3V01A

Discovery of novel allosteric mek inhibitors possessing classical and non-classical bidentate ser212 interactions.
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
322
structure length
289
Chain Sequence
MELKDDDFEKISELGAGNGGVVFKVSHKPSGLVMARKLIHLEIKPAIRNQIIRELQVLHECNSPYIVGFYGAFYSDGEISICMEHMDGGSLDQVLKKAGRIPEQILGKVSIAVIKGLTYLREKHKIMHRDVKPSNILVNSRGEIKLCDFGVSGQLIDSMAVGTRSYMSPERLQGTHYSVQSDIWSMGLSLVEMAVGRYPIPPPDAKELELMFPPMAIFELLDYIVNEPPPKLPSGVFSLEFQDFVNKCLIKNPAERADLKQLMVHAFIKRSDAEEVDFAGWLCSTIGLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dual specificity mitogen-activated protein kinase kinase 1
publication title Discovery of Novel Allosteric Mitogen-Activated Protein Kinase Kinase (MEK) 1,2 Inhibitors Possessing Bidentate Ser212 Interactions.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/inhibitor
total genus 85
structure length 289
sequence length 322
ec nomenclature ec 2.7.12.2: Mitogen-activated protein kinase kinase.
pdb deposition date 2011-12-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3v01A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3v01A01
3QRIA 5IUHA 1E1XA 3ID6C 2PVRA 2W1ZA 2ZAZA 5CF4A 3EKNA 1KWPA 2H9VA 2ZM1A 3O8UA 1BI8A 3CC6A 4EHGA 3TCPA 3QRUA 3C0GA 4V04A 4AFJA 3FLYA 5D7AA 2VWIA 4PDPA 4RIYB 2YEXA 5K0XA 1SZMA 4A9SA 3OW4A 3KCKA 3UDBA 4F9AA 3DDQA 3HLLA 3K5VA 4TWCA 4XG8A 4IANA 3F69A 1FGKA 4ANBA 3KXHA 4BDGA 4EOKA 2BIYA 1MP8A 3BZ3A 1YXSA 4IB1A 3UYSA 5A6NA 4ZK5A 1GNGA 5CX9A 3QA8A 2OKRA 2R7BA 4KRDA 4L3PA 2JDRA 4YJOA 5E8XA 4ANMA 4L01A 4F0IA 3VBVA 2YDKA 2X81A 5CNNA 4GU9A 3JS2A 3VJNA 4ANLA 3KC3A 5CF5A 3NW5A 3L9PA 4LOPA 4LRJA 4M69A 1F3MC 5FP5A 1TQMA 3BHUA 3F3WA 4Y5QA 4GVAA 3UVQA 4H1JA 3W8QA 2JIVA 3QCQA 4AZSA 3QWKA 4IC8A 2Z7SA 4QTDA 4FKJA 3Q5IA 4Q9SA 3UBDA 4KA3A 3PVGA 3DAKA 4JG6A 3PXRA 2IVSA 4HNFA 4QYHA 5DH3A 5IQGA 4AZEA 3IOPA 2JD5A 1GAGA 3Q9WA 5AADA 5L4QA 4RFMA 5KMLA 4FTNA 5IQAA 4BI1A 3BYOA 5DT3A 5L2IA 4UMRA 3OD6X 3D2KA 2XB7A 4GW8A 4JQ8A 3OTUA 4GG7A 4APCA 1URWA 3WE4A 4TTHB 3RM7A 1SM2A 4M12A 4J1RA 3OUKA 3THBA 4HYSA 5EI6A 5HLPA 3ZLXA 4C61A 1P4OA 1JPAA 5KCVA 4FIFA 2WMVA 5LARA 4RIXA 4NUSA 5HG7A 2XMYA 4ZLYA 3GUBA 4C36A 4QMVA 5CQUA 4Y46A 1OKVA 4MCVA 4L6QA 5CSWA 5BNJA 4W4WA 3CD8A 3UQFA 1UWJA 3FMDA 1M7NA 2IVTA 3DXNA 2YERA 2YITA 2VTOA 4V01A 4RPVA 3H30A 5AP4A 4CYIA 4FT5A 1NA7A 4UWYA 5IA2A 3CGFA 3NCGA 3AD4A 2YM8A 3KKVA 2RKUA 4ITIA 4QMTA 4X3FC 3NPCA 3RCDA 4F08A 3A7FA 4LOOA 2JKOA 4FZAB 4NTSA 4J8MA 4APPA 5EW9A 4DTBA 4EC9A 2IW9A 4FTAA 3WF8A 3CQWA 1PXLA 3PSBA 2WKMA 4L45A 4DT9A 4FEUA 3L8PA 4OBPA 4MBJA 3FWQA 4I0SA 3W2QA 2O5KA 2WMRA 3KGAA 3O50A 1U5RA 3PA3A 3PG3A 3D5WA 2HELA 2WFYA 3VRYA 4E5AX 4HPTE 3PVUA 3CTJA 3JYAA 5DOSA 4BVUA 1UVRA 3P1AA 3TKHA 4BCMA 3DDPA 3NRMA 2BRMA 1YI6A 3NR9A 3OS3A 2EB2A 3R7GA 3OCGA 3ODZX 4OT6A 2R3PA 4JBPA 2WMAA 1OMWA 4FTIA 2VTNA 2Z60A 5HU9A 3POZA 4H3BA 4F0GA 1XKKA 3ANRA 1FMOE 3QTQA 2UW9A 4I4EA 4DGNA 5CXHA 4F4PA 4XG7A 4ID7A 2WPAA 2YCSA 3FHRA 5J1WA 2UW7A 4YC6A 1VJYA 5D41A 4KUJA 3PPJA 4FV2A 3NUAA 5IQEA 2QU6A 3V51A 3TJCA 4EKLA 2BROA 4ENXA 4UMTA 5J9ZA 3I7CA 3OXIA 2Q0NA 4FVPA 3TV7A 4BDKA 2XKEA 3DOGA 4YR8A 4LUEA 2F7XE 5EH0A 3QUDA 4K1BA 5CEMA 5BVWA 3PWDA 4EK8A 2JDOA 1H07A 4HGTA 3R8MA 4AW0A 1PRYA 3ZEPA 4K33A 2QOKA 4JDKA 4LV5A 2OFVA 2QG7A 1OKWA 1KOBA 1ZRZA 3FPMA 4JJRA 1V0PA 3OF0A 4FKTA 3LCKA 2PHKA 4U45A 5AIKA 4W8DA 5ANKA 3UG2A 2XK3A 3ZH8A 5HO7A 4O0YA 4O7LA 4BWPA 4RVTA 2Y8OA 3RBWA 5M55A 2HY81 5AAFA 3VBQA 4DFBA 4N6YA 3Q32A 4L43A 3AOXA 3LXPA 4UMPA 5AV4A 4ACDA 4IEBA 3FQEA 3HMOA 3KEXA 5GIOE 2C5NA 1ZMUA 2IZSA 3OW3A 2Z7RA 3EKKA 3IG7A 4IB0A 4TYIA 1PHKA 3CSVA 5AA9A 3MFSA 3ZU7A 3VIDA 4H39A 4DGOA 3OWJA 4PMSA 2ZDUA 3CD3A 3R7OA 2RIOA 1M14A 2YA9A 2GTNA 1K3AA 3EYHA 3C7QA 5ANDA 5IUGA 2XRUA 4ENYA 3P4KA 2BDJA 3DTCA 4IFCA 4GFOA 3ZXTA 1JOWB 3I4BA 2J0KA 5LWMA 2GNFA 4IAYA 4FVQA 1FBNA 2W1FA 1U59A 1UU9A 2HXLA 3BGQA 4L9IA 3D9VA 5E8ZA 4ZXTA 3I1AA 4MHAA 3EN4A 5D12A 3R7IA 4E20A 3BBWA 3RWQA 1UU7A 5LMAA 3UO6A 2XUUA 2W1HA 3A7GA 3RPYA 2HOGA 3LFDA 4U41A 4BHZA 3NDMA 3CS9A 1XBAA 4FSZA 3Q4ZA 3AT3A 4HOKA 3HGKA 3QTRA 4J52A 5M57A 4P5QA 3C5IA 1OKZA 1WBPA 2OBJA 4FZDB 5DYJA 2J7TA 4O0UA 2G01A 2EXMA 3P5KA 4GUEA 4IVDA 5CYIA 1F0QA 4QMWA 4RWIA 5DR2A 3ZC6A 4U40A 3FHIA 5IH4A 3U6JA 3HX4A 3E5AA 4IXPA 3AXWA 4L7SA 3HVCA 5C8MA 4ZMFA 3FI4A 4JBVA 5HG5A 4FSNA 2W7XA 5DA3A 4ACMA 1WBSA 3COKA 4PPAA 4AG8A 4E4MA 5TOZA 4HPUE 4G34A 3MY1A 3HZTA 4BDCA 3EZRA 2VTAA 2VTQA 4QT1A 5DN3A 4PX6A 2Y6OA 5AV2A 1T46A 4NFNA 3UP2A 5L8JA 4D2SA 3Q52A 4ZY4A 2ZDTA 2YCQA 3LFBA 4CV8A 2OZOA 4FZFB 5LXMA 4DBNA 4J96A 3GC7A 2UZVA 3MYGA 4USDA 1P4FA 5IA1A 3UQCA 1BUHA 2QHMA 3UNZA 3WE8A 3LQ3A 4ZAUA 4RC3A 3HMIA 5HNBA 3DU8A 4E73A 4NIFA 1YXXA 2G9XA 1XJDA 3M42A 4XUFA 5EDQA 3WF6A 3DXPA 4IX3A 3P23A 3IW5A 1TQIA 3PWYA 4EH3A 3QUEA 2R3NA 4D58A 2GQGA 3F5PA 1WBTA 3BLQA 3GQLA 1IR3A 3AC1A 3LFSA 4I5HA 3VN9A 2UZBA 1YVJA 3AMYA 5KUPA 4PWNA 4ZP5A 4AOIA 2PZYA 2XIYA 3ATSA 1GZ8A 4BCQA 5KBQA 3PPZA 3G9LX 4FTMA 2OZAA 4JI9A 5B7VA 2I40A 2NPQA 1B39A 2PZRA 2FSMX 3ET7A 4G5PA 3ZONA 4DTKA 5T6KA 4IB5A 4O1OA 4F1MA 5HX8A 5IU2A 4CQGA 2W99B 2C0TA 4OTGA 4XG9A 4IM2A 4I20A 4GSBA 3UG1A 1JSUA 3MSSA 1YXTA 5JFSA 4O7RA 4HCTA 4IWDA 3F82A 4BWKA 3FMEA 1O6LA 2R5TA 4AOJA 4DEAA 2PWLA 3ZFYA 3C13A 5IA4A 2PMNX 3EQRA 4YGAA 5F94A 4KBKA 3RTPA 4F1OA 1LPUA 1ZZLA 4K77A 3R7VA 4QP4A 1OIUA 3EQFA 1IG1A 3ZBXA 4MXOA 3O8PA 4QP1A 3RHKA 5H8GA 4C58A 2ETMA 1CKIA 4ANQA 1M2PA 2WMSA 1XO2B 3EQDA 5AX9A 4MWIA 3TEIA 4EZ7A 4KBCA 3S95A 4LMUA 3S00A 4XG3A 1ZLTA 4L46A 4EHEA 3DQWA 5AAGA 4X3FA 4GFGA 4RWKA 1P2AA 2GMXA 1OL1A 4Y85A 4XOYA 4S33A 4BWXA 4R77A 4GK3A 3FMMA 4GUBA 2W17A 5EW8A 3WZDA 3BI6A 1YW2A 2IO6A 5E4HA 3KVWA 3ORXA 4KB8A 3NNVA 5C01A 1JSVA 1MUOA 2JIUA 4R3RA 4G3DA 4U43A 4D2PA 1RJBA 4YZBA 5LJJA 2E9PA 3Q9ZA 2IZUA 4GU6A 3JY9A 2WMBA 2PUNA 5ANEA 4BIDA 3TWJA 4EZ3A 5EM7A 4FI1A 4L44A 4MAOA 4PTEA 4PV0A 1YHSA 2ETKA 4DITA 1DM2A 2J90A 5BYZA 3GFEA 3R8UA 3UP7A 3RK9A 3G6HA 2JAVA 2RF9A 4FSYA 3FYJX 3C0IA 2X9EA 1CKJA 3DFCB 3ZSHA 1VR2A 4CSVA 4CG8A 4DGLC 3QZHA 2W1EA 4OTRA 5LQFA 1G8AA 4QQ5A 5DBXA 3OWPA 2NP8A 4ZTLA 4OGRA 3IGOA 4JOAA 3JR1A 2R9SA 4FEQA 3E64A 1YQJA 4S31A 1AQ1A 3ZHPC 2J2IB 1WVYA 4WKQA 4C2VA 3HAVA 4TT7A 1PMEA 2R2PA 2UUEA 3ZRLA 4IBMA 4BI0A 3OOMA 5I5ZA 1L8TA 4P90A 4MXYA 1ZY5A 4FNXA 4AP7A 4TWOA 1R0EA 2CJMA 4TY1A 2JDSA 4X6QC 3NYVA 3VS7A 3FSFA 4V0GB 5CS6A 4EWHA 3BE9A 2OJIA 4ASZA 3OBJA 5A4CA 2C4GA 2WMWA 5FTQA 4E93A 1ZYJA 1FOTA 3Q6WA 4J8NA 5JZJA 4A4LA 5HG9A 4PMPA 3U54A 4TW9A 4L42A 5F9EA 2BRHA 3T9IA 4BZOA 3ZO1A 5ICPA 2PVJA 4XYFA 4C2WA 3Q6UA 3PE2A 2UW0A 4ZZMA 4YTIA 5E90A 3EWHA 1OECA 5C03A 5CEQA 3TIYA 4OTWA 2YCRA 2I0YA 3PA4A 5ETAA 1R39A 1SVGA 3GCVA 2V22A 1TVOA 1FMKA 2UVZA 3TNPC 2R0UA 3QWJA 4DT8A 3R00A 3WZKA 5KMMA 3SA0A 4O7TA 4EUTA 1J91A 2XIZA 2AC3A 2SRCA 2XCKA 2YDIA 2BVAA 3ORPA 4R8QA 4WSQA 4DCEA 3UE4A 2GHGA 2Y7JA 5DMZA 1YI3A 3PFQA 5TKDA 3MJ2A 4O2PA 3HAMA 4QP6A 3MS9A 3R02A 4YSMA 5HIBA 4FNZA 3DFAA 3BYSA 3P0MA 2OG8A 4KKHA 4NK9A 2OZAB 3DK3A 4FG7A 2XNGA 3QX4A 4IACA 5ANIA 5L6WL 3PIYA 4FV7A 5AR2A 3QA0A 2BDFA 3BHTA 3F3TA 4RVLA 4EL9A 3GU6A 3LM0A 4RT7A 2PVLA 2QR8A 3ANQA 3GU5A 4BDIA 2XH5A 2GNGA 1XH8A 2GDOA 2XEYA 3QLGA 4EK4A 2X2MA 3F6XA 3R71A 4YPDA 3HV5A 4IWPA 3SOCA 2PVMA 2EVAA 1BL6A 4C37A 4FKUA 2HYYA 2VTRA 3ORIA 4LRKA 4CMUA 3VHEA 4AFEA 4G3EA 5IUIA 4FTQA 3PIXA 4DH7A 3QD0A 2QURA 3SGCA 1WVWA 1UKIA 4KWPA 1W98A 1X8BA 4U81A 3TJDA 3TT0A 5CEIA 3F3VA 2XNNA 4E5WA 4BN1A 2H8HA 2XYUA 3QL8A 5H8BA 3HV3A 5AMNA 4RRVA 3RAHA 1FVTA 3DBQA 3GQIA 3REPA 2I7QA 3V8TA 5K0KA 3W32A 3BLRA 4AW1A 2YABA 3RINA 2QOQA 1KSWA 3GB2A 3O7LB 3PPKA 4FV8A 3Q53A 4C02A 1FQ1B 5CVGA 1PW2A 3ZO4A 2IZRA 1W84A 2ZB1A 2CKOA 4ITJA 3LMIA 4DG2E 4ZLOA 2YIWA 3GCSA 1OL6A 2AYPA 3CE3A 4FT9A 3UOJA 5CASA 5BMMA 2X4ZA 4CLJA 4GKIA 3BWJA 1H4LA 1SNXA 1PXIA 3UIUA 3ZMMA 2C6DA 1LEWA 3FXXA 4MH7A 3MVMA 4JT3A 3HUCA 1OGUA 5FXSA 2FB8A 2QVSE 1OIQA 5HVKA 1MRYA 4XG6A 3ORNA 3VS1A 5A4EA 1JWHA 5EHLA 3AD5A 4N4SA 1OL5A 5HCZA 4CZUA 3S1HA 2PVHA 4FTTA 3KQ7A 4LUDA 2OIBA 2YJSA 4BF2A 4G2FA 5AP1A 1V0BA 2BFXA 3WF7A 4OT5A 5E92A 4RWLA 2C6MA 4FGBA 4YJTA 3UO4A 3QALE 5HU3A 3E8CA 4IZ5A 3SG8A 1H27A 1Z5MA 3NWWA 2C5OA 3H4JA 3ZLSA 4II5A 4JX7A 4ZS4A 1G5SA 3COMA 2ACXA 4ZMEA 5C9CA 4YPSA 4DLIA 3FEGA 3ZRMA 4LV8A 4K0YA 4OW8A 4OAVB 4PNKA 1QPJA 2OIDA 4A06A 4M15A 3NNWA 4O0TA 3VWAA 3FBVA 3QHRA 4QMOA 2ZM3A 5CT0A 4EEVA 1Q8TA 5K5NA 3JPVA 2QODA 2W0JA 2OU7A 3I5ZA 4MXXA 2DUVA 3FLWA 5AP0A 5JRSA 4GK2A 4HJOA 3IONA 3QTXA 4J99A 4ACCA 2IJMA 4FKRA 2YIXA 3G90X 2G2HA 2XIRA 5FXQA 3GFWA 5L2QA 4F70A 3DA6A 3AC3A 2OJFE 2R3QA 5M56A 2BHEA 5D1JA 5AV3A 5AUTA 1LP4A 3R7YA 3TZ9A 3DKFA 5GINE 3NZ0A 3PJ1A 5IQBA 3DXQA 2X2KA 2C3LA 3R01A 4BKJA 5CNOA 3ORLA 4W9XA 3UYTA 3QYWA 3QTUA 1A48A 3JY0A 2J5FA 1MRUA 3VS6A 1KV1A 2BRBA 2GNHA 1WMKA 4J53A 2P2IA 3FLZA 3AG9A 3PZHA 1YOMA 3PY3A 4MK0A 4C4HA 5JFXA 1M2RA 2W06A 4DFLA 2ZM4A 1Z9XA 3ZYAA 4DAWA 4DH3A 5IMXA 3MV5A 2X8DA 4UZHA 2OF4A 3CPCA 4R5SA 3QQKA 3F2RA 5E8TA 4F9WA 2G15A 4FX3A 4YP8A 5ACKA 5J1VA 4IAAA 4AGDA 4C33A 4FT3A 4G6LA 4B99A 4XP0A 2ITVA 3FJQE 5HLNA 5A46A 4DEBA 5JQ5A 2R3KA 4F6UA 5DLSA 3VHKA 2XK7A 2ITQA 3PRIA 3SDJA 5AP2A 4CGAA 4JDJA 3LXNA 4E4NA 5KKRC 4R3CA 5H2UA 5CU6A 3QGWA 4ORKA 2YIQA 3AQVA 3M2WA 3NAXA 3UIXA 4AF3A 1I44A 3O8TA 5HIEA 2Z02A 4Y72A 3PE1A 3KXMA 4RJ8A 3RP9A 3DT1A 3G9NA 3ZOSA 4G3FA 5HTIA 3IPHA 4S32A 3V5LA 4G9RA 3QRTA 4GIIA 4YTHA 1PXMA 3CJFA 3FMNA 4IFGA 2OFUA 1ZMVA 3F7WA 2QNJA 5HVJA 2PVFA 3EHAA 4RX7A 3EFJA 4ZSEA 4YLJA 4FSTA 1OVEA 4DA5A 1IA8A 3D7TB 4HNIA 4A9TA 2WQBA 3CTHA 2VGPA 4NFMA 3G33A 2WU6A 1Q24A 3HV4A 4NKSA 3QZGA 1YI4A 4RWJA 4EZ5A 1XBBA 4K11A 4F7LA 4TRLA 1OBDA 3VRZA 4LGGA 3LQ5A 2ZV7A 4I41A 1JAMA 1XH9A 2KULA 4W4XA 4ANSA 4I4FA 5DT4A 2J6MA 3QTWA 3KU2A 2WU7A 4XV9A 4U6RA 5CXZA 4PUZA 5KO1A 2QG5A 3FLSA 3RCJA 3AC5A 4J95A 5AM7A 5HOAA 3DBCA 4MYGA 4BCOA 1GOLA 5I9VA 2ZVAA 3ETAA 4O82A 2WMTA 3EN7A 5E8YA 5HG8A 3BQCA 1KUTA 2GNLA 5AR3A 4U3YA 3VS2A 1JLUE 1Q3WA 3MFTA 1PXOA 3QFVA 4YMJA 3WZEA 4ZTHA 3PP1A 4QPAA 2F9GA 4D4YA 3TUCA 4HGSA 1RE8A 2HZIA 4M8TA 5J95A 2PE1A 4IB3A 3R04A 3TNHA 4CFWA 4BTKA 1PXKA 4RQKA 3PJ8A 3UNJA 3T8OA 3ZO3A 5AEPA 2VX0A 2C5XA 3CY2A 3PLSA 1R78A 3PJ2A 4RFZA 2RFSA 5FEEA 2XKFA 3V6SA 3QKLA 5DE2A 4CQEA 3LM5A 4FV6A 5DR6A 2ITNA 5EK7A 4AACA 2C6LA 3AT2A 3MVLA 3HYHA 3EN9A 4G6NA 2I1MA 4GJ2A 4O22A 4FF8A 3ORKA 4IVAA 4OTIA 3FMHA 2O8YA 2R3JA 4QQJA 5CVHA 4NKAA 5F1ZA 2PUIA 2VTHA 1J1CA 5CEOA 1U5QA 4CLIA 3OHTA 5CAVA 2UZOA 4FTJA 3UVPA 3LFNA 4AGUA 4HVSA 5EG3A 4QRCA 5JSMA 2XK4A 5CZIA 5I4NA 5JRQA 3RJCA 3U55A 3SW7A 3C51A 3EQHA 1DI8A 3V01A 3HDMA 3K3JA 3LXKA 4FV4A 5KMKA 3TDWA 2I0HA 5L6PA 2VO7A 5K3YA 2VWVA 3ROCA 4YTFA 2WTKC 2A2AA 1OBGA 4WUNA 2GS7A 2XK9A 3LJ0A 5AP7A 2UVXA 5L3AA 5JH6A 4RX8A 4BDEA 3TN8A 3UODA 4X2KA 5AWMA 3RK5A 1OZ1A 4E6DA 3OT3A 5EI2A 4OTFA 3KMWA 1L3RE 3ENMA 4XH6A 3NS9A 1YOLA 3R8ZA 2QOCA 4J97A 4NT4A 5IKWA 2PVYA 5BX0A 5FM2A 2BMCA 4XJ0A 3QQGA 3NSZA 4DC2A 1REKA 3BEAA 3OUNB 4EUUA 4U3ZA 2ZJWA 4FK3A 4U5JA 2O65A 4RBLA 3W10A 5GJGA 5DRBA 5FG8A 1AD5A 2WIPA 3W1FA 4BBFA 2ITOA 4XV3A 3T3VA 4L53A 4QMUA 1P5EA 3VQHA 2QU5A 4Q5HA 3RVGA 3SG9A 1JKKA 4NM7A 4EH7A 3D5VA 1FGIA 5ANJA 4NJDA 2PYWA 3R9NA 4MF1A 2Y4IC 2RSVA 4YJNA 1A9UA 4OTQA 3TG1A 5TO8A 5LVPA 4MXCA 3E92A 4JQ7A 3D94A 2VV9A 3F3ZA 5IZFA 1PMVA 4UY9A 5L2TA 1WCCA 1PYEA 3I5NA 4ZZOA 1ND4A 3MTLA 2DS1A 4W8EA 4QMPA 3IDBA 3R6XA 4RVKA 3EFWA 4IZAA 2P3GX 4XHKB 4E5BA 3MPAA 4ZIMA 1GZNA 4F9CA 3UZPA 4RX9A 4U97A 3E7OA 2F2CB 4EWQA 3H0ZA 4BDDA 1B38A 4F9YA 3PRFA 4O0XA 4MF0A 4Q9ZA 4CTBA 5FGKA 4RGJA 2XP2A 4O7ZA 4IAZA 4C3FA 3ZFXA 3DJ7A 3IW6A 5CY3A 5M4CA 1CKPA 3RM6A 4BCGA 3W33A 2HENA 2XNOA 1UWHA 3Q9XA 3IK3A 4HGEA 4YJRA 2GQRA 3JXWA 3O7LD 3R22A 2ONLC 3MVJA 2QOHA 4XV2A 4I5PA 5HNGA 4GL9A 3TNIA 1Q61A 2EUFB 3E88A 2XZSA 2XM8A 5GHVA 5KMIA 3FZ1A 3BHHA 3DNEA 1Y57A 4Q2AA 5HTBA 2AC5A 1PF8A 3LMGA 3LOKA 4NW6A 4KD1A 2R3MA 1H08A 5EFQA 3TIZA 2X6EA 4YHTA 3DNDA 4ANNA 2BILB 2X1NA 4EHZA 3DV3A 1GZKA 4QMQA 2BR1A 3VUHA 3KA0A 1O6YA 4G6OA 4BBMA 5CAUA 5I3RA 1JBPE 3QZFA 4FGRA 3U6HA 5EKOA 5HCYA 2X6DA 4HVGA 3DLSA 3LJ2A 5FD2A 2IWIA 2YLFA 5CTPA 4CNHA 4IM3A 3IECA 4DFYA 4R1YA 1Y91A 2VO3A 2XNEA 3BEGA 1DS5A 2JDVA 4FTOA 3ZDUA 1BYGA 3EH9A 4CZTA 4QMNA 3EL7A 2WXVA 4JRNA 3ZDIA 5EYKA 3GI3A 5I9WA 3W2OA 2VTJA 4QTAA 3H9RA 3CEKA 3OWLA 3R2YA 4LG4A 3R7UA 4FEXA 3R83A 3EOCA 4FV5A 5M07A 3NVKI 3G5DA 4CYJA 5G6VA 2F4JA 3R9OA 4EOQA 4IX5A 4M69B 5EQPA 3KN6A 2ZV8A 1Y8YA 3FZPA 4O1PA 4WRSA 5D11A 4BL1A 4CCBA 4NL0A 3H3CA 4O7SA 5CI6A 4WBOA 2C6EA 2WQEA 3PZEA 4M84A 5ETFA 4L00A 4XEYA 2CN5A 5HO6A 3F5XA 2UW8A 4TPTA 1ZOEA 3CR0A 4WT6A 5BMSA 3CLYA 3F9NA 5D7VA 2LGCA 2RFEA 3QHWA 4PMTA 3F5UA 4WHZA 3QC9A 4D9TA 2YZLA 1R3CA 3FLQA 2IVUA 2NO3A 4NH1A 2YAKA 5C1QB 4JLCA 2C6IA 5K5XA 5M08A 2WTCA 3W2PA 2CGWA 4ANOA 2PTKA 1QMZA 3KMMA 4E6CA 2JBOA 2J0LA 3BQRA 5IDPA 3LPBA 5D9HA 2VRXA 2W9ZB 4RIXB 5AIRA 4FEWA 1PKGA 2ERZE 4GYGA 4OTDA 1KE8A 5LVLA 3RPVA 2GTMA 3TTIA 4ARKA 4AUAA 3GCPA 1Q99A 4NEUA 4PP7A 4BB4A 3CP9A 4M97A 5B2MA 5IISA 4IDVA 4V05A 3NNXA 1XQZA 2VAGA 5CU4A 4A7CA 3U87A 4C3PA 4RA5A 4X2JA 4ZTMA 5LOHA 2YWPA 5IQIA 3DJ5A 3R9RA 3Q4UA 2YLEA 4D0WA 2YAAA 3BIZA 3ZSGA 1VEBA 5FLFA 4C62A 4WRGA 4IE9A 1BI7A 2BAJA 4D1ZA 4YBJA 4PY1A 3MH3A 5A9UA 2Y6MA 4P2KA 2ERKA 3FPQA 2ITXA 3PY0A 3C5UA 2A1AB 4PL4A 5AX3A 4C34A 2XYNA 4GMYA 4I6FA 4EH2A 3MIYA 4O91A 3MPTA 4DYMA 3S0OA 1YWVA 3AGMA 4FIGA 5CLPA 1YWRA 2BCJA 3TZMA 3TUBA 3PA5A 3C4CA 2R3GA 1S9JA 3KY2A 3RKBA 3WI6A 4NWMA 3NYXA 1GIHA 4MKCA 5H8EA 4EOIA 5JGDA 1ZXEA 4RMZA 4WIHA 4NM5A 2OF2A 4XP3A 2C1AA 4BC6A 2CGVA 4YJSA 3C4WA 5FXRA 5D10A 5CEPA 1J1BA 1CDKA 3MH1A 2V5QA 3E8EA 3CCNA 1PJKA 3NYNA 4I23A 4K6ZA 4EK5A 4IDTA 3BHYA 3FL5A 3AMBA 3FSKA 5KMOA 4R1VA 2BPMA 3CIKA 4BCPA 4O84A 4GFMA 4D2RA 3LIJA 1BL7A 4MQ2A 4ZJIA 5FM3A 3Q2MA 4KS7A 1WVXA 2GHMA 5ANGA 2OH0E 4CFMA 4EKKA 4EI4A 2BKKA 1SVHA 3GNIB 4MD8E 2PE2A 2NRUA 4M0YA 4EOPA 3EL8A 2VD5A 3BELA 2YIYA 3NCZA 3QBNA 2ITTA 4GK4A 4HVIA 4IQ6A 3VJOA 3W8LA 4I1ZA 4JXFA 4QYEA 2XJ1A 4TYHA 3V5PA 4PTCA 3H9OA 1GIIA 2OXDA 3QD4A 5CT7A 4AOTA 3OCTA 4TL0A 2ITPA 2OK1A 4Y5HA 5HZNA 5EYCA 4ZSAA 5AUZA 3ITZA 5HGIA 4PDYA 4YZCA 1HCLA 4FTCA 3ELJA 4NM0A 5CSPA 2UV2A 2WZJA 4BCHA 3R8VA 4CG9A 5KMJA 4QTCA 5M53A 1H01A 2RG6A 3HEGA 4RJ3A 3QQUA 4EK3A 1H26A 1ZYCA 4EH8A 5AA8A 5IQDA 3NMUF 4LM5A 3QAME 2V55A 4FTKA 3QCSA 4GT3A 3ULZA 1T45A 4JG7A 4I0TA 5HE1A 2JEDA 4QQTA 3ORTA 3OCSA 4BFMA 1VZOA 5GJFA 3R1NA 2XS0A 1XH6A 2GCDA 4MX9A 4HGLA 3VBYA 2GU8A 4BIEA 3R9HA 5CQWA 4O38A 5HE2A 2VU3A 4YU2A 2IVVA 4M0ZA 5LVOA 2QC6A 4ONAA 3I79A 1WBOA 3PVWA 5TT7A 3B2WA 2J0IA 4M7IA 1YKRA 2F7ZE 2PVNA 4FKPA 5HI2A 4L3LA 3V8WA 2WHBA 4X3JA 2VNYA 5C27A 4D1XA 5L2WA 3LJ1A 3N4TA 4AA0A 2YM3A 2WQMA 4MBLA 4QD6A 4I94A 2W5HA 1Q62A 3CKXA 3HV7A 3T3UA 3FL4A 4FNWA 4WNMA 2ZMDA 2UZDA 5TE0A 4OR5A 2BIKB 4DFNA 3L9LA 1NT2A 4BKYA 1W7HA 1J7IA 4K2RA 1UKHA 3VUTA 1H8FA 4C59A 3DB6A 4DINA 4JDHA 3QU0A 4FKIA 4BYJA 4E3CA 4GG5A 4N70A 3S4QA 4Z16A 4L67A 1QCFA 2XRWA 3B8QA 3EB0A 3QF9A 4XP2A 5FEDA 2Z8CA 4CKRA 4F99A 1WFCA 4RLLA 2QR7A 4B4LA 5K9IA 4IADA 3NUNA 1WAKA 3A4PA 3LQ8A 1UV5A 4FUXA 3RPRA 3NVMB 2W1IA 5I9UA 2FSTX 3FY0A 5I0BA 3D83A 1YHVA 2XM9A 1LEZA 4KABA 2PZ5A 5HQ0A 5CU3A 4D2WA 2WGJA 4JAJA 5CSVA 4GT4A 4L7FA 4JIKA 3VF9A 5DPVA 5HKMA 4D4SA 3TUDA 3PXFA 2BZHB 3MWUA 3HA8A 1JSTA 3H0YA 2XNPA 2B9FA 2CHLA 5E1EA 1YDTE 4MTAA 2OW3A 4IZ7A 4KIKA 3MJ1A 3AT4A 3QQFA 3C0HA 3PXQA 5DWRA 4EONA 5I9ZA 2PUPA 4AN2A 2WOUA 4NIFB 4GVJA 1YHWA 1ZARA 3LE6A 2A4LA 2CCIA 3RNYA 3U4WA 3WYXA 1H0WA 3U4UA 3WYYA 5BVNA 2QKRA 2WMXA 3IW7A 2LAVA 1OPKA 4QMMA 4UZDA 3RNIA 4AN3A 5BVOA 1M7QA 3G0FA 2G2IA 3OEZA 2QKWB 4PL3A 4M68A 2C5VA 3RI1A 4NTTA 4QQCA 5HD4A 5K4IA 3LHJA 2VO0A 4CRLA 3PYYA 3F7ZA 2WTKB 3LFAA 5L8KA 4GV1A 1OPJA 5E8VA 3OFMA 5HHWA 4FV1A 4TKSA 1DAYA 3S3IA 3CKWA 1IAHA 4FTRA 4BDJA 2PK9A 3P79A 4YC3A 1NXKA 3QD2B 4EOMA 3PTGA 1P14A 1MQ4A 2XJ2A 3NYOA 5EM8A 3ZLWA 5JT2A 3ORZA 4MXZA 2VWXA 4LOQA 1XH4A 4XS2A 3OTVA 3TACA 4FA2A 3L1SA 4U80A 3TDVA 5AP3A 2QONA 4BR3A 3RHXA 3HDNA 4LQMA 4F0FA 4USFA 4OLIA 5I9YA 4EH6A 1V0OA 5AR4A 2WTWA 3W18A 4KIOA 3ZSIA 3NAYA 4BDFA 5EM6A 4D5KA 2PPQA 1RQQA 3HV6A 3TKIA 2JDTA 1BX6A 5DRDA 2ZYBA 4FODA 3SD0A 4AT3A 4IW0A 3UJGA 1Q8ZA 2Y4IB 2B9JA 4FKSA 4G9CA 3DAJA 3GBZA 3SXFA 2V7OA 2WELA 1UU8A 4DCAA 2ZV2A 3OT8A 4X3FB 1H00A 3KRRA 5E91A 4C7TA 1H1QA 2C6KA 3R2BA 5FEQA 2XIXA 2X8IA 1ZOGA 2XF0A 5KZIA 3WOWA 2OLCA 3TKUA 2WMQA 2Y0AA 5EI8A 4QMZA 2HWOA 3NUYA 4WUAA 4X0MA 2QCSA 1XBCA 3T9TA 1IAJA 4JR7A 3Q5ZA 2X8EA 4R7HA 3MA6A 3OCBA 5LCJA 4IMYA 2F7EE 2BTSA 4TYGA 4R5YA 5EOBA 5E7RA 2OWBA 1CTPE 4CT2A 4WG4A 2X7FA 1MQBA 2ZOQA 2JC6A 5DIAA 4BI2A 3GU8A 3SC1A 3E7VA 3UTOA 4Z55A 1QPDA 3QTZA 5M4FA 3VW6A 2HK5A 5CF6A 2PL0A 4Z3VA 4RIWA 4QTBA 4BHNA 5I9XA 5H3QA 4IHPA 4WO5A 2GNIA 2XKDA 4OAUC 3CXWA 2P2HA 1HOWA 2RFDA 1GIJA 3SXSA 3TM0A 2WAJA 2F57A 4IWOA 4G3CA 4XRJA 3W2CA 3UMXA 4KKEA 4E8AA 4AZVA 4IVBA 1JKSA 2FYSA 4QYGA 2XK6A 5DT0A 3ZLYA 1BKXA 3E62A 1RDQE 4UV0A 4AE9A 4DHFA 4FKLA 4P4CA 4X6RA 2OXYA 4KNBA 4QNYA 3B8RA 4GCJA 3UZTA 4EH9A 4M14A 3MDYA 2CLXA 3A7JA 3GOKA 3FAAA 3WBLA 4CTCA 5CF8A 3DLZA 1W8CA 4JNWA 3QQHA 2OICA 3LFFA 4DEDA 2FO0A 3LFCA 1MRVA 4FUYA 4QMLA 1OPLA 4TXCA 4QYFA 4DLJA 5HNIX 4KSQA 4RQVA 3BCEA 3WIKA 4XOZA 4P5ZA 1O6KA 3OMVA 5JGAA 5HBEA 4XG4A 5J79A 1H25A 1GJOA 2WTDA 4QP8A 1OB3A 1XHAA 2YM6A 3COHA 3LLAA 2QOLA 4PQNA 3FXZA 4CMTA 4EQUA 4YTCA 1ZOHA 3EN5A 3R28A 4C0TA 5LMKC 3FZRA 3VBWA 5C4KA 4FKQA 3DQXA 4YHJA 2YM7A 1GZOA 4EOOA 4FKWA 4AW2A 4AZFA 1NVRA 4J7BA 4RIYA 4TNBA 1NY3A 4B7TA 4LL0A 3TZ8A 3A8WA 5HE3A 4DN5A 1PXJA 1JKTA 1A06A 2C6TA 2C5YA 5AUYA 5IQFA 4O27B 5ITAA 3DBFA 2FVDA 4S30A 2GS2A 3DK7A 4O7YA 4B6LA 3QRKA 1ZWSA 3EQGA 3IDCA 4NW5A 1YDSE 4C4FA 2B9IA 3BLHA 4UYNA 4WG3A 4BZDA 4QP9A 5J5TA 2A27A 2PZPA 5M51A 2W9FB 4FTLA 4FOBA 2UZNA 3HUBA 2R7IA 1NVSA 3MY0A 2B52A 3A60A 5HD7A 5HBHA 3UC4A 2XK8A 3SV0A 2R3IA 4D4VA 1K9AA 4IM0A 4TYJA 2HZNA 3WILA 4CRSA 4E4XA 1W82A 4KS8A 3QKKA 4RVMA 1ZZ2A 4CFVA 5AFVA 4KINA 1OL7A 1VYZA 3EFLA 4CKJA 2QI8A 3P7BA 3FI3A 3C50A 4PDOA 2F49A 4CCUA 4JIAA 3SW4A 4AXAA 3BU5A 3F61A 2V0DA 2VWYA 3NNUA 4HCUA 4Y8DA 4B8LA 5M4UA 3QCYA 3DK6A 4ZTRA 4C38A 3PUPA 1J7UA 4E6AA 5IMEA 4AS0A 5L6OA 4JL9A 4ZLZA 2Z7LA 2WQOA 4XV1A 5C26A 2UZLA 1KE7A 3MGYA 4CD0A 3PIZA 2W5AA 4GRBA 3FC1X 2C0IA 4XLIA 4A4OA 4C57A 3EMGA 4I0RA 5FP6A 1SNUA 4H36A 4JQEA 3FYKX 4MWHA 4EC8A 2Q83A 2E2BA 4WSYA 4F64A 4UN0C 4PMMA 3VS0A 1S9IA 3AC8A 1G3NA 3KB7A 4I22A 4DEHA 1H1RA 4Y95A 5FDXA 5C4LA 2DYLA 2GPHA 3TZ7A 2Y4PA 1IA9A 2X7GA 4NZWB 2BZJA 4YC8A 4KKGA 2FH9A 4WD5A 2YZAA 4LMNA 4U7ZA 2UW6A 4XBRA 3MESA 2JFLA 1QL6A 4I93A 3Q4TA 3A62A 3NUUA 2R3HA 4DFXE 4FE2A 3WIGA 2O63A 3LFEA 3UPXA 4EQCA 3LXLA 5CZHA 3VBXA 3L9MA 1APME 4PTGA 4MNEA 4XCUA 3OOGA 4FV9A 4ITHA 2VX1A 1G8SA 3IGGA 3ZXZA 1TQPA 4AZTA 3EZVA 4QP3A 3VUKA 5IH6A 2OH4A 4IJ9A 4RSSA 1OIYA 4G3GA 4QP7A 2CKEA 2BKZA 2PMIA 4XX9A 3SHEA 2YCFA 2CMWA 5C8NA 3UOLA 1YXVA 4EHVA 2CLQA 3KF7A 3FMJA 4I5CA 4OUCA 4A9RA 4DFUA 5CAPA 4L8MA 3FV8A 2H34A 4U8ZA 4QPMA 4CZYB 5B2KA 3BX5A 4XLVA 3VS3A 3BV3A 5IQCA 5IEVA 2R3OA 3DY7A 2ZV9A 3IKAA 4FKVA 3FZTA 3ZUUA 4F65A 2GQSA 3E87A 5E1SA 3NEWA 2YISA 2HWPA 4WNKA 1FINA 2J51A 4I92A 1HCKA 3EJ1A 5AUXA 1WBWA 4J71A 3I0QA 2BAQA 3FMKA 5CAQA 4F09A 4AAAA 2CNQA 1XH5A 2EWAA 2VTLA 4H1MA 4IX6A 1YWNA 4F63A 2BAKA 3KL8A 3N9XA 3KXXA 4C4EA 1YXUA 4IX4A 3RAWA 3OC1A 5JEBA 1Q41A 3RPSA 5CSXA 4FSQA 4HVHA 2Q0BA 3RGFA 4R7IA 1DAWA 3VBTA 2NNWB 1OIRA 2PU8A 1JKLA 3SX9A 4R7BA 4G31A 3O17A 5J8IA 2VWWA 3H10A 3D5UA 4M13A 3MIAA 5HORA 1KOAA 1ZAOA 4UMQA 5E8UA 2FSOX 3OXZA 2I6LA 2A0CX 2Z2WA 2BHHA 5CAOA 3P86A 4CVAA 3ZZWA 3MW1A 5IPJA 5L8LA 4BCKA 4FG8A 5T3QA 1U46A 2XIKA 4RJ4A 1H0VA 4O7VA 4F6SA 3DTWA 4Y73A 2J4ZA 3GOPA 3M1SA 2BRGA 4XNEA 2P0CA 4O0WA 5AP5A 3Q04A 1Q97A 4RA4A 1PXNA 3HP5A 3OY1A 2AUHA 3EQBA 2XJ0A 3Q60A 3Q3BA 4R3PA 4W4YA 4BCJA 3SOAA 4EH5A 4DH1A 2YWVA 4U79A 2EB3A 4ASEA 3KULA 4EBWA 4H3QA 2BRNA 4ZSJA 5IA5A 2W4JA 4ALVA 1UNLA 2PE0A 3FE3A 2R4BA 1H1SA 4UXLA 4E1ZA 4BY9E 2H96A 5BVEA 3MH2A 5GJDA 3OY3A 4JS8A 4D5HA 3TXOA 4B8MA 5B2LA 3OZ6A 3CGOA 2QO7A 1Y6AA 4TN6A 4YNEA 1RW8A 5JZNA 4OTPA 1KE6A 3KN5A 4FL2A 3MPMA 3ACJA 2FSLX 2WTJA 2QOBA 4HZRA 1UNGA 5EKNA 3BYVA 3GU4A 2GHLA 3M11A 5C8KA 3V5WA 3IW4A 4TWNA 5LMKA 2W5BA 2IN6A 5LCKA 3RZBA 4FSRA 3PLAE 3HECA 4UWBA 3SRVA 3GGFA 5CANA 5DNRA 5HLWA 3NIZA 3O96A 5HX6A 4FEVA 5A4LA 4W9WA 3QTIA 1Q8WA 3GP0A 2PVKA 3SXRA 2C3JA 3I0OA 4CFUA 2WOTA 3FZSA 3LFQA 3PJ3A 3QQLA 2RL5A 3GT8A 4HYUA 2CPKE 4WOVA 4E6QA 5IF1A 2WTVA 3Q2JA 4MQ1A 4YZ9A 3D5XA 3LZBA 4MNEB 3A7HA 3K2LA 3F2AA 1Q5KA 2EXCX 2JKKA 3RK7A 4O0RA 3WARA 1BLXA 4ASDA 4BYIA 3RPOA 3MI9A 1M17A 3QYZA 1K2PA 3RALA 4IJPA 3GENA 3PSDA 5CU0A 4EJNA 4NU1A 3CJGA 3WZJA 2XBJA 5KMNA 2WD1A 4C4GA 2V7AA 5FTGA 4HCVA 4FIJA 4K9YA 3E93A 3K54A 3QX2A 5G1XA 5CVFA 3OVVA 2IPXA 3QC4A 4BBEA 1WZYA 3G6GA 2CSNA 2ITYA 4WA9A 5L2SA 4OBQA 1ZYDA 2FUMA 1OUYA 3HRBA 3LCSA 4FKGA 4CT1A 4DF3A 2R3LA 2C69A 3G15A 4H05A 3QXPA 3E8NA 2E9NA 1FPUA 3VULA 1R0PA 5IH5A 1PKDA 4DTAA 2J9MA 2C47A 1Q8YA 2WMUA 2P33A 4RFYA 5HICA 3TL8A 1ERKA 3NW7A 5GZAA 2W96B 4UMUA 4D2VA 1UNHA 2GNJA 2CDZA 3CQUA 3EFKA 1Z57A 4U44A 2JKQA 4UEUA 3ZFMA 4B0GA 1Y8GA 4RIOA 1OKYA 3U51A 3BKBA 1UA2A 3EYGA 4D4RA 4BCIA 3BYUA 3U8WA 5DEYA 3BE2A 2VGOA 5BYLA 3R7EA 1FVVA 2IZTA 3KRWA 3BPRA 4I6HA 4RJ6A 4ACHA 4YO4A 2BUJA 1Q4LA 3KRJA 2PZIA 4C4JA 3W2RA 2HY0A 1OITA 4E7WA 3O0GA 2XKCA 5ETIA 5B0XA 3LCDA 4Q5EA 3W2SA 5KBRA 2CN8A 3UC3A 3R1QA 2VWBA 3RMFA 4Z7GA 5J7BA 4O0VA 2E9OA 4BCNA 4F7JA 2CNVA 4FL1A 3VF8A 4DEGA 4EH4A 5K4JA 2PULA 4O7NA 3DB8A 3OP5A 5IG1A 4FBXA 5LVMA 2ITZA 1URCA 4PF4A 4AT4A 3FQSA 5EHOA 3WF9A 4AW5A 1F5QA 4BDBA 3F5GA 4BRXA 3NGAA 4YJPA 4IVCA 5HVYA 2FA2A 5KHXA 4L52A 1DI9A 4XBUA 4BKZA 4EORA 2CNUA 4MVFA 3OXTA 3UQGA 4A9YA 3O71A 3KULB 1Q8UA 4JG8A 4ALUA 4FYNA 3ZEWA 2JFMA 4FTUA 4FIEA 4NSTA 4PPBA 4WBBB 2RG5A 2OGVA 2HZ4A 4G5JA 2QOIA 1H1WA 2C68A 4RJ5A 5HEZA 3BWFA 4RX5A 4UYAA 4N57A 4BIBA 2YFXA 4AQCA 2WQNA 3MFUA 5F4NA 2HZ0A 2VO6A 3ROYA 2YHVA 2VNWA 4FSWA 2VN9A 3NX8A 3OWKA 3F3UA 2QOOA 4JVGA 4K8AA 3ENHA 4DH5A 2EU9A 4DGMA 2QO9A 4O21A 4CEGA 4CXAA 3O23A 4B9DA 2JKMA 2Z7QA 4IAIA 3P78A 4D2TA 4EOSA 4F7SA 3VQUA 4KIQA 2CGUA 5HIDA 3E8DA 3HRFA 4XRLA 4FIHA 1ZYSA 2XCHA 3GCQA 4UB7A 3I81A 5AP6A 4DGGA 5M44A 5DI1A 3KRLA 3Q96A 4L68A 4O83A 5FUTA 3SRVB 2YN8A 4KBAA 2W1DA 2BDWA 2I0VA 3R1SA 3VUGA 2GS6A 1VYWA 3BHVA 2PY3A 3QLFA 4LGDA 4ZOGA 4V0GA 3CTQA 5EW3A 5FDPA 3D4QA 1M52A 4G1WA 5DFPA 3OG7A 3A4OX 2NRYA 3ZUTA 3VW8A 3DJ6A 4I21A 4FIIA 2CKQA 5M09A 3C1XA 4YNOA 3KF4A 4EOLA 5FTOA 5FRIA 3N51A 4QMXA 3TNQB 3OROA 2W4KA 3L9NA 3ZCLA 4FG9A 3ZS5A 2B4SB 3VS4A 2UZUE 4LRMA 3C4XA 4ZJJA 5CENA 2PSQA 3U6IA 1BMKA 3FQHA 4M67A 3PJCA 4NYEA 5IEYA 4RLKA 3EN6A 3WF5A 4ZTQA 3FMLA 3HP2A 5ETCA 3JVRA 3TTJA 4FK6A 4EK6A 2QD9A 3IOKA 5EM5A 1SVEA 1REJA 2WIHA 5DG5A 3A61A 3N4VA 3KRXA 2BFYA 4O6LA 4JDIA 4AE6A 3P08A 4YZDA 2C1BA 5KKRB 2YIRA 3F88A 4LL5A 4ASXA 2E9VA 3E63A 3O51A 4C3RA 1M2QA 3TV6A 5IDNA 4RJ7A 4DE4A 4S2ZA 5J9YA 3QQJA 3L8XA 4JR3A 3RAKA 2O3PA 5A4TA 5AR5A 4ZZNA 5DVRA 4I5MA 4TWPA 4EJ7A 2GSFA 2R64A 1W0XC 5EYMA 1CMKE 3MA3A 5A3XA 1U54A 4YUQA 5BUEA 4WG5A 4UALA 4DG0E 5IEXA 4RC4A 3UGCA 5J9LA 2O64A 2B55A 4YURA 2ZB0A 5KE0A 4O7WA 2ITUA 3CBLA 4LGHA 3PP0A 4ERKA 4NCTC 4YLLA 3UO5A 3UOHA 5A14A 3VUDA 3KXNA 1H24A 2UW5A 2W1GA 2I0EA 4BTJA 5GNKA 5IA0A 2O2UA 4RZWA 3JVSA 2DWBA 3BGZA 1XR1A 2C6OA 1PXPA 3G2FA 4LFIA 3FUPA 3VUIA 5DEWA 4F1TA 3VC4A 2P4IA 2UVYA 1JQHA 1PYXA 1J3HA 2EXEA 2ONLA 4MD9E 5JFVA 4UBAA 3E3PA 5F95A 3NUXA 5AM6A 1PMNA 1YOJA 4QMSA 1XH7A 3NIEA 2X39A 1O9UA 3FY2A 2QHNA 4YHFA 1JNKA 5ANOA 2ESMA 2WEIA 3KCFA 4QMYA 3VNTA 3V04A 4D55A 4UX9A 3HRCA 4IAFA 3TNWA 3WZUA 3ZO2A 3DZQA 5J7HA 2BTRA 3QCXA 5CALA 4JBOA 3JUHA 1V1KA 3R0TA 2ZMCA 3HMMA 3ZTXA 4AT5A 3QXOA 3RAIA 3A7IA 2PMOX 4BTMA 3AD6A 3V3VA 5KNJA 1UU3A 3I6WA 4PL5A 4D28A 4JBQA 2VZ6A 3C4EA 3II5A 3P7CA 3IDPA 2QLQA 4O6EA 2OO8X 4DFZE 4BCFA 2PUUA 4PP9A 2OI4X 3GC0A 3NUPA 5EQYA 3VS5A 4D1SA 3V5QA 2RFNA 5DHJA 4GEOA 2IW8A 1TKIA 4E26A 2DQ7X 5A54A 2WTIA 3I6UA 2B54A 2OSCA 5DR9A 3FLNC 4I24A 3V5TA 2VWUA 4QTEA 2QQ7A 5KZ0A 3V6RA 4IAKA 3TI1A 2HXQA 3DZOA 3SKCA 5BUJA 3N4UA 4W4VA 5JGBA 2HW6A 2JBPA 1EH4A 5E9EA 4Z7HA 3MN3A 1OL2A 1NW1A 4FKOA 4S34A 4O81A 4FR4A 4EOJA 4LYNA 3QTSA 3VAPA 3RWPA 4BDAA 4ZTSA 3SLSA 4P7EA 3FZOA 4BTFA 1IRKA 3D0EA 4USEA 2PMLX 3GXLA 5AR8A 5GZ9A 2JITA 3R30A 4GYIA 3MY5A 3FI2A 2VTIA 5A6OA 3KXZA 4GH2A 5LMBA 4D0XA 2YM4A 2R3FA 4GT5A 3MBLA 4GS6A 4BZNA 1OI9A 2UZTA 4AGCA 3PDTA 1IEPA 2JIIA 4AA5A 4A9UA 4TYHB 3MFRA 4CMOA 3KREA 2C3IB 2X7OA 4FL3A 3ODYX 2J0JA 3LMHA 2OJ9A 4EYJA 3RZFA 3R1YA 2BALA 4YLKA 3GC9A 4ZS0A 4JAIA 4QO9A 4CFNA 3CQEA 5M06A 4DG3E 3LCOA 4FZ7A 1E9HA 3HMNA 3D7ZA 3DKOA 3H9FA 3KK8A 3IW8A 5LVNA 4ZEGA 5CEKA 4R78A 2J5EA 3ACKA 2C3KA 5CI7A 3HNGA 4ZTNA 3K5UA 2HAKA 3HKOA 4D9UA 4MNFA 4FVRA 4M66A 5EHYA 5JN2A 1R1WA 2W05A 3PSCA 5DGZA 4YSJA 3L8VA 2QO2A 5JFWA 4ZY6A 4AWIA 1SMHA 5BQ0A 4AA4A 3D14A 3R21A 5AV0A 4DEIA 5EOLA 5TR6A 4MBIA 4ZY5A 1AGWA 2E9UA 2IW6A 3NW6A 3ORMA 4I6QA 4MD7E 4C4IA 1U54B 5A4QA 4TYEA 4O86A 4PRJA 4JX3A 2JAMA 3IS5A 2YDJA 4FICA 5T68A 3HMPA 3ZM9A 4ACGA 4ZJVA 3VO3A 3FKNA 3A99A 4BGQA 3BV2A 2XNMA 3PXKA 3V8SA 3ULIA 2VTPA 3MTFA 5J5SA 1J7LA 5TF9A 4CFFA 4G16A 4HYHA 2WO6A 3I7BA 3NLBA 4DH8A 5AAEA 3HA6A 2CKPA 3UNKA 4C35A 3V5JA 3CPBA 4NM3A 5ACBC 3BU3A 5AR7A 4BICA 3OBGA 3ZRKA 4FSUA 1OUKA 1QPEA 5FWKK 3AMAA 3UOKA 4HVDA 4IH8A 2V62A 1SYKA 3D7TA 3GEQA 3LAUA 4OTHA 3DKGA 5HCXA 4FV3A 2XEZA 4GJ3A 4H58A 4CKIA 3C4ZA 5BVFA 5CSHA 5AUVA 5KHWA 3QUPA 5F20A 4AGWA 3O2MA 3POOA 4IZYA 4EBVA 3TV4A 1CM8A 3DAEA 4MEDA 2WEVA 4YJUA 1PY5A 3S2PA 3PVBA 3EQCA 3FKLA 3Q4CA 2OXXA 2H6DA 3R8PA 4NJ3A 2B0QA 3VUMA 3SAYA 4BGGA 3U9NA 3ZC5A 5E8WA 3DGKA 4XG2A 2VTMA 1ZMWA 5BPYA 4U42A 3C9WA 2GFSA 4Y83A 3R9DA 2W4OA 4RC2A 2CCHA 5EQEA 4A07A 4ERWA 4O0SA 4O2ZA 4AX8A 3F2NA 5HE0A 4KIKB 2WB8A 1NVQA 2YM5A 3BU6A 2YJRA 5AV1A 3Q9YA 3FXWA 2F2UA 5HO8A 4ALWA 3SVVA 1U4DA 3F66A 5CWZA 4JRVA 4DEEA 1E1VA 5AJQA 4YBKA 5CU2A 4AN9A 3MVHA 5EDRA 4CV9A 3KK9A 2X0GA 4HYIA 2P55A 5IA3A 3KXGA 4FZ6A 3KVXA 1I09A 4UXQA 5JQ8A 5BUIA 1ATPE 1QPCA 3BGPA 4ZSLA 4KRCA 3EQPA 4BGHA 4O96A 4QPSA 4C8BA 2RGPA 3C4FA 3IO7A 3P7AA 5BYYA 4FT7A 3BBTB 2B9HA 3PY1A 4MXAA 4X2NA 5FBOA 3EQIA 1IASA 5AUUA 5BVDA 2VTTA 4K18A 2C0OA 3HL7A 1WBVA 4GIHA 2VWZA 4HW7A 2VTSA 2ETRA 3E3BX 3ZM4A 2VUWA 4IC7A 5BVKA 4IIRA 3FI8A 1KE5A 4EQMA 2G1TA 4Z9LA 4BDHA 4GKHA 3UIBA 4FC0A 4WNPA 3G0EA 4NCTA 2REIA 3AGLA 1FVRA 1PMUA 4PPCA 4X2GA 4LI5A 3IQ7A 5HBJA 2R0IA 3U9CA 4QYYA 3NUSA 3LCTA 1KV2A 2VX3A 3A2CA 4I3ZA 4QNAA 5JKGA 1Q3DA 2HW7A 3R73A 4KSPA 4YZNA 5EDPA 3GC8A 3QRJA 2W1CA 4FNYA 4YO6A 5H9BA 5EYDA 3W16A 3DS6A 2FGIA 3K3IA 4H3PA 3DBEA 4N6ZA 2OJJA 2ITWA 3PXZA 4UWCA 4X7QA 4PDSA 1OM1A 3LLTA 2OJGA 2A19B 2J50A 4QOXA 5FQDC 3ATTA 1W83A 5GIPE 1STCE 5JMSA 3QGYA 1YRPA 1LR4A 3GVUA 4A4XA 5IQHA 3B2TA 5E8SA 2WNTA 3D2IA 3MB7A 4X21A 3AC2A 2JGZA 3MH0A 4FMQA 3UVRA 3DBDA 2YACA 3UIMA 2B53A 4N0SA 5J87A 1LUFA 1ZY4A 1KE9A 3UMWA 2UW4A 3QZIA 2UZWE 3MB6A 3R8LA 4YJVA 2R3RA 1GY3A 5M4IA 4FSMA 1H28A 3G51A 1XWSA 4QP2A 5HTCA 4CFXA 2O0UA 4AU8A 1CSNA 3QKMA 1B6CB 4TNDA 4F7NA 3I60A 2OIQA 3ZUVA 2X4FA 2QOFA 3DCVA 3LVPA 4FV0A 4FT0A 4U0IA 3L8SA 3ERKA 3PG1A 2GFCA 3OEFX 4AZWA 3CY3A 1WBNA 1Y6BA 3ALOA 2BZIB 3KFAA 4RG0A 4XMOA 4YJQA 4E4LA 2XNBA 3BRBA 2HIWA 4RIWB 4F6WA 4WNOA 5GZ8A 5AUWA 3FC2A 4TZRA 3ALNA 3W55A 3COIA 3QD3A 2XA4A 2BZKB 3FDNA 2UW3A 2B7AA 2G2FA 3D15A 5JK3A 2B1PA 2CGXA 4YZMA 2J0MB 4EYMA 3AC4A 3GCUA 3LW0A 2X9FA 4DBXA 3VVHA 4U9AA 3ZBFA 2IG7A 2X2LA 2HCKA 4X2FA 3LKMA 2KTYA 3UZRA 3SQQA 4HZSA 1YDRE 3A8XA 3DKCA 4FYOA 2XVDA 2JLDA 3BYMA 5I3OA 5LWNA 1JVPP 3DPKA 2Y9QA 3FKOA 3R63A 2UZEA 4RZVA 1H1PA 4IWQA 4KIPA 4R6VA 3EIDA 3P9JA 2QLUA 4FOCA 4J98A 4L3JA 1ZYLA 2XBAA 4PNIA 4ZSGA 4G17A 3ZZEA 4F9BA 4OBOA 5FBNC 3KMUA 4M3QA 4I6BA 2C30A 3UPZA 5HESA 5KX8A 3PXYA 3GU7A 4KAOA
chains in the Genus database with same CATH superfamily
3QRIA 5IUHA 1E1XA 3ID6C 2PVRA 2W1ZA 2ZAZA 5CF4A 3EKNA 1KWPA 2H9VA 4O4CA 2ZM1A 3O8UA 1BI8A 3CC6A 4EHGA 3TCPA 3QRUA 3C0GA 4V04A 4AFJA 3FLYA 5D7AA 2VWIA 4PDPA 4RIYB 2YEXA 5K0XA 1SZMA 4A9SA 3OW4A 3KCKA 3UDBA 4F9AA 3DDQA 3HLLA 3K5VA 4TWCA 4XG8A 4IANA 3F69A 1FGKA 4ANBA 3KXHA 4BDGA 4EOKA 2BIYA 1MP8A 3BZ3A 1YXSA 4IB1A 3UYSA 5A6NA 4ZK5A 1GNGA 5CX9A 3QA8A 2OKRA 2R7BA 4KRDA 4L3PA 2JDRA 4YJOA 5E8XA 4ANMA 4L01A 4F0IA 3VBVA 2YDKA 2X81A 5CNNA 4GU9A 3JS2A 3VJNA 4ANLA 3KC3A 5CF5A 3NW5A 3L9PA 4AXEA 4LOPA 4LRJA 4M69A 1F3MC 5FP5A 1TQMA 3BHUA 3F3WA 4Y5QA 4GVAA 3UVQA 4H1JA 3W8QA 2JIVA 3QCQA 4AZSA 3QWKA 4IC8A 2Z7SA 4QTDA 4FKJA 3Q5IA 4Q9SA 3UBDA 4KA3A 3PVGA 3DAKA 4JG6A 3PXRA 2IVSA 4HNFA 4QYHA 5DH3A 3W0RA 5IQGA 4AZEA 3IOPA 2JD5A 1GAGA 3Q9WA 5AADA 5L4QA 4RFMA 5KMLA 4FTNA 5IQAA 2X0QA 3BYOA 5DT3A 4BI1A 5L2IA 4UMRA 3OD6X 3D2KA 2XB7A 4GW8A 4JQ8A 3OTUA 4GG7A 4O4DA 4APCA 1XMLA 1URWA 3WE4A 4TTHB 3RM7A 1SM2A 4M12A 4J1RA 3OUKA 3THBA 4HYSA 5EI6A 5HLPA 3ZLXA 4C61A 1P4OA 1JPAA 5KCVA 4FIFA 2WMVA 5LARA 4RIXA 4NUSA 5HG7A 2XMYA 4ZLYA 3GUBA 4C36A 4QMVA 2XALA 5CQUA 4Y46A 1OKVA 4MCVA 4L6QA 5CSWA 5BNJA 4W4WA 3CD8A 3UQFA 1UWJA 3FMDA 1M7NA 2IVTA 3DXNA 2YERA 2YITA 2VTOA 4V01A 4RPVA 3H30A 5AP4A 4CYIA 4FT5A 1NA7A 4UWYA 5IA2A 3CGFA 3NCGA 3AD4A 2YM8A 3KKVA 2RKUA 4ITIA 4QMTA 4X3FC 3NPCA 3RCDA 4F08A 3A7FA 4LOOA 2JKOA 4FZAB 4NTSA 4J8MA 4APPA 5EW9A 3AKJA 4EC9A 4DTBA 2IW9A 4FTAA 3WF8A 3CQWA 1PXLA 3PSBA 2WKMA 4L45A 4DT9A 1VLRA 3L8PA 4OBPA 4FEUA 4AXDA 4MBJA 3FWQA 4I0SA 3W2QA 2O5KA 2WMRA 3KGAA 3O50A 1U5RA 3PA3A 3PG3A 3D5WA 2HELA 2WFYA 3VRYA 4E5AX 4HPTE 3PVUA 3CTJA 3JYAA 5DOSA 4BVUA 1UVRA 3P1AA 3TKHA 4BCMA 3DDPA 2IEWA 3NRMA 2BRMA 1YI6A 3NR9A 3OS3A 2EB2A 3R7GA 3OCGA 3ODZX 4OT6A 2R3PA 4JBPA 2WMAA 1OMWA 4FTIA 2VTNA 1TZDA 2Z60A 5HU9A 3POZA 4H3BA 4F0GA 1XKKA 3ANRA 1FMOE 3QTQA 2UW9A 4I4EA 4DGNA 5CXHA 4F4PA 4XG7A 4ID7A 2WPAA 2YCSA 3FHRA 5J1WA 2UW7A 4YC6A 1VJYA 5D41A 3NFFB 4KUJA 3PPJA 4FV2A 3NUAA 5IQEA 2QU6A 3V51A 3TJCA 4EKLA 2BROA 4ENXA 4UMTA 5J9ZA 3I7CA 3OXIA 2Q0NA 4FVPA 3TV7A 4BDKA 2XKEA 3DOGA 4YR8A 4LUEA 2F7XE 5EH0A 3QUDA 4K1BA 5CEMA 5BVWA 3PWDA 4EK8A 2JDOA 1H07A 4HGTA 3R8MA 4AW0A 1PRYA 3ZEPA 4K33A 2QOKA 4JDKA 4LV5A 2OFVA 2QG7A 1OKWA 1KOBA 1ZRZA 3FPMA 4JJRA 1V0PA 3OF0A 4FKTA 3LCKA 2PHKA 4U45A 5AIKA 4W8DA 5ANKA 3UG2A 2XK3A 3ZH8A 5HO7A 4O0YA 4O7LA 4BWPA 4RVTA 2Y8OA 3RBWA 5M55A 2HY81 5AAFA 3VBQA 4DFBA 4N6YA 3Q32A 4L43A 3AOXA 3LXPA 4UMPA 5AV4A 4ACDA 4IEBA 3FQEA 3HMOA 3KEXA 5GIOE 2C5NA 1ZMUA 2IZSA 3OW3A 2Z7RA 3EKKA 3IG7A 4IB0A 4TYIA 1PHKA 3CSVA 5AA9A 3MFSA 3ZU7A 3VIDA 4H39A 4DGOA 3OWJA 4PMSA 2ZDUA 3CD3A 3R7OA 2RIOA 1M14A 2YA9A 2GTNA 1K3AA 3EYHA 3C7QA 5ANDA 5IUGA 2XRUA 4ENYA 3P4KA 2BDJA 3DTCA 4IFCA 4GFOA 3ZXTA 1JOWB 3I4BA 2J0KA 5LWMA 2GNFA 4IAYA 4FVQA 1FBNA 2W1FA 1U59A 1UU9A 2HXLA 3BGQA 4L9IA 3D9VA 5E8ZA 4ZXTA 3I1AA 4MHAA 3EN4A 5D12A 3R7IA 4E20A 3BBWA 3RWQA 1UU7A 5LMAA 3UO6A 2XUUA 2W1HA 3A7GA 3RPYA 2HOGA 3LFDA 4U41A 4BHZA 3NDMA 3CS9A 1XBAA 4FSZA 3Q4ZA 3AT3A 4HOKA 3HGKA 3QTRA 4J52A 5M57A 4P5QA 3C5IA 1OKZA 1WBPA 2OBJA 4FZDB 3BL9A 5DYJA 2J7TA 4O0UA 2G01A 2EXMA 3P5KA 4GUEA 4IVDA 5CYIA 1F0QA 4QMWA 4RWIA 5DR2A 3ZC6A 4U40A 3FHIA 5IH4A 3U6JA 3HX4A 3E5AA 4IXPA 3AXWA 4L7SA 3HVCA 5C8MA 4ZMFA 3FI4A 4JBVA 5HG5A 4FSNA 2W7XA 5DA3A 4ACMA 1WBSA 3COKA 4PPAA 4AG8A 4E4MA 5TOZA 4HPUE 4G34A 3MY1A 3HZTA 4BDCA 3EZRA 2VTAA 2VTQA 4QT1A 5DN3A 4PX6A 2Y6OA 5AV2A 1T46A 4NFNA 3UP2A 5L8JA 4D2SA 3Q52A 4ZY4A 2ZDTA 2YCQA 3LFBA 4CV8A 2OZOA 4FZFB 5LXMA 4DBNA 4J96A 3GC7A 2UZVA 3MYGA 4USDA 1P4FA 5IA1A 3UQCA 1BUHA 2QHMA 3UNZA 3WE8A 3LQ3A 4ZAUA 4RC3A 3HMIA 5HNBA 3DU8A 4E73A 4NIFA 1YXXA 2G9XA 1XJDA 3M42A 4XUFA 5EDQA 3WF6A 3DXPA 4IX3A 3P23A 3IW5A 1TQIA 3PWYA 4EH3A 3QUEA 2R3NA 4D58A 2GQGA 3F5PA 1WBTA 3BLQA 3GQLA 1IR3A 3AC1A 3LFSA 4I5HA 3VN9A 2UZBA 1YVJA 3AMYA 5KUPA 4PWNA 4ZP5A 4AOIA 2PZYA 2XIYA 3ATSA 1GZ8A 4BCQA 5KBQA 3PPZA 3G9LX 4FTMA 2OZAA 4JI9A 5B7VA 2I40A 2NPQA 1B39A 2PZRA 2FSMX 3ET7A 4G5PA 3ZONA 4DTKA 5T6KA 4IB5A 4O1OA 4F1MA 5HX8A 5IU2A 4CQGA 2W99B 2C0TA 4OTGA 4XG9A 4IM2A 4I20A 4GSBA 3UG1A 1JSUA 3O5AA 3MSSA 1W2DA 1YXTA 5JFSA 4HCTA 4O7RA 4IWDA 3F82A 4BWKA 3FMEA 1O6LA 2R5TA 4AOJA 4DEAA 2PWLA 3ZFYA 3C13A 5IA4A 2PMNX 3EQRA 4YGAA 5F94A 4KBKA 3RTPA 4F1OA 1LPUA 1ZZLA 4K77A 3R7VA 4QP4A 1OIUA 3EQFA 1IG1A 3ZBXA 4MXOA 3O8PA 4QP1A 3RHKA 5H8GA 4C58A 2ETMA 1CKIA 4ANQA 1M2PA 2WMSA 3PFYA 1XO2B 3EQDA 5AX9A 4MWIA 3TEIA 4EZ7A 4KBCA 3S95A 4LMUA 3S00A 4XG3A 1ZLTA 4L46A 4EHEA 3DQWA 5AAGA 4X3FA 4GFGA 4RWKA 1P2AA 2GMXA 1OL1A 4Y85A 4XOYA 4S33A 4BWXA 4R77A 4GK3A 3FMMA 4GUBA 2W17A 5EW8A 3WZDA 3BI6A 1YW2A 2IO6A 5E4HA 3KVWA 3ORXA 4KB8A 3NNVA 5C01A 1JSVA 1MUOA 2JIUA 4R3RA 4G3DA 4U43A 4D2PA 4FJVA 1RJBA 4YZBA 5LJJA 2E9PA 3Q9ZA 2IZUA 4GU6A 3JY9A 2WMBA 2PUNA 5ANEA 4BIDA 3TWJA 4EZ3A 5EM7A 4FI1A 4L44A 4MAOA 4PTEA 4PV0A 1YHSA 2ETKA 4DITA 1DM2A 2J90A 5BYZA 3GFEA 3R8UA 3UP7A 3RK9A 3G6HA 2JAVA 2RF9A 4FSYA 3FYJX 3C0IA 2X9EA 1CKJA 3DFCB 3ZSHA 1VR2A 4CSVA 4CG8A 4QDVA 4DGLC 3QZHA 2W1EA 4OTRA 5LQFA 1G8AA 4QQ5A 5DBXA 3OWPA 2NP8A 4ZTLA 4AXFA 4OGRA 3IGOA 4JOAA 3JR1A 2R9SA 4FEQA 3E64A 1YQJA 4S31A 1AQ1A 3ZHPC 2J2IB 1WVYA 4WKQA 4C2VA 1OGYA 3HAVA 4TT7A 1PMEA 2R2PA 2UUEA 3ZRLA 4IBMA 4BI0A 3OOMA 5I5ZA 1L8TA 4P90A 4MXYA 1ZY5A 4FNXA 4AP7A 4TWOA 1R0EA 2CJMA 4TY1A 2JDSA 4X6QC 3NYVA 3VS7A 3FSFA 4V0GB 5CS6A 4EWHA 3BE9A 2OJIA 4ASZA 3OBJA 5A4CA 2C4GA 2WMWA 5FTQA 4E93A 1ZYJA 1FOTA 3Q6WA 4J8NA 5JZJA 4A4LA 5HG9A 4PMPA 3U54A 4TW9A 4L42A 5F9EA 2BRHA 3T9IA 4BZOA 3ZO1A 5ICPA 2PVJA 4XYFA 4C2WA 3Q6UA 3PE2A 2UW0A 3AKKA 4ZZMA 4YTIA 5E90A 3EWHA 1OECA 5C03A 5CEQA 3TIYA 4OTWA 2YCRA 2I0YA 3PA4A 5ETAA 1R39A 1SVGA 3GCVA 2V22A 1TVOA 1FMKA 2UVZA 3TNPC 2R0UA 3QWJA 4DT8A 3R00A 3WZKA 5KMMA 3SA0A 4O7TA 4EUTA 1J91A 2XIZA 2AC3A 2SRCA 2XCKA 2YDIA 2BVAA 3ORPA 4R8QA 4WSQA 4DCEA 1G8KA 3UE4A 2GHGA 2Y7JA 5DMZA 1YI3A 3PFQA 5TKDA 3MJ2A 4O2PA 3HAMA 4QP6A 3MS9A 3R02A 4YSMA 5HIBA 4FNZA 3DFAA 3BYSA 3P0MA 2OG8A 4KKHA 4NK9A 2OZAB 3DK3A 4FG7A 2XNGA 3QX4A 4IACA 5ANIA 5L6WL 3PIYA 4FV7A 5AR2A 3QA0A 2BDFA 3BHTA 3F3TA 4RVLA 4EL9A 3GU6A 3LM0A 4RT7A 2PVLA 2QR8A 3ANQA 3GU5A 4BDIA 2XH5A 2GNGA 1XH8A 2GDOA 2XEYA 3QLGA 4EK4A 2X2MA 3F6XA 3R71A 4YPDA 3HV5A 4IWPA 3SOCA 2PVMA 2EVAA 4O4EA 1BL6A 4C37A 4FKUA 2HYYA 2VTRA 3ORIA 4LRKA 4CMUA 3VHEA 4AFEA 4G3EA 5IUIA 4FTQA 3PIXA 4DH7A 3QD0A 2QURA 3SGCA 1WVWA 1UKIA 4KWPA 1W98A 1X8BA 4U81A 3TJDA 3TT0A 5CEIA 3F3VA 2XNNA 4E5WA 4BN1A 2H8HA 2XYUA 3QL8A 5H8BA 3HV3A 5AMNA 4RRVA 3RAHA 1FVTA 3DBQA 3GQIA 3REPA 2I7QA 3V8TA 5K0KA 3W32A 3BLRA 4AW1A 2YABA 3RINA 2QOQA 1KSWA 3GB2A 3O7LB 3PPKA 4FV8A 3Q53A 4C02A 1FQ1B 5CVGA 1PW2A 3ZO4A 2IZRA 1W84A 2ZB1A 2CKOA 4ITJA 3LMIA 4DG2E 4ZLOA 2YIWA 3GCSA 1OL6A 2AYPA 3CE3A 4FT9A 3UOJA 5CASA 5BMMA 2X4ZA 4CLJA 4GKIA 3BWJA 1H4LA 1SNXA 1PXIA 3UIUA 3ZMMA 2C6DA 1LEWA 3FXXA 4MH7A 3MVMA 4JT3A 3HUCA 1OGUA 5FXSA 2FB8A 2QVSE 1OIQA 5HVKA 1MRYA 4XG6A 3ORNA 3VS1A 5A4EA 1JWHA 5EHLA 3AD5A 4N4SA 1OL5A 5HCZA 4CZUA 3S1HA 2PVHA 4FTTA 3KQ7A 4LUDA 4DDGA 2OIBA 2YJSA 4BF2A 4G2FA 5AP1A 2AEGA 1V0BA 2BFXA 3WF7A 4OT5A 5E92A 4RWLA 2C6MA 4FGBA 4YJTA 3UO4A 3QALE 5HU3A 2IF8A 3E8CA 4IZ5A 3SG8A 1H27A 1Z5MA 3NWWA 4LV7A 2C5OA 3H4JA 3ZLSA 4II5A 4JX7A 4ZS4A 1G5SA 3COMA 2ACXA 4ZMEA 5C9CA 4YPSA 4DLIA 3FEGA 3ZRMA 4LV8A 4K0YA 4OW8A 4OAVB 4PNKA 1QPJA 2OIDA 4A06A 4M15A 3NNWA 4O0TA 3VWAA 3FBVA 3QHRA 4QMOA 2ZM3A 5CT0A 4EEVA 1Q8TA 5K5NA 3JPVA 2QODA 2W0JA 2OU7A 3I5ZA 4MXXA 2DUVA 3FLWA 5AP0A 5JRSA 4GK2A 4HJOA 3IONA 3QTXA 4J99A 4ACCA 2IJMA 4FKRA 2YIXA 3G90X 2G2HA 2XIRA 5FXQA 3GFWA 5L2QA 4F70A 3DA6A 3AC3A 2OJFE 2R3QA 5M56A 2BHEA 5D1JA 5AV3A 5AUTA 1LP4A 3R7YA 3TZ9A 3DKFA 5GINE 3NZ0A 3PJ1A 5IQBA 3DXQA 2X2KA 2C3LA 3R01A 4BKJA 5CNOA 3ORLA 4W9XA 3UYTA 3QYWA 3QTUA 1A48A 3JY0A 2J5FA 1MRUA 3VS6A 1KV1A 2BRBA 2GNHA 1WMKA 4J53A 2P2IA 3FLZA 3AG9A 3PZHA 1YOMA 3PY3A 4MK0A 4C4HA 5JFXA 1M2RA 2W06A 4DFLA 2ZM4A 2XANA 1Z9XA 3ZYAA 4DAWA 4DH3A 5IMXA 3MV5A 2X8DA 4UZHA 2OF4A 3CPCA 4R5SA 3QQKA 3F2RA 5E8TA 4F9WA 2G15A 4FX3A 4YP8A 5ACKA 5J1VA 4IAAA 5BV3A 4AGDA 4C33A 4FT3A 4G6LA 4B99A 3UDSA 4XP0A 2ITVA 3FJQE 5HLNA 5A46A 4DEBA 5JQ5A 2R3KA 4F6UA 5DLSA 3VHKA 2XK7A 2ITQA 3PRIA 3SDJA 5AP2A 4CGAA 4JDJA 3LXNA 4E4NA 5KKRC 4R3CA 5H2UA 5CU6A 3QGWA 4ORKA 2YIQA 3AQVA 3M2WA 3NAXA 3UIXA 4AF3A 1I44A 3O8TA 5HIEA 2Z02A 4Y72A 3PE1A 3KXMA 4RJ8A 3RP9A 3DT1A 3G9NA 3ZOSA 4G3FA 5HTIA 3IPHA 4S32A 3V5LA 4G9RA 3QRTA 4GIIA 4YTHA 1PXMA 3CJFA 3FMNA 4IFGA 2OFUA 1ZMVA 3F7WA 2QNJA 5HVJA 2PVFA 3EHAA 4RX7A 4AQKA 3EFJA 4ZSEA 4YLJA 4FSTA 1OVEA 4DA5A 1IA8A 3D7TB 4HNIA 4A9TA 2WQBA 3CTHA 2VGPA 4NFMA 3G33A 2WU6A 1Q24A 3HV4A 4NKSA 3QZGA 1YI4A 4RWJA 4EZ5A 1XBBA 4K11A 4F7LA 4TRLA 1OBDA 3VRZA 4LGGA 3LQ5A 2ZV7A 4I41A 1JAMA 1XH9A 2KULA 4W4XA 4ANSA 4I4FA 5DT4A 2J6MA 3QTWA 3KU2A 2WU7A 4XV9A 4U6RA 5CXZA 4PUZA 5KO1A 2QG5A 3FLSA 3RCJA 3AC5A 4J95A 5AM7A 5HOAA 4QEBA 3DBCA 4MYGA 3TYKA 4BCOA 1GOLA 5I9VA 2ZVAA 3ETAA 4O82A 2WMTA 3EN7A 5E8YA 5HG8A 3BQCA 1KUTA 2GNLA 5AR3A 4U3YA 4I6LA 3VS2A 1JLUE 1Q3WA 3MFTA 1PXOA 3QFVA 4YMJA 3WZEA 4ZTHA 3PP1A 4QPAA 2F9GA 4D4YA 3TUCA 4HGSA 1RE8A 2HZIA 4M8TA 5J95A 2PE1A 4IB3A 3R04A 3TNHA 4CFWA 4F78A 1TFFA 4BTKA 1PXKA 4RQKA 3PJ8A 3UNJA 3T8OA 3ZO3A 5AEPA 2VX0A 2C5XA 3CY2A 3PLSA 1R78A 3PJ2A 4RFZA 2RFSA 5FEEA 2XKFA 3V6SA 3QKLA 5DE2A 4CQEA 3LM5A 4FV6A 5DR6A 2ITNA 5EK7A 4AACA 2C6LA 3AT2A 3MVLA 3HYHA 3EN9A 4G6NA 2I1MA 4GJ2A 4O22A 4FF8A 3ORKA 4IVAA 4OTIA 3FMHA 2O8YA 2R3JA 4QQJA 5CVHA 4NKAA 5F1ZA 2PUIA 2VTHA 1J1CA 5CEOA 1U5QA 4CLIA 3OHTA 5CAVA 3BL7A 2UZOA 4FTJA 3UVPA 3LFNA 4AGUA 4HVSA 5EG3A 4QRCA 5JSMA 3ML1A 2XK4A 5CZIA 5I4NA 5JRQA 3UDZA 3RJCA 3U55A 3SW7A 3C51A 3EQHA 1DI8A 3V01A 3HDMA 3K3JA 3LXKA 4FV4A 5KMKA 3TDWA 2I0HA 5L6PA 2VO7A 5K3YA 2VWVA 3ROCA 4YTFA 2WTKC 2A2AA 1OBGA 4WUNA 2GS7A 2XK9A 3LJ0A 5AP7A 2UVXA 5L3AA 5JH6A 4RX8A 4BDEA 3TN8A 3UODA 4X2KA 5AWMA 3RK5A 1OZ1A 4E6DA 3OT3A 5EI2A 4OTFA 3KMWA 1L3RE 3ENMA 4XH6A 3NS9A 1YOLA 3R8ZA 2QOCA 4J97A 4AXCA 4NT4A 5IKWA 2PVYA 5BX0A 5FM2A 2BMCA 4XJ0A 3QQGA 3NSZA 4DC2A 1REKA 3BEAA 3OUNB 4EUUA 4U3ZA 2ZJWA 4FK3A 4U5JA 2O65A 4RBLA 3W10A 5GJGA 5DRBA 5FG8A 1AD5A 2WIPA 3VONA 3W1FA 4BBFA 2ITOA 4XV3A 3T3VA 4L53A 4QMUA 1P5EA 3VQHA 2QU5A 4Q5HA 3RVGA 2XAOA 1JKKA 4NM7A 4EH7A 3SG9A 3D5VA 1FGIA 5ANJA 4NJDA 2PYWA 3R9NA 4MF1A 2Y4IC 2RSVA 4YJNA 1A9UA 4OTQA 3TG1A 5TO8A 5LVPA 4MXCA 3E92A 4JQ7A 3D94A 2VV9A 3F3ZA 5IZFA 1PMVA 4UY9A 5L2TA 1WCCA 1PYEA 3I5NA 4ZZOA 1ND4A 3MTLA 2DS1A 4W8EA 4QMPA 3IDBA 3R6XA 4RVKA 3EFWA 4IZAA 2P3GX 4XHKB 4E5BA 4LDTA 3MPAA 4ZIMA 1GZNA 4F9CA 3UZPA 4RX9A 4U97A 3E7OA 2F2CB 4EWQA 3H0ZA 4BDDA 1B38A 4F9YA 3PRFA 4O0XA 4MF0A 4Q9ZA 4CTBA 5FGKA 4RGJA 2XP2A 4O7ZA 4IAZA 4C3FA 3ZFXA 3DJ7A 3IW6A 5CY3A 5M4CA 1CKPA 3RM6A 4BCGA 3W33A 2HENA 2XNOA 1UWHA 3Q9XA 3IK3A 4HGEA 4YJRA 2GQRA 3JXWA 3O7LD 3R22A 2ONLC 3MVJA 2QOHA 4XV2A 4I5PA 5HNGA 4GL9A 3TNIA 1Q61A 2EUFB 3E88A 2XZSA 2XM8A 5GHVA 5KMIA 3FZ1A 3BHHA 3DNEA 1Y57A 4Q2AA 5HTBA 2AC5A 1PF8A 3LMGA 3LOKA 4NW6A 4KD1A 2R3MA 1H08A 5EFQA 3W0QA 3TIZA 2X6EA 4YHTA 3DNDA 4ANNA 2BILB 2X1NA 4EHZA 3DV3A 1GZKA 4QMQA 2BR1A 3VUHA 3KA0A 1O6YA 4G6OA 4BBMA 5CAUA 5I3RA 1JBPE 3QZFA 4FGRA 3U6HA 5EKOA 5HCYA 2X6DA 4HVGA 3DLSA 3NFGB 3LJ2A 5FD2A 2IWIA 2YLFA 5CTPA 4CNHA 4IM3A 3IECA 4DFYA 4R1YA 1Y91A 2VO3A 2XNEA 3BEGA 1DS5A 2JDVA 4FTOA 3ZDUA 1BYGA 3EH9A 4CZTA 4QMNA 3EL7A 2WXVA 4JRNA 3ZDIA 5EYKA 3GI3A 5I9WA 3W2OA 2VTJA 4QTAA 3H9RA 3CEKA 3OWLA 3R2YA 4LG4A 3R7UA 4FEXA 3R83A 3EOCA 4FV5A 5M07A 3NVKI 3G5DA 4CYJA 5G6VA 3W0SA 2F4JA 3R9OA 4EOQA 4IX5A 4M69B 5EQPA 3KN6A 2ZV8A 1Y8YA 3FZPA 4O1PA 4WRSA 5D11A 4BL1A 4CCBA 4NL0A 3H3CA 4O7SA 5CI6A 4WBOA 2C6EA 2WQEA 3PZEA 4M84A 5ETFA 4L00A 4XEYA 2CN5A 5HO6A 3F5XA 2UW8A 4TPTA 1ZOEA 3CR0A 4WT6A 5BMSA 3CLYA 3F9NA 5D7VA 2LGCA 2RFEA 3QHWA 4PMTA 3F5UA 4WHZA 3QC9A 4D9TA 2YZLA 1R3CA 3FLQA 3AKLA 2IVUA 2NO3A 4NH1A 2YAKA 5C1QB 2XAMA 4JLCA 2C6IA 5K5XA 5M08A 2WTCA 3W2PA 2CGWA 4ANOA 2PTKA 1QMZA 3KMMA 4E6CA 2JBOA 2J0LA 3BQRA 5IDPA 3LPBA 5D9HA 2VRXA 2W9ZB 4RIXB 5AIRA 4FEWA 1PKGA 2ERZE 4GYGA 4OTDA 1KE8A 5LVLA 3RPVA 2GTMA 3TTIA 4ARKA 4AUAA 3GCPA 1Q99A 4NEUA 4PP7A 4BB4A 3CP9A 4M97A 5B2MA 5IISA 4IDVA 4V05A 3NNXA 1XQZA 2VAGA 5CU4A 4A7CA 3U87A 4C3PA 4RA5A 4X2JA 4ZTMA 5LOHA 2YWPA 5IQIA 3DJ5A 3R9RA 3Q4UA 2YLEA 4D0WA 2YAAA 3BIZA 3ZSGA 1VEBA 5FLFA 4C62A 4WRGA 4IE9A 1BI7A 2A98A 2BAJA 4D1ZA 4YBJA 3UDTA 1W2CA 3MH3A 4PY1A 5A9UA 2Y6MA 4P2KA 2ERKA 3FPQA 2ITXA 3PY0A 3C5UA 2A1AB 4PL4A 5AX3A 4C34A 2XYNA 4GMYA 4I6FA 4EH2A 3MIYA 4O91A 3MPTA 4DYMA 3S0OA 1YWVA 3AGMA 4FIGA 5CLPA 1YWRA 2BCJA 3TZMA 3TUBA 3PA5A 3C4CA 2R3GA 1S9JA 3KY2A 3RKBA 3WI6A 4NWMA 3NYXA 1GIHA 4MKCA 5H8EA 4EOIA 5JGDA 1ZXEA 4RMZA 4WIHA 4NM5A 2OF2A 1ST0A 4XP3A 2C1AA 4BC6A 2CGVA 4YJSA 3C4WA 5FXRA 5D10A 5CEPA 1J1BA 1CDKA 3MH1A 2V5QA 3E8EA 3CCNA 1PJKA 3NYNA 4I23A 4K6ZA 4EK5A 4IDTA 3BHYA 3FL5A 3AMBA 3FSKA 5KMOA 4R1VA 2BPMA 3CIKA 4BCPA 4O84A 4GFMA 4D2RA 3LIJA 1BL7A 4MQ2A 4ZJIA 5FM3A 3Q2MA 4KS7A 1WVXA 2GHMA 5ANGA 2OH0E 4CFMA 4EKKA 4EI4A 2BKKA 1SVHA 3GNIB 4MD8E 2PE2A 2NRUA 4M0YA 4EOPA 3EL8A 4DDIA 2VD5A 3BELA 2YIYA 3NCZA 3QBNA 2ITTA 4GK4A 4HVIA 4IQ6A 3VJOA 3W8LA 4I1ZA 4JXFA 4QYEA 2XJ1A 4TYHA 3V5PA 4PTCA 3H9OA 1GIIA 2OXDA 3QD4A 5CT7A 4AOTA 3OCTA 4TL0A 2ITPA 2OK1A 4Y5HA 5HZNA 5EYCA 4ZSAA 5AUZA 3ITZA 5HGIA 4PDYA 4YZCA 1HCLA 4FTCA 3ELJA 4NM0A 5CSPA 2UV2A 2WZJA 4BCHA 3R8VA 4CG9A 5KMJA 4QTCA 5M53A 1H01A 2RG6A 3HEGA 4RJ3A 3QQUA 4EK3A 1H26A 1ZYCA 4EH8A 5AA8A 5IQDA 3NMUF 4LM5A 3QAME 2V55A 4FTKA 3QCSA 4GT3A 3ULZA 1T45A 4JG7A 4I0TA 5HE1A 2JEDA 4QQTA 3ORTA 3OCSA 4BFMA 1VZOA 5GJFA 3R1NA 2XS0A 1XH6A 2GCDA 4MX9A 4HGLA 3VBYA 2GU8A 4BIEA 3R9HA 5CQWA 4O38A 5HE2A 2VU3A 4YU2A 2IVVA 4M0ZA 5LVOA 2QC6A 4ONAA 3I79A 1WBOA 3PVWA 5TT7A 3B2WA 2J0IA 4M7IA 1YKRA 2F7ZE 2PVNA 4FKPA 5HI2A 4L3LA 3V8WA 2WHBA 4X3JA 2VNYA