3V01A

Discovery of novel allosteric mek inhibitors possessing classical and non-classical bidentate ser212 interactions.
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
322
structure length
289
Chain Sequence
b'MELKDDDFEKISELGAGNGGVVFKVSHKPSGLVMARKLIHLEIKPAIRNQIIRELQVLHECNSPYIVGFYGAFYSDGEISICMEHMDGGSLDQVLKKAGRIPEQILGKVSIAVIKGLTYLREKHKIMHRDVKPSNILVNSRGEIKLCDFGVSGQLIDSMAVGTRSYMSPERLQGTHYSVQSDIWSMGLSLVEMAVGRYPIPPPDAKELELMFPPMAIFELLDYIVNEPPPKLPSGVFSLEFQDFVNKCLIKNPAERADLKQLMVHAFIKRSDAEEVDFAGWLCSTIGLN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dual specificity mitogen-activated protein kinase kinase 1
publication title Discovery of Novel Allosteric Mitogen-Activated Protein Kinase Kinase (MEK) 1,2 Inhibitors Possessing Bidentate Ser212 Interactions.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/inhibitor
total genus 85
structure length 289
sequence length 322
ec nomenclature ec 2.7.12.2: Mitogen-activated protein kinase kinase.
pdb deposition date 2011-12-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3v01A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3v01A01
4MBIA 3R63A 4CFFA 2W06A 4MAOA 3NIZA 4CD0A 4RX8A 4DEEA 1XH4A 5JN2A 1VYZA 4BGGA 2P55A 3PIZA 3Q04A 4IZYA 1DAYA 2UW8A 5IU2A 5E9EA 4JIKA 5C8NA 1ZMWA 2RFDA 4FNXA 4XV1A 4LL5A 4BGQA 4O0VA 4LMNA 4KS7A 2PTKA 4FL1A 4ZY5A 4H39A 3OY1A 1FMOE 3AOXA 3F69A 4FC0A 2VWUA 1OGUA 4II5A 4QMMA 4YJSA 3UIXA 3P1AA 4RIXB 2YIWA 3ZMMA 4BCGA 5FBNC 3NYVA 4RVLA 5HTCA 3DAEA 5IISA 3BU6A 2YHVA 5HBJA 5E4HA 3R21A 3SC1A 5LXMA 4QP2A 4E1ZA 2YCSA 3MH2A 4I6QA 2EXMA 5D7AA 3W2SA 5IUIA 4F4PA 2O64A 3FMKA 4S34A 3VF8A 4LM5A 4J97A 1KWPA 3F9NA 1KV2A 2C0IA 3OWJA 3WF6A 5JH6A 2A27A 5L8KA 5AUUA 4FA2A 2IW9A 2HOGA 3MS9A 2OFVA 4O0XA 3O8UA 5CSXA 1YHWA 3MBLA 5JFVA 4RC4A 3QA8A 2QOIA 3LXKA 2CKQA 4ZSJA 4RFYA 3R7YA 3AD5A 4QTCA 5EDQA 4EWQA 4O0TA 2YN8A 3V6SA 4ASDA 3DXPA 3GU7A 3R9OA 4MEDA 1OIYA 2VGPA 3B8RA 2XCHA 1R78A 5HI2A 2C4GA 1YXUA 3D7ZA 4HNIA 3WBLA 3CP9A 5C01A 3ZONA 5IA0A 1G5SA 1JLUE 1ZAOA 3HRBA 3COIA 3NYOA 2C5NA 5KX8A 2CNUA 3UC3A 3ZSHA 2R64A 3C4FA 4JT3A 1I09A 4FTLA 3PY0A 3GQIA 3LLTA 3QRIA 2X2LA 3ZUTA 4EQMA 2G15A 2W96B 5KHXA 2IG7A 3C4EA 4AP7A 4GKHA 4HGSA 3II5A 4FIEA 4YZCA 3VRZA 1XBAA 4OAUC 3C0IA 3E8NA 3DBQA 3QCYA 4XV9A 4JAIA 2WOUA 4KABA 4C7TA 4PX6A 2CGVA 4B8MA 4O0RA 3E5AA 3QQGA 1CMKE 4JG7A 3D5XA 4X3JA 5ANEA 3ZZWA 3PY3A 5HD7A 2C6DA 4GL9A 4BWXA 5B7VA 2VV9A 4KSQA 5FRIA 3NZ0A 1EH4A 3VAPA 5DFPA 4EKKA 2UVXA 4NCTA 4EOMA 3ZM9A 4B9DA 3PSDA 3U54A 5E8SA 5LMAA 2JIUA 3FMLA 4ERKA 1RQQA 4Z9LA 4TPTA 4HGEA 3A7FA 1ERKA 5E8WA 4ZMFA 2XNNA 4YJTA 3EQCA 2VWIA 2EVAA 3BQCA 3S2PA 4F63A 3R2YA 4FYOA 3VS5A 2Y0AA 4KBCA 3M2WA 5HOAA 5IPJA 3IQ7A 3ZUVA 1GIHA 3C4XA 4U97A 5CEIA 4GG5A 3W1FA 1P14A 2FA2A 5CASA 2PY3A 2J2IB 2EXCX 4W9WA 4DC2A 4M69B 5E7RA 1PF8A 5C4KA 4EOOA 4GU6A 4FTIA 4RWIA 3DJ7A 3HGKA 4RIWB 4XP2A 4YO6A 5D12A 5AUWA 5FTOA 4FUXA 4U79A 4E5BA 5E90A 4EHEA 2BIYA 4IM2A 1H01A 1JQHA 3ZLWA 2GS2A 4E6CA 4D2TA 4MF1A 4F6SA 2JC6A 4QMTA 5CT0A 4J71A 4LRMA 4UEUA 1H8FA 2PZIA 4OTQA 2PVLA 3NW6A 4GS6A 4YURA 3FMEA 1YHVA 3EWHA 3IDBA 3DBCA 2Z7RA 4H1JA 4ITIA 4QNYA 1OBGA 2OLCA 4DCAA 4FV3A 4ASEA 4AT3A 4I41A 3CD8A 2V0DA 3VS0A 2XK9A 2PMNX 2QLUA 2W4OA 1YWNA 3CY3A 4LGHA 2PUNA 1JAMA 4Q5EA 2X9EA 3KGAA 4EK3A 3TZ9A 3PPKA 4WHZA 3U4WA 1XHAA 4UMPA 3TTIA 4Z7HA 5F9EA 3EN9A 3ERKA 4J99A 1J91A 4A4LA 4R6VA 1OPLA 2XK3A 1H1RA 4CFVA 4FTNA 4J53A 3ZDIA 4CFXA 4DAWA 3A7HA 4O21A 3IONA 4DG2E 2SRCA 1H27A 5A3XA 1KE9A 3QFVA 4O1OA 2UW4A 2ETKA 2WQNA 2B7AA 2AUHA 4ZZMA 1PXNA 4YP8A 3HDNA 2UW7A 3ZTXA 3QCXA 4APCA 1NY3A 3C7QA 4RQKA 4DGGA 4F09A 4JDHA 4RRVA 3EYGA 4CV9A 5CVHA 5E8UA 2BZHB 2XK8A 3EL8A 3QRUA 4FT9A 3EN4A 4YPDA 5DR6A 3W32A 5M4IA 4I5CA 4DE4A 4GVAA 2HELA 3MTFA 4GT4A 4U44A 5BYLA 4WIHA 5LJJA 3HMPA 3FWQA 2XK6A 4H3PA 4DH3A 4RLKA 2ERZE 5E91A 3EN6A 4FV9A 4EOIA 3TIZA 3QTXA 3KF4A 2VTAA 1UNLA 5DLSA 3RKBA 4CQGA 4DGNA 4XRJA 1ZLTA 2DQ7X 4O7RA 3UVPA 4D5HA 3BHVA 3GEQA 4HCUA 3U9NA 4XG6A 2ETMA 3GI3A 4RX7A 1PXIA 5JRSA 4D58A 5K0KA 5M56A 4ONAA 4FSYA 4HOKA 2QG5A 2OXYA 1M2QA 4X2FA 4OBOA 3R7GA 4Z7GA 2Q83A 3ALNA 2DYLA 3TZ7A 3LJ2A 4TL0A 3H4JA 3S0OA 3QL8A 2ITWA 3LFBA 3V5TA 3QD3A 2RIOA 2GNFA 4QMNA 1Q99A 4XBRA 1BI7A 4D4YA 4D4VA 3FMMA 4M7IA 2XKCA 4QRCA 4HGTA 1REJA 4O96A 2OH0E 2W05A 4AA5A 1U5RA 5AWMA 1Q8TA 4B6LA 4JBPA 3ZC5A 2CNQA 5AV3A 3IW7A 3KRLA 4NTTA 5CVFA 1XQZA 4P5QA 4GUBA 5AAFA 4OAVB 2R3NA 3FXWA 4KIPA 4FYNA 4O27B 2X8DA 4CXAA 3BZ3A 2OU7A 3AQVA 5HLNA 3RCDA 3BEGA 4E5WA 5GIOE 3R2BA 5IH5A 2PL0A 3TM0A 2G2FA 1XR1A 2WMWA 4GFMA 4LG4A 2R9SA 5B2MA 4P2KA 1ZWSA 4GIIA 4BDKA 1PXPA 4TYEA 5HESA 4I0SA 5AR3A 2OBJA 2QOHA 4AQCA 2BRNA 1H1SA 3CPCA 4BDGA 5ETIA 3I0QA 1IAHA 5DH3A 2BZKB 4AS0A 5IQGA 1GZKA 2B9FA 4N6YA 5CSHA 1NVQA 2PE1A 5M07A 3D94A 2PVJA 5KMOA 4IX4A 4E6DA 2QHNA 2WMQA 3E92A 4GFOA 3LAUA 2JBOA 3D14A 4J52A 1Q8UA 1M2RA 2UZLA 3N4VA 4BDDA 3HP5A 1DI8A 3PG3A 3PWDA 4ZZNA 2XJ1A 3W18A 4IW0A 1CKPA 3CIKA 3N51A 2ZV9A 5HO8A 4OLIA 4YPSA 4AGCA 5CAUA 1UWJA 4AWIA 2ITUA 4AW2A 3SVVA 1QPCA 4IB5A 3PE2A 3OMVA 3PXYA 4J8MA 3R83A 2FSOX 4H05A 3WIGA 3KFAA 3VUIA 1Q8YA 1UU3A 4KKHA 4M0ZA 3L9PA 1YVJA 4L3PA 1JKTA 3M11A 4HCVA 1PXMA 3QYWA 4ZY4A 3PZHA 4IJPA 4U6RA 3I60A 4F70A 3FPMA 5CEPA 2YEXA 3LCKA 4FG7A 3RZFA 4G6NA 3FI8A 5C26A 4MK0A 4O7LA 2X6EA 4D2WA 4D2RA 4O7VA 5IQFA 3BQRA 4IWQA 1RW8A 3KN6A 4JIAA 2HZ0A 2XKDA 3QU0A 2E9VA 1YI4A 5GJFA 4ITHA 5DHJA 1JOWB 5CEKA 3TZMA 2HIWA 2I40A 1Y8YA 4MXAA 4OTWA 4E93A 5EM8A 2NNWB 3R71A 3CCNA 3LM5A 5L4QA 3NNXA 4IH8A 5M08A 4G3EA 2JKQA 2XK4A 3T8OA 3VS3A 3RBWA 3AC2A 3ZXZA 3GCUA 2VU3A 2UZWE 5HG5A 3WF9A 3FZSA 4L7SA 4FTOA 4TZRA 2R3QA 2X7GA 3ACJA 3HKOA 3Q5IA 3QC9A 3V5JA 3VQHA 3BPRA 4A06A 4MXXA 1APME 3N4UA 5FXSA 2BCJA 4E26A 4RBLA 3HVCA 2WMBA 2ITTA 4YJPA 3VWAA 3MFUA 4TRLA 4BIEA 4YJRA 1SNXA 3QTZA 5H2UA 5K3YA 3RPYA 5D7VA 5FDPA 1H00A 3WF8A 2XIRA 1FBNA 5KBRA 5CU2A 3W2QA 5CSPA 3R22A 5IDPA 1I44A 4MXZA 3O17A 4DN5A 3HRCA 3FKOA 3DKOA 4IZ5A 1GZOA 1YW2A 3MVJA 4UY9A 5JMSA 3U6HA 5L2QA 4O2ZA 2BUJA 4JQ7A 3WZKA 4ERWA 2E9PA 2XUUA 5HO7A 1U5QA 2E9NA 4TWNA 4YNEA 4NYEA 4DEHA 3COHA 4QP9A 1ZOGA 3IDCA 3SV0A 5AR5A 3MH1A 2ZJWA 4CFWA 4IVBA 3KQ7A 4D0XA 3U6JA 3BBTB 3GFEA 3IOPA 4I1ZA 2QOCA 4JDJA 3WILA 4JRVA 4BGHA 3AXWA 3GP0A 3BI6A 1BKXA 3FQHA 3NUXA 3RTPA 2BAKA 3SXFA 3FDNA 1M52A 2AC3A 2YA9A 4F7JA 2YZAA 2XA4A 5CYIA 1E1XA 4I4EA 4C36A 3TIYA 1QL6A 4C3PA 1PXLA 4ANBA 3KREA 4FGRA 5CSWA 4DTBA 4KWPA 3G0FA 2CKEA 2QOLA 3G90X 3F5XA 4FVPA 5ACKA 4PTEA 3IO7A 2WEVA 3F61A 3UIUA 1SNUA 4DFUA 3DTWA 3DXNA 1NA7A 5AV1A 4FKTA 4ZZOA 2OSCA 3LFCA 4Y73A 1VEBA 2E9OA 2HXQA 3LCOA 3WIKA 4BFMA 3W2CA 5EI2A 4I94A 4L8MA 3P0MA 3DAJA 2ITYA 4WT6A 1URWA 4TYHB 5AJQA 4EJNA 3LMHA 2QU5A 3OCSA 1F5QA 3S4QA 3RK7A 1R1WA 5J79A 4PL4A 1BMKA 4L3LA 2P33A 1R39A 2PMOX 4GH2A 4ZP5A 5I4NA 4RGJA 5TOZA 3U6IA 4DTKA 5FGKA 2ZMDA 5DEYA 3C4WA 4F0FA 4FG9A 4ANSA 2OJ9A 3BGQA 3KULB 2W9ZB 5DIAA 2PZRA 2C1AA 4K2RA 4FK6A 2I0EA 2GS6A 3F6XA 5AV2A 3TN8A 4IZAA 5HBHA 4BCNA 1Q61A 1KE7A 4KIQA 2JFMA 2PZYA 2ZYBA 3B2WA 2P4IA 3UC4A 3FAAA 4A9UA 1U4DA 3GC9A 4CCUA 2Y6OA 4QYGA 4PMSA 4TYHA 1WMKA 3AD4A 3U51A 2HENA 3BBWA 3SDJA 5HZNA 3N9XA 2ITZA 2A4LA 1RDQE 3C4CA 1ZMVA 3R9NA 1S9JA 4Q9ZA 3LXLA 2YDJA 3ORTA 1K3AA 3MI9A 2X2KA 5EI8A 4C4IA 3R1NA 3WZDA 4YSMA 3SA0A 3KULA 4OTHA 5BUEA 2C5YA 5C9CA 5A6OA 3VRYA 5HLPA 4BBEA 1YDTE 3OHTA 3I6WA 3HA8A 3P7CA 4FVQA 3UG2A 3BU5A 3OT3A 3HV3A 4XG2A 5J7BA 2OW3A 3NYNA 4U5JA 5J95A 1J1BA 2VWBA 1J1CA 3ORMA 2VWYA 4NJDA 5DBXA 3OF0A 3EH9A 3R01A 4IBMA 3QRJA 5T6KA 3IPHA 4J7BA 3VQUA 5GINE 4QTDA 5DRBA 5C4LA 1W8CA 1ZOEA 4UBAA 1Q41A 4M15A 3DAKA 4Y8DA 4F6WA 3JS2A 3EQGA 3Q2JA 5EQYA 4JL9A 4OUCA 1FINA 3PDTA 3QQFA 2IZUA 5DNRA 3R9HA 4F1OA 3CGFA 1KOAA 4PL3A 3I5NA 1U46A 3EB0A 3QKKA 4L00A 4CTCA 5JQ8A 3KMWA 3QYZA 4BHZA 4DINA 3LCTA 4J95A 1YXSA 5ANGA 2V7OA 4RX9A 4QMXA 3KVWA 2RG6A 1XH5A 3QZFA 1ZYLA 4U7ZA 5DOSA 4HVGA 4JBQA 4E7WA 5GZ8A 4USDA 3GC0A 4LL0A 4WNPA 4EOLA 3VW8A 4FIHA 4RWLA 5BVNA 3TKIA 3TUBA 4U80A 4CTBA 3KY2A 5A4TA 5A4LA 3P7AA 4UMQA 3D7TB 3VUKA 4HVHA 1FPUA 1Y6BA 4V04A 1VJYA 5IG1A 3ZRKA 4IANA 2ZM1A 4JBVA 4PTCA 1MRYA 5D41A 2ESMA 2AYPA 3B2TA 3HV4A 1UKIA 3ZO1A 3NEWA 5L2SA 3S1HA 4WNMA 4JJRA 1UVRA 3FXXA 5M4FA 4TKSA 5CAPA 3DB8A 4BI0A 2JAMA 3F3WA 3K5UA 2JIVA 1BI8A 3BHYA 3BLHA 3L8XA 3HUCA 3JR1A 4ACHA 3ORLA 3A61A 4NM5A 4GRBA 3NCGA 1OECA 2VZ6A 4BTMA 1KV1A 2XS0A 5H3QA 5M51A 2UZUE 3ROCA 3ZSGA 4XG4A 3RJCA 3CQEA 1H1QA 5DT4A 4BKZA 5EYKA 3D5UA 4AGWA 2WMTA 2XVDA 3KXZA 5BVKA 2GU8A 5HCZA 2XK7A 4EORA 3O51A 2C6IA 1TQMA 3UVQA 4G34A 4ZLZA 2ZOQA 4IFCA 2VTNA 3QTRA 3A4PA 3L1SA 4CYIA 3D7TA 1Q8WA 4O0WA 4RPVA 3TXOA 4QQ5A 3LW0A 2VTIA 3PUPA 4RJ8A 2CN8A 2C3LA 5B0XA 3UDBA 1CKIA 5CF4A 4CKRA 3UQFA 5J87A 4F9AA 3DS6A 4KA3A 4K11A 3UOJA 1UKHA 1A06A 1BYGA 2DWBA 4IQ6A 5HG7A 4EH3A 2A2AA 4MVFA 3FC1X 2Z7QA 5KMLA 5A4QA 5HIDA 2F57A 4FNZA 3UO6A 4EHGA 3MJ1A 5KUPA 2PULA 3FEGA 5FTQA 3CY2A 3EFKA 3QQHA 1SVEA 4QMLA 4YR8A 5J5SA 4OTDA 3CE3A 2VWXA 4V05A 2C5OA 3RP9A 4YZBA 3KK8A 1GIJA 3CJGA 4XHKB 3AC4A 1O9UA 3QHWA 4FV2A 4UXQA 4W4WA 4FX3A 3DU8A 1IRKA 4DF3A 4IVAA 4O84A 4BTJA 5IEXA 5JZJA 4U9AA 1Z57A 1SM2A 3PXFA 5CTPA 3TV7A 4IWDA 4O0SA 3V51A 5IQHA 4OR5A 3QLFA 5AP3A 3S3IA 2YLFA 4C3FA 3HRFA 1LEWA 4X6QC 3PLSA 2QOOA 4BICA 2XZSA 4AZTA 4F7LA 4JR3A 2PVHA 5J1WA 2YZLA 3R28A 2OO8X 5EYMA 4ASZA 5EM6A 4P7EA 4B99A 3I79A 1XBCA 3NAXA 3DDQA 3Q53A 3ALOA 2YM6A 2W1FA 4GCJA 3ZLYA 4I22A 4IX6A 5ANJA 4I20A 4FIJA 3FPQA 3RWPA 2Z60A 4A7CA 2IZRA 3WI6A 5EM5A 4ALWA 2XYNA 1V0OA 2UZNA 3DOGA 3QHRA 4YTIA 5HORA 5M09A 3POZA 3NLBA 3PLAE 2X8EA 4EH4A 3P78A 2XEZA 3GVUA 4IACA 5L2WA 4OTPA 4YC6A 5AP7A 3GOPA 2XIZA 3QF9A 4MNEB 5BVOA 1YDRE 1Q3DA 5J7HA 4X2NA 5AA8A 4QYFA 4ENYA 2XMYA 3OC1A 4FKIA 3ROYA 4Z3VA 2DS1A 3QTIA 5DT0A 2QQ7A 5HCYA 2JDOA 2C6MA 2UVYA 2X6DA 2JKKA 3DBFA 3ORXA 3LMIA 5AP6A 3UODA 2V7AA 4JLCA 4L43A 3KXMA 3R02A 3QLGA 4I93A 4B0GA 4HYIA 3A2CA 5AUYA 4E4XA 2QKRA 2XCKA 3Q6UA 4BHNA 5KZ0A 2QOQA 4I23A 4NIFA 3HMNA 3W33A 3LQ3A 4IVDA 2QVSE 4XBUA 4YBKA 4LV5A 4IMYA 3L8VA 4ACMA 1PJKA 2HYYA 4BZOA 4ITJA 4DBNA 5KKRC 4QP8A 4ZSGA 4H36A 4O7WA 1R0EA 5AUZA 2UW0A 3CGOA 4MNEA 3ZXTA 3VHKA 1STCE 4TTHB 4BIBA 4J1RA 4X7QA 3E87A 2QCSA 4RFZA 4PRJA 4ZSEA 3KCKA 4RIYB 3RHXA 5D1JA 4DFZE 5HU3A 3EIDA 4AAAA 1PXJA 4ZTSA 2HZIA 3O2MA 2IVVA 2YCRA 4M66A 4QTBA 4D2SA 5AADA 2VNWA 3UJGA 3VVHA 1OBDA 3FZRA 2UZTA 4M12A 3HECA 2ZV2A 3R8MA 5CU3A 3TTJA 1PYXA 2BDJA 4RJ5A 2PHKA 3MDYA 2VTHA 3FMJA 5LVNA 2PMIA 2R0UA 2V55A 1WFCA 4FZ7A 5DR2A 3BGPA 4O6LA 4I5HA 4RX5A 2XP2A 4D0WA 3I5ZA 2BRBA 3BCEA 3O7LB 4AE9A 5A9UA 2WQMA 4FNWA 4HYUA 4KAOA 2CGWA 2Q0BA 3OW3A 3QGYA 3MB6A 2OIDA 4UZDA 3R7EA 4YO4A 4HW7A 3FMHA 1IASA 5L8JA 4BDAA 2WQOA 1WBOA 2C5VA 4Y85A 5F4NA 4DT9A 4OGRA 2VN9A 3FBVA 4NKAA 4RIYA 5CEMA 1Q97A 2HZNA 2R3OA 5FDXA 4KRDA 4UN0C 2G01A 3LHJA 1Y6AA 3FJQE 2VAGA 1ZYSA 5EKNA 3PWYA 4NTSA 4TNDA 4UWBA 1CM8A 3LJ1A 1K2PA 4RIXA 4NM7A 3TI1A 4GVJA 2ONLC 3QBNA 4GT3A 3V5PA 3SX9A 2WHBA 2Z7LA 2XKFA 3GB2A 2PVNA 3R9RA 4WBBB 3NSZA 3WZUA 2CNVA 3SKCA 3ORNA 1Y57A 5BVWA 4CT1A 3E63A 4GJ3A 4WUNA 1OIUA 1OM1A 3RI1A 4IM3A 3DFAA 4XX9A 4DFLA 5HLWA 5LVPA 1WCCA 3NWWA 4F0GA 2IPXA 3KXNA 2YITA 3BKBA 2CN5A 4X2GA 4MCVA 3P23A 4CLIA 1XJDA 5LVLA 4FIGA 1OITA 3JUHA 4Q9SA 2ZDTA 1H28A 4BKYA 4ANMA 1WVYA 3KC3A 1ZXEA 4DITA 2FH9A 2OXXA 4G16A 3CTHA 4RMZA 4BF2A 4RSSA 4BTFA 4MBJA 4D9TA 1OL7A 3VBWA 4YLJA 5EQPA 3BE9A 2JFLA 5EOBA 3UMXA 4ZTHA 5KMIA 2QOFA 4MXYA 4QQJA 1WBPA 5H8EA 4KBKA 3UBDA 5TR6A 4FTRA 1KE8A 2KTYA 3GOKA 3TJDA 4EC8A 3I4BA 5JQ5A 4XG9A 2YM5A 4N4SA 2W1CA 3O50A 4W4YA 2HY0A 3HL7A 3M1SA 2ITOA 2ZVAA 4YLKA 3NUUA 3T3VA 3KL8A 5AX3A 3IDPA 5HG8A 3D4QA 4MQ2A 3TNWA 4HJOA 4NK9A 2BFXA 4EH7A 2GNIA 4TWPA 3DZOA 2X81A 5LMKC 2NRUA 4FR4A 1H26A 4BWKA 4EOSA 3BRBA 4ZK5A 4NKSA 4C4GA 4RC2A 3OOGA 4CLJA 3P9JA 3F2AA 1BX6A 3Q52A 3Q96A 4QTEA 3FZTA 2LGCA 3DJ6A 3CR0A 4RJ7A 2WEIA 5ANOA 4FEQA 4FIIA 1IA8A 2W4JA 3CQUA 3O8TA 4EH5A 3NGAA 3ZRMA 5DT3A 3QTSA 3F3ZA 4N0SA 4QYEA 4Y83A 4BDEA 1J7LA 4YC8A 4PWNA 1G8AA 4BKJA 2CGXA 4OTGA 4EC9A 5M53A 5AIKA 3Q2MA 4ZMEA 4QMZA 3WE8A 2VTSA 1M14A 4UXLA 5A54A 5CF8A 5IDNA 3E8EA 3OS3A 3OP5A 3SD0A 5J9ZA 3MGYA 4CFNA 2GTMA 5CU0A 4F6UA 5EDRA 4FKPA 1G3NA 3E7OA 5BQ0A 3HEGA 2VTTA 3OT8A 4KNBA 3SW4A 3AGMA 3MFSA 2PE0A 3AT2A 3NRMA 4D4SA 1V0PA 5KKRB 4EEVA 3UZRA 3G6GA 3FQEA 4FTUA 4ZSLA 3RAIA 4ZAUA 4U42A 2BALA 2B9HA 3NUYA 4KKGA 2VX3A 4M69A 3A60A 4GJ2A 1BL7A 5I9VA 1VR2A 1J7IA 4RIWA 5CENA 5KE0A 1YOJA 2B4SB 3KXGA 5EYDA 2G9XA 3VHEA 4ZTLA 4BR3A 4BDFA 2W9FB 4AN2A 3JYAA 2OZAB 3MV5A 4XLVA 4DEBA 4CNHA 1H07A 4F7NA 5E8VA 4ANOA 1UU8A 4IB3A 3KRRA 2WD1A 4USEA 3PIXA 4PY1A 3LFDA 4PPAA 4EBWA 3BYVA 2YABA 3DLSA 4K8AA 4S30A 2HW7A 4IWOA 2C6LA 3RAHA 5CI6A 2AC5A 4ANNA 4IAZA 2O0UA 1OUKA 3PSCA 3RVGA 3NW7A 2WMXA 4MXOA 4O86A 4UZHA 1YI6A 5HQ0A 1GOLA 4FVRA 4AW0A 5B2LA 3WYYA 1HOWA 1TQPA 4FOBA 4JI9A 3E3PA 5FEQA 1KE6A 3LM0A 5AP1A 5J9LA 2Z2WA 4R3RA 1BUHA 3ZFXA 3HV5A 5TO8A 2X2MA 5HVJA 2OG8A 3BHTA 3R04A 4JG8A 4LOQA 4EUUA 5LARA 5M44A 3UNKA 3DZQA 4AOIA 2KULA 2OF2A 4WO5A 5JKGA 3N4TA 2OZAA 3ORPA 4E20A 3F82A 2X8IA 5AAGA 1YWRA 4C62A 4AF3A 3EZVA 1WBTA 2XKEA 3FMDA 2V5QA 3PSBA 1MP8A 3EQRA 5CQWA 4LRKA 3SQQA 5FTGA 2PVFA 5JRQA 4CKJA 3DNEA 5HTBA 4KD1A 5HTIA 2GNLA 1OMWA 2PSQA 1LPUA 1FVRA 4BCIA 5ETAA 3UPZA 4AGUA 2WAJA 3H0ZA 3C51A 4ARKA 5A46A 1LP4A 4L01A 3ZFYA 1MUOA 3MB7A 4QMYA 4AN9A 2G2HA 4F9WA 5BMMA 4JBOA 4EL9A 5CAVA 4O7TA 4NSTA 5AX9A 4GU9A 2NP8A 4MD8E 3NW5A 5CX9A 5IF1A 4ANLA 3QTQA 4U40A 2YWPA 3EYHA 4M84A 4R7IA 4GG7A 3TKHA 1OI9A 3G51A 4TXCA 3ATTA 1JSTA 3P4KA 2R3HA 3DY7A 3D9VA 2QG7A 4QP6A 4QMSA 2WFYA 3FYJX 3W2PA 4HVDA 5A6NA 2O3PA 3QZIA 5IEVA 4PNIA 3S95A 3QUEA 4GFGA 1Z5MA 3IK3A 3SXSA 1IEPA 4TN6A 4ENXA 3BYOA 2P2HA 3W10A 4LI5A 2F4JA 3QZHA 4WSYA 3VJOA 1JKSA 3HMIA 1GJOA 2BKZA 4YC3A 4DEGA 1M7NA 4EH2A 2HW6A 3AC8A 3C0GA 3CXWA 1GZ8A 3OY3A 4BI2A 4C3RA 5HX6A 3UVRA 2UZVA 3PXRA 5HGIA 3C9WA 2FSTX 3EFWA 3EKKA 1B39A 1PW2A 3HDMA 4RFMA 4FT5A 1TVOA 4YZDA 3QCSA 2XNEA 3R7VA 4W9XA 2X7FA 4QD6A 2GSFA 4PDSA 3PA4A 4ZTRA 3QTUA 5KO1A 5JEBA 2WTKC 3P7BA 3FLWA 2YIYA 3FSKA 4PMMA 5CNNA 4DH7A 3CTQA 2I1MA 3UE4A 4C4FA 4ZOGA 5JZNA 2EUFB 3AGLA 5IQDA 2YJSA 2QKWB 4GSBA 4OW8A 3KRWA 3E93A 3DQWA 4FEWA 4O82A 2B1PA 3VUTA 4ACDA 2OJIA 1B6CB 2P0CA 3FKNA 2XIKA 3L9NA 2YM8A 3OUNB 5HIBA 4U43A 3UP2A 4WD5A 1YKRA 5FEDA 2JGZA 3P79A 4BCFA 4FV0A 3V8TA 3OROA 2X4FA 4ZS0A 5C03A 4EJ7A 4YNOA 2XEYA 2ZDUA 2PVMA 4XS2A 2FVDA 2V62A 3W16A 4E4MA 3V5LA 5GIPE 3BEAA 5BYYA 2F7EE 3L8SA 5JGBA 2RF9A 3H30A 4QMVA 3H9OA 4UMTA 4O7ZA 4XP0A 3R7OA 3D5VA 3QGWA 4G3DA 5EW8A 2OGVA 2RGPA 2C6KA 1M7QA 3UMWA 2JDRA 1SYKA 3FC2A 4D2PA 2R3KA 4KIKB 3WF7A 3F2RA 1XWSA 2XM9A 3TKUA 3HP2A 4XV2A 3PPZA 3PXQA 3GT8A 4MD7E 4GK4A 4R3CA 4H1MA 3ZBXA 2ITVA 4FODA 3VS7A 3WOWA 2XRUA 5L6OA 3QKLA 5KBQA 4D28A 4FTQA 4O7NA 5CT7A 4IAAA 3IW4A 5BUJA 4LOOA 4FNYA 4LMUA 5IQCA 5CXZA 3D83A 3OXIA 4PPBA 5J8IA 3H3CA 4FZFB 3ZO2A 5AR8A 4EOQA 2IJMA 3F7WA 1L8TA 3RWQA 4HVSA 2B52A 3LFAA 2PMLX 5HD4A 2I0VA 3Q3BA 2R2PA 4S2ZA 3ELJA 1H08A 4EH9A 4TNBA 5KMMA 3CPBA 2WTVA 4HNFA 3ZM4A 3NYXA 5DMZA 4WRGA 5CLPA 3QWJA 2F7XE 2WU7A 3LOKA 4RT7A 4AA0A 5LQFA 5IZFA 4E8AA 1V0BA 2GHMA 2HCKA 2ZV8A 5I9WA 3VUDA 2W1ZA 3ZH8A 3UZTA 3PG1A 3CKXA 2BROA 1Z9XA 2WQBA 3O0GA 4IC8A 4GUEA 4BCHA 4P4CA 4TYIA 4J98A 3R73A 2GTNA 4UMRA 3MWUA 5CS6A 3NVKI 3PA3A 1YXVA 3MVLA 4EK6A 3PVWA 4M8TA 4KBAA 1QMZA 3ZCLA 4EOJA 3Q4UA 4L67A 4R78A 2CMWA 4FKUA 4M13A 4D4RA 4E5AX 2OI4X 4EWHA 4BTKA 1Q3WA 3GQLA 2GPHA 3MY1A 4EYJA 3MJ2A 3RM6A 2VGOA 4YJUA 5AAEA 3DFCB 5FUTA 2R3GA 3FQSA 4FI1A 4I5PA 4NFMA 2WU6A 3VBQA 3VS1A 4FICA 5CAOA 3BLQA 3LVPA 1HCLA 2JBPA 1REKA 4FK3A 5CSVA 5KCVA 4O83A 4DTAA 2WMRA 2J0KA 4JOAA 5CEQA 4CZYB 3QRTA 2J51A 1P2AA 1ZARA 4YZNA 2C6EA 4FSQA 2B54A 3OEFX 1DI9A 3AMYA 5HO6A 4AN3A 2REIA 3VBVA 1W82A 2VX0A 4DFXE 4F1MA 4FZAB 4TWCA 2PVKA 5HKMA 4YHFA 3R0TA 5JK3A 3OCGA 3PFQA 3ZEPA 2JDTA 5IH6A 4CRSA 4W8EA 5A14A 4L6QA 3F5UA 2UW6A 3R30A 4S32A 3TZ8A 5LMBA 4QQTA 4MNFA 2C1BA 3CQWA 4XG8A 2VWZA 4ZTNA 3FZ1A 3PXKA 4IWPA 4CKIA 2JD5A 4MH7A 1JVPP 1J7UA 5E92A 4DYMA 5HU9A 4YU2A 4I6FA 3CTJA 4NJ3A 5TE0A 4R7HA 2WTKB 4AZSA 5GNKA 5EM7A 2BRGA 3NMUF 4XJ0A 1JSUA 3ENMA 1K9AA 3W2RA 3FLNC 2XBJA 1ZZLA 3K2LA 4XV3A 4HVIA 4O22A 1Q4LA 1HCKA 4DG0E 1MRVA 3DPKA 3LPBA 3TDVA 1OKZA 4FTMA 2GQRA 3MPMA 2CCIA 2BVAA 5KMNA 3QTWA 4AXAA 3PYYA 1ZZ2A 3QC4A 5I9ZA 4IM0A 4EHVA 2CSNA 2W0JA 4GMYA 4MF0A 1DAWA 3GFWA 3TV4A 4EZ5A 3FXZA 3WZEA 5M55A 3L8PA 5HHWA 3ZO3A 2CDZA 4KKEA 5ETCA 3NR9A 4X2KA 3TNQB 4XNEA 3U87A 3VF9A 4DLIA 3W8QA 5FEEA 3LQ5A 5AV0A 4CMUA 3R00A 4U0IA 5DVRA 4ZIMA 4APPA 3D5WA 3QUDA 2GMXA 3CEKA 2Z02A 3PVUA 2PZ5A 3QQLA 1W83A 4BC6A 5EHOA 3OVVA 3GENA 2R3JA 2UW3A 3AMAA 2XIXA 2BIKB 3GU4A 3NIEA 3MPTA 3SAYA 2EU9A 5GJDA 2J5EA 5CZIA 3VUHA 2WO6A 3ANQA 3AD6A 4RQVA 2ERKA 2J6MA 4FF8A 1H1PA 2Z7SA 4N6ZA 4R1VA 3QX2A 2UUEA 5EFQA 3W2OA 5IA1A 3DNDA 3BYMA 4QYYA 2C69A 2G2IA 3V8WA 5I0BA 1PMVA 5AR7A 5A4EA 3MA3A 4RJ3A 1YDSE 2XNBA 4AW5A 1JKLA 2RFNA 4GIHA 2CHLA 2UVZA 3HLLA 4HGLA 1YXXA 2XNOA 4EONA 3VN9A 2QI8A 4G5JA 4NUSA 4Z16A 1U59A 4LRJA 4WRSA 3C5IA 3PY1A 2GNJA 4YMJA 4G3CA 4ZJJA 5AMNA 1F0QA 1F3MC 2X9FA 2OJJA 2ZAZA 4TT7A 3R8UA 3DBDA 3EN7A 1PRYA 3ZEWA 2R5TA 1MQ4A 3JXWA 4CFMA 3GU5A 5BYZA 1ND4A 3SRVB 2J0LA 2XF0A 1OIQA 4U3ZA 4EUTA 4QTAA 4PMPA 4GK2A 2UZOA 3E7VA 5EH0A 4A9SA 3K5VA 4O2PA 2XNPA 3GC7A 3RZBA 3FSFA 3NVMB 4RVMA 3KB7A 4IHPA 4UYAA 4YZMA 5LWMA 4G6LA 3HNGA 4WA9A 3IG7A 4Y46A 3QRKA 5FWKK 3RHKA 2W5BA 3HA6A 4L46A 3ZS5A 2OK1A 3A7JA 5FG8A 2VO3A 5HNIX 4GKIA 2X0GA 3UOHA 4XEYA 5L6PA 4FSRA 3Q60A 3ODZX 2H8HA 4NEUA 5AIRA 1FMKA 3OOMA 3KVXA 4IIRA 4OBQA 4I0RA 2QU6A 2JKOA 4FKQA 5ANDA 3RNIA 4D9UA 2EWAA 4E3CA 3FE3A 5DRDA 3CSVA 4F0IA 5DN3A 4Q5HA 4QQCA 4JXFA 3DBEA 1OZ1A 1GNGA 2ACXA 3PJ3A 3AC1A 1JPAA 4L44A 3SOAA 3TNPC 3SRVA 3G33A 2WTCA 5L8LA 4CG9A 2PYWA 5AP4A 3COKA 4FKWA 3OWKA 3W8LA 3UOKA 3VS4A 3QALE 4YUQA 2XBAA 3O96A 5HX8A 4FEVA 3OFMA 1O6KA 2BMCA 2YWVA 5EW3A 4A07A 4KS8A 2BR1A 4R8QA 2W1HA 4YJNA 4I21A 4YTFA 1O6LA 1UV5A 2C3JA 3AG9A 4RG0A 3FHRA 1UA2A 5AR4A 4E4LA 4AFEA 1YHSA 5J9YA 3FI2A 2BZJA 4A9TA 4ALUA 4XG3A 3KCFA 1S9IA 2Y4PA 3V8SA 3UPXA 2A0CX 1GAGA 3WF5A 4BBFA 2FO0A 3QQUA 3QD4A 4GYGA 3R7IA 4C4HA 2GNGA 3LZBA 5M4CA 3HAVA 5HVYA 4PV0A 3MSSA 4QPSA 3OBJA 1SZMA 3PP0A 4YTHA 3FY0A 5IUHA 2CGUA 3LFQA 3AT4A 4BDIA 1OL2A 5T68A 3VS6A 5AUVA 3A7GA 3RCJA 5CI7A 3EQIA 4U45A 3RM7A 3I81A 3PRFA 3MPAA 3GU8A 4OT6A 2GHGA 3TG1A 1PYEA 2J9MA 3EFLA 4G5PA 3C1XA 4DG3E 4PP7A 3GGFA 2Y6MA 3CC6A 3L9LA 3PVGA 3QA0A 2WKMA 4QOXA 5CZHA 4EI4A 4QMQA 5JGAA 1U54B 3DXQA 3VUMA 3MN3A 2QO7A 3EKNA 1NXKA 3IS5A 2C3IB 5FBOA 5HNGA 4AACA 4GEOA 5IH4A 3BELA 1YOLA 4QMUA 5DR9A 2O5KA 5C27A 1XH6A 4R5YA 3NCZA 4RIOA 4WG5A 4I3ZA 2W7XA 3ZC6A 1SVGA 3WARA 2Y8OA 2RFEA 4QT1A 4XRLA 4LYNA 3TV6A 3UGCA 3VBYA 4GK3A 3LIJA 1TQIA 3OTVA 4NWMA 3PP1A 4C34A 2VX1A 1JSVA 3JVRA 5DWRA 4FKVA 2W1GA 2W1IA 3A7IA 4QPMA 4WOVA 4EHZA 2WTJA 3EQDA 5FM2A 4F1TA 3FL5A 4WNKA 1U54A 3MFRA 2W1EA 4M68A 4PDYA 2QHMA 3MVHA 3TUCA 4IFGA 2BHEA 3A4OX 4M97A 1W7HA 4CQEA 2F2UA 5HE0A 5EKOA 3V6RA 1V1KA 1FGKA 1R3CA 2VWVA 3CLYA 4MWIA 5C8MA 5IQBA 4CGAA 2JDVA 3UIMA 3QQKA 4IAYA 3WZJA 4AFJA 4F65A 3UP7A 4QP4A 4G3FA 4AOJA 3FZOA 5M57A 3O71A 4FUYA 2GQGA 3OW4A 3G6HA 2BRMA 4I4FA 3ZU7A 5BVFA 4DFNA 5K5XA 2YACA 2IW6A 3PJ1A 2RKUA 3K3IA 4Y5QA 2IVTA 3BHHA 4F9YA 2NRYA 5C1QB 5ICPA 2VD5A 1M17A 4IVCA 4I92A 3DLZA 2C0TA 2WOTA 3BV2A 3RGFA 3ACKA 2PUPA 2WMSA 3QZGA 4FL2A 3DV3A 4H3QA 1Q24A 3POOA 4IAFA 3QD0A 1WZYA 5GHVA 1XO2B 4LOPA 3V5WA 4XUFA 4DGLC 4PDPA 5IKWA 4QO9A 2GFSA 4EH8A 3FKLA 3F88A 1FQ1B 1BL6A 3ZDUA 3RPOA 3MH0A 4AT5A 3GCQA 4R1YA 4WSQA 3UTOA 1CKJA 3C4ZA 4BIDA 1GIIA 2ITXA 2GFCA 5FXQA 5L2TA 1RJBA 4XOYA 3E62A 4X3FC 5F20A 1LR4A 5AUXA 5EW9A 4M14A 3FV8A 4BCMA 1CTPE 3PVBA 5EYCA 4N70A 4F08A 3R8LA 4XG7A 2BKKA 5I9XA 4D1ZA 3EMGA 2J90A 3SGCA 3ZFMA 5HEZA 3WE4A 2VTPA 1MQBA 4BYIA 2B9JA 5HBEA 3D2IA 4XP3A 3V01A 3OUKA 4FIFA 4H58A 3R7UA 3QKMA 1VZOA 3H9FA 2R3LA 3R9DA 2VTLA 1OIRA 4BCOA 4G9RA 2BILB 3UNZA 4CEGA 4BY9E 2WB8A 4BCQA 1WBWA 3A62A 4LFIA 4FT7A 3O7LD 3CD3A 3BHUA 3VUGA 5HIEA 4FMQA 4RZVA 1URCA 2ZB0A 4XLIA 4FKJA 4EZ7A 4EQUA 3EOCA 5IEYA 4RJ4A 3AC3A 4JNWA 5FLFA 3BLRA 2CJMA 5CU4A 3NPCA 2HK5A 3O8PA 4FL3A 4UMUA 3G5DA 3U4UA 2XB7A 3FLQA 1J3HA 2J0MB 2CLQA 3SG8A 2WIHA 1WVXA 2XH5A 2W1DA 4KRCA 1QPEA 4Y72A 2ZV7A 4NU1A 4ACCA 3KXHA 3R1SA 5DA3A 3ZLXA 5K5NA 3DKFA 4FV5A 4DCEA 2OIQA 2Z8CA 1JKKA 4DH5A 2RL5A 2XIYA 3LJ0A 3QX4A 2F9GA 4FG8A 4RLLA 5AEPA 4CZTA 2PVRA 2X4ZA 4FSNA 3MA6A 4M3QA 1P4OA 1H24A 5HG9A 1OKVA 4C33A 4I0TA 2BTSA 4OBPA 2FB8A 4IDVA 4FTCA 3RPRA 3KEXA 5DG5A 2VO6A 3DKCA 3G9NA 2O63A 4K77A 3F5PA 3UYSA 3BWJA 3QUPA 4A9YA 2PWLA 3RPVA 4ORKA 3Q9XA 4CRLA 5G1XA 2BAQA 5KNJA 4KSPA 4ZY6A 3ITZA 1PKDA 5IA2A 4CZUA 3F66A 3CBLA 3UQGA 2HY81 3OBGA 2YM4A 2VO7A 4ZXTA 1GY3A 5CANA 2YLEA 2C3KA 4C8BA 3AC5A 2I6LA 1X8BA 4DFBA 2Q0NA 3FI4A 4O7SA 4BYJA 4I24A 4IX5A 4IJ9A 4UV0A 3F7ZA 3QQJA 3Q9YA 2R7IA 3B8QA 4W4XA 5ACBC 5I9YA 3CJFA 2W5AA 4PDOA 4FZDB 5FM3A 2VTJA 4TW9A 1YQJA 2J0JA 4WG4A 3G0EA 3IGOA 4E6AA 2QONA 2X1NA 2PVYA 2UZEA 1UU7A 2GHLA 2YDKA 2OICA 3JVSA 5FP6A 3OG7A 2H96A 3EQBA 3TCPA 4RVTA 4P5ZA 5BVEA 4QP7A 5BVDA 5LWNA 4K18A 5H8GA 4A9RA 4ZJIA 2YIQA 2WTWA 2JITA 3CKWA 3THBA 3E3BX 4ACGA 4DH8A 1PXOA 5CU6A 4FV8A 3VBXA 3PJCA 3NAYA 3OXTA 3DQXA 4YSJA 2Y7JA 5D9HA 3ATSA 1FVTA 4ZTMA 3ZOSA 3U9CA 3Q4ZA 3HV7A 3Q5ZA 4PPCA 5DE2A 1XH9A 3V5QA 2C6OA 3MYGA 3KU2A 4V01A 5LVMA 4JQEA 3R6XA 2YISA 4I6BA 3NNVA 4IX3A 3LXPA 2WELA 4Y5HA 5A4CA 1IR3A 5AM7A 5AFVA 2QLQA 4RWKA 5AM6A 4QMWA 3VW6A 4X3FB 2QO2A 2VRXA 1PMNA 4J96A 3RK9A 2BTRA 4AW1A 4EYMA 5AP5A 5AA9A 4O6EA 2UW9A 2VTOA 4O91A 2FYSA 3ORIA 3AT3A 2H9VA 3Q4CA 3IGGA 3FL4A 1NW1A 4TWOA 2XM8A 5EK7A 2BRHA 2I0HA 4O7YA 2OZOA 4R3PA 1UNHA 3H10A 2IVSA 4PL5A 4RWJA 4MXCA 4JG6A 4LV8A 1GZNA 2Y4IC 2I0YA 3E88A 2R3PA 3EL7A 4M67A 2V22A 4JX3A 4PMTA 3UOLA 4ANQA 3EHAA 4C0TA 4C38A 3DTCA 2IW8A 1ZOHA 2H6DA 4O81A 3TNIA 3A99A 4BB4A 4DT8A 5CALA 3RAWA 2WPAA 4HYSA 3WYXA 4DHFA 2VTQA 4IDTA 5EOLA 3I6UA 2BHHA 3V3VA 2ONLA 2GQSA 4FEXA 4X3FA 1PMUA 4QMPA 4IB1A 3LKMA 5CQUA 1L3RE 4MKCA 1ZYCA 1PMEA 2W17A 3A8WA 4IAKA 4OTFA 5CVGA 4ALVA 4ZS4A 1H25A 3EFJA 3HZTA 3KA0A 4WUAA 5BPYA 4F7SA 5I9UA 1YRPA 1LUFA 3NDMA 4FT0A 4FV4A 3GCVA 1T45A 4FV6A 3F3VA 5M4UA 3CS9A 2VUWA 4FKLA 3ZO4A 4JR7A 3KKVA 5FQDC 3TEIA 2EB2A 4CV8A 5CF5A 3MFTA 4M0YA 4EK4A 3ORZA 3S00A 2A1AB 3HMMA 3LXNA 5FXRA 4DFYA 1P5EA 3BWFA 4C37A 3W55A 3IW8A 3LE6A 5EI6A 1IA9A 3FYKX 3TUDA 4IB0A 2QNJA 2P2IA 3ZRLA 4IE9A 1H0VA 4HCTA 3RNYA 3NNUA 3RINA 4D1SA 3VNTA 3TJCA 3NUPA 4BCPA 5IQEA 3U55A 1WBVA 5EHYA 4DA5A 3K54A 1ZY5A 4RVKA 3LQ8A 5HE3A 5CY3A 2PUUA 2O2UA 4YHJA 3PA5A 1OL1A 4C2VA 1VYWA 2HXLA 4Y95A 3G9LX 4UX9A 3O23A 1E9HA 4FOCA 4X21A 5LMKA 3R1YA 1B38A 2BDFA 3C13A 1YXTA 2OJGA 4RJ6A 2XYUA 3RMFA 4FKOA 5BX0A 5L3AA 2ZMCA 1Q8ZA 3DK7A 2PU8A 1JNKA 2J0IA 4HYHA 4WBOA 1ZMUA 2BAJA 4FKRA 5D11A 4AE6A 4YTCA 4B4LA 1LEZA 3DCVA 2YM7A 4HPTE 5ANIA 3SOCA 4FSWA 4AGDA 3KRXA 1OPJA 2CLXA 3Q32A 3DB6A 3A8XA 4AZWA 2A19B 3QD2B 2LAVA 4GV1A 1G8SA 3D2KA 4YZ9A 1XH7A 2W5HA 3ET7A 1PHKA 4EK5A 5F94A 2IO6A 4DGOA 2NPQA 3JPVA 4USFA 1OKWA 3G2FA 3KRJA 2OH4A 4UALA 3TACA 1DS5A 1ZRZA 2WMUA 4JDIA 5E8YA 3FZPA 5DYJA 4AZVA 4E4NA 4FTTA 3HYHA 2C5XA 4CFUA 1WAKA 2C47A 2HWOA 2R3IA 5F95A 3P86A 4O1PA 4DBXA 2J5FA 2YERA 3BV3A 4L53A 3TL8A 2R3MA 3LLAA 3VULA 1JWHA 1QCFA 2UZBA 4FTKA 4C59A 3UIBA 4LQMA 4JDKA 4RA5A 5LCJA 3ODYX 2B55A 4IADA 4WG3A 1W98A 1Y91A 5IA3A 4MQ1A 2FGIA 4C61A 2YAKA 2JDSA 2Y9QA 3HAMA 3VBTA 4KIOA 3NUNA 2E2BA 4UYNA 1ATPE 2VNYA 4KIKA 4DEAA 4EQCA 3FUPA 1AD5A 5TT7A 3EQHA 3I0OA 4BZNA 4FSZA 2UW5A 2WIPA 4I6HA 3U8WA 2XJ0A 2DUVA 5I3RA 4IEBA 5CF6A 3OWPA 4XOZA 4W8DA 3PTGA 3HV6A 3E8CA 2ITPA 1AGWA 4MBLA 3KMMA 5IUGA 4KB8A 4LGGA 1NT2A 2YM3A 3IKAA 5L2IA 3BIZA 2QR8A 2O8YA 3R1QA 3EN5A 4CMOA 4E73A 3KK9A 1WBSA 4CYJA 5HNBA 4IZ7A 5JFXA 1OVEA 3Q4TA 2IN6A 4K0YA 1XH8A 5I3OA 2B0QA 2Y4IB 3F3UA 5IQAA 4K6ZA 4F64A 2F7ZE 3KXXA 4HPUE 4GYIA 3ZLSA 1OKYA 3MVMA 2C68A 1PY5A 4S33A 4RA4A 4DH1A 3DA6A 5HCXA 1R0PA 4ID7A 4UWYA 3NUSA 5TKDA 5LCKA 4LUDA 4G1WA 5J5TA 4AA4A 3NUAA 5B2KA 3F5GA 4D5KA 5AV4A 3ULIA 3VIDA 5BNJA 3OEZA 5EHLA 2R7BA 4G17A 3ORKA 2QOBA 5GZ9A 4YJVA 2RG5A 4O38A 3QXPA 4BBMA 1E1VA 5K4IA 1XKKA 2QURA 3D15A 4NH1A 3ANRA 4KUJA 1DM2A 1OUYA 3PRIA 2E9UA 4IC7A 5E8XA 1BLXA 3MIYA 2FSMX 3HX4A 1XBBA 3LFNA 4PP9A 1UWHA 1WVWA 1Q62A 2IVUA 4FT3A 2VWWA 4RC3A 5JFSA 1AQ1A 3F3TA 5KMKA 4G31A 4R7BA 2RSVA 4K33A 2BFYA 4L68A 4TYGA 3UYTA 5IMEA 5LOHA 1RE8A 3BYUA 4JRNA 4MYGA 3KMUA 4U81A 3RK5A 5JFWA 4K1BA 1CDKA 4UWCA 1YOMA 5JSMA 5AP0A 4MX9A 1A48A 5AUTA 4R77A 4QPAA 4AOTA 1T46A 4BWPA 3C0HA 5M06A 3FLYA 2HWPA 4BCJA 5IQIA 2J50A 5CWZA 4K9YA 2WZJA 3PJ2A 5ETFA 3MY0A 4GT5A 4FTAA 2QD9A 2CCHA 3QXOA 4AT4A 2JLDA 3IW6A 3GCPA 4TY1A 4X0MA 3REPA 3ID6C 4DLJA 2OF4A 1W84A 3DKGA 4ZEGA 5GZAA 2WMAA 3VS2A 5ITAA 4EK8A 2ETRA 3BU3A 4G9CA 4EOPA 4GW8A 4YGAA 2W99B 3BE2A 1KOBA 4RZWA 3G15A 3TDWA 2C30A 4QYHA 4D2VA 2VO0A 5F1ZA 5AP2A 2R4BA 2XNMA 3FLZA 4G6OA 2BDWA 5HVKA 3DDPA 4G2FA 2QO9A 4BZDA 4EOKA 3PE1A 2XJ2A 2R0IA 3PJ8A 4YJQA 4ZTQA 5TF9A 2OFUA 4W4VA 1ZYJA 1SVHA 2R3RA 2X39A 5FP5A 4C4JA 2WXVA 1H4LA 2PK9A 3DGKA 3H0YA 3L9MA 4L52A 2I7QA 5BMSA 3GBZA 2CKPA 4PF4A 2G1TA 2H34A 4BVUA 3VO3A 2EXEA 4NM3A 4CT2A 4XH6A 3HUBA 4OT5A 4AZFA 4NW5A 2WGJA 5AR2A 2W4KA 4CVAA 3MIAA 5K0XA 1IAJA 4A4XA 4Q2AA 3AMBA 4L45A 1WBNA 2JAVA 1PXKA 3JY9A 3M42A 3OD6X 4U3YA 3RAKA 4BL1A 5EQEA 4PNKA 1QPJA 5BUIA 4UB7A 3V04A 3MESA 3BX5A 3OCTA 4JS8A 1OB3A 3KN5A 4HZSA 5HE2A 2C0OA 4JAJA 3SXRA 1ZYDA 3ENHA 2NO3A 3I1AA 1UNGA 4FTJA 3T9IA 3GNIB 3TWJA 1W0XC 1A9UA 2PUIA 3RALA 2IZSA 4L3JA 3EJ1A 4CSVA 2QC6A 4NT4A 3GU6A 3PIYA 5JT2A 2JIIA 4G3GA 4L9IA 4V0GB 5IA5A 2ZB1A 2YCFA 3K3JA 1FVVA 5E1EA 4I5MA 4U8ZA 4XYFA 3R8PA 1YI3A 3SG9A 4CCBA 2RFSA 1SMHA 2YDIA 3OWLA 4C58A 3COMA 3PPJA 3DJ5A 3UQCA 4FKSA 4J8NA 4EKLA 3NX8A 2GDOA 2OWBA 4PQNA 4YLLA 2C6TA 4TYJA 3VC4A 2QR7A 4AG8A 3UO4A 4BDCA 4EZ3A 3Q6WA 5ANKA 4NFNA 5H8BA 2QODA 1MRUA 2HZ4A 3QWKA 4B7TA 4NZWB 5DPVA 2WTDA 2YCQA 4WKQA 5DEWA 1OPKA 2VTMA 4U41A 4F9BA 5FD2A 4BDHA 2BPMA 2GNHA 3EQPA 4DEDA 4ZLYA 4AUAA 3JY0A 4MWHA 2HAKA 3GC8A 5E1SA 3Q9WA 4YBJA 4H3BA 2PE2A 3ZZEA 4ASXA 4F99A 4V0GA 4B8LA 2OIBA 2FUMA 4YHTA 3PXZA 5CXHA 2ITQA 4JQ8A 5L6WL 1QPDA 5KMJA 2ZM4A 3QCQA 1O6YA 2OKRA 2UV2A 4N57A 4CG8A 3LFSA 4XCUA 3LMGA 3P5KA 4MTAA 3Q9ZA 3ZUUA 4FE2A 3TT0A 4C2WA 2YFXA 3R8VA 2IZTA 3E8DA 3FLSA 4BN1A 4EH6A 4FSUA 3LFFA 4C35A 5IA4A 1M2PA 1YWVA 4FGBA 4D55A 3ZSIA 3GUBA 4O0YA 5DI1A 3D0EA 2JEDA 3P08A 5GJGA 4BDJA 5D10A 3IW5A 5CAQA 3DT1A 4LUEA 4LGDA 4MD9E 2F2CB 2JKMA 3DK6A 3PZEA 4NCTC 4D1XA 3MTLA 3UZPA 5C8KA 5K9IA 4JVGA 5J1VA 3OTUA 4R5SA 4F9CA 5IMXA 4IXPA 4C02A 2P3GX 4FKGA 2YAAA 5E8TA 1Y8GA 3ZBFA 4YJOA 2CKOA 4BCKA 1ZY4A 2QOKA 3QAME 5KZIA 4DEIA 4MHAA 4AZEA 2YIXA 2O65A 4EBVA 4ZLOA 2ITNA 1FOTA 3NS9A 4NW6A 4AX8A 5G6VA 2GCDA 5JGDA 3OCBA 4FV1A 2WTIA 3GCSA 3MW1A 3OZ6A 2ZM3A 4FBXA 3OXZA 4BRXA 3UNJA 1NVRA 1IG1A 4C4EA 3HMOA 3IECA 1OL6A 4QNAA 4S31A 3F2NA 4L7FA 3SHEA 3C5UA 5H9BA 4BI1A 5K4JA 4NM0A 2CPKE 3FY2A 1CSNA 5HE1A 5KHWA 2FSLX 2WQEA 4FV7A 5EG3A 5HICA 2YJRA 4L42A 3UG1A 3EQFA 1H0WA 4QMOA 5I5ZA 2XNGA 4PTGA 3I7CA 1TKIA 2X7OA 3MY5A 4BDBA 3EZRA 4FZ6A 5T3QA 4QP3A 3SW7A 1PKGA 5CNOA 4PUZA 1P4FA 4NL0A 4CMTA 2F49A 2GS7A 4E6QA 5CEOA 2OXDA 2XRWA 3T3UA 1H1WA 3NNWA 3KF7A 4KINA 4NIFB 3GXLA 4P90A 4QP1A 4ZJVA 5DGZA 4FSMA 3ETAA 2BZIB 3ZHPC 3LCDA 3T9TA 4DGMA 3IOKA 4X2JA 1KUTA 3RPSA 3BGZA 4ZSAA 2J7TA 3MH3A 3UO5A 2R3FA 2WMVA 3TNHA 3SLSA 5E8ZA 3C50A 3ZYAA 2PZPA 1KSWA 2YIRA 1NVSA 4FSTA 5EDPA 2IWIA 2PPQA 1KE5A 3H9RA 2J4ZA 4JX7A 4OTRA 3DK3A 4C57A 3LFEA 2EB3A 4Z55A 1FGIA 3R8ZA 1UU9A 3LCSA 2WNTA 3VJNA 1OL5A 2VTRA 3BYSA 3FMNA 1JBPE 3E64A 4XMOA 4O0UA 4AU8A 3I7BA 4WNOA 4IAIA 3ULZA 4A4OA 4OTIA 5LVOA 2OJFE 4FEUA 2B53A 2B9IA 1Q5KA 3FHIA 4HZRA 4X6RA 3FI3A 2UZDA
chains in the Genus database with same CATH superfamily
4MBIA 3R63A 4CFFA 2W06A 4MAOA 3NIZA 4CD0A 4RX8A 4DEEA 3TMOA 1XH4A 5JN2A 1VYZA 4BGGA 2P55A 3PIZA 3Q04A 4IZYA 1DAYA 2UW8A 5IU2A 5E9EA 4JIKA 5C8NA 1ZMWA 1ST0A 2RFDA 4FNXA 4XV1A 4LL5A 4BGQA 4O0VA 4LMNA 4KS7A 2PTKA 4FL1A 4ZY5A 4H39A 3OY1A 1FMOE 3AOXA 3F69A 4FC0A 2VWUA 1OGUA 4II5A 4QMMA 4YJSA 3UIXA 3P1AA 4RIXB 2YIWA 3ZMMA 4BCGA 5FBNC 3NYVA 4RVLA 5HTCA 3DAEA 5IISA 3BU6A 2YHVA 5HBJA 5E4HA 3R21A 3SC1A 5LXMA 4QP2A 4E1ZA 2YCSA 3MH2A 4I6QA 2EXMA 5D7AA 3W2SA 5IUIA 4F4PA 2O64A 3FMKA 4S34A 3VF8A 4LM5A 4J97A 1KWPA 3F9NA 2XAOA 1KV2A 2C0IA 3OWJA 3WF6A 3P5JC 5JH6A 2A27A 5L8KA 5AUUA 4FA2A 2IW9A 2HOGA 3MS9A 2OFVA 4O0XA 3O8UA 5CSXA 1YHWA 3MBLA 5JFVA 4RC4A 3QA8A 2QOIA 3LXKA 2CKQA 4ZSJA 4RFYA 3R7YA 3AD5A 4QTCA 5EDQA 4EWQA 4O0TA 2YN8A 3V6SA 4ASDA 3DXPA 3GU7A 3R9OA 4MEDA 1OIYA 2VGPA 3B8RA 2XCHA 1R78A 5HI2A 2C4GA 1YXUA 3D7ZA 4HNIA 3WBLA 3CP9A 5C01A 3ZONA 5IA0A 1G5SA 1JLUE 1ZAOA 3HRBA 3COIA 3NYOA 2C5NA 5KX8A 2CNUA 3UC3A 3ZSHA 2R64A 3C4FA 4JT3A 1I09A 4FTLA 3PY0A 3GQIA 3LLTA 3QRIA 2X2LA 3ZUTA 4EQMA 2G15A 2W96B 5KHXA 2IG7A 3C4EA 4AP7A 4GKHA 4HGSA 3II5A 4FIEA 4YZCA 3VRZA 1XBAA 4OAUC 3C0IA 3E8NA 3DBQA 3QCYA 4XV9A 4JAIA 2WOUA 4KABA 4C7TA 4PX6A 2CGVA 4B8MA 4O0RA 3E5AA 3QQGA 1CMKE 4JG7A 3D5XA 4X3JA 5ANEA 3ZZWA 3PY3A 5HD7A 2C6DA 4GL9A 4BWXA 5B7VA 2VV9A 4KSQA 5FRIA 3NZ0A 1EH4A 3VAPA 5DFPA 4EKKA 2UVXA 4NCTA 4EOMA 3ZM9A 4B9DA 3PSDA 3U54A 5E8SA 5LMAA 2JIUA 3FMLA 4ERKA 1RQQA 4Z9LA 4TPTA 4HGEA 3A7FA 1ERKA 5E8WA 4ZMFA 2XNNA 4YJTA 3EQCA 2VWIA 2EVAA 3BQCA 3S2PA 4F63A 3R2YA 4FYOA 3VS5A 2Y0AA 4KBCA 1G8JA 3M2WA 5HOAA 4I6LA 5IPJA 3IQ7A 3ZUVA 1GIHA 3C4XA 4U97A 5CEIA 4GG5A 3W1FA 1P14A 2FA2A 5CASA 4LDTA 2PY3A 1XMLA 2J2IB 2EXCX 4W9WA 4DC2A 4M69B 5E7RA 1PF8A 5C4KA 4EOOA 4GU6A 4FTIA 4RWIA 3DJ7A 3HGKA 4RIWB 4XP2A 4YO6A 5D12A 5AUWA 5FTOA 4FUXA 4U79A 4E5BA 5E90A 4EHEA 2BIYA 4IM2A 1H01A 1JQHA 3ZLWA 2GS2A 4E6CA 4D2TA 4MF1A 4F6SA 2JC6A 4QMTA 5CT0A 4J71A 4LRMA 4UEUA 1H8FA 4DDIA 2PZIA 4OTQA 2PVLA 3NW6A 4GS6A 4YURA 3FMEA 1YHVA 3EWHA 3IDBA 3DBCA 2Z7RA 4H1JA 4ITIA 4QNYA 1OBGA 2OLCA 4DCAA 4FV3A 4ASEA 4AT3A 4I41A 3CD8A 2V0DA 3VS0A 2XK9A 2PMNX 2QLUA 2W4OA 1YWNA 3CY3A 4LGHA 2PUNA 1JAMA 4Q5EA 2X9EA 3KGAA 4EK3A 3TZ9A 3PPKA 4WHZA 3U4WA 1XHAA 4UMPA 3TTIA 4Z7HA 5F9EA 3NFFB 3EN9A 3ERKA 4J99A 1J91A 4A4LA 4R6VA 1OPLA 2XK3A 1H1RA 4CFVA 4FTNA 4J53A 3ZDIA 4CFXA 4DAWA 3A7HA 4O21A 3IONA 4DG2E 2SRCA 1H27A 5A3XA 1KE9A 3QFVA 4O1OA 2UW4A 2ETKA 2WQNA 2B7AA 2AUHA 4ZZMA 1PXNA 4YP8A 3HDNA 2UW7A 3ZTXA 3QCXA 4APCA 1NY3A 3C7QA 4RQKA 4DGGA 4F09A 4JDHA 4RRVA 3EYGA 4CV9A 5CVHA 5E8UA 2BZHB 2XK8A 3EL8A 3QRUA 4FT9A 3EN4A 4YPDA 5DR6A 3W32A 5M4IA 4I5CA 4DE4A 4GVAA 2HELA 3MTFA 4GT4A 4U44A 5BYLA 4WIHA 5LJJA 3HMPA 3FWQA 2XK6A 4H3PA 4DH3A 4RLKA 2ERZE 5E91A 3EN6A 4FV9A 4EOIA 3TIZA 3QTXA 3KF4A 2VTAA 1UNLA 5DLSA 3RKBA 4CQGA 4DGNA 4XRJA 1ZLTA 2DQ7X 4O7RA 3UVPA 4D5HA 3BHVA 3GEQA 4HCUA 3U9NA 4XG6A 2ETMA 3GI3A 4RX7A 1PXIA 5JRSA 4D58A 5K0KA 5M56A 4ONAA 4FSYA 4HOKA 2QG5A 2OXYA 1M2QA 4X2FA 4OBOA 3R7GA 4Z7GA 2Q83A 3ALNA 2DYLA 3TZ7A 3LJ2A 4TL0A 3H4JA 3S0OA 3QL8A 2ITWA 3LFBA 3V5TA 3QD3A 2RIOA 2GNFA 4QMNA 3W0QA 1Q99A 4XBRA 1BI7A 4D4YA 4D4VA 3FMMA 4M7IA 2XKCA 4QRCA 4HGTA 1REJA 4O96A 2OH0E 2W05A 4AA5A 1U5RA 5AWMA 1Q8TA 4B6LA 4JBPA 3ZC5A 2CNQA 5AV3A 3IW7A 3KRLA 4NTTA 5CVFA 1XQZA 4P5QA 4GUBA 5AAFA 4OAVB 2R3NA 3FXWA 4AXEA 4KIPA 4FYNA 4O27B 2X8DA 4CXAA 3BZ3A 2OU7A 3AQVA 5HLNA 3RCDA 3BEGA 4E5WA 3BL9A 3R2BA 2X0PA 5IH5A 5GIOE 2PL0A 3TM0A 2G2FA 1XR1A 2WMWA 4GFMA 4LG4A 2R9SA 5B2MA 4P2KA 1ZWSA 4GIIA 4BDKA 1PXPA 1TZDA 4TYEA 5HESA 4I0SA 5AR3A 2OBJA 2QOHA 4AQCA 2BRNA 1H1SA 3CPCA 4BDGA 5ETIA 3I0QA 1IAHA 5DH3A 2BZKB 4AS0A 5IQGA 1GZKA 2B9FA 4N6YA 5CSHA 1NVQA 2PE1A 5M07A 3D94A 2PVJA 5KMOA 4IX4A 4E6DA 2QHNA 2WMQA 3E92A 4GFOA 3LAUA 2JBOA 3D14A 4J52A 1Q8UA 1M2RA 2UZLA 3N4VA 4BDDA 3HP5A 1DI8A 3PG3A 3PWDA 4ZZNA 2XJ1A 3W18A 4IW0A 1CKPA 3CIKA 3N51A 2ZV9A 5HO8A 4OLIA 4YPSA 4AGCA 5CAUA 1UWJA 4AWIA 2ITUA 4AW2A 3SVVA 1QPCA 4IB5A 3PE2A 3OMVA 3PXYA 4J8MA 3R83A 2FSOX 4H05A 3WIGA 3KFAA 3VUIA 1Q8YA 1UU3A 4KKHA 4M0ZA 3L9PA 1YVJA 4L3PA 1JKTA 3M11A 4HCVA 1PXMA 3QYWA 4ZY4A 3PZHA 4IJPA 4U6RA 3I60A 4F70A 3FPMA 5CEPA 2YEXA 3LCKA 4FG7A 3RZFA 4G6NA 3FI8A 5C26A 4MK0A 4O7LA 2X6EA 4D2WA 4D2RA 4O7VA 5IQFA 3BQRA 4IWQA 1RW8A 3KN6A 4JIAA 2HZ0A 2XKDA 3QU0A 2E9VA 1YI4A 5GJFA 4ITHA 5DHJA 1JOWB 5CEKA 3TZMA 2HIWA 2I40A 1Y8YA 4MXAA 4OTWA 4E93A 4BJJB 5EM8A 2NNWB 3R71A 3CCNA 3LM5A 5L4QA 3NNXA 4IH8A 5M08A 4G3EA 2JKQA 2XK4A 3T8OA 3VS3A 3RBWA 3AC2A 3ZXZA 3GCUA 2VU3A 2UZWE 5HG5A 3WF9A 3FZSA 4L7SA 4FTOA 4TZRA 2R3QA 3KIOC 2X7GA 3ACJA 3HKOA 3Q5IA 3QC9A 3V5JA 3VQHA 3BPRA 4A06A 4MXXA 1APME 3N4UA 5FXSA 2BCJA 4E26A 4RBLA 3HVCA 2WMBA 2ITTA 4YJPA 3VWAA 3MFUA 4TRLA 4BIEA 4YJRA 1SNXA 3QTZA 5H2UA 5K3YA 3RPYA 5D7VA 5FDPA 1H00A 3WF8A 2XIRA 1FBNA 5KBRA 5CU2A 3W2QA 5CSPA 3R22A 5IDPA 1I44A 4MXZA 3O17A 4DN5A 3HRCA 3FKOA 3DKOA 4IZ5A 1GZOA 1YW2A 3MVJA 4UY9A 5JMSA 3U6HA 5L2QA 4O2ZA 2BUJA 4JQ7A 3WZKA 4ERWA 2E9PA 2XUUA 5HO7A 1U5QA 2E9NA 4TWNA 4YNEA 4NYEA 4DEHA 3COHA 4QP9A 1ZOGA 3IDCA 3SV0A 5AR5A 3MH1A 2ZJWA 4CFWA 4IVBA 3KQ7A 4D0XA 3U6JA 3BBTB 3GFEA 3IOPA 4I1ZA 2QOCA 4JDJA 3WILA 4JRVA 4BGHA 3AXWA 3GP0A 3BI6A 1BKXA 3FQHA 3NUXA 3RTPA 2BAKA 3SXFA 3FDNA 1M52A 2AC3A 2YA9A 4F7JA 2YZAA 2XA4A 5CYIA 1E1XA 4I4EA 4C36A 3PFYA 3TIYA 1QL6A 4C3PA 1PXLA 4ANBA 3KREA 4FGRA 5CSWA 4DTBA 4KWPA 3G0FA 2CKEA 2QOLA 3G90X 3F5XA 4FVPA 5ACKA 1W2DA 4PTEA 3IO7A 2WEVA 3F61A 3UIUA 1SNUA 4DFUA 3DTWA 3DXNA 1NA7A 5AV1A 4FKTA 4ZZOA 2OSCA 3LFCA 4Y73A 1VEBA 2E9OA 2HXQA 3LCOA 3WIKA 4BFMA 3W2CA 5EI2A 4I94A 4L8MA 3P0MA 3DAJA 2ITYA 4WT6A 1URWA 4TYHB 5AJQA 4EJNA 3LMHA 2QU5A 3OCSA 1F5QA 3S4QA 3RK7A 1R1WA 5J79A 4PL4A 1BMKA 4L3LA 2P33A 1R39A 2PMOX 4GH2A 4ZP5A 5I4NA 4RGJA 5TOZA 3U6IA 4DTKA 5FGKA 2ZMDA 5DEYA 3C4WA 4F0FA 4FG9A 4ANSA 2OJ9A 3BGQA 3KULB 2W9ZB 5DIAA 2PZRA 2C1AA 4K2RA 4FK6A 2I0EA 2GS6A 3F6XA 5AV2A 3TN8A 4IZAA 5HBHA 4BCNA 1Q61A 1KE7A 4KIQA 2JFMA 2PZYA 2ZYBA 3B2WA 2P4IA 3UC4A 3FAAA 4A9UA 1U4DA 3GC9A 4CCUA 2Y6OA 4QYGA 4PMSA 4TYHA 1WMKA 3AD4A 3U51A 2HENA 3BBWA 3SDJA 5HZNA 3N9XA 2ITZA 2A4LA 1RDQE 3C4CA 1ZMVA 3R9NA 1S9JA 4Q9ZA 3LXLA 2YDJA 3ORTA 1K3AA 3MI9A 2X2KA 5EI8A 4C4IA 3R1NA 3WZDA 4YSMA 3SA0A 3KULA 4OTHA 5BUEA 2C5YA 5C9CA 5A6OA 3VRYA 5HLPA 4BBEA 1YDTE 3OHTA 3I6WA 3HA8A 3P7CA 4FVQA 3UG2A 3BU5A 3OT3A 3HV3A 4XG2A 5J7BA 2OW3A 3NYNA 4U5JA 5J95A 1J1BA 2VWBA 1J1CA 3ORMA 2VWYA 4NJDA 5DBXA 3OF0A 3EH9A 3R01A 4IBMA 3QRJA 5T6KA 3IPHA 4J7BA 3VQUA 5GINE 4QTDA 5DRBA 5C4LA 1W8CA 1ZOEA 4UBAA 1Q41A 4M15A 3DAKA 4Y8DA 4F6WA 3JS2A 3EQGA 3Q2JA 5EQYA 4JL9A 4OUCA 1FINA 3PDTA 3QQFA 2IZUA 5DNRA 3R9HA 4F1OA 3CGFA 1KOAA 4PL3A 3I5NA 1U46A 3EB0A 3QKKA 4L00A 4CTCA 5JQ8A 3KMWA 3QYZA 4BHZA 4DINA 4DHZA 4QDEA 3LCTA 4J95A 1YXSA 5ANGA 2V7OA 4RX9A 4QMXA 3KVWA 2RG6A 1XH5A 3QZFA 1ZYLA 4U7ZA 5DOSA 3NFGB 4HVGA 4JBQA 4E7WA 5GZ8A 4USDA 3GC0A 4LL0A 4WNPA 4EOLA 3VW8A 4FIHA 4RWLA 5BVNA 3TKIA 3TUBA 4U80A 4CTBA 3KY2A 5A4TA 5A4LA 3P7AA 4UMQA 3D7TB 3VUKA 4HVHA 1FPUA 1Y6BA 4V04A 1VJYA 5IG1A 3ZRKA 4IANA 2ZM1A 4JBVA 4PTCA 1MRYA 5D41A 2ESMA 2AYPA 3B2TA 3HV4A 1UKIA 3ZO1A 3NEWA 5L2SA 3S1HA 4WNMA 4JJRA 1UVRA 3FXXA 5M4FA 4TKSA 5CAPA 3DB8A 4BI0A 2JAMA 3F3WA 3K5UA 2JIVA 1BI8A 3BHYA 3BLHA 3L8XA 3HUCA 3JR1A 4ACHA 3ORLA 3A61A 4NM5A 4GRBA 3NCGA 1OECA 2VZ6A 4BTMA 1KV1A 2XS0A 5H3QA 5M51A 2UZUE 3ROCA 3ZSGA 4XG4A 3RJCA 3CQEA 1H1QA 5DT4A 4BKZA 5EYKA 3D5UA 4AGWA 2WMTA 2XVDA 3KXZA 5BVKA 2GU8A 5HCZA 2XK7A 4EORA 3O51A 2C6IA 1TQMA 3UVQA 4G34A 4ZLZA 2ZOQA 4IFCA 2VTNA 3QTRA 3A4PA 3L1SA 4CYIA 3D7TA 1Q8WA 4O0WA 4RPVA 3TXOA 4QQ5A 3LW0A 2VTIA 3PUPA 4RJ8A 2CN8A 2C3LA 5B0XA 3UDBA 1CKIA 5CF4A 4CKRA 3UQFA 5J87A 4F9AA 3DS6A 4KA3A 4K11A 3UOJA 1UKHA 1A06A 1BYGA 2DWBA 4IQ6A 5HG7A 4EH3A 2A2AA 4MVFA 3FC1X 2Z7QA 5KMLA 5A4QA 5HIDA 2F57A 4FNZA 3UO6A 4EHGA 3MJ1A 5KUPA 2PULA 3FEGA 5FTQA 3CY2A 3EFKA 3QQHA 1SVEA 4QMLA 4YR8A 5J5SA 4OTDA 3CE3A 2VWXA 4V05A 2C5OA 3RP9A 4YZBA 3KK8A 1GIJA 3CJGA 4XHKB 3AC4A 1O9UA 1ST4A 3QHWA 4FV2A 4UXQA 4W4WA 4FX3A 3DU8A 1IRKA 4DF3A 4IVAA 4O84A 4BTJA 5IEXA 5JZJA 4U9AA 1Z57A 1SM2A 3PXFA 5CTPA 3TV7A 4IWDA 4O0SA 3V51A 5IQHA 4OR5A 3QLFA 5AP3A 3S3IA 2YLFA 4C3FA 3HRFA 1LEWA 4X6QC 3PLSA 2QOOA 4FRFA 4BICA 2XZSA 4AZTA 4F7LA 4JR3A 2PVHA 5J1WA 2YZLA 3R28A 2OO8X 5EYMA 4ASZA 5EM6A 4P7EA 4B99A 3I79A 1XBCA 3NAXA 3DDQA 3Q53A 3ALOA 2YM6A 2W1FA 4GCJA 3ZLYA 4I22A 4IX6A 5ANJA 4I20A 4FIJA 3FPQA 3RWPA 2Z60A 4A7CA 2IZRA 3WI6A 5EM5A 3ML1A 4ALWA 2XYNA 1V0OA 2UZNA 3DOGA 3QHRA 4YTIA 5HORA 5M09A 3POZA 3NLBA 3PLAE 2X8EA 4EH4A 3P78A 2XEZA 3GVUA 4IACA 5L2WA 4OTPA 4YC6A 5AP7A 3GOPA 2XIZA 3QF9A 4MNEB 5BVOA 1YDRE 1Q3DA 5J7HA 4X2NA 5AA8A 4QYFA 4ENYA 2XMYA 3OC1A 4FKIA 3ROYA 4Z3VA 2DS1A 3QTIA 5DT0A 2QQ7A 5HCYA 2JDOA 2C6MA 2UVYA 2X6DA 2JKKA 3DBFA 3ORXA 3LMIA 5AP6A 3UODA 2V7AA 4JLCA 4L43A 3KXMA 3R02A 3QLGA 4I93A 4B0GA 4HYIA 3A2CA 5AUYA 4E4XA 2QKRA 2XCKA 3Q6UA 4BHNA 5KZ0A 2QOQA 4I23A 4NIFA 3HMNA 3W33A 3LQ3A 4IVDA 2QVSE 4XBUA 4YBKA 4LV5A 4IMYA 3L8VA 4ACMA 1PJKA 2HYYA 4BZOA 4ITJA 4DBNA 5KKRC 4QP8A 4ZSGA 4H36A 4O7WA 1R0EA 5AUZA 2UW0A 3CGOA 4MNEA 3ZXTA 3VHKA 1STCE 1W2FA 4DHIB 4TTHB 4BIBA 4J1RA 4X7QA 3E87A 2QCSA 4RFZA 4PRJA 4ZSEA 3KCKA 4RIYB 3RHXA 5D1JA 4DFZE 5HU3A 3EIDA 4AAAA 1PXJA 4ZTSA 2HZIA 3O2MA 2IVVA 2YCRA 4M66A 4QTBA 4D2SA 5AADA 2VNWA 3UJGA 3VVHA 1OBDA 3FZRA 2UZTA 4M12A 3HECA 2ZV2A 3R8MA 5CU3A 3TTJA 1PYXA 2BDJA 4RJ5A 2PHKA 3MDYA 2VTHA 3FMJA 5LVNA 2PMIA 2R0UA 2V55A 1WFCA 4FZ7A 4O4EA 5DR2A 3BGPA 4O6LA 4I5HA 4RX5A 2XP2A 4D0WA 3I5ZA 2BRBA 3BCEA 3O7LB 4AE9A 5A9UA 2WQMA 4FNWA 4HYUA 4KAOA 2CGWA 2Q0BA 3OW3A 3QGYA 3MB6A 2OIDA 4UZDA 3R7EA 4YO4A 4HW7A 3FMHA 1IASA 5L8JA 4BDAA 2WQOA 1WBOA 2C5VA 4Y85A 5F4NA 4DT9A 4OGRA 2VN9A 3FBVA 4NKAA 4RIYA 5CEMA 1Q97A 2HZNA 2R3OA 5FDXA 4KRDA 4UN0C 2G01A 3LHJA 1Y6AA 3FJQE 2VAGA 1ZYSA 5EKNA 3PWYA 4NTSA 4TNDA 4UWBA 1CM8A 3LJ1A 1K2PA 4RIXA 4NM7A 3TI1A 4GVJA 2ONLC 3QBNA 4GT3A 3V5PA 3SX9A 2WHBA 2Z7LA 2XKFA 3GB2A 2PVNA 3R9RA 4WBBB 3NSZA 3WZUA 2CNVA 3SKCA 3ORNA 1Y57A 5BVWA 4CT1A 3E63A 4GJ3A 4WUNA 1OIUA 1OM1A 3RI1A 4IM3A 3DFAA 4XX9A 4DFLA 5HLWA 5LVPA 1WCCA 3NWWA 4F0GA 2IPXA 3KXNA 2YITA 3BKBA 2CN5A 4X2GA 4MCVA 3P23A 4CLIA 1XJDA 5LVLA 4FIGA 1OITA 3JUHA 4Q9SA 2ZDTA 1H28A 4BKYA 2XALA 4ANMA 1WVYA 3KC3A 1ZXEA 4DITA 2FH9A 2OXXA 4G16A 3CTHA 4RMZA 4BF2A 4RSSA 4BTFA 4MBJA 4D9TA 1OL7A 3VBWA 4YLJA 5EQPA 3BE9A 2JFLA 5EOBA 3UMXA 4ZTHA 5KMIA 2QOFA 4MXYA 4QQJA 1WBPA 5H8EA 4KBKA 3UBDA 5TR6A 2XAMA 4FTRA 1KE8A 2KTYA 3GOKA 3TJDA 4EC8A 3I4BA 5JQ5A 4XG9A 2YM5A 4N4SA 2W1CA 3O50A 4W4YA 2HY0A 3HL7A 3M1SA 2ITOA 2ZVAA 4YLKA 3NUUA 3T3VA 3KL8A 5AX3A 3IDPA 5HG8A 3D4QA 4MQ2A 4O4CA 3TNWA 4HJOA 4NK9A 2BFXA 4EH7A 2GNIA 4TWPA 3DZOA 2X81A 5LMKC 2NRUA 4FR4A 1H26A 4BWKA 4EOSA 3BRBA 4ZK5A 4NKSA 4C4GA 4RC2A 3OOGA 4CLJA 3P9JA 3F2AA 1BX6A 3Q52A 3Q96A 4QTEA 3W0SA 3FZTA 2LGCA 3DJ6A 3CR0A 4RJ7A 2WEIA 5ANOA 4FEQA 4FIIA 1IA8A 2W4JA 3CQUA 3O8TA 4EH5A 3NGAA 3ZRMA 5DT3A 3QTSA 3F3ZA 4N0SA 4QYEA 4Y83A 4BDEA 1J7LA 4YC8A 4PWNA 1G8AA 4BKJA 2CGXA 4OTGA 4EC9A 5M53A 5AIKA 3Q2MA 4ZMEA 4QMZA 3WE8A 2VTSA 1M14A 4UXLA 5A54A 5CF8A 5IDNA 3E8EA 3OS3A 3OP5A 3SD0A 5J9ZA 3MGYA 4CFNA 2GTMA 5CU0A 4F6UA 5EDRA 4FKPA 1G3NA 3E7OA 5BQ0A 2XARA 3HEGA 2VTTA 3OT8A 4KNBA 3SW4A 3AGMA 3MFSA 2PE0A 3AT2A 3NRMA 4D4SA 1V0PA 5KKRB 4EEVA 3UZRA 3G6GA 3FQEA 4FTUA 4ZSLA 3RAIA 4ZAUA 4U42A 2BALA 2B9HA 3NUYA 4KKGA 2VX3A 4M69A 3A60A 4GJ2A 1BL7A 5I9VA 1VR2A 1J7IA 4RIWA 5CENA 5KE0A 1YOJA 2B4SB 3KXGA 5EYDA 2G9XA 3VHEA 4ZTLA 4BR3A 4BDFA 2W9FB 4AN2A 3JYAA 2OZAB 3MV5A 4XLVA 4DEBA 4CNHA 1H07A 4F7NA 5E8VA 4ANOA 1UU8A 4IB3A 3KRRA 2WD1A 4USEA 3PIXA 4PY1A 3LFDA 4PPAA 4EBWA 3BYVA 2YABA 3DLSA 4K8AA 4S30A 2HW7A 4IWOA 2C6LA 3RAHA 5CI6A 2AC5A 4ANNA 4IAZA 2O0UA 1OUKA 3PSCA 3RVGA 3NW7A 2WMXA 4MXOA 4O86A 4UZHA 1YI6A 5HQ0A 1GOLA 4FVRA 4AW0A 5B2LA 3WYYA 1HOWA 1TQPA 4FOBA 4JI9A 3E3PA 5FEQA 1KE6A 3LM0A 5AP1A 5J9LA 2Z2WA 4R3RA 1BUHA 3ZFXA 3HV5A 5TO8A 2X2MA 5HVJA 2OG8A 3BHTA 3R04A 4JG8A 4LOQA 4EUUA 5LARA 5M44A 3UNKA 3DZQA 4AOIA 2KULA 2OF2A 4WO5A 5JKGA 3N4TA 2OZAA 3ORPA 4E20A 3F82A 2X8IA 5AAGA 1YWRA 4C62A 5BV3A 4AF3A 3EZVA 1WBTA 2XKEA 3FMDA 2V5QA 3PSBA 1MP8A 3EQRA 5CQWA 4LRKA 3SQQA 5FTGA 2PVFA 5JRQA 4CKJA 3DNEA 5HTBA 4KD1A 5HTIA 2GNLA 1OMWA 2PSQA 1LPUA 1FVRA 4BCIA 5ETAA 3UPZA 4AGUA 2WAJA 3H0ZA 3C51A 4ARKA 5A46A 1LP4A 4L01A 3ZFYA 1MUOA 3MB7A 4QMYA 4AN9A 2G2HA 4F9WA 3AKKA 5BMMA 4JBOA 4EL9A 5CAVA 4O7TA 4NSTA 5AX9A 4GU9A 2NP8A 4MD8E 3NW5A 5CX9A 5IF1A 4ANLA 3QTQA 4U40A 2YWPA 3EYHA 4M84A 4R7IA 4GG7A 3TKHA 1OI9A 3G51A 4TXCA 3ATTA 1JSTA 3P4KA 2R3HA 3DY7A 3D9VA 2QG7A 4QP6A 4QMSA 2WFYA 3FYJX 3W2PA 4HVDA 5A6NA 2O3PA 3QZIA 5IEVA 4PNIA 3S95A 3QUEA 4GFGA 1Z5MA 3IK3A 3SXSA 1IEPA 4TN6A 4ENXA 3BYOA 2P2HA 3W10A 4LI5A 2F4JA 3QZHA 4WSYA 3VJOA 1JKSA 3HMIA 3W0NA 1GJOA 2BKZA 4YC3A 4DEGA 1M7NA 4EH2A 2HW6A 3AC8A 3C0GA 3CXWA 1GZ8A 3OY3A 4BI2A 4C3RA 5HX6A 3UVRA 2UZVA 3PXRA 5HGIA 3C9WA 2FSTX 3EFWA 3EKKA 4F78A 1B39A 1PW2A 3HDMA 4RFMA 4FT5A 1TVOA 4YZDA 3QCSA 2XNEA 3R7VA 4W9XA 2X7FA 4QD6A 2GSFA 4PDSA 3PA4A 4ZTRA 3QTUA 5KO1A 5JEBA 2WTKC 3P7BA 3FLWA 1VLRA 2YIYA 3FSKA 4PMMA 5CNNA 4DH7A 3CTQA 2I1MA 3UE4A 4C4FA 4AXCA 4ZOGA 5JZNA 2EUFB 3AGLA 5IQDA 2YJSA 2QKWB 4GSBA 4OW8A 3KRWA 3E93A 3DQWA 4FEWA 4O82A 3AKJA 3UDSA 2B1PA 3VUTA 4ACDA 2OJIA 1B6CB 2P0CA 3FKNA 2XIKA 3L9NA 2YM8A 3OUNB 5HIBA 4U43A 3UP2A 4WD5A 1YKRA 5FEDA 2JGZA 3P79A 4BCFA 4FV0A 3V8TA 3OROA 2X4FA 4ZS0A 5C03A 4EJ7A 4YNOA 2XEYA 2ZDUA 2PVMA 4XS2A 2FVDA 2V62A 3W16A 4E4MA 3V5LA 5GIPE 3BEAA 5BYYA 2F7EE 3L8SA 5JGBA 2RF9A 3H30A 4QMVA 3H9OA 4UMTA 4O7ZA 4XP0A 3R7OA 3D5VA 3QGWA 4G3DA 5EW8A 2OGVA 2RGPA 2C6KA 1M7QA 3UMWA 2JDRA 1SYKA 3FC2A 4D2PA 2R3KA 4KIKB 3WF7A 3F2RA 1XWSA 2XM9A 3TKUA 3HP2A 4XV2A 3PPZA 3PXQA 3GT8A 4MD7E 4GK4A 4R3CA 4H1MA 3ZBXA 2ITVA