4CV9A

Mps1 kinase with 3-aminopyridin-2-one inhibitors
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
280
structure length
254
Chain Sequence
FQSMSVKGRIYSILKQIGSGGSSKVFQVLNEKKQIYAIKYVNLEEADNQTLDSYRNEIAYLNKLQQHSDKIIRLYDYEITDQYIYMVMECGNIDLNSWLKKKKSIDPWERKSYWKNMLEAVHTIHQHGIVHSDLKPANFLIVDGMLKLIDFGIANVGVNYMPPEAIKDMSISPKSDVWSLGCILYYMTYGKTPFQQIINQISKLHAIIDPNHEIEFPDIPEKDLQDVLKCCLKRDPKQRISIPELLAHPYVQIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Protein Kinase Selectivity of a 3-Aminopyridin-2- One Based Fragment Library, Identification of 3-Amino-5-(Pyridin-4-Yl)Pyridin-2(1H)-One as a Novel Scaffold for Mps1 Inhibition
rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords DUAL SPECIFICITY PROTEIN KINASE TTK
total genus 76
structure length 254
sequence length 280
ec nomenclature ec 2.7.12.1: Dual-specificity kinase.
pdb deposition date 2014-03-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4cv9A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4cv9A01
2VTAA 2C3KA 3R01A 3OVVA 4AA5A 4AW2A 4DGOA 3OT3A 3I7CA 3KF7A 3QTRA 4LMUA 4EWHA 2Q83A 4FKGA 3MB7A 4MF0A 4JG6A 5CQUA 4YPDA 5EM5A 1Q8ZA 3RWPA 1G5SA 3KRLA 3ORKA 3VUHA 3UQFA 2ITVA 2IW6A 3UO6A 4JBOA 4EUTA 1JPAA 3FE3A 3UNZA 4Y46A 4FKIA 2V62A 4XS2A 4LFIA 2R3OA 4ANQA 3A7FA 4C33A 5IUGA 2BZHB 4IDTA 1PXJA 3KQ7A 2BRMA 4QP7A 4O1OA 2W4JA 3PSDA 4MF1A 4B8MA 4DCEA 5LVNA 1R78A 2XNMA 3MWUA 2P2IA 3AXWA 4FTJA 4IWDA 1MRYA 4JI9A 2I0VA 3D0EA 3PA3A 5CX9A 2UW6A 5FQDC 3OUKA 1HOWA 5FTGA 1MUOA 4BCHA 4X3FC 2ERZE 3AMYA 4GU6A 2CJMA 3WI6A 3Q53A 4BZDA 2EB3A 2O64A 4PTCA 4H3QA 1Q4LA 4DFLA 3OEZA 3LQ3A 1E1XA 3V6RA 4IM2A 5JGBA 3S1HA 2W9ZB 3MVMA 2QKWB 3OP5A 3LZBA 1H07A 2PWLA 4L42A 3B8QA 3MBLA 4MHAA 4NFMA 4RVLA 3Q2MA 3R1YA 5HQ0A 4ERKA 1URWA 3H10A 2B1PA 4FIGA 3BGZA 3B2TA 3UOLA 3W1FA 4YJOA 2YM8A 3T3VA 3CGOA 3ZLXA 4AT3A 2YACA 3R9DA 4ASZA 5DR6A 3MJ1A 3P7AA 4PX6A 4A7CA 2GS6A 5E91A 5EM6A 4YNOA 4B7TA 2QNJA 3VF9A 2YM4A 3ZSHA 2ZOQA 3WILA 3C1XA 5B7VA 3DKCA 4ZMFA 2BRGA 4RIYB 5CVHA 4A4LA 2Q0BA 3VUGA 1H8FA 4FIFA 4MQ2A 1JKKA 3NRMA 4D1XA 2XK7A 4O7ZA 4OTHA 4PDSA 4XEYA 2I40A 2J90A 2E9VA 2R0IA 2V55A 5B0XA 5DVRA 3MFSA 4PNIA 1PF8A 3C5UA 4YZBA 5IZFA 2XCHA 5GHVA 5KNJA 2OFUA 4LOOA 2W4KA 3E93A 3FC2A 2F7XE 4AZSA 3ALOA 4NKSA 3PSBA 2BHHA 5AR8A 3TV7A 4C8BA 3O50A 3ZZWA 3WZUA 4YURA 4ITJA 1Y57A 3OZ6A 3FQHA 5BVFA 5GZAA 1GIJA 3GC8A 2R3PA 4GJ3A 5GIOE 4KBAA 2Q0NA 3QYZA 2XZSA 4GUBA 2X9EA 3HUBA 4NWMA 4B99A 1H1QA 3W32A 4EH9A 1X8BA 4APCA 5FEEA 2HXLA 3BGQA 2Z7RA 2YABA 4HCVA 2ZDUA 4B9DA 3VS2A 4PWNA 3ORLA 3VRYA 4ANLA 2C0IA 4O2ZA 5AAFA 3PXYA 4JBQA 4QPMA 2CCHA 3FXXA 2YAKA 2XJ1A 1H1PA 3Q96A 4K1BA 2G2HA 4NM7A 3FI2A 2W1EA 5HU3A 2JDVA 2QR7A 4P5QA 2ZM4A 4XRLA 4NJ3A 3QRIA 5C8NA 3QBNA 1OPLA 3IDCA 3RAWA 2BILB 2I1MA 1KE6A 4FTTA 4D5HA 5KHXA 4N70A 2X2KA 4UMUA 3RCJA 3LXKA 5FWKK 2VTLA 4NCTA 4XBRA 1G3NA 3R00A 2CKEA 3F5XA 3ZO2A 3EMGA 4K8AA 3LJ2A 4QP9A 3Q9ZA 4TNDA 4APPA 2J7TA 2PMOX 3ZSGA 3AD6A 2A2AA 3BWJA 4BB4A 5C26A 3F88A 4ZP5A 3CIKA 4EZ7A 2XCKA 3WF7A 3AT4A 2GU8A 4G3DA 1AD5A 4KKGA 4KS7A 3HV4A 1ZZLA 2NRYA 3H0ZA 4CEGA 4EK8A 3OF0A 3EYGA 4GIHA 3ZFYA 4HYUA 4RIWB 4C0TA 2GTMA 3FHIA 4YPSA 3FAAA 4U45A 4L00A 4QMMA 5CSPA 2GCDA 2XMYA 2WPAA 4YZ9A 4FIHA 3RINA 5A4TA 4YP8A 5LJJA 2IVVA 1JKLA 3I1AA 3P08A 3VS4A 4L44A 3SRVA 5F94A 3RALA 3TUBA 4XV9A 2QQ7A 1ZZ2A 1U46A 4QPAA 1RDQE 4XCUA 5F4NA 4E4MA 4D2WA 5GIPE 4YJRA 4RX5A 2Z7QA 3E7OA 4HVGA 4IAIA 3DDPA 5DGZA 1PKGA 3W55A 3R2BA 3V6SA 3WZDA 4A4XA 1YOMA 5L2QA 5JK3A 4QMUA 3VS6A 1PXLA 5K5XA 4YBJA 5KMLA 4N4SA 3W16A 1W83A 4I5PA 4EK3A 4YZDA 4QQCA 5AUUA 4CCBA 5JEBA 4F0GA 4FGBA 4C61A 2O0UA 2YITA 1WBWA 4YJSA 4ZIMA 4AW5A 5EW9A 3UMXA 1PXMA 4MAOA 3SOAA 5C27A 1OKVA 1OL1A 3COHA 2GHLA 4AA4A 1W84A 4R3CA 1P4OA 3OD6X 1FVVA 2B9IA 2IVTA 3R8LA 2HOGA 5AIRA 5TOZA 1Q3WA 3O23A 3KA0A 2ITOA 3NW5A 3OCBA 4DG0E 3HA8A 5L8JA 2PPQA 4WIHA 4BDEA 5HD7A 2VUWA 5HCYA 4IAKA 3NMUF 4YTCA 3GUBA 4MWIA 4FOCA 5CU0A 2WTDA 5BYLA 4AGCA 4FYOA 1ZMWA 4ACCA 3POZA 3FI3A 3KCKA 4GVJA 4RG0A 4DEAA 2VO3A 4JR3A 4E4XA 3LFBA 3QTQA 5E8SA 3ZONA 2GQRA 2BAJA 2Y4IB 2PVKA 3H0YA 4IEBA 4O38A 5DG5A 3WE8A 3ETAA 4XMOA 2ERKA 5F20A 3PXQA 4JOAA 3REPA 4BR3A 3ORXA 4TWCA 1KV2A 5H8EA 4PL5A 4FSZA 2C3IB 3QALE 3CBLA 1NA7A 3UGCA 1GJOA 3MTLA 5JQ5A 3HDMA 5HBHA 4E26A 4YTHA 1WVYA 2C6IA 5FM3A 5LVMA 3TZ9A 2BKKA 1SYKA 3ZLYA 3CE3A 4C3FA 1J1BA 1W0XC 2GNIA 3ZDUA 3O17A 1XO2B 3FY2A 2WFYA 3TNHA 4DEDA 4NJDA 3FWQA 4MBLA 5CF6A 4HZSA 2WNTA 4L45A 3KGAA 2X1NA 4NW5A 4QP2A 4O0YA 4QYHA 5HLWA 4JRVA 1XH6A 2F9GA 5EDPA 2W9FB 2XYUA 1AGWA 3WE4A 4EBWA 3I6WA 2XKEA 3ELJA 4IX4A 3NIEA 4FKTA 4WHZA 4QQ5A 1PYXA 5HESA 2RG5A 4WG3A 4ZTSA 1FINA 3D2KA 4D1ZA 3G2FA 4YJUA 2V7OA 3RJCA 3ZOSA 4R7IA 4EHEA 2JKMA 4CCUA 4CVAA 1GZKA 3DOGA 3KULB 3COKA 3D7ZA 1MRVA 4L68A 5HU9A 4QMLA 2ITZA 2VTMA 4KRDA 3TV4A 3ATTA 3PP0A 2XIRA 3K2LA 5IEVA 2R3HA 5IEYA 2ZV9A 3MVJA 3EN4A 3OT8A 4RWJA 4MXZA 4RPVA 4MBIA 5IUIA 4YO6A 3S00A 1A48A 4I24A 4IAZA 4KRCA 3VS5A 2YWPA 4ZTQA 1HCLA 4DGGA 4CT1A 2JD5A 4OR5A 3ZUVA 2W1GA 3EQPA 4ACMA 1XQZA 4I94A 2QLUA 1KOAA 4QMQA 3KRWA 2IPXA 3KVXA 4EQMA 3KXMA 3CPCA 2FVDA 2W4OA 2WHBA 3FYKX 3ZBXA 4USEA 1Q99A 3I6UA 1Q8UA 5KMJA 2CNQA 2F49A 1OPJA 3CY3A 1PXNA 1WBPA 4PMTA 3ID6C 4X2JA 4XG7A 4YLKA 1A06A 4D2SA 3DNEA 4IX5A 2CGXA 2J9MA 2C6KA 3ZH8A 4N57A 2I0EA 4MD8E 4XG8A 4GV1A 3BLRA 4EL9A 2PVNA 3V01A 1KWPA 4FVPA 2IVUA 3PYYA 4JQEA 2G2IA 5ETCA 4F7JA 3BZ3A 4YZCA 5DOSA 4GKIA 1E9HA 3IONA 3BHYA 5KMOA 4M8TA 5CVGA 2WMTA 2W7XA 4MYGA 5CT0A 5HG7A 2ITPA 2FUMA 3V51A 1DI9A 2PUUA 1VJYA 5HHWA 4RA5A 3CPBA 3ORPA 4E4NA 3D83A 4E8AA 3MV5A 4JDKA 4RIOA 2A4LA 3A7IA 4E6QA 3BIZA 4F08A 5IH4A 4MNFA 3RVGA 2X6DA 3SOCA 1YI3A 1YRPA 1OMWA 3K3IA 4ORKA 5CWZA 1H1SA 4C38A 4A9RA 5GINE 3OXZA 3KXZA 3MB6A 4GT3A 5IQFA 3UDBA 3DXNA 3A62A 3KU2A 4NUSA 4RIYA 4ZLZA 3EYHA 4JVGA 3PXZA 4QP8A 1WCCA 3U9NA 2VV9A 4L3PA 3OW4A 3F7WA 5L3AA 4LMNA 4V0GB 3P9JA 4XX9A 3N4UA 2LGCA 3GOKA 3TUCA 3NEWA 5AAEA 1XWSA 5IUHA 2YJRA 2QR8A 4I6HA 4EQCA 5KUPA 5EDRA 1FQ1B 4DF3A 2ZB0A 3VO3A 3U6JA 3NYVA 1M2RA 5ACKA 1OUKA 2BVAA 4CFUA 3BELA 3KN6A 5ETIA 1NW1A 3UC3A 3UP7A 4KS8A 3FZOA 3IGOA 1TKIA 3BQCA 4J95A 2HZ0A 4DA5A 2C0OA 4C4HA 3D4QA 4XH6A 3LCTA 3H30A 3N9XA 2WIHA 4LRKA 3QQLA 3Q4ZA 3R22A 4GMYA 4I0TA 4EHGA 2PYWA 4CG9A 3IPHA 4U42A 4WOVA 5TF9A 5AP5A 2OH4A 4QNYA 1FMKA 4EH6A 2Y0AA 3VQHA 2OXYA 5CF8A 2C47A 4TW9A 4YSJA 5IQDA 2ETKA 3RPRA 4X3FB 3DFCB 3ZC5A 2ITWA 3KXNA 2QOKA 4BIDA 3F2AA 3IQ7A 3E88A 4X0MA 4LV8A 3BRBA 1H27A 5CTPA 4B6LA 4F6UA 3ZO3A 3VVHA 5AR7A 5AV2A 3R28A 4AT4A 3FMKA 3CKXA 3O7LB 4QYYA 2BZKB 4D9UA 2UW5A 3MH2A 3NUXA 4AE9A 4BCJA 5BVNA 3E7VA 4MD7E 4GFMA 1ZXEA 3ZFMA 4CYIA 4D58A 2OXXA 1Z57A 2SRCA 2UZWE 3NUUA 4JJRA 4K6ZA 3KEXA 4I0RA 4I23A 4EK4A 3AMBA 3C4WA 3FSKA 3WIGA 3WZKA 4BZOA 2C5XA 5L2WA 3F7ZA 3PXRA 2QC6A 5CS6A 2OXDA 3TCPA 5IA3A 2PMIA 1XKKA 4D2PA 4YJQA 3QCYA 1WFCA 5ANOA 3GCVA 4GK2A 4M15A 3QTWA 3PLSA 4K18A 5D41A 5HIDA 4B8LA 5CAUA 3NUAA 5CZHA 1W98A 2WU6A 2P3GX 1ATPE 2BDJA 2X81A 4OTQA 4FZ7A 2R3JA 1Q97A 4RC4A 2UZEA 2R2PA 4PPCA 3NGAA 5CSVA 2XK8A 4R5SA 5FXSA 4IX6A 3U55A 3PRFA 3P78A 4D1SA 5IA4A 1BI7A 5BVKA 5LCJA 3M11A 5CU6A 1ZY4A 4XHKB 3AD5A 3FY0A 4QO9A 3NVMB 2VWBA 1RW8A 4OTRA 5HVYA 5AP6A 2OWBA 4AQCA 5AFVA 4RX8A 2R9SA 3BU6A 2AUHA 1BMKA 2OIDA 2CLQA 2B0QA 2OO8X 2WQEA 4KINA 2V5QA 3R71A 4QMTA 5BMMA 3ZEWA 2UZDA 2XYNA 4NTTA 4EH7A 3ITZA 3BYSA 3U6HA 2UW8A 5E7RA 4O7SA 2UZOA 3MA6A 3TKIA 2QODA 4EOQA 4PQNA 5I9XA 4HGTA 5AP3A 3CTJA 4FSQA 4O91A 5EOLA 5IQIA 5HTBA 4FICA 2O63A 3QTZA 4GJ2A 3KXXA 4ZSEA 5CEKA 4RZVA 1LR4A 3GC7A 3LFEA 3LPBA 5EHLA 4E3CA 4C3PA 1PMNA 4LL5A 2CLXA 4D4RA 4G9CA 3KREA 3QD0A 4U81A 4E20A 4HOKA 3EQCA 1M2PA 4FIJA 1RQQA 4ITIA 4Y8DA 4IQ6A 2QU6A 2WQBA 3R63A 2Z7SA 5M55A 4BYJA 3F69A 1VYWA 5AUTA 3QKKA 4HNIA 3H4JA 4FTOA 4DBXA 3ZO4A 2BCJA 3FI4A 3OWKA 2DS1A 2WMQA 3LCDA 4RWKA 2ITUA 4A9YA 2CKQA 5JT2A 2BZIB 3K54A 4E5WA 4UMQA 3AGMA 4HNFA 4FEWA 4IDVA 4R1VA 4EZ3A 3HL7A 3PVGA 4O21A 2VRXA 5ETAA 5E8VA 4XNEA 4IJ9A 2W06A 4Z55A 5I3RA 4O22A 4PP7A 5M53A 2OZAA 4IWPA 5K4JA 4KB8A 1CTPE 3BGPA 5BQ0A 4DC2A 2IG7A 3UZTA 2P4IA 4ID7A 4AN2A 4RJ8A 4NFNA 3JYAA 3I60A 3EZVA 1PMUA 1UA2A 4TNBA 1YOLA 5J8IA 3HV3A 3RM7A 5LMBA 5DE2A 4EH4A 2WMVA 4OT5A 5LVLA 1GZOA 3MH0A 3G15A 2J0LA 3KRJA 5E8XA 2GPHA 1Q41A 1YW2A 5CF5A 2OZOA 3IS5A 3Q9YA 2JAMA 3VUIA 4UB7A 3V04A 4AWIA 3ZLWA 4P90A 5CU3A 5CXHA 2XM8A 2OI4X 4MX9A 2PZ5A 2Y9QA 2XKFA 2Y4IC 4AGUA 4NEUA 5M07A 3WBLA 4ZTRA 1GNGA 3PY0A 1UWHA 2WTCA 2BRNA 4AP7A 1W8CA 4GUEA 2BTRA 3HRFA 3LXNA 4G31A 1QMZA 4CMTA 4OTGA 3KN5A 1SNXA 2VU3A 2EXMA 1YOJA 2UVYA 3OBGA 3VW6A 3W8LA 4BDHA 3VAPA 3SA0A 3R7GA 4DE4A 3SVVA 4MXCA 4BI1A 4Z16A 2OJJA 3T3UA 2X7FA 4Y85A 1ZYCA 4WSYA 4GSBA 3VWAA 1YWRA 4QP4A 5KBQA 4JDJA 4X3JA 1DI8A 5AV0A 3VJOA 4FEXA 3NNWA 5C9CA 3QRJA 3TWJA 3FMDA 4MH7A 2VTTA 4ZZMA 2VX0A 5ANEA 1UWJA 2GNFA 5M4CA 2J0MB 5KMKA 1V0PA 3BWFA 3LQ5A 5AR5A 3EQHA 5AUXA 4DITA 3A7GA 4R5YA 2R3NA 3PDTA 3V8SA 2IN6A 4OLIA 5E8YA 3U9CA 2BPMA 4RX7A 4CRLA 3DXPA 3H3CA 2FGIA 2YM7A 3A4OX 5EKOA 2C69A 4AU8A 2R3MA 3NNXA 3HA6A 3QHRA 3PSCA 3RHXA 4CQEA 4ZY6A 3C4EA 5HE2A 3QTIA 2AC5A 3QXOA 4U80A 3Q9XA 3BBWA 3ZXTA 4L7SA 4AN3A 5CANA 2OLCA 1JLUE 4V0GA 5LVOA 4IBMA 4O0SA 3W33A 3FKOA 4AOJA 3QTUA 3F2RA 1VEBA 2G01A 4WRGA 4WBOA 3ZTXA 4YZMA 4C36A 2WMBA 4W8DA 3ANQA 1PRYA 4KIKB 4GG7A 5AUVA 2UZUE 3RHKA 5LWNA 3GFWA 5TT7A 5IQAA 3SXFA 3MJ2A 3QTXA 1KUTA 3BYUA 4TWNA 2QG5A 4JNWA 5KMNA 1SZMA 2WQOA 1GY3A 3DS6A 4EYJA 4FTKA 1H0WA 3UMWA 3HX4A 2B9JA 1BUHA 3ZO1A 4JXFA 3DZQA 2DWBA 2VWXA 3K3JA 4JBVA 4QP1A 3VS7A 4YLLA 2JDRA 3PJCA 3G6GA 1YWVA 3DJ5A 1PMVA 3EQDA 3OY1A 4C35A 3CXWA 4H36A 4S34A 4F1MA 4LL0A 2UVZA 3ZM4A 3FMNA 1JAMA 4BKZA 5FDXA 3RAHA 3F3TA 4FG8A 1PJKA 4GG5A 4AOIA 4F70A 2C3JA 3EZRA 4U3YA 3LCOA 3KVWA 4DH1A 2HENA 4QMXA 4U9AA 4RJ5A 4CG8A 3D5VA 3KY2A 1OL6A 3MFUA 4FT5A 4HVHA 3TKUA 5EG3A 4W4YA 3G5DA 4FNXA 4IXPA 2YDKA 4QMWA 3RGFA 3G9LX 2WEIA 1UNHA 2IVSA 1NY3A 2F2UA 4USDA 5CY3A 1FGIA 2C30A 3O8UA 5EYDA 1S9IA 3VS0A 3VBWA 2C3LA 3D5XA 2QI8A 4V01A 5BNJA 2B4SB 5JGAA 2ZMDA 4XG3A 2C5VA 4DFNA 1OIRA 2CNUA 3R9RA 3GT8A 1FPUA 4P7EA 3W2RA 3MPMA 1U5QA 5H8GA 4FV0A 1ERKA 3IGGA 2YJSA 3TTJA 1CM8A 4RA4A 3VN9A 3SGCA 3QRTA 3VIDA 2YM6A 5HG5A 4YTIA 5H8BA 4EOMA 1P2AA 3B8RA 2JIVA 1Q62A 4O96A 4S30A 2W99B 3PPJA 4FYNA 2QOOA 4AFEA 2QU5A 4EZ5A 5DMZA 2XM9A 3DCVA 2VGOA 3PIZA 3AC8A 4FV1A 4ZSAA 4ZLYA 3HRBA 1IAHA 3DGKA 3LCKA 5J9ZA 3FLSA 1GAGA 4FL3A 4NSTA 5J87A 1KE5A 3P4KA 2XNNA 1IAJA 1J7UA 2CGUA 3NIZA 2OZAB 4FKOA 3FJQE 4G5JA 4C57A 3F66A 1IRKA 3HKOA 5HE1A 4YNEA 2YLEA 1JQHA 3V8TA 3MIAA 4TYHB 2JGZA 4H1JA 4K9YA 4HPTE 3LFAA 3RK9A 2HZ4A 5ANGA 4LQMA 4W4WA 4F65A 3O71A 3ZDIA 1U54A 5CNOA 5A6OA 3N51A 5IKWA 5M08A 4J53A 2WTKC 5I3OA 5E1SA 1R3CA 2E9OA 4FK3A 4F0FA 3QQJA 2CPKE 1NVSA 4FSMA 4FTQA 5D12A 5AV1A 3SHEA 2XKCA 3FUPA 3U87A 3VULA 4AW1A 2UZVA 2PZIA 1ZYLA 4FV8A 5EM8A 4BIEA 2PVRA 2HXQA 3O51A 4NT4A 3IW5A 3TIYA 3W8QA 1H01A 3R1NA 3DBCA 2R7IA 3MY1A 3PVWA 4ZTNA 3R2YA 3FLQA 3HV5A 4W9WA 5DI1A 4D28A 3DXQA 5AMNA 4F1TA 4GCJA 4XV1A 4UY9A 3E63A 4KSPA 4EHZA 3A60A 2VZ6A 3F3WA 4IJPA 5FM2A 3ORZA 3HLLA 2R5TA 4EOLA 2VTIA 3VS1A 2HWOA 4L52A 2G1TA 4L3LA 4QTBA 1CKPA 2XK9A 3PG1A 5L8LA 2WTIA 2XP2A 3GC0A 4FEVA 2H96A 3JPVA 2QOBA 1U54B 3TDWA 2F57A 1R0EA 3EL7A 2QLQA 1DAYA 2YDIA 4BHNA 4RZWA 4I4EA 4FSYA 4BDCA 5DH3A 1W7HA 3NR9A 1Q8TA 5KZ0A 2O65A 3CTHA 4E73A 4EH3A 3OEFX 3I0QA 3NYOA 3C5IA 5HORA 2X4ZA 4BDBA 3MIYA 4TYGA 4S31A 3VBXA 4QRCA 4S32A 3ZCLA 4FTNA 4X2KA 5E92A 3ZS5A 5M06A 3PG3A 4L67A 5KCVA 3SXSA 1V0OA 4RJ6A 5EI8A 3CJGA 4MXOA 2GNGA 3OHTA 2WXVA 2OG8A 4KIPA 5EI2A 1OM1A 1H00A 2PE0A 4Q5EA 4BYIA 1FVTA 5LMKA 5CSXA 1Y8GA 2YCRA 4WNMA 2CSNA 4U8ZA 5L8KA 1XBBA 2WAJA 4BTFA 3S0OA 1G8AA 4XP3A 2B9FA 1B38A 3DB8A 3O96A 2VN9A 4G3CA 4IB5A 4HPUE 4Y83A 5HICA 3PP1A 5A14A 4BCQA 1XH8A 4PL3A 3RM6A 3VW8A 4I6BA 4BKYA 4JG7A 3NLBA 4CV8A 3S3IA 4DTBA 3NPCA 2EVAA 1IEPA 4QQTA 4G9RA 4IC8A 1OIUA 3S4QA 4DEIA 2JITA 3EB0A 2VO6A 1O9UA 2PVMA 3DT1A 3PPZA 3LFNA 4BGQA 1REKA 1H0VA 3HEGA 3NW6A 3QUEA 2OF4A 4O0XA 4CYJA 4FEUA 3QZFA 2JLDA 3ZRKA 4KUJA 5HEZA 5IA1A 3QWJA 4A9UA 1CSNA 4IC7A 3LOKA 4AXAA 2EUFB 5CSWA 2XK4A 4CT2A 3Q4CA 2R0UA 5C8KA 3JXWA 4DTAA 4RFMA 5KKRC 2XEZA 1WBTA 2PTKA 2R4BA 2W1CA 3CLYA 2PZPA 1Q8YA 3VUMA 5ANIA 4OTDA 5AP2A 3FZRA 1SVEA 1XHAA 4IWOA 2WOUA 3Q6UA 4U44A 2J0IA 5KE0A 3IOKA 3UIBA 3MPAA 2WMAA 3K5VA 5AM6A 3ZU7A 1KE9A 1NVQA 2BR1A 3LLTA 3V5PA 3CQUA 4R8QA 3GVUA 3Q9WA 1EH4A 5A54A 4DAWA 2QURA 2NPQA 3OCTA 2R3FA 3W2QA 5J9LA 4QMZA 5EYCA 4C4GA 2BMCA 4KKEA 2OKRA 4XOZA 1R0PA 2P0CA 3A7HA 2HW6A 3Q5ZA 4WO5A 4FT7A 5KO1A 1E1VA 4WG5A 2GDOA 4TWPA 2A1AB 1YXTA 3FMEA 3MDYA 4LRJA 4TXCA 4DH3A 3KK8A 5DNRA 1OL5A 4FV9A 5EFQA 2ZM3A 4GRBA 3QLFA 2WEVA 1B39A 2ITTA 1Y6AA 4ZY4A 3L9NA 2CKOA 3KF4A 5C03A 1OI9A 1ZARA 1M17A 4JG8A 3KFAA 4IM3A 4UWBA 3L9MA 4PMMA 3PRIA 3VBYA 1F0QA 4ZLOA 4IVCA 2PVJA 3DK6A 4I21A 2ZDTA 4YR8A 3TTIA 4YTFA 2PVYA 3JVSA 3C7QA 3SG9A 3UOHA 4H39A 4D55A 4WNOA 1Q3DA 1ZAOA 2R64A 3LFQA 4OTPA 1MRUA 4U43A 4BGHA 3UE4A 4G2FA 3AC4A 3KK9A 5JSMA 3ZSIA 3B2WA 4R6VA 4D4VA 3UQCA 5K0KA 3E64A 2W1IA 4XP0A 4BL1A 3MFRA 4FVQA 3Q5IA 3SRVB 3Q6WA 3QCSA 2W1HA 3BYVA 3C4CA 3D7TA 4X21A 1WBNA 2WOTA 3GU7A 5DA3A 5DLSA 2GQSA 4FF8A 4C3RA 1WMKA 3CP9A 1JOWB 4IMYA 3U4WA 2Y4PA 3GP0A 2ZJWA 4RQKA 3WF5A 2J4ZA 2YM3A 4TY1A 5I9UA 4ENXA 1Z5MA 3I81A 3N4TA 4EWQA 5BYYA 5KMIA 2XRUA 3C4ZA 4CD0A 5CF4A 3TI1A 2YCFA 2WB8A 4O0WA 5G1XA 4AGWA 4LYNA 2IWIA 5GZ9A 4QYEA 2WMUA 4AZFA 4E6CA 3QX2A 4BDJA 4JDIA 3EFWA 3RNYA 1ZWSA 5JZJA 3W2SA 3CR0A 2IZTA 2VO0A 3G0FA 1KSWA 4I5HA 3R83A 1TQMA 2JKOA 5LOHA 4XYFA 4EOOA 2E9NA 4FTLA 2ACXA 3UODA 5JZNA 5A9UA 4Q5HA 3R7OA 5GJDA 1J7LA 4P5ZA 4AACA 3E3BX 5BVEA 3DJ7A 4BTKA 1Y8YA 1YHSA 4E1ZA 5I9VA 2UV2A 3NWWA 3KL8A 2WZJA 3D5UA 2C6TA 2CGVA 3EN5A 4KA3A 3OS3A 4KD1A 5CAPA 4IX3A 1KV1A 4TT7A 5KKRB 5E8WA 4IWQA 4FTMA 4IFCA 3CY2A 2JBPA 2QOHA 4ARKA 4CKIA 5IDPA 2I0HA 2I6LA 5J95A 4PMSA 2A19B 1BX6A 3OUNB 4W4XA 1VYZA 5CT7A 3GB2A 1V0BA 3UIUA 3OCSA 4I20A 1WAKA 3TJDA 4E6AA 3EQBA 2BDWA 1MQBA 3P86A 3O7LD 2HY81 4WNKA 4F6WA 4F7NA 2Z02A 2Y7JA 4TL0A 1H26A 4MNEA 1BI8A 5IEXA 3LLAA 3V5QA 4UWYA 3PWYA 4OGRA 3DU8A 3PE2A 4GS6A 5AA8A 3SW7A 3A2CA 4U79A 3NNUA 3PIYA 3L8SA 4FT9A 4TYIA 3D5WA 3LW0A 3C4FA 4XG6A 5ACBC 3OMVA 4FUXA 2WTJA 4IVAA 5AX9A 3HUCA 3SLSA 3EQRA 3UPXA 4D2TA 2ONLC 2XBAA 4GK4A 4YJNA 3QYWA 5FGKA 2PMLX 4O27B 3R04A 2NRUA 5AP1A 1JWHA 2BIKB 4RVKA 4CZYB 4F6SA 1M14A 4FTIA 2YM5A 2WIPA 3GCUA 4DFZE 5HD4A 5JMSA 4DHFA 1ZOHA 3FDNA 4UBAA 4ENYA 3C0HA 5IISA 2BFXA 3H9OA 4O0RA 4A9TA 4H3BA 4PTGA 2V7AA 2VTSA 3TEIA 3E8DA 4Z3VA 3LFFA 2G15A 4XBUA 4RIXA 1H28A 4BY9E 3GC9A 3MN3A 1OKZA 5GJFA 4BIBA 4CZTA 3SDJA 4S2ZA 3VJNA 2C6LA 4S33A 4FBXA 1CMKE 5CZIA 4BCOA 1H1WA 3BX5A 2A27A 5L6PA 1M2QA 4FKVA 5CU2A 3GCPA 3LAUA 1PMEA 4AE6A 3UO5A 4G17A 4M12A 2W5AA 4HYSA 2GNJA 4MXYA 1WVXA 4XG9A 5EHOA 4L9IA 1SM2A 3UJGA 5L4QA 4DT8A 2WQMA 1IA9A 3TN8A 4TRLA 2OICA 4I22A 5EW3A 4AZWA 4D2VA 5GJGA 1AQ1A 2XH5A 4NU1A 3CQWA 4FNYA 4QMPA 5AP0A 3OWPA 2EWAA 3Q04A 4U97A 3A7JA 1OL7A 4GYGA 5JGDA 3BYOA 4KIKA 4OTFA 4WD5A 5KHWA 3DZOA 4UXQA 3QUDA 3IDPA 4BN1A 4RWLA 4BCKA 2PVLA 3HMMA 3FSFA 5M4FA 2ITYA 3PTGA 3MS9A 4AFJA 4RIXB 3CD8A 5M56A 3HNGA 4U41A 2PSQA 4ITHA 3WF9A 4QOXA 4DG2E 3SKCA 3LIJA 3ZMMA 3JS2A 2YISA 1PKDA 1H08A 2QHNA 2XF0A 2HIWA 2Y6MA 2W5BA 2R3IA 3ZUUA 5EW8A 2FSOX 3LM0A 2OF2A 2PZRA 1YXXA 2DUVA 3H9FA 2Z2WA 3QD3A 4IW0A 3ZFXA 1J91A 5IA5A 4PDPA 2H6DA 4IFGA 5L2SA 3RI1A 1FGKA 3GU4A 3OC1A 2OSCA 4A07A 4FZFB 3FPMA 5TR6A 4G3FA 3CQEA 4ZTLA 4F99A 3R0TA 3SC1A 1KE7A 1ZYDA 3LMIA 1R39A 3FLNC 3I4BA 4QTEA 2HAKA 3FMMA 3HV7A 5FBNC 4ZS4A 2IW9A 3ORNA 1OKWA 4FMQA 2O2UA 4FG9A 4PTEA 2W05A 1VZOA 2CMWA 3P79A 4DBNA 5FDPA 3BEAA 5DYJA 4ZMEA 3FZPA 4FC0A 3QCXA 3DBEA 3QZIA 5J9YA 3DQXA 2YWVA 5BUJA 5A4EA 4F4PA 2X2LA 3TNWA 4BWKA 4FIIA 5J7BA 4H05A 2QCSA 3D9VA 4O7RA 3MA3A 3P7BA 4FVRA 4G6NA 4N6YA 4BRXA 2YFXA 3O2MA 4KWPA 4C2VA 4YSMA 1YXSA 3RWQA 4ZAUA 1ZYSA 2VTNA 3F82A 2C5OA 3HDNA 4WG4A 5CSHA 5M44A 4Q9SA 3W2OA 4BDAA 2UW0A 4FT3A 2HK5A 5DT4A 4DFYA 3GCQA 4BFMA 4BDKA 4IIRA 4HGSA 3WYXA 4AW0A 2OJ9A 2J0JA 1T46A 3AC2A 3LM5A 2UVXA 4FL1A 3BU5A 4QD6A 5DT0A 1CKJA 1G8SA 5AAGA 4TPTA 4HYIA 4AUAA 4IVDA 3EFLA 3MY0A 4EONA 2E9UA 4ZJIA 5L2TA 4F7SA 2C68A 4GFOA 2X0GA 5LWMA 5KX8A 5KZIA 3DBDA 2QHMA 2XK6A 3G90X 2PE2A 2X7OA 4XLIA 4JS8A 5DEYA 3BQRA 3TACA 4BBEA 4PUZA 3AC5A 3QCQA 2OU7A 2RF9A 4F1OA 4ACDA 3QWKA 3ROCA 3R1QA 3EHAA 3G9NA 3KMMA 4MVFA 3WYYA 4CFVA 4CKRA 4O7WA 3CCNA 2FYSA 4O7LA 4L43A 4ALUA 3FC1X 3PY3A 4RC3A 4L3JA 1TVOA 5C01A 2YZLA 5IQEA 4A9SA 2VO7A 2YIWA 4ZTHA 5HBJA 4BTJA 5JFXA 5CEMA 2OW3A 3HMNA 5C1QB 4YC8A 1VR2A 3QUPA 1XH7A 4FKSA 5AX3A 2QOFA 2UW4A 3ACKA 5I4NA 4JBPA 4RT7A 2PHKA 3FKLA 4ANSA 3MSSA 5CU4A 4BCFA 1TQPA 2KTYA 1OBGA 4O7VA 3OOGA 5H2UA 4ZZOA 2JEDA 3DBQA 4X6QC 4C34A 4PP9A 4X3FA 5DR2A 3A8WA 3TNQB 2BUJA 1URCA 1IASA 3MW1A 5H9BA 4IE9A 3V5TA 1RE8A 2HCKA 5EOBA 3KC3A 4JQ8A 4C7TA 4IADA 4RWIA 2JDOA 2CCIA 1T45A 3BBTB 1O6KA 3ULIA 4K2RA 1GZNA 3DKFA 5HE0A 4EEVA 1OL2A 4NM5A 3UNJA 4PDOA 3SX9A 3R8ZA 4MKCA 3EL8A 1OIQA 4OW8A 1K9AA 4WT6A 4DEBA 5HLNA 4GKHA 4XV3A 4DT9A 3DV3A 2WTVA 3LMGA 4ZJJA 4C62A 5FLFA 4F7LA 3RMFA 5I5ZA 5HGIA 4J8MA 2OJFE 3G6HA 3KCFA 2GHGA 4FNZA 4M69B 3UTOA 4BGGA 2XKDA 4FV4A 2CKPA 4FNWA 3E8NA 4R3RA 2W5HA 2HYYA 4MXAA 3R7YA 3DTWA 3MFTA 3P0MA 4C59A 2PUNA 4I0SA 3QLGA 4O0UA 2B9HA 3UZRA 2JFLA 3AMAA 2VX1A 1MP8A 5C4KA 5A4QA 2WMRA 3LJ0A 4BDDA 4DH7A 1RJBA 2E9PA 4FSUA 3SG8A 2X8DA 5KMMA 4YHTA 4FKPA 3NZ0A 4YJTA 3MESA 5CNNA 4CKJA 4X7QA 4TYEA 4E5AX 1OBDA 1JSTA 2NNWB 5HVJA 4MEDA 4N6ZA 4WRSA 1SNUA 1OB3A 4FG7A 5HX6A 1U4DA 3RCDA 3MGYA 2QKRA 4KABA 5CI6A 3QKLA 3UP2A 3F2NA 3FV8A 1YDTE 3RZBA 4G5PA 3UVRA 2RGPA 1H24A 4HVSA 3IK3A 3WZJA 5JN2A 5EI6A 3JR1A 5EKNA 5FXRA 1Q61A 2QO7A 3GBZA 1OGUA 2Z7LA 4BKJA 2WGJA 3IW7A 4HCTA 3D15A 3D94A 4NIFA 4RRVA 4KBCA 3RKBA 1L3RE 2UZBA 5HCZA 2E2BA 3JUHA 1SMHA 3CSVA 1QPDA 4F09A 4NW6A 2REIA 4PRJA 3ZLSA 3BV2A 3ACJA 3R9HA 3SD0A 4BBMA 4ZJVA 4QMVA 2YHVA 3Q3BA 5BUEA 3FHRA 2XJ2A 4FSTA 4Y72A 1UU7A 2VTPA 4BICA 5EQPA 4FZDB 4KBKA 4M7IA 3WIKA 3HVCA 3IOPA 3QA8A 5HO7A 1I09A 1OIYA 2VTQA 2BKZA 4M13A 5FEDA 5IPJA 1Q24A 2R3GA 1YDSE 3QZGA 4NCTC 1YKRA 2RFDA 4XOYA 5HX8A 1PXIA 3VF8A 1J1CA 5FG8A 1LUFA 4UX9A 4F9YA 2JIIA 2EU9A 4PL4A 4P2KA 4U6RA 1HCKA 4UEUA 2PU8A 2UUEA 3OBJA 5HI2A 5EYKA 3PLAE 1M52A 3GI3A 4ONAA 3QC9A 1JSVA 3VHKA 3UPZA 5HE3A 3R7VA 1TQIA 2HW7A 3EKNA 5GZ8A 5IA0A 2QG7A 2OGVA 3TNIA 5JRQA 2UW9A 3C0IA 5EH0A 5K5NA 4LV5A 2PULA 2YIXA 5GNKA 3PFQA 3KMUA 2C4GA 4CGAA 3UZPA 1APME 4I6QA 4NZWB 2JBOA 3RZFA 3TZ7A 4BHZA 2H9VA 3EFKA 4EHVA 4FKRA 3WF8A 2IO6A 2R3LA 5CAVA 3R6XA 2XNPA 1YI4A 2PVFA 3ZEPA 4ALVA 3TIZA 1Y6BA 3OCGA 2VWWA 5DIAA 4YHJA 4BCNA 4CFXA 5BPYA 3RAIA 2ITQA 3F5UA 3UBDA 4AT5A 3DAEA 4BI0A 3QRUA 4KIOA 3R7UA 4CFNA 4M0ZA 4NKAA 2ITXA 4ANOA 4PY1A 3KMWA 3OROA 4X2FA 5LMKC 4RGJA 4FV7A 4IB1A 4QP6A 3AG9A 4J99A 2X7GA 4UZHA 2GS7A 3V5LA 5LXMA 4FTRA 3MTFA 5LVPA 3S95A 4IH8A 5CEQA 3ERKA 4ZY5A 4BCIA 3FPQA 2BHEA 3TM0A 4Q2AA 5HOAA 4FR4A 4O84A 3PA5A 4J8NA 5IQHA 4M3QA 3DLSA 3UC4A 3ENMA 3HV6A 4JDHA 3KULA 5HTIA 2J0KA 2FSMX 5T3QA 2XB7A 2ONLA 5JRSA 3RPVA 3V8WA 3W18A 4E7WA 2BRBA 4D4YA 3HECA 2F7ZE 5D7AA 2C1BA 1P5EA 4ZSGA 5AR2A 3DPKA 2B54A 4JLCA 4ZTMA 4ANBA 5IMEA 1OKYA 3UNKA 3I0OA 4LM5A 3Q4UA 3NDMA 2P55A 4I93A 5D10A 4NM3A 4JX3A 4TYJA 4UN0C 3F61A 3HP2A 4IANA 3E8EA 3UO4A 5G6VA 4RC2A 3R8MA 4I6FA 4DGMA 1QCFA 2ZV2A 5DBXA 4BDFA 4XLVA 4CLJA 2VNYA 5CLPA 5AJQA 2B55A 3QRKA 5FXQA 3UVPA 2PMNX 4BDIA 2F7EE 5ANJA 4HVDA 2W17A 4JRNA 4HJOA 1H25A 3UVQA 5M4UA 3PVBA 4O86A 5K0XA 3GU6A 2ITNA 5HO6A 2XBJA 3GEQA 1REJA 2WD1A 1FMOE 4OT6A 4C4EA 3DA6A 2H8HA 4ASEA 4AG8A 4E6DA 5D1JA 4EC9A 5HTCA 3MVHA 2PUPA 1NVRA 4OTWA 1ZMUA 4BF2A 3L8XA 4WNPA 3PJ8A 3RNIA 4ANNA 4E5BA 2X39A 3QGYA 4R1YA 4F63A 5IQGA 4NK9A 3QD2B 3FQEA 1XBCA 3RTPA 5AUYA 5HNIX 4FL2A 4YJVA 2DYLA 2W96B 3NYXA 5F1ZA 3ZC6A 4JX7A 5J1VA 3EQFA 5HZNA 3DAJA 3ODYX 4CFWA 3RP9A 2FH9A 3P1AA 4JL9A 4CLIA 2WTKB 4NIFB 4MNEB 4YC3A 3RPSA 1BKXA 3OWJA 5E1EA 4ZSLA 5IQCA 5CI7A 4AS0A 3CGFA 5JFSA 2WU7A 3VUKA 1NXKA 4M0YA 1ZYJA 4WBBB 5DN3A 5CEIA 4EOKA 4O7NA 4G6LA 5ICPA 2RKUA 3KB7A 3AQVA 3FXWA 3SXRA 4YHFA 1L8TA 4L53A 4OTIA 5AUZA 2GNHA 3AT2A 3MI9A 4Q9ZA 4C02A 1ZRZA 3DNDA 1OZ1A 3QFVA 5HCXA 4ZZNA 4ACGA 4QMYA 4CQGA 5BVDA 3LFSA 4IHPA 2XK3A 4MTAA 4RIWA 3GGFA 4W9XA 2HWPA 3NS9A 4WA9A 3TZMA 4CTBA 3ZHPC 4C37A 4LG4A 5E8TA 5A3XA 2VWIA 2Y6OA 2YAAA 4GEOA 3OG7A 2CDZA 5DRBA 4EORA 3PJ3A 4QT1A 4DFXE 5DT3A 4F9WA 2J2IB 5A4CA 3QQFA 4FOBA 2Z8CA 4UMTA 5AR4A 4G3GA 3ULZA 3KRRA 3IECA 4FODA 3NUYA 2PY3A 1LPUA 3EKKA 3VC4A 2OIBA 3WARA 2GHMA 4DGLC 2X4FA 3ANRA 5E4HA 4ZXTA 1XH9A 3ZZEA 3MY5A 4CXAA 4DLJA 3HMIA 2H34A 3I79A 4BWXA 3NAYA 3NYNA 2PK9A 3F3ZA 5HIEA 5F95A 4XUFA 4D5KA 3NUNA 5AP4A 4V05A 5AA9A 5IA2A 5IF1A 4U40A 2JDTA 2ZV7A 5AEPA 4FKQA 5EHYA 2ESMA 3GENA 3TV6A 2GQGA 4WUNA 5DEWA 2B52A 4IZYA 3RAKA 4C4FA 3VBVA 3AOXA 1OPKA 1PW2A 3VUDA 4DN5A 4R77A 3AD4A 4IACA 5BVWA 3JY9A 3NUSA 3BCEA 4M84A 1U59A 2IZSA 1B6CB 2ZAZA 1Q5KA 4QMOA 5JH6A 3C4XA 5EK7A 1YHVA 4L7FA 2YA9A 3G0EA 2FA2A 3O0GA 4GVAA 3P23A 3L8PA 4QYGA 4AZEA 3U6IA 2BTSA 3QL8A 5LARA 4Y73A 4BZNA 3DKOA 3COMA 4RFYA 1LP4A 3QXPA 3LQ8A 4GT4A 1BLXA 4EC8A 3HAMA 3VBQA 2FSTX 3QHWA 5J5SA 2XIKA 2RG6A 4D0XA 5D9HA 4FZ6A 2RL5A 3AC1A 4DEHA 5B2KA 2A0CX 5FRIA 3HYHA 1XH5A 4J71A 3PXFA 3V3VA 1IA8A 4YUQA 5BVOA 3FKNA 2YDJA 1YWNA 4U5JA 1YQJA 2XEYA 4XRJA 3FXZA 4Z7HA 2OH0E 3SW4A 3FLZA 3CJFA 4G16A 3ZRLA 2YN8A 4ZS0A 2X9FA 4RLLA 1H4LA 5IH5A 3FLYA 3IG7A 3RK7A 4FKUA 4TN6A 4UYAA 3OOMA 2XJ0A 1SVHA 3LFDA 1XR1A 4LUEA 1JBPE 3DAKA 3MYGA 1A9UA 5M51A 4EI4A 4CSVA 3NCGA 4I5CA 3VUTA 4FA2A 5AP7A 2X8EA 4MK0A 4RBLA 1S9JA 3NCZA 2YCQA 1JSUA 5D11A 4K33A 2BZJA 3QD4A 1YHWA 5FTOA 2BAQA 2XIYA 5A4LA 5E8ZA 1UNGA 4FSRA 2QOLA 2BRHA 4IAYA 4FSWA 2W1FA 5DPVA 2O3PA 2HY0A 4PV0A 3ATSA 3AGLA 3ET7A 1CKIA 3JVRA 2Y8OA 3N4VA 4J98A 4FE2A 3O8TA 2CGWA 5AADA 3C13A 3E8CA 3EWHA 3RK5A 4EH2A 5IQBA 2BFYA 4TZRA 5EDQA 4UYNA 2YZAA 5T6KA 4O82A 3R8VA 4F9CA 3EN7A 4I4FA 4O83A 5DFPA 3LE6A 4RJ3A 4OUCA 3DLZA 1UU9A 5J79A 4IZAA 2VTHA 2IZUA 4O7TA 4DFBA 3M2WA 5TKDA 2VGPA 3GOPA 1XH4A 3TDVA 3VBTA 3QQGA 2ETRA 4XP2A 4BTMA 3FBVA 2XNEA 3MPTA 4IM0A 4RJ7A 1PYEA 5AUWA 2EXEA 2V0DA 4BCPA 1WZYA 3QC4A 4ZSJA 3R7EA 3OTVA 4LGHA 3A8XA 3MH1A 4AA0A 4FKLA 3MVLA 3FMJA 1KE8A 5CYIA 5EM7A 5L6OA 2GTNA 3U54A 4DEEA 1ZMVA 4KSQA 3ZXZA 4CNHA 3DFAA 2BROA 4LI5A 3II5A 4QP3A 3T9TA 3CC6A 2X2MA 3E3PA 3A99A 1XJDA 2QD9A 4U7ZA 4OBOA 5D7VA 5IH6A 5HKMA 4M66A 3EQGA 4EJNA 4OAVB 3COIA 4I41A 5FUTA 2ZB1A 5IU2A 5LMAA 1GZ8A 4ZOGA 4UMPA 2C1AA 3Q60A 5DWRA 3R30A 2JKQA 4KAOA 2CN8A 2OJGA 3Q32A 3QF9A 3OTUA 3LFCA 2QVSE 2WQNA 4EYMA 4AF3A 3DY7A 3G51A 2YEXA 3BKBA 4J97A 5H3QA 4DG3E 3ORIA 3LMHA 2XA4A 5DRDA 5FEQA 4IVBA 4QPSA 3QA0A 5EQEA 1UNLA 2NP8A 5LCKA 3BV3A 4O0TA 3NW7A 4CFMA 4GT5A 3SQQA 5M4IA 4PNKA 4G3EA 3CEKA 5JFWA 2RFSA 2QOCA 5BX0A 2I0YA 2YCSA 3FMHA 4K77A 4H3PA 4NTSA 5CAOA 3DK7A 2R3KA 1BL6A 4EOPA 3OFMA 1JVPP 3F3UA 3U51A 5ITAA 3HRCA 3CTQA 2B53A 4AGDA 5ANDA 3FMLA 3DTCA 2WMSA 4MCVA 3FQSA 4Y5HA 3UIMA 3TXOA 5HLPA 4QMSA 5HIBA 3FEGA 3I7BA 4GL9A 3R02A 3EN9A 5HVKA 2IW8A 3T9IA 3DKGA 2JIUA 4DH8A 4IB3A 3Q4TA 3V5JA 3THBA 4JIKA 4L6QA 4BDGA 4RX9A 4Z9LA 1JKTA 3W2PA 1P4FA 3EH9A 3L9LA 2JFMA 2VWUA 3ORTA 4EH5A 4BC6A 3NX8A 3PIXA 3BHUA 4BWPA 3D14A 4L01A 1P14A 2PE1A 2C0TA 4K0YA 4WUAA 4R3PA 3CD3A 4G1WA 4HGLA 4HGEA 4O1PA 5CENA 5J5TA 1K2PA 4UZDA 1LEZA 4I1ZA 4MBJA 3M42A 3EN6A 1ZY5A 4FZAB 3UIXA 4FGRA 1YXUA 4M68A 4D4SA 4ERWA 4BCGA 3BYMA 5HG9A 3BLHA 3PZHA 4FTUA 4FK6A 3OY3A 1SVGA 2RSVA 4ZK5A 2XIXA 2XNGA 1JNKA 2ETMA 3JY0A 3EFJA 4R7BA 3D2IA 4GFGA 5E90A 1WBSA 3A61A 3ENHA 3LXLA 5CEPA 5JQ8A 3R73A 3C0GA 5TE0A 4RQVA 2XNOA 2B7AA 1F3MC 3PXKA 4OBQA 3TG1A 1J3HA 1QPCA 1ZLTA 5B2LA 3NAXA 3BPRA 4AZTA 2G2FA 3ZRMA 5T68A 1MQ4A 1XBAA 2KULA 3UG1A 2OBJA 3F6XA 3UG2A 3GU5A 4OBPA 4KKHA 4W4VA 4AX8A 2WO6A 5M57A 1KOBA 3E62A 4TKSA 2VWZA 3W10A 4FV6A 5CXZA 1DS5A 2P2HA 4NH1A 1H1RA 4EJ7A 5L2IA 1OECA 1CDKA 4MXXA 4DLIA 3E87A 2R3RA 5FP6A 5CEOA 2JKKA 4JAIA 3L1SA 3LCSA 4NM0A 4K11A 3F5PA 2YLFA 4MD9E 3TJCA 4QTDA 2C5YA 2RFEA 3W2CA 4DGNA 3HZTA 3R8PA 2EXCX 3VHEA 3FZSA 2GFCA 2OIQA 4EBVA 2XRWA 4IZ7A 1WBVA 3IKAA 2OK1A 3BHHA 4EK5A 4LOPA 1ZOGA 4X2GA 3SAYA 5BYZA 1PXKA 2IJMA 3G33A 3T8OA 3C9WA 4WKQA 1JKSA 4DYMA 1UU3A 5AV4A 5I9ZA 4ASXA 2YIQA 3UQGA 1I44A 4O6EA 3R21A 3NNVA 5AR3A 4IB0A 4H58A 3VNTA 1J7IA 2XUUA 3FZ1A 3GNIB 3PWDA 4I5MA 2VD5A 4FEQA 3FYJX 4FIEA 3TNPC 3QTSA 4RLKA 4B0GA 4BBFA 3C50A 4PMPA 5JFVA 4Z7GA 4CRSA 3DK3A 4J7BA 4V04A 5AM7A 3GFEA 3EQIA 3OWLA 4CFFA 2IZRA 4IAAA 4TTHB 4A4OA 4DTKA 4RVTA 5AIKA 3L8VA 2PVHA 1WBOA 2DQ7X 2OJIA 5IMXA 1LEWA 5CALA 2ZM1A 1W82A 2VTJA 1UV5A 2EB2A 3KKVA 4DINA 4DH5A 2C6OA 1ZOEA 2YERA 4RVMA 4C4IA 1Z9XA 5CASA 3L9PA 4J96A 3I5ZA 1OITA 1QL6A 1F5QA 2O5KA 3OW3A 4Y5QA 2UW3A 4BCMA 4ALWA 2VTRA 3QX4A 3H9RA 3R1SA 3ZUTA 4NYEA 4GYIA 5CAQA 2HZNA 2J5FA 1YVJA 3DBFA 4YZNA 1O6YA 3HAVA 4KNBA 3ODZX 4LGDA 2GNLA 3C51A 3PA4A 3FL4A 4FTCA 4UWCA 4XG4A 3BEGA 2WTWA 3IW8A 5FP5A 3E92A 3BE9A 4CTCA 2RIOA 2ZYBA 3P7CA 5I9WA 4HVIA 5AWMA 5ANKA 2F2CB 4QQJA 2P33A 2W1DA 3M1SA 4JR7A 2UZNA 4UMRA 2UZLA 4XV2A 4ZEGA 5I0BA 2NO3A 2J5EA 3DB6A 1R1WA 5A46A 3F5GA 1ND4A 4ANMA 1UU8A 3P5KA 3PY1A 5K4IA 3KXHA 3FLWA 4WSQA 3D7TB 3ORMA 3QU0A 1DAWA 5CQWA 5M09A 3HMOA 2C6EA 2WMXA 1O6LA 2PUIA 1GIIA 4RMZA 4GW8A 5JKGA 4TWOA 2C5NA 4I92A 2VAGA 3F3VA 2WELA 5DHJA 1FOTA 1YDRE 2G9XA 4CMOA 3QGWA 4YBKA 4PDYA 3Q52A 4RSSA 3NSZA 3LVPA 4LGGA 2R3QA 3WOWA 3FI8A 2QOQA 3LHJA 4USFA 4FTAA 3PZEA 4FKJA 4C4JA 5AV3A 2C6DA 4CZUA 3IW6A 3ROYA 3GXLA 2PL0A 2X6EA 2J50A 4FI1A 2ZMCA 3DJ6A 4FKWA 4EQUA 2JC6A 3AT3A 4O0VA 3WF6A 3DDQA 5BUIA 5KBRA 3UYTA 2JAVA 3O8PA 3LKMA 4G34A 4IZ5A 3F9NA 1PXPA 4QYFA 3QQHA 1PHKA 3ZYAA 4DFUA 2PZYA 4HW7A 3PE1A 4J1RA 2XVDA 4FSNA 1M7NA 2VNWA 4O81A 2FO0A 1GOLA 4I3ZA 4R78A 3GCSA 4YC6A 4ACHA 1WVWA 2GFSA 2UZTA 5K9IA 4BVUA 3IDBA 4II5A 2WKMA 2X8IA 4UALA 2RFNA 3MH3A 3PJ2A 2GMXA 1FVRA 3LJ1A 2VWVA 3TL8A 3QAME 3BE2A 4HCUA 3TT0A 4HYHA 4M69A 2AC3A 3GU8A 3U8WA 4YMJA 3PJ1A 2BDFA 4F64A 3GQIA 4JQ7A 4EOSA 1Q8WA 5FBOA 3EIDA 3CKWA 3R7IA 4JAJA 5E8UA 5CVFA 3IO7A 4GIIA 2W1ZA 3HP5A 4C58A 2GS2A 4QNAA 1NT2A 4LRMA 3TUDA 4X6RA 5IDNA 3BLQA 2AYPA 4LUDA 3UYSA 4EOIA 3A4PA 3IW4A 1IR3A 3KRXA 4MWHA 4XJ0A 4F9AA 4RJ4A 1YI6A 3S2PA 3UOJA 1GIHA 3EOCA 3BI6A 4X2NA 3HMPA 5HG8A 4CMUA 4EH8A 4NL0A 2QO2A 5B2MA 4GU9A 4UV0A 4A06A 4XG2A 3AC3A 2YIRA 3GQLA 4FT0A 3U4UA 4F0IA 5C4LA 3BU3A 4PPAA 3VS3A 5HO8A 4DCAA 4FX3A 4AN9A 3FL5A 2O8YA 4CV9A 2J51A 5I9YA 2XS0A 3BHTA 4O7YA 3QQUA 4MQ1A 3OXIA 4D9TA 1BL7A 5E9EA 4FUYA 3EJ1A 3HGKA 4FV2A 4G6OA 2JDSA 5ETFA 2FSLX 4FV3A 4JIAA 4O6LA 4AAAA 4R7HA 5IG1A 2VX3A 2FB8A 3CS9A 3TKHA 5LQFA 3V5WA 4E93A 4YLJA 4C2WA 4GK3A 5TO8A 5HNBA 3DQWA 3QZHA 4KIQA 5C8MA 3UOKA 4DEGA 4EKKA 3K5UA 4IAFA 4YU2A 2BAKA 3QQKA 1BYGA 4P4CA 2F4JA 3R8UA 1FBNA 1UVRA 2WMWA 2BALA 1IG1A 4YJPA 5L6WL 4B4LA 2XIZA 4L46A 5BMSA 2YIYA 3R9OA 4HZRA 4LOQA 4PPBA 1QPEA 2CHLA 3WZEA 3POOA 2CN5A 4D2RA 3Q2JA 5K3YA 4M67A 4YO4A 4U3ZA 5A6NA 4QTCA 4OAUC 2V22A 3ALNA 4M97A 1YXVA 3PVUA 4GH2A 3QKMA 4F9BA 1OVEA 4BI2A 1PXOA 3KXGA 3LXPA 2QOIA 4RFZA 1M7QA 4EK6A 2HELA 1K3AA 3R9NA 3RPYA 2R7BA 2I7QA 2Z60A 3VRZA 5HBEA 4U0IA 1PY5A 4D0WA 4EKLA 2QO9A 5EYMA 3PUPA 4TYHA 3RPOA 2C6MA 2VWYA 3FZTA 4W8EA 1STCE 3SV0A 4AOTA 4O2PA 4UXLA 3E5AA 5FTQA 5HNGA 3RBWA 1UKHA 1Y91A 1OUYA 2ZV8A 3PPKA 2J6MA 4M14A 2HZIA 2VTOA 3BHVA 4QTAA 5F9EA 4JT3A 5DR9A 4PF4A 5J1WA 5J7HA 4EOJA 2QONA 2W0JA 1UKIA 2GSFA 2LAVA 1U5RA 4Y95A 3VQUA 4E4LA 3NUPA 2BIYA 4YGAA 3TZ8A 1V1KA 4N0SA 4FV5A 4AZVA 4J52A 4EUUA 2XNBA 4ASDA 2ZVAA 4H1MA 1QPJA 1DM2A 3I5NA 2UW7A 5EQYA 3ZBFA 2CNVA 3ZM9A 4L8MA 2OFVA 3NVKI 5FD2A 4QMNA 3OXTA
chains in the Genus database with same CATH superfamily
2VTAA 2C3KA 3R01A 3OVVA 4AA5A 4AW2A 4DGOA 3OT3A 3I7CA 3KF7A 3QTRA 4LMUA 4EWHA 2Q83A 4FKGA 3MB7A 4MF0A 4JG6A 5CQUA 4YPDA 5EM5A 1Q8ZA 3RWPA 1G5SA 3KRLA 3ORKA 3VUHA 3UQFA 2ITVA 2IF8A 3W0QA 2IW6A 3UO6A 4JBOA 4EUTA 1JPAA 3FE3A 3UNZA 4Y46A 4FKIA 2V62A 4XS2A 4LFIA 2R3OA 4ANQA 3A7FA 4C33A 5IUGA 2BZHB 4IDTA 1PXJA 3KQ7A 3W0OA 2BRMA 4QP7A 4O1OA 2W4JA 3PSDA 4MF1A 4B8MA 4DCEA 3UDTA 5LVNA 1R78A 2XNMA 3MWUA 2P2IA 3AXWA 4FTJA 4IWDA 1MRYA 4JI9A 2I0VA 3D0EA 3PA3A 5CX9A 2UW6A 5FQDC 3W0MA 3OUKA 1HOWA 5FTGA 1MUOA 4BCHA 4X3FC 2ERZE 3AMYA 4GU6A 2CJMA 3WI6A 3Q53A 4BZDA 2EB3A 2O64A 4PTCA 4H3QA 1Q4LA 4DFLA 3OEZA 3LQ3A 1E1XA 3V6RA 4IM2A 5JGBA 3S1HA 2W9ZB 3MVMA 2QKWB 3OP5A 3LZBA 1H07A 2PWLA 4L42A 3B8QA 3MBLA 4MHAA 4NFMA 4RVLA 3Q2MA 3R1YA 5HQ0A 4ERKA 1URWA 3H10A 2B1PA 4FIGA 3BGZA 3B2TA 3UOLA 3W1FA 4YJOA 2YM8A 3T3VA 3CGOA 3ZLXA 4AT3A 2YACA 3R9DA 4ASZA 5DR6A 3MJ1A 3P7AA 4PX6A 4A7CA 2GS6A 5E91A 5EM6A 4YNOA 4B7TA 2QNJA 3VF9A 2YM4A 3ZSHA 2ZOQA 3WILA 3C1XA 5B7VA 3DKCA 4ZMFA 2BRGA 4RIYB 5CVHA 4A4LA 2Q0BA 3VUGA 1H8FA 4FIFA 4MQ2A 1JKKA 3NRMA 4D1XA 2XK7A 4O7ZA 4OTHA 4PDSA 4XEYA 2I40A 2J90A 2E9VA 2R0IA 2V55A 5B0XA 5DVRA 3MFSA 4PNIA 1PF8A 3C5UA 4YZBA 5IZFA 2XCHA 5GHVA 5KNJA 2OFUA 4LOOA 2W4KA 3E93A 3FC2A 2F7XE 4AZSA 3ALOA 4NKSA 3PSBA 2BHHA 5AR8A 3TV7A 4C8BA 3O50A 3ZZWA 3WZUA 4YURA 4ITJA 1Y57A 3OZ6A 3FQHA 5BVFA 5GZAA 1GIJA 3GC8A 2R3PA 4GJ3A 5GIOE 4KBAA 2Q0NA 3QYZA 2XZSA 4GUBA 2X9EA 3HUBA 4NWMA 4B99A 1H1QA 3W32A 4EH9A 1X8BA 4APCA 5FEEA 2HXLA 3BGQA 2Z7RA 2YABA 4HCVA 2ZDUA 4B9DA 3VS2A 4PWNA 3ORLA 3VRYA 4ANLA 2C0IA 4O2ZA 5AAFA 3PXYA 4JBQA 4QPMA 2CCHA 3FXXA 2YAKA 2XJ1A 1H1PA 3Q96A 4K1BA 2G2HA 4NM7A 3FI2A 2W1EA 5HU3A 2JDVA 2QR7A 4P5QA 3AKJA 2ZM4A 4XRLA 4NJ3A 3QRIA 5C8NA 3QBNA 1OPLA 3IDCA 3RAWA 2BILB 2I1MA 1KE6A 2IEWA 4FTTA 4D5HA 5KHXA 4N70A 2X2KA 4UMUA 3RCJA 3LXKA 5FWKK 2VTLA 4NCTA 4XBRA 1G3NA 3R00A 2CKEA 3F5XA 3ZO2A 3EMGA 4K8AA 3LJ2A 4QP9A 3Q9ZA 4TNDA 4APPA 2J7TA 2PMOX 3ZSGA 3AD6A 2A2AA 3BWJA 4BB4A 5C26A 3F88A 4ZP5A 3CIKA 1TZDA 4EZ7A 2XCKA 3WF7A 3AT4A 2GU8A 4G3DA 1AD5A 4KKGA 4KS7A 3HV4A 1ZZLA 2NRYA 3H0ZA 4CEGA 4EK8A 3OF0A 3EYGA 4GIHA 3ZFYA 4HYUA 4RIWB 4C0TA 2GTMA 3FHIA 4YPSA 3FAAA 4U45A 4L00A 4QMMA 5CSPA 2GCDA 2XMYA 2WPAA 4YZ9A 4FIHA 3RINA 5A4TA 4YP8A 5LJJA 2IVVA 1JKLA 3I1AA 3P08A 3VS4A 4L44A 4AXCA 3SRVA 5F94A 3RALA 3TUBA 4XV9A 2QQ7A 1ZZ2A 1U46A 4QPAA 1RDQE 4XCUA 5F4NA 4E4MA 4D2WA 5GIPE 4QDEA 4YJRA 4RX5A 2Z7QA 3E7OA 4HVGA 4IAIA 3DDPA 5DGZA 1PKGA 3W55A 3R2BA 3V6SA 3WZDA 4A4XA 1YOMA 5L2QA 5JK3A 4QMUA 3VS6A 1PXLA 5K5XA 4YBJA 5KMLA 4N4SA 3W16A 1W83A 4I5PA 4EK3A 4YZDA 4QQCA 5AUUA 4CCBA 5JEBA 4F0GA 4FGBA 4C61A 2O0UA 2YITA 1WBWA 4YJSA 4ZIMA 4AW5A 5EW9A 3UMXA 1PXMA 4MAOA 3SOAA 5C27A 1OKVA 1OL1A 3COHA 2GHLA 4AA4A 1W84A 4R3CA 1P4OA 3OD6X 1FVVA 2B9IA 2IVTA 3R8LA 2HOGA 5AIRA 5TOZA 1Q3WA 3O23A 3KA0A 2ITOA 3NW5A 3OCBA 4DG0E 3HA8A 5L8JA 2PPQA 4WIHA 4BDEA 5HD7A 2VUWA 5HCYA 4IAKA 3NMUF 4YTCA 3GUBA 4MWIA 4FOCA 5CU0A 2WTDA 5BYLA 4AGCA 4FYOA 1ZMWA 4ACCA 3POZA 3FI3A 3KCKA 4GVJA 4RG0A 4DEAA 2VO3A 4JR3A 4E4XA 3LFBA 3QTQA 5E8SA 3ZONA 2GQRA 2BAJA 2Y4IB 2PVKA 3H0YA 4IEBA 4O38A 5DG5A 3WE8A 3ETAA 4XMOA 2ERKA 5F20A 3PXQA 4JOAA 3REPA 4BR3A 3ORXA 4TWCA 1KV2A 5H8EA 4PL5A 4FSZA 2C3IB 3QALE 3CBLA 1NA7A 3UGCA 1GJOA 3MTLA 5JQ5A 3HDMA 5HBHA 4E26A 4YTHA 1WVYA 2C6IA 5FM3A 5LVMA 3TZ9A 2BKKA 1SYKA 3ZLYA 3CE3A 4C3FA 1J1BA 1W0XC 2GNIA 3ZDUA 3O17A 1XO2B 3FY2A 2WFYA 3TNHA 4DEDA 4NJDA 3FWQA 4MBLA 5CF6A 4HZSA 2WNTA 4L45A 3KGAA 2X1NA 4NW5A 4QP2A 4O0YA 4QYHA 5HLWA 4JRVA 1XH6A 2F9GA 5EDPA 2W9FB 2XYUA 1AGWA 3WE4A 4EBWA 3I6WA 1XMLA 2XKEA 3ELJA 4IX4A 3NIEA 4FKTA 4WHZA 4QQ5A 1PYXA 5HESA 2RG5A 4WG3A 4ZTSA 1FINA 3D2KA 4D1ZA 3G2FA 4YJUA 2V7OA 3RJCA 3ZOSA 4R7IA 4EHEA 2JKMA 4CCUA 4CVAA 2X0QA 1GZKA 3DOGA 3KULB 3COKA 3D7ZA 1MRVA 4L68A 5HU9A 4QMLA 2ITZA 2VTMA 4KRDA 3TV4A 3ATTA 3W0NA 3PP0A 2XIRA 3K2LA 5IEVA 2R3HA 5IEYA 2ZV9A 3MVJA 3EN4A 3OT8A 4RWJA 4MXZA 4RPVA 4MBIA 5IUIA 4YO6A 3S00A 1A48A 4I24A 4IAZA 4KRCA 3VS5A 2YWPA 4ZTQA 1HCLA 4DGGA 4CT1A 2JD5A 4OR5A 3ZUVA 2W1GA 3EQPA 4ACMA 1XQZA 4I94A 2QLUA 1KOAA 4QMQA 3KRWA 2IPXA 3KVXA 4EQMA 3KXMA 3CPCA 2FVDA 2W4OA 2WHBA 3FYKX 3ZBXA 4USEA 1Q99A 3I6UA 1Q8UA 5KMJA 2CNQA 2F49A 1OPJA 3CY3A 1PXNA 1WBPA 4PMTA 3ID6C 4X2JA 4XG7A 4YLKA 1A06A 4D2SA 3DNEA 4IX5A 2CGXA 2J9MA 2C6KA 3ZH8A 4N57A 2I0EA 4MD8E 4XG8A 4GV1A 3BLRA 4EL9A 2PVNA 3V01A 1KWPA 4FVPA 2IVUA 3PYYA 4JQEA 2G2IA 5ETCA 4F7JA 3BZ3A 4YZCA 5DOSA 4GKIA 1E9HA 3IONA 3BHYA 5KMOA 4M8TA 5CVGA 2AQXA 2WMTA 2W7XA 4MYGA 5CT0A 5HG7A 2ITPA 2FUMA 3V51A 1DI9A 2PUUA 1VJYA 5HHWA 4RA5A 3CPBA 3ORPA 4O4CA 3D83A 4E4NA 4E8AA 3MV5A 4JDKA 4RIOA 2A4LA 3A7IA 4E6QA 3BIZA 4F08A 5IH4A 4MNFA 3RVGA 2X6DA 3SOCA 1YI3A 1YRPA 1OMWA 3K3IA 4ORKA 5CWZA 1H1SA 4C38A 4A9RA 5GINE 3OXZA 3KXZA 3MB6A 4GT3A 5IQFA 3UDBA 3DXNA 3A62A 3KU2A 4NUSA 4RIYA 4ZLZA 3EYHA 4JVGA 3PXZA 4QP8A 1WCCA 3U9NA 2VV9A 4L3PA 3OW4A 3F7WA 5L3AA 4LMNA 4V0GB 3P9JA 4XX9A 3N4UA 2LGCA 3GOKA 3TUCA 3NEWA 5AAEA 1XWSA 5IUHA 2YJRA 2QR8A 4I6HA 4EQCA 5KUPA 5EDRA 3UDSA 1FQ1B 4DF3A 2ZB0A 3VO3A 3U6JA 3NYVA 1M2RA 5ACKA 1OUKA 2BVAA 4CFUA 3BELA 3KN6A 5ETIA 1NW1A 3UC3A 3UP7A 4KS8A 3FZOA 3IGOA 1TKIA 3BQCA 4J95A 2HZ0A 4DA5A 2C0OA 4C4HA 3D4QA 4XH6A 3LCTA 3H30A 3N9XA 2WIHA 4LRKA 3QQLA 3Q4ZA 3R22A 4GMYA 4I0TA 4EHGA 2PYWA 4CG9A 3IPHA 4U42A 4WOVA 5TF9A 5AP5A 2OH4A 4QNYA 1FMKA 4EH6A 2Y0AA 3VQHA 2OXYA 5CF8A 2C47A 4TW9A 4YSJA 5IQDA 2ETKA 3RPRA 4X3FB 3DFCB 3ZC5A 2ITWA 3KXNA 2QOKA 4BIDA 3F2AA 3IQ7A 3E88A 4X0MA 4LV8A 3BRBA 4BJJA 1H27A 5CTPA 4B6LA 4F6UA 3ZO3A 3VVHA 5AR7A 5AV2A 3R28A 4AT4A 3FMKA 3CKXA 3O7LB 4QYYA 2BZKB 4D9UA 2UW5A 3MH2A 3NUXA 4AE9A 4BCJA 5BVNA 3E7VA 4MD7E 4GFMA 1ZXEA 3ZFMA 4CYIA 4D58A 2OXXA 1Z57A 2SRCA 2UZWE 3NUUA 4JJRA 4K6ZA 3KEXA 4I0RA 4I23A 4EK4A 3AMBA 3C4WA 3FSKA 3WIGA 3WZKA 4BZOA 2C5XA 5L2WA 3F7ZA 3PXRA 2QC6A 5CS6A 2OXDA 3TCPA 5IA3A 2PMIA 1XKKA 4D2PA 4YJQA 3QCYA 1WFCA 5ANOA 3GCVA 4GK2A 4M15A 3QTWA 3PLSA 4K18A 5D41A 5HIDA 4B8LA 5CAUA 3NUAA 5CZHA 1W98A 2WU6A 2P3GX 1ATPE 2BDJA 2X81A 4OTQA 4FZ7A 2R3JA 1Q97A 4RC4A 2UZEA 2R2PA 4PPCA 3NGAA 5CSVA 2XK8A 4R5SA 5FXSA 2X0OA 4IX6A 3PRFA 3P78A 4D1SA 3U55A 5IA4A 1BI7A 5BVKA 5LCJA 3M11A 5CU6A 1ZY4A 4XHKB 3AD5A 3FY0A 4QO9A 3NVMB 2VWBA 1RW8A 4OTRA 5HVYA 5AP6A 2OWBA 4AQCA 5AFVA 4RX8A 2R9SA 3BU6A 2AUHA 1BMKA 2OIDA 2CLQA 2B0QA 2OO8X 2WQEA 4KINA 2V5QA 3R71A 4QMTA 5BMMA 3ZEWA 2UZDA 2XYNA 4NTTA 4EH7A 3ITZA 3BYSA 3U6HA 2UW8A 5E7RA 4O7SA 2UZOA 3MA6A 3TKIA 2QODA 4EOQA 4PQNA 5I9XA 4HGTA 5AP3A 3CTJA 4FSQA 4O91A 5EOLA 5IQIA 5HTBA 4FICA 2O63A 3QTZA 4GJ2A 3KXXA 4ZSEA 5CEKA 4RZVA 1LR4A 3GC7A 3LFEA 3LPBA 5EHLA 4E3CA 4C3PA 1PMNA 4LL5A 2CLXA 4D4RA 4G9CA 3KREA 3QD0A 4U81A 4E20A 4HOKA 3EQCA 1M2PA 4FIJA 1RQQA 4ITIA 4Y8DA 4DDGA 4IQ6A 2QU6A 2WQBA 3R63A 2Z7SA 5M55A 4BYJA 3F69A 1VYWA 5AUTA 3QKKA 4HNIA 3H4JA 4FTOA 4DBXA 3ZO4A 2BCJA 3FI4A 3OWKA 2DS1A 2WMQA 3LCDA 4RWKA 2ITUA 4A9YA 2CKQA 5JT2A 2BZIB 3K54A 4E5WA 4UMQA 3AGMA 4HNFA 4FEWA 4IDVA 4R1VA 4EZ3A 3HL7A 3PVGA 4O21A 2VRXA 5ETAA 5E8VA 4XNEA 4IJ9A 2W06A 4Z55A 5I3RA 4O22A 4PP7A 5M53A 2OZAA 4IWPA 5K4JA 4KB8A 1CTPE 3BGPA 5BQ0A 4DC2A 2IG7A 3UZTA 2P4IA 4ID7A 4AN2A 4RJ8A 4NFNA 3JYAA 3I60A 3EZVA 1PMUA 1OGYA 1UA2A 4TNBA 1YOLA 5J8IA 3HV3A 3RM7A 5LMBA 5DE2A 4EH4A 2WMVA 4OT5A 5LVLA 1GZOA 3MH0A 3G15A 2J0LA 3KRJA 5E8XA 2GPHA 1Q41A 1YW2A 5CF5A 2OZOA 3IS5A 3Q9YA 2JAMA 3VUIA 4UB7A 3V04A 4AWIA 3ZLWA 4P90A 5CU3A 5CXHA 2XM8A 2OI4X 4MX9A 2PZ5A 2Y9QA 2XKFA 2Y4IC 4AGUA 4NEUA 5M07A 3WBLA 4ZTRA 1GNGA 3PY0A 1UWHA 2WTCA 2BRNA 4AP7A 1W8CA 4GUEA 2BTRA 3HRFA 3LXNA 4G31A 1QMZA 4CMTA 4OTGA 3KN5A 1SNXA 2VU3A 2EXMA 1YOJA 2UVYA 3OBGA 3VW6A 3W8LA 4BDHA 3VAPA 3SA0A 3R7GA 4DE4A 3SVVA 4MXCA 4BI1A 4Z16A 2OJJA 3T3UA 2X7FA 4Y85A 1ZYCA 4WSYA 4GSBA 3VWAA 3BL9A 1YWRA 4QP4A 5KBQA 4JDJA 4X3JA 1DI8A 5AV0A 3VJOA 4FEXA 3NNWA 5C9CA 3QRJA 3TWJA 3FMDA 4MH7A 2VTTA 4ZZMA 2VX0A 5ANEA 1UWJA 2GNFA 4FJVA 5M4CA 2J0MB 2X0PA 5KMKA 1V0PA 3BWFA 3LQ5A 5AR5A 3EQHA 5AUXA 4DITA 3A7GA 4R5YA 2R3NA 3PDTA 3V8SA 2IN6A 4O4FA 4OLIA 5E8YA 3U9CA 2BPMA 4RX7A 4CRLA 3DXPA 3H3CA 2FGIA 2YM7A 3A4OX 5EKOA 2C69A 4AU8A 2R3MA 3NNXA 3HA6A 3QHRA 3PSCA 3RHXA 4CQEA 4ZY6A 3C4EA 5HE2A 3QTIA 2AC5A 3QXOA 4U80A 3Q9XA 3BBWA 3ZXTA 4L7SA 4AN3A 5CANA 2OLCA 1JLUE 4V0GA 5LVOA 4IBMA 4O0SA 3W33A 3FKOA 4AOJA 3QTUA 3F2RA 1VEBA 2G01A 4WRGA 4WBOA 3ZTXA 4YZMA 4C36A 2WMBA 4W8DA 3ANQA 1PRYA 4KIKB 4GG7A 5AUVA 3P5JC 2UZUE 3RHKA 5LWNA 3GFWA 5TT7A 5IQAA 3SXFA 3MJ2A 3QTXA 1KUTA 3BYUA 4TWNA 2QG5A 4JNWA 5KMNA 1SZMA 2WQOA 1GY3A 3DS6A 4EYJA 4FTKA 1H0WA 3UMWA 3HX4A 2B9JA 1BUHA 3ZO1A 4JXFA 3DZQA 2DWBA 2VWXA 3K3JA 4JBVA 4QP1A 3VS7A 4YLLA 2JDRA 3PJCA 3G6GA 1YWVA 3DJ5A 1PMVA 3EQDA 3OY1A 4C35A 3CXWA 4H36A 4S34A 4F1MA 4LL0A 2UVZA 3ZM4A 3FMNA 1JAMA 4BKZA 5FDXA 3RAHA 3F3TA 4FG8A 1PJKA 4GG5A 4AOIA 4F70A 2C3JA 3EZRA 4U3YA 3LCOA 3KVWA 4DH1A 2HENA 4QMXA 4U9AA 4RJ5A 4CG8A 3D5VA 3KY2A 1OL6A 3MFUA 4FT5A 4HVHA 3TKUA 5EG3A 4W4YA 3G5DA 4FNXA 4IXPA 2YDKA 4QMWA 3RGFA 3G9LX 2WEIA 1UNHA 2IVSA 1NY3A 2F2UA 4USDA 5CY3A 1FGIA 2C30A 3O8UA 5EYDA 1S9IA 3VS0A 3VBWA 2C3LA 3D5XA 2QI8A 4V01A 5BNJA 2B4SB 5JGAA 2ZMDA 4XG3A 2C5VA 4DFNA 1OIRA 2CNUA 3R9RA 3GT8A 1FPUA 4P7EA 3W2RA 3MPMA 1U5QA 5H8GA 4FV0A 1ERKA 3IGGA 2YJSA 3TTJA 1CM8A 4RA4A 3VN9A 3SGCA 3QRTA 3VIDA 2YM6A 5HG5A 4YTIA 5H8BA 4EOMA 1P2AA 3B8RA 2JIVA 1Q62A 4O96A 4S30A 2W99B 3PPJA 4FYNA 2QOOA 4AFEA 2QU5A 4EZ5A 5DMZA 2XM9A 3DCVA 2VGOA 3PIZA 3AC8A 4FV1A 4ZSAA 4ZLYA 3HRBA 1IAHA 3DGKA 3LCKA 5J9ZA 3FLSA 1GAGA 4FL3A 4NSTA 5J87A 1KE5A 3P4KA 2XNNA 1IAJA 1J7UA 2CGUA 3NIZA 2OZAB 4FKOA 3FJQE 4G5JA 4C57A 3F66A 1IRKA 3HKOA 5HE1A 4YNEA 2YLEA 1JQHA 3V8TA 3MIAA 4TYHB 2JGZA 4H1JA 4K9YA 4HPTE 3LFAA 3RK9A 2HZ4A 5ANGA 4LQMA 4W4WA 4F65A 3O71A 3ZDIA 1U54A 5CNOA 5A6OA 3N51A 5IKWA 5M08A 4J53A 2WTKC 5I3OA 5E1SA 1R3CA 2E9OA 4FK3A 4F0FA 3QQJA 2CPKE 1NVSA 4FSMA 4FTQA 5D12A 5AV1A 3SHEA 2XKCA 3FUPA 3U87A 3VULA 4AW1A 2UZVA 2PZIA 1ZYLA 4FV8A 5EM8A 4BIEA 2PVRA 2HXQA 3O51A 4NT4A 3IW5A 3TIYA 3W8QA 1H01A 3R1NA 3DBCA 2R7IA 3MY1A 3PVWA 4ZTNA 3R2YA 3W0SA 3FLQA 3HV5A 4W9WA 5DI1A 4D28A 3DXQA 5AMNA 4F1TA 4GCJA 4XV1A 4UY9A 3E63A 4KSPA 4EHZA 3A60A 2VZ6A 3F3WA 4IJPA 5FM2A 3ORZA 3HLLA 2R5TA 4EOLA 2VTIA 3VS1A 2HWOA 4L52A 2G1TA 4L3LA 4QTBA 1CKPA 2XK9A 3PG1A 5L8LA 2WTIA 2XP2A 4QDVA 3GC0A 4FEVA 2H96A 3JPVA 2QOBA 1U54B 3TDWA 2F57A 1R0EA 3EL7A 2QLQA 1DAYA 2YDIA 4BHNA 4RZWA 4I4EA 4FSYA 4BDCA 5DH3A 1W7HA 3NR9A 1Q8TA 5KZ0A 2O65A 3CTHA 4E73A 4EH3A 3OEFX 3I0QA 2XALA 3NYOA 3C5IA 5HORA 2X4ZA 4BDBA 3MIYA 4TYGA 4S31A 3VBXA 4QRCA 4S32A 3ZCLA 4FTNA 4X2KA 5E92A 3ZS5A 5M06A 3PG3A 4L67A 5KCVA 3SXSA 1V0OA 4RJ6A 5EI8A 3CJGA 4MXOA 2GNGA 3OHTA 2WXVA 2OG8A 4KIPA 5EI2A 1OM1A 1H00A 2PE0A 4Q5EA 4BYIA 1FVTA 5LMKA 5CSXA 1Y8GA 2YCRA 4WNMA 2CSNA 4U8ZA 3RKBA 1XBBA 2WAJA 4BTFA 5L8KA 3S0OA 1G8AA 4F78A 4XP3A 2B9FA 1B38A 3DB8A 3O96A 2VN9A 4G3CA 4IB5A 4HPUE 4Y83A 5HICA 3PP1A 5A14A 4BCQA 1XH8A 4PL3A 3RM6A 3VW8A 4I6BA 4BKYA 4JG7A 3NLBA 4CV8A 3S3IA 4DTBA 3NPCA 2EVAA 1IEPA 4QQTA 4G9RA 4IC8A 1OIUA 3S4QA 4DEIA 2JITA 3EB0A 2VO6A 1O9UA 2PVMA 3DT1A 3PPZA 3LFNA 4BGQA 1REKA 1H0VA 3HEGA 3ML1A 3NW6A 3QUEA 2OF4A 4O0XA 4CYJA 4FEUA 3QZFA 2JLDA 3ZRKA 4KUJA 5HEZA 5IA1A 3QWJA 4A9UA 1CSNA 4IC7A 3LOKA 4AXAA 2EUFB 5CSWA 2XK4A 4CT2A 3Q4CA 2R0UA 5C8KA 3JXWA 4DTAA 4RFMA 5KKRC 2XEZA 1WBTA 2PTKA 2R4BA 2W1CA 3CLYA 2PZPA 1Q8YA 3VUMA 5ANIA 4OTDA 5AP2A 3FZRA 1SVEA 1XHAA 4IWOA 2WOUA 3Q6UA 4U44A 2J0IA 5KE0A 3IOKA 3UIBA 3MPAA 2WMAA 3K5VA 5AM6A 3ZU7A 1KE9A 1NVQA 2BR1A 3LLTA 3V5PA 3CQUA 4R8QA 3GVUA 3Q9WA 1EH4A 5A54A 4DAWA 2QURA 2NPQA 3OCTA 1W2FA 2R3FA 3W2QA 5J9LA 4QMZA 5EYCA 4C4GA 2BMCA 4KKEA 2OKRA 4XOZA 1R0PA 2P0CA 3A7HA 2HW6A 3Q5ZA 4WO5A 4FT7A 5KO1A 1E1VA 4WG5A 4DHJA 2GDOA 4TWPA 2A1AB 1YXTA 3FMEA 3MDYA 4LRJA 4TXCA 4DH3A 3KK8A 5DNRA 1OL5A 4FV9A 5EFQA 2ZM3A 4GRBA 3QLFA 2WEVA 1B39A 2ITTA 1Y6AA 4ZY4A 3L9NA 2CKOA 3KF4A 5C03A 1OI9A 1ZARA 1M17A 3W0PA 4JG8A 3KFAA 4IM3A 4UWBA 3L9MA 4PMMA 3PRIA 3VBYA 1F0QA 4ZLOA 4IVCA 2PVJA 3DK6A 4I21A 2ZDTA 4YR8A 3TTIA 4YTFA 2PVYA 3JVSA 3C7QA 3SG9A 3UOHA 4H39A 3NFGB 4D55A 4WNOA 1Q3DA 1ZAOA 2R64A 3LFQA 4OTPA 1MRUA 4U43A 4BGHA 3UE4A 4G2FA 3AC4A 3KK9A 5JSMA 3ZSIA 3B2WA 4R6VA 4D4VA 3UQCA 5K0KA 3E64A 2W1IA 4XP0A 4BL1A 3MFRA 4FVQA 4LV7A 3Q5IA 3SRVB 3Q6WA 3QCSA 2W1HA 3BYVA 3C4CA 3D7TA 4X21A 1WBNA 2WOTA 3GU7A 5DA3A 5DLSA 2GQSA 4FF8A 4C3RA 1WMKA 3CP9A 1JOWB 4IMYA 3U4WA 2Y4PA 3GP0A 2ZJWA 4RQKA 3WF5A 2J4ZA 2YM3A 4TY1A 5I9UA 4ENXA 1Z5MA 3I81A 3N4TA 4EWQA 5BYYA 5KMIA 2XRUA 3C4ZA 4CD0A 5CF4A 3TI1A 2YCFA 2WB8A 4O0WA 5G1XA 4AGWA 4LYNA 2IWIA 5GZ9A 4QYEA 2WMUA 4AZFA 4E6CA 3QX2A 4BDJA 4JDIA 3EFWA 3RNYA 1ZWSA 5JZJA 3W2SA 3CR0A 2IZTA 2VO0A 3G0FA 4AAYA 1KSWA 4I5HA 3R83A 1TQMA 2JKOA 5LOHA 4XYFA 4EOOA 2E9NA 4FTLA 2ACXA 3UODA 5JZNA 5A9UA 4Q5HA 3R7OA 5GJDA 1J7LA 4P5ZA 4AACA 3E3BX 5BVEA 3DJ7A 4BTKA 1Y8YA 1YHSA 4E1ZA 5I9VA 2UV2A 3NWWA 3KL8A 2WZJA 3D5UA 2C6TA 2CGVA 3EN5A 4KA3A 3OS3A 4KD1A 5CAPA 4IX3A 1KV1A 4TT7A 5KKRB 5E8WA 4IWQA 4FTMA 4IFCA 3CY2A 2JBPA 2QOHA 4ARKA 4CKIA 5IDPA 2I0HA 2I6LA 5J95A 4PMSA 2A19B 1BX6A 3OUNB 4W4XA 1VYZA 5CT7A 3GB2A 1V0BA 3UIUA 3OCSA 4I20A 1WAKA 3TJDA 4E6AA 3EQBA 2BDWA 1MQBA 3P86A 4DHIB 3O7LD 2HY81 4WNKA 4F6WA 4F7NA 2Z02A 2Y7JA 4TL0A 1H26A 4MNEA 1BI8A 5IEXA 3LLAA 3V5QA 4UWYA 3PWYA 4OGRA 3DU8A 3PE2A 4GS6A 5AA8A 3SW7A 3A2CA 4U79A 3NNUA 3PIYA 3L8SA 4FT9A 4TYIA 5BV3A 3D5WA 3LW0A 3C4FA 4XG6A 5ACBC 3OMVA 4FUXA 2WTJA 4IVAA 5AX9A 3HUCA 3SLSA 3EQRA 3UPXA 4D2TA 2ONLC 2XBAA 4GK4A 4YJNA 3QYWA 5FGKA 2PMLX 4O27B 3R04A 2NRUA 5AP1A 1JWHA 2BIKB 4RVKA 4CZYB 4F6SA 1M14A 4FTIA 2YM5A 2WIPA 3GCUA 4DFZE 5HD4A 5JMSA 4DHFA 1ZOHA 3FDNA 4UBAA 4ENYA 3C0HA 5IISA 2BFXA 4DHZA 3H9OA 4O0RA 4O4BB 4A9TA 4H3BA 4PTGA 2V7AA 2VTSA 3TEIA 3E8DA 4Z3VA 3LFFA 2G15A 4XBUA 4RIXA 1H28A 4AQKA 4BY9E 3GC9A 3MN3A 1OKZA 5GJFA 4BIBA 4CZTA 3SDJA 4S2ZA 3VJNA 2C6LA 4S33A 4FBXA 1CMKE 5CZIA 4BCOA 1H1WA