ORTA 4U42A 3CKWA 4DEDA 1G8AA 5HVYA 5EYCA 2R3IA 3CJFA 3C5UA 3C4ZA 4FX3A 1Z5MA 3F3WA 2F7XE 3EQHA 4OBQA 3NX8A 4S32A 5C03A 5FDPA 2RFNA 2CNQA 4FOBA 5J8IA 4O7NA 1TVOA 3A4OX 4TZRA 2JGZA 1OL6A 4YJOA 4IWPA 3EL8A 4LV7A 5IQEA 2C0TA 4S31A 3R21A 1NVRA 3RALA 3MIYA 2VU3A 4YURA 3TM0A 3W0MA 4P5ZA 1QPCA 1J1CA 4H39A 4YP8A 3ZFXA 3ZO3A 5L4QA 5AM7A 5IUHA 4R7IA 4I6BA 4GT3A 4FG9A 2H8HA 4RPVA 4XG2A 3T3VA 4ERKA 5JQ5A 4JJRA 5KCVA 4BWKA 4QP7A 5GZAA 3D5VA 2OSCA 3WIGA 4BRXA 3COIA 4I0RA 2BHHA 3FZ1A 3II5A 4E4MA 5BVOA 3F5UA 4I21A 4OBOA 2R64A 1U59A 1J91A 2GHLA 1R3CA 5AX3A 2ZB1A 3NUUA 4KSPA 3QD2B 4PNIA 2JDVA 4O7VA 5CYIA 4IFCA 3PXKA 3PVGA 5CEPA 3OG7A 1CSNA 3LPBA 4O2PA 1Q8WA 4O4BB 4QMSA 5JGDA 3NVMB 4XRLA 4PX6A 1XBBA 3G0EA 3PIZA 1QPEA 2I0VA 3C0GA 4KBCA 4W4VA 4YJQA 3QKLA 5I9UA 4E26A 2PVNA 1DAWA 2VX3A 4DFZE 3W2PA 5E92A 2XKDA 3F7WA 3TCPA 3UIMA 4YZ9A 4CVAA 2C6OA 4CFNA 3UVQA 5DLSA 2YITA 4AA5A 2ZV7A 1ATPE 2W1DA 4MH7A 4ASDA 3U87A 4CMTA 3BV2A 1Q4LA 3JXWA 3NUNA 4D1SA 2GPHA 3GNIB 4NSTA 2X6DA 4YC6A 4AT3A 3KQ7A 4HYUA 5LCJA 1Q62A 4RJ3A 3OW3A 3LFBA 5M06A 2PY3A 5DIAA 2OZAB 1YI3A 2HW6A 4NU1A 2PE2A 1G5SA 3M2WA 3D83A 1JVPP 3S2PA 3W2CA 4H1MA 1OITA 2WPAA 4TWCA 3KRWA 1RW8A 4AQKA 3EQCA 5AP5A 5IH4A 4BZNA 3DT1A 3IDPA 4D5KA 3LFNA 4QP8A 1AGWA 2P0CA 3FBVA 5K9IA 3P1AA 2ZV9A 2XNPA 2VTSA 3ZBXA 3QBNA 3KMMA 3MY0A 4JX7A 3A7FA 3QQKA 5FXSA 5A4CA 3GU5A 5GZ8A 3OC1A 3M11A 1IRKA 4PNKA 1GZNA 3CD8A 1SMHA 1YHWA 2RG5A 1ZMUA 2W99B 3DZQA 4IACA 3MH0A 5CXHA 4I22A 3THBA 3OWKA 3C51A 4YTFA 3JY9A 1PF8A 4BVUA 3UVRA 3P0MA 4C4FA 3BGZA 3Q9ZA 4BBFA 3V3VA 2C3KA 3PG3A 1U5RA 4FR4A 3CKXA 1PXMA 5AR2A 4O91A 2OIDA 2FVDA 5EHYA 4JMQA 3C13A 2WTIA 3V04A 5BUJA 2QKWB 2WXVA 4NT4A 4CRLA 4L00A 4DH7A 1YOLA 2WKMA 2VRXA 2XM9A 3D9VA 1K3AA 3LFEA 5I3OA 4C3FA 4BYJA 2Y4IC 4FZFB 1KWPA 1KOAA 3PP1A 5EDQA 4QRCA 4O1PA 1YWVA 5F1ZA 5IUIA 4ZK5A 4FNXA 4LM5A 3FZOA 1L8TA 1IR3A 2CKOA 5H8EA 4FKWA 4I6FA 5JFSA 4WG3A 4ZXTA 2WTKB 3QF9A 2UW7A 4K8AA 3RKBA 3FQSA 4R8QA 4NJ3A 2CKQA 5LCKA 4A9TA 2B9IA 4O0SA 2C3LA 2OZOA 4C4HA 3UQFA 1GJOA 4L52A 4QEBA 5LQFA 2WU7A 3OW4A 2QOIA 4QNAA 3TZMA 3VW6A 3BWFA 3BWJA 5HI2A 4A9RA 4F7SA 3UNZA 5KMIA 5L6PA 2WQMA 1ZYJA 5AAFA 5BV3A 4H58A 4BTFA 3SOCA 1MQ4A 3NPCA 1H25A 1OIQA 4NM5A 2QOQA 5HHWA 3ZUTA 3DY7A 4R6VA 4CTBA 2W05A 1A9UA 3BYOA 2X0QA 3FMMA