4CV9A

Mps1 kinase with 3-aminopyridin-2-one inhibitors
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
280
structure length
254
Chain Sequence
FQSMSVKGRIYSILKQIGSGGSSKVFQVLNEKKQIYAIKYVNLEEADNQTLDSYRNEIAYLNKLQQHSDKIIRLYDYEITDQYIYMVMECGNIDLNSWLKKKKSIDPWERKSYWKNMLEAVHTIHQHGIVHSDLKPANFLIVDGMLKLIDFGIANVGVNYMPPEAIKDMSISPKSDVWSLGCILYYMTYGKTPFQQIINQISKLHAIIDPNHEIEFPDIPEKDLQDVLKCCLKRDPKQRISIPELLAHPYVQIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords DUAL SPECIFICITY PROTEIN KINASE TTK
publication title Protein Kinase Selectivity of a 3-Aminopyridin-2- One Based Fragment Library, Identification of 3-Amino-5-(Pyridin-4-Yl)Pyridin-2(1H)-One as a Novel Scaffold for Mps1 Inhibition
rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 76
structure length 254
sequence length 280
ec nomenclature ec 2.7.12.1: Dual-specificity kinase.
pdb deposition date 2014-03-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4cv9A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4cv9A01
4DFBA 1PYEA 2YA9A 3LZBA 3LFNA 4IWPA 5AUZA 1MQ4A 2V22A 4UZDA 3GI3A 4FOCA 4QD6A 4P90A 2BDWA 3N9XA 4AGWA 4BCGA 2WMRA 2XNOA 3GGFA 1WBSA 3QQJA 4X2KA 2XKDA 4WSYA 4U3YA 2OWBA 5A14A 4XP3A 2AC5A 2QOOA 4JNWA 5AWMA 4CZTA 2PVHA 4OGRA 5KMNA 1OPLA 2C68A 1H1RA 1XJDA 4FL1A 4IX6A 2ZMDA 4JDKA 4E7WA 1SVHA 1YOLA 2QOKA 4AN9A 1GZKA 1Q62A 4FTIA 4CLIA 3UVPA 3TKUA 3PVBA 5IMEA 1LEZA 3HMIA 5J9YA 3VWAA 4I4EA 5EDQA 1O9UA 3AOXA 4FNWA 3FWQA 5GZ8A 3RM7A 4AACA 3UOJA 3TG1A 4K18A 1LEWA 4WBOA 5CAVA 1IAJA 5IA0A 3TZ8A 3V5LA 2XBJA 4WT6A 5HCYA 3MY0A 1MRYA 4IEBA 4XYFA 4J95A 1B6CB 2A27A 2YJSA 3FXWA 4IB3A 1GOLA 5AUXA 3V3VA 3C4FA 4L43A 3QGWA 2OFUA 3A60A 5F9EA 2REIA 3FL4A 4MNFA 2Z7LA 4RJ7A 1J7UA 4F7SA 4A9UA 3T8OA 4CKJA 4RWLA 4ERKA 4XJ0A 3MH2A 4I6FA 4BBEA 4M14A 3KY2A 4D58A 2OF4A 2OJJA 3GFWA 2C5OA 2JKMA 3L1SA 3ZLYA 2QODA 4MTAA 2UV2A 1ATPE 3FV8A 5CXZA 4Q2AA 3D5WA 5M56A 4CFXA 4M0ZA 4C7TA 5A6NA 5DN3A 4FICA 4JQ7A 4C3RA 3TZ9A 2C5VA 2WQBA 4W4YA 2J0LA 5E9EA 1JKKA 2J5EA 2X8EA 4OT5A 1QMZA 1Y8YA 4HGTA 5FUTA 1WBOA 2C6TA 3IS5A 4EBVA 3AC4A 5CY3A 1XHAA 5ANKA 4QP2A 5IA5A 3KN6A 1PW2A 2DYLA 2FSOX 2PMNX 3L9MA 3LXKA 4MNEB 3TDWA 4S30A 2O63A 2OIDA 4FNYA 2PUPA 3OP5A 2ZYBA 4NJDA 4ARKA 1J1BA 2Y6MA 4FG8A 3IW4A 5E8SA 3ZRLA 4E93A 4F64A 1RJBA 5ANOA 3MFTA 4EKLA 4PY1A 4QYFA 2C47A 3PA5A 1OL2A 4A4LA 2BALA 4I4FA 4J7BA 4CT1A 4XG3A 4O6EA 4D4VA 4QP9A 2OJGA 1OKZA 2CKEA 3EQHA 4PTEA 3RK5A 4A9YA 5IA2A 5LVNA 2B52A 2Y6OA 3PJ2A 3POZA 4EK3A 1WZYA 3EN6A 3UNZA 2F7XE 3DFAA 3F82A 3MA6A 5KHWA 3HA8A 4IQ6A 2YZAA 2X4FA 3Q60A 2YABA 4O7NA 2IW6A 2XIRA 4IAIA 2UW6A 4FR4A 4NSTA 4PQNA 3FEGA 1YI3A 4M66A 5AAGA 5BMSA 3DQWA 3TUDA 3FZOA 4FC0A 3ORLA 4BI1A 4OUCA 5LMBA 2Z7SA 3ORKA 4IM3A 4L46A 2IZSA 5J1WA 4WKQA 3QCYA 4DBXA 1XBBA 4E6DA 1B38A 1UU7A 4FVPA 4HYUA 2VNWA 3A99A 3HZTA 4BBFA 5EQEA 3DKOA 2LAVA 1PMUA 2HW7A 3ZCLA 2QOHA 4EOKA 4F9YA 3R7IA 3NW6A 4GS6A 3VJNA 1HCLA 2WMWA 4HGEA 5DHJA 5EFQA 4QYYA 4IZAA 4JL9A 3OWLA 2YJRA 3QTSA 3EZVA 2HOGA 4ITHA 3U87A 4YU2A 1H08A 5F95A 4CZYB 3BYMA 4HVDA 3QQGA 5DNRA 3R7OA 5BUIA 4Q9SA 1OIRA 5C27A 3C13A 2BFYA 5D11A 2DQ7X 3RJCA 4WD5A 2ITZA 5H8BA 2BRGA 3A4OX 3O7LB 2ZAZA 3ZMMA 2VX0A 2NPQA 4YSJA 1SZMA 4IVAA 5CT7A 3R9HA 3ULIA 4JAJA 2WQNA 3FAAA 4XV3A 5CU2A 4L3JA 3H0ZA 1VZOA 2YDIA 3MDYA 4KB8A 3BV3A 4RLLA 4AZTA 5CSVA 3DB8A 4FODA 2GPHA 5ANEA 3EMGA 1H8FA 1NXKA 2B1PA 2JIUA 3FSFA 4I22A 4F70A 4W4XA 4CKRA 2J0MB 4ZJIA 2VTJA 2B4SB 3C4EA 5AIRA 4D2TA 4QQTA 1B39A 4FK3A 5L8JA 2JKQA 3VS0A 2O3PA 2VN9A 1H07A 4I5CA 1CDKA 5L6PA 1XH9A 2RKUA 4I0SA 5FBOA 4LFIA 4USDA 5LCJA 3R0TA 4EUUA 4FZFB 3DGKA 2XKCA 4YTFA 3UE4A 4BYIA 4CRSA 5M4UA 2WTDA 4A07A 1OB3A 3KRRA 2WTJA 4H58A 3DDQA 3AXWA 1E1VA 3FJQE 3QTZA 3M2WA 5HCXA 5K0KA 1Q41A 4FL2A 4ASEA 3VO3A 3CTHA 3FHRA 2IZRA 4ZTSA 2YFXA 2CNQA 3CJGA 3L8SA 2GTMA 2WMUA 1G5SA 5IZFA 1H25A 4FL3A 2PMLX 2RFEA 3C51A 4QMZA 5FM3A 3WI6A 3F5UA 4BI0A 4F99A 3HNGA 4ALVA 1ZARA 2XRUA 1CKIA 5LMAA 1SVGA 4JX3A 2PZPA 2XCKA 3KF4A 3DZQA 4IE9A 3F5PA 4UB7A 3K3JA 5CQUA 4YGAA 4ZTNA 3GC9A 4O1PA 5EOBA 2W1FA 3UO4A 3VW6A 4YTHA 4BDIA 1F3MC 4D5KA 4H1JA 3MH3A 3QKKA 2IPXA 4XLVA 1GAGA 5I0BA 1HCKA 2OZAB 4D4RA 4DEHA 3OMVA 2ITXA 2V0DA 5D7AA 3W33A 3KCFA 3QYWA 3G2FA 5FDXA 3SVVA 3GC0A 4RVKA 5LMKC 4RGJA 4YR8A 4E4XA 3PPKA 4WHZA 4IAYA 3DJ7A 4QMYA 3R7GA 3LFQA 5HBEA 4WNOA 4EHEA 2W7XA 1JKTA 4Q9ZA 4FUXA 4EOPA 5A54A 2Y4IC 5BVEA 3DBQA 4FIEA 5FEEA 3OCGA 5AUYA 4IDTA 4YO4A 5IEVA 1XH8A 4LGHA 4FT7A 1TQMA 4V04A 4I94A 5AAEA 4TWOA 3CJFA 3Q53A 2XCHA 4K11A 4LGDA 3O96A 2BZIB 4ZTQA 4XCUA 3OY3A 4FT5A 4RSSA 5E91A 4F6WA 1LPUA 2QOBA 3SA0A 3W8LA 5KX8A 2QVSE 4K1BA 4RC2A 3CTJA 4WOVA 1NA7A 1OITA 2YCRA 3U9CA 3N4VA 2W9FB 4K77A 3ZDUA 5M09A 1U4DA 1WVYA 3IDPA 1UKHA 4PDSA 4MF1A 5L2QA 2BZKB 3OZ6A 2VWBA 5A4CA 5EW9A 3Q4TA 1KUTA 2B9IA 3CTQA 1APME 4WRGA 5EHLA 5HG7A 3F88A 2GHGA 4UWBA 1M2RA 3DS6A 2PZYA 3G51A 3L8PA 3ETAA 4RZWA 2YACA 5HLNA 2ONLC 4IDVA 4YJQA 5KHXA 5EHYA 4GKIA 3TTIA 2B53A 4BCOA 3MN3A 3ZONA 5HHWA 2F7ZE 4X3JA 2OJIA 3DKFA 2G15A 3UOKA 4X3FC 2Y4IB 1FOTA 3DXNA 4XBRA 1Y6AA 2V5QA 3BGZA 3UVQA 3ZU7A 4YZBA 2BKZA 3E7OA 1DI9A 3QKLA 5CNNA 4ZTMA 3AC2A 5CU4A 1OM1A 2J7TA 3RTPA 4IB1A 3NUUA 1XH7A 4M12A 1Q24A 3PFQA 4IX5A 4MXOA 4NM0A 5M53A 3AT3A 1ZYDA 4QTCA 3IPHA 4I5HA 2X2LA 3TI1A 1PXMA 2QNJA 4AOJA 2C6KA 3JY9A 3FKLA 4D1XA 5FGKA 3ATTA 2CGVA 2OJ9A 3QBNA 2VWIA 4IFCA 4Y73A 3JR1A 1KV2A 3QUEA 2UZDA 2QQ7A 4ZSEA 2HY81 5D41A 5FM2A 5JSMA 3W2QA 5AP1A 4FSMA 3R01A 2XB7A 4F1TA 2OO8X 3QTXA 3ZO1A 3Q3BA 3EKKA 5AP3A 1OI9A 2BPMA 3SW4A 3F5GA 3PRFA 3JXWA 3G0FA 4HZRA 2XS0A 2BRBA 1ZZ2A 4D2PA 3OBGA 5T68A 5HIDA 4Q5HA 5AA9A 3GC7A 5FG8A 3UZTA 1UNGA 1OVEA 2X9FA 3HRBA 4BTMA 4GT3A 1NVQA 3C1XA 3FLQA 1K2PA 4KRDA 5EYDA 3ZC5A 3AQVA 2PMIA 4X3FB 1ZWSA 4E26A 4L67A 4EOMA 5LXMA 4N57A 4FUYA 3CPCA 2VO0A 3HYHA 3E64A 1MRVA 5GJDA 4NIFB 2YIRA 4HCTA 2W5HA 4G3EA 5IUIA 1WBPA 3O0GA 3CKXA 5A4EA 5IQIA 1PKGA 2XYUA 4O0XA 2VWXA 4NCTC 1FQ1B 3FI4A 3RPSA 3UTOA 3ZEPA 2C1AA 4AW0A 3EQRA 1ZOEA 2PVYA 1ZYLA 4DH8A 3NYOA 4NIFA 2ITOA 3QA8A 5I9VA 3SV0A 5HIBA 4D2VA 1JKLA 2WTKC 3AD4A 3GB2A 5HE1A 2XJ1A 3WF9A 3OHTA 4HYHA 4M69B 1WVXA 3BGPA 4FTOA 2GU8A 4J96A 3UQFA 4GW8A 4AF3A 3KGAA 3QXOA 3RHXA 4DEIA 1FVTA 2B9HA 3Q9WA 3GCUA 3SDJA 3PE2A 4GMYA 2VWWA 4W9WA 5E7RA 3OOGA 4BDJA 5KKRC 4KBAA 3FMDA 4LMUA 4F09A 2PL0A 5H8EA 3Q52A 5CANA 1GNGA 3NNWA 4JRVA 4WG5A 4FV0A 5CAUA 5GHVA 5J8IA 3GNIB 4DINA 1XR1A 3NW7A 3EZRA 5CSHA 1YXVA 2X8DA 4ID7A 4YLKA 2UW4A 3OTVA 3V51A 4U45A 2WZJA 4AOTA 2RG6A 3CC6A 4AU8A 3NAYA 3TTJA 3P5KA 2EB3A 4C4IA 3DAKA 2W1ZA 4FTQA 1Q8ZA 3I81A 3GP0A 5ITAA 4OAVB 3F66A 2V55A 3BHTA 3C5UA 4EZ3A 5HQ0A 5IQEA 2YLFA 4CQGA 2YM4A 4HPUE 4EK8A 4ZSGA 1Z5MA 3O17A 2ITTA 4FSUA 3NIZA 3LFSA 4Y85A 3HLLA 4FSYA 5EDRA 3B8RA 5M4CA 4UYAA 3FE3A 1UNLA 4NJ3A 3PSDA 4BF2A 4JAIA 4D2WA 4BCQA 2IG7A 3RKBA 1KE8A 3UBDA 4RIOA 2R3HA 2PY3A 3QTRA 5HOAA 3V6SA 3TIZA 5K4IA 2CPKE 3UG2A 4CFNA 3HMPA 5AP0A 3RAIA 4GK4A 4Y5QA 2GS6A 2QG5A 2X7OA 5KKRB 3HEGA 2VTIA 4U79A 5E8ZA 3Q2JA 3VF9A 2B0QA 3PXQA 5FTGA 2B55A 4DGGA 1Q97A 3GQLA 3LQ8A 2QC6A 3DBFA 4YHTA 5CEQA 3E5AA 4PDYA 4GEOA 3ZEWA 3D7ZA 3EOCA 2Y7JA 3F3UA 3FMLA 4RG0A 5EHOA 5ETIA 4EH8A 3EN9A 5BQ0A 3OXTA 5CSWA 4U7ZA 3E62A 3PA3A 2ACXA 4FE2A 5AV1A 3ORNA 4KIKB 5DG5A 5A4TA 1IA9A 1UVRA 2W06A 3SOCA 3MJ1A 4OBPA 2IN6A 2BAJA 2WIHA 5EM8A 2EB2A 3WYXA 2WEVA 2PZIA 4HCUA 4Y83A 4IC8A 3RVGA 1Z9XA 3FY0A 4NYEA 1M7NA 4EORA 3F3TA 4QTBA 2RGPA 2XNEA 5LWNA 5FBNC 4BIEA 5J9ZA 3HV3A 5DBXA 3U9NA 4BHZA 1JVPP 5J7BA 4ZLZA 4RFYA 1SYKA 2PUUA 3LFBA 2BAKA 2VTSA 4KIOA 1ZY4A 4PDPA 3I4BA 3RP9A 3CY2A 3FZPA 1VYZA 4FV5A 4RQKA 3LVPA 3W55A 4IB0A 3W10A 3P1AA 4FV1A 3VS6A 3FY2A 3VHKA 2WTWA 4H3PA 3U6JA 4C4GA 3EQGA 3FBVA 5BVKA 2UVYA 3PY1A 2CKQA 1P14A 5JQ8A 2XKFA 2X2MA 5AP4A 4ZZNA 4GYIA 4AN2A 5EKOA 5KMMA 2WEIA 3ORMA 4HJOA 4X0MA 3BU6A 3NGAA 4QTDA 4DYMA 3E92A 3LCSA 3NYNA 5BNJA 3NWWA 3PLSA 3DV3A 4PPCA 2WAJA 4ZSJA 3C0IA 3NPCA 3I79A 4IIRA 5E8WA 4ZJJA 2W05A 4WNPA 2XNGA 3U51A 4CFWA 5IA1A 4QMVA 4JDJA 2GNFA 2UW0A 3DBCA 3NCZA 4EH6A 3R71A 5CU6A 5A3XA 2UZBA 4S2ZA 4X6QC 2ETRA 4X2NA 1BI8A 3R2YA 3PIZA 1FMOE 3M1SA 2JEDA 2CGWA 1JNKA 4DG3E 4F4PA 4HVSA 1F0QA 5HG5A 2QOQA 2W5BA 2WKMA 4FYNA 2XYNA 5K0XA 2BDJA 2OICA 3KF7A 3W2PA 2E9UA 3O8TA 4FKSA 2XNPA 4BRXA 4OBOA 2EUFB 5BVWA 3EYHA 1M7QA 2WU7A 3DNEA 3IOKA 4RX8A 3WF5A 2XEYA 4BDFA 5IA3A 1PYXA 3O8PA 2XNBA 3FKNA 4Y72A 1VJYA 4IZ7A 2C3LA 4JG8A 2P4IA 4R78A 1YXSA 3GCPA 3TKIA 2JBOA 4O1OA 2CJMA 1YI6A 4PMTA 4TPTA 3RM6A 4QTEA 2EXEA 4FEUA 2J50A 4AOIA 5ACKA 4IWQA 4XHKB 2BTRA 3ORZA 3PJ3A 4ALUA 2BR1A 3CQUA 4F9CA 5E4HA 3ZHPC 2QKWB 3ROYA 1YDSE 2WPAA 2YWVA 2BRMA 5HESA 2VWYA 2XNMA 1TQPA 2PPQA 3BQRA 5GJFA 3RAWA 2OGVA 3A2CA 2RFNA 5ANJA 1MP8A 3CLYA 4G31A 4ZEGA 5CVFA 2HXLA 4H3BA 5FEQA 4U97A 5JKGA 3FC2A 4RA5A 5KBQA 3TWJA 1DI8A 2RSVA 3QQLA 4DGNA 2R3RA 4ZZMA 1G3NA 5M51A 2IZUA 2O8YA 3K3IA 4U80A 5LVMA 4LUDA 4BCMA 4CG9A 5I9ZA 3QHRA 4C57A 2Y4PA 2YCSA 3JVSA 4D28A 1CKJA 5I9UA 2A0CX 3F3VA 1VR2A 3TNPC 3QA0A 3TIYA 4F9AA 2OXYA 2VUWA 3EKNA 3ZUUA 5CZHA 3UPXA 2PVMA 4XLIA 4EOSA 5L2TA 5IF1A 1M52A 2Z2WA 1XWSA 2IVSA 4R5YA 4BC6A 4IBMA 4R6VA 3QD0A 4YJNA 2G2HA 5AADA 4TYJA 3TNHA 3R63A 1H1SA 3QD3A 2VTLA 5HD7A 3PYYA 1H0WA 3LCKA 2QD9A 3MTLA 1JLUE 2R3GA 3QTUA 1GIHA 4NK9A 1M2PA 4M67A 4DT9A 4C8BA 4ENXA 1TQIA 1NY3A 4HW7A 3HRFA 4MXAA 3LM0A 4MX9A 3GENA 5JGDA 5IQAA 3ZLSA 2OJFE 2WOTA 2HCKA 2OH0E 3WZKA 4E5BA 3BQCA 2JDRA 3PTGA 4FTKA 4NFMA 4EQCA 1IAHA 2VRXA 5EM7A 4FSNA 2ZM4A 3LLTA 2OH4A 4IM0A 4FKIA 2FVDA 5EQPA 3HX4A 4DLIA 2A2AA 5GJGA 5EI2A 4MVFA 3RHKA 5LOHA 4TYHB 4DCAA 4O0VA 4XV1A 5CT0A 4FV3A 1O6KA 5C26A 2W5AA 4QMPA 4DEAA 4CCUA 4GIHA 2R9SA 3DTWA 3ZO4A 4AA5A 4RVLA 1QPJA 4C2VA 4DTBA 1KE7A 2ERKA 4RT7A 4EYJA 4L01A 1NW1A 2R3IA 2VTTA 3P23A 2O64A 4PUZA 1GJOA 3RWPA 4QP1A 4I0RA 5AM7A 1R39A 2R0IA 3GVUA 4MD9E 2OBJA 3ZXTA 3VHEA 5F20A 2CKOA 4UEUA 4U6RA 3NUSA 3PG1A 3CBLA 4YBKA 1M2QA 2VV9A 3VN9A 4FVRA 3EFJA 4DEDA 4J52A 3NIEA 5CF4A 3V5TA 4IANA 4JBQA 3UZPA 2NP8A 3W16A 4O0UA 1AGWA 2FSLX 2XK4A 1YVJA 4FTUA 4CLJA 5CI6A 2WELA 4EOLA 2Q83A 3K2LA 5AV0A 3DDPA 1FINA 4M15A 4C62A 3VS1A 4UN0C 5ICPA 4HGSA 5M08A 2C0OA 4TNBA 2OW3A 4ALWA 3EHAA 1H1QA 3QTIA 4H36A 1U46A 3FPMA 5DOSA 4BFMA 3LJ2A 1FVVA 1ZZLA 2YIYA 4J8NA 3I5NA 4E6CA 3FKOA 4G6OA 4RJ5A 3LMGA 3VRYA 4JS8A 4M7IA 2GS7A 3FXXA 3TNWA 1YDRE 3DK3A 3DK7A 2WQMA 3UODA 3BWFA 1J91A 1R0PA 3FHIA 4AZWA 1XH5A 3KA0A 2VU3A 4L68A 4MF0A 4U8ZA 4DFYA 3KEXA 5GIPE 1XH6A 3MFRA 3LMIA 5F4NA 5LCKA 5L6WL 4C38A 3C50A 4AQCA 2CHLA 2EVAA 4K8AA 5ANIA 4LOOA 2C0IA 4DFZE 1JBPE 4Y95A 3JUHA 5CX9A 4PP9A 3S95A 3HP2A 4P2KA 5E8TA 2QU6A 5EKNA 4EWQA 4RMZA 4I93A 4MEDA 1PJKA 4TL0A 4G6NA 2CN8A 2WQEA 3BBWA 3NUXA 4R1VA 1W98A 3FQEA 5DH3A 1Q61A 2G2IA 3PZHA 3MPAA 5EQYA 3PVWA 3UQGA 3EFKA 3ELJA 4CGAA 3Q4ZA 4JQ8A 4EH5A 3BHHA 3EIDA 3CPBA 3F2NA 4RX9A 4C0TA 4FTTA 2I0YA 3SW7A 5DWRA 1KOAA 2UZNA 5FXRA 4ZS4A 3LKMA 3HV5A 3LAUA 4KKEA 4UWCA 3L8XA 1BLXA 3OCBA 2HELA 2ITPA 4IAKA 2BTSA 4O2PA 4GT4A 3DCVA 5HTBA 3V01A 5K5NA 3FMJA 4DH5A 4IJ9A 4AW1A 4N6ZA 4YZMA 5HI2A 1CKPA 3L9PA 4BB4A 5B2MA 5KMOA 2HIWA 3IW6A 3IGOA 3OBJA 5JFWA 3EB0A 2GNLA 3AD6A 4XRJA 4W4VA 1PRYA 4AW2A 3QC9A 4YHFA 4DFLA 2NNWB 2DS1A 3FMHA 3LLAA 2YCFA 4PMSA 3QFVA 1E1XA 4GUEA 4RWKA 3T3UA 4BDBA 3COHA 4FKOA 2I1MA 4C33A 3LMHA 4MD8E 4OTPA 2C1BA 2UW7A 3SLSA 2J6MA 2OXXA 3VUKA 4D5HA 4ZMEA 1OL5A 4GVJA 1SNUA 3IO7A 1XQZA 1REJA 3F2AA 4BR3A 4DTAA 4OTGA 3DAJA 1X8BA 4OW8A 2PVKA 3ANQA 1U54A 3GEQA 5IDNA 4L3PA 5F1ZA 1W0XC 3Q5ZA 4JR3A 4EL9A 4G34A 3I5ZA 4BVUA 1W8CA 2O65A 4LV8A 3IW8A 3R7UA 4TZRA 4XV9A 2UZOA 2BRHA 4WUNA 4QNAA 4XOYA 3VUIA 4B4LA 5GZAA 4ORKA 3N51A 3VVHA 3PUPA 4R77A 2RG5A 3KXGA 4O27B 3RCJA 1W82A 1OL7A 2C6OA 2XIXA 3EQIA 4J53A 4L3LA 2VO7A 2ZMCA 3LFDA 4RIWA 3UNKA 1OKYA 4CXAA 5BVNA 1PXKA 3G33A 4R3CA 2WO6A 1YHWA 1TKIA 4FA2A 3ZTXA 4YZCA 4MAOA 4I24A 2PK9A 3QHWA 2UUEA 4FV6A 1Y57A 3BE2A 1CTPE 4YNOA 3DKGA 5B0XA 4BKJA 2WIPA 4WBBB 4IZYA 1ZMUA 4E5WA 4ZJVA 3WZEA 3CIKA 3COIA 3JS2A 4B7TA 1QPCA 5CYIA 3ZZEA 2Y8OA 3E3BX 4F7NA 4J98A 3FLZA 4HYIA 1PKDA 3GU6A 3R7YA 3MH1A 2QKRA 2XK9A 4FT0A 2F7EE 5I9YA 5EH0A 3P78A 5CASA 3IW5A 1PY5A 3MB7A 2HZNA 2J0KA 3DLZA 4M8TA 3UJGA 3MWUA 3QCSA 4GFOA 4K6ZA 3D5XA 1OMWA 4WSQA 3UIUA 4QMMA 5CXHA 3D0EA 3FLNC 5FXSA 4TRLA 4L44A 3S1HA 4XG6A 3OG7A 4D4YA 2JAMA 4U9AA 5CAOA 3BYOA 4Y8DA 2QOLA 2WMBA 4RWJA 4FTMA 4H39A 5HD4A 3PXKA 4G3FA 5TT7A 4AGCA 3ZC6A 3LFFA 4ENYA 5FWKK 5IUHA 5E90A 4C34A 4PPAA 3ZFYA 3MVJA 4M3QA 5CSPA 2G9XA 3TV7A 5CU3A 2C5NA 1W84A 2OK1A 2C5YA 5LQFA 1UU9A 2QONA 3SKCA 2ZB0A 5KZIA 2CMWA 4W8EA 4G9RA 3TCPA 3BEGA 4FKQA 3AT4A 3FI2A 1H24A 3E8EA 4BCHA 5JK3A 5BVOA 1KOBA 4C58A 5HO8A 4CNHA 3FMNA 3CKWA 2XZSA 5HGIA 3WIKA 2XNNA 5C9CA 5AP5A 1KE9A 2VTRA 3MH0A 2VX1A 5F94A 3HV7A 3UG1A 3BWJA 3UVRA 5JFVA 1G8AA 2WQOA 4PP7A 5J1VA 2ETKA 2JAVA 4FV7A 3T9TA 4EJNA 4ZY4A 3LHJA 2XK3A 4X2JA 5FD2A 4RJ8A 3MPTA 5I3RA 1IG1A 3QRKA 1LR4A 3KVXA 3QZFA 5HX8A 3LCOA 4ASZA 4MQ1A 2JKOA 4QO9A 2XJ0A 5C03A 4DBNA 3PVUA 3OEZA 5CALA 2UZVA 5JFXA 4LG4A 5HLPA 1YXXA 4BWKA 5EI8A 1YWRA 4S34A 4YTIA 4EWHA 3REPA 4ZXTA 4ZTHA 3R04A 5IUGA 4AA4A 2Z02A 2PSQA 5DE2A 2PE1A 2F2UA 3VC4A 4NWMA 4QP8A 3AMAA 1WBWA 4PX6A 3FMEA 2ITYA 2HY0A 3BKBA 4EEVA 1ZAOA 5M4FA 4XG4A 5DPVA 4XEYA 2WMTA 3E3PA 1R1WA 2CCHA 3QALE 3OY1A 3W8QA 5M44A 3HV6A 1XH4A 1ND4A 4X6RA 5HVYA 3ZUVA 4MWHA 4CYIA 3N4UA 2WTCA 5CVGA 2WFYA 4B6LA 2R7IA 5IH4A 1XKKA 3BHUA 2YITA 3HRCA 3PSBA 1BYGA 1PXIA 2QO2A 4KWPA 2F57A 3OC1A 3QD4A 4E6QA 4JR7A 3THBA 3Q9ZA 5L8KA 3OCSA 4HVHA 2XM8A 3I6WA 3LXNA 4FG7A 4F1MA 2C6IA 3EFLA 3FLSA 3RCDA 5J9LA 5AM6A 4MCVA 3TL8A 2JC6A 3E8NA 4FEVA 3P08A 2ZOQA 3LQ5A 4KABA 2A1AB 1NVSA 4OTFA 3PP1A 3RNIA 3W2RA 4DFNA 3G9LX 4ZLYA 3HAMA 1FVRA 2E2BA 1FMKA 4G5PA 4EHZA 4PTCA 1OBDA 1PXNA 3FLYA 2ZV7A 3NCGA 4PTGA 1J1CA 3UOLA 4QMLA 3F5XA 2I40A 3ZBXA 3BELA 1BX6A 3SGCA 1Q8TA 1IRKA 1L3RE 4YUQA 3LFCA 2YCQA 3GCQA 4GU9A 3FPQA 1YXTA 4O7LA 4LL0A 3ZSHA 5FP6A 3IOPA 3O50A 4FOBA 3C5IA 1H00A 3BYSA 4J8MA 5JH6A 2PHKA 2QHNA 4RX7A 5A6OA 3MESA 4FKLA 4ZY6A 4IVCA 3KKVA 3DLSA 4JDIA 2FO0A 3A7FA 3MBLA 4I5PA 3CE3A 1KSWA 3CY3A 3S4QA 4KSQA 3VS4A 5JQ5A 3OWJA 3PXYA 3G6HA 4FF8A 2BUJA 4K9YA 4XRLA 4UY9A 2X7FA 3BI6A 2PVJA 5EM5A 3HMOA 3U6HA 2VGOA 1UV5A 3Q96A 1I09A 3Q2MA 4F0FA 3LE6A 3BGQA 4KA3A 1PXOA 1SVEA 3HECA 2UW9A 2VAGA 5T6KA 4AG8A 3ZS5A 4DFXE 2JKKA 4XG7A 2ITUA 4FV4A 2GNHA 2YWPA 1STCE 5L4QA 4C3PA 5CF6A 3KRJA 3JVRA 3AC8A 4L42A 3U8WA 2W1GA 1PXJA 4E6AA 3MJ2A 3D15A 4L7FA 4Z16A 3DY7A 4P5QA 5TE0A 4RRVA 2BMCA 4OT6A 5HICA 3IGGA 3EQCA 4DLJA 4FTCA 3UO5A 3I0OA 5E92A 4FKUA 3OS3A 4BKZA 5HLWA 4JBPA 4W9XA 4O7RA 1EH4A 2HWOA 2E9OA 4NTTA 4DG0E 2W4KA 3ZRKA 1WAKA 4FEWA 1YW2A 3Q9YA 5CQWA 2OU7A 3A7IA 3NMUF 4ITIA 5HTIA 4X2GA 4JJRA 3CEKA 4O91A 5IQFA 3O23A 3QGYA 4FTLA 5DT3A 3G6GA 3D94A 2EXCX 3DFCB 3OCTA 4TYIA 5TOZA 4FNZA 3ZO2A 4O7WA 3E63A 5AAFA 4P5ZA 5I3OA 4U40A 4BDAA 2WMXA 3UIBA 3QX2A 3ZFMA 4NKAA 2UZWE 4EZ7A 4TTHB 5CZIA 5TO8A 3VQHA 5CAQA 4QMUA 3LJ1A 2WGJA 2VTHA 4EONA 3EN4A 4H05A 2C6LA 2B9JA 4TN6A 3ZSGA 3V8SA 3F2RA 4FKWA 4YSMA 2GDOA 3V5WA 2CCIA 2ZV2A 1UA2A 1GZNA 2YDKA 2ETMA 4FKGA 2R2PA 2HENA 5DVRA 5EM6A 3CCNA 5JMSA 3R1YA 3V8WA 2Z7RA 5AEPA 4O7YA 1CMKE 2C3JA 3R2BA 3QWKA 3ROCA 5E1EA 4TNDA 5AR5A 3VBXA 2OXDA 2OKRA 4LGGA 4L53A 4M0YA 2GQSA 3W2OA 2H8HA 2GHLA 4I21A 5HVKA 2VWVA 3KULB 2O5KA 2XEZA 3F7ZA 5BYLA 2W1CA 5L6OA 4MBIA 4WUAA 3TUCA 4OR5A 5GNKA 5HG8A 4CV9A 4KKHA 5G1XA 4B0GA 3KULA 3EJ1A 1UWHA 4X7QA 5AR8A 3HP5A 4A9RA 4X2FA 3KXHA 4YPSA 3DAEA 1Q5KA 4OLIA 5D10A 1BMKA 2X6EA 5CLPA 3PY3A 3UQCA 4YZ9A 4CFMA 5KE0A 5CVHA 5HCZA 2FSTX 2FA2A 4E73A 2C6MA 3C4WA 4V0GB 2X0GA 3KCKA 3R9NA 4RIYA 3PRIA 4QP4A 5EDPA 2VTPA 4I41A 1OL1A 1U5QA 1YOJA 3IDBA 2UZLA 3VRZA 3W2SA 3HKOA 3DQXA 4LRJA 3NW5A 4UMQA 4V0GA 3BHYA 2H6DA 4BDHA 2JDVA 2BIYA 4I23A 2RFSA 3UIMA 2YIWA 3R9DA 5IQCA 4Z7HA 5DIAA 5AV2A 4FKTA 3COKA 4BL1A 2OFVA 5CSXA 4DF3A 4RFMA 5M4IA 4LL5A 5CTPA 1OBGA 4APPA 4JXFA 2YDJA 3KFAA 4IMYA 3IQ7A 2OLCA 3FDNA 3M11A 4KSPA 2XA4A 2VO3A 3GCVA 5AA8A 3H10A 3OVVA 1ZMVA 2R3NA 1PMEA 4JLCA 2P55A 4G9CA 2PMOX 3GUBA 1WBNA 2J2IB 3Q5IA 4JIKA 4FG9A 2JDSA 4ASXA 2QOFA 3DA6A 3WBLA 5M55A 4TW9A 3R8ZA 3KC3A 5E8UA 3H0YA 4BDKA 4FBXA 5JZJA 1A48A 4QMTA 2BHHA 2XH5A 3F3ZA 3SHEA 4L00A 4QMNA 5C8NA 3MYGA 3D7TB 2ZJWA 3FZTA 4XH6A 1Q8YA 2FGIA 3TJDA 4OTIA 2WB8A 3ET7A 3TZMA 3PWYA 3MY5A 4GG5A 4PNKA 4R3RA 3IONA 4FTAA 3NNVA 3D7TA 2HWPA 5IQDA 3RK7A 1FBNA 3NYVA 1YWVA 3O7LD 4ANNA 4LOQA 4O0WA 3RGFA 3VUDA 3A8XA 4PF4A 4O0SA 3FI3A 5BVDA 2PVLA 4EH3A 4YC8A 1DAYA 2RIOA 3RZBA 4ACGA 4AWIA 3FLWA 2BZHB 2NRUA 4GSBA 3AT2A 4YJRA 3S00A 5JEBA 5J5SA 3AC1A 4FSQA 3QYZA 4TWPA 3VS5A 3TUBA 2VX3A 1OUYA 3PJ8A 4TXCA 2ZDUA 4FX3A 5DA3A 2YAAA 1DAWA 2F4JA 4QYGA 4RZVA 5C8MA 4E4MA 2JBPA 3AMBA 5C4LA 3UC4A 3BX5A 4QMXA 5IA4A 3U4WA 4Y46A 4FSZA 1DM2A 1V0PA 2VWUA 1Y8GA 1FPUA 3RBWA 3KMMA 4TYGA 3DT1A 3HDNA 2R3QA 4FI1A 5AP6A 1OIQA 2JITA 5HE0A 3UP2A 3WYYA 3TV4A 5I4NA 5ETAA 2XIKA 2BIKB 3OD6X 4EK6A 2BROA 2X6DA 4IFGA 2JDOA 4AGUA 3UO6A 3ZBFA 2YZLA 4BDEA 1K3AA 2IVVA 4AAAA 3FUPA 4ANSA 2QG7A 3ATSA 4EH4A 1Q99A 5CU0A 3POOA 4UMRA 3UMWA 2PE2A 5CS6A 3OT3A 3GU5A 3OXIA 4XG2A 1JWHA 1YHVA 4XOZA 4J97A 4BTKA 2GQRA 2H96A 1H1WA 3I1AA 4KAOA 4V01A 2X2KA 1SNXA 5HBJA 4UX9A 4DC2A 4FV8A 3F61A 4LQMA 4YURA 3MW1A 3R73A 5BPYA 4WIHA 5AUVA 1FGIA 3C0GA 3SX9A 4ACDA 2W0JA 1CM8A 1ZYCA 1RW8A 4K2RA 3U55A 4YJOA 3QAME 4JVGA 4WG4A 1WFCA 4DITA 2V7OA 3E88A 2GNJA 3MA3A 4XP0A 5HKMA 3IW7A 3KL8A 3SRVB 3AGLA 3IDCA 1WBVA 4PNIA 3C9WA 3I7CA 5E1SA 2RF9A 4YC3A 2CLQA 4TT7A 3LIJA 2BVAA 3FSKA 3W32A 5B2LA 4FK6A 4EOQA 3SRVA 4MXCA 4I1ZA 3DK6A 4TY1A 3SXSA 4FZAB 4F08A 4FT3A 4CTCA 4D9UA 3QD2B 4FV9A 4BCFA 1YQJA 2W1IA 2X8IA 3EQBA 4QTAA 1E9HA 1MQBA 2PE0A 1YI4A 2R4BA 2CKPA 2GSFA 2ZDTA 3OUKA 2WMQA 3WF8A 4BGQA 4CRLA 4WA9A 5CEKA 4EH9A 4F0GA 5KMJA 3FQHA 2QU5A 1UU3A 4CYJA 1V0OA 2UW8A 3L9NA 2G2FA 2X1NA 2AUHA 3LPBA 2W1DA 2XK6A 1BI7A 1Q8UA 3PIYA 2XK8A 1QPDA 4C61A 4ZSAA 4L6QA 2IW8A 3AD5A 2I6LA 2OIQA 2R3PA 5D1JA 4G3GA 3P4KA 4USEA 2IW9A 1P4OA 3DXQA 2O2UA 4F6SA 2H9VA 3CGOA 3NNUA 3ODYX 2IO6A 3D2KA 4QRCA 4OAUC 5HE2A 3TZ7A 3TXOA 3QZGA 4AE9A 2IZTA 2OF2A 4CZUA 1LP4A 2W4OA 5KNJA 5LVPA 2A19B 4BN1A 3D5VA 2YIQA 4UMUA 4KIQA 3NLBA 4IM2A 4AFJA 5E8VA 4O7ZA 4BWPA 3VULA 3OT8A 1AD5A 2JIIA 2QOCA 4JQEA 4DAWA 1S9JA 3SAYA 1YKRA 4GT5A 3R6XA 4ZTRA 3TNIA 4U81A 3SXRA 3V6RA 2BFXA 1P2AA 1I44A 4EK4A 5AUWA 5IDPA 4FKVA 4IWOA 2JD5A 1JOWB 3KMUA 3QZHA 4L8MA 1RDQE 4F1OA 5C8KA 4BCNA 1R0EA 2WTVA 2GFSA 5AP7A 4R5SA 4YPDA 4EI4A 2P0CA 2R7BA 4G6LA 1JKSA 2VZ6A 4MQ2A 4G1WA 5KMIA 5HNIX 3ZH8A 1YOMA 4IACA 4WRSA 5HORA 3D4QA 5L8LA 2ZM3A 4S33A 3RPYA 3QRTA 2ITVA 2UW3A 3EQDA 4MBLA 4NZWB 5AUTA 1A9UA 2HZ0A 5BYZA 5K9IA 3MIAA 2UZTA 2E9PA 5CEOA 4B8LA 3EQPA 1M17A 1L8TA 3L8VA 2PUIA 2HYYA 3FYJX 2I0HA 3PP0A 5CEIA 4I0TA 3SC1A 5IQHA 3ANRA 3BLHA 4HCVA 4AXAA 4EC9A 4G17A 4MHAA 4GV1A 3OWPA 4YBJA 5IQGA 4UV0A 1G8SA 4JOAA 2IJMA 4RJ4A 1R3CA 5HO7A 4Z9LA 5L2SA 2HZIA 4Y5HA 3GBZA 3G90X 3VBVA 4DTKA 4YLLA 3W2CA 5FRIA 2C3IB 3ORIA 4OBQA 4A7CA 4NW6A 3O71A 4EOJA 1ZYJA 2JGZA 4FZ6A 5J95A 3V8TA 3IK3A 4EH2A 2HXQA 5T3QA 4AS0A 3LM5A 5JFSA 2QO9A 4XP2A 3WF6A 3DB6A 3UDBA 3QQHA 1ZY5A 2WU6A 4YMJA 2HZ4A 1JSVA 5CI7A 3EL8A 4BZOA 5JZNA 1O6YA 2XK7A 2ZB1A 4YLJA 3PWDA 2J0JA 3PE1A 4PRJA 4AFEA 5KCVA 2C0TA 3R00A 4CMUA 2CGXA 3GOPA 3ULZA 4AT4A 1W7HA 1IA8A 4CSVA 4F7LA 2W1HA 3AGMA 3HV4A 5FXQA 3UPZA 3VUHA 5D7VA 4ZAUA 3ITZA 4FSRA 3TN8A 4D4SA 4YJTA 2F9GA 4M68A 3MI9A 4C4FA 3SOAA 2YLEA 4QQJA 2VD5A 3ERKA 3ZM4A 4DH3A 5BMMA 3NUYA 4E20A 5HU3A 4O7TA 4ZMFA 3BU5A 4I5MA 4HNIA 4R1YA 4JBVA 4PMMA 4YJUA 3IKAA 3NDMA 3GQIA 3QRIA 1GZOA 3JYAA 2ZM1A 4RC4A 2PVFA 3F9NA 3I7BA 4XMOA 5HBHA 3P9JA 5KMLA 4OTDA 4IAZA 4AT3A 3UC3A 3DBDA 3O51A 2CNUA 1OKVA 4FSTA 4DCEA 4AT5A 5AR4A 5AR3A 2JDTA 3VUMA 4C4EA 3RWQA 4EYMA 4MWIA 3OF0A 4JBOA 3CQWA 2QLQA 4NFNA 5LARA 3TEIA 1Q3WA 3ZFXA 3ZLWA 4G3DA 4RJ3A 3VS2A 2GMXA 2X39A 4ERWA 3U6IA 5CWZA 4ONAA 2WOUA 1BKXA 3H9OA 4N70A 1V1KA 5FEDA 2PUNA 5HIEA 4TYEA 1IEPA 1U54B 3FXZA 3WZUA 4WNKA 4K33A 2FH9A 4MNEA 3DXPA 2ITWA 3ACJA 4MD7E 2PWLA 2XBAA 3BIZA 3KXMA 3I0QA 4DT8A 2VWZA 1IR3A 3O8UA 4MBJA 4ZOGA 4D0XA 5ANGA 2C30A 3K5UA 4LI5A 3PA4A 4QYEA 3MIYA 2WTIA 4RIWB 3P7CA 3LJ0A 4I92A 4JI9A 4ANBA 1PHKA 3R1NA 3GU8A 2BKKA 1Q8WA 1O6LA 5JN2A 5HNBA 4A4OA 4XX9A 2X4ZA 4FKPA 3CXWA 1UKIA 4DE4A 3RMFA 3KMWA 4YJVA 5E8YA 4IX4A 4TWCA 4AX8A 3PXRA 3KVWA 3QX4A 4HNFA 4CT2A 3CGFA 4AUAA 3FZRA 4FTRA 3JY0A 4BIBA 1Z57A 3NYXA 3L9LA 2VO6A 3PIXA 2XM9A 1BUHA 4ZY5A 3MFUA 1JQHA 3MV5A 2GNGA 4Z55A 4IXPA 5HZNA 1XBCA 4II5A 4I6QA 2HK5A 2Z8CA 1QL6A 2HW6A 3QLGA 4IZ5A 3QQFA 3F7WA 3H30A 3UNJA 2B54A 3ALOA 1OKWA 4KBCA 3DNDA 2AYPA 2JFMA 3B2WA 3QU0A 4E3CA 3E8DA 4GJ3A 4LRMA 5GIOE 1R78A 3O2MA 5DLSA 3PY0A 5EYMA 3ENMA 4NT4A 4C02A 5AV4A 3MY1A 4I6HA 4AA0A 4EZ5A 2X81A 4UWYA 3T3VA 2YAKA 1A06A 4U5JA 5EW3A 2ZVAA 5AR7A 3UYSA 5J5TA 5TF9A 2VTAA 3F6XA 3H9FA 4U44A 1H01A 4I20A 2ITNA 3A4PA 3FZ1A 5AUUA 5C4KA 3GU4A 3OUNB 2YM7A 3HMNA 5HEZA 4OTRA 5DR9A 4D9TA 4ZZOA 4V05A 3QTQA 5LWMA 4YJPA 4U43A 2Z7QA 2QR7A 4O0TA 2J9MA 2YISA 2G1TA 4JRNA 4IVDA 3KK8A 2I0EA 1WMKA 2W17A 3CP9A 2XKEA 4MXXA 4O21A 4TWNA 5EW8A 4GFMA 3UYTA 3NUNA 4FV2A 3ZOSA 4CCBA 4CVAA 1ZYSA 1ZOHA 4J1RA 4QQ5A 4RC3A 2IVUA 3FQSA 3FYKX 5DR6A 4F0IA 2GTNA 5HE3A 3TNQB 4MXYA 3Q04A 1JPAA 3A7JA 5HG9A 1H27A 2IWIA 3KREA 4EJ7A 1IASA 4LOPA 5IKWA 2DWBA 3CD8A 4FTJA 5CEMA 2ESMA 2PVNA 3V04A 4JG6A 3LFEA 3WILA 5BUJA 4H3QA 5EI6A 3DTCA 1WCCA 3LXPA 2BCJA 3KRWA 2IVTA 2E9VA 4XNEA 4YO6A 3CSVA 3NS9A 3QRUA 4O84A 2OI4X 4EC8A 2OIBA 2C69A 3PLAE 4UZHA 2P2IA 2NRYA 2PZRA 3NUPA 3R22A 4M84A 3RAKA 1PMVA 4U42A 3W18A 3AC5A 5L2IA 4JG7A 2Y0AA 3PDTA 4B99A 4M13A 4FTNA 3MS9A 3HUBA 3S2PA 4QP3A 5DRBA 3K54A 2YIXA 3ORXA 4MH7A 4KS7A 4TKSA 3MGYA 4GFGA 4KKGA 4CMOA 1LUFA 4YP8A 2I7QA 2CNVA 3W1FA 5TR6A 4YZNA 3UMXA 3P0MA 4BGHA 3EYGA 4RLKA 5B7VA 3CR0A 3DBEA 3GCSA 1AQ1A 3VF8A 4E4NA 4HGLA 3RALA 1J7LA 4ASDA 3OWKA 3RAHA 2WMAA 3OFMA 3H9RA 4JT3A 4N4SA 4C4JA 2P3GX 2Z60A 3UOHA 4HVGA 5LVOA 1SM2A 3WZDA 3AG9A 3QC4A 1RQQA 4C37A 4C3FA 4QMSA 2OZAA 3VNTA 4NUSA 3RI1A 1VYWA 3R02A 3KN5A 1ERKA 4YNEA 3FC1X 4BKYA 4D1SA 3NNXA 4LV5A 3Q9XA 4GRBA 2CLXA 4F7JA 1OPKA 2G01A 4L45A 2OZOA 4IX3A 5HNGA 4GKHA 4C2WA 3SG9A 3NSZA 4KS8A 3R8UA 3C4ZA 3D83A 3WOWA 1YXUA 2VNYA 3EFWA 4OTHA 2WMSA 2I0VA 4NTSA 4QP6A 4BDDA 2W99B 5A9UA 4FYOA 3OOMA 3T9IA 4FT9A 3BPRA 4BYJA 3CS9A 5IH6A 4EQUA 3SD0A 2XIYA 4AGDA 1KV1A 2GS2A 4MKCA 3QUPA 3VBTA 4LUEA 4A9TA 2W96B 4GJ2A 4IAFA 3BV2A 3DOGA 2LGCA 4PL3A 4EKKA 3ZM9A 3VW8A 3WE4A 4BBMA 5M06A 2YERA 4QPAA 4CKIA 5M07A 4R3PA 4CMTA 4J71A 4GUBA 4OTQA 5H8GA 4P7EA 1WBTA 3E8CA 3PXZA 4W8DA 1VEBA 2V7AA 5AP2A 3ZYAA 4HVIA 1NT2A 3F3WA 3UZRA 4CG8A 3BE9A 3HAVA 4KBKA 2EXMA 4RA4A 1JAMA 3P7AA 4EOOA 4AW5A 4EK5A 5CF5A 1Y91A 5IMXA 3BRBA 5DEWA 5D12A 4GCJA 4I3ZA 2J90A 3NVKI 4FKRA 3KXXA 4O0RA 3FMKA 3PJCA 5IG1A 2QLUA 2RFDA 1H1PA 3SXFA 4LMNA 1BL7A 3RPRA 2YM3A 5FP5A 5KZ0A 1Q3DA 1V0BA 4BGGA 1W83A 1WVWA 2XUUA 3HGKA 5IQBA 2UVXA 2GHMA 3NZ0A 3QTWA 4S31A 5LMKA 3N4TA 3TDVA 1J7IA 4FNXA 3GU7A 4F9WA 5HX6A 3ORTA 1ZMWA 3S3IA 5IPJA 4HYSA 4G3CA 5BUEA 3QCXA 3OEFX 4ACCA 5AV3A 3LXLA 2UZEA 4WO5A 1JSTA 2ITQA 4IAAA 4C35A 4IHPA 3PG3A 1PXPA 4P4CA 3NVMB 1BL6A 5IU2A 4ZTLA 2AC3A 3PJ1A 4DGLC 2GNIA 2QCSA 2KTYA 3GC8A 1J3HA 3GOKA 4RQVA 5ANDA 1YDTE 5TKDA 1ZRZA 4HOKA 4QPSA 3JPVA 4UYNA 3R28A 3VAPA 4PL4A 3VQUA 4BZNA 5J87A 4S32A 1M14A 3R9RA 3Q4CA 2WMVA 4FVQA 4BCPA 5KBRA 4UXLA 5KMKA 2R64A 4N6YA 4R7IA 4DN5A 1GIIA 4BICA 3NUAA 4BIDA 3COMA 4G2FA 4GK2A 4QNYA 5AIKA 2P2HA 3Q32A 2JIVA 2OG8A 3PPJA 5HTCA 3R83A 3ODZX 5CF8A 2R0UA 3NEWA 4KRCA 1Q4LA 2ZV9A 3HL7A 4L52A 4PV0A 2Q0BA 5KO1A 3QXPA 3LCDA 3TM0A 3HVCA 4YHJA 2C6EA 3KRXA 3BZ3A 2ONLA 4QP7A 5E8XA 1OZ1A 5CNOA 3GXLA 3A61A 3ALNA 3NAXA 2BDFA 4GIIA 3A62A 5HO6A 3BU3A 3S0OA 5IH5A 4O6LA 4E5AX 4QMWA 3NRMA 1H26A 4O7VA 4X3FA 2R3KA 5HVJA 2B9FA 2GCDA 4AN3A 2QR8A 4DFUA 4L7SA 4MXZA 4ZIMA 2OSCA 3ZSIA 2WXVA 4EOIA 2YHVA 3EN5A 3QF9A 4IVBA 5A46A 3M42A 2PZ5A 4B8MA 3RPVA 4EH7A 4R7BA 4CEGA 2F49A 5M57A 2PYWA 4RIXB 2VTMA 3BYVA 4NKSA 4O0YA 4GL9A 4UXQA 5IEYA 1H0VA 3A7GA 3WE8A 2KULA 2W9ZB 1P5EA 1YWNA 2EU9A 2FUMA 2C4GA 2J51A 3EH9A 5FTOA 3A7HA 2QO7A 1UNHA 3P7BA 4JDHA 5GZ9A 4C4HA 4A4XA 1T46A 2J4ZA 3D2IA 3G9NA 4RIXA 4BDGA 4ZK5A 5AJQA 4HZSA 4ZSLA 3SG8A 4M69A 5DFPA 3ZLXA 3ZRMA 2EWAA 3CQEA 2UZUE 4DH1A 5DMZA 3H4JA 3BEAA 3HA6A 1F5QA 3KK9A 4XBUA 3TT0A 4FIGA 2PU8A 4RIYB 4A06A 5H2UA 4PWNA 5AMNA 4FZDB 4FIJA 3C4XA 2W1EA 3F69A 4APCA 3QQUA 4BY9E 3R8LA 3I60A 3EWHA 1OECA 3OW4A 2RL5A 2CN5A 3GT8A 3E7VA 5FQDC 3TJCA 5ETCA 4NM7A 4BZDA 1PF8A 1ZOGA 3OTUA 4NH1A 3VBYA 2CDZA 2XVDA 2JLDA 3MVLA 5I5ZA 2C3KA 1KE6A 5CENA 2FB8A 5BYYA 3TKHA 3IECA 5EG3A 4EHVA 1FGKA 3VJOA 3VS3A 1Y6BA 3WF7A 5JRSA 4BI2A 2J0IA 3C0HA 3PZEA 2QHMA 4IW0A 5G6VA 3PSCA 4CTBA 3R7EA 4EHGA 4F63A 5KUPA 4RWIA 4B9DA 5C01A 4BCKA 4KINA 4PL5A 3VUGA 2WTKB 4KNBA 4NCTA 3G15A 1KWPA 3EL7A 1T45A 3DJ5A 4U0IA 4GK3A 3UIXA 3D14A 3ZO3A 4AZFA 5DEYA 2CSNA 3RINA 5K4JA 4GVAA 4LRKA 4DH7A 4RX5A 4C36A 5I9XA 3RNYA 2ZV8A 4G5JA 3DZOA 3E93A 2XIZA 2XP2A 3TV6A 3E87A 4ANMA 4YC6A 4O82A 2Q0NA 4O22A 5B2KA 1GZ8A 4NM5A 3V5PA 4FSWA 4U3ZA 1K9AA 5A4LA 4FEXA 4FKJA 1QCFA 3BCEA 1OPJA 4O86A 2BRNA 3D5UA 3EQFA 4EUTA 3PXFA 4FIHA 4NU1A 4FGBA 4OTWA 3VBWA 2XRWA 4USFA 3SQQA 4BTFA 4E4LA 3MPMA 3Q4UA 2R3LA 5FLFA 1GIJA 3UP7A 4IH8A 4LM5A 3LQ3A 4M97A 5K5XA 4GYGA 2F2CB 4AZEA 4PMPA 3QQKA 4A9SA 5DYJA 3PPZA 4ITJA 3ORPA 3ACKA 4DEGA 1XBAA 4KIKA 4CFUA 5EYKA 3KXZA 4WG3A 3LFAA 2VTNA 4O38A 4QQCA 4YJSA 1GY3A 2FYSA 5EK7A 3A8WA 2R5TA 3HDMA 3R8PA 2DUVA 4EBWA 1URWA 5L2WA 4BTJA 5J7HA 3DU8A 1XO2B 3FI8A 3KXNA 4F6UA 4BCJA 3HMMA 3WIGA 5L3AA 4O2ZA 5FDPA 1MRUA 3R7VA 3R8VA 3DJ6A 1H4LA 3IG7A 2R3JA 3KQ7A 2GQGA 2BAQA 1SMHA 3MFSA 3RZFA 1H28A 3ZXZA 2E9NA 2V62A 3Q6UA 4K0YA 5K3YA 3V5JA 3VUTA 4L9IA 3BHVA 4PDOA 4NW5A 4LYNA 3LW0A 4PPBA 2WNTA 3MTFA 4NEUA 3MVMA 4ZS0A 1YRPA 2YM6A 4D0WA 2YEXA 3MSSA 1U5RA 4FZ7A 3H3CA 2UW5A 4XUFA 2YN8A 4QOXA 2O0UA 2W4JA 4QMOA 3OXZA 3NR9A 3FMMA 3ZDIA 4RFZA 4ANOA 4D2RA 5DRDA 5JRQA 3BLQA 4D2SA 3DPKA 3KRLA 4Z7GA 3QL8A 3UGCA 4FEQA 3KB7A 1KE5A 4G16A 4H1MA 4BWXA 4DG2E 2QOIA 4FMQA 4J99A 3U4UA 4AZVA 5HU9A 1MUOA 5DI1A 4FIFA 3P79A 4BHNA 3OROA 3FL5A 3NX8A 5FTQA 1TVOA 4AP7A 2QI8A 4CV8A 2PVRA 3AMYA 3R1SA 3I6UA 4MYGA 3WARA 3ZUTA 3OW3A 2WD1A 3HUCA 2VTQA 3QWJA 1RE8A 4C59A 4EQMA 3B8QA 4YTCA 2A4LA 2YM8A 4ZLOA 2VGPA 5AFVA 4O81A 4E1ZA 3AC3A 1UWJA 3PVGA 3QLFA 3GFEA 1DS5A 2BZJA 1ZXEA 4GH2A 2X7GA 2SRCA 2XF0A 4RJ6A 5H3QA 3LOKA 4Q5EA 5BX0A 2C5XA 1YHSA 2JFLA 3LCTA 2R3MA 4UALA 3ZZWA 1OIUA 4HPTE 4RVMA 3RPOA 3Q6WA 3BLRA 4F65A 4ANLA 4GU6A 4UMTA 2WHBA 3P86A 4I6BA 2P33A 2YM5A 3QUDA 4CD0A 4DGMA 5JT2A 3G5DA 5EOLA 1U59A 3R8MA 4AZSA 1NVRA 4IB5A 3VIDA 5IEXA 4RVTA 2ERZE 2NO3A 1P4FA 4N0SA 5A4QA 4UBAA 2CGUA 3KU2A 3ID6C 1REKA 4X21A 5EYCA 3QRJA 4IJPA 3QCQA 5CEPA 4WNMA 2B7AA 2XMYA 4BCIA 3U54A 4IWDA 4CQEA 2VTOA 3QZIA 3QKMA 3EN7A 2UVZA 2FSMX 4DA5A 4KIPA 4XS2A 3V5QA 5I9WA 4R8QA 4E8AA 3C7QA 3MVHA 2BHEA 4QPMA 4RBLA 5DT0A 5JGBA 2X9EA 5H9BA 2J5FA 5LVLA 4Z3VA 4NM3A 3WZJA 2R3FA 4FIIA 4O83A 5J79A 1PXLA 1UU8A 2HAKA 2Y9QA 3MB6A 4QMQA 3R30A 3RK9A 4R7HA 4ZP5A 4JX7A 4DHFA 4NL0A 4IADA 3FZSA 4O7SA 1QPEA 5AX9A 4CFVA 3BYUA 1HOWA 4IC7A 1OL6A 4YZDA 5DGZA 4CFFA 3DKCA 4KUJA 4F9BA 1ZLTA 2C6DA 5AX3A 1S9IA 4BDCA 4MK0A 3G0EA 3B2TA 4QYHA 1PMNA 3VS7A 4DEBA 5DR2A 3BBTB 4XV2A 4GG7A 4D55A 4JIAA 4O96A 4ACHA 5CAPA 5DT4A 2H34A 3R9OA 4ACMA 2XJ2A 4DGOA 2QURA 5D9HA 1OGUA 3C4CA 5IISA 4XG9A 5C1QB 2BILB 4AE6A 1CSNA 1URCA 3VBQA 5GINE 4W4WA 1JSUA 4QT1A 1OUKA 4RPVA 5JGAA 2PTKA 4FGRA 3ENHA 4U41A 3D9VA 4UMPA 1OIYA 4TYHA 2GFCA 5AR2A 4DEEA 5LJJA 3K5VA 2R3OA 3R21A 5BVFA 3TACA 3CD3A 4ANQA 3R1QA 5ACBC 4D1ZA 2PULA 3II5A 4KD1A 5ETFA 4XG8A
chains in the Genus database with same CATH superfamily
4DFBA 1PYEA 2YA9A 3LZBA 3LFNA 4IWPA 5AUZA 1MQ4A 2V22A 4UZDA 3HAMA 3GI3A 4FOCA 4QD6A 4P90A 2BDWA 3N9XA 4AGWA 4BCGA 2WMRA 2XNOA 3GGFA 1WBSA 3QQJA 4X2KA 2XKDA 4WSYA 4U3YA 2OWBA 5A14A 4XP3A 2AC5A 2QOOA 4JNWA 5AWMA 4CZTA 2PVHA 4OGRA 5KMNA 1OPLA 2C68A 1H1RA 1XJDA 4FL1A 4IX6A 2ZMDA 4JDKA 4E7WA 1SVHA 1YOLA 2QOKA 4AN9A 1GZKA 1Q62A 4FTIA 4CLIA 3UVPA 3TKUA 3PVBA 5IMEA 1LEZA 3HMIA 5J9YA 3VWAA 4I4EA 5EDQA 1O9UA 3AOXA 4FNWA 3FWQA 5GZ8A 3RM7A 4AACA 3UOJA 3TG1A 4K18A 1LEWA 4WBOA 5CAVA 1IAJA 5IA0A 3TZ8A 3V5LA 2XBJA 4WT6A 5HCYA 2X0QA 1MRYA 3MY0A 4IEBA 4XYFA 4J95A 1B6CB 2A27A 2YJSA 3FXWA 4IB3A 1GOLA 5AUXA 3V3VA 3C4FA 4L43A 3QGWA 2OFUA 3A60A 5F9EA 2REIA 3FL4A 4MNFA 2Z7LA 4RJ7A 1J7UA 4F7SA 4A9UA 3T8OA 4CKJA 4RWLA 4ERKA 4XJ0A 3MH2A 4I6FA 4BBEA 4M14A 3KY2A 4D58A 2OF4A 2OJJA 3GFWA 2C5OA 2JKMA 3L1SA 3ZLYA 2QODA 4MTAA 2UV2A 1ATPE 3FV8A 5CXZA 4Q2AA 3D5WA 5M56A 4CFXA 4M0ZA 4C7TA 5A6NA 5DN3A 4FICA 4JQ7A 4C3RA 3TZ9A 2C5VA 2WQBA 4W4YA 2J0LA 5E9EA 1JKKA 2J5EA 2X8EA 4OT5A 1QMZA 1Y8YA 4HGTA 5FUTA 1WBOA 2C6TA 3IS5A 4EBVA 3AC4A 5CY3A 1XHAA 5ANKA 4QP2A 5IA5A 3KN6A 1PW2A 2DYLA 2FSOX 2PMNX 3L9MA 3LXKA 4MNEB 3TDWA 4S30A 2O63A 2OIDA 4FNYA 2PUPA 3OP5A 2ZYBA 4NJDA 4ARKA 1J1BA 2Y6MA 4FG8A 1XMLA 3IW4A 5E8SA 3ZRLA 4E93A 4F64A 1RJBA 5ANOA 3MFTA 4EKLA 4PY1A 4QYFA 2C47A 3PA5A 1OL2A 4A4LA 2BALA 4I4FA 4J7BA 4CT1A 4XG3A 4O6EA 4D4VA 4QP9A 2OJGA 1OKZA 2CKEA 3EQHA 4PTEA 3RK5A 4A9YA 5IA2A 4O4FA 2B52A 5LVNA 2Y6OA 3PJ2A 3POZA 4EK3A 1WZYA 3EN6A 3UNZA 2F7XE 3DFAA 3F82A 3MA6A 5KHWA 3HA8A 4IQ6A 2YZAA 2X4FA 3Q60A 2YABA 4O7NA 2IW6A 2XIRA 4IAIA 2UW6A 4FR4A 4NSTA 4PQNA 3FEGA 1YI3A 4M66A 5AAGA 5BMSA 3DQWA 3TUDA 3FZOA 4FC0A 3ORLA 4BI1A 4OUCA 5LMBA 2Z7SA 3ORKA 4IM3A 4L46A 2IZSA 5J1WA 4WKQA 3QCYA 4DBXA 1XBBA 4E6DA 1B38A 1UU7A 4FVPA 4HYUA 2VNWA 3A99A 3HZTA 4BBFA 5EQEA 3DKOA 2LAVA 1PMUA 2HW7A 3ZCLA 2QOHA 4EOKA 4F9YA 3R7IA 3NW6A 4GS6A 3VJNA 1HCLA 2WMWA 4HGEA 5DHJA 5EFQA 4QYYA 4LV7A 4IZAA 4JL9A 3OWLA 2YJRA 3QTSA 3EZVA 2HOGA 4ITHA 3U87A 4YU2A 1H08A 5F95A 4CZYB 3BYMA 4HVDA 3QQGA 5DNRA 3R7OA 5BUIA 4Q9SA 1OIRA 5C27A 3C13A 2BFYA 5D11A 2DQ7X 4O4DA 3RJCA 4WD5A 2ITZA 5H8BA 2BRGA 3A4OX 3O7LB 2ZAZA 3ZMMA 2VX0A 2NPQA 4YSJA 1SZMA 4IVAA 5CT7A 3R9HA 3ULIA 4JAJA 2WQNA 3FAAA 4XV3A 5CU2A 3TYKA 4L3JA 3H0ZA 1VZOA 2YDIA 3MDYA 4KB8A 3BV3A 4RLLA 4AZTA 5CSVA 3DB8A 4FODA 2GPHA 5ANEA 3EMGA 1H8FA 1NXKA 2B1PA 2JIUA 3FSFA 4I22A 4F70A 4W4XA 4CKRA 2J0MB 4ZJIA 2VTJA 2B4SB 3C4EA 5AIRA 4D2TA 4QQTA 1G8JA 1B39A 4FK3A 5L8JA 2AQXA 2JKQA 3VS0A 2O3PA 2VN9A 1H07A 4I5CA 1CDKA 5L6PA 1XH9A 2RKUA 4I0SA 5FBOA 4LFIA 4USDA 5LCJA 3R0TA 4EUUA 4FZFB 3DGKA 2XKCA 4YTFA 3UE4A 4BYIA 4CRSA 5M4UA 2WTDA 4A07A 1OB3A 3KRRA 2WTJA 4H58A 3DDQA 3AXWA 1E1VA 3FJQE 3QTZA 3M2WA 5HCXA 5K0KA 1Q41A 4FL2A 4ASEA 3VO3A 3CTHA 3FHRA 2IZRA 4ZTSA 2YFXA 2CNQA 3CJGA 3L8SA 2GTMA 2WMUA 1G5SA 5IZFA 1H25A 4FL3A 2PMLX 2RFEA 3C51A 4QMZA 5FM3A 3WI6A 3F5UA 4BI0A 4F99A 3HNGA 4ALVA 1ZARA 2XRUA 1CKIA 5LMAA 1SVGA 4JX3A 2PZPA 2XCKA 3KF4A 3DZQA 4IE9A 3F5PA 4UB7A 3K3JA 5CQUA 4YGAA 4ZTNA 3GC9A 4O1PA 5EOBA 2W1FA 3UO4A 3VW6A 4YTHA 4BDIA 1F3MC 4D5KA 4H1JA 3MH3A 3QKKA 2IPXA 4XLVA 1GAGA 5I0BA 1HCKA 2OZAB 4D4RA 4DEHA 3OMVA 2ITXA 2V0DA 5D7AA 3W33A 3KCFA 3QYWA 3G2FA 5FDXA 3SVVA 3GC0A 4RVKA 5LMKC 4RGJA 4YR8A 4AAYA 2X0PA 4E4XA 3PPKA 4WHZA 4IAYA 3DJ7A 4QMYA 3R7GA 3LFQA 5HBEA 4WNOA 4EHEA 2W7XA 1JKTA 4Q9ZA 4FUXA 4EOPA 5A54A 2Y4IC 5BVEA 3DBQA 4FIEA 5FEEA 3OCGA 5AUYA 4IDTA 4YO4A 4LDTA 5IEVA 1XH8A 4LGHA 4FT7A 1TQMA 4V04A 4I94A 5AAEA 4TWOA 3CJFA 3Q53A 2XCHA 4K11A 4LGDA 3O96A 2BZIB 4ZTQA 4XCUA 3OY3A 4FT5A 4RSSA 5E91A 4F6WA 1LPUA 2QOBA 3SA0A 3W8LA 5KX8A 2QVSE 4K1BA 4RC2A 3CTJA 4WOVA 1NA7A 1OITA 2YCRA 3U9CA 3N4VA 2W9FB 4K77A 3ZDUA 5M09A 1U4DA 1WVYA 3IDPA 1UKHA 4PDSA 4MF1A 5L2QA 2BZKB 3OZ6A 2VWBA 5A4CA 5EW9A 3Q4TA 1KUTA 2B9IA 3CTQA 1APME 4WRGA 5EHLA 5HG7A 3F88A 4KUJA 2GHGA 4UWBA 1M2RA 3DS6A 2PZYA 3G51A 3L8PA 3ETAA 4RZWA 2YACA 5HLNA 2ONLC 4IDVA 4YJQA 5KHXA 5EHYA 4GKIA 3TTIA 2B53A 4BCOA 3MN3A 3ZONA 5HHWA 2F7ZE 4X3JA 2OJIA 3DKFA 2G15A 3UOKA 4X3FC 2Y4IB 1FOTA 3DXNA 4XBRA 1Y6AA 2V5QA 3BGZA 3UVQA 3ZU7A 4YZBA 2BKZA 3E7OA 1DI9A 3QKLA 5CNNA 4ZTMA 3AC2A 5CU4A 1OM1A 2J7TA 3RTPA 4IB1A 3NUUA 1XH7A 4M12A 1Q24A 3PFQA 4IX5A 3AKJA 4MXOA 4NM0A 5M53A 3AT3A 1ZYDA 4QTCA 3IPHA 4I5HA 2X2LA 3TI1A 1PXMA 2QNJA 4AOJA 2C6KA 3JY9A 3FKLA 4D1XA 5FGKA 3ATTA 2CGVA 2OJ9A 3QBNA 2VWIA 4IFCA 4Y73A 3JR1A 1KV2A 3QUEA 2UZDA 2QQ7A 4ZSEA 2HY81 5D41A 5FM2A 5JSMA 3W2QA 5AP1A 4FSMA 3R01A 2XB7A 4F1TA 2OO8X 3QTXA 3ZO1A 3Q3BA 3EKKA 5AP3A 1OI9A 2BPMA 3SW4A 3F5GA 3PRFA 3JXWA 3G0FA 4HZRA 2XS0A 2BRBA 1ZZ2A 4D2PA 3OBGA 5T68A 5HIDA 4Q5HA 5AA9A 3GC7A 5FG8A 3UZTA 1UNGA 1OVEA 2X9FA 3HRBA 4BTMA 4GT3A 1NVQA 3C1XA 3FLQA 1K2PA 4KRDA 5EYDA 3ZC5A 3AQVA 2PMIA 4X3FB 1ZWSA 4E26A 4L67A 4EOMA 5LXMA 4N57A 4FUYA 3CPCA 2VO0A 3HYHA 3E64A 1MRVA 5GJDA 4NIFB 2YIRA 4HCTA 2W5HA 4G3EA 5IUIA 1WBPA 3O0GA 3CKXA 5A4EA 5IQIA 1PKGA 2XYUA 4O0XA 2VWXA 4NCTC 1FQ1B 3FI4A 3RPSA 3UTOA 3ZEPA 2C1AA 4AW0A 3EQRA 1ZOEA 2PVYA 1ZYLA 4DH8A 3NYOA 4NIFA 2ITOA 3QA8A 5I9VA 3SV0A 5HIBA 4D2VA 1JKLA 2WTKC 3AD4A 3GB2A 5HE1A 2XJ1A 3WF9A 3OHTA 4HYHA 4M69B 1WVXA 3BGPA 4FTOA 2GU8A 4J96A 3UQFA 4GW8A 4AF3A 3KGAA 3QXOA 3RHXA 4DEIA 1FVTA 2B9HA 3Q9WA 3GCUA 3SDJA 3PE2A 4GMYA 2VWWA 4W9WA 5E7RA 3OOGA 4BDJA 5KKRC 4KBAA 3FMDA 3BL7A 4LMUA 4F09A 2PL0A 5H8EA 3Q52A 5CANA 1GNGA 3NNWA 4JRVA 4WG5A 4FV0A 5CAUA 4FJVA 5GHVA 5J8IA 3GNIB 4DINA 1XR1A 3NW7A 3EZRA 5CSHA 1YXVA 2X8DA 4ID7A 4YLKA 2UW4A 3OTVA 3V51A 4U45A 2WZJA 4AOTA 2RG6A 3CC6A 4AU8A 3NAYA 3TTJA 3P5KA 2EB3A 4C4IA 3DAKA 2W1ZA 4FTQA 1Q8ZA 3I81A 3GP0A 5ITAA 4OAVB 3F66A 2V55A 3BHTA 3C5UA 4EZ3A 5HQ0A 5IQEA 2YLFA 4CQGA 2YM4A 4HPUE 4EK8A 4ZSGA 1Z5MA 3O17A 2ITTA 4FSUA 3NIZA 3LFSA 4Y85A 4QDEA 3HLLA 4FSYA 5EDRA 3B8RA 5M4CA 4UYAA 3FE3A 1UNLA 4NJ3A 3PSDA 4BF2A 4JAIA 4D2WA 4BCQA 2IG7A 3RKBA 1KE8A 3UBDA 4RIOA 2R3HA 2PY3A 3QTRA 5HOAA 3V6SA 3TIZA 5K4IA 2CPKE 3UG2A 4CFNA 3HMPA 4AXFA 5AP0A 3RAIA 4GK4A 4Y5QA 2GS6A 2QG5A 2X7OA 5KKRB 3NFFB 3HEGA 2VTIA 4U79A 5E8ZA 3Q2JA 3VF9A 2B0QA 3PXQA 5FTGA 2B55A 4DGGA 1Q97A 3GQLA 3LQ8A 2QC6A 3DBFA 4YHTA 5CEQA 3E5AA 4PDYA 4GEOA 3ZEWA 3D7ZA 3EOCA 2Y7JA 3F3UA 3FMLA 4RG0A 5EHOA 5ETIA 4EH8A 3EN9A 5BQ0A 3OXTA 5CSWA 4U7ZA 3E62A 3PA3A 2ACXA 4FE2A 5AV1A 3ORNA 4KIKB 5DG5A 5A4TA 1IA9A 1UVRA 2W06A 3SOCA 3MJ1A 4OBPA 2IN6A 2BAJA 2WIHA 5EM8A 2EB2A 3WYXA 2WEVA 2PZIA 4HCUA 4Y83A 4IC8A 3RVGA 1Z9XA 3FY0A 4NYEA 2IF8A 1M7NA 4EORA 3F3TA 4QTBA 2RGPA 2XNEA 5LWNA 5FBNC 4BIEA 5J9ZA 3HV3A 1VLRA 5DBXA 3U9NA 4BHZA 1JVPP 5J7BA 4ZLZA 4RFYA 1SYKA 2PUUA 3LFBA 2BAKA 2VTSA 4KIOA 1ZY4A 4PDPA 3I4BA 3RP9A 3CY2A 3FZPA 1VYZA 4FV5A 4RQKA 3LVPA 3W55A 4IB0A 3W10A 3P1AA 4FV1A 3VS6A 3FY2A 3VHKA 2WTWA 4H3PA 3U6JA 4C4GA 3EQGA 3FBVA 5BVKA 2UVYA 3PY1A 2CKQA 1P14A 5JQ8A 2XKFA 2X2MA 5AP4A 4ZZNA 4GYIA 4AN2A 5EKOA 5KMMA 2WEIA 3ORMA 4HJOA 4X0MA 3BU6A 3NGAA 4QTDA 4DYMA 4BJJA 3E92A 3LCSA 3NYNA 5BNJA 3NWWA 3PLSA 3DV3A 4PPCA 2WAJA 4ZSJA 3C0IA 3NPCA 3I79A 4IIRA 5E8WA 4ZJJA 2W05A 4WNPA 2XNGA 3U51A 4CFWA 5IA1A 4QMVA 4JDJA 2GNFA 2UW0A 3DBCA 3NCZA 4EH6A 3R71A 5CU6A 5A3XA 2UZBA 4S2ZA 4X6QC 2ETRA 4X2NA 1BI8A 3R2YA 3PIZA 1FMOE 3M1SA 2JEDA 2CGWA 1JNKA 4DG3E 4F4PA 4HVSA 1F0QA 5HG5A 2QOQA 2W5BA 2WKMA 4FYNA 2XYNA 5K0XA 2BDJA 4F78A 2OICA 3KF7A 3PFYA 3W2PA 2E9UA 3O8TA 4FKSA 2XNPA 4BRXA 4OBOA 2EUFB 5BVWA 3EYHA 1M7QA 2WU7A 3DNEA 3IOKA 4RX8A 3WF5A 2XEYA 4BDFA 5IA3A 1PYXA 3O8PA 2XNBA 3FKNA 4Y72A 1VJYA 4IZ7A 2C3LA 4JG8A 2P4IA 4R78A 1YXSA 3GCPA 3TKIA 2JBOA 4O1OA 2CJMA 1YI6A 4PMTA 4TPTA 3RM6A 1ST0A 4QTEA 2EXEA 4FEUA 2J50A 4AOIA 5ACKA 4IWQA 4XHKB 2BTRA 3ORZA 3PJ3A 4ALUA 3ML1A 2BR1A 3CQUA 4F9CA 5E4HA 3ZHPC 2QKWB 3ROYA 1YDSE 2WPAA 2YWVA 2BRMA 5HESA 2VWYA 2XNMA 1TQPA 2PPQA 3BQRA 5GJFA 3RAWA 2OGVA 3A2CA 2RFNA 5ANJA 1MP8A 3CLYA 4G31A 4ZEGA 5CVFA 2HXLA 2XAMA 4H3BA 5FEQA 4U97A 5JKGA 3FC2A 4RA5A 5KBQA 3TWJA 1DI8A 2RSVA 3QQLA 4DGNA 2R3RA 4ZZMA 1G3NA 5M51A 2IZUA 2O8YA 3K3IA 4U80A 5LVMA 4LUDA 4BCMA 4CG9A 5I9ZA 3QHRA 4C57A 2Y4PA 2YCSA 3JVSA 4D28A 1CKJA 5I9UA 2A0CX 3F3VA 1VR2A 3TNPC 3QA0A 3TIYA 4F9AA 3NFGB 2OXYA 2VUWA 3EKNA 3ZUUA 5CZHA 3UPXA 2PVMA 4XLIA 4EOSA 5L2TA 5IF1A 1M52A 2Z2WA 1XWSA 2IVSA 4R5YA 4BC6A 4IBMA 4R6VA 3QD0A 4YJNA 2G2HA 5AADA 3UDTA 4TYJA 3TNHA 3R63A 1H1SA 3QD3A 2VTLA 5HD7A 3PYYA 2NYAA 1H0WA 3LCKA 2QD9A 3MTLA 1JLUE 2R3GA 3QTUA 1GIHA 4NK9A 1M2PA 4M67A 4DT9A 4C8BA 4ENXA 1TQIA 1NY3A 4HW7A 3HRFA 4MXAA 3LM0A 4MX9A 3GENA 5JGDA 5IQAA 3ZLSA 2OJFE 2WOTA 2HCKA 2OH0E 3WZKA 4E5BA 3BQCA 2JDRA 3PTGA 4FTKA 4NFMA 4EQCA 1IAHA 2VRXA 5EM7A 4FSNA 2ZM4A 3LLTA 2OH4A 4IM0A 4FKIA 2FVDA 5EQPA 3HX4A 4DLIA 2A2AA 3BL9A 5GJGA 5EI2A 4MVFA 3RHKA 5LOHA 4TYHB 4DCAA 4O0VA 4XV1A 5CT0A 4FV3A 1O6KA 5C26A 2W5AA 4QMPA 4DEAA 4CCUA 4GIHA 2R9SA 3DTWA 3ZO4A 4AA5A 4RVLA 1QPJA 4C2VA 4DTBA 1KE7A 2ERKA 4RT7A 4EYJA 4L01A 1NW1A 2R3IA 2VTTA 3P23A 2O64A 4PUZA 1GJOA 3RWPA 4QP1A 4I0RA 5AM7A 1R39A 2R0IA 3GVUA 4MD9E 2OBJA 3ZXTA 3VHEA 5F20A 2CKOA 4UEUA 4U6RA 3NUSA 3PG1A 3CBLA 4YBKA 3W0RA 1M2QA 2VV9A 3VN9A 4FVRA 3EFJA 4DEDA 4J52A 3NIEA 5CF4A 3V5TA 4IANA 4JBQA 3UZPA 2NP8A 3W16A 4O0UA 1AGWA 4DHZA 2FSLX 2XK4A 1YVJA 4FTUA 4CLJA 5CI6A 2WELA 4EOLA 2Q83A 3K2LA 5AV0A 3DDPA 1FINA 4M15A 4C62A 3VS1A 4UN0C 5ICPA 4HGSA 5M08A 2C0OA 4TNBA 2OW3A 4ALWA 3EHAA 1H1QA 3QTIA 4H36A 1U46A 3FPMA 5DOSA 4BFMA 3LJ2A 1FVVA 2YIYA 1ZZLA 4J8NA 3I5NA 4E6CA 3FKOA 4G6OA 4RJ5A 3LMGA 3VRYA 4JS8A 3W0SA 4M7IA 2GS7A 3FXXA 3TNWA 1YDRE 3DK3A 3DK7A 2WQMA 3UODA 3BWFA 1J91A 1R0PA 3FHIA 4AZWA 1XH5A 3KA0A 2VU3A 4L68A 4MF0A 4U8ZA 4DFYA 3KEXA 5GIPE 1XH6A 3MFRA 3LMIA 5F4NA 5LCKA 5L6WL 4C38A 3C50A 4AQCA 2CHLA 2EVAA 4K8AA 3W0PA 5ANIA 4LOOA 2C0IA 4DFZE 1JBPE 4Y95A 3JUHA 5CX9A 4PP9A 3S95A 3HP2A 4P2KA 5E8TA 2QU6A 2IEWA 5EKNA 4EWQA 4RMZA 4I93A 4MEDA 1PJKA 4TL0A 4G6NA 2CN8A 2WQEA 3BBWA 3NUXA 4R1VA 1W98A 3FQEA 5DH3A 1Q61A 2G2IA 3PZHA 3MPAA 5EQYA 3PVWA 3UQGA 3EFKA 3ELJA 4CGAA 3Q4ZA 4JQ8A 4EH5A 4JMQA 3BHHA 3EIDA 3CPBA 3F2NA 4RX9A 4C0TA 4FTTA 2I0YA 3SW7A 5DWRA 1KOAA 2UZNA 5FXRA 4ZS4A 3LKMA 3HV5A 3LAUA 4KKEA 4UWCA 3L8XA 1BLXA 3OCBA 2HELA 2ITPA 4IAKA 2BTSA 4O2PA 4GT4A 3DCVA 5HTBA 3V01A 5K5NA 3FMJA 4DH5A 4IJ9A 4AW1A 4N6ZA 4YZMA 5HI2A 1CKPA 3L9PA 4BB4A 5B2MA 5KMOA 2HIWA 3IW6A 3IGOA 3OBJA 5JFWA 3EB0A 2GNLA 3AD6A 4XRJA 4W4VA 1PRYA 4AW2A 3QC9A 4YHFA 4DFLA 2NNWB 2DS1A 3FMHA 3LLAA 2YCFA 4PMSA 3QFVA 1E1XA 4GUEA 4RWKA 3T3UA 4BDBA 3COHA 4FKOA 2I1MA 4C33A 3LMHA 4MD8E 4OTPA 2C1BA 2UW7A 3SLSA 2J6MA 2OXXA 3VUKA 4D5HA 4ZMEA 1OL5A 4GVJA 1SNUA 3IO7A 1XQZA 1REJA 3F2AA 4BR3A 4DTAA 4OTGA 3DAJA 1X8BA 4OW8A 2PVKA 3ANQA 1U54A 3GEQA 5IDNA 4L3PA 5F1ZA 1W0XC 3Q5ZA 4JR3A 4EL9A 4G34A 3I5ZA 4BVUA 1W8CA 2O65A 4LV8A 3IW8A 3R7UA 4TZRA 4XV9A 2UZOA 2BRHA 4WUNA 4QNAA 4XOYA 3VUIA 4B4LA 5GZAA 4ORKA 3N51A 3VVHA 3PUPA 4R77A 2RG5A 3KXGA 4O27B 3RCJA 1W82A 1OL7A 2C6OA 2XIXA 3EQIA 4J53A 4L3LA 2VO7A 2ZMCA 3LFDA 4RIWA 3UNKA 1OKYA 4CXAA 5BVNA 1PXKA 3G33A 4R3CA 2WO6A 1YHWA 1TKIA 4FA2A 3ZTXA 4YZCA 4MAOA 4I24A 2PK9A 3QHWA 2UUEA 4FV6A 1Y57A 3BE2A 1CTPE 4YNOA 3DKGA 5B0XA 4BKJA 2WIPA 4WBBB 4IZYA 1W2FA 1ZMUA 2X0OA 4E5WA 3WZEA 4ZJVA 3CIKA 3COIA 3JS2A 4B7TA 1QPCA 5CYIA 3ZZEA 2Y8OA 3E3BX 4F7NA 4J98A 3FLZA 4HYIA 1PKDA 3GU6A 3R7YA 3MH1A 2QKRA 2XK9A 4FT0A 2F7EE 5I9YA 5EH0A 3P78A 5CASA 3IW5A 1PY5A 3MB7A 2HZNA 2J0KA 3DLZA 4M8TA 3UJGA 3MWUA 3QCSA 4GFOA 4K6ZA 3D5XA 1OMWA 4WSQA 3UIUA 4QMMA 5CXHA 3D0EA 3FLNC 5FXSA 4TRLA 4L44A 3S1HA 4XG6A 3OG7A 4D4YA 2JAMA 4U9AA 5CAOA 3BYOA 4Y8DA 2QOLA 2WMBA 4RWJA 4FTMA 4H39A 5HD4A 3PXKA 4G3FA 5TT7A 4AGCA 3ZC6A 3LFFA 4ENYA 3PUFC 5FWKK 5IUHA 5E90A 4C34A 4PPAA 3ZFYA 3MVJA 4M3QA 5CSPA 2G9XA 3TV7A 5CU3A 2C5NA 1W84A 2OK1A 2C5YA 5LQFA 1UU9A 2QONA 3SKCA 2ZB0A 5KZIA 2CMWA 4W8EA 4G9RA 3TCPA 3BEGA 4FKQA 3AT4A 3FI2A 1H24A 3E8EA 4BCHA 5JK3A 5BVOA 1KOBA 4C58A 5HO8A 4CNHA 3FMNA 3CKWA 2XZSA 5HGIA 3WIKA 2XNNA 5C9CA 5AP5A 1KE9A 2VTRA 3MH0A 2VX1A 5F94A 3HV7A 3UG1A 3BWJA 3UVRA 5JFVA 1G8AA 2WQOA 4PP7A 5J1VA 2ETKA 2JAVA 4FV7A 3T9TA 4EJNA 4ZY4A 3LHJA 2XK3A 4X2JA 5FD2A 4RJ8A 3MPTA 5I3RA 1IG1A 3QRKA 1LR4A 3KVXA 3QZFA 5HX8A 3LCOA 4ASZA 4MQ1A 2JKOA 4QO9A 2XJ0A 5C03A 4DBNA 3PVUA 3OEZA 5CALA 2UZVA 5JFXA 4LG4A 5HLPA 1YXXA 4BWKA 1W2DA 1YWRA 4S34A 5EI8A 4YTIA 3REPA 4EWHA 4ZXTA 4ZTHA 3R04A 5IUGA 4AA4A 2Z02A 2PSQA 5DE2A 2PE1A 2F2UA 3VC4A 4NWMA 4QP8A 3AMAA 1WBWA 4PX6A 3FMEA 2ITYA 2HY0A 3BKBA 4EEVA 1ZAOA 5M4FA 4XG4A 5DPVA 4XEYA 2WMTA 3E3PA 1R1WA 2CCHA 3QALE 3OY1A 3W8QA 5M44A 3HV6A 1XH4A 1ND4A 4X6RA 5HVYA 4DDGA 3ZUVA 4MWHA 4CYIA 3N4UA 2WTCA 5CVGA 2WFYA 4B6LA 2R7IA 5IH4A 1XKKA 3BHUA 2YITA 3HRCA 3PSBA 1BYGA 1PXIA 2QO2A 4KWPA 2F57A 3OC1A 3QD4A 4E6QA 2AEGA 4JR7A 3THBA 3Q9ZA 5L8KA 3OCSA 4HVHA 2XM8A 3I6WA 3LXNA 4FG7A 4F1MA 2C6IA 3EFLA 3FLSA 3RCDA 5J9LA 5AM6A 4MCVA 3TL8A 2JC6A 3E8NA 4FEVA 3P08A 2ZOQA 3LQ5A 4KABA 2A1AB 1NVSA 4OTFA 3PP1A 3RNIA 3W2RA 4DFNA 3G9LX 4ZLYA 2XANA 1FVRA 2E2BA 1FMKA 4G5PA 4EHZA 4PTCA 1OBDA 1PXNA 3FLYA 2ZV7A 3NCGA 4PTGA 1J1CA 3UOLA 4QMLA 3F5XA 2I40A 3ZBXA 3BELA 1BX6A 3SGCA 1Q8TA 1IRKA 1L3RE 4YUQA 3LFCA 2YCQA 3GCQA 4GU9A 3FPQA 1YXTA 4O7LA 4LL0A 3ZSHA 5FP6A 3IOPA 3O50A 4FOBA 3C5IA 1H00A 3BYSA 4J8MA 5JH6A 2PHKA 2QHNA 4RX7A 5A6OA 3MESA 4FKLA 4ZY6A 4IVCA 3KKVA 3DLSA 4JDIA 2FO0A 3A7FA 3MBLA 4I5PA 3CE3A 1KSWA 3CY3A 3S4QA 4KSQA 3VS4A 5JQ5A 3OWJA 3PXYA 3G6HA 4FF8A 2BUJA 4K9YA 4XRLA 4UY9A 2X7FA 3BI6A 2PVJA 3W0OA 5EM5A 4O4CA 3HMOA 3U6HA 2VGOA 1UV5A 3Q96A 1I09A 3Q2MA 4F0FA 3LE6A 3BGQA 4KA3A 1PXOA 1SVEA 3HECA 2UW9A 2VAGA 5T6KA 4AG8A 3AKKA 3ZS5A 4DFXE 2JKKA 4XG7A 2ITUA 4FV4A 2GNHA 2YWPA 1STCE 5L4QA 4C3PA 5CF6A 3KRJA 3JVRA 3AC8A 4FRFA 4L42A 3U8WA 2W1GA 1PXJA 4E6AA 3MJ2A 3D15A 4L7FA 4Z16A 3DY7A 4P5QA 5TE0A 4RRVA 2BMCA 4OT6A 5HICA 3IGGA 3EQCA 4DLJA 4FTCA 3UO5A 3I0OA 5E92A 4FKUA 3OS3A 4BKZA 5HLWA 4JBPA 4W9XA 4O7RA 1EH4A 2HWOA 2E9OA 4NTTA 4DG0E 2W4KA 3ZRKA 1WAKA 4FEWA 1YW2A 3Q9YA 5CQWA 2OU7A 3A7IA 3NMUF 4ITIA<