3V01A

Discovery of novel allosteric mek inhibitors possessing classical and non-classical bidentate ser212 interactions.
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
322
structure length
289
Chain Sequence
MELKDDDFEKISELGAGNGGVVFKVSHKPSGLVMARKLIHLEIKPAIRNQIIRELQVLHECNSPYIVGFYGAFYSDGEISICMEHMDGGSLDQVLKKAGRIPEQILGKVSIAVIKGLTYLREKHKIMHRDVKPSNILVNSRGEIKLCDFGVSGQLIDSMAVGTRSYMSPERLQGTHYSVQSDIWSMGLSLVEMAVGRYPIPPPDAKELELMFPPMAIFELLDYIVNEPPPKLPSGVFSLEFQDFVNKCLIKNPAERADLKQLMVHAFIKRSDAEEVDFAGWLCSTIGLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dual specificity mitogen-activated protein kinase kinase 1
publication title Discovery of Novel Allosteric Mitogen-Activated Protein Kinase Kinase (MEK) 1,2 Inhibitors Possessing Bidentate Ser212 Interactions.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/inhibitor
total genus 85
structure length 289
sequence length 322
ec nomenclature ec 2.7.12.2: Mitogen-activated protein kinase kinase.
pdb deposition date 2011-12-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3v01A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3v01A01
1R1WA 3FMKA 2YACA 3ZFYA 5L2TA 3OT3A 3A99A 5A14A 3H9FA 4LFIA 4G6OA 2ITXA 2ZVAA 5L3AA 2B1PA 3WIGA 3ZXTA 3MTLA 4UXQA 5EFQA 3JY0A 4ZY4A 4MK0A 4I3ZA 5CAUA 3F9NA 3OCBA 4O38A 2GCDA 4E1ZA 2B9IA 2I0VA 3CTQA 4BC6A 1U5QA 3EN9A 4IB5A 3HV7A 3EQFA 3PPZA 5FTOA 4TNDA 3D14A 5AIRA 5EW9A 1CTPE 4E4MA 4YC6A 4RA4A 5GZAA 5AP2A 4FKSA 3FUPA 2OJGA 2EXMA 3SV0A 3Q3BA 1G8SA 4F08A 3EKKA 5CZHA 3PY3A 1BMKA 4RZWA 5LMAA 4NKSA 2XVDA 2JEDA 3ZTXA 4R1YA 4EHVA 4PNKA 2XM9A 4NW5A 3R0TA 2GNFA 4JRNA 2XEZA 3AC3A 2BIKB 3F82A 3RAHA 1FPUA 3DA6A 3U4WA 4D5KA 2X9EA 4FIFA 3DNDA 4R3PA 4I5PA 3E5AA 2W06A 5JGAA 3UO5A 1Q8UA 4YTIA 2VTRA 2ITYA 4KRCA 2A2AA 3LVPA 4IFCA 3B2TA 2B54A 2PMNX 4C3PA 3S2PA 1SMHA 3MJ2A 2C69A 1Q3DA 2CGVA 2RL5A 4GCJA 5TKDA 3CQWA 4J8MA 4GRBA 4X2NA 4D2VA 4NJ3A 4RG0A 2BKKA 5FG8A 4Z16A 3ATSA 3DBQA 2JKOA 4MBIA 5M4UA 2G1TA 4P90A 1H1SA 3BLRA 4JT3A 1PXOA 3RPYA 5BPYA 3LM0A 2IO6A 4PF4A 3TM0A 3COIA 4BRXA 2R3GA 4LL0A 4QMPA 4TYHA 4J98A 4Y85A 2C3KA 5CX9A 3PXYA 4EWHA 5JFVA 1XH4A 1ND4A 5DFPA 1GIHA 3OW3A 2QKWB 4KNBA 4ZS4A 2BCJA 3WF5A 4FL2A 4YO6A 4X3FC 5B2MA 3QQHA 4J71A 1GIIA 3UVPA 4AZVA 4Q9ZA 3OWKA 3WI6A 4FNYA 2ZV2A 5C4KA 2OIQA 4XMOA 5HBJA 4D4SA 5A6NA 4XP0A 5FGKA 3ID6C 4QT1A 4I5MA 4I6QA 5FEQA 4FGRA 1PXLA 4JBOA 5HNIX 3UG1A 2PHKA 4M97A 1NVSA 4HVHA 4FKQA 4AACA 2XNOA 4PDSA 4QPMA 1XH6A 4BWKA 4I23A 2GHMA 3U9CA 4KIPA 3SKCA 3RGFA 4WSQA 2BMCA 2BRBA 4YP8A 2OF2A 4BI1A 3MFTA 2OJJA 2XK9A 2QNJA 4YZMA 5FEDA 3KF4A 3UVRA 4YTFA 3M11A 4BDJA 4F64A 3PVWA 1ZZ2A 2WQEA 4JR7A 4UZHA 3TG1A 4EZ7A 1G5SA 4IBMA 5LMBA 4G1WA 2JGZA 2V7AA 4FSYA 4F09A 5DMZA 2IZSA 4CTBA 5IA2A 2Y4PA 3GB2A 3H4JA 3BYOA 2X0GA 2IWIA 3E3PA 3HV5A 3R1NA 4FC0A 3OHTA 3D2IA 4BCPA 5J87A 4CRLA 1GAGA 3MS9A 3PE2A 4FT0A 4LYNA 4YJNA 5J95A 3TCPA 1ZYSA 5K4JA 1PXIA 1YDTE 4FV7A 4RJ5A 2JBOA 3QAME 1OKWA 4FYNA 1FMKA 4MBLA 4WBBB 4O2ZA 3VF8A 3VIDA 3SVVA 3VNTA 2F2UA 4EK6A 4FT3A 2XB7A 3O8UA 3R30A 4E4XA 3TL8A 2BAQA 4IADA 4EORA 2VRXA 3KK8A 2I0EA 2O65A 4C57A 5EM8A 4G3FA 4UMPA 2F4JA 2J0JA 5BVEA 4DH8A 4UWYA 2Y6OA 4D2TA 3C4XA 3HV3A 3A60A 3A61A 5H3QA 4E6AA 2IVSA 3S0OA 2W0JA 4BKJA 3R9RA 3QLFA 3L9NA 2XK8A 3FMNA 5AAFA 5IEYA 4M68A 2V55A 5K5XA 2BZKB 3GFWA 3MTFA 3PP0A 4I22A 2V5QA 5HU9A 2DYLA 1YWRA 5M09A 1MRUA 2GNIA 4QP6A 3D5UA 1WFCA 4I0SA 4RLKA 3TNIA 2R3JA 3TUDA 5CEPA 3UNKA 2R4BA 3GFEA 4QYGA 2IW8A 3UOKA 3W2OA 3C5UA 4UMTA 3ZCLA 5AUUA 3KF7A 3WE8A 5HCYA 3KXNA 4FZFB 3Q9YA 4JOAA 4ZTSA 5HE3A 4AW0A 1OL2A 3TKUA 3O96A 4ZTQA 5DH3A 4G5JA 4R77A 3ZONA 5B0XA 2C1BA 2I0HA 4QTAA 1YOMA 3SLSA 4CKIA 3Q52A 2OI4X 2R3KA 4O1OA 4X2KA 4EBVA 5CWZA 4FUXA 4AOJA 2XIKA 4A7CA 4ANLA 1WBTA 3DJ5A 3DS6A 4W9WA 4IACA 3MA3A 5CT0A 4IC7A 3D0EA 5CLPA 3F5UA 3TNWA 5E1EA 3R04A 3ZC6A 3EFWA 4DTBA 2QONA 2ZM3A 3HA6A 2ETKA 1OKZA 3FLQA 1ERKA 2UZWE 3PJCA 4AW2A 4BIBA 4EOJA 3IDPA 4L42A 3G5DA 3NUYA 3W2CA 2UZNA 4C2WA 2WIPA 3CCNA 5HNGA 2XNPA 3ZZWA 5EG3A 4IVBA 3RKBA 2GHLA 2J50A 4G31A 3SOCA 4CKRA 1FOTA 2PUIA 2X81A 5DOSA 4HVSA 1WAKA 2PVKA 3ULIA 2RFNA 4XP2A 3K54A 4I4FA 4GU9A 4FVQA 3WILA 3TJCA 3U8WA 3HMNA 4WNOA 4V05A 3WF7A 2QHMA 5HE2A 4EL9A 5DR9A 4GUEA 4DH7A 5AAEA 2X1NA 1SVHA 3HMPA 1FVTA 3QA8A 2FB8A 4X2JA 1ZOEA 4L00A 4BDFA 3KEXA 3EOCA 1PMEA 5ANKA 4RJ8A 1A9UA 2QQ7A 3U55A 4KIOA 3VQUA 5HIBA 1OPJA 2JDSA 3KFAA 2H8HA 2EXCX 5HESA 3REPA 2ZDTA 4EHGA 2ITVA 2X7FA 2YEXA 4BCFA 1FINA 2OGVA 1ZOGA 3N4UA 1P2AA 4UMQA 2VO0A 4G3EA 2OZOA 5HX8A 3Q2MA 2J2IB 2YLFA 2YIRA 4RX7A 3NYOA 5GNKA 3HGKA 4HCTA 4XG2A 3PG3A 4O91A 3CGOA 2KTYA 4EH4A 3OY1A 4HZSA 4QYFA 4U0IA 5E8WA 5IG1A 4E4NA 4LOOA 4EOKA 5IQGA 3PLSA 1OKYA 2F57A 2Z7RA 4F1MA 1VYZA 4YZ9A 3R83A 4U41A 3A2CA 2VWBA 3PZHA 4OTGA 4S34A 4X7QA 3F2RA 2UVZA 1YI6A 2UUEA 4H58A 4WKQA 2P4IA 5BX0A 4LMUA 4M69B 4FTKA 5JRQA 3EFJA 5JZJA 3PSBA 5EHOA 4ENYA 4UV0A 1L8TA 1JVPP 2BHEA 4XG3A 4KINA 2RGPA 2OJFE 3L9LA 3PE1A 4DBXA 3TWJA 3R8UA 3RHKA 4I6FA 4C4HA 4ALWA 2PE0A 1KOBA 4C4EA 3BWFA 2HXQA 3FLNC 4EHEA 2HW6A 1H00A 2OICA 2UW6A 3QYWA 4OTHA 3MFUA 3EQIA 4S33A 4XCUA 3D4QA 4XNEA 5F94A 5KBRA 3CQUA 3FMLA 3GC9A 1B6CB 3DDQA 4QTBA 4WG5A 3KVXA 3FKLA 5A4LA 4L9IA 3ZDIA 3UP7A 4CEGA 4KWPA 4A9SA 2DQ7X 4AGDA 1STCE 4EOPA 4IQ6A 3DLZA 3G33A 4MXOA 4XOZA 1WBSA 4FZAB 4HPTE 4YJQA 4L67A 4BGQA 2GSFA 3OFMA 4FMQA 4M69A 4W4WA 4RLLA 4AFEA 3DK6A 4A06A 3F5GA 1J3HA 4DEBA 3OTVA 4CLIA 4F6SA 3ROCA 4DE4A 2VTSA 4YZNA 4D2SA 3ZOSA 3QKKA 5IQDA 2VTMA 2WGJA 4GMYA 5J8IA 4RVTA 4DFXE 3D2KA 2GNLA 3PPKA 4O7ZA 5EM6A 5IF1A 3OBJA 1UV5A 3GCPA 4RQVA 4Q5HA 2OK1A 4C62A 5IISA 5L2WA 2R2PA 4GYGA 3RVGA 4DEGA 1M7NA 4QP8A 3E8NA 3A8WA 4B8MA 5BMSA 3L8XA 3CXWA 3RCJA 5CEOA 3EL7A 4G16A 2PUNA 4UYAA 3KA0A 3BX5A 4IX6A 1MP8A 2WTKB 3KRRA 4MXAA 3SX9A 3D94A 3ZS5A 4D9TA 1HOWA 3TDWA 4JBQA 5AUZA 5HI2A 3QCSA 2HXLA 2WMAA 2YISA 4M14A 2WQOA 3DFCB 2XH5A 4AA0A 5AA8A 3UO4A 3O0GA 3GU7A 4L8MA 3VF9A 5T68A 3OTUA 3OEFX 3CD8A 2QHNA 4I0RA 2R0IA 5HBEA 3UE4A 3AT2A 5IDNA 3WZDA 4C02A 4XG8A 4D2PA 3QFVA 4N57A 1ZZLA 4BHNA 4EQUA 5LJJA 5J1WA 4G3GA 3UOHA 5JK3A 3QL8A 5ETFA 1A06A 5L8LA 4F0FA 5A54A 2YIWA 1OB3A 2YM8A 2W1ZA 4QQJA 3ZLWA 4F9BA 2A0CX 3FL4A 4G5PA 4FIGA 4H3QA 5EDRA 4Z3VA 1JAMA 4JQ7A 4XG9A 3VUHA 1OIYA 4XP3A 3IW8A 4XUFA 4HOKA 4BL1A 1UU9A 4C33A 2PVLA 3AC8A 2V62A 4EC8A 2ETRA 4ERKA 4PY1A 5AFVA 4FTTA 3LLTA 4X0MA 1S9JA 2QOBA 2X2LA 3NVMB 3WF8A 2JFLA 3U4UA 1IAJA 4X2GA 4JDJA 4L68A 4QMUA 5KCVA 3FLYA 3QGWA 1ZOHA 3PP1A 5GJGA 4D1SA 4EOMA 4WUNA 5LMKA 4KKGA 3QD4A 2PVHA 4G9CA 5HBHA 1HCKA 3RMFA 1DAWA 4O7RA 1KE8A 1M7QA 4G17A 5EM5A 4NZWB 5IQHA 5CVHA 4CGAA 4CT2A 1OM1A 4GK2A 3LPBA 2JIIA 2YWPA 4M8TA 4PP9A 4QP9A 3TEIA 5A4TA 4PMPA 4GK3A 1JKTA 5CU4A 3A62A 5M51A 2XNBA 3MH2A 2OLCA 3HAMA 1SZMA 4I20A 2O64A 2PVFA 4RC2A 1WBOA 2FO0A 3Q9ZA 3VQHA 4HVGA 4BTKA 3FY0A 3F88A 5J7BA 3QUPA 2JDTA 1OL5A 4D2RA 3QRUA 1REKA 5CF5A 2YAAA 3KN6A 2YM4A 3OROA 4FF8A 3VS2A 2W5BA 3LMHA 2XF0A 2XJ2A 3TDVA 4IB0A 1YXUA 2CGWA 3LCTA 3I6WA 1FGIA 2H96A 2R64A 2XRUA 4RX8A 5FP6A 4FR4A 3PA5A 3R7UA 4BBEA 5I9VA 5HLWA 1J1BA 2X6EA 3ZZEA 4QQTA 3ZSHA 4DG0E 4RMZA 5HOAA 3F3UA 3QTIA 5HVYA 3W8QA 4RIWB 1YXTA 4K18A 3H0ZA 4HGSA 4YHJA 4FL3A 5HVKA 4AW1A 5ANJA 3CC6A 1SNXA 4IX4A 2UVXA 4FT7A 4XV1A 3PXKA 4BICA 4F1TA 3DLSA 3K5UA 4C35A 1VJYA 5FBOA 4EQCA 4S32A 1VYWA 5HICA 3TZ9A 2CKOA 2OU7A 2E2BA 3I0QA 3PXQA 4A9YA 5JEBA 3O71A 3Q4TA 4PWNA 3NNWA 4QYHA 3F69A 5LWMA 4GW8A 5M08A 3R21A 1TQMA 1UU8A 4QMSA 4I92A 3M1SA 5AMNA 3DY7A 2ZB0A 2P0CA 2JFMA 4NWMA 3NUSA 3QTXA 2JIUA 2X6DA 4ASXA 3DV3A 3EQDA 3GNIB 2WEVA 1DM2A 1NA7A 2EB2A 3SDJA 4AZTA 5KHXA 4LOQA 2IW9A 5AADA 2BKZA 4C7TA 2OXXA 1OKVA 3FI4A 3QTWA 4JAIA 5CENA 3DK3A 4OBPA 2FYSA 1XHAA 4D4YA 3LCSA 4RIWA 4ACHA 4DFZE 1YRPA 1WMKA 3RTPA 3N4VA 3JYAA 3Q9XA 1U5RA 4N6ZA 3VAPA 3P1AA 1EH4A 2BROA 1YHVA 2G2HA 2X9FA 3FDNA 3R8VA 3QQFA 2OJ9A 2RG5A 1PF8A 3GUBA 4I0TA 5LARA 1XBBA 4OTFA 4LV5A 3IK3A 2RFDA 2R3NA 4PPCA 4II5A 3W2SA 1FVRA 1P5EA 4ALUA 3IW5A 2C5OA 3VN9A 5IEXA 4FV4A 1UU3A 5FTGA 3C1XA 2XNGA 3MH1A 4EH3A 2ESMA 3EIDA 3ZUVA 2QG7A 4IJPA 2QODA 5C27A 5JQ8A 3R1YA 2F7EE 3E8EA 3AGMA 3ZRMA 3UQFA 2HWOA 4DLJA 4O0XA 2IZUA 4LRMA 2HY0A 2I1MA 3MV5A 4E5WA 3QTZA 3NVKI 3PA4A 2WTDA 1JSTA 5BUEA 3ORTA 3PIYA 5IMEA 2ERKA 2YAKA 5J7HA 2GMXA 3DGKA 4UMUA 3VWAA 3DJ7A 2QD9A 3K2LA 2VN9A 4QTCA 2B7AA 2REIA 3A4PA 3NNXA 4P2KA 4BZNA 5JMSA 3O7LD 5HLNA 4JLCA 3RPSA 4FTIA 3O17A 4JIAA 1JQHA 2YIYA 4B7TA 5HG7A 4NL0A 4HW7A 4DEEA 1F0QA 4WG3A 2WTVA 4U8ZA 2XA4A 3IQ7A 4J99A 3ANRA 3C4ZA 4H1JA 4FOBA 4BBMA 1UNGA 1YVJA 2IPXA 5IUGA 2RF9A 2BFYA 2VTPA 4M3QA 1OIRA 2YIQA 1P14A 3I1AA 4UBAA 3R7OA 3M2WA 4CNHA 2XK4A 4MCVA 5KHWA 1IA9A 4DA5A 3A7FA 4M7IA 4FT9A 3OCGA 5HNBA 3GC8A 4EOOA 2PVJA 2W1EA 4P5QA 3GT8A 3BGQA 4DG3E 4E5BA 4F0IA 4EJ7A 4ZLZA 2C5YA 3LFCA 5ANOA 2H6DA 4E26A 1XH5A 3EN6A 1Q8WA 3ORIA 4H36A 3TI1A 4ANOA 2WTKC 4IZ5A 2HY81 4IDTA 4C37A 4CQEA 1CSNA 4RQKA 2OG8A 3G0EA 4XV3A 4WUAA 2OO8X 2I6LA 1PHKA 3VW8A 3NIZA 1H27A 3MH3A 1XJDA 3ODZX 3HP2A 4XRJA 3G9NA 3WZUA 3LCOA 4DTKA 4FKRA 5CALA 1BL7A 4U79A 3BQCA 1ZAOA 2HIWA 4LM5A 3NUPA 4L43A 1O6LA 3F5XA 3Q96A 2CGUA 3ORXA 4F99A 4E8AA 3QTQA 4EOQA 2HCKA 4FV3A 4QMOA 4YJUA 4BCOA 5AV0A 4YR8A 1AD5A 2VWIA 2FUMA 3FZ1A 2HZIA 3R9OA 4ARKA 4BDBA 4I6HA 5L6OA 2WQNA 4B0GA 4AGWA 3D15A 3DKGA 3PVUA 2LAVA 4MQ2A 4BDDA 2X8EA 3BYVA 3RK7A 3QKLA 4I5HA 1YXVA 4BCNA 3WBLA 4C0TA 3D5VA 4IB3A 2W1FA 3QLGA 3R9DA 5IUHA 5L2SA 3F7ZA 4I93A 5HLPA 2VU3A 5CAVA 4RWLA 4FGBA 3R28A 3KRWA 3DQXA 1BL6A 4YNEA 4AU8A 2AYPA 2ZM4A 3RBWA 4DEAA 5LVOA 1F3MC 2YFXA 4N6YA 5EQYA 3CLYA 4AZFA 1JWHA 3N4TA 3ZM4A 2FGIA 2W4OA 1KE5A 4RJ4A 3LMIA 2BIYA 3FYJX 2PMOX 3O23A 4FKVA 3A7HA 4P4CA 3GENA 2OFVA 2C6EA 3IS5A 4BBFA 4IAKA 5IH5A 5GINE 4R1VA 4OTWA 5IA0A 1JOWB 4RT7A 3F2NA 5D7AA 4O0RA 2VWZA 3DNEA 1KOAA 3QALE 4C8BA 4XX9A 2PZRA 3N51A 4YLJA 4M84A 2Y4IB 5KMLA 4R3RA 4H05A 3DPKA 5AM6A 1R3CA 5H2UA 2B55A 4NM5A 5A4CA 3CPBA 4K77A 3BV3A 4E20A 2Y6MA 2X8IA 1BI8A 4CCUA 4FTNA 4GIIA 4TW9A 3T3VA 4NFMA 5EYCA 2JDVA 3F61A 3OWLA 3WIKA 4DFLA 1Q97A 3GQIA 3I5ZA 4HPUE 2FA2A 3RZFA 2GU8A 5LWNA 1FMOE 3IOKA 5EH0A 4FEWA 2C68A 3C0IA 2XIRA 3PIXA 4DYMA 5J9YA 4UMRA 1H0WA 5A4EA 4DT8A 4AN2A 3JVSA 2WMRA 4HYHA 4XLVA 3T9TA 1W84A 4WSYA 4QMMA 3FZOA 3QZHA 3MBLA 2IN6A 2XM8A 3EQCA 3E87A 3PTGA 3Q4UA 2VNYA 3MH0A 1UKHA 3Q04A 3UZRA 1R78A 4OTDA 5HD7A 3R8LA 5JSMA 5E4HA 3O8PA 3DBEA 4FV1A 3BBWA 5K3YA 3VUMA 5DYJA 4Y5HA 5EK7A 3P23A 1PXNA 4MEDA 3ZFXA 1MUOA 3OVVA 4L44A 1YW2A 2VWXA 4QNAA 4WO5A 5CVFA 4KUJA 3VS0A 5AWMA 2PYWA 4R6VA 4WOVA 3RWQA 4F0GA 1H24A 2YCRA 4YHFA 4H39A 5F1ZA 2R7BA 2ITOA 4EEVA 2BDFA 2IJMA 3W10A 3E7VA 2BDJA 1GNGA 5JRSA 5KNJA 4O83A 4U5JA 1KE7A 2XIZA 3GBZA 4LMNA 3A8XA 3NX8A 4O0YA 4OTIA 4ZZMA 4YJRA 3ACKA 2VTJA 5DT4A 4EHZA 3W18A 3WYXA 3V6SA 1UWHA 2FSOX 4XS2A 2W7XA 4ACDA 3U6JA 3JY9A 4ANNA 1UWJA 3KKVA 4GT4A 4FVPA 3OT8A 5AX9A 2XCKA 1OL7A 3VUKA 3FQEA 4NUSA 4O6EA 3TIYA 3E7OA 4PV0A 4R7IA 4AE9A 2Y8OA 1YWVA 2HK5A 2WMTA 3ALOA 3FV8A 2W05A 5F4NA 4Z7GA 3FEGA 4FKIA 4ZTLA 5EW8A 1WZYA 2UZDA 2PPQA 1IRKA 2G2IA 3T3UA 5HHWA 5GIPE 2CJMA 3PRFA 4TPTA 3ZEPA 5AUVA 4RIOA 3OMVA 5A46A 3BHYA 4NKAA 2QU6A 5E8TA 3EWHA 4HYUA 2C1AA 1ATPE 2F9GA 4NSTA 4E6CA 1JKSA 1ZMUA 2B9HA 4WRSA 4DH3A 3H10A 3WZJA 4ZJVA 3JR1A 1PYXA 2ZM1A 3QA0A 1YHWA 4L6QA 3FHRA 5FM2A 4ZXTA 4DFNA 3TUBA 4MTAA 4UB7A 4FT5A 2YHVA 4ASEA 1REJA 2Y7JA 3EN5A 3HVCA 3KULB 4DGGA 3I60A 4FV0A 3OEZA 3JS2A 3L1SA 4GV1A 3P86A 4PTGA 3W2PA 4ACGA 3TNHA 3P08A 4O22A 2RG6A 4BN1A 3E63A 3IPHA 2C3LA 4AA5A 2B4SB 3LLAA 3COKA 3R1QA 5DPVA 4ZLYA 4NFNA 5CSXA 4GK4A 3DTCA 1Y8YA 1H08A 4TL0A 2A27A 2W17A 4GVAA 4TXCA 4AZWA 4RGJA 4AGCA 3NW5A 1BYGA 3QWJA 4WRGA 4ZTNA 5BYZA 3ZLYA 3Q4CA 4KBCA 4O7SA 3BCEA 4UZDA 5DEWA 4BFMA 3FSKA 3MIAA 2YN8A 3BBTB 5CEMA 4RWKA 4M0ZA 1TVOA 2BAKA 2R3OA 2GFSA 2YLEA 4PL4A 4RIXB 3PUPA 4LOPA 1YQJA 2BTRA 2QR8A 4ZAUA 1S9IA 2C6IA 4WT6A 3UIXA 3KXHA 4D9UA 5M4CA 3KULA 3AG9A 3TZ8A 3FZPA 5GJDA 3TN8A 5CF4A 3RCDA 2WELA 3DTWA 4Y72A 2WD1A 5DGZA 3MN3A 5CI7A 3HL7A 2WXVA 4O2PA 5DE2A 5GHVA 4BDAA 4EZ3A 3FMMA 4O0UA 3KB7A 4YSMA 4EH6A 3KVWA 3CJFA 2WU7A 2VNWA 2ZJWA 3EFKA 4MD7E 4LUDA 4RJ7A 3QRJA 3WARA 3G6GA 2RKUA 4FTCA 5H8EA 3VBYA 2OZAB 2E9NA 3P5KA 1VZOA 4IWOA 3ZMMA 2G2FA 1YDRE 3D5XA 1IG1A 3NYNA 4KSPA 3TV6A 3W55A 5HZNA 4DT9A 3CEKA 3OOGA 3Q5ZA 3V5QA 4E4LA 4EH8A 2ITWA 4RVKA 4YJPA 3OUNB 2CSNA 3NYVA 3SQQA 3FMDA 4UALA 3QQUA 1X8BA 2YM6A 3ENHA 1UA2A 5AV1A 5B7VA 3L8PA 2PE2A 5FWKK 3F3WA 4RFZA 3HLLA 3L9MA 4UXLA 4FBXA 1PRYA 3UPZA 4GKIA 2ITUA 4EWQA 3KK9A 1F5QA 3R7IA 3DT1A 4RRVA 5DR2A 4BKYA 1R0PA 4B4LA 3VS7A 3FI8A 2ZMDA 3D7TB 4FA2A 4NT4A 2YJRA 2Z7SA 5HO7A 2O63A 5DG5A 3EQBA 3MB6A 2IZTA 5JN2A 3MIYA 4FZ6A 4KIQA 3SW7A 3V51A 2UW0A 1ZYCA 2QLUA 2OZAA 2VWYA 4ACCA 4G34A 4JRVA 5DBXA 2UZVA 3PIZA 3NW6A 4IE9A 3BZ3A 3R63A 4Q2AA 3QC4A 4KABA 3UC3A 2PZIA 4QP1A 5E1SA 2OWBA 1YI4A 5HCZA 4JBVA 4FV2A 3FL5A 4ZK5A 4CYJA 5IU2A 5JGBA 3LKMA 4ZTHA 3NYXA 5HTCA 4HJOA 3LMGA 3OC1A 4KBAA 3ORLA 3I7BA 4RC3A 1JLUE 2W1CA 4NYEA 3SAYA 1J7UA 5C8NA 3H9OA 4APPA 3C4WA 4FSMA 4EK3A 2R0UA 4Y95A 2PMLX 3FKOA 4NH1A 3THBA 1I09A 3DBCA 5IZFA 4DEIA 3RAWA 5FRIA 3D7TA 2UZOA 3ZSIA 2R3MA 3AC5A 4QYEA 4JG7A 5AUTA 4FV8A 3UMWA 2HZ0A 3LXKA 5ETCA 4O0TA 1XBAA 3VC4A 4I24A 4N70A 3I81A 1LUFA 5AUXA 3UP2A 3FI2A 3GC0A 2C4GA 5AM7A 4AQCA 1B39A 3KC3A 4MXYA 4YZCA 3EQHA 3Q53A 4YPSA 2VTTA 3LFFA 4CFNA 1OITA 4K11A 5FD2A 2CKQA 4FKOA 3MFRA 4ZSAA 4HNIA 4NM3A 2UV2A 3DFAA 1OL1A 2WEIA 2YM3A 4C38A 4PRJA 1U46A 1GIJA 3BRBA 3PG1A 4FUYA 5AAGA 5I9WA 4A9RA 5B2KA 3KMWA 3MDYA 5DT3A 5KE0A 5K5NA 2G01A 4F1OA 4CLJA 3OW4A 3P7BA 4XJ0A 3BIZA 1G3NA 4IJ9A 1YOLA 5G1XA 3KRLA 4TYEA 2XIXA 4QMLA 4RWJA 2FSLX 3EMGA 4AN3A 3ZFMA 1NY3A 3OXTA 2VGOA 1OECA 2PY3A 3RHXA 1MQBA 3T8OA 4BI0A 2CNVA 4F4PA 4PUZA 4YZBA 4CQGA 4ONAA 2DWBA 4FIIA 3UMXA 4ANQA 4NTSA 3VRYA 3ZLSA 3QD3A 5EHYA 4ZJJA 5ACBC 1H1QA 5HCXA 2IVVA 5L8JA 5E92A 3R71A 4JJRA 5I3OA 2W99B 3N9XA 1LPUA 4X6QC 3QHWA 4OW8A 4CMOA 4D0WA 2VAGA 2E9UA 4OT6A 3NCGA 4TN6A 4BDCA 1YDSE 2GQRA 3PJ2A 4U80A 2C0TA 3QX2A 4W4VA 4BY9E 4ZY5A 2Q83A 5JT2A 1YI3A 4CV9A 3PWDA 2R3RA 3EN4A 2PWLA 3B2WA 4MHAA 3Q60A 4BIDA 3CS9A 2NPQA 4GUBA 3GCVA 4F65A 5M4IA 4RFMA 4E5AX 4L53A 3CD3A 1CKJA 4XV9A 5J9ZA 4C3FA 3RINA 3UG2A 2V7OA 5BMMA 3S00A 4ZS0A 1YWNA 3L8VA 1NVQA 3VO3A 1WCCA 5BVDA 3ERKA 5BVKA 4F7NA 4J96A 5CANA 4QMXA 3IW4A 3IDCA 2WTJA 4J95A 3PVBA 1XH9A 2HW7A 3JXWA 2PMIA 1Y91A 2BRNA 3UNJA 3GOPA 3KQ7A 3R1SA 5ICPA 5DRBA 4FTOA 2GNJA 3GU6A 4FK3A 2GS6A 4IM0A 3BYSA 2H9VA 2QR7A 4ITJA 1M17A 4L3LA 4BTJA 4BYJA 3EZVA 4DLIA 5CAPA 5KKRB 4MAOA 4F7LA 2YCFA 3QTUA 5E91A 5F20A 3V8TA 4I94A 4RWIA 3AD6A 3C4CA 3T9IA 2NP8A 4K1BA 4BCKA 4FK6A 4RSSA 5AP0A 5IMXA 3VBTA 4D58A 4E6DA 2J9MA 4L3JA 5HIEA 2BAJA 5EYDA 4O1PA 2QOIA 3BGZA 5CYIA 5TE0A 3ZO4A 4ENXA 4EONA 3AMYA 4HVDA 4EOSA 4AE6A 4K33A 2BRHA 5CY3A 1UKIA 4FIJA 5BVNA 2UW9A 3RAKA 4UN0C 2WB8A 1KWPA 1OUKA 2QO9A 3LW0A 3IW6A 3R02A 4EH2A 2W1GA 5AA9A 5AR4A 2GNGA 1BI7A 2ERZE 2WTIA 5AV2A 4JVGA 2XP2A 3ZBXA 5IQFA 2WTWA 4I6BA 4EQMA 4X2FA 4AWIA 2PVRA 4EOLA 4CG9A 3QRKA 2X7OA 4NJDA 2I7QA 4MNFA 4OUCA 2BVAA 3KRJA 5AX3A 1MRVA 1Q8YA 2WHBA 3IDBA 2QOKA 3MPAA 2PU8A 5FM3A 1PXMA 2OXDA 2GDOA 4YJVA 1G8AA 4EOIA 1Q24A 4JDHA 3I79A 4TWCA 4EBWA 3VUGA 4FG9A 3WF6A 3POOA 3R2YA 4IMYA 5LCJA 4DAWA 5KZIA 4YJTA 3MY1A 5IQIA 3R8MA 1WBNA 4EK8A 4YO4A 3LFAA 1XQZA 1ZRZA 2GS7A 4IXPA 2PZPA 3P0MA 5CF6A 5KMIA 4KSQA 3R7EA 4BZOA 3UGCA 3OBGA 2F7XE 4CKJA 4YURA 4IM3A 4C4GA 3BU5A 3LQ8A 2OJIA 4FKPA 3R7YA 3TNPC 4UWCA 4CTCA 3MVJA 3AQVA 4KAOA 1K3AA 2WMXA 5CTPA 4AFJA 4CG8A 2UZEA 4HZRA 4GVJA 4KRDA 4W4XA 3UQCA 1DI8A 5DR6A 4BDKA 4B99A 1NT2A 1BUHA 4EK4A 5AV4A 2PULA 5L8KA 4C61A 2VTOA 3OY3A 4HYIA 4RIYB 4BCMA 4DC2A 3EB0A 1O6YA 2R3HA 3RPVA 3E64A 5GZ9A 3UJGA 3UIBA 3BE2A 3ITZA 3EH9A 2PVNA 2ZAZA 5E8ZA 5F9EA 1SVEA 1H4LA 1W8CA 3OWJA 3R9NA 4GH2A 4ANBA 4DH1A 5DN3A 4CFWA 3O51A 1WBWA 1U4DA 2WFYA 3R6XA 4JAJA 3ZU7A 2WMUA 4FE2A 5ITAA 2Z7QA 2B0QA 3RNYA 4Y5QA 4CCBA 3COHA 3I6UA 4W8DA 5E9EA 1H07A 1GZOA 5IQBA 3UNZA 4PDYA 4K0YA 2BZIB 2CDZA 3II5A 4MNEB 4IWPA 3FC2A 4IFGA 4AS0A 1V1KA 2R3IA 4L01A 3MSSA 4KIKB 4H3PA 3RAIA 5D9HA 5BNJA 4Z9LA 3DU8A 4M66A 4OBQA 5JQ5A 3IO7A 3RZBA 3NUXA 3EZRA 4JXFA 1PJKA 1QPDA 2C6KA 3SC1A 5E7RA 2HZNA 2W96B 4NW6A 2OFUA 1YHSA 3LFDA 1TQPA 2WMVA 3QXPA 3SW4A 3U51A 4B9DA 5IH4A 4RIYA 3HMMA 3AOXA 4OTPA 1K9AA 3GC7A 5D11A 2CNUA 4O7VA 4FSZA 4IZAA 5E90A 3R2BA 3BLHA 4F63A 5I9ZA 1CM8A 3F2AA 4U40A 1M14A 1GZNA 3LCKA 2C5NA 5EHLA 2QI8A 4FKLA 3NIEA 4ANSA 4BTFA 3BV2A 4QMZA 2BR1A 3UBDA 3DAEA 3TIZA 5DEYA 4DGNA 3KU2A 4OTRA 2XNNA 3LZBA 4FTRA 5D1JA 1RW8A 3TZMA 4MNEA 3DJ6A 2XKDA 5CSVA 4GL9A 4J53A 4MQ1A 4ZTMA 4KIKA 3W33A 4FSQA 2HELA 3WYYA 3HNGA 3MPMA 2VWVA 4XOYA 3TACA 4KA3A 5BYLA 2UZBA 3RPRA 3GEQA 4E73A 4QPAA 4OGRA 3UDBA 4MH7A 4FOCA 3PRIA 3DAKA 1Z57A 4OLIA 3DQWA 3U87A 4MVFA 3ZHPC 5CU0A 3BGPA 3KL8A 4FKTA 4AAAA 5HTBA 1ZMWA 3BYUA 4OT5A 5AP3A 4EH9A 1XKKA 4DINA 4W4YA 2X4ZA 3GOKA 1OI9A 4FV9A 3C50A 3HZTA 3LM5A 4FYOA 2B9FA 4FKUA 4L52A 3EHAA 4LI5A 5KMMA 1ZWSA 2CMWA 4M13A 4M67A 4RJ3A 2B53A 4FEUA 5M57A 5J79A 2ZV8A 1UU7A 2BZHB 3HYHA 2JIVA 3GU8A 4AT3A 5HX6A 3DXPA 2CCHA 3UC4A 2XK3A 2UW8A 2YERA 2GTMA 2OIDA 2XUUA 5FEEA 3UZTA 4APCA 1YKRA 4GU6A 4E93A 3VULA 3HV6A 1Q5KA 4J7BA 4R7BA 5EQEA 3FE3A 2VGPA 3B8QA 4Z7HA 2VTLA 4XHKB 3P9JA 4KKEA 2Z8CA 2QO2A 3GCUA 3ORKA 3S4QA 2RFEA 5D12A 1JBPE 3DOGA 3NLBA 3HRBA 2WU6A 3MJ1A 3OS3A 5EYKA 4A9UA 3EYGA 4NM0A 5CEQA 4EC9A 5HG5A 4FIEA 4FNZA 4S2ZA 2YZLA 5E8XA 4EI4A 4P7EA 3CGFA 4O82A 3Q4ZA 4BYIA 3NR9A 4YBJA 2Z7LA 3DK7A 3KXGA 2XKFA 2XKCA 4KS8A 3RI1A 3NZ0A 1QCFA 4Z55A 5EKOA 4JDIA 4R7HA 3OXIA 2WPAA 3BQRA 1OPKA 2ONLA 4QP3A 4UY9A 5H9BA 4USEA 5KKRC 3BU6A 3PVGA 4IWDA 2GHGA 4GT5A 4TZRA 4WG4A 4FEQA 3QWKA 1PY5A 5D41A 5IKWA 3U9NA 4BCJA 3GU5A 4U3ZA 3R00A 3VW6A 3K3JA 4D1XA 5IQAA 4XRLA 4DITA 4AX8A 2YJSA 4XEYA 1PMUA 3FLSA 5FDXA 3LXPA 4F7SA 4TYIA 5J5TA 4R8QA 1MQ4A 2VZ6A 5J1VA 4AT4A 5LMKC 4LQMA 3HRFA 3POZA 1DS5A 4MKCA 1SVGA 5G6VA 4Y46A 4DBNA 3KXMA 4D0XA 2BUJA 4YMJA 2P33A 4H3BA 3A4OX 2DS1A 4YJSA 5I9UA 4E6QA 1IR3A 2ITNA 2JBPA 2A19B 2QOCA 1H26A 1PW2A 1Y6AA 4NIFB 2UVYA 3OCSA 1H1WA 5AUYA 4NK9A 4LL5A 5FBNC 1XO2B 3FXWA 4JL9A 3PA3A 2R3QA 4DEHA 3W8LA 3KCKA 3PJ1A 3IW7A 5IA4A 2C3JA 1Q99A 3R01A 2BILB 5FDPA 4U45A 1IASA 4CV8A 3ULZA 4MD9E 4ANMA 1R0EA 3OZ6A 3ZM9A 5LVMA 3QCQA 4UYNA 4L3PA 4DGLC 4O7WA 2C6LA 2QLQA 3NEWA 2B9JA 5DT0A 2HYYA 3NMUF 2O2UA 1ZYLA 4CYIA 4ASZA 1URCA 2Q0BA 3TZ7A 5CAOA 4N4SA 4C4IA 4AGUA 3WOWA 2HWPA 5IDPA 1Q4LA 3QD0A 3FMJA 4K8AA 5GJFA 1O9UA 3TXOA 4MWIA 5EI2A 2UW4A 3QRIA 5CQUA 4CFUA 4DCEA 2XK7A 5KMKA 4IC8A 4DGMA 4YC8A 2OH4A 4FG8A 4IZYA 4CFFA 4LG4A 2YABA 5AP4A 3DDPA 4WA9A 5HIDA 2YDIA 4YC3A 3PDTA 5M07A 2H34A 4ZSJA 4IX5A 3NUAA 4NIFA 3HP5A 2NO3A 3MA6A 2VTIA 4HGEA 4K6ZA 3C13A 3MVMA 4ORKA 4JQEA 3PY0A 4O0SA 2PUPA 1QPEA 1UNHA 3AC1A 3AD5A 5T6KA 1APME 2E9VA 4O7YA 2X8DA 4DCAA 3PXZA 3VUTA 4CMUA 2XNMA 1A48A 4PMMA 2GQSA 4TWNA 4QP7A 3Q6WA 4RVLA 2PZYA 2XK6A 4GFOA 3WE4A 4FTLA 4L45A 4FV6A 4V01A 4IB1A 4WD5A 3LJ2A 4KB8A 4WNKA 3EN7A 3OOMA 3OUKA 4YLLA 3ROYA 3E92A 1FVVA 2WOUA 3TTJA 2I40A 4PPBA 4FEVA 5CU2A 3MW1A 1IEPA 5CU3A 2LGCA 4QP4A 2XKEA 3DBDA 4QPSA 3DXQA 2CCIA 4LGHA 4O6LA 1WBPA 3PJ8A 3ALNA 4RX9A 5KZ0A 5KX8A 5AP7A 4ZLOA 2W4KA 3A7IA 3BHHA 3FAAA 3QZIA 1FQ1B 3S95A 3NUUA 1W0XC 4EUUA 2XJ1A 5AR3A 1LP4A 3QU0A 4IH8A 4AP7A 3EQGA 1Z9XA 4ZJIA 1JKLA 3UZPA 4BB4A 3CP9A 3I0OA 4FKWA 3V8SA 4XV2A 2GS2A 3ZLXA 2BALA 5CZIA 1P4FA 5LVLA 2V0DA 2YA9A 3ZBFA 1QL6A 1TKIA 3CTJA 1HCLA 3BI6A 1J7IA 5HTIA 5K4IA 3H9RA 3FZRA 2WTCA 4RX5A 1Y57A 3QD2B 5F95A 5FP5A 2PSQA 5HEZA 3BHUA 3CJGA 5L6WL 2P55A 3ET7A 4AG8A 2QVSE 3HEGA 3HAVA 1RE8A 1VEBA 2X2MA 3F3VA 5HORA 4TYHB 1XH8A 4GG7A 3RP9A 4PNIA 5TO8A 3O7LB 4EKKA 5JKGA 1PMNA 3UO6A 4R3CA 5I5ZA 3G15A 1OBGA 3R22A 3GCQA 3SXFA 3MWUA 3TNQB 1ZXEA 4A4XA 1TQIA 1OVEA 5CF8A 4FKJA 3ORZA 2O3PA 1M52A 2O8YA 4MXCA 5D10A 1M2QA 4GKHA 3E8DA 1P4OA 4BDHA 4BWXA 5LQFA 5CQWA 3HMIA 3UOLA 4M15A 3AXWA 3B8RA 3ELJA 2ITTA 4IVAA 3CTHA 3MGYA 2VX1A 4QP2A 3QQGA 2F7ZE 3ZO3A 4C34A 3IG7A 4HCUA 2Z02A 4PDOA 5FXQA 4G3DA 3VHKA 5BYYA 3SA0A 1BKXA 1JKKA 4FIHA 5EDQA 4CFVA 2OSCA 5AIKA 5BVFA 3CR0A 5IEVA 2GQGA 1GJOA 4MF0A 3O2MA 4IHPA 4F9AA 5JGDA 3QZFA 3BE9A 3RWPA 3ZUUA 1OL6A 5DA3A 4AT5A 3FKNA 4G9RA 1GOLA 3DXNA 4GJ3A 2X7GA 3RALA 3V5PA 3ZYAA 2J5FA 4EYJA 4O7TA 1Q41A 2ONLC 3UPXA 3FZSA 4FVRA 4F70A 5J9LA 2ZMCA 5K9IA 4CZUA 3NGAA 5ANEA 3I7CA 3MVHA 4FNWA 4U7ZA 3SHEA 3V5JA 3VS1A 2FH9A 4DN5A 5CXZA 3IGGA 1QMZA 2NNWB 4PDPA 2F2CB 3G6HA 5HE1A 4H1MA 5AR8A 4ERWA 5EKNA 5I9XA 2W1DA 4QMQA 3E8CA 3ANQA 4GEOA 3SG8A 4EJNA 2WNTA 3F5PA 3BEGA 2SRCA 3BEAA 3FMHA 3TV4A 1IAHA 2VX3A 3CKWA 3DZQA 4KS7A 2E9PA 2J0MB 3CPCA 2PK9A 4TKSA 4IIRA 5I9YA 3QTSA 4O81A 2Q0NA 5BUIA 3BU3A 2KULA 5TF9A 1H01A 3DAJA 2VO7A 4MYGA 4DG2E 3A7JA 5FLFA 1Y8GA 5M4FA 4DFUA 4QTEA 4HNFA 4U44A 2OKRA 3FXZA 2G15A 3FPMA 4UX9A 3SOAA 3ZRLA 1Q61A 3GGFA 4J8NA 4MD8E 4YGAA 4ALVA 3OP5A 5M06A 2JKQA 5DWRA 3VS4A 4TNBA 4G3CA 2C6OA 4TYJA 5EW3A 4WBOA 3C0GA 2F49A 5AP1A 2CNQA 5D7VA 3PZEA 4V04A 3V3VA 3VS6A 3NSZA 5GIOE 4PTEA 4U81A 5EQPA 4RBLA 5CVGA 1GZKA 2XBAA 4USFA 3DBFA 5L6PA 3QX4A 2JD5A 2J51A 3QC9A 3Q5IA 4BDIA 5JFXA 4FICA 3D9VA 4FTJA 4BDEA 4KD1A 4KKHA 1E1XA 3EQRA 1E1VA 2JAMA 2VWWA 3GI3A 3IKAA 4FL1A 3VVHA 4CD0A 5C26A 1H28A 2ZV9A 1CKPA 5E8UA 4ZMEA 2VWUA 2JKKA 1OPLA 5IUIA 4AZEA 4FODA 3JUHA 5K0KA 4NCTA 2ITZA 4FTQA 4MXZA 4QQCA 5ACKA 5IQEA 2WZJA 3ORPA 4RIXA 3TUCA 4C58A 3LFEA 3QRTA 4IAIA 1H25A 4FSNA 5AR2A 5AEPA 2GNHA 3KMUA 3GP0A 4L46A 4ZEGA 2NRUA 3SG9A 3COMA 4U9AA 5BVOA 1PXPA 2BRGA 4JS8A 4AZSA 2EXEA 5IH6A 4G6NA 5CS6A 3WZEA 3AC4A 3P7AA 2J5EA 2ACXA 3LFBA 4BVUA 3FLZA 5CI6A 5I4NA 3VS5A 1AGWA 1R39A 5HD4A 1Q3WA 1URWA 4YJOA 5KMNA 2IZRA 2XYNA 5FXRA 3SXRA 4QMNA 4FSUA 4TRLA 2ZB1A 2VUWA 3LXLA 4Y73A 3LFQA 4X6RA 4BHZA 5CASA 4E3CA 3VRZA 2ETMA 4I1ZA 4YLKA 3ORMA 1UNLA 2WAJA 2Y9QA 4O27B 4GFMA 3PPJA 3JPVA 1KV2A 3QZGA 4W9XA 3QCYA 4PP7A 1O6KA 4ZTRA 2Y4IC 4FSRA 1NW1A 2J7TA 2EVAA 4CMTA 1KE9A 4BGHA 4F9CA 4DTAA 1UVRA 1PMVA 4YSJA 5EI6A 2CN5A 3C7QA 3V5TA 5JH6A 2O5KA 4G6LA 4B8LA 3HDNA 4QTDA 3QHRA 3BELA 4J97A 3ODYX 3MYGA 4FX3A 4O96A 4NEUA 4YTHA 3C5IA 3C4EA 4O0VA 3Q2JA 1ZLTA 3LCDA 2BDWA 4NTTA 4CZYB 4I41A 2ZYBA 4LGDA 3W1FA 2J4ZA 2W9ZB 2WMQA 2XZSA 4WIHA 4CSVA 4BIEA 3PLAE 5AP6A 4FKGA 4V0GB 4FSWA 3CY2A 3FC1X 3ATTA 1RQQA 5CSHA 2WMWA 2YDJA 5ANDA 4DH5A 2W5HA 3FJQE 1M2PA 3Q9WA 3AMBA 3GU4A 2RIOA 4ZIMA 4IEBA 3VBVA 4LGGA 3QBNA 4U97A 5HG8A 5IPJA 1J91A 4K9YA 1U59A 4U42A 3FMEA 3FI3A 3CIKA 2J6MA 3MI9A 4EKLA 4EH5A 3G2FA 5IQCA 4LV8A 3F3TA 4CFMA 5CU6A 2JC6A 1WVYA 3R8ZA 4ITHA 4ASDA 1ZYDA 4FNXA 1ZY4A 4JNWA 1FBNA 1M2RA 3U6IA 5M53A 1QPJA 4IAAA 1PXJA 3PWYA 3BHVA 4O7NA 1Q8TA 1JSUA 3BWJA 5EYMA 2C5VA 4O84A 4MWHA 1MRYA 4V0GA 4X21A 1K2PA 3AMAA 3RPOA 5C4LA 3MPTA 5CSPA 2XMYA 4TT7A 3P78A 3PSDA 3AC2A 1JPAA 2BRMA 4OTQA 3LAUA 3P4KA 5L4QA 3FY2A 5KUPA 1NVRA 3M42A 2BPMA 3NRMA 4JG8A 2R7IA 2J0LA 4JR3A 2C30A 3L8SA 2UZTA 3LE6A 3HECA 4AOIA 5FUTA 1GZ8A 5M44A 1JNKA 3UOJA 4IDVA 3FHIA 1U54B 4C2VA 4ACMA 2WMSA 3LJ1A 4TYGA 3RK9A 1OGUA 5ANIA 2CPKE 2P2IA 2XCHA 1OIUA 4IM2A 4ZSGA 5ETIA 3R9HA 4EK5A 2PL0A 4NM7A 2R5TA 1XBCA 3HRCA 1KUTA 4F9YA 2EWAA 2EUFB 2C47A 5IA3A 2AUHA 3FQSA 5JZNA 4F6UA 2C6MA 3MY5A 4BDGA 3V5WA 4IVDA 2BHHA 2FVDA 2QKRA 2VTHA 5B2LA 3R73A 4WNMA 3W16A 3QQLA 4KBKA 3FZTA 2C6TA 4GYIA 2R3FA 5BVWA 4UWBA 4A07A 1DI9A 4QNYA 2VTQA 2OW3A 5CAQA 1B38A 3MESA 2HAKA 3NCZA 2OIBA 3CE3A 4U43A 5TR6A 3DKOA 1E9HA 3F7WA 3UYTA 4Q5EA 1ZMVA 4IAFA 4OBOA 1XH7A 3KXXA 2BZJA 2C3IB 3UIUA 4D2WA 1RJBA 1U54A 3F66A 5J5SA 1H8FA 3F6XA 3MFSA 3IOPA 4ZZOA 4QMYA 3AT3A 4QMVA 4BCQA 2IW6A 2ZOQA 3HX4A 3OG7A 4GT3A 4U3YA 5DLSA 2C5XA 3H0YA 2WMBA 4I5CA 5DVRA 4IVCA 3RK5A 2VTNA 5AUWA 3GQLA 4BKZA 5DNRA 3S3IA 4MX9A 3UVQA 2DUVA 4YNOA 3QTRA 1DAYA 5T3QA 4CZTA 4D1ZA 4EH7A 3VUDA 2JDRA 4GS6A 3A7GA 5C9CA 4BCGA 4IW0A 5GZ8A 4WHZA 3QGYA 3ENMA 4JDKA 3MB7A 4PL5A 4NCTC 3L9PA 1QPCA 3VS3A 4OR5A 2Z2WA 4RPVA 4AXAA 4RJ6A 4I21A 5AR5A 4JQ8A 2IG7A 2FSTX 1Y6BA 4BGGA 2PVYA 3NNUA 4QOXA 2OF4A 1T46A 4IAYA 2J0KA 3QUEA 1OBDA 2PUUA 3HA8A 1XWSA 3QCXA 5KBQA 4TY1A 5A3XA 2WO6A 3DCVA 3EL8A 5CXHA 1V0PA 2W5AA 5BQ0A 3R8PA 1RDQE 5JFWA 4PL3A 2QOQA 2UZLA 3DB8A 3HKOA 3Q6UA 5CNNA 5HKMA 5HQ0A 5L2IA 5LCKA 4FTAA 3HMOA 3C51A 3DB6A 4QYYA 4O86A 4MXXA 2OH0E 2XEYA 1SYKA 5AP5A 5AJQA 5ANGA 1LR4A 4X3JA 2QURA 2R3LA 4WNPA 5EM7A 4LRJA 3MY0A 5C8KA 4FTUA 4EUTA 3H3CA 4ZSEA 3BLQA 4BF2A 3NNVA 4IANA 3LIJA 3PFQA 4XG7A 4DHFA 1KV1A 4BZDA 4TWOA 4IWQA 2CLQA 2ITQA 2PVMA 2VO6A 3FQHA 4EZ5A 3ZDUA 2QU5A 4Q9SA 3UIMA 3E88A 4Y8DA 2JLDA 5E8VA 2JDOA 3EKNA 4FV5A 3NUNA 2EU9A 4IAZA 2P3GX 1SNUA 4YTCA 4O0WA 4ID7A 4D4VA 3LFNA 2OXYA 3LOKA 4J52A 3LQ5A 3QKMA 4B6LA 1SM2A 1FGKA 2YM7A 3ZO1A 4GIHA 3WF9A 3FWQA 3ORNA 5DIAA 4S31A 2I0YA 3KY2A 4ITIA 1H1PA 3VBXA 4BI2A 2CN8A 4XH6A 2XIYA 2YM5A 1T45A 5ETAA 4Y83A 1CKIA 4XYFA 1XR1A 1BLXA 2GFCA 5M55A 3ETAA 3G90X 4BWPA 4GSBA 2R9SA 3RM7A 4ZY6A 2ZDUA 2NRYA 4N0SA 3CKXA 5FQDC 4GFGA 2UW7A 3D5WA 5K0XA 1YOJA 2VX0A 5KMJA 4QQ5A 5HU3A 2W9FB 3E62A 1OMWA 2WQMA 3CSVA 2C0IA 1LEWA 2ITPA 5CEIA 3OF0A 4M12A 4RA5A 3W2QA 2JITA 1JSVA 4L7FA 2UW5A 5E8SA 5DRDA 4PPAA 1VR2A 4JX7A 4EYMA 4FG7A 1V0OA 2BTSA 2WKMA 2P2HA 4JX3A 3NPCA 2XYUA 3HDMA 2AC5A 2OBJA 3UYSA 3FYKX 3IECA 5TOZA 1KE6A 2UW3A 3GCSA 4YBKA 5EOBA 4D4RA 3Q32A 4LUEA 3LFSA 2CGXA 4QO9A 1OZ1A 4XG6A 3UQGA 5LVPA 4XG4A 3HUBA 3OCTA 1PKGA 4D5HA 4RFYA 3FLWA 5LOHA 3E93A 3VBWA 3UODA 3S1HA 2BFXA 1OUYA 5EDPA 2CKEA 4HGTA 5E8YA 3TKHA 3QF9A 4BTMA 3R7VA 1PYEA 4HYSA 3CBLA 5I0BA 1V0BA 4O7LA 2HZ4A 3AD4A 3PSCA 3PJ3A 4JG6A 4NU1A 5L2QA 2XS0A 4MF1A 1YXSA 3H30A 2QOFA 3TTIA 2C0OA 3LHJA 3FXXA 4OAUC 3DKFA 4CVAA 4CFXA 2XNEA 2CHLA 2B52A 2QOLA 4XLIA 3PYYA 2J0IA 1AQ1A 2X4FA 4JIKA 1CMKE 2VTAA 3W32A 3ZRKA 3AGLA 3LJ0A 1H1RA 4ZP5A 3ZUTA 2YWVA 2QO7A 3SXSA 4RZVA 1OIQA 2IVTA 1Z5MA 2A1AB 3ZSGA 4JBPA 3ZO2A 2AC3A 3EYHA 4UEUA 2EB3A 3QQJA 4C4JA 3NS9A 4C59A 4A4OA 4D55A 3HV4A 3D7ZA 3ZXZA 1Q62A 3NW7A 3D83A 2GPHA 1ZYJA 3SRVB 4FZDB 3EFLA 2QOHA 5LVNA 4X3FB 5BUJA 1PKDA 4I4EA 3VJNA 4W8EA 3C0HA 4QMWA 5FTQA 3TV7A 4U6RA 5C01A 5C03A 3K5VA 1ZY5A 3SGCA 4PQNA 4CRSA 2JAVA 3DZOA 3NDMA 2X39A 3RNIA 3TKIA 3VHEA 5LXMA 4TTHB 2YDKA 1YXXA 4FI1A 4RC4A 1NXKA 2Y0AA 4J1RA 3C4FA 3V04A 3ZC5A 4IX3A 4C4FA 4HGLA 3I5NA 4C36A 4C3RA 5HE0A 2HENA 1WBVA 3V01A 3CQEA 2E9OA 4A4LA 5HG9A 3RM6A 4YUQA 4M0YA 2XBJA 5CEKA 3VBQA 2YCQA 3I4BA 4CT1A 1I44A 4FEXA 4DFBA 4DEDA 1WVWA 2V22A 5M56A 4YU2A 4BR3A 2IVUA 4R78A 3QXOA 3OD6X 3BHTA 3DKCA 4GJ2A 3JVRA 3SRVA 3PXRA 2CKPA 2QC6A 1J7LA 2YZAA 4X3FA 2HOGA 1W83A 2JKMA 4G2FA 3O8TA 3LQ3A 3PY1A 1H0VA 3ACJA 2J90A 4QMTA 1CDKA 4USDA 3FPQA 5JFSA 4R5YA 4FZ7A 2W4JA 3OXZA 4PMSA 5A9UA 2WQBA 5DI1A 2QCSA 5HGIA 3FBVA 3U54A 2XRWA 3KN5A 2WIHA 2C6DA 2XJ0A 4PMTA 3R7GA 3P79A 3MVLA 3QYZA 1L3RE 3VUIA 3HUCA 2A4LA 3RJCA 4BCIA 1GY3A 2FSMX 5EOLA 2PE1A 5HO6A 1LEZA 3LXNA 1W82A 4DF3A 3BPRA 1KSWA 3TT0A 2ZV7A 3KMMA 3AT4A 4IZ7A 4ZMFA 4DFYA 3UTOA 2PZ5A 4BCHA 3F3ZA 4FSTA 3G9LX 3GXLA 5FXSA 4CXAA 3U6HA 3PXFA 2PTKA 5H8GA 3EJ1A 1W98A 3NAXA 5A4QA 5H8BA 4XBUA 2Z60A 4YPDA 3KREA 5HO8A 5AR7A 5CSWA 3C9WA 1ZARA 2RFSA 2YIXA 2QG5A 4GG5A 4LRKA 4QRCA 5EI8A 5IA5A 3VJOA 3BKBA 3G0FA 4E7WA 4MBJA 4F9WA 4XBRA 4RVMA 4ZSLA 5CNOA 3FSFA 2W1IA 3IONA 2G9XA 3TJDA 3GVUA 3V5LA 4AF3A 3KCFA 3CY3A 3KXZA 2YITA 3K3IA 1Q8ZA 4DGOA 3SD0A 5AV3A 4L7SA 5KO1A 4A9TA 2W1HA 5CT7A 4ZZNA 3V8WA 5A6OA 1WVXA 4K2RA 5C1QB 4YZDA 4F7JA 4JI9A 5C8MA 2VV9A 3NAYA 1J1CA 4TWPA 4D28A 1BX6A 5KMOA 3G51A 4PTCA 2GTNA 1IA8A 3KRXA 3OWPA 2VD5A 3WZKA 3P7CA 2X2KA 3KGAA 4AA4A 2WOTA 4OAVB 2QOOA 3E3BX 4AW5A 4P5ZA 4HVIA 4HCVA 3QQKA 3BYMA 4YHTA 4ZOGA 2VO3A 1PXKA 3W2RA 4O21A 4PX6A 5I3RA 3O50A 3ZEWA 4F6WA 3V6RA 2UZUE 3IGOA 4FTMA 3NWWA 5IA1A 2O0UA 2R3PA 5TT7A 4S30A 1W7HA 2CLXA 5HVJA 4AOTA 4AN9A 2RSVA 2YCSA 3EQPA 4QD6A 3ZH8A 5DHJA 4AUAA 4R5SA 3QUDA
chains in the Genus database with same CATH superfamily
1R1WA 3FMKA 2YACA 3ZFYA 5L2TA 3OT3A 3A99A 5A14A 3H9FA 4FJVA 4LFIA 4G6OA 2ITXA 2ZVAA 5L3AA 2B1PA 3WIGA 3ZXTA 3MTLA 4UXQA 5EFQA 3JY0A 4ZY4A 4MK0A 4I3ZA 5CAUA 3F9NA 3OCBA 4DDIA 4O38A 2GCDA 4E1ZA 2B9IA 2I0VA 3CTQA 4BC6A 1U5QA 3EN9A 4IB5A 3HV7A 3EQFA 3PPZA 5FTOA 4TNDA 3D14A 5AIRA 5EW9A 1CTPE 4E4MA 4YC6A 4RA4A 5GZAA 5AP2A 4FKSA 3FUPA 2OJGA 2EXMA 3SV0A 3Q3BA 1G8SA 4F08A 3EKKA 5CZHA 3PY3A 1BMKA 4RZWA 5LMAA 4NKSA 2XVDA 2JEDA 3ZTXA 4R1YA 4EHVA 4PNKA 2XM9A 4NW5A 3NFFB 3R0TA 2GNFA 4JRNA 2XEZA 3AC3A 2BIKB 3F82A 3RAHA 1FPUA 3DA6A 3U4WA 4D5KA 2X9EA 4FIFA 3DNDA 4R3PA 4I5PA 3E5AA 2W06A 1XMMA 5JGAA 3UO5A 1Q8UA 4YTIA 2VTRA 2ITYA 4KRCA 2A2AA 3LVPA 4IFCA 3B2TA 2B54A 2PMNX 4C3PA 3S2PA 1SMHA 3MJ2A 2C69A 1Q3DA 2CGVA 2RL5A 4GCJA 5TKDA 3CQWA 4J8MA 4GRBA 4X2NA 4D2VA 4NJ3A 4RG0A 2BKKA 5FG8A 4Z16A 3ATSA 3DBQA 2JKOA 4MBIA 5M4UA 2G1TA 4P90A 1H1SA 3BLRA 4JT3A 1PXOA 3RPYA 5BPYA 3LM0A 2IO6A 4PF4A 3TM0A 3COIA 3P5JC 4BRXA 2R3GA 4LL0A 4QMPA 4TYHA 4J98A 4Y85A 2C3KA 5CX9A 3PXYA 4EWHA 5JFVA 1XH4A 1ND4A 5DFPA 1GIHA 3OW3A 2QKWB 4KNBA 4ZS4A 2BCJA 3WF5A 4FL2A 4YO6A 4X3FC 5B2MA 3QQHA 4J71A 1GIIA 3UVPA 4AZVA 4Q9ZA 3OWKA 3WI6A 4FNYA 2ZV2A 5C4KA 2OIQA 4XMOA 5HBJA 4D4SA 5A6NA 4XP0A 5FGKA 3ID6C 4QT1A 4I5MA 4I6QA 5FEQA 4FGRA 1PXLA 4JBOA 5HNIX 3UG1A 2PHKA 4M97A 1NVSA 4HVHA 4FKQA 4AACA 2XNOA 4PDSA 4QPMA 1XH6A 4BWKA 4I23A 2GHMA 3U9CA 4KIPA 3SKCA 3RGFA 4WSQA 2BMCA 2BRBA 4YP8A 2OF2A 4BI1A 3MFTA 2OJJA 2XK9A 2QNJA 4YZMA 5FEDA 3KF4A 3UVRA 4YTFA 3M11A 4BDJA 4F64A 3PVWA 1ZZ2A 2WQEA 4JR7A 4UZHA 3TG1A 4EZ7A 1G5SA 4IBMA 5LMBA 4G1WA 2NYAA 2JGZA 2V7AA 4FSYA 4F09A 5DMZA 2IZSA 4CTBA 5IA2A 2Y4PA 3GB2A 3H4JA 3BYOA 2X0GA 2IWIA 3E3PA 3HV5A 3R1NA 4FC0A 3OHTA 3D2IA 4BCPA 5J87A 4CRLA 1GAGA 3MS9A 3PE2A 4FT0A 4LYNA 4YJNA 5J95A 3TCPA 1ZYSA 5K4JA 1PXIA 1YDTE 4FV7A 4RJ5A 2JBOA 3QAME 1OKWA 4FYNA 1FMKA 4MBLA 4WBBB 4O2ZA 3VF8A 3VIDA 3SVVA 3VNTA 2F2UA 4EK6A 4FT3A 2XB7A 3O8UA 3R30A 4E4XA 3TL8A 2BAQA 4IADA 4EORA 2VRXA 3KK8A 2I0EA 2O65A 4C57A 5EM8A 4G3FA 4UMPA 2F4JA 2J0JA 5BVEA 4DH8A 4UWYA 2Y6OA 4D2TA 3C4XA 3HV3A 3A60A 3A61A 5H3QA 4E6AA 2IVSA 3S0OA 2W0JA 4BKJA 3R9RA 3QLFA 3L9NA 2XK8A 3FMNA 5AAFA 5IEYA 4M68A 2V55A 5K5XA 2BZKB 3GFWA 3MTFA 3PP0A 4I22A 2V5QA 5HU9A 4AXFA 2DYLA 1YWRA 5M09A 1MRUA 2GNIA 4QP6A 3D5UA 1WFCA 4I0SA 4O4EA 4RLKA 3TNIA 2R3JA 3TUDA 5CEPA 3UNKA 2R4BA 3GFEA 4QYGA 2IW8A 3UOKA 3W2OA 2ZFYA 3C5UA 4UMTA 3ZCLA 5AUUA 3KF7A 3WE8A 5HCYA 3KXNA 4FZFB 3Q9YA 4JOAA 4ZTSA 5HE3A 4AW0A 1OL2A 3TKUA 3O96A 4ZTQA 5DH3A 4G5JA 4R77A 3ZONA 5B0XA 2C1BA 2I0HA 4QTAA 1YOMA 3SLSA 4CKIA 3Q52A 2OI4X 2R3KA 4O1OA 4X2KA 4EBVA 5CWZA 4FUXA 4O4DA 4AOJA 2XIKA 4A7CA 4ANLA 1WBTA 3DJ5A 3DS6A 4W9WA 4IACA 3MA3A 5CT0A 4IC7A 3D0EA 5CLPA 3F5UA 3TNWA 5E1EA 3R04A 3ZC6A 3EFWA 4DTBA 2QONA 2ZM3A 3HA6A 2ETKA 1OKZA 3FLQA 1ERKA 2UZWE 3PJCA 4AW2A 4BIBA 4EOJA 3IDPA 4L42A 3G5DA 3NUYA 3W2CA 2UZNA 4C2WA 2WIPA 3CCNA 5HNGA 2XNPA 3ZZWA 5EG3A 4IVBA 3RKBA 2GHLA 2J50A 4G31A 3SOCA 4CKRA 1FOTA 1ST4A 2X81A 5DOSA 4HVSA 1WAKA 2PUIA 2PVKA 3ULIA 2RFNA 4XP2A 3K54A 4I4FA 4GU9A 4FVQA 3WILA 3TJCA 3U8WA 3HMNA 4WNOA 4V05A 3WF7A 2QHMA 5HE2A 4EL9A 5DR9A 4GUEA 4DH7A 5AAEA 2X1NA 1SVHA 4JMQA 3HMPA 1FVTA 3QA8A 2FB8A 4X2JA 1ZOEA 4L00A 4BDFA 3KEXA 3EOCA 1PMEA 5ANKA 4RJ8A 3W0OA 1A9UA 2QQ7A 3U55A 4KIOA 3VQUA 5HIBA 1OPJA 2JDSA 3KFAA 2H8HA 2EXCX 5HESA 3REPA 2ZDTA 4EHGA 2ITVA 2X7FA 2YEXA 4BCFA 1FINA 2OGVA 1ZOGA 3N4UA 1P2AA 4UMQA 2VO0A 4G3EA 2OZOA 5HX8A 3Q2MA 2J2IB 2YLFA 2YIRA 4RX7A 3NYOA 5GNKA 3NFGB 3HGKA 4HCTA 4XG2A 3PG3A 4O91A 3CGOA 2KTYA 4EH4A 3OY1A 4HZSA 4QYFA 4U0IA 5E8WA 5IG1A 4E4NA 4LOOA 4EOKA 5IQGA 3PLSA 1OKYA 2F57A 2Z7RA 4F1MA 1VYZA 4YZ9A 3R83A 4U41A 3A2CA 2VWBA 3PZHA 4OTGA 4S34A 4X7QA 3F2RA 2UVZA 1YI6A 2UUEA 4H58A 4WKQA 2P4IA 5BX0A 4LMUA 4M69B 4FTKA 5JRQA 3EFJA 5JZJA 3PSBA 5EHOA 4ENYA 4UV0A 1L8TA 1JVPP 2BHEA 4XG3A 4KINA 2RGPA 2OJFE 3L9LA 3PE1A 4DBXA 3TWJA 3R8UA 3RHKA 4I6FA 4C4HA 4ALWA 2PE0A 1KOBA 4C4EA 3BWFA 2HXQA 3FLNC 4EHEA 2HW6A 1H00A 2OICA 2UW6A 3QYWA 4OTHA 3MFUA 3EQIA 4S33A 4XCUA 3D4QA 4XNEA 5F94A 5KBRA 3CQUA 3FMLA 3GC9A 1B6CB 3DDQA 4QTBA 4WG5A 3KVXA 3FKLA 5A4LA 4L9IA 3ZDIA 3UP7A 4CEGA 4KWPA 4A9SA 2DQ7X 4AGDA 1STCE 4EOPA 4IQ6A 3DLZA 3G33A 4MXOA 4XOZA 1WBSA 4FZAB 4HPTE 4YJQA 4L67A 4BGQA 2GSFA 3OFMA 4FMQA 4M69A 4W4WA 4RLLA 4AFEA 3DK6A 4A06A 3F5GA 1J3HA 4DEBA 3OTVA 4CLIA 4F6SA 3ROCA 4DE4A 2VTSA 4YZNA 4D2SA 3ZOSA 3QKKA 5IQDA 2VTMA 2WGJA 4GMYA 5J8IA 4RVTA 4DFXE 3D2KA 2GNLA 3PPKA 4O7ZA 5EM6A 5IF1A 3OBJA 1UV5A 3GCPA 4RQVA 4Q5HA 2OK1A 4C62A 5IISA 5L2WA 2R2PA 4GYGA 3RVGA 4DEGA 2XALA 1M7NA 4QP8A 3E8NA 3A8WA 4B8MA 5BMSA 3L8XA 3CXWA 3RCJA 5CEOA 3EL7A 4G16A 2PUNA 4UYAA 3KA0A 3BX5A 4IX6A 1MP8A 2WTKB 3KRRA 4MXAA 3SX9A 3D94A 3ZS5A 4D9TA 1HOWA 3TDWA 4JBQA 5AUZA 5HI2A 3QCSA 2HXLA 2WMAA 2YISA 4M14A 2WQOA 3DFCB 2XH5A 4AA0A 5AA8A 3UO4A 3O0GA 3GU7A 4L8MA 3VF9A 5T68A 3OTUA 3OEFX 3CD8A 2QHNA 4I0RA 2R0IA 5HBEA 3UE4A 3AT2A 5IDNA 3WZDA 4C02A 4XG8A 4D2PA 3QFVA 4N57A 1ZZLA 4BHNA 4EQUA 5LJJA 5J1WA 4G3GA 3UOHA 5JK3A 3QL8A 5ETFA 1A06A 5L8LA 4F0FA 5A54A 2YIWA 1OB3A 2YM8A 2W1ZA 4QQJA 3ZLWA 4F9BA 2A0CX 3FL4A 4G5PA 4FIGA 4H3QA 5EDRA 4Z3VA 1JAMA 4JQ7A 4XG9A 3VUHA 1OIYA 4XP3A 3IW8A 4XUFA 4HOKA 4BL1A 1UU9A 4C33A 2PVLA 3AC8A 2V62A 4EC8A 2ETRA 4ERKA 4PY1A 5AFVA 4FTTA 3LLTA 4X0MA 1S9JA 2QOBA 2X2LA 3NVMB 3WF8A 2JFLA 3U4UA 1IAJA 4X2GA 4JDJA 4L68A 4QMUA 5KCVA 3FLYA 3QGWA 1ZOHA 3PP1A 5GJGA 4D1SA 4EOMA 4WUNA 5LMKA 4KKGA 3QD4A 2PVHA 4G9CA 5HBHA 1HCKA 3RMFA 1DAWA 4O7RA 1KE8A 1M7QA 4G17A 5EM5A 4NZWB 5IQHA 5CVHA 4CGAA 4CT2A 1OM1A 4GK2A 3LPBA 2JIIA 2YWPA 4M8TA 4PP9A 4QP9A 3TEIA 5A4TA 4PMPA 4GK3A 1JKTA 5CU4A 3A62A 5M51A 2XNBA 3MH2A 2OLCA 3HAMA 1SZMA 4I20A 2O64A 2PVFA 4RC2A 1WBOA 2FO0A 3Q9ZA 3VQHA 4HVGA 4BTKA 3FY0A 3F88A 5J7BA 3QUPA 2JDTA 1OL5A 4D2RA 3QRUA 1REKA 5CF5A 2YAAA 3KN6A 2YM4A 3OROA 4FF8A 4O4CA 3VS2A 2W5BA 3LMHA 2XF0A 2XJ2A 3TDVA 4IB0A 1YXUA 2CGWA 3LCTA 3I6WA 1FGIA 2H96A 2R64A 2XRUA 4RX8A 5FP6A 4FR4A 3PA5A 3R7UA 4BBEA 5I9VA 5HLWA 1J1BA 2X6EA 3ZZEA 4QQTA 3ZSHA 4DG0E 4RMZA 5HOAA 3F3UA 3QTIA 5HVYA 3W8QA 4RIWB 1YXTA 4K18A 3H0ZA 4HGSA 4YHJA 4FL3A 5HVKA 4AW1A 5ANJA 3CC6A 1SNXA 4IX4A 2UVXA 4FT7A 4XV1A 3PXKA 4BICA 4F1TA 3DLSA 3K5UA 4C35A 1VJYA 5FBOA 4EQCA 4S32A 1VYWA 5HICA 3TZ9A 2CKOA 2OU7A 2E2BA 3I0QA 3PXQA 4A9YA 5JEBA 3O71A 3Q4TA 4PWNA 3NNWA 4QYHA 3F69A 5LWMA 4GW8A 5M08A 3R21A 1TQMA 1UU8A 4QMSA 4I92A 3M1SA 5AMNA 3DY7A 2ZB0A 2P0CA 2JFMA 4NWMA 3NUSA 3QTXA 2JIUA 2X6DA 4ASXA 3DV3A 3EQDA 3GNIB 2WEVA 1DM2A 1NA7A 2EB2A 3SDJA 4AZTA 5KHXA 4LOQA 2IW9A 5AADA 2BKZA 4C7TA 2OXXA 1OKVA 4DHJA 4DDGA 3FI4A 3QTWA 4JAIA 5CENA 2A98A 3DK3A 4OBPA 2FYSA 1XHAA 4D4YA 3LCSA 4RIWA 4ACHA 4DFZE 1YRPA 1WMKA 3RTPA 3N4VA 3JYAA 3Q9XA 1U5RA 4N6ZA 3VAPA 3P1AA 1EH4A 2BROA 1YHVA 2G2HA 2X9FA 3FDNA 3R8VA 3QQFA 2OJ9A 2RG5A 1PF8A 3GUBA 4I0TA 5LARA 1XBBA 4OTFA 4LV5A 3IK3A 2RFDA 2R3NA 4PPCA 4II5A 3W2SA 1FVRA 1P5EA 4ALUA 3IW5A 2C5OA 3VN9A 5IEXA 4FV4A 1UU3A 5FTGA 3C1XA 2XNGA 3MH1A 4EH3A 2ESMA 3EIDA 3ZUVA 2QG7A 4IJPA 2QODA 5C27A 5JQ8A 3R1YA 2F7EE 3E8EA 3AGMA 3ZRMA 3UQFA 2HWOA 4DLJA 4O0XA 2IZUA 4LRMA 2HY0A 2I1MA 3MV5A 4E5WA 3QTZA 3NVKI 3PA4A 2WTDA 1JSTA 5BUEA 3ORTA 3PIYA 5IMEA 2ERKA 2YAKA 5J7HA 2GMXA 3DGKA 4UMUA 3VWAA 3DJ7A 2QD9A 3K2LA 2VN9A 3TMOA 4QTCA 2B7AA 2REIA 3A4PA 3NNXA 4P2KA 4BZNA 5JMSA 3O7LD 5HLNA 4JLCA 3RPSA 4FTIA 3O17A 4JIAA 1JQHA 2YIYA 4B7TA 5HG7A 4NL0A 4HW7A 4DEEA 1F0QA 4WG3A 2WTVA 4U8ZA 2XA4A 3IQ7A 4J99A 3ANRA 3C4ZA 4H1JA 4FOBA 4BBMA 1UNGA 1YVJA 2IPXA 5IUGA 2RF9A 2BFYA 2VTPA 4M3QA 1OIRA 2YIQA 1P14A 3I1AA 4UBAA 3R7OA 3M2WA 4CNHA 2XK4A 4MCVA 5KHWA 5BV3A 1IA9A 4DA5A 3A7FA 4M7IA 4FT9A 3OCGA 5HNBA 3GC8A 4EOOA 2PVJA 2W1EA 4P5QA 3GT8A 3BGQA 4DG3E 4E5BA 4F0IA 4EJ7A 4ZLZA 2C5YA 3LFCA 5ANOA 2H6DA 4E26A 1XH5A 3EN6A 1Q8WA 3ORIA 4H36A 3TI1A 4ANOA 2WTKC 4IZ5A 2HY81 4IDTA 4C37A 4CQEA 1CSNA 4RQKA 2OG8A 3G0EA 4XV3A 4WUAA 2OO8X 2I6LA 1PHKA 3VW8A 3NIZA 1H27A 3MH3A 1XJDA 3ODZX 3HP2A 4XRJA 3G9NA 3WZUA 3LCOA 4DTKA 3W0SA 4FKRA 5CALA 4O4BB 1BL7A 2AEGA 4U79A 3BQCA 1ZAOA 2HIWA 4LM5A 3NUPA 4L43A 1O6LA 3F5XA 3Q96A 2CGUA 3ORXA 4F99A 4E8AA 3QTQA 4EOQA 2HCKA 4FV3A 4QMOA 4YJUA 4BCOA 5AV0A 4YR8A 1AD5A 2VWIA 2FUMA 3FZ1A 2HZIA 3R9OA 4ARKA 4BDBA 4I6HA 5L6OA 2WQNA 4B0GA 4AGWA 3D15A 3DKGA 3PVUA 2LAVA 4MQ2A 4BDDA 2X8EA 3BYVA 3W0PA 3RK7A 3QKLA 4I5HA 1YXVA 4BCNA 3WBLA 4C0TA 3D5VA 4IB3A 2W1FA 3QLGA 3R9DA 5IUHA 5L2SA 3F7ZA 4I93A 5HLPA 2VU3A 5CAVA 4RWLA 4FGBA 3R28A 3KRWA 3DQXA 1BL6A 4YNEA 4AU8A 2AYPA 2ZM4A 3RBWA 4DEAA 5LVOA 1F3MC 2YFXA 4N6YA 5EQYA 3CLYA 4AZFA 1JWHA 3N4TA 3ZM4A 2FGIA 2W4OA 1KE5A 4RJ4A 3LMIA 2BIYA 3FYJX 2PMOX 3O23A 4FKVA 3A7HA 4P4CA 3GENA 2OFVA 2C6EA 3IS5A 4BBFA 4IAKA 5IH5A 5GINE 4R1VA 4OTWA 5IA0A 1JOWB 4RT7A 3F2NA 5D7AA 4O0RA 2VWZA 3DNEA 1KOAA 3QALE 3AKKA 4C8BA 4XX9A 4AXCA 2PZRA 3N51A 4YLJA 4M84A 2Y4IB 5KMLA 4R3RA 4H05A 3DPKA 5AM6A 1R3CA 5H2UA 2B55A 4NM5A 5A4CA 3CPBA 4K77A 3BV3A 4E20A 2Y6MA 2X8IA 1BI8A 4CCUA 4FTNA 4GIIA 4TW9A 3T3VA 4NFMA 5EYCA 2JDVA 3F61A 3OWLA 3WIKA 4DFLA 1Q97A 3GQIA 3I5ZA 4HPUE 2FA2A 3RZFA 2GU8A 5LWNA 1FMOE 3IOKA 5EH0A 4FEWA 2C68A 3C0IA 2XIRA 3PIXA 4DYMA 5J9YA 4UMRA 1H0WA 5A4EA 4DT8A 4AN2A 3JVSA 2WMRA 4HYHA 4XLVA 3T9TA 1W84A 4WSYA 4QMMA 3FZOA 3QZHA 3MBLA 2IN6A 2XM8A 3EQCA 3E87A 3PTGA 3Q4UA 2VNYA 3MH0A 1UKHA 3Q04A 3UZRA 1R78A 4OTDA 5HD7A 3R8LA 5JSMA 5E4HA 3O8PA 3DBEA 4FV1A 3BBWA 5K3YA 3VUMA 5DYJA 4Y5HA 4LV7A 5EK7A 3P23A 1PXNA 4MEDA 3ZFXA 1MUOA 3OVVA 4L44A 1YW2A 2VWXA 4QNAA 4WO5A 5CVFA 4KUJA 3VS0A 5AWMA 2PYWA 4R6VA 4WOVA 3RWQA 4F0GA 1H24A 2YCRA 4YHFA 4H39A 5F1ZA 2R7BA 2ITOA 4EEVA 2BDFA 2IJMA 3W10A 3E7VA 2BDJA 1GNGA 5JRSA 5KNJA 4O83A 4U5JA 1KE7A 2XIZA 3GBZA 4LMNA 3A8XA 3NX8A 4O0YA 4OTIA 4ZZMA 4AAYA 4YJRA 3ACKA 2VTJA 5DT4A 4EHZA 3W18A 3WYXA 3V6SA 1UWHA 2FSOX 4XS2A 2W7XA 4ACDA 3U6JA 3JY9A 4ANNA 1UWJA 3KKVA 4GT4A 4FVPA 3OT8A 5AX9A 2XCKA 1OL7A 3VUKA 3FQEA 4NUSA 3VONA 4O6EA 3TIYA 3E7OA 4PV0A 4R7IA 4AE9A 2Y8OA 1YWVA 2HK5A 2WMTA 3ALOA 3FV8A 2W05A 5F4NA 4Z7GA 3FEGA 4FKIA 4ZTLA 5EW8A 2XARA 1WZYA 2UZDA 2PPQA 1IRKA 2G2IA 3T3UA 5HHWA 5GIPE 2CJMA 3PRFA 4TPTA 3ZEPA 5AUVA 4RIOA 3OMVA 5A46A 3BHYA 4NKAA 2QU6A 5E8TA 3EWHA 4HYUA 2C1AA 2X0OA 1ATPE 2F9GA 4NSTA 4E6CA 1JKSA 1ZMUA 2B9HA 4WRSA 4DH3A 3H10A 3WZJA 4ZJVA 3JR1A 1PYXA 2ZM1A 3QA0A 1YHWA 4L6QA 3FHRA 5FM2A 4ZXTA 4DFNA 3TUBA 4MTAA 4UB7A 4FT5A 2YHVA 4ASEA 1REJA 2Y7JA 3EN5A 3HVCA 3KULB 4DGGA 3I60A 4FV0A 3OEZA 3JS2A 3L1SA 4GV1A 3P86A 4PTGA 3W2PA 4ACGA 3TNHA 3P08A 4O22A 2RG6A 4BN1A 3E63A 3IPHA 2C3LA 4AA5A 2B4SB 3LLAA 3COKA 3R1QA 5DPVA 4ZLYA 4NFNA 5CSXA 4GK4A 3DTCA 1Y8YA 1H08A 4TL0A 2A27A 2W17A 4GVAA 4TXCA 4AZWA 4RGJA 4AGCA 3NW5A 1BYGA 3QWJA 4WRGA 4ZTNA 5BYZA 3ZLYA 3Q4CA 4KBCA 4O7SA 3BCEA 4UZDA 5DEWA 4BFMA 3FSKA 3MIAA 2YN8A 3BBTB 5CEMA 4RWKA 4M0ZA 1TVOA 2BAKA 2R3OA 2GFSA 2YLEA 4PL4A 4RIXB 3PUPA 4LOPA 1YQJA 2BTRA 2QR8A 4ZAUA 1S9IA 2C6IA 4WT6A 3UIXA 3KXHA 4D9UA 5M4CA 3KULA 3AG9A 3TZ8A 3FZPA 5GJDA 3TN8A 5CF4A 3RCDA 2WELA 3DTWA 4Y72A 2WD1A 5DGZA 3MN3A 5CI7A 3HL7A 2WXVA 4O2PA 5DE2A 5GHVA 4BDAA 4EZ3A 3FMMA 4O0UA 3KB7A 4YSMA 4EH6A 3KVWA 3CJFA 2WU7A 2VNWA 2ZJWA 3EFKA 4MD7E 4LUDA 4RJ7A 3QRJA 3WARA 3G6GA 2RKUA 4FTCA 5H8EA 3VBYA 2OZAB 2E9NA 3P5KA 1VZOA 4IWOA 3ZMMA 2G2FA 1YDRE 3D5XA 1IG1A 3NYNA 4KSPA 3TV6A 3W55A 5HZNA 4DT9A 3CEKA 3OOGA 3Q5ZA 3V5QA 4E4LA 4EH8A 2ITWA 4RVKA 4YJPA 3OUNB 2CSNA 3NYVA 3SQQA 3FMDA 4UALA 3QQUA 1X8BA 2YM6A 3ENHA 1UA2A 5AV1A 5B7VA 3L8PA 2PE2A 5FWKK 3F3WA 4RFZA 3HLLA 3L9MA 4UXLA 4FBXA 1PRYA 3UPZA 4GKIA 2ITUA 4EWQA 3KK9A 1F5QA 3R7IA 3DT1A 4RRVA 5DR2A 4BKYA 1R0PA 4B4LA 3VS7A 3FI8A 2ZMDA 3D7TB 4FA2A 4NT4A 2YJRA 2Z7SA 5HO7A 2O63A 5DG5A 3EQBA 3MB6A 2IZTA 5JN2A 3MIYA 4FZ6A 4KIQA 3SW7A 3V51A 2UW0A 1ZYCA 2QLUA 2OZAA 2VWYA 4ACCA 4G34A 4JRVA 1XMLA 5DBXA 2UZVA 3PIZA 3NW6A 4IE9A 3BZ3A 3R63A 4Q2AA 3QC4A 4KABA 3UC3A 2PZIA 4QP1A 5E1SA 2OWBA 1YI4A 5HCZA 4JBVA 4FV2A 3FL5A 4ZK5A 4CYJA 5IU2A 5JGBA 3LKMA 4QDEA 4ZTHA 3NYXA 5HTCA 4HJOA 3LMGA 3OC1A 4KBAA 3ORLA 3I7BA 4RC3A 1JLUE 2W1CA 4NYEA 3SAYA 1J7UA 5C8NA 3H9OA 4APPA 3C4WA 4FSMA 4EK3A 2R0UA 4Y95A 2PMLX 3FKOA 4NH1A 3THBA 1I09A 3DBCA 5IZFA 4DEIA 3RAWA 5FRIA 3D7TA 2UZOA 3ZSIA 2R3MA 3AC5A 4QYEA 4JG7A 5AUTA 1G8JA 4FV8A 3UMWA 1TZDA 2HZ0A 3LXKA 5ETCA 4O0TA 1XBAA 3VC4A 4I24A 4N70A 3I81A 1LUFA 5AUXA 3UP2A 3FI2A 3GC0A 2C4GA 5AM7A 4AQCA 1B39A 3KC3A 4MXYA 4YZCA 3EQHA 3Q53A 4YPSA 2VTTA 3LFFA 4CFNA 1OITA 4K11A 5FD2A 2CKQA 4FKOA 3MFRA 4ZSAA 4HNIA 4NM3A 2UV2A 3DFAA 1OL1A 2WEIA 2YM3A 4C38A 4PRJA 1U46A 1GIJA 3BRBA 3PG1A 4FUYA 5AAGA 5I9WA 4A9RA 5B2KA 3KMWA 3MDYA 5DT3A 5KE0A 5K5NA 2G01A 4F1OA 4CLJA 3OW4A 3P7BA 4XJ0A 3BIZA 1G3NA 4IJ9A 1YOLA 5G1XA 3KRLA 4TYEA 2XIXA 4QMLA 4RWJA 2FSLX 3EMGA 4AN3A 3ZFMA 1NY3A 3OXTA 2VGOA 1OECA 2PY3A 3RHXA 1MQBA 3T8OA 4BI0A 2CNVA 4F4PA 4PUZA 4YZBA 4CQGA 4ONAA 2DWBA 4FIIA 3UMXA 4ANQA 4NTSA 3VRYA 3ZLSA 3QD3A 5EHYA 4ZJJA 5ACBC 1H1QA 5HCXA 2IVVA 5L8JA 5E92A 3R71A 4JJRA 5I3OA 3BL9A 2W99B 3N9XA 1LPUA 4X6QC 3QHWA 4OW8A 4CMOA 4D0WA 2VAGA 2E9UA 4OT6A 3NCGA 4TN6A 4BDCA 1YDSE 2GQRA 3PJ2A 4U80A 2C0TA 3QX2A 4W4VA 4BY9E 4ZY5A 2Q83A 5JT2A 1YI3A 4CV9A 3PWDA 2R3RA 3EN4A 2PWLA 3B2WA 4MHAA 3Q60A 4BIDA 3CS9A 2NPQA 4GUBA 3GCVA 4F65A 5M4IA 4RFMA 4E5AX 4L53A 3CD3A 1CKJA 4XV9A 5J9ZA 4C3FA 3RINA 3UG2A 2V7OA 5BMMA 3S00A 4ZS0A 1YWNA 3L8VA 1NVQA 3VO3A 1WCCA 5BVDA 3ERKA 5BVKA 4F7NA 4J96A 5CANA 4QMXA 3IW4A 3IDCA 2WTJA 4J95A 3PVBA 1XH9A 2HW7A 3JXWA 2PMIA 1Y91A 2BRNA 3UNJA 3GOPA 3KQ7A 3R1SA 5ICPA 5DRBA 4FTOA 2GNJA 3GU6A 4FK3A 2GS6A 4IM0A 3BYSA 2H9VA 2QR7A 4ITJA 1M17A 4L3LA 4BTJA 4BYJA 3EZVA 4DLIA 5CAPA 5KKRB 4MAOA 4F7LA 2YCFA 3QTUA 5E91A 5F20A 3V8TA 4I94A 4RWIA 3AD6A 3C4CA 3T9IA 2NP8A 4K1BA 4BCKA 4FK6A 4RSSA 5AP0A 5IMXA 3VBTA 4D58A 4E6DA 2J9MA 4L3JA 5HIEA 2BAJA 5EYDA 4O1PA 2QOIA 3BGZA 5CYIA 5TE0A 3ZO4A