3V01A

Discovery of novel allosteric mek inhibitors possessing classical and non-classical bidentate ser212 interactions.
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
322
structure length
289
Chain Sequence
MELKDDDFEKISELGAGNGGVVFKVSHKPSGLVMARKLIHLEIKPAIRNQIIRELQVLHECNSPYIVGFYGAFYSDGEISICMEHMDGGSLDQVLKKAGRIPEQILGKVSIAVIKGLTYLREKHKIMHRDVKPSNILVNSRGEIKLCDFGVSGQLIDSMAVGTRSYMSPERLQGTHYSVQSDIWSMGLSLVEMAVGRYPIPPPDAKELELMFPPMAIFELLDYIVNEPPPKLPSGVFSLEFQDFVNKCLIKNPAERADLKQLMVHAFIKRSDAEEVDFAGWLCSTIGLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/inhibitor
molecule keywords Dual specificity mitogen-activated protein kinase kinase 1
publication title Discovery of Novel Allosteric Mitogen-Activated Protein Kinase Kinase (MEK) 1,2 Inhibitors Possessing Bidentate Ser212 Interactions.
pubmed doi rcsb
source organism Homo sapiens
total genus 85
structure length 289
sequence length 322
ec nomenclature ec 2.7.12.2: Mitogen-activated protein kinase kinase.
pdb deposition date 2011-12-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3v01A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3v01A01
3V5JA 3R21A 1YOLA 3UNZA 4L46A 5CAVA 3UO5A 4AFJA 3R0TA 3W55A 3FLWA 5E7RA 3VBQA 1E1XA 3IGGA 4J96A 4FBXA 4EH7A 3U55A 3PXZA 4Z7GA 1LP4A 3TDVA 2NNWB 1ZYJA 2KTYA 4F70A 1Y91A 2CCIA 3OUNB 3IPHA 4AGCA 2XBJA 4G9CA 1UU7A 2PY3A 3JS2A 1W82A 3UJGA 3SRVA 5FEDA 2OW3A 4BTFA 3KRRA 5LCKA 5EH0A 3Q2MA 1UWJA 3FLNC 3ORXA 5J95A 1ZXEA 3C50A 4D4SA 3MVLA 3UO4A 4BBMA 3BHHA 4ZSJA 4XG6A 3QGYA 2P4IA 2RFNA 3L1SA 4AGWA 5A4LA 4FKPA 4IVBA 2Z7SA 4V05A 4C62A 4QQ5A 3NCZA 5LWMA 1H26A 1PY5A 4D0XA 4ZZMA 3FUPA 4FL3A 4ZTQA 3MA6A 1H00A 2JDRA 2XS0A 5AV0A 3RNYA 2QO9A 3QTQA 3HV7A 4NCTC 5HOAA 5HLNA 4O7ZA 4GH2A 2XK8A 4MXZA 3FZRA 3QLFA 5AP0A 2ZMDA 3CBLA 3KCFA 3KULA 4HGSA 2PZRA 4MD8E 4F99A 3KXMA 4RFZA 3GB2A 2EB3A 1H1SA 2PE1A 4H3BA 4EHZA 3BGQA 4DFXE 5IA4A 3TNHA 3NRMA 4D5HA 3PDTA 5EM8A 3I0QA 2Z7LA 2Z2WA 1PJKA 1OB3A 4E73A 5IQBA 2OK1A 1BLXA 5AR2A 2CCHA 1M7NA 3ORZA 1FINA 2F2CB 4R7HA 2RF9A 2VD5A 3A7JA 3IQ7A 4V0GB 4RT7A 3RCJA 3ZC5A 3FMLA 3UQCA 3R30A 3VUGA 1P4OA 2RKUA 3BEAA 1OIYA 1ZYCA 4G3FA 4RPVA 3V5LA 4CZUA 3GC8A 4I41A 1T45A 4I5HA 4NH1A 4ZLOA 1JPAA 2QI8A 3ZFYA 5AV4A 4EQCA 1OITA 3LIJA 5LWNA 4XNEA 3R8MA 4Q5EA 2RFEA 2X7FA 4JAIA 4UX9A 3GCUA 1KOAA 4NFMA 3MFRA 4QMTA 3QA0A 5F9EA 3R28A 5CENA 5E8TA 3R1SA 5KMJA 1YXTA 1DI9A 4GK4A 5EI2A 1UNHA 3OCGA 4ENYA 4EYMA 4USFA 4E93A 1AGWA 1KV1A 2C6LA 3NW6A 4N6ZA 4KIKA 3IDPA 3M1SA 4FTCA 4YGAA 3OF0A 4S30A 2IWIA 2RFDA 4IAKA 2J0JA 2RG5A 3FMHA 4BCFA 2WD1A 5KX8A 3CQWA 3TV7A 5LVOA 3LCOA 2YERA 3AT4A 3OXTA 4GL9A 2IW9A 3I60A 1OKZA 3ORLA 4DGMA 3KKVA 4M14A 2BZJA 4ANLA 2ITOA 2VGOA 1NVQA 3OWKA 4FV7A 2C1AA 4FKVA 4F0FA 2F57A 3D7TB 4FYNA 4KIPA 4FZAB 2HOGA 3GVUA 4EOPA 2FB8A 2FVDA 4U7ZA 4ENXA 3TNWA 3UPZA 3ELJA 2OFVA 3O8UA 2ITVA 2FYSA 4TWCA 2E9VA 5CSWA 1OPJA 4OTPA 1RE8A 3OWJA 3JY9A 5IF1A 5L8LA 3C4ZA 3OHTA 5IQCA 1BI7A 2QOKA 1J7UA 3CR0A 4FOBA 4BZNA 2A2AA 2WMUA 4O6EA 5AP1A 3BV2A 4M15A 1CSNA 3O8PA 4RZVA 2ZAZA 3VUDA 2ERKA 2FGIA 3UOKA 4NW5A 2ACXA 2PVHA 4L7SA 3QX2A 4AXAA 4BWXA 4LL5A 1Q24A 5CX9A 3OY3A 2QG5A 4MKCA 5FDXA 3GQLA 4Y95A 4D2TA 4AA5A 1WMKA 5A14A 5IUHA 2HAKA 4X2NA 4WIHA 3EMGA 4I20A 4EH8A 3DNEA 5FBOA 4ZP5A 3MYGA 4BDAA 4XYFA 4CTBA 5CALA 1M52A 2WAJA 3ZUVA 2WQMA 2QKRA 5JFWA 2HXLA 3BV3A 3MTLA 3QQFA 5CTPA 3D2IA 3FV8A 3BHTA 1T46A 4FICA 2YLFA 3DFCB 4N70A 4FIEA 3RTPA 4BZOA 4KD1A 2X81A 3K5UA 3MESA 4I6QA 4M66A 1FGIA 2HZ0A 3NYXA 5M4CA 2XZSA 2IZSA 4M69A 3LFAA 3TZMA 1YDSE 3MIAA 4E5BA 3Q96A 3VS3A 5BMMA 3OOGA 5IDNA 3DXNA 5DIAA 4F9CA 3EHAA 2PVRA 3UYTA 3EL8A 3ZYAA 1JNKA 3EQBA 4EYJA 5BX0A 2AC5A 4WBBB 5I3OA 2P3GX 3O50A 5HI2A 3VIDA 4A9RA 2BR1A 3VVHA 4FSQA 5DBXA 5F94A 2ZB0A 3OC1A 3JXWA 3BYOA 2DWBA 3UNKA 3R6XA 2B9IA 2ZV9A 4BBEA 5DWRA 3ZM9A 3FXXA 4BDBA 3EQHA 2UZUE 3ORTA 4X6QC 4APPA 2YN8A 3OTUA 4IDTA 3VBWA 4O7RA 4XLIA 2Y6OA 3M2WA 4KB8A 4A9SA 3EJ1A 4UYNA 4RMZA 2JAMA 4CKIA 5J1VA 1K2PA 2CKOA 3GOPA 3TZ9A 2QU6A 4D2RA 4AW1A 4X2KA 5EW3A 3EFJA 3R8VA 3ATTA 5E90A 4HYHA 5J1WA 2W7XA 5M53A 4ZTNA 5BVKA 5KO1A 3BGPA 1BI8A 2YIRA 5C4LA 2PE2A 2BMCA 4QMLA 3D7TA 4KA3A 3DY7A 3S0OA 4GVAA 2VX1A 4ITIA 1OKYA 3FLYA 1O9UA 2YM8A 4ARKA 2XIZA 4R1VA 4XBUA 5EYMA 1I09A 3NYNA 4BWPA 4O7LA 4UWBA 1YDTE 4ZSLA 3KXGA 2BHHA 3V51A 4Z16A 3KU2A 3IECA 3TXOA 2E9UA 4YNOA 2C47A 2V0DA 3MGYA 4ASEA 3PG1A 3PPJA 4QMSA 4CQEA 1H1QA 4FI1A 1ZY4A 4UZDA 2IZUA 5HLPA 4AUAA 3BGZA 4QMXA 3EN7A 3FL4A 4KIOA 1W84A 4FV6A 4QP4A 3RPRA 4F08A 4NW6A 4JX7A 4BCQA 3ZHPC 5L8JA 5JFSA 5GJFA 3NVMB 3OG7A 3M11A 3V8SA 1RQQA 4EH3A 4QP9A 3QYZA 3S2PA 2WFYA 5HIEA 4L7FA 3G6GA 2XJ2A 2R7IA 4YTHA 4ANMA 1XH8A 2WTDA 4FKLA 4AA0A 2E9NA 1ATPE 1H25A 3GP0A 4L6QA 4BCJA 4DTBA 1ZRZA 4AW5A 1XH5A 2BZKB 3VUMA 2YLEA 3F3ZA 3RMFA 4IVAA 1YHSA 2NP8A 3A61A 3QRIA 4ANSA 4I93A 5HVKA 4LM5A 2CJMA 3EQDA 3PVBA 4JQEA 3OZ6A 2QOLA 2R3PA 4QMNA 1U54B 1XH7A 3PSDA 3MY0A 3ULIA 2WMRA 3ITZA 2ETRA 4CYJA 4YPDA 3O7LB 5IQGA 2WNTA 5E9EA 3ZLXA 5J8IA 4RJ5A 5H8BA 3FSKA 2JFLA 3MN3A 3QD3A 4EL9A 2WIHA 2W1GA 3NAYA 4PDPA 2X2MA 3F2AA 3R7GA 2CNVA 4LUDA 4WUNA 3UVQA 3Q9XA 3N4UA 3FLZA 4HYUA 2XF0A 4YJTA 1RDQE 4ACHA 1GAGA 3W32A 4P5ZA 3DBEA 3DBDA 3R1QA 2PPQA 4EORA 3TN8A 1PXKA 3BLHA 4YJSA 2J0IA 3LM5A 3VW8A 5I5ZA 2R3JA 1FQ1B 1YOJA 3MW1A 4FUYA 4KABA 4YJVA 3LCDA 4DT8A 3UE4A 3I0OA 2E2BA 5LVLA 1ZZ2A 4RJ6A 4YC8A 3EQGA 2JLDA 2GHMA 3BBTB 5DT0A 2JITA 1F3MC 3NYVA 4FKQA 4H3PA 4RIYB 3AC1A 3FI2A 2PU8A 2FUMA 3QD2B 4FV8A 3FBVA 2X7OA 4L45A 4EH5A 4MQ2A 3SLSA 3B8QA 3RHXA 4DITA 1YWVA 1IA9A 4E6CA 4B7TA 4IZ5A 3P4KA 3ZBFA 2G2FA 2R9SA 3KVWA 3W18A 4F4PA 5L2TA 3FSFA 4ZTMA 4CMTA 3UVPA 4IVDA 3LXNA 5ACKA 2IVUA 4H39A 3TL8A 3TV6A 4JG6A 5LMKC 3DKGA 3FJQE 3ACJA 1QPDA 4FKTA 4J97A 1L3RE 5DN3A 3W2OA 2XK7A 2WPAA 1S9JA 3O23A 3K3IA 5K3YA 5F1ZA 5E8ZA 2IZRA 4EQMA 5FEEA 3I5NA 5DA3A 5AM6A 4E4LA 2J50A 2XKEA 5DEYA 2UZDA 4IX4A 4YZCA 1E1VA 2ITQA 3DCVA 3BBWA 4MXOA 3VJNA 2CKPA 4MQ1A 2PZPA 3VUHA 4EZ3A 4QQTA 3QX4A 3COIA 4R8QA 4O7TA 1V0PA 5HBHA 2ZOQA 3Q9ZA 5AR3A 2GS6A 2C5VA 3UO6A 4EOOA 4E26A 4O7NA 5IH6A 4FMQA 4DCAA 1R78A 4ZJIA 2JDVA 1BUHA 3LCTA 4QO9A 4ZTSA 5KUPA 2OSCA 4IWOA 5J9LA 5CVGA 5FG8A 4I4FA 3F2RA 3R1NA 5AR8A 4FT5A 4FIIA 4MEDA 5HORA 5J5SA 2W1DA 3SGCA 4M12A 1OL2A 2XNGA 1W8CA 4LRMA 1H27A 4AT5A 4E4NA 5JMSA 3PFQA 2VTSA 4J52A 1J3HA 5CI7A 3ZXTA 3BQCA 5DR9A 3PVGA 1LEZA 4ZLZA 3Q6WA 3RAKA 3R9HA 2UW5A 2NRUA 4M67A 2CNQA 1U5RA 2A19B 2VU3A 4AQCA 3FXZA 4QMZA 3NMUF 2BRHA 4F65A 3SVVA 4PMTA 4A7CA 3DJ6A 3KC3A 3PA5A 4GV1A 4FTIA 4OW8A 1A9UA 3QC9A 4DEIA 4I22A 3KXXA 3ZOSA 3EYGA 3QHRA 4LOPA 5C27A 3TCPA 5M06A 3ZS5A 3TJDA 3UTOA 4C4IA 3R00A 2GQRA 2PMLX 2QOHA 2UW6A 4HCUA 4PUZA 3FZSA 2YFXA 5HCZA 2GU8A 4CFFA 3CGFA 3C9WA 1URWA 2WHBA 2W4JA 4BDHA 2B9FA 5E8WA 2W0JA 3DZQA 1W7HA 5I4NA 2ZMCA 4AOIA 4EK8A 4TW9A 3QYWA 4S2ZA 1Q3WA 4C4GA 3PWDA 5EHLA 5HD4A 4R6VA 3IW5A 2YACA 2PVKA 4I6FA 1IASA 2WQEA 4O27B 3RAIA 4IWDA 5HHWA 4BDFA 2Z7RA 4WG4A 1U5QA 4A4XA 1H01A 1PKGA 4YO6A 3V01A 4ZS4A 1OGUA 1NVSA 3OXZA 3LLAA 3CTHA 1NY3A 1LR4A 1OUKA 4UXQA 2JIIA 4QPMA 1XH9A 5AR4A 5CEPA 4U9AA 1RW8A 2QKWB 2R3RA 3RM6A 1STCE 5AX3A 1YXSA 4FGBA 2UW0A 2G1TA 1Y8YA 3VS4A 4IC7A 4NZWB 4DEBA 5AR7A 4C33A 3CLYA 2R0IA 4ZLYA 3MY1A 2UW4A 3DB8A 4Y8DA 2H6DA 4LRKA 2PYWA 3L9MA 4RFYA 4DEHA 3NAXA 4QTAA 5TOZA 1DS5A 4FSNA 4GU9A 4RX7A 3ZRLA 2BRGA 3FYKX 3IO7A 4RVLA 4WSQA 3KEXA 3KMWA 4PDYA 4W4XA 1E9HA 2RG6A 2Z8CA 4KIQA 4FSMA 2C5YA 3LXKA 2HW7A 3FEGA 2UZNA 4AOTA 1ZOEA 3ULZA 5E1EA 4RIWB 4X2FA 4O0VA 2ITXA 5BNJA 4MF1A 5CEQA 4FVQA 2HWOA 4WOVA 3DKOA 4DH3A 4GUBA 4XOZA 3OVVA 4O7YA 4QMOA 4X0MA 3L9LA 1JKLA 2XIXA 3BU5A 4IX6A 3GFEA 5GJGA 2IVTA 5LXMA 3I6WA 1FOTA 4PL3A 4I23A 4TL0A 3PJ3A 3DAJA 3W16A 5A46A 4FSRA 3VF9A 4R7BA 1F5QA 3U54A 3MPAA 3UIXA 5IA3A 2R3HA 3P78A 2EXCX 4JBVA 4TNBA 5LCJA 3F5PA 4FG8A 3ZEWA 4PDOA 3ZC6A 2R2PA 4O1OA 3QL8A 4XP0A 1VR2A 4XOYA 3MH3A 2VO7A 4OUCA 4MD7E 5I9YA 2XM8A 2WTWA 4W9XA 5HG9A 4RSSA 2W1EA 2QU5A 4F09A 5B2MA 4PTGA 5CVFA 5DT3A 3LAUA 4K2RA 4DG3E 4AZWA 3T3UA 3LFDA 2XK9A 3QD0A 4L68A 2FSOX 2UZLA 2Y8OA 3NUNA 4WG3A 3P7CA 3BELA 1YW2A 3AQVA 2WMBA 4L43A 2A1AB 4E1ZA 3THBA 2YJRA 3NUAA 4KBKA 1V1KA 3KL8A 2UUEA 4HVIA 2B4SB 2OO8X 4RIOA 5KNJA 2QLUA 3V6SA 4MNEB 2BTRA 1J7IA 3CD8A 4L3PA 3FC1X 4ERWA 3LPBA 3LFNA 2VO0A 4NIFA 1JWHA 4PMMA 4QMUA 3MSSA 4A06A 3PJCA 1OIUA 3VQUA 2QR8A 1BL7A 5H8EA 1JAMA 1ZMVA 3W8QA 4CFWA 4EH2A 3SG8A 5ANOA 3UP7A 4EOLA 4DFUA 4BTKA 4C59A 3AGLA 3LCSA 4WA9A 5E4HA 2W99B 3OROA 4I94A 3R73A 1SZMA 2WOTA 4HPTE 1M2PA 4NK9A 1P5EA 3NS9A 3Q4UA 5JZNA 2R7BA 4N0SA 3RK9A 4BI0A 4ZY4A 3SC1A 3C51A 3WF6A 3IGOA 1OM1A 3FDNA 5DE2A 2C6IA 4DBNA 3ZLWA 5M44A 4G5PA 4XEYA 3R7UA 3HKOA 2BFXA 4RWKA 3POOA 2E9PA 2W1CA 5HCYA 4BDDA 4D1SA 4QMPA 2WTKC 4F6UA 4FKOA 4J71A 4BYJA 3ZM4A 4AU8A 3N4TA 3H9OA 1XH6A 4DCEA 5GIPE 4F1OA 5IG1A 4C4EA 3QUPA 5IUIA 4E6DA 4CRSA 5J9ZA 3F5UA 3NLBA 2XCHA 2WMWA 1AQ1A 4QMYA 3PXRA 3T9IA 3W2CA 3R83A 5JK3A 3F6XA 3Q53A 2YDJA 1R39A 4O84A 4DLIA 3NUYA 5CU0A 4RIXA 2P2IA 3LFSA 1XQZA 4FSWA 4AW0A 3LE6A 2WMXA 4DH8A 4C34A 1SVHA 4EOMA 2C0TA 1PF8A 4A9UA 4MK0A 2OLCA 1XBCA 4U41A 3MB7A 4AOJA 5I0BA 1IAHA 3JPVA 3COMA 5IPJA 3IDCA 2CLXA 4H3QA 5CU6A 5DPVA 3R22A 2VWUA 2HK5A 5CQWA 4EJNA 3A2CA 2VTPA 3S00A 1YHWA 2WMTA 4FTMA 4FT7A 4UBAA 2FO0A 3E62A 1SVGA 3FQSA 4YJNA 5CU3A 4FR4A 4H36A 5G1XA 5IH5A 3VBVA 1YI3A 3BPRA 2YAKA 2XIRA 4GRBA 5ICPA 3DNDA 5E1SA 5M51A 3RBWA 3W33A 3VC4A 3F9NA 3FE3A 1UA2A 3AG9A 4GSBA 5CI6A 4CTCA 1CM8A 3EQIA 3KULB 4EK5A 4UMUA 1J1BA 3FLSA 5IA2A 2ITTA 4YHJA 3W8LA 3JR1A 1ZY5A 3MTFA 3O2MA 5A6NA 4C02A 4ZJJA 2QOCA 2XNBA 3V5QA 1P14A 3EQCA 4ZZNA 2C69A 3Q3BA 5CEKA 4O7SA 4EBWA 5HO6A 4ALUA 4AT4A 4U5JA 4F7LA 1Q61A 4FTJA 3TKIA 1U59A 1WBVA 4JR3A 5KMOA 2VWYA 3PE2A 4GJ3A 4TNDA 4XG9A 2B0QA 2OI4X 3DBCA 4FV3A 4NU1A 4C35A 3PPKA 2ZM1A 4H58A 4NSTA 3SQQA 4IC8A 3U51A 3N51A 1SVEA 4FT9A 4ZMFA 4YO4A 5KKRC 3KMUA 3H30A 1L8TA 3R7OA 5GIOE 4XP2A 2R3IA 3QZFA 3NIEA 5DFPA 5EFQA 3CD3A 2PVFA 4YP8A 4BCHA 5EQEA 3LJ2A 3RK5A 4AN9A 4FEQA 1OBDA 2PMNX 4DINA 4QMMA 4EBVA 4KNBA 4KIKB 4ZOGA 4F1TA 2QOQA 4AAAA 2JAVA 4EWHA 3G5DA 4B6LA 3ZSHA 5M08A 2PUIA 2X8DA 3QKKA 3NUXA 4KRCA 3WE4A 4YJOA 1DI8A 2QLQA 2VO6A 4NKAA 3GUBA 4RJ8A 3IONA 3R9DA 5CAPA 4CZTA 3W2PA 3HL7A 4YC6A 4FV4A 4M84A 3HP5A 4YU2A 2SRCA 1FVVA 3FQHA 5I3RA 3BRBA 3PWYA 3FQEA 4XG8A 1YVJA 3Q52A 3ZEPA 4IB3A 5K4IA 3U9NA 3TIZA 1B39A 3WYYA 1ZMWA 1GIHA 5IISA 2PZYA 4NM0A 4BVUA 1TQMA 1Y6AA 3PG3A 1Q8ZA 3H0YA 3V5TA 3D9VA 2UZWE 3HV3A 4FKWA 2W17A 1XKKA 2JEDA 4ANQA 2GTMA 2XMYA 3N9XA 4MX9A 3AC3A 5K5XA 1WBPA 4U3ZA 3DAKA 3BYMA 3ZO2A 4HVDA 3ORIA 5IQEA 2YM3A 5IQIA 4IXPA 4H1JA 5KMNA 2C6TA 4WO5A 1DM2A 2OF2A 3AT2A 3FHRA 3I6UA 4J8MA 4I4EA 1BL6A 4PNIA 2R64A 4S34A 4BZDA 5HU9A 1UKHA 4GVJA 2WQBA 1OI9A 3GCSA 5EOBA 3A7GA 5IEXA 4E5WA 3KF7A 3B2WA 4FTAA 4C38A 3DTWA 3H9FA 3O0GA 3UQFA 3U6IA 4BIDA 1XBBA 4FTQA 4RBLA 5AP4A 1CDKA 4E4XA 4YTCA 3G15A 1OECA 4QOXA 3JYAA 3F82A 5K0XA 3AT3A 5J7BA 2WQOA 2CGXA 4GYIA 2OZAA 4FZFB 4J7BA 4L00A 4RJ4A 4BKYA 2O65A 2W96B 4MH7A 4JBPA 3F3VA 3UP2A 4M69B 2IZTA 4ZSGA 4CCBA 3LCKA 3UZTA 4NM5A 4D2WA 1REKA 3TNIA 3COKA 2C6DA 4DGGA 4QPAA 4YZDA 2O2UA 1PMEA 3G9NA 3KN6A 2J7TA 2ONLA 5DVRA 2IPXA 1ZOGA 5FTGA 3EOCA 2VWIA 4HNIA 2VGPA 4DT9A 2BPMA 3ZTXA 2XNEA 4FSTA 5CEOA 2WOUA 4Y5QA 2WMSA 4IX3A 3MWUA 2B55A 1LEWA 4WRGA 4CFXA 2J6MA 2W9FB 4WNOA 3QRTA 1Q4LA 3ID6C 2P0CA 2W5BA 4IAIA 4ZTHA 3GT8A 3C0HA 4WBOA 4OBPA 3GU8A 3TUBA 5JGBA 5LOHA 2CKEA 5C9CA 3HV6A 5FP5A 3V5PA 4AE9A 4KBAA 5D41A 3POZA 1TQIA 1WBOA 5M56A 4WRSA 2UW9A 3FY0A 4LYNA 3KVXA 3VS0A 4EHVA 3BYUA 3D0EA 3DTCA 3B2TA 3Q5IA 4GT5A 4UXLA 3OP5A 4RX8A 2QHNA 3R7YA 4TWNA 4AZSA 2XKCA 4PTEA 3LKMA 3FKLA 4ONAA 1QCFA 2VRXA 5CF4A 3SD0A 3QD4A 2X39A 5HO7A 5A4QA 2X6EA 2XNMA 2YITA 2EWAA 3PJ1A 4G3GA 4DTKA 4IX5A 3PY3A 4UWYA 5CAUA 2WQNA 2AYPA 1Q8TA 2C5XA 3GEQA 1P4FA 4YJPA 4WT6A 4WNKA 3PA4A 2Q83A 3KQ7A 4P7EA 5AA8A 3CXWA 3MV5A 3CTJA 4RWLA 4F7JA 3HUCA 4MWIA 4O1PA 2YCQA 4FIHA 4OGRA 4GFGA 5LMAA 4RFMA 4R77A 2VX3A 2YISA 5IA5A 3ZSGA 4M97A 2PVYA 1BYGA 5E8XA 3DBQA 4AZVA 3RAWA 3ORNA 5DT4A 5FD2A 1HCLA 5F20A 4I92A 4WKQA 3Q4CA 3HYHA 1KSWA 4JQ7A 4XP3A 4DH7A 2GNIA 1ZAOA 4GU6A 2C1BA 3FZ1A 4WUAA 2W1FA 1Q62A 3K5VA 3TKHA 5D1JA 3E8NA 3UNJA 5GZ9A 4E6AA 4S31A 3P7BA 4R5YA 4HVGA 2RIOA 3ETAA 3QZGA 4FSUA 1XWSA 2W9ZB 1U46A 2QVSE 3VQHA 3UQGA 2G9XA 4M8TA 1PYXA 5AEPA 3CEKA 4LL0A 5AAEA 4U81A 5HG5A 4FODA 2BKZA 2OJFE 5BVEA 2PTKA 3CE3A 3KFAA 5BMSA 3VS1A 5HZNA 3QKLA 5EKNA 2B53A 3QA8A 4IEBA 4YTFA 5BVNA 3PLAE 1P2AA 4GJ2A 1KOBA 4OTWA 3E8CA 5FWKK 5LARA 1PHKA 3U8WA 2C4GA 4D2PA 4OTRA 5AV1A 4EHEA 2GMXA 3LFCA 2RFSA 3CJFA 3QQHA 4AWIA 4FTUA 2P2HA 2RGPA 2V7OA 4FV0A 3EN4A 1PXOA 3ODYX 1UKIA 4YLKA 5GZ8A 2GQSA 4U40A 3D5XA 3RPVA 4AGDA 5HGIA 2XK6A 1XR1A 2X9FA 2BAQA 3DKFA 4MHAA 3E5AA 4O96A 2VTMA 5CQUA 4DAWA 4CGAA 3N4VA 3WARA 1NT2A 2PVNA 4BDIA 2C3IB 4AA4A 4A4LA 3O7LD 3LMGA 2UW3A 3TZ8A 3T3VA 4IH8A 4K6ZA 2JGZA 2Y0AA 4IB1A 1PXLA 3MH2A 4PPCA 3AC2A 4BGHA 3GI3A 4L3LA 5C26A 1SNXA 3QTUA 4DLJA 5H3QA 3WYXA 3ENHA 5CZHA 4I21A 2GCDA 3HMIA 4NM3A 2WTIA 3ZRMA 2GFCA 4Z3VA 4KKHA 1QPEA 2JIUA 2QD9A 5GINE 2XYNA 4PV0A 2WZJA 5EOLA 4PTCA 4QP1A 2JBPA 4DG0E 2XVDA 4UEUA 4IB0A 3HAVA 3MVJA 2CPKE 5DLSA 4BDKA 1ZOHA 3FPMA 3GC7A 1WBNA 5AAFA 4MWHA 5AUZA 4KUJA 4A07A 3DAEA 3FY2A 4FX3A 5ANKA 4YR8A 3SXRA 4NTTA 2H96A 4XV9A 5AP7A 4XJ0A 2H8HA 2W1ZA 2PUPA 4WD5A 1GOLA 4YHFA 4Y73A 4WNMA 4OTQA 2HZIA 4EZ7A 4XCUA 3LMIA 4DEDA 3S95A 4GG5A 3ZMMA 3P1AA 1A48A 2O5KA 5HVYA 4GK2A 5IQDA 5B0XA 5TKDA 3QF9A 5H9BA 3GGFA 3MIYA 4IJ9A 2GPHA 3TG1A 5CEIA 4O0XA 2IVSA 1MQBA 5ANIA 4EEVA 4B99A 4C36A 3OS3A 5DR6A 5AP2A 4JJRA 2F7XE 2FSMX 2JKQA 5I9WA 4DH1A 5C8NA 1Y57A 2GNFA 2ERZE 4FTRA 3C4WA 2WTVA 1FGKA 2QOOA 3CSVA 1FMOE 3RNIA 2VTAA 3JUHA 3DXQA 3OD6X 3ZCLA 3I79A 3NUUA 3QCSA 4BCKA 3VNTA 1Q8UA 5EDRA 5HVJA 1W83A 1S9IA 4GIIA 2R3GA 2YAAA 3SXSA 2Q0NA 4OTGA 2QOIA 3ZZWA 3BU3A 4BGGA 4CLIA 1CKIA 2PK9A 2OJ9A 4YSJA 1JKSA 5JN2A 3E64A 5HE3A 3NW5A 1FMKA 2AUHA 1GY3A 4LMNA 1CMKE 4QTBA 3MH0A 3Q4TA 3UYSA 4FT3A 1PXIA 1OIRA 4ACMA 4J53A 5EI8A 4FTLA 4JXFA 2QOFA 3VUTA 4RJ7A 1SM2A 2PUUA 4O91A 2PUNA 2KULA 4ZTLA 4J8NA 3RGFA 4DFNA 4WG5A 1YKRA 2BRBA 4IQ6A 1PYEA 4AZFA 1JKTA 3U87A 4IZAA 1UU3A 5CU4A 3Q6UA 2XH5A 1R0EA 2QONA 3ORKA 3NYOA 2YA9A 5AIRA 4QP8A 4X3JA 2Y4IC 3O96A 4XG4A 2A0CX 3KRXA 4AF3A 3FMDA 4DG2E 3EKKA 4XH6A 4U97A 3LW0A 4NKSA 4OAUC 3UDBA 1URCA 3A62A 3OW3A 2JFMA 2O64A 3EH9A 4FTKA 2HCKA 4XS2A 3BIZA 3CGOA 2PMIA 3F5GA 4I5CA 5B2KA 3P9JA 5HTCA 5HX8A 4JBOA 2O3PA 4DC2A 4CKJA 1VJYA 2YIXA 3Q60A 3L8PA 4JI9A 4ANBA 4YC3A 3TJCA 4IACA 4P4CA 3RM7A 2JC6A 3SAYA 2VZ6A 4K18A 4TT7A 4TYJA 2DQ7X 2NRYA 2P55A 3G6HA 4LQMA 4ACGA 3HDNA 3BE2A 5CS6A 2YZLA 3OW4A 4PMSA 5IQHA 4XG3A 2CGWA 3DB6A 3LFEA 1VYWA 4NWMA 4E7WA 4FV1A 5FBNC 3LM0A 4CV9A 3RAHA 2YM7A 2J0KA 2PL0A 5AADA 4C2VA 3LVPA 4NJ3A 3MJ2A 3EYHA 5A3XA 2F49A 3GU6A 1G5SA 1IG1A 2Q0BA 3D5WA 4IHPA 3PYYA 3R01A 4FG9A 4G16A 4TZRA 5DOSA 3TZ7A 3UIMA 5HTBA 3F5XA 3OCBA 4OTIA 3PXYA 3M42A 4ALVA 3QWKA 4NYEA 4TYGA 4USEA 4M3QA 1GIIA 4BN1A 3ET7A 3KRWA 1JSVA 3QUEA 4Q9SA 1XJDA 2VTJA 3NX8A 2ZV2A 3I5ZA 4OTDA 5EG3A 4FVRA 4FL2A 1IA8A 4QMWA 4FYOA 2BIYA 1H0WA 1ZLTA 4FV5A 3R9RA 4LGGA 3FXWA 3I81A 4I0TA 4JL9A 1F0QA 4EC9A 1SYKA 4UB7A 3BHYA 4FK6A 3SXFA 1UNLA 2YM4A 4JIKA 2XK4A 1EH4A 3GU7A 4BDEA 4D2VA 1WCCA 3ZFXA 4P5QA 1YI4A 4G5JA 4HNFA 4I6BA 4KBCA 4JBQA 3CCNA 3GCVA 2PSQA 2ZVAA 2F7ZE 3EN5A 3MA3A 4O0SA 4U43A 4RLKA 3G0EA 3LFFA 4NUSA 1TQPA 3L8VA 4ORKA 2QNJA 1JVPP 3QQUA 5FUTA 4LG4A 4EC8A 4EJ7A 5FP6A 3I7BA 3A99A 4NIFB 4XV3A 1JSUA 2PHKA 5EW9A 2ITPA 3G2FA 4GFMA 1OBGA 3UODA 1XO2B 2OH4A 4AACA 3GCPA 2YDIA 4CVAA 2CDZA 3DA6A 4JLCA 4DGLC 4G3EA 2BFYA 2UVXA 3GBZA 4U0IA 3RALA 3VS2A 4WNPA 4FIFA 4UMTA 4O7WA 4C2WA 5HESA 4YLJA 3CQEA 3ORMA 5HNIX 2VTTA 2GTNA 4M0ZA 2WTKB 3F66A 5FM2A 1K9AA 4D5KA 3G90X 4W9WA 5T3QA 5I9ZA 3RWPA 3HLLA 4RLLA 3SV0A 3DJ5A 1OPKA 4FEXA 3LLTA 3AC8A 3REPA 4HGEA 5JRQA 1O6LA 3O51A 4RX9A 3KK9A 4Y85A 4IZ7A 3DXPA 3RI1A 5HU3A 2X8EA 5FEQA 5HBEA 2XB7A 3WBLA 5DH3A 5KE0A 5CASA 4AP7A 3WIGA 3Q9YA 5HE1A 3ATSA 1CKJA 2E9OA 2IO6A 2Z60A 4FKUA 5T6KA 5L2SA 3UVRA 1Z5MA 2I40A 2X1NA 2HENA 3F7WA 3BWFA 1H08A 4K11A 4YBJA 5BUJA 2OIQA 2W1HA 3R63A 3QTSA 4RIXB 4R3CA 2OJIA 2BAJA 1ZWSA 2ZV7A 4HCVA 4IAZA 4YZBA 5F4NA 5HIDA 5HNGA 2IN6A 2UW7A 3H3CA 4V04A 3IG7A 4LI5A 4KRDA 1OKVA 4Q5HA 3A60A 3H9RA 5HIBA 5FTQA 4EK3A 5BYYA 4HCTA 1J1CA 2ETKA 3Q9WA 3VBXA 3A8WA 3QFVA 2UVZA 5L2WA 4IE9A 3QWJA 1OUYA 3WI6A 1YWRA 2VTHA 4RRVA 5J79A 2XIYA 3D5UA 1CKPA 2JIVA 4PRJA 4G1WA 2BKKA 3PTGA 3UOHA 3VAPA 4QMVA 3C4CA 2ZM3A 3FI3A 1UU8A 3QTWA 3OWLA 4O2ZA 2FA2A 3DS6A 5M55A 4O83A 4IM2A 4IWPA 2C6EA 2QR7A 4TYEA 1YXUA 5DR2A 4ZIMA 3LQ3A 3HAMA 3BZ3A 3NUPA 4QQJA 4CSVA 1DAWA 3UG2A 1XBAA 2I0YA 1UVRA 4F9BA 4OBQA 5LJJA 1CTPE 3V8TA 4C4JA 5EM6A 2G15A 3PPZA 4BDJA 4M7IA 4TY1A 2C30A 4BY9E 4KKGA 4AE6A 1J7LA 4X6RA 2XIKA 3FZTA 3RJCA 2C0OA 4CMOA 2I6LA 5TE0A 3QTIA 4FNWA 2F9GA 5KKRB 1MRVA 2QO2A 3FL5A 4QYYA 2YWPA 4NFNA 3BYVA 4J95A 4UMPA 4D1XA 3F69A 5JRSA 4BHNA 5IUGA 5K9IA 3D14A 4W4WA 5KZ0A 4FZDB 5KBRA 3TI1A 2JDOA 3UC3A 3DU8A 4Y46A 1MP8A 5IZFA 2ITNA 5IDPA 3RWQA 5KHXA 1Q99A 3OEFX 3TUDA 3R2BA 5CZIA 2LGCA 4O38A 3II5A 5AV3A 3PXQA 4L3JA 1NXKA 3ZU7A 2G01A 4A4OA 3UPXA 4YJQA 4USDA 1KUTA 3K3JA 2X2KA 1KV2A 3NWWA 3DK7A 3KCKA 4PF4A 4APCA 3ODZX 2BALA 4CV8A 3CY2A 4JS8A 2CN5A 4M68A 2ZM4A 3AMBA 4LV8A 4O22A 5L2QA 4QNYA 3OY1A 2J5FA 5JZJA 1APME 4YPSA 3RPSA 1PKDA 2W5HA 4E4MA 3FMNA 1H1RA 4MYGA 4PL4A 1JLUE 2YHVA 3G9LX 2X4FA 3BQRA 3CY3A 4QTDA 3T8OA 4HPUE 3TM0A 4GKIA 2QODA 4AG8A 2OFUA 1HCKA 4DA5A 1YDRE 3FYJX 4BIEA 2JBOA 5L8KA 5L6OA 3P5KA 1WAKA 5D7AA 4CZYB 4LV5A 4F64A 1M2RA 3LQ8A 4HZSA 2J0LA 3LJ0A 4W8DA 1H1PA 2V7AA 1ZYDA 4FGRA 4ZMEA 4D58A 2LAVA 4DFZE 2JKMA 2CMWA 1SNUA 3OUKA 4ERKA 3PRFA 3ZXZA 4EH4A 1PXMA 1JQHA 5AUTA 3DOGA 5CNOA 5C4KA 3BHUA 2I0EA 3L8SA 2XJ1A 3PIXA 3LOKA 5CSHA 4BR3A 2GSFA 2EVAA 5JH6A 4DFBA 3V5WA 4OR5A 2BRNA 5HCXA 4FUXA 1H07A 4R78A 3WZDA 4XRJA 4EZ5A 3F88A 4OAVB 2YJSA 3JVRA 5TT7A 5BYLA 2YIQA 3W2QA 3A4PA 2OZAB 4JQ8A 5LQFA 3CKXA 4BTJA 1Q8YA 4BF2A 2BIKB 1W98A 4TXCA 2XBAA 3PP0A 4U3YA 4JOAA 4XV1A 3QXPA 4FEWA 2YCSA 4FZ7A 1KE7A 3A8XA 4P2KA 3MPMA 3MH1A 1B38A 4KS8A 3IK3A 4FV2A 3V6RA 3R71A 4C58A 5JEBA 2YWVA 3AMAA 3I7CA 4BRXA 3UZRA 4GT3A 3AXWA 4G34A 2X7GA 1PMUA 4BIBA 3SOCA 4IMYA 2VWBA 1Q41A 4UMRA 4O0WA 1OL7A 3AD5A 3OBGA 3ORPA 4QP7A 4J1RA 4R3RA 1PXPA 2X4ZA 3R9NA 2X6DA 4GIHA 3QZHA 1WBTA 4ZSEA 1H8FA 5A4TA 2OF4A 4PNKA 1ZYLA 5JFXA 4PP9A 5EKOA 1Z57A 2R3OA 1ZARA 3HX4A 4FT0A 4RWIA 2ETMA 4O6LA 3RK7A 3R8LA 4X3FA 4FSYA 2CGUA 2VTRA 4R7IA 4G6LA 3UIBA 5M4UA 3IS5A 4I0RA 5CF6A 5HICA 3T9TA 4FKSA 3V04A 3FLQA 3GCQA 3NW7A 4O0TA 3R7VA 4W4VA 3VN9A 2X8IA 5BUEA 3QQJA 4ITJA 5AUYA 3ZUUA 4AFEA 3BI6A 3F7ZA 3QQGA 4KAOA 5AIKA 3FKNA 1FVTA 1KE9A 4QNAA 4UV0A 4D9TA 5J87A 3MVHA 4AS0A 4JG8A 3KXZA 3H4JA 4B9DA 4O0UA 5EQYA 5AA9A 2R3NA 3A7IA 5JQ8A 5B7VA 2ZYBA 4LOOA 4UYAA 5IH4A 3UMXA 2ZDTA 1YQJA 3DK3A 3VRYA 2XK3A 5ITAA 3ZDUA 1PXJA 1Y8GA 3HVCA 3L9PA 4IAAA 3MBLA 1GJOA 3HV4A 4XMOA 3GC9A 2QQ7A 3NEWA 3R7IA 4PQNA 2BDJA 4CFUA 2WU6A 2R3FA 5GZAA 3O17A 3CJGA 4I24A 4C37A 3GNIB 4O21A 3WZUA 3TTJA 4MBLA 3WF5A 4C3FA 5EYCA 4F6SA 4X21A 3S3IA 5KCVA 4NCTA 2IW8A 3FMEA 1OKWA 4JT3A 4JAJA 3QLGA 3B8RA 3ROYA 3G33A 3ZO4A 2GNGA 3KXHA 3QTZA 1SMHA 4FKRA 4TKSA 4BC6A 5HLWA 3QALE 1OZ1A 5E91A 2BDWA 5DMZA 5AX9A 4CG8A 2JDTA 4U8ZA 2UW8A 4TYHB 5CXZA 5B2LA 2FSLX 4S32A 3PZHA 3L8XA 2VO3A 5AM7A 1V0OA 2G2IA 3W2RA 4FKGA 5D12A 3VUIA 1Z9XA 4TPTA 3E87A 1JSTA 5D11A 3D4QA 4CQGA 1YRPA 4EOSA 3RVGA 1OPLA 5A4EA 3OFMA 2W05A 4XUFA 3E88A 4MCVA 4J99A 2ONLC 3IDBA 4G17A 3OMVA 5DG5A 4IIRA 5JSMA 3KY2A 2VWXA 4WHZA 3BCEA 3COHA 2W5AA 5IQFA 2C5OA 2XRUA 3PJ8A 5CLPA 3H0ZA 4G6NA 4QP3A 3HUBA 5A54A 4U42A 2WTJA 4RC3A 3GFWA 4AZEA 3KB7A 3UIUA 1OL1A 2VWVA 3AC4A 2XA4A 1KE6A 2BVAA 3EQFA 4LGHA 2NO3A 4W4YA 4DE4A 2XRWA 2QHMA 3MVMA 4BYIA 2R5TA 3FAAA 3KA0A 4RG0A 3DV3A 4F63A 1UV5A 4L8MA 4L53A 3TUCA 3PLSA 3ACKA 4K1BA 3ENMA 2PVMA 4KSQA 5BVWA 4EH6A 3QXOA 1YXXA 4HGLA 5AUVA 3R7EA 3CC6A 2O8YA 3TNPC 2OH0E 2YZAA 3HMOA 4GEOA 3R04A 3NPCA 2PULA 3RPOA 5JGAA 3LFQA 3CKWA 4CLJA 3FMMA 3SHEA 5L3AA 5M57A 2XP2A 2UZOA 2QG7A 4GMYA 4K33A 3WZJA 2C3LA 3C0IA 2EUFB 3E7VA 3ZSIA 2CLQA 3NDMA 5DRDA 2J4ZA 5IKWA 4FF8A 3FI4A 5E8YA 3BLQA 3UG1A 4EHGA 5HTIA 3LZBA 3NVKI 3EB0A 1WBSA 4DFYA 4I5MA 1VEBA 5IU2A 4A9TA 2XEYA 4JX3A 4AT3A 4FK3A 5HG8A 1PMVA 5D7VA 4IAYA 5CSXA 4CRLA 1QL6A 4C4FA 3VRZA 4GW8A 2OJJA 5BUIA 4YSMA 4QYHA 2XCKA 3OXIA 1I44A 4JDIA 4MXYA 3RZFA 2DYLA 4AGUA 2YDKA 2UZEA 2I0HA 2BTSA 4F0IA 3A4OX 2DS1A 2OICA 4I0SA 4RC2A 4DN5A 5M09A 4MXCA 3NNVA 4JG7A 3ALOA 3VUKA 4DEAA 4EKLA 5J9YA 1A06A 4TYHA 5E8SA 1Y6BA 3BKBA 4YJUA 4FZ6A 5HEZA 4Z55A 5CVHA 4BBFA 4TTHB 2WXVA 2HZ4A 4FA2A 3TV4A 3VO3A 1YOMA 2BZIB 4HGTA 1NVRA 3DJ7A 2QOBA 2C3KA 3NIZA 5LVNA 5DNRA 5TR6A 1XH4A 3ZO1A 4B8LA 2WMQA 2VTLA 3BHVA 1H24A 3IOPA 5JGDA 3ZUTA 3O71A 1WVYA 2B9HA 5KZIA 5JFVA 2Y9QA 2F4JA 4FL1A 5CWZA 4D4RA 2GS7A 5M4IA 1B6CB 3BE9A 4GK3A 4R5SA 5CAOA 4V0GA 5ANDA 2YEXA 3P7AA 2R3MA 3DGKA 4ZZOA 4OBOA 3OTVA 5JQ5A 2VN9A 2YCFA 3KGAA 2BCJA 3W2SA 3JVSA 4B0GA 1QPJA 5AR5A 3TEIA 1GZOA 3NSZA 4C0TA 3C1XA 5EK7A 2IG7A 3VWAA 2BAKA 2O0UA 1G3NA 4ITHA 4O81A 2XNOA 4K77A 3TT0A 4O7VA 3VBYA 4G2FA 4KINA 4FTTA 3MJ1A 3WF9A 2XYUA 2FSTX 3NUSA 5KMMA 2Y4IB 2B52A 3VF8A 4XHKB 5HG7A 2YIYA 2QURA 3HECA 3OT8A 2ITUA 2W1IA 3DZOA 5CSPA 1VZOA 1KE8A 3CP9A 4HVHA 5CT0A 3UZPA 5KMLA 2Y7JA 5EI6A 5LVMA 2JD5A 3IW6A 4UN0C 3C0GA 4NM7A 4ZXTA 3VHEA 2GHLA 4Y72A 3PY1A 3PRIA 2OGVA 3R1YA 3ERKA 2R0UA 4O0YA 4IM0A 3DDPA 4Y83A 3PVWA 4R3PA 3OBJA 5FM3A 2O63A 2XNNA 3TNQB 2OKRA 2Z02A 2J51A 2HELA 3BWJA 4D28A 3KN5A 4GG7A 5ANJA 4BCPA 4ZY6A 4HW7A 2EU9A 4BB4A 3FHIA 3U9CA 1O6KA 4ANNA 4FKJA 4FSZA 3IOKA 3HMPA 1M14A 5EM7A 3MFSA 4DEGA 1IRKA 4BL1A 2WEVA 2WMVA 2CNUA 5CT7A 3OEZA 3GU4A 4BWKA 4N4SA 5E92A 4FE2A 4L52A 4C4HA 3P79A 3DKCA 2BRMA 5C8KA 3MFTA 3HMMA 4O0RA 4TRLA 1Q97A 1JOWB 4E3CA 3OCSA 4TYIA 3HDMA 5L6WL 2HY0A 2UZVA 3R02A 1Q8WA 4XLVA 4DYMA 2J2IB 1ZZLA 3HA8A 4XV2A 4MD9E 3Q2JA 4F9YA 3R8UA 2CSNA 2PZIA 3PJ2A 4GUEA 2PMOX 4A9YA 3D2KA 3BEGA 4IAFA 3TWJA 4MF0A 1X8BA 3C13A 4IFGA 3E8EA 5IMXA 4GT4A 4QYFA 4D0WA 3E93A 1G8AA 3TTIA 2OXYA 2I1MA 2F7EE 2VWZA 4JVGA 4PDSA 2WGJA 4JR7A 5EHOA 2XEZA 4PY1A 4QP2A 4U44A 5AWMA 4ASDA 2WEIA 4F1MA 4EK4A 3CS9A 2OJGA 4JRVA 3C7QA 1MUOA 4FIGA 4IW0A 5A6OA 5BVOA 1QMZA 2VTNA 3DDQA 4IDVA 4U79A 3R8ZA 4DH5A 5HQ0A 4ALWA 3G0FA 3G51A 2C6MA 3DPKA 2WTCA 3EIDA 2B7AA 2VNWA 5C1QB 5D9HA 3NNUA 4C8BA 5HKMA 2HZNA 2ZDUA 2R3QA 5GJDA 3UGCA 3QKMA 4CMUA 4L44A 3Q5ZA 4O86A 2H9VA 4AN3A 4QYGA 3E92A 4PWNA 3ZONA 3NR9A 4YZ9A 5GNKA 2XKDA 1R0PA 3EQPA 4ASZA 2CN8A 3WF8A 4CT1A 1H4LA 4L67A 5DYJA 3MFUA 3U6HA 1H28A 2CGVA 4LGDA 4BCMA 3PSBA 2PE0A 3RP9A 3E3BX 3EZVA 4K0YA 4KKEA 1M17A 2QO7A 3PA3A 2QC6A 3IKAA 3VHKA 4FNYA 4M0YA 3BLRA 3ZFMA 3HGKA 3PXKA 4F9AA 3Q4ZA 1PW2A 2ZV8A 5JT2A 4QTEA 3SG9A 1ERKA 4U80A 3GQIA 1TVOA 1REJA 2NPQA 2IW6A 2YABA 5HX6A 5JKGA 3PP1A 2WO6A 4CCUA 2BUJA 3GENA 5ANEA 2ITWA 3Q04A 4EOKA 4EWQA 4KS7A 4IVCA 5LMKA 2I0VA 2OU7A 3QTXA 3WILA 1WBWA 4JDJA 1G8SA 3A7FA 3A7HA 4ZSAA 2RL5A 4OT6A 3ZH8A 1MRUA 3QUDA 4V01A 2YM5A 3DQXA 3R2YA 4LOQA 3W10A 4BGQA 3UOJA 4I6HA 4CFVA 2VUWA 2AC3A 2Y4PA 3K54A 4BI2A 3PIYA 2WMAA 4F7NA 2C68A 2HIWA 1KE5A 2GNHA 3QQLA 3IW4A 4DEEA 3SOAA 2C6OA 5EYKA 3D7ZA 5IMEA 3R9OA 2OG8A 3OCTA 4NJDA 3PXFA 3SKCA 3PIZA 4UY9A 5ETCA 3ALNA 4L01A 4EUTA 2GNJA 3VW6A 5C03A 2GNLA 5DEWA 3ROCA 3GU5A 3WIKA 3QRKA 1TKIA 3D83A 1YXVA 2OWBA 5FRIA 4R1YA 4BICA 1NA7A 4RC4A 4RQKA 4IM3A 2V5QA 3AD6A 3HRCA 4HYSA 2A27A 2YCRA 3DFAA 3C4FA 3EN9A 4QT1A 3NNWA 2R3LA 4XG2A 2WB8A 1M2QA 2BROA 4GS6A 4QTCA 3AOXA 4G31A 4TWPA 4YLLA 4F9WA 2UZTA 4O82A 4AZTA 1PXNA 2XUUA 3TIYA 4ID7A 2JKKA 3SA0A 4EKKA 1U54A 2IVVA 3I4BA 3RKBA 2Z7QA 4QD6A 3ANQA 5CYIA 1R1WA 4NT4A 5EDPA 3F3TA 2G2HA 3LJ1A 1U4DA 3ZLSA 4LRJA 5I9UA 5AUWA 3ZDIA 4EQUA 3RCDA 4E5AX 3BYSA 4FC0A 2HXQA 5A4CA 4YMJA 4FEUA 3LMHA 3QU0A 1IEPA 2X2LA 2JKOA 4ACDA 3AGMA 3NCGA 5I9VA 4AW2A 4B4LA 1OVEA 5CU2A 3E8DA 3AC5A 3AMYA 3F3UA 4JIAA 3KRJA 3PSCA 2PVLA 4E6QA 2B9JA 4G6OA 3GC0A 3P86A 2V22A 3SDJA 1O6YA 2XNPA 3ZZEA 5C8MA 3S1HA 5GHVA 3JY0A 4QQCA 4NL0A 1WFCA 4NTSA 4X2JA 5ETAA 3MDYA 4EH9A 4UZHA 3EKNA 4PMPA 3QHWA 3CQUA 4KSPA 3AD4A 4BCOA 4FIJA 4RIYA 3HRFA 3I1AA 5DI1A 5AP5A 4ANOA 1OL6A 3DT1A 3MS9A 3UOLA 5L4QA 4D2SA 4FEVA 4RZWA 3RINA 5FLFA 4IB5A 4CNHA 1GIJA 3BU6A 3F61A 2YIWA 2YM6A 4FV9A 4N6YA 4P90A 5CY3A 2OBJA 1YI6A 5IA0A 4FNZA 1UNGA 3DQWA 3NNXA 1BKXA 4QP6A 5AJQA 5BQ0A 2C3JA 5AFVA 4BKZA 5AMNA 5DHJA 2XJ0A 3EFKA 4IZYA 4MXAA 4ZS0A 4D55A 2W4KA 3L9NA 4CG9A 3V3VA 1WVWA 4C7TA 4EI4A 4MVFA 3ZO3A 2BILB 4EOQA 3VJOA 5E8VA 4BKJA 5T68A 3RPYA 4EUUA 1GZ8A 5K5NA 1Q5KA 5F95A 3VBTA 1R3CA 3LFBA 5FTOA 3UBDA 4H1MA 1GZNA 1AD5A 1BX6A 1ND4A 4I5PA 4MNFA 4G9RA 1J91A 3QQKA 3ZRKA 2WIPA 2CHLA 3LQ5A 1H0VA 4TWOA 4YTIA 5C01A 3EL7A 4BCGA 4BTMA 4BI1A 3FWQA 4RVMA 5FXSA 4RX5A 5LMBA 3RZBA 1V0BA 1JBPE 4YNEA 2J90A 3E7OA 5BVDA 4J98A 5HNBA 2C6KA 3MI9A 3D5VA 3FZPA 4FVPA 4XG7A 3EWHA 5HD7A 5AP6A 3NGAA 5CF8A 4AX8A 4U45A 1BMKA 2ITZA 4M13A 4QRCA 4JDKA 1FVRA 5J7HA 3FKOA 3HV5A 1QPCA 3MPTA 4E20A 2OXXA 5CAQA 2P33A 4DHFA 5FXQA 4GYGA 2EXEA 1YHVA 4Z7HA 3FMJA 2VAGA 4YBKA 4CT2A 3EFWA 5K4JA 4EOIA 5KMIA 3F2NA 3QAME 4G3DA 3QCXA 2R4BA 3O8TA 5HE0A 2C5NA 2VWWA 4I3ZA 4IANA 3PZEA 4ACCA 3OWPA 3QGWA 4OTFA 4C57A 2B54A 3DBFA 4IFCA 4IBMA 5TO8A 4CXAA 3PY0A 3VS7A 1FBNA 4JDHA 4WSYA 3FZOA 1OL5A 5K0KA 1K3AA 2PVJA 5BYZA 3W1FA 4CD0A 2GS2A 5FXRA 5I9XA 5LVPA 4LMUA 3WZKA 2DUVA 4U6RA 2WKMA 5A9UA 4MXXA 5M4FA 2J9MA 5CANA 3C5IA 3E3PA 1IR3A 3KMMA 1HOWA 4FG7A 2GHGA 3S4QA 3ZBXA 5L2IA 2W06A 4BDGA 4EK6A 3H10A 2GFSA 4FOCA 3Q32A 5EHYA 5DRBA 4CFMA 4XRLA 5FGKA 1KWPA 4RJ3A 3UMWA 4D9UA 3LXPA 1DAYA 3P08A 2B1PA 4OLIA 4Z9LA 4DGOA 4YURA 5HBJA 5EW8A 3DLSA 5BPYA 4RQVA 4PP7A 1ZMUA 4QYEA 3TKUA 4Y5HA 4BCIA 4IADA 4X7QA 4HOKA 5AP3A 5IEYA 4ZEGA 3U4UA 1LPUA 4ZJVA 4RGJA 3EFLA 4AN2A 2VV9A 2W4OA 2UV2A 3FI8A 3CPCA 5FDPA 3NZ0A 3OOMA 4QMQA 2X0GA 2VTIA 4ZAUA 4BCNA 4DTAA 5EM5A 4YZNA 3U4WA 3HEGA 3QCYA 2VNYA 3C5UA 3F3WA 4IJPA 4UMQA 2H34A 4LFIA 4D4YA 4DGNA 4CKRA 2BZHB 5ANGA 3SX9A 4X3FB 1Q3DA 5CXHA 4HVSA 4FTNA 3WF7A 5AUXA 1UU9A 2WELA 2RSVA 5H2UA 5H8GA 1NW1A 4H05A 5BVFA 3P0MA 3IW7A 1ZYSA 4ZTRA 3FC2A 3WZEA 4F0GA 3FPQA 5L6PA 1XHAA 2OIBA 4II5A 4EOJA 2PZ5A 3PVUA 2F2UA 3QC4A 2X9EA 5HE2A 4YHTA 3ANRA 2J0MB 2UVYA 3KXNA 4S33A 2CKQA 2C0IA 2OIDA 4HJOA 4ZY5A 3QBNA 4GKHA 3C4EA 5ETFA 4L42A 5KMKA 3GOKA 1VYZA 4RIWA 4TN6A 1PMNA 4NEUA 1W0XC 3HNGA 5E8UA 3KRLA 3HMNA 2WU7A 1IAJA 1WZYA 4YZMA 1MQ4A 1UWHA 2BHEA 3LHJA 4MBIA 3TACA 3E63A 3VS5A 4CFNA 2XKFA 3ZLYA 4FTOA 3PUPA 4FNXA 5CNNA 3HZTA 3UC4A 3V8WA 4W8EA 4G3CA 4EONA 5IA1A 5M07A 5AAGA 4C3RA 3FMKA 4PX6A 1FPUA 3SRVB 2FH9A 3CPBA 5IQAA 4QPSA 4MAOA 3KF4A 4LUEA 4RVKA 3WE8A 5DGZA 4X2GA 3R8PA 2V55A 2ITYA 2OXDA 2OZOA 3IW8A 4ASXA 2BDFA 3U6JA 4FKIA 2QCSA 4DBXA 1GNGA 1OMWA 3LXLA 3OT3A 4MBJA 3VS6A 5CF5A 5FQDC 4GCJA 5CSVA 3D15A 2HWPA 4L9IA 4HYIA 3MB6A 4ZK5A 4CEGA 4D4VA 4YUQA 3GXLA 3QRUA 4DFLA 2ESMA 4K8AA 3DLZA 5TF9A 3HRBA 2XM9A 4OTHA 4XX9A 4HZRA 3VULA 3HP2A 4C3PA 5HO8A 3DK6A 2ZB1A 2A4LA 4N57A 1YWNA 3QTRA 3CTQA 4BHZA 4D1ZA 1OIQA 4IWQA 3KREA 4JRNA 4MNEA 2V62A 4MTAA 3CIKA 5ETIA 5EYDA 3HA6A 4RA5A 2HY81 3D94A 3P23A 4K9YA 1JKKA 3MY5A 4BFMA 4GFOA 2REIA 3K2LA 4PPBA 3QCQA 4CYIA 4O2PA 4Q9ZA 3QZIA 3PE1A 3QRJA 4C61A 5CEMA 1H1WA 2UZBA 4BDCA 3TDWA 4OT5A 3EN6A 4RVTA 2VX0A 1LUFA 4XBRA 1MRYA 4F7SA 5AV2A 5EQPA 1WVXA 4E8AA 4UWCA 2HYYA 4UALA 2IJMA 3BX5A 2HW6A 5EDQA 4YJRA 3RHKA 5AUUA 4PL5A 5KBQA 5KHWA 3SW7A 1M7QA 3EQRA 3WOWA 3EZRA 1PRYA 2Y6MA 2GDOA 3KK8A 4DF3A 2I7QA 2JDSA 4Q2AA 2VTQA 3SW4A 2EB2A 5J5TA 2J5EA 5ACBC 4KWPA 4B8MA 2R3KA 4RA4A 5IEVA 2VTOA 4F6WA 5D10A 4X3FC 3C4XA 5G6VA 1RJBA 4I1ZA 2ZJWA 4JNWA 2PWLA 4RWJA 4PPAA 1GZKA 2GQGA 2EXMA
chains in the Genus database with same CATH superfamily
3V5JA 3R21A 1YOLA 3UNZA 4L46A 5CAVA 3UO5A 4AFJA 3R0TA 3W55A 3FLWA 5E7RA 4AXCA 3VBQA 1E1XA 3IGGA 4J96A 4FBXA 4EH7A 3U55A 3PXZA 4Z7GA 1LP4A 3TDVA 2NNWB 1ZYJA 2KTYA 4F70A 1Y91A 2CCIA 3OUNB 3IPHA 4AGCA 2XBJA 4G9CA 4FJVA 1UU7A 2PY3A 3JS2A 1W82A 3UJGA 3SRVA 5FEDA 2OW3A 4BTFA 3KRRA 5LCKA 5EH0A 3Q2MA 1UWJA 3FLNC 3ORXA 5J95A 1ZXEA 3C50A 4D4SA 3MVLA 3UO4A 4BBMA 3BHHA 4ZSJA 4XG6A 3QGYA 2P4IA 2RFNA 3L1SA 4AGWA 5A4LA 4FKPA 4IVBA 2Z7SA 4V05A 4C62A 4QQ5A 3NCZA 5LWMA 1H26A 1PY5A 1XMLA 4D0XA 4ZZMA 3FUPA 4FL3A 4ZTQA 3MA6A 1H00A 2JDRA 2XS0A 5AV0A 3RNYA 2QO9A 3QTQA 3HV7A 4NCTC 5HOAA 5HLNA 4O7ZA 4GH2A 2XK8A 4MXZA 3FZRA 3QLFA 5AP0A 2ZMDA 3CBLA 3KCFA 3KULA 4HGSA 2PZRA 4MD8E 4F99A 3KXMA 4RFZA 3GB2A 2EB3A 1H1SA 2PE1A 4H3BA 4EHZA 3BGQA 4DFXE 5IA4A 3TNHA 3NRMA 4D5HA 3PDTA 5EM8A 3I0QA 2Z7LA 2Z2WA 1PJKA 1OB3A 4E73A 5IQBA 2OK1A 1BLXA 5AR2A 2CCHA 1M7NA 3ORZA 1FINA 2F2CB 4R7HA 2RF9A 2VD5A 3A7JA 3IQ7A 4V0GB 4RT7A 3RCJA 3ZC5A 3FMLA 3UQCA 3R30A 3VUGA 1P4OA 2RKUA 3BEAA 1OIYA 1ZYCA 4G3FA 4RPVA 3V5LA 4CZUA 3GC8A 4I41A 1T45A 4I5HA 4NH1A 4ZLOA 1JPAA 2QI8A 3ZFYA 5AV4A 4EQCA 1OITA 3LIJA 5LWNA 4XNEA 3R8MA 4Q5EA 2RFEA 2X7FA 4JAIA 4UX9A 3GCUA 1KOAA 4NFMA 3MFRA 4QMTA 3QA0A 5F9EA 3R28A 5CENA 5E8TA 3R1SA 5KMJA 1YXTA 1DI9A 4GK4A 5EI2A 1UNHA 3OCGA 4ENYA 4EYMA 4USFA 4E93A 1AGWA 1KV1A 2C6LA 3NW6A 4N6ZA 4KIKA 3IDPA 3M1SA 4FTCA 4YGAA 3OF0A 4S30A 2IWIA 2RFDA 4IAKA 2J0JA 2RG5A 3FMHA 4BCFA 2WD1A 5KX8A 3CQWA 3TV7A 5LVOA 4DDIA 3LCOA 4I6LA 2YERA 3AT4A 3OXTA 4GL9A 2IW9A 3I60A 1OKZA 3ORLA 4DGMA 3KKVA 4M14A 2BZJA 4ANLA 2ITOA 2VGOA 1NVQA 3OWKA 4FV7A 2C1AA 4FKVA 4F0FA 2F57A 3D7TB 4FYNA 4KIPA 4FZAB 2HOGA 3GVUA 4EOPA 2FB8A 2FVDA 4U7ZA 4ENXA 3TNWA 3UPZA 3ELJA 2OFVA 3O8UA 2ITVA 2FYSA 4TWCA 2E9VA 5CSWA 1OPJA 4OTPA 1RE8A 3OWJA 3JY9A 5IF1A 5L8LA 3C4ZA 3OHTA 5IQCA 4QEBA 1BI7A 2QOKA 1J7UA 3CR0A 4FOBA 4BZNA 2A2AA 2WMUA 4DHJA 4O6EA 5AP1A 3BV2A 4M15A 1CSNA 3O8PA 4RZVA 2ZAZA 3VUDA 2ERKA 2FGIA 4BJJA 3UOKA 4NW5A 2ACXA 3PUFC 2PVHA 4L7SA 3QX2A 4AXAA 4BWXA 4LL5A 1Q24A 5CX9A 3OY3A 2QG5A 4MKCA 5FDXA 3GQLA 4Y95A 4D2TA 4AA5A 1WMKA 5A14A 5IUHA 2HAKA 4X2NA 4WIHA 2XAOA 3EMGA 4I20A 4EH8A 3DNEA 5FBOA 4ZP5A 3MYGA 4BDAA 4XYFA 4CTBA 5CALA 1M52A 2WAJA 3ZUVA 2WQMA 2QKRA 5JFWA 2HXLA 3BV3A 3MTLA 3QQFA 5CTPA 3D2IA 3FV8A 3BHTA 3W0OA 1T46A 4FICA 2YLFA 3DFCB 4N70A 4FIEA 3RTPA 4BZOA 4KD1A 2X81A 3K5UA 3MESA 4I6QA 4M66A 1FGIA 2HZ0A 3NYXA 5M4CA 2XZSA 2IZSA 4M69A 3LFAA 3TZMA 1YDSE 3MIAA 4E5BA 3Q96A 3VS3A 5BMMA 3OOGA 5IDNA 3DXNA 5DIAA 4F9CA 3EHAA 2PVRA 3UYTA 3EL8A 3ZYAA 1JNKA 3EQBA 4EYJA 5BX0A 2AC5A 4WBBB 5I3OA 2P3GX 3O50A 5HI2A 3VIDA 4A9RA 2BR1A 3VVHA 4FSQA 5DBXA 5F94A 2ZB0A 3OC1A 3JXWA 3BYOA 2DWBA 3UNKA 3R6XA 2B9IA 2ZV9A 4BBEA 5DWRA 3ZM9A 3FXXA 4BDBA 3EQHA 2UZUE 3ORTA 4X6QC 4APPA 2YN8A 3OTUA 4IDTA 3VBWA 4O7RA 4XLIA 2Y6OA 3M2WA 4KB8A 4A9SA 3EJ1A 4UYNA 4RMZA 2JAMA 4CKIA 5J1VA 1K2PA 2CKOA 3GOPA 3TZ9A 2QU6A 4D2RA 4AW1A 4X2KA 5EW3A 3EFJA 3R8VA 3ATTA 5E90A 4HYHA 5J1WA 2W7XA 5M53A 4ZTNA 5BVKA 5KO1A 3BGPA 1BI8A 2YIRA 5C4LA 2PE2A 2BMCA 4QMLA 3D7TA 4KA3A 3DY7A 3S0OA 4GVAA 2VX1A 4ITIA 1OKYA 3FLYA 1O9UA 2YM8A 4ARKA 2XIZA 4R1VA 4XBUA 5EYMA 1I09A 3NYNA 4BWPA 4O7LA 4UWBA 1YDTE 4ZSLA 3KXGA 2BHHA 3V51A 4Z16A 3KU2A 3IECA 3TXOA 2E9UA 4YNOA 2C47A 2V0DA 3MGYA 4ASEA 3PG1A 3PPJA 4QMSA 4CQEA 1H1QA 4FI1A 1ZY4A 4UZDA 1VLRA 2IZUA 5HLPA 4AUAA 3BGZA 4QMXA 3EN7A 3FL4A 4KIOA 1W84A 4FV6A 3BLAA 4QP4A 3RPRA 4F08A 4NW6A 4JX7A 4BCQA 3ZHPC 5L8JA 5JFSA 5GJFA 3NVMB 3UDSA 3OG7A 3M11A 3V8SA 1RQQA 4EH3A 4QP9A 3QYZA 3S2PA 2WFYA 5HIEA 4L7FA 3G6GA 2XJ2A 2R7IA 4YTHA 4ANMA 1XH8A 2WTDA 4FKLA 4AA0A 2E9NA 1ATPE 1H25A 3GP0A 4L6QA 4BCJA 4DTBA 1ZRZA 4AW5A 1XH5A 2BZKB 3VUMA 2YLEA 3F3ZA 3RMFA 4IVAA 1YHSA 2NP8A 3A61A 3QRIA 4ANSA 4I93A 5HVKA 5BV3A 4LM5A 2CJMA 3EQDA 3PVBA 4JQEA 3OZ6A 2QOLA 2R3PA 4QMNA 1U54B 1XH7A 3PSDA 3MY0A 3ULIA 2WMRA 3ITZA 2ETRA 4CYJA 4YPDA 3O7LB 5IQGA 2WNTA 5E9EA 3ZLXA 5J8IA 4RJ5A 5H8BA 3FSKA 2JFLA 3MN3A 3QD3A 4EL9A 2WIHA 2W1GA 3NAYA 4PDPA 2X2MA 3F2AA 3R7GA 2CNVA 4LUDA 4WUNA 3UVQA 3Q9XA 3N4UA 3FLZA 4HYUA 2XF0A 4YJTA 1RDQE 4ACHA 1GAGA 3W32A 4P5ZA 3DBEA 3DBDA 3R1QA 2PPQA 4EORA 3TN8A 1PXKA 3BLHA 4YJSA 2J0IA 3LM5A 3VW8A 5I5ZA 2R3JA 1FQ1B 1YOJA 3MW1A 4FUYA 4KABA 4YJVA 3VONA 3LCDA 4DT8A 3UE4A 3I0OA 2E2BA 5LVLA 1ZZ2A 4RJ6A 4YC8A 3EQGA 2JLDA 2GHMA 3BBTB 5DT0A 2JITA 1F3MC 3NYVA 4FKQA 4H3PA 4RIYB 3AC1A 3FI2A 1TFFA 2PU8A 2FUMA 3QD2B 4FV8A 3FBVA 2X7OA 4L45A 4EH5A 4MQ2A 3SLSA 3B8QA 3RHXA 4DITA 1YWVA 1IA9A 4E6CA 3AKJA 4B7TA 4IZ5A 3P4KA 3ZBFA 2G2FA 2R9SA 3KVWA 3W18A 4F4PA 5L2TA 3FSFA 4ZTMA 4CMTA 3UVPA 4IVDA 3LXNA 5ACKA 2IVUA 4H39A 3TL8A 3TV6A 4JG6A 5LMKC 3DKGA 3FJQE 3ACJA 1QPDA 4FKTA 4J97A 1L3RE 5DN3A 3W2OA 2XK7A 2WPAA 1S9JA 3O23A 3K3IA 5K3YA 5F1ZA 5E8ZA 2IZRA 4EQMA 5FEEA 3I5NA 5DA3A 5AM6A 4E4LA 2J50A 2XKEA 5DEYA 2UZDA 4IX4A 4YZCA 1E1VA 2ITQA 3DCVA 3BBWA 4MXOA 3VJNA 2CKPA 4MQ1A 2PZPA 3VUHA 4EZ3A 4QQTA 3QX4A 3COIA 4R8QA 4O7TA 1V0PA 5HBHA 2ZOQA 3Q9ZA 5AR3A 2GS6A 2C5VA 3UO6A 2AEGA 4EOOA 4E26A 4O7NA 5IH6A 4FMQA 4DCAA 1R78A 4ZJIA 2JDVA 1BUHA 3LCTA 4QO9A 4ZTSA 5KUPA 2OSCA 4IWOA 5J9LA 5CVGA 5FG8A 4I4FA 3F2RA 3R1NA 5AR8A 4FT5A 4FIIA 4MEDA 5HORA 2A98A 5J5SA 2W1DA 3SGCA 4M12A 1OL2A 2XNGA 1W8CA 4LRMA 1H27A 4AT5A 4E4NA 5JMSA 3PFQA 2VTSA 4J52A 1J3HA 5CI7A 3ZXTA 3BQCA 5DR9A 3PVGA 1LEZA 4ZLZA 3Q6WA 3RAKA 3R9HA 2UW5A 2NRUA 4M67A 2CNQA 1U5RA 2A19B 2VU3A 4AQCA 3FXZA 4QMZA 3NMUF 2BRHA 4F65A 3SVVA 4PMTA 4A7CA 3DJ6A 3KC3A 3PA5A 4GV1A 4FTIA 4OW8A 1A9UA 3QC9A 4DEIA 4I22A 3KXXA 3ZOSA 3EYGA 3QHRA 4LOPA 5C27A 3TCPA 5M06A 3ZS5A 3TJDA 3UTOA 4C4IA 3R00A 2GQRA 2PMLX 2QOHA 2UW6A 4HCUA 4PUZA 3FZSA 2YFXA 5HCZA 2GU8A 4CFFA 3CGFA 3C9WA 1URWA 2WHBA 2W4JA 4BDHA 2B9FA 5E8WA 2W0JA 3DZQA 1W7HA 5I4NA 4JMQA 3W0RA 2ZMCA 4AOIA 4EK8A 4TW9A 3QYWA 4S2ZA 1Q3WA 4C4GA 3PWDA 5EHLA 5HD4A 4R6VA 3IW5A 2YACA 2PVKA 4I6FA 1IASA 2WQEA 4O27B 3RAIA 4IWDA 5HHWA 4BDFA 2Z7RA 4WG4A 1U5QA 4A4XA 1H01A 1PKGA 4YO6A 3V01A 4ZS4A 1OGUA 1NVSA 3OXZA 3LLAA 1NY3A 3CTHA 1LR4A 1OUKA 4UXQA 2JIIA 4QPMA 1XH9A 5AR4A 5CEPA 4U9AA 1RW8A 2QKWB 2R3RA 3RM6A 1STCE 5AX3A 1YXSA 4FGBA 2UW0A 2G1TA 1Y8YA 3VS4A 4IC7A 4NZWB 4DEBA 5AR7A 4C33A 3CLYA 2R0IA 4ZLYA 3MY1A 3PFYA 2UW4A 3DB8A 4Y8DA 2H6DA 4LRKA 2PYWA 3L9MA 4RFYA 4DEHA 3NAXA 4QTAA 5TOZA 1DS5A 4FSNA 4GU9A 4RX7A 3ZRLA 2BRGA 3FYKX 3IO7A 4RVLA 4WSQA 3KEXA 3KMWA 4PDYA 4W4XA 1E9HA 2RG6A 2Z8CA 4KIQA 4FSMA 2C5YA 3LXKA 2HW7A 3FEGA 2UZNA 4AOTA 1ZOEA 3ULZA 5E1EA 4RIWB 4X2FA 4O0VA 2ITXA 5BNJA 4MF1A 5CEQA 4FVQA 2HWOA 4WOVA 3DKOA 4DH3A 4GUBA 4XOZA 3OVVA 4O7YA 4QMOA 4X0MA 3L9LA 1JKLA 2XIXA 3BU5A 4IX6A 3GFEA 5GJGA 2IVTA 5LXMA 3I6WA 1FOTA 4PL3A 4I23A 4TL0A 3PJ3A 3DAJA 3W16A 5A46A 4FSRA 3VF9A 1XMMA 4R7BA 1F5QA 4QDEA 3MPAA 3UIXA 5IA3A 3U54A 2R3HA 3P78A 2EXCX 3AKLA 4JBVA 4TNBA 5LCJA 3F5PA 4FG8A 3ZEWA 4PDOA 3ZC6A 2R2PA 4O1OA 3QL8A 4XP0A 1VR2A 4XOYA 3MH3A 2VO7A 2X0PA 4OUCA 4MD7E 5I9YA 2XM8A 2WTWA 4W9XA 5HG9A 4RSSA 2W1EA 2QU5A 4F09A 5B2MA 4PTGA 5CVFA 5DT3A 3LAUA 4K2RA 4DG3E 4AZWA 3T3UA 3LFDA 2XK9A 3QD0A 4L68A 2FSOX 2UZLA 2Y8OA 3NUNA 4WG3A 3P7CA 3BELA 1YW2A 3AQVA 2WMBA 4L43A 2A1AB 4E1ZA 3THBA 2YJRA 3NUAA 4KBKA 1V1KA 3KL8A 2UUEA 4HVIA 3P5JC 2B4SB 2OO8X 4RIOA 5KNJA 3UDZA 2QLUA 3V6SA 4MNEB 2BTRA 1J7IA 3CD8A 4L3PA 3FC1X 4ERWA 3LPBA 3LFNA 2VO0A 4NIFA 2XARA 1JWHA 4PMMA 4QMUA 3MSSA 4A06A 3PJCA 1OIUA 3VQUA 2QR8A 1BL7A 5H8EA 1JAMA 1ZMVA 3W8QA 4CFWA 4EH2A 3SG8A 5ANOA 3UP7A 4EOLA 4DFUA 4BTKA 4C59A 3AGLA 3LCSA 4WA9A 5E4HA 2W99B 3OROA 4I94A 3R73A 1SZMA 2WOTA 4HPTE 1M2PA 4NK9A 1P5EA 3NS9A 1OGYA 3Q4UA 5JZNA 2R7BA 4N0SA 3RK9A 4BI0A 4ZY4A 3O5AA 3SC1A 3C51A 3WF6A 3W0PA 3IGOA 1OM1A 3FDNA 5DE2A 2C6IA 4DBNA 3ZLWA 5M44A 4G5PA 4XEYA 3R7UA 3HKOA 2BFXA 4RWKA 3POOA 2E9PA 2W1CA 5HCYA 4BDDA 4D1SA 4QMPA 2WTKC 4F6UA 4FKOA 4J71A 4BYJA 3ZM4A 4AU8A 3N4TA 3H9OA 1XH6A 4DCEA 5GIPE 4F1OA 5IG1A 4C4EA 3QUPA 5IUIA 4E6DA 4CRSA 5J9ZA 3F5UA 3NLBA 2XCHA 2WMWA 1AQ1A 4QMYA 3PXRA 3T9IA 3W2CA 3R83A 5JK3A 3F6XA 3Q53A 2YDJA 1R39A 4O84A 4DLIA 3NUYA 5CU0A 4RIXA 2P2IA 3LFSA 1XQZA 4FSWA 4AW0A 3LE6A 2WMXA 4DH8A 4C34A 1SVHA 4EOMA 2C0TA 1PF8A 4A9UA 4MK0A 2OLCA 1XBCA 4U41A 3MB7A 4AOJA 5I0BA 1IAHA 4DDGA 3JPVA 3COMA 5IPJA 3IDCA 4YUQA 2CLXA 4H3QA 5CU6A 5DPVA 3R22A 2VWUA 2HK5A 5CQWA 4EJNA 3A2CA 2VTPA 3S00A 1YHWA 2WMTA 4FTMA 4FT7A 4UBAA 2FO0A 3E62A 1SVGA 3FQSA 2XAMA 4YJNA 5CU3A 4FR4A 4H36A 5G1XA 5IH5A 3VBVA 1YI3A 3BPRA 2YAKA 2XIRA 4GRBA 5ICPA 3DNDA 5E1SA 5M51A 3RBWA 3W33A 3VC4A 3F9NA 3FE3A 1UA2A 3AG9A 4GSBA 5CI6A 4CTCA 1CM8A 3EQIA 3KULB 4EK5A 4UMUA 1J1BA 3FLSA 5IA2A 2ITTA 4YHJA 3W8LA 3JR1A 1ZY5A 3MTFA 3O2MA 5A6NA 4C02A 4ZJJA 2QOCA 2XNBA 3V5QA 1P14A 3EQCA 4ZZNA 2C69A 3Q3BA 5CEKA 4O7SA 4EBWA 5HO6A 4ALUA 4AT4A 4U5JA 4F7LA 1Q61A 4FTJA 3TKIA 1U59A 1WBVA 4JR3A 5KMOA 2VWYA 3PE2A 4GJ3A 4TNDA 4XG9A 2B0QA 2OI4X 3DBCA 4FV3A 4NU1A 4C35A 3PPKA 2ZM1A 4H58A 4NSTA 3SQQA 4IC8A 3U51A 3N51A 1SVEA 4FT9A 4ZMFA 4YO4A 5KKRC 3KMUA 3H30A 1L8TA 3R7OA 5GIOE 4XP2A 2R3IA 3QZFA 3NIEA 5DFPA 5EFQA 3CD3A 2PVFA 4YP8A 4BCHA 5EQEA 3TMOA 3LJ2A 3RK5A 4AN9A 4FEQA 1OBDA 2PMNX 4DINA 4QMMA 4EBVA 4KNBA 4KIKB 4ZOGA 4F1TA 2QOQA 4AAAA 2JAVA 4EWHA 3G5DA 4B6LA 3ZSHA 5M08A 2PUIA 2X8DA 3QKKA 3NUXA 4KRCA 3WE4A 4YJOA 1DI8A 2QLQA 2VO6A 4NKAA 3GUBA 4RJ8A 3IONA 3R9DA 5CAPA 4CZTA 3W2PA 3HL7A 4YC6A 4FV4A 4M84A 3HP5A 4YU2A 2SRCA 1FVVA 3FQHA 5I3RA 3BRBA 3PWYA 3FQEA 4XG8A 1YVJA 3Q52A 3ZEPA 4IB3A 5K4IA 3U9NA 3TIZA 1B39A 3WYYA 1ZMWA 1GIHA 2X0QA 5IISA 2PZYA 4NM0A 4BVUA 1TQMA 1Y6AA 3PG3A 1Q8ZA 3H0YA 3V5TA 3D9VA 2UZWE 3HV3A 4FKWA 2W17A 1XKKA 2JEDA 4ANQA 2GTMA 2XMYA 4AXEA 3N9XA 4MX9A 3AC3A 5K5XA 1WBPA 4U3ZA 3DAKA 3BYMA 3ZO2A 4HVDA 3ORIA 5IQEA 2YM3A 5IQIA 4IXPA 4H1JA 5KMNA 2C6TA 4WO5A 4BJJB 1DM2A 2OF2A 3AT2A 3FHRA 3I6UA 4J8MA 4I4EA 1BL6A 4PNIA 2R64A 4S34A 4BZDA 5HU9A 1UKHA 4GVJA 2WQBA 1OI9A 3GCSA 5EOBA 3A7GA 5IEXA 4E5WA 3KF7A 3B2WA 4FTAA 4C38A 3DTWA 3H9FA 3O0GA 3UQFA 3U6IA 4BIDA 1XBBA 4FTQA 4RBLA 5AP4A 1CDKA 4E4XA 4YTCA 3G15A 1OECA 4QOXA 3JYAA 3F82A 5K0XA 3AT3A 5J7BA 2WQOA 2CGXA 4GYIA 2OZAA 4FZFB 4J7BA 4L00A 4RJ4A 4BKYA 2O65A 2W96B 4MH7A 4JBPA 3F3VA 3UP2A 4M69B 2IZTA 4ZSGA 3TYKA 4CCBA 3LCKA 3UZTA 4NM5A 4D2WA 1REKA 3TNIA 3COKA 2C6DA 4DGGA 4QPAA 4YZDA 2O2UA 1PMEA 3G9NA 3KN6A 2J7TA 2ONLA 5DVRA 2IPXA 1ZOGA 5FTGA 3EOCA 2VWIA 4HNIA 2VGPA 4DT9A 2BPMA 3ZTXA 2XNEA 4FSTA 5CEOA 2WOUA 4Y5QA 2WMSA 4IX3A 3MWUA 2B55A 1LEWA 4WRGA 4CFXA 2J6MA 2W9FB 4WNOA 3QRTA 1Q4LA 3ID6C 2P0CA 2W5BA 4IAIA 4ZTHA 3GT8A 3C0HA 4WBOA 4OBPA 3GU8A 3TUBA 5JGBA 5LOHA 2CKEA 5C9CA 3HV6A 5FP5A 3V5PA 4AE9A 4KBAA 5D41A 3POZA 1TQIA 1WBOA 5M56A 4WRSA 2UW9A 3FY0A 4LYNA 3KVXA 3VS0A 4EHVA 3BYUA 3D0EA 3DTCA 3B2TA 3Q5IA 4GT5A 4UXLA 3OP5A 4RX8A 2QHNA 3R7YA 4TWNA 4AZSA 2XKCA 4PTEA 3LKMA 3FKLA 4ONAA 1QCFA 2VRXA 5CF4A 3SD0A 3QD4A 2X39A 5HO7A 5A4QA 2X6EA 2XNMA 2YITA 2EWAA 3PJ1A 4G3GA 4DTKA 3W0NA 4IX5A 3PY3A 4UWYA 5CAUA 2WQNA 2AYPA 1Q8TA 2C5XA 3GEQA 1P4FA 4YJPA 4WT6A 4WNKA 3PA4A 2Q83A 3KQ7A 4P7EA 5AA8A 3CXWA 3MV5A 3CTJA 4RWLA 4F7JA 3HUCA 4MWIA 4O1PA 2YCQA 4FIHA 4OGRA 4GFGA 5LMAA 4RFMA 4R77A 2VX3A 2YISA 5IA5A 3ZSGA 4M97A 2PVYA 1BYGA 5E8XA 3DBQA 4AZVA 3RAWA 3ORNA 5DT4A 5FD2A 1HCLA 5F20A 4I92A 4WKQA 3Q4CA 3HYHA 1KSWA 4JQ7A 4XP3A 4DH7A 2GNIA 1ZAOA 4GU6A 2C1BA 3FZ1A 4WUAA 2W1FA 1Q62A 3K5VA 3TKHA 5D1JA 3E8NA 3UNJA 5GZ9A 4E6AA 1ST4A 4S31A 3P7BA 4R5YA 4HVGA 2RIOA 3UDTA 3ETAA 3QZGA 4FSUA 1XWSA 2W9ZB 1U46A 2QVSE 3VQHA 3UQGA 2G9XA 4M8TA 1PYXA 5AEPA 3CEKA 4LL0A 5AAEA 4U81A 3NFFB 5HG5A 4FODA 2BKZA 2OJFE 5BVEA 2PTKA 3CE3A 3KFAA 5BMSA 3VS1A 5HZNA 3QKLA 5EKNA 2B53A 3QA8A 4IEBA 4YTFA 5BVNA 3PLAE 2IF8A 1P2AA 4GJ2A 1KOBA 4OTWA 3E8CA 5FWKK 5LARA 1PHKA 3U8WA 2C4GA 4D2PA 4OTRA 5AV1A 4EHEA 2GMXA 3LFCA 2RFSA 3CJFA 3QQHA 4AWIA 4FTUA 2P2HA 2RGPA 2V7OA 4FV0A 3EN4A 1PXOA 3ODYX 1UKIA 4YLKA 5GZ8A 2GQSA 4U40A 3D5XA 3RPVA 4AGDA 5HGIA 2XK6A 1XR1A 2X9FA 2BAQA 3DKFA 4MHAA 3E5AA 4O96A 2VTMA 5CQUA 4DAWA 4CGAA 3N4VA 3WARA 1NT2A 2PVNA 4BDIA 2C3IB 4AA4A 4A4LA 3O7LD 3LMGA 2UW3A 3TZ8A 3T3VA 4IH8A 4K6ZA 2JGZA 2Y0AA 4IB1A 1PXLA 3MH2A 4PPCA 3AC2A 4BGHA 3GI3A 4L3LA 5C26A 1SNXA 3QTUA 4DLJA 5H3QA 3WYXA 3ENHA 5CZHA 4I21A 2GCDA 3HMIA 4NM3A 2WTIA 3ZRMA 2GFCA 4Z3VA 4KKHA 1QPEA 2JIUA 2QD9A 5GINE 2XYNA 4PV0A 2WZJA 5EOLA 4PTCA 4QP1A 2JBPA 4DG0E 2XVDA 4UEUA 4IB0A 3HAVA 3MVJA 2CPKE 5DLSA 4BDKA 1ZOHA 3FPMA 3GC7A 1WBNA 5AAFA 4MWHA 5AUZA 4KUJA 4A07A 3DAEA 3FY2A 4FX3A 5ANKA 4YR8A 3SXRA 4NTTA 2H96A 4XV9A 5AP7A 4XJ0A 2H8HA 2W1ZA 2PUPA 4WD5A 1GOLA 4YHFA 4Y73A 4WNMA 4AAYA 4OTQA 2HZIA 4EZ7A 4XCUA 3LMIA 4DEDA 3S95A 4GG5A 3ZMMA 3P1AA 1A48A 2O5KA 5HVYA 4GK2A 5IQDA 5B0XA 5TKDA 3QF9A 5H9BA 3GGFA 3MIYA 4IJ9A 2GPHA 3TG1A 5CEIA 4O0XA 2IVSA 1MQBA 5ANIA 4EEVA 4B99A 4C36A 3OS3A 5DR6A 5AP2A 4JJRA 2F7XE 2FSMX 2JKQA 5I9WA 1ST0A 4DH1A 5C8NA 1Y57A 2GNFA 2ERZE 4FTRA 3C4WA 2WTVA 1FGKA 2QOOA 3CSVA 1FMOE 3RNIA 2VTAA 3JUHA 3DXQA 3OD6X 3ZCLA 3I79A 3NUUA 3QCSA 4BCKA 3VNTA 1Q8UA 5EDRA 5HVJA 1W83A 1S9IA 4GIIA 2R3GA 2YAAA 3SXSA 2Q0NA 4OTGA 2QOIA 3ZZWA 3BU3A 4BGGA 4CLIA 1CKIA 2PK9A 2OJ9A 4YSJA 1JKSA 5JN2A 3E64A 5HE3A 3NW5A 1FMKA 2AUHA 1GY3A 4LMNA 1CMKE 4QTBA 3MH0A 3Q4TA 3UYSA 4FT3A 1PXIA 1OIRA 4ACMA 4J53A 5EI8A 4FTLA 4JXFA 2QOFA 3VUTA 4RJ7A 1SM2A 2PUUA 4O91A 2PUNA 2KULA 4O4DA 4ZTLA 4J8NA 3RGFA 4DFNA 4WG5A 1YKRA 2BRBA 4IQ6A 1PYEA 4AZFA 1JKTA 3U87A 4IZAA 1UU3A 5CU4A 3Q6UA 2XH5A 1R0EA 2QONA 3ORKA 3NYOA 2YA9A 5AIRA 4QP8A 4X3JA 2Y4IC 3O96A 4XG4A 2A0CX 3KRXA 4AF3A 3FMDA 4DG2E 3EKKA 4XH6A 4U97A 3LW0A 4NKSA 4OAUC 3UDBA 1URCA 3A62A 3OW3A 2JFMA 2O64A 3EH9A 4FTKA 2HCKA 4XS2A 3BIZA 3CGOA 2PMIA 3F5GA 4I5CA 5B2KA 3P9JA 5HTCA 5HX8A 4JBOA 2O3PA 4DC2A 4CKJA 1VJYA 2YIXA 3Q60A 3L8PA 4JI9A 4ANBA 4YC3A 3TJCA 4IACA 4P4CA 3RM7A 2JC6A 3SAYA 2VZ6A 4K18A 4TT7A 4TYJA 1W2FA 2DQ7X 2NRYA 2P55A 3G6HA 4LQMA 4ACGA 3HDNA 3BE2A 5CS6A <