4CV9A

Mps1 kinase with 3-aminopyridin-2-one inhibitors
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
280
structure length
254
Chain Sequence
FQSMSVKGRIYSILKQIGSGGSSKVFQVLNEKKQIYAIKYVNLEEADNQTLDSYRNEIAYLNKLQQHSDKIIRLYDYEITDQYIYMVMECGNIDLNSWLKKKKSIDPWERKSYWKNMLEAVHTIHQHGIVHSDLKPANFLIVDGMLKLIDFGIANVGVNYMPPEAIKDMSISPKSDVWSLGCILYYMTYGKTPFQQIINQISKLHAIIDPNHEIEFPDIPEKDLQDVLKCCLKRDPKQRISIPELLAHPYVQIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords DUAL SPECIFICITY PROTEIN KINASE TTK
publication title Protein Kinase Selectivity of a 3-Aminopyridin-2- One Based Fragment Library, Identification of 3-Amino-5-(Pyridin-4-Yl)Pyridin-2(1H)-One as a Novel Scaffold for Mps1 Inhibition
rcsb
source organism Homo sapiens
total genus 76
structure length 254
sequence length 280
ec nomenclature ec 2.7.12.1: Dual-specificity kinase.
pdb deposition date 2014-03-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4cv9A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4cv9A01
3UOLA 4KIQA 4C58A 3P1AA 3NNWA 4RVMA 1CMKE 5CVGA 1TQPA 4EHVA 4HVIA 4NYEA 2PYWA 3IOPA 4DF3A 3VBTA 4LMUA 2OZOA 3EZRA 4F1OA 3PVBA 1LEZA 5L6OA 2P33A 4FT9A 1PMNA 3OG7A 3SOCA 4DEIA 2YA9A 4EOLA 4NL0A 2XKFA 3UJGA 3FL4A 4YU2A 1LUFA 4DG3E 3GOPA 4QMNA 3IOKA 4CEGA 3BHVA 3ZFMA 1UV5A 4NZWB 3KEXA 4YBKA 3DBQA 3PSBA 5F94A 3L8PA 3UQGA 4AT3A 2IVVA 3EMGA 3F9NA 2XK7A 3ZUVA 2XKEA 4PMMA 4YJQA 4E3CA 4A9UA 2UZUE 1JAMA 3BHHA 4DFYA 3FUPA 3FL5A 4BF2A 1BI7A 1J1CA 2ZM4A 3KMUA 4R1VA 2EUFB 2WTCA 4FVQA 4AA4A 2JAMA 4C59A 4IB3A 2UW5A 2YLFA 4XUFA 4DFZE 3COKA 4FVPA 1F0QA 2YCRA 3MFRA 2XK3A 3D7ZA 4O7WA 2OJFE 3NUUA 1Z9XA 4IEBA 3UIBA 5L8JA 4DFBA 3VS2A 5F20A 5HU3A 3MN3A 3IW7A 1PXKA 2X4FA 4HVDA 3AC1A 3OEZA 5I9ZA 2UW6A 4JG7A 4BC6A 2G1TA 4FV6A 2Y0AA 3TXOA 4IM3A 1DI8A 1OIQA 2FYSA 4QMTA 3ZSIA 4E4MA 1YXXA 1IAJA 3UMXA 4F63A 5JZNA 4X3FC 3TV7A 4PY1A 1FVRA 3W55A 3I7CA 3RNIA 3QC9A 3TACA 4RIOA 3FMNA 2JDTA 4E5AX 2J2IB 5KKRB 3SA0A 5GIOE 1LR4A 3QYWA 1YWRA 3EJ1A 1B38A 4BR3A 3DNEA 3MYGA 3IW4A 4FTQA 4OW8A 1JQHA 1OKZA 4EOIA 2ZOQA 4Y5QA 1JBPE 2PK9A 1OGUA 2OJ9A 3P23A 1H25A 3BHUA 2HZNA 4D1SA 2Q0BA 2X9FA 1URWA 5IQDA 3EQPA 3HMPA 4G6NA 4FV4A 3WIKA 5E8UA 1U54B 3GENA 5F1ZA 5GZ8A 4RLLA 4AN9A 3I81A 3SAYA 4FEQA 4M7IA 4ZLYA 4BI1A 2XVDA 2CCIA 2R3OA 4MH7A 3C50A 3PTGA 4FV0A 4RC3A 4MBLA 4A7CA 1UNLA 4BDHA 4FI1A 4AW2A 4YR8A 5DH3A 4ZTSA 3VAPA 1WAKA 5DHJA 2BRNA 3Q4TA 1J1BA 3F82A 3OTVA 2QO9A 4YJOA 4OAVB 4IVCA 3V5QA 2E2BA 4AE6A 5L8LA 3KFAA 1XH4A 2VRXA 2HXQA 5EW3A 4AWIA 5CAQA 2HZ4A 2W5BA 3F3ZA 4PP9A 3TNPC 2W4JA 2WQMA 4ZS4A 3CE3A 4O86A 5DBXA 5FQDC 3R30A 4L7SA 4BZDA 1NXKA 4FOBA 2QU5A 4JRNA 5CLPA 4C34A 4FZ7A 2BKKA 4BRXA 4ACGA 1CSNA 4ALVA 2HZIA 4ALUA 4AW1A 4DEAA 2HZ0A 2QD9A 3VWAA 4PRJA 5LMBA 5EHYA 2QKWB 1EH4A 3LCSA 4O6EA 3MBLA 5FP5A 2PVLA 5CYIA 2VWUA 2XJ0A 3FLZA 5M4UA 3LIJA 2Z7RA 5D7AA 3R7EA 5HTIA 3U4UA 1OUYA 2P2HA 2PMLX 4GCJA 4M15A 2BKZA 2GNJA 4YJSA 4YLKA 4BBEA 2JDVA 4FKGA 1XBBA 3KXNA 3NW5A 3UQCA 4F9CA 4BTJA 4FL3A 5H8EA 5J5TA 4U6RA 3ZSHA 2C5VA 3NCZA 2GQGA 3M42A 4GT5A 4BHNA 3R22A 4TNDA 5HG9A 3LMIA 3NNUA 2OKRA 4I21A 4OT5A 2ONLC 2UZTA 3KXHA 1SNUA 4PX6A 4WBBB 4KSPA 4FEUA 5DLSA 1W8CA 3S0OA 3S95A 3RMFA 4YJRA 1YDTE 3DBCA 5AM7A 4BDGA 5BVFA 2DS1A 3HNGA 1XH7A 4DLJA 4EUTA 4QYEA 4X2GA 3TNWA 1OBDA 4IAKA 1Q8UA 4U81A 3QTWA 3Q3BA 4WNPA 4RIWB 5HBHA 1PYXA 1PXLA 5EKOA 3QRKA 4O7RA 4DGNA 4FGBA 5K5NA 3LQ3A 3G15A 4FYNA 3LQ5A 4AZTA 5CTPA 3QX4A 2VWYA 3AT3A 4ITHA 3GCPA 1Q8ZA 1KE5A 2HW6A 4F7NA 4NKSA 4CG9A 5DEYA 4PNIA 4C62A 1U46A 5L2IA 2WD1A 4CFWA 2B9FA 4IX4A 3VQUA 3OROA 5L2TA 2XK6A 4BDDA 4BWKA 5KKRC 2GCDA 2OWBA 5AAGA 5HIDA 5M08A 4QPAA 2OZAA 3F2AA 3ZFXA 4CYJA 5DVRA 2YM8A 3FI3A 3G5DA 4JLCA 5HE2A 4EHEA 4HJOA 4C57A 3B8QA 4KIKA 2Y6MA 4CKJA 1UA2A 4IW0A 3KK8A 3RPVA 4FT3A 4FV7A 1XH5A 1NW1A 3UZPA 4XOZA 3G33A 4RJ4A 4RVTA 3UG1A 3GU4A 4H1JA 3ZUUA 4L52A 5KBRA 4EWHA 3GVUA 4QP7A 4KKEA 2PVRA 2WU7A 3MB7A 4IHPA 4J99A 4UYAA 4FUXA 2ZMCA 4WT6A 5E8WA 5AR3A 2RFDA 5HOAA 3PE1A 2VTLA 5IZFA 4FTOA 4WA9A 3R9NA 2ITNA 1O6LA 3FYJX 3SGCA 3FMDA 2EXMA 4X6RA 4A9SA 1Y8GA 5AV4A 2HENA 5AX9A 1A9UA 1M17A 4TWNA 5M4CA 2CGUA 3KGAA 4OTIA 3RCJA 4F70A 3S2PA 4I5PA 1E1XA 3IO7A 3PZEA 3HV3A 4CXAA 5KUPA 5L3AA 3CC6A 3CSVA 3SX9A 4PP7A 3TM0A 5FTOA 1GIHA 3GP0A 3I6WA 4P4CA 5HNIX 3ACJA 3OF0A 3DAJA 4YNEA 2XRUA 3H10A 3COMA 3VUKA 3ENMA 5LARA 4KKGA 5DIAA 5K4IA 3DJ5A 2PWLA 3D94A 5JRQA 1KE6A 5CU0A 3NDMA 4EK5A 3TIYA 3P78A 5DE2A 3F7ZA 3FSFA 3KA0A 3KRLA 3LPBA 4WHZA 3BLRA 4S2ZA 4BWPA 3RM6A 2F2UA 4UMTA 4I93A 1M52A 1FMOE 3QHRA 3ZMMA 4M84A 4YZBA 4ZZMA 4X3JA 4O7LA 2HWPA 3E88A 4O91A 4OTRA 5IQCA 1ZOHA 4TNBA 4TZRA 4CFNA 3CEKA 3FMHA 3I5NA 2PMIA 4BI0A 5HD4A 5LXMA 4CKIA 4R78A 1PYEA 4EUUA 2YHVA 3A60A 3TG1A 2EXCX 5AV3A 4U3ZA 5HG5A 4BHZA 2R9SA 4QTDA 4U42A 5FXSA 5I9WA 2J5FA 3NWWA 4TRLA 4PPBA 5D9HA 3G0FA 3PJCA 4FA2A 3PSDA 3F2RA 1OPKA 3ZM4A 3NYOA 3PG1A 5IMXA 3BELA 2XIXA 3DK6A 5IA5A 2WU6A 5M07A 3O71A 3PXRA 4DFXE 3UPZA 1H1QA 1STCE 2JDOA 3DJ7A 3EN4A 3LAUA 3OCBA 2O63A 3VJNA 2FSMX 4FK6A 1YXVA 1ZAOA 4MTAA 1H1SA 4MNFA 1OB3A 3EN7A 5FP6A 4EOKA 5K4JA 3S1HA 3IGGA 4O0WA 3KCKA 1R0PA 5AV1A 2WTWA 3HECA 1YI4A 2GNFA 3RM7A 4M66A 4CVAA 1Q41A 2BALA 2BCJA 1OECA 3G2FA 4JX3A 4R5SA 4J7BA 5IH4A 4RGJA 3PE2A 3QU0A 2JBOA 4IAFA 4PUZA 4FSTA 3U55A 5ANGA 4FZDB 1J7UA 4LYNA 4H36A 4IJ9A 5ANDA 2C5YA 3BCEA 3MH2A 4FEXA 3D5VA 5HNGA 4I5MA 1Q3DA 2W1CA 3H3CA 3LVPA 4I0RA 2BZKB 4Z7GA 4IVBA 3LLTA 3I1AA 4TYJA 3TT0A 4A4XA 3VIDA 4EH6A 5FXRA 4O81A 4DE4A 1H24A 2HW7A 2W1DA 2ITQA 1OL5A 3ULIA 4EJ7A 2W1ZA 5DEWA 4FKJA 4EBVA 4TL0A 2JKMA 4MD9E 4AX8A 2CGWA 2GSFA 4AE9A 2YDIA 4QP6A 1XJDA 5EDQA 2A1AB 4CFFA 4IJPA 1P4FA 5TF9A 5D1JA 1RQQA 1WFCA 2R3KA 3NUYA 4EK8A 1OKWA 3O2MA 2OK1A 5IA0A 3HP5A 1GY3A 3ZBFA 3WF6A 4I41A 5CU3A 2B7AA 3QKLA 4RJ3A 2PY3A 1I09A 3IDCA 4PWNA 4JR7A 4OTHA 4D9TA 2IG7A 3KN5A 3ORNA 1WBOA 4B9DA 2Z02A 4QQCA 3E63A 3R9HA 1PY5A 1A06A 2UVYA 2WMTA 2I1MA 3LKMA 2VGPA 3OXIA 4CRLA 3MWUA 4F6UA 4O7SA 4FIJA 4ERWA 2WQBA 1KWPA 4YSMA 4DH7A 3NGAA 3CQUA 1M2PA 1P4OA 3NRMA 3NYNA 3PZHA 3ZC5A 4P5ZA 5IISA 2FUMA 3RAKA 4IAYA 5TKDA 4ANLA 2YDKA 4APPA 4JDIA 4ANSA 1PHKA 3RBWA 2BAKA 5EFQA 5M09A 4AQCA 4F1MA 3BU5A 5I9XA 2CNUA 3QA8A 5DOSA 3P08A 4S30A 2WTVA 1JKKA 2OIQA 1PJKA 3ORTA 1H01A 1QPDA 3F3WA 4E73A 5CQWA 1WBTA 3JXWA 4KRDA 4BVUA 3IQ7A 3OOMA 3D7TB 5LMKA 4W9XA 3UG2A 4QYGA 3OS3A 4E5BA 3LXKA 1PW2A 5FWKK 3R2YA 1IASA 3QQJA 4WG5A 4ZP5A 2UW9A 3F2NA 5FBNC 1OKVA 3A7IA 5HG8A 4PDYA 3MJ1A 2VWIA 3WYXA 5AP3A 4C4JA 3CD3A 3RZBA 5IPJA 3DXPA 4C33A 2EXEA 4NU1A 5EYCA 3UNJA 4JBPA 3V8WA 3W10A 1H8FA 3QYZA 4AUAA 4C38A 3DU8A 4XP0A 2YWVA 4DYMA 2X39A 4DEGA 5M06A 1IR3A 3IGOA 2PULA 3R83A 4NFNA 1TQMA 3RALA 1JLUE 3DAEA 5FEEA 4F08A 2O5KA 4WD5A 3ETAA 3JYAA 4GEOA 4UZDA 4MKCA 1UNHA 3CTHA 2UZOA 3DBEA 4F6SA 2OF4A 3UVPA 4AP7A 3GCUA 3CR0A 2QLQA 4GL9A 4FSWA 3ZHPC 2UZWE 3SRVA 3OMVA 3DPKA 4BDCA 5AP7A 4DEEA 2EB3A 4E6DA 4IAZA 4Y73A 3OY3A 2FSOX 2UW4A 1YOMA 4ZSAA 3MI9A 5CNOA 4GT4A 4GG5A 3AD5A 4NEUA 3N4VA 2GNIA 4HCVA 2UZEA 1REJA 3QCXA 4HZRA 5CSHA 5AP0A 4CCBA 2IVTA 4LL5A 4XEYA 3FSKA 5FXQA 5HIBA 3RHKA 5CF8A 2C6TA 4FTTA 3OFMA 4RA4A 3OEFX 3F5GA 4BKYA 3R9OA 4FIEA 1YOJA 5HLWA 2OJIA 4P90A 5DA3A 2VO6A 3FXZA 5JGDA 3VQHA 4ALWA 2J90A 4GVAA 4W8EA 5AIRA 4C36A 4TYHB 5JQ5A 5E91A 4YZ9A 3FKOA 1URCA 2VNWA 4ZMFA 3C51A 5EYMA 3SV0A 3GB2A 5ANEA 4XJ0A 3Q9YA 3SKCA 4ZAUA 4FC0A 4EOOA 1LPUA 2VWBA 2YAKA 2JEDA 3A7FA 2GFCA 4ZTNA 3BE9A 4G9RA 1H07A 3KY2A 3ZS5A 2UZDA 3RINA 3UIUA 4B99A 4IM0A 2I6LA 3T8OA 2J0JA 4G3EA 4FSMA 3BLHA 4FSQA 3B2WA 5H8GA 2W9FB 3OOGA 5E8ZA 3PY1A 4X2NA 3T3UA 2I0HA 4DFLA 1BI8A 3DA6A 3LOKA 3QTRA 4ZZNA 4HYSA 4F7JA 1H4LA 3FLSA 3N51A 3ORIA 1ZXEA 4DGGA 4R3CA 5BUEA 3E5AA 5LWMA 5HNBA 1Q3WA 1KE7A 3EQHA 4H3PA 2PL0A 4RLKA 3SOAA 2XIZA 4D1ZA 3QRUA 4R8QA 2OO8X 4R7BA 2XNEA 2R3LA 3BHTA 3F5PA 4MXZA 4MEDA 4QQJA 5CANA 3QZHA 4FT0A 4JBVA 2VTIA 5T68A 3KULA 4ZSLA 4U79A 2QOLA 5ITAA 4HPTE 4M0YA 3UODA 2X6DA 3AD6A 2WHBA 4NWMA 4K2RA 3AGLA 1HCLA 5HTBA 1UNGA 4YGAA 5AEPA 2Y4IB 1X8BA 2C6KA 5KCVA 4HCTA 3GQLA 1GOLA 4Q5HA 2PZRA 1YW2A 5HX8A 5IQHA 4EWQA 1KSWA 3HRBA 5K9IA 4EZ7A 1H27A 2CN5A 2YZAA 4RJ6A 4L46A 1OZ1A 1ZYLA 2JKKA 2VU3A 4PL5A 2FSTX 3UO4A 1HCKA 4YJTA 4JIAA 2Z8CA 3VS5A 4F0GA 5HZNA 2GNLA 3O23A 4ONAA 2NO3A 2OGVA 1YKRA 5A4CA 3IDBA 5BVNA 3H30A 2VO3A 2JBPA 1M7QA 5LQFA 5GJDA 3R0TA 4IB1A 4F09A 3HUCA 3L8XA 1YXUA 2GHMA 5AR5A 2VTSA 3QKKA 3QQFA 1ERKA 3VUIA 4D4SA 5ANJA 2OXYA 2XKDA 4BDFA 3ET7A 3Q96A 5C03A 4KNBA 5I5ZA 5KMNA 3BPRA 2B55A 3PIZA 2GU8A 4X6QC 3GUBA 3RK5A 3H0YA 4LUDA 4HW7A 4RQKA 4WBOA 3ZEWA 4YPSA 2Z7QA 4ID7A 4KA3A 3VS3A 4BDEA 3COIA 4J8MA 4IX3A 1BKXA 3VO3A 1JWHA 3KRJA 3JPVA 5KBQA 4L3JA 2Y9QA 4GK2A 3OWLA 4MBJA 5DR2A 4G3FA 3CQWA 1OL7A 3F88A 2P55A 4Z9LA 3H4JA 4DGLC 1CDKA 4BL1A 1FQ1B 3LCDA 2I0EA 3TJDA 4O27B 3L8VA 4PV0A 5FUTA 2WZJA 4QP2A 4GU9A 5DI1A 1YI3A 3LFEA 4Y83A 5CSPA 3QXPA 2W06A 5LMAA 3SHEA 3LM5A 3PJ3A 1MQ4A 2A19B 3SXSA 5LVOA 1VZOA 2I7QA 3KF4A 2R3RA 3HKOA 3I0OA 2OH4A 4KRCA 2IZRA 3R8UA 5DRDA 4OBPA 3RK9A 3II5A 3ZTXA 3EFWA 5J5SA 5M57A 1R78A 1PRYA 5H2UA 3NZ0A 5AADA 2R5TA 4G9CA 3FMEA 4CZYB 4LGHA 2WMBA 1CM8A 3VUTA 1YXSA 4F9WA 4UXQA 3DLSA 5IU2A 4DT9A 1OIYA 5M56A 5AM6A 2C6EA 3VS0A 3DBFA 5HICA 3FC2A 3TKHA 5EYKA 4BWXA 1GNGA 4UYNA 4XLVA 3GU7A 4IE9A 3VUHA 5CI7A 5CEIA 4Q2AA 2HY0A 2HELA 2B53A 3D0EA 3PPJA 5HO8A 2P2IA 1Q4LA 4WNKA 3TWJA 2XK9A 2OXXA 2BUJA 3FWQA 3OHTA 4ACCA 5E8XA 4AW5A 4WRSA 1SVEA 3C4EA 4BTMA 1REKA 3E7OA 5A46A 1TKIA 2VO7A 4QQ5A 5LJJA 1BL7A 1RDQE 2KULA 2E9NA 3A4PA 3MIAA 5EOLA 4N6ZA 5AP6A 4QMVA 5A6OA 4JQEA 4N6YA 4M14A 3ZLWA 5TT7A 5E90A 3QGYA 5K3YA 4PDPA 4WNOA 4YBJA 5CAVA 4A9RA 4AZVA 3FQSA 3VF9A 4J1RA 3WOWA 3ZCLA 3NMUF 2CNQA 5CEPA 1UKHA 2I0VA 4RIXB 5B7VA 3MIYA 3UE4A 2RFNA 3SXRA 4QTEA 3HDNA 2BR1A 3LHJA 1ZMWA 5FGKA 2XJ1A 3ANRA 1WMKA 3R8ZA 3NPCA 3HV4A 2F57A 4PL3A 5ETAA 2QOBA 1Y91A 3UYSA 4ZEGA 5M44A 4HVGA 5DR9A 2QR7A 4UXLA 3NAXA 4MNEA 5HG7A 4AF3A 4BCQA 1PF8A 1WVXA 4G5PA 4MQ2A 2BTRA 2ITZA 4K0YA 1KE8A 1PXOA 3HP2A 2CGXA 5JFVA 3NUAA 1JPAA 4FOCA 3A8WA 4K9YA 4DTKA 3R7YA 3TL8A 2R7IA 5JFXA 3WZDA 3NUNA 3CTQA 5EG3A 3R73A 3O8TA 2HXLA 3E3BX 3CY2A 4FL1A 3O51A 3PWYA 3R8PA 4Y95A 4BIBA 1PKGA 2F49A 2X8DA 4QP8A 3R7VA 2C47A 4IC7A 2VTNA 2YJSA 3VUDA 3ZRLA 4EJNA 4GFOA 4D2SA 2OW3A 4IZ7A 3QCQA 5ANOA 4ZSEA 5I9UA 1PXIA 1BUHA 3E62A 2CMWA 3R8LA 2YZLA 4FR4A 5GINE 3TUDA 3OUKA 4YHTA 3RGFA 4K8AA 2X2MA 5JKGA 3QQKA 5BX0A 3R1YA 4BCPA 3NVKI 4V0GA 4ZJJA 3GT8A 3ZDIA 1IEPA 4D0WA 4DH8A 5BVOA 5CAOA 4IZYA 4GW8A 4BIDA 3DDPA 4O7VA 2DUVA 4U40A 3QUPA 4EH8A 5J1WA 1BYGA 5IF1A 2OLCA 3U9CA 4GVJA 4MYGA 3R8VA 3RKBA 4DCEA 4YUQA 1S9JA 1P5EA 5IDPA 1VJYA 4WUAA 1V0PA 4YJUA 2WEIA 2X8EA 4BCIA 5F4NA 3BYVA 3VBVA 4BCJA 4CYIA 4WG4A 4CLIA 2NPQA 3DB6A 4G2FA 5I9YA 2W7XA 4FSUA 5IQAA 4MQ1A 3DGKA 3AMBA 4M12A 1JSUA 5M53A 2WOTA 5LOHA 2EVAA 3QD2B 1Q97A 4FSYA 4RA5A 4ZLOA 2YIYA 4FV8A 5HEZA 5IQBA 4L45A 4FVRA 2GTNA 3OXZA 2H6DA 5CAUA 4XV9A 3HVCA 4RX5A 3KU2A 5DT3A 2YITA 4G6OA 2QC6A 4F99A 5EK7A 4ENYA 4D58A 3BEAA 2GPHA 4KS7A 3ODZX 4JR3A 3K3IA 1OL6A 4RIYB 5F9EA 5CU4A 3FPMA 2Y7JA 3UVRA 4DBXA 5HESA 4R3RA 2VTQA 4BDAA 1QCFA 5KHXA 3HA8A 3JVRA 4LV5A 4OGRA 3HGKA 4IM2A 4PNKA 5LVPA 1YHWA 3SVVA 3ZDUA 3K5VA 3KXZA 4CSVA 3E8NA 3RHXA 3Q6WA 2J5EA 2YFXA 4MAOA 5JSMA 4YURA 4DH1A 4EH4A 1OUKA 4U5JA 4FMQA 4C3RA 4GSBA 1V0BA 2PMOX 3CP9A 2W1HA 4AZFA 3OXTA 4EZ5A 3PIYA 3TI1A 4D55A 3LXPA 4YP8A 4EOQA 3FKLA 4Y8DA 3BWJA 1RJBA 2HY81 4GRBA 3GFEA 4QP4A 5FG8A 5ETFA 4YLLA 1FGIA 3LFDA 3C9WA 4FTIA 3ORLA 4YJVA 4YJNA 3VUMA 3G90X 4BTFA 2BRBA 2J0MB 5CEQA 1F3MC 4MK0A 3FI2A 1ZY5A 5GJGA 2C3IB 4KSQA 4KIOA 4ZK5A 4CT1A 3OT3A 4WIHA 2ZJWA 4XBUA 3DK3A 3FQHA 3R7OA 3SG9A 5J9LA 2LGCA 3QHWA 4XYFA 3U9NA 2ERZE 4AZSA 3UMWA 5L2SA 1H1PA 1WBNA 5AAEA 4MD8E 2H34A 4IANA 3ZO4A 5AX3A 2YCQA 4TYEA 4Y72A 4IFGA 3FZ1A 3I6UA 3C5UA 3OCTA 3ZU7A 2VTRA 3ZBXA 5B2LA 3V01A 3KCFA 2OFUA 3ZH8A 2DQ7X 1APME 5FRIA 3ZSGA 1DI9A 3AC8A 3SQQA 3O8PA 4O0UA 5F95A 3HMMA 4FKPA 2JKQA 2WMAA 3T3VA 2C6OA 3A7HA 3CPBA 2UW7A 4FKSA 3KRWA 4NCTC 2VZ6A 4YTHA 4FV2A 4ZXTA 1W82A 1KV2A 4M13A 3EN5A 3NVMB 4IVDA 5A3XA 4NW5A 2J0IA 4FZAB 3WE4A 4ACDA 1U5RA 3TZ7A 4AW0A 5IH5A 1BX6A 2Q0NA 3ATSA 4F9YA 2R4BA 4AOJA 4J52A 4TXCA 4BKJA 4EH2A 5L2QA 5DFPA 3KMWA 4YO4A 4LQMA 5ETIA 3Q9WA 3JY9A 5EM7A 4O2PA 3Q6UA 4C4EA 1G3NA 4GV1A 3BQCA 5EOBA 3ZRMA 1WVYA 2WOUA 3CKXA 3ORKA 4RFYA 3EB0A 5ACBC 4I22A 3GCQA 4FTAA 3L9MA 4XG7A 5D7VA 3LFAA 4HGLA 4O21A 1ATPE 3E7VA 4JOAA 5TE0A 2PMNX 5CF6A 5AUXA 4CV8A 1KOAA 3QTXA 3VS1A 2QO2A 3UYTA 3ZZEA 4FG7A 3PLSA 2B52A 1VYWA 1XHAA 4ZY4A 3FPQA 3VC4A 4M69B 4F7SA 4A07A 5DMZA 2XF0A 4EQCA 3QA0A 3PSCA 4II5A 5JK3A 3FKNA 2J7TA 4L9IA 4L01A 4X3FA 3A2CA 4L00A 5IH6A 3POOA 4ARKA 3BI6A 4H3BA 4CMUA 4EK4A 4GKIA 2CLXA 3TZMA 5J1VA 2ZV9A 4HYIA 3ZO2A 4LOQA 2W5AA 4ZOGA 3ZLYA 2YM4A 5KMOA 4XV2A 4U97A 4NT4A 2X8IA 3EN9A 4FEWA 2WMWA 2XK8A 5IA3A 4YC3A 5CQUA 2GS6A 2X7FA 5HX6A 2BMCA 4G16A 3CS9A 3QC4A 3PYYA 1PMUA 4OLIA 5IQEA 4Y46A 4YSJA 3LMGA 2NRUA 5I3OA 4PTEA 3EL7A 4D28A 3TTIA 4CTCA 2X0GA 3R8MA 3TN8A 4EQMA 1SVGA 2J0LA 3A4OX 4N70A 4C2VA 5IG1A 2A4LA 1O6KA 3UTOA 5JFWA 3NEWA 4MXCA 5L2WA 3UOJA 1MRYA 3NR9A 2BRMA 5KO1A 3EZVA 3C4XA 4W8DA 4RVLA 1M14A 2QHMA 1J7LA 1UU8A 4I6HA 3Q4UA 3ROYA 1PXNA 3GOKA 5T6KA 4O0RA 3LFCA 5HO6A 4FL2A 2BZHB 3NYVA 2W96B 2G2FA 5A4QA 5AP5A 4LOPA 2XNPA 3FMJA 3ORZA 4AGWA 4CLJA 3V8TA 3DDQA 3T9IA 1YWVA 4MVFA 2YM3A 5A54A 5CXZA 4O82A 3O17A 4E4NA 3UC3A 1R3CA 2GHLA 5DG5A 4CFUA 4FZ6A 4PTCA 1FMKA 4ORKA 3KVXA 5DPVA 4BCMA 4D2RA 3R63A 4O0SA 5JFSA 3RPSA 1OBGA 1IAHA 2W1IA 3BV2A 4P2KA 4FKRA 2BRHA 3Q9ZA 4G6LA 4X2FA 3QTIA 4XP2A 4EC8A 1OIUA 3QCSA 4WUNA 3ZXZA 3V5JA 3QTUA 5IUGA 5JZJA 3TEIA 2ETMA 2ETKA 2XNNA 3IS5A 2ZV7A 3CLYA 3C0IA 3W8QA 1KE9A 3BGQA 2WTKB 5C1QB 1LP4A 4RPVA 4ZIMA 4G17A 3W2SA 3IPHA 4GIHA 2XB7A 4HNIA 5AP1A 5G6VA 3PP0A 4R1YA 5FTGA 4EH3A 4J97A 1UWHA 3QD3A 4FIGA 3K2LA 4LGGA 4PMPA 4FNXA 2GS2A 3THBA 3DKFA 5E8SA 1RE8A 5KE0A 5HTCA 4L8MA 5EM6A 5EQEA 5I4NA 4KD1A 3HX4A 4FKUA 3N4TA 5HCZA 4QMOA 4Z7HA 4X0MA 4NIFB 3TCPA 2AUHA 2QONA 3R02A 4Q9SA 2YCFA 3ALOA 4X2KA 4PDSA 2PUIA 2X6EA 2G2IA 5FD2A 2CGVA 3Q5ZA 4EH5A 4EOMA 3R28A 2YLEA 5GNKA 3P7AA 4XV3A 3BBWA 3BZ3A 3RNYA 3POZA 2WKMA 3OY1A 4H58A 4G31A 3MS9A 3PY3A 4BN1A 3AXWA 2QOCA 3ATTA 4G3CA 3C4CA 4EKKA 4C02A 4CRSA 3H0ZA 4DG0E 4YTFA 4UMQA 3W2PA 3ZFYA 5JT2A 2VN9A 3FZRA 4JDKA 2XKCA 3NIEA 4GK3A 3RAWA 2HK5A 1U59A 5DT4A 4ACMA 2PPQA 3QQGA 2BAQA 3HMOA 4G1WA 3PJ2A 4FKVA 3RK7A 2KTYA 1XO2B 3UGCA 3UPXA 4BB4A 1SM2A 2XUUA 2BDFA 2OBJA 2UUEA 1B6CB 4NK9A 2I0YA 2IVUA 4K77A 4OTDA 2PVHA 4IDVA 3PA3A 3C4FA 3QD0A 4IBMA 4PTGA 4CD0A 2IZTA 4LOOA 3DXQA 1JKSA 4FG8A 3G6GA 3WIGA 3TV6A 4IMYA 3KN6A 3TJCA 3W8LA 4BTKA 2QOKA 5HVJA 4EZ3A 2F7ZE 4M68A 5M55A 3KB7A 3HV5A 4MCVA 2WTDA 3EFLA 4FNZA 2BZJA 2QO7A 3SG8A 2QU6A 2C68A 4KAOA 4O2ZA 4N4SA 3FXWA 1TQIA 2RF9A 5B2MA 2E9UA 3HA6A 4FICA 2C6MA 4LUEA 2YAAA 2UW0A 3M1SA 4JQ7A 4K11A 2VWVA 2C0TA 4GYIA 5K0KA 4DFNA 3LM0A 3CJFA 3LFBA 5D12A 4EONA 4DH3A 4WKQA 3BV3A 4UY9A 2IWIA 2VUWA 1W7HA 3ENHA 3FI4A 4BDKA 2PUUA 3JY0A 3I0QA 4AT4A 4D1XA 5E8YA 5ANIA 3ZZWA 5HCYA 3BRBA 4GYGA 2I40A 2WXVA 3IKAA 2WMSA 3QRIA 4ZY6A 3RPRA 3ZOSA 5EW9A 3OWKA 1O9UA 3BIZA 4S33A 2QVSE 2ZM3A 3D15A 3EQFA 3EFKA 4JT3A 1Q61A 4L53A 3FLNC 5C9CA 3ZLXA 4D5KA 1MRUA 2BFXA 3BX5A 5K0XA 4ASXA 2B9JA 3FBVA 3FI8A 4EEVA 2F7EE 4UMRA 1G8AA 3R04A 3BU3A 2WTKC 3A62A 3SXFA 4CTBA 4CZUA 1H00A 5A4LA 1VR2A 1LEWA 3JUHA 5J9ZA 2ITYA 3MJ2A 3Q52A 4IACA 5E92A 1XQZA 3KRRA 4HCUA 2OIDA 5BVEA 3SLSA 2R64A 3FQEA 2GS7A 2FSLX 3IDPA 3UP2A 3C4WA 3ALNA 3MV5A 3ODYX 5EI2A 3LFNA 4C4FA 4HPUE 3S4QA 4ZJVA 5C01A 3KVWA 3TKUA 2Y4PA 4F0IA 4QMZA 4R7HA 2JIUA 3OZ6A 3CGOA 5FM3A 3VBYA 5CEKA 2QI8A 1MQBA 2WIHA 4NJ3A 4LMNA 3NW7A 4U41A 1J3HA 3D2KA 4LG4A 4LI5A 3ITZA 5E7RA 4Z55A 4LRJA 3DS6A 3RJCA 2R2PA 2W4KA 1W98A 5E1EA 1YQJA 2A2AA 4RIWA 3EWHA 3UZTA 3BEGA 4L44A 4MBIA 4AXAA 4R77A 1E9HA 2WFYA 3HRCA 3UIXA 2WTIA 4EH9A 1H28A 3ZM9A 3MDYA 3PG3A 4QMMA 4RMZA 4QNAA 3DFAA 4FV3A 2C4GA 4TTHB 5CAPA 5IUIA 4JAJA 2GHGA 5CZHA 4XCUA 4F1TA 2J51A 4FYOA 4KWPA 3BQRA 3IW8A 1OI9A 5FBOA 5C4KA 2PU8A 1ZYCA 2J4ZA 4CFMA 4EI4A 4AACA 3MFTA 4EBWA 4FTMA 4FZFB 4UALA 1M2QA 3DZQA 4FTJA 3DK7A 2WAJA 3REPA 1SMHA 2HWOA 5AR8A 5KZ0A 3ID6C 4G3DA 3FMKA 4L42A 3R7IA 4C3PA 3PPZA 4IWDA 3V5LA 5BNJA 5E8VA 2J0KA 2OH0E 2XCHA 2XNBA 2QR8A 3GU6A 3QAME 5CVHA 3LW0A 4AAAA 2JIVA 4DLIA 5HU9A 2JGZA 4L7FA 3NNVA 3VBQA 4XG4A 5AMNA 4EHZA 3LLAA 2F7XE 4FSNA 4J95A 4MHAA 2G15A 4ZS0A 4RJ5A 3WF7A 2UZVA 2C30A 1PMVA 3NCGA 2JDRA 4D5HA 2OU7A 4FIIA 5EDRA 4O38A 3I4BA 4YHFA 3B2TA 4XV1A 2CKQA 5HO7A 2YWPA 4M0ZA 3I7BA 1GZKA 1SNXA 4YZDA 3Q32A 4WSYA 2UZLA 4V01A 3EKNA 4C2WA 2PVKA 2C1AA 3A99A 3U51A 1JOWB 1KOBA 1JVPP 2R7BA 2ITUA 3HRFA 3TTJA 3AOXA 3TKIA 3C4ZA 3QLFA 1XH8A 1RW8A 5L8KA 2E9OA 4O84A 3OCGA 3MY0A 2PVMA 4FTUA 2E9VA 3EN6A 1XBCA 1ZOGA 3E93A 1YI6A 4FNWA 4YZCA 4USEA 3OBGA 5M4IA 5IKWA 3MA6A 3VULA 3C0GA 2ETRA 4MF1A 4ENXA 3PWDA 2OI4X 2ZAZA 2WNTA 2J6MA 4CQEA 5AR4A 3QX2A 4E7WA 2ZB0A 4R5YA 1WBSA 1YXTA 4I6BA 4V05A 5CT7A 4FGRA 4G3GA 5AUVA 2C3JA 3CIKA 3QKMA 4X7QA 5FM2A 3P9JA 4I3ZA 2IZSA 2OF2A 1UU7A 2JC6A 4I0TA 3TNQB 4E5WA 4UN0C 5CALA 4FE2A 4KKHA 2RG6A 3UZRA 2CLQA 3V6SA 2WIPA 1FINA 2QOFA 3F3UA 4DEBA 4NW6A 3D14A 2LAVA 2DYLA 1WBVA 2RG5A 5IQGA 3P7BA 2V22A 4R6VA 3Q2JA 3TZ8A 4ZSJA 2PHKA 3C1XA 2BVAA 2QG7A 2YACA 3IW5A 4R7IA 1XH9A 2GMXA 4IWPA 5CEMA 2EB2A 2V62A 3OW4A 4RJ8A 3P86A 4DAWA 4K1BA 4FKTA 2QNJA 2VTPA 3UBDA 3VBWA 1ZZ2A 4I4EA 1DAYA 3GEQA 4P7EA 4I94A 4KIPA 4F64A 1U5QA 4M67A 5BUJA 4W9WA 5IEXA 2CKPA 4JS8A 5DN3A 2X2KA 2WQOA 2DWBA 5AUUA 5CNNA 4M3QA 4C4HA 2XBJA 3QQHA 3UOKA 2IPXA 3BYUA 4JDJA 5HE3A 3BYOA 2HOGA 2ZV2A 3ACKA 2YIRA 2YM5A 1ZLTA 3O8UA 5JRSA 4CCUA 4XMOA 1I44A 2E9PA 3DTCA 4E6QA 5HLPA 1ZYDA 5J87A 3R2BA 4JBOA 5J79A 1Q24A 4ZSGA 5D41A 1ZY4A 3AMAA 2QKRA 1P14A 5C8MA 3BYSA 3VUGA 4OR5A 2VNYA 1Q99A 3GQIA 4U80A 1L8TA 4O83A 2RIOA 5HVYA 4H39A 4C35A 3TDWA 3AD4A 3FXXA 4RC4A 5LWNA 2BILB 1FBNA 2VTAA 4I20A 5E8TA 2OZAB 4FTRA 4D4YA 4AA0A 1AD5A 3LJ2A 5CY3A 4GUBA 5CF4A 4USDA 1OPLA 4YLJA 4KIKB 3RCDA 2XIRA 5HE0A 3HYHA 4FSZA 2FH9A 5AUYA 1ND4A 2PVNA 4QMPA 4WO5A 4IAAA 5GHVA 5AP2A 3H9RA 3ORPA 2EU9A 4JVGA 3WE8A 5HD7A 4X21A 4ACHA 1W0XC 2B9HA 2ITVA 2JKOA 2PE0A 4QMXA 1OM1A 5D10A 5DGZA 3VW6A 4ANBA 5C8NA 2VTOA 3CD8A 4NM5A 4Y85A 2RL5A 2V0DA 5CS6A 4I6QA 3W16A 4B7TA 1FVTA 3MPMA 2RFSA 4D2VA 2YDJA 1IG1A 4FIFA 4QMLA 3SRVB 4NKAA 2WELA 4RWLA 3MTLA 3NLBA 3W2QA 1GZNA 1YHVA 3GI3A 2C6DA 5BYZA 2W5HA 2C3LA 4EH7A 1XR1A 2C1BA 3QF9A 3MVLA 2X7OA 4PQNA 2Z60A 3FLWA 3QWJA 3FZOA 5EHLA 5ETCA 2UV2A 4BCGA 1K3AA 2XA4A 3BKBA 3MPAA 4N57A 4ZMEA 5D11A 2XNMA 5J95A 5IA2A 5HKMA 4QRCA 3B8RA 4E1ZA 4L3PA 3R1NA 3C5IA 3CPCA 1ZYSA 4TN6A 3MB6A 4EOPA 3D7TA 3DKOA 1H1RA 3GXLA 5CU6A 5EM8A 3U54A 3LXNA 2X7GA 3MH3A 3VRYA 3VS4A 5IQFA 3VN9A 3BYMA 5FEDA 1J7IA 5IDNA 3OWPA 1ZZLA 2VTTA 4H05A 4ZTRA 3KC3A 2XH5A 3D5XA 3FJQE 1H26A 4EL9A 4JXFA 5CI6A 4C3FA 5BUIA 1OMWA 4IXPA 2WEVA 2YABA 3PIXA 4HYHA 1NVRA 2ITXA 4ASDA 4TW9A 4J96A 2XK4A 4U0IA 5AV0A 3PJ1A 4WNMA 3G51A 3FEGA 3P5KA 2VTHA 4ANNA 4RVKA 3CY3A 2O64A 4TKSA 4NSTA 1OPJA 2CDZA 5DRBA 4B8LA 5TO8A 2UZBA 1OIRA 4QNYA 3W32A 4CQGA 3VS7A 4AN3A 4NM3A 3VVHA 4E6CA 5A14A 1ZMUA 4D4RA 5I0BA 1Q8WA 4DEDA 5AFVA 1NVSA 4IX6A 1PMEA 2FO0A 3R71A 3PPKA 3MSSA 3F69A 5HE1A 3OW3A 4DITA 2XZSA 4IH8A 3GC7A 4JL9A 4YZMA 5KNJA 4BZOA 4UX9A 3VS6A 5EHOA 4RX7A 4IAIA 2BAJA 4LV8A 2XM8A 3W33A 3JVSA 1CKIA 3P79A 3Q2MA 3K3JA 3OVVA 3QALE 4CFXA 2W99B 5HVKA 3E3PA 4IB5A 2XJ2A 3GBZA 2XP2A 4RBLA 3NUSA 4XG9A 3DZOA 3FMMA 2CNVA 4TYHA 5B2KA 4IIRA 4UMPA 4BIEA 5H8BA 2RKUA 4GT3A 1QPJA 4DH5A 2XEZA 4C4IA 2VTMA 1L3RE 2XYNA 2XIKA 3PXFA 5A6NA 4F0FA 3JR1A 3WZJA 2Z7SA 4P5QA 3DAKA 5L6WL 4RG0A 3FDNA 1GIIA 5AUTA 2SRCA 4BCKA 4CMTA 3QQLA 4FUYA 2ITOA 4RFZA 3S00A 1YDSE 4E4LA 3ZO1A 1GZ8A 2C69A 2C5NA 3FZTA 4MWIA 3G6HA 2V7AA 3DQXA 4U44A 3OT8A 3DKCA 4AGDA 5CVFA 5G1XA 3HUBA 2OIBA 3C0HA 5IEYA 4QP9A 3U87A 3GC9A 2ITTA 3EL8A 4JG6A 4QPMA 3MVMA 5KMMA 4I1ZA 4O1PA 3KXGA 2VAGA 4W4YA 2RGPA 2VO0A 4FEVA 2XNGA 3IECA 1E1VA 5H9BA 1XKKA 3D5WA 1M2RA 3COHA 4O0TA 4TYIA 5EYDA 3VNTA 4I5CA 4UV0A 4L6QA 1NT2A 2VX1A 2RSVA 4L43A 4B4LA 1PKDA 4B0GA 2QOOA 3HAMA 3DJ6A 3R00A 5BVWA 2IW9A 1K2PA 5L4QA 4GH2A 4FKIA 4FV9A 3Q4ZA 5KHWA 4HGTA 1BLXA 1HOWA 4USFA 5EQPA 5AIKA 4IFCA 4O96A 1JKTA 2PZPA 4JI9A 2QHNA 4NM0A 5CT0A 5C27A 5IMEA 4DTAA 2WQNA 2ZM1A 5KMJA 2QURA 2QQ7A 5DT0A 3QL8A 4QMYA 1OKYA 4GU6A 2BZIB 5AJQA 2C5OA 5IQIA 2OXDA 4DG2E 4Z3VA 3NYXA 3C7QA 4BGGA 2A0CX 4ITJA 2R3PA 2BDWA 4DHFA 2JAVA 1JKLA 3MPTA 3PFQA 3W2CA 4GMYA 1F5QA 3F66A 1XH6A 5CSXA 4NTTA 5JGAA 4J98A 4AG8A 5EQYA 4QO9A 4F9AA 3A61A 4NJDA 5CXHA 5LVLA 3PXYA 5ICPA 1XWSA 2FA2A 2R3FA 4GS6A 4M8TA 4YJPA 1DM2A 4JRVA 3MA3A 4EOJA 2YIQA 3OD6X 3KL8A 3QRJA 3R21A 4U9AA 4U45A 4IZ5A 4WRGA 4OUCA 2JFLA 3ZEPA 1CTPE 3LJ0A 3PP1A 3QD4A 2OSCA 3DKGA 4S34A 3H9OA 1NA7A 3QZGA 4FNYA 2WPAA 2AC5A 3CKWA 4QPSA 3PVUA 2V7OA 3LFFA 2IVSA 3LJ1A 3LMHA 3BGZA 1QPEA 3PA4A 3GCSA 3Q9XA 4JJRA 4XG3A 2CJMA 3EYGA 3L9NA 4FV5A 4OT6A 4GUEA 4FKLA 3MY1A 3FC1X 1SYKA 5EI6A 3UVQA 4MXAA 4XNEA 3PY0A 1MRVA 2B0QA 4UWYA 3RTPA 2PE2A 3HDMA 4YPDA 4O7ZA 4FF8A 2FVDA 3W2OA 2WMXA 4IVAA 3UC4A 3UP7A 2IZUA 3QUDA 4QYYA 4HNFA 4J8NA 3OWJA 3QTZA 4JG8A 4PF4A 3G0EA 4DBNA 4BBMA 3R1SA 5FDXA 1OL2A 4UWBA 4GK4A 5HCXA 3WARA 4U7ZA 4I6FA 5FDPA 4YMJA 1WCCA 2GNHA 4GJ3A 2BIYA 1JNKA 5HBJA 4JX7A 2W1FA 4HGEA 3ZLSA 3GCVA 3ERKA 2PE1A 4E93A 4O1OA 5HLNA 3RWQA 2ITPA 3DLZA 3QWKA 1DS5A 4BGQA 4FKOA 5J8IA 2C6LA 1B39A 3CTJA 2PZ5A 3IW6A 4J53A 5HBEA 4YC6A 3WZUA 3QBNA 4B6LA 3MW1A 4FT5A 2UVXA 4RZVA 4O0XA 4FKQA 4BZNA 1ZYJA 3SC1A 4XG2A 2VTJA 2PSQA 1BMKA 3WZEA 2QOQA 2PZYA 4QQTA 4DA5A 5EW8A 4EK3A 4V04A 3V8SA 4BDJA 5LVMA 3ANQA 3WF8A 3AT2A 5E1SA 3KMMA 3ZYAA 5I3RA 4FODA 3EHAA 4C61A 2HAKA 5DNRA 3SD0A 4IX5A 5DR6A 4G5JA 3W18A 4BDBA 2XCKA 4U8ZA 1VYZA 5BPYA 4RC2A 4ZTMA 4IB0A 3VBXA 1ZRZA 4QP3A 5CWZA 2ZDTA 4RWIA 2XRWA 2W4OA 4PDOA 3R7UA 4EQUA 3V5PA 4MXYA 3NS9A 3GNIB 5KZIA 3V5WA 2F2CB 3O0GA 3UO6A 3KULB 4ITIA 4RIXA 4ZTHA 4FKWA 5GZ9A 5T3QA 3WF5A 1IRKA 5E9EA 4OTFA 5LMKC 4BICA 3AG9A 1W84A 2H8HA 3FYKX 1V1KA 3W2RA 3F6XA 3PRIA 1CKJA 1FOTA 3ORMA 2ZMDA 4L68A 4FTNA 4UEUA 4ZTQA 4KBKA 3IONA 3O96A 4XRLA 4YHJA 2PUPA 2VWXA 4X2JA 3RZFA 4ZLZA 1ZOEA 1Z5MA 4RFMA 4XG6A 3U8WA 2F9GA 2XYUA 5J7BA 4DINA 5H3QA 5IA1A 3RPOA 4YC8A 4TWPA 3RWPA 4S31A 4G34A 4F7LA 3GU8A 2A27A 3L9LA 3DT1A 3F5UA 3EKKA 3DOGA 3G9NA 4K6ZA 4C37A 1MUOA 3KXMA 3QXOA 4RWKA 2ZVAA 5AUZA 4RSSA 2C6IA 4DC2A 1H0VA 3BU6A 3D9VA 4FV1A 3Q60A 3ZRKA 2OJJA 4KABA 4BBFA 4CFVA 5AA9A 4BYJA 3SDJA 3UOHA 2PTKA 4K33A 3CBLA 5JQ8A 3RPYA 2ONLA 5IUHA 4MXXA 2RFEA 4ZTLA 4LFIA 2VWZA 3AGMA 2W9ZB 3K5UA 2J50A 2JITA 3L1SA 2O8YA 5E4HA 1YDRE 1Q5KA 1R1WA 5EKNA 3HV7A 3Q04A 4NCTA 3Q53A 2O65A 3V3VA 3EIDA 4JQ8A 3RP9A 3FE3A 2BHHA 2XEYA 4WOVA 2VD5A 4AFJA 4UZHA 4C8BA 4MWHA 3FMLA 1O6YA 2IJMA 2NNWB 2PVJA 4QMUA 3CCNA 2XM9A 4RT7A 4DGMA 2P4IA 3QTQA 4I5HA 3DY7A 4KBCA 4HGSA 2EWAA 2VGOA 2OG8A 4AZEA 4IQ6A 4L3LA 1K9AA 3D4QA 4IZAA 4D2PA 2WO6A 2GNGA 3FZPA 1UVRA 4QP1A 3H9FA 4YNOA 5KMIA 3ULZA 3NNXA 5GJFA 2HYYA 4F9BA 1YHSA 2JIIA 4YTCA 4IC8A 3C13A 2GTMA 3R01A 5C4LA 4OTQA 3GFWA 2VV9A 4D2WA 3JS2A 1T46A 5IEVA 1U54A 1Q62A 2R0IA 3EOCA 3HL7A 4OTPA 4NM7A 3KF7A 4JAIA 4RIYA 3E8EA 3EQIA 3DNDA 1YOLA 3NUPA 3OCSA 4TY1A 1GJOA 4MXOA 2CKOA 4AN2A 5BYLA 2GDOA 5FLFA 3PA5A 5LCKA 3Q5IA 3CQEA 5HORA 3GGFA 4ERKA 5FEQA 1SVHA 4BCHA 3ZXTA 3FAAA 1SZMA 2VX3A 2X81A 1J91A 1JSTA 3PRFA 2O3PA 4OTWA 3NX8A 4EORA 3WILA 4AZWA 2P3GX 2PVYA 4BGHA 1G8SA 4UMUA 2R3NA 4F6WA 3HV6A 3QZFA 3MTFA 3O7LD 4CZTA 4GJ2A 1Y6BA 2Y6OA 4AU8A 1NVQA 3D2IA 4RRVA 3LE6A 5J9YA 4OBQA 4XP3A 4AS0A 2Y8OA 3TUBA 2YM7A 3QGWA 3R9DA 3HAVA 3RAIA 3F3VA 2Z2WA 4M97A 3U6IA 3P7CA 1PXMA 3QRTA 4CNHA 1QL6A 2HIWA 3V51A 4CMOA 4D0XA 1V0OA 3FY2A 4EOSA 2B4SB 4FIHA 4PPCA 3NW6A 4O22A 1G5SA 5DYJA 4FG9A 3R1QA 2IW8A 4YZNA 5HHWA 3S3IA 1Z57A 4RQVA 4BCFA 2X9EA 3NIZA 2UZNA 3QFVA 1M7NA 2BFYA 3NAYA 3KKVA 3E8CA 3P4KA 4QMWA 4PL4A 4F65A 3BE2A 4MNEB 4ZZOA 4TWCA 3LCOA 4ASEA 3LXLA 5KMLA 1ZMVA 2QCSA 3HMNA 1H0WA 4QYHA 4RWJA 5EDPA 3L9PA 3ELJA 5BYYA 1IA9A 3PLAE 4APCA 4GFGA 5EH0A 3AT4A 2YISA 1WZYA 3HLLA 4AFEA 4QT1A 4AGUA 3DV3A 5HQ0A 3OTUA 3EQBA 5B0XA 4S32A 3LZBA 4QMQA 3RVGA 4KINA 5BQ0A 4UBAA 3EQRA 2R0UA 1UU3A 3LCKA 4JIKA 4HVHA 3A8XA 3E64A 3F3TA 1GAGA 5BVKA 2REIA 3U6JA 2YIXA 4Y5HA 3QZIA 1JSVA 5JGBA 4ZY5A 3V6RA 3E8DA 3KREA 4BKZA 4DEHA 1GZOA 4D2TA 3OP5A 5KMKA 1P2AA 3I5ZA 4UB7A 1XBAA 4BFMA 4BI2A 3UQFA 5ACKA 2W0JA 2BRGA 4DN5A 4HVSA 3LQ8A 2R3HA 5TOZA 4B8MA 2X1NA 4EKLA 1Y57A 3FLQA 4HZSA 1QPCA 2R3IA 4QTCA 3U6HA 3WZKA 4QTAA 4V0GB 3CJGA 3WI6A 2AYPA 3UNZA 3EFJA 4KB8A 4F4PA 3VW8A 4MF0A 2P0CA 3FHRA 3AMYA 1PXJA 3VRZA 4XLIA 3VF8A 2IN6A 3A7JA 3DTWA 2R3QA 4W4XA 4M69A 2AC3A 5BMSA 3BWFA 2BDJA 1CKPA 2G9XA 4CKRA 3BHYA 3IG7A 4L67A 3K54A 3OUNB 3AQVA 3MH0A 4K18A 1GIJA 4I24A 5DWRA 3CXWA 4Q9ZA 2C0OA 4FBXA 4RZWA 1OVEA 4U3YA 5AR7A 4IWQA 1BL6A 4J71A 2J9MA 1H1WA 2PZIA 2R3JA 4JDHA 3HMIA 4PMSA 4FT7A 1UU9A 4IWOA 3PXZA 3V04A 4H1MA 4QTBA 2CN8A 3Q4CA 3D83A 1MP8A 3HZTA 3TNHA 4EHGA 2GQRA 3V5TA 3MVJA 3NUXA 4Z16A 2FB8A 3VHEA 4U43A 4DTBA 3I60A 4GFMA 2XS0A 3UNKA 3O7LB 1Y6AA 2UW3A 2XIYA 1R0EA 2H9VA 1YVJA 3E92A 3LFQA 4CV9A 3QTSA 1NY3A 2YM6A 4FX3A 1YWNA 5FTQA 3WYYA 5HIEA 1A48A 2ZV8A 3KK9A 2B9IA 2HCKA 5GZAA 3OC1A 1WVWA 4MD7E 3F7WA 4BYIA 3LCTA 2QLUA 4BDIA 2JDSA 3OBJA 5I9VA 2JFMA 1YRPA 4W4VA 5JH6A 2YJRA 5BMMA 2WTJA 2NRYA 1AGWA 3PVGA 1TVOA 2W17A 2YN8A 3FY0A 4A4LA 3ZC6A 2G2HA 2R3MA 5EI8A 2WQEA 4C0TA 4PPAA 2ZDUA 3MFUA 2OICA 3ZONA 3MESA 5C8KA 2YCSA 4BCOA 2NP8A 4GG7A 5A9UA 4NFMA 4EYJA 5A4TA 3BLQA 5BVDA 2B1PA 4C7TA 2WMVA 4TT7A 5CU2A 3GC0A 1H08A 4H3QA 3TIZA 4QD6A 3EYHA 5CZIA 2C0IA 4FSRA 4A06A 3UDBA 4E6AA 2YERA 5JN2A 5JMSA 1UWJA 3VHKA 3MY5A 3P0MA 3L8SA 3N9XA 4N0SA 1T45A 2ERKA 4KS8A 3ROCA 3PUPA 2XBAA 1Y8YA 2F4JA 2R3GA 3R6XA 4ANOA 3E87A 4HOKA 5HGIA 4CG8A 1AQ1A 2BPMA 4LRKA 5CF5A 3NSZA 5EM5A 5L6PA 1Q8TA 1QMZA 2CSNA 3ZO3A 4FTCA 2OFVA 3EH9A 4FTKA 4I0SA 4QYFA 4TWOA 4NTSA 3U4WA 4IDTA 5TR6A 5M51A 4LL0A 3A7GA 4DCAA 5HI2A 3G9LX 4GKHA 5LCJA 4E4XA 4D4VA 2IW6A 1Q8YA 2WGJA 1DAWA 3IK3A 3QQUA 4TPTA 4E26A 4O7YA 5CSVA 4LM5A 3D5UA 3R9RA 3W1FA 3AC5A 4TYGA 3TDVA 1OITA 4JBQA 1ZARA 4QOXA 4W4WA 2BTSA 5J7HA 2BHEA 2G01A 1WBWA 5AUWA 3DQWA 3ORXA 5C26A 4OTGA 5AR2A 4E20A 1FPUA 2CKEA 4EYMA 3DFCB 3BGPA 5AV2A 4NIFA 2Z7LA 4XH6A 5AWMA 4I92A 3PXQA 3FLYA 3GU5A 4CT2A 5LVNA 3UO5A 2H96A 4DGOA 1PXPA 4R3PA 3SW7A 4RX9A 1R39A 1VEBA 3FHIA 2O2UA 3WF9A 2QG5A 2UW8A 2V5QA 3QLGA 3MVHA 4HYUA 1KV1A 4ANMA 5CASA 3M11A 5CEOA 4KUJA 2BROA 2O0UA 4RX8A 4KBAA 2IO6A 4WG3A 2W05A 4I4FA 3BBTB 3N4UA 2X4ZA 5GIPE 2C5XA 4XHKB 5KX8A 4ANQA 4NH1A 3DXNA 3MH1A 3AC3A 5CX9A 4JNWA 5A4EA 2W1GA 3KXXA 2UVZA 4O7NA 4I23A 3VJOA 4Q5EA 4XBRA 2CPKE 3I79A 4X3FB 2ACXA 3TV4A 4C4GA 1WBPA 2ITWA 4FK3A 3FV8A 3EQGA 3LFSA 3RAHA 2PVFA 2XNOA 2ZB1A 4LRMA 1FVVA 4XOYA 4E8AA 4EK6A 4YTIA 5K5XA 3QCYA 3TNIA 2WMRA 1IA8A 3RI1A 4O6LA 5IA4A 4YO6A 4A4OA 4XG8A 2YEXA 1U4DA 3MFSA 5JEBA 4A9YA 4CGAA 4WSQA 2CHLA 3F61A 4FTLA 1FGKA 4MX9A 2PUNA 4NUSA 3UIMA 3WBLA 1S9IA 2VWWA 4O0VA 4PMTA 5CENA 3T9TA 2VX0A 3O50A 3TZ9A 3PJ8A 1UKIA 2ESMA 4OAUC 2WB8A 4BCNA 4BY9E 3GC8A 1ZWSA 3EQCA 4A9TA 3KQ7A 3DCVA 4IADA 5AA8A 3ZUTA 3AC2A 3DBDA 4XS2A 2WMQA 3QUEA 4O0YA 4QMSA 2OJGA 4AT5A 3AC4A 2JD5A 2Q83A 2ZYBA 2GQSA 4AA5A 2B54A 3R7GA 3F5XA 2JLDA 2C3KA 4GIIA 4AGCA 2QOIA 2W1EA 2FGIA 2WMUA 2Y4IC 3CGFA 5CSWA 4AOTA 5M4FA 4EC9A 3M2WA 4ASZA 4XX9A 4D9UA 4DFUA 4O7TA 2GFSA 2QODA 3SW4A 3HEGA 3PVWA 2XMYA 3PXKA 4LGDA 4OBOA 4XRJA 4AOIA 1KUTA 3DB8A 1OL1A 3PDTA 2X2LA 4UWCA 3EQDA 4RJ7A 2QOHA 2YIWA 4ZJIA 3FZSA 5AAFA 2BIKB 2V55A 2CCHA 3MGYA 3KRXA 1W83A 5AP4A 3TUCA 4DT8A 5ANKA
chains in the Genus database with same CATH superfamily
3UOLA 4KIQA 4C58A 3P1AA 3NNWA 4RVMA 1CMKE 5CVGA 1TQPA 4EHVA 4HVIA 4NYEA 4F78A 2PYWA 3IOPA 4DF3A 3VBTA 4LMUA 2OZOA 3EZRA 4F1OA 3PVBA 1LEZA 5L6OA 2P33A 3AKKA 4FT9A 1PMNA 3OG7A 3SOCA 4DEIA 2YA9A 4EOLA 4NL0A 2XKFA 3UJGA 3FL4A 4YU2A 1LUFA 4DG3E 3GOPA 4QMNA 3IOKA 4CEGA 3BHVA 3ZFMA 1UV5A 4NZWB 3KEXA 4YBKA 3DBQA 3PSBA 5F94A 3L8PA 3UQGA 4AT3A 2IVVA 3EMGA 3F9NA 2XK7A 3ZUVA 2XKEA 4PMMA 4YJQA 4E3CA 4A9UA 2UZUE 1JAMA 3BHHA 4DFYA 3FUPA 3FL5A 4BF2A 1BI7A 1J1CA 2ZM4A 3KMUA 4R1VA 2EUFB 2WTCA 4FVQA 4AA4A 2JAMA 4C59A 4IB3A 2UW5A 2YLFA 4XUFA 4DFZE 3COKA 4FVPA 1F0QA 2YCRA 3MFRA 2XK3A 3D7ZA 4O7WA 2OJFE 3NUUA 1Z9XA 4IEBA 3UIBA 5L8JA 4DFBA 3VS2A 5F20A 5HU3A 3MN3A 3IW7A 1PXKA 2X4FA 4HVDA 3AC1A 3OEZA 5I9ZA 2UW6A 4JG7A 3W0NA 4BC6A 2G1TA 4FV6A 2Y0AA 3TXOA 4IM3A 1DI8A 1OIQA 2FYSA 4QMTA 3ZSIA 4E4MA 1YXXA 1IAJA 3UMXA 4F63A 5JZNA 4X3FC 3TV7A 4PY1A 1FVRA 3W55A 3I7CA 3RNIA 3QC9A 3TACA 3KIOC 4RIOA 3FMNA 2JDTA 4E5AX 2J2IB 5KKRB 3SA0A 5GIOE 1LR4A 3QYWA 1YWRA 3EJ1A 1B38A 4BR3A 3DNEA 3MYGA 3IW4A 4FTQA 4OW8A 1JQHA 1OKZA 4EOIA 2ZOQA 4Y5QA 1JBPE 2PK9A 4O4EA 1OGUA 2OJ9A 3P23A 1H25A 3BHUA 2HZNA 4D1SA 2Q0BA 2X9FA 1URWA 2XANA 5IQDA 3EQPA 3HMPA 4G6NA 4FV4A 3WIKA 5E8UA 1U54B 3GENA 5F1ZA 5GZ8A 4RLLA 4AN9A 3I81A 3SAYA 4FEQA 4M7IA 4ZLYA 4BI1A 2XVDA 2CCIA 2R3OA 4MH7A 3C50A 3PTGA 4FV0A 4RC3A 4MBLA 4A7CA 1UNLA 4BDHA 4FI1A 4AW2A 4YR8A 5DH3A 4ZTSA 3VAPA 1WAKA 5DHJA 2BRNA 3Q4TA 1J1BA 3F82A 3OTVA 2QO9A 4YJOA 4OAVB 4IVCA 3V5QA 2E2BA 4AE6A 5L8LA 3KFAA 1XH4A 2VRXA 2HXQA 5EW3A 4AWIA 5CAQA 2HZ4A 2W5BA 3F3ZA 4PP9A 3TNPC 2W4JA 2WQMA 4ZS4A 3CE3A 4O86A 5DBXA 5FQDC 3R30A 4L7SA 4BZDA 1NXKA 4FOBA 2QU5A 4JRNA 5CLPA 4C34A 4FZ7A 2BKKA 4BRXA 4ACGA 1CSNA 4ALVA 2HZIA 4ALUA 4AW1A 4DEAA 2HZ0A 2QD9A 3VWAA 4PRJA 5LMBA 5EHYA 2QKWB 1EH4A 3LCSA 4O6EA 3MBLA 5FP5A 2PVLA 5CYIA 2VWUA 2XJ0A 3FLZA 5M4UA 3LIJA 2Z7RA 5D7AA 3R7EA 5HTIA 3U4UA 1OUYA 2P2HA 2PMLX 4GCJA 4M15A 2BKZA 2GNJA 4YJSA 4YLKA 4BBEA 2JDVA 4FKGA 1XBBA 3KXNA 3NW5A 3UQCA 4F9CA 4BTJA 4FL3A 5H8EA 5J5TA 4U6RA 3ZSHA 2C5VA 3NCZA 2GQGA 3M42A 4GT5A 4BHNA 3R22A 4TNDA 5HG9A 3LMIA 3NNUA 2OKRA 4I21A 4OT5A 2ONLC 2UZTA 3KXHA 1SNUA 4PX6A 4WBBB 4KSPA 4FEUA 5DLSA 1W8CA 3S0OA 3S95A 3RMFA 4YJRA 1YDTE 3DBCA 5AM7A 4BDGA 5BVFA 2DS1A 3HNGA 1XH7A 4DLJA 4EUTA 4QYEA 4X2GA 3TNWA 1OBDA 4IAKA 1Q8UA 4U81A 3QTWA 3Q3BA 4WNPA 4RIWB 5HBHA 1PYXA 1PXLA 5EKOA 3QRKA 4O7RA 4DGNA 4FGBA 5K5NA 3LQ3A 3G15A 4FYNA 2X0PA 3LQ5A 4AZTA 5CTPA 3QX4A 2VWYA 3AT3A 4ITHA 3GCPA 1Q8ZA 1KE5A 2HW6A 4F7NA 4NKSA 4CG9A 5DEYA 4PNIA 4C62A 1U46A 5L2IA 2WD1A 4CFWA 2B9FA 4IX4A 3VQUA 3OROA 5L2TA 2XK6A 4BDDA 4BWKA 5KKRC 2GCDA 2OWBA 5AAGA 5HIDA 5M08A 4QPAA 2OZAA 3F2AA 3ZFXA 4CYJA 5DVRA 2YM8A 3FI3A 3G5DA 4JLCA 5HE2A 4EHEA 4HJOA 4C57A 3B8QA 4KIKA 2Y6MA 4CKJA 1UA2A 4IW0A 3KK8A 3RPVA 4FT3A 4FV7A 1XH5A 1NW1A 3UZPA 4XOZA 3G33A 4RJ4A 4RVTA 3UG1A 3GU4A 4H1JA 3ZUUA 4L52A 5KBRA 4EWHA 3GVUA 4QP7A 4KKEA 2PVRA 2WU7A 3MB7A 4IHPA 4J99A 4UYAA 4FUXA 2ZMCA 4WT6A 5E8WA 5AR3A 2RFDA 5HOAA 3PE1A 2VTLA 5IZFA 4FTOA 4WA9A 3R9NA 2ITNA 1O6LA 3FYJX 3SGCA 3FMDA 2EXMA 4X6RA 4A9SA 1Y8GA 5AV4A 2HENA 5AX9A 3O5AA 1A9UA 1M17A 4TWNA 5M4CA 2CGUA 3KGAA 4OTIA 3RCJA 4F70A 3S2PA 4I5PA 3PFYA 1E1XA 3IO7A 3PZEA 3HV3A 4CXAA 1W2DA 5KUPA 5L3AA 3CC6A 3CSVA 3SX9A 4PP7A 3TM0A 5FTOA 1GIHA 3GP0A 3I6WA 4P4CA 5HNIX 3ACJA 3OF0A 3DAJA 4YNEA 2XRUA 3H10A 3COMA 3VUKA 3ENMA 5LARA 4KKGA 5DIAA 5K4IA 3DJ5A 2PWLA 3D94A 5JRQA 1KE6A 5CU0A 3NDMA 4EK5A 3TIYA 3P78A 5DE2A 3F7ZA 3FSFA 3KA0A 3KRLA 3LPBA 4WHZA 3BLRA 4S2ZA 4BWPA 3RM6A 2F2UA 4UMTA 4I93A 1M52A 1FMOE 3QHRA 3ZMMA 4M84A 4YZBA 4ZZMA 4X3JA 4O7LA 2HWPA 3E88A 4O91A 4OTRA 1OGYA 1ZOHA 4TNBA 4TZRA 4CFNA 3CEKA 3FMHA 3I5NA 2PMIA 4BI0A 5HD4A 5LXMA 4CKIA 4R78A 1PYEA 4EUUA 2YHVA 3A60A 3TG1A 2EXCX 5AV3A 4U3ZA 5HG5A 4BHZA 2R9SA 4QTDA 4U42A 5FXSA 5I9WA 2J5FA 3NWWA 4TRLA 4PPBA 5D9HA 3G0FA 3PJCA 4FA2A 3PSDA 3F2RA 1OPKA 3ZM4A 3NYOA 3PG1A 5IMXA 3BELA 2XIXA 3DK6A 5IA5A 2WU6A 5M07A 3O71A 3PXRA 4DFXE 3UPZA 1H1QA 1STCE 2JDOA 3DJ7A 3EN4A 3LAUA 3OCBA 4AXEA 2O63A 3VJNA 2FSMX 4FK6A 1YXVA 1ZAOA 4MTAA 1H1SA 4MNFA 1OB3A 3EN7A 5FP6A 4EOKA 5K4JA 3S1HA 3IGGA 4O0WA 3KCKA 1R0PA 5AV1A 2WTWA 3HECA 1YI4A 2GNFA 3RM7A 4M66A 4CVAA 1Q41A 2BALA 2BCJA 1OECA 3G2FA 4JX3A 4R5SA 4J7BA 5IH4A 4RGJA 3PE2A 3QU0A 2JBOA 4IAFA 4PUZA 4FSTA 3VONA 3U55A 5ANGA 4FZDB 1J7UA 4LYNA 4H36A 4IJ9A 5ANDA 2C5YA 3BCEA 3MH2A 4FEXA 3D5VA 5HNGA 4I5MA 1Q3DA 2W1CA 3H3CA 3LVPA 4I0RA 2BZKB 4Z7GA 4IVBA 3LLTA 3I1AA 4TYJA 3TT0A 4A4XA 3VIDA 4EH6A 5FXRA 4O81A 4DE4A 1H24A 2HW7A 2W1DA 2ITQA 1OL5A 3ULIA 4EJ7A 2W1ZA 5DEWA 4FKJA 4EBVA 4MUQA 4TL0A 4DHZA 2JKMA 4MD9E 4AX8A 2CGWA 2GSFA 4AE9A 2YDIA 4QP6A 1XJDA 5EDQA 2A1AB 4CFFA 4IJPA 1P4FA 5TF9A 5D1JA 1RQQA 1WFCA 2R3KA 3NUYA 4EK8A 1OKWA 3O2MA 2OK1A 5IA0A 3HP5A 1GY3A 3ZBFA 3WF6A 4I41A 5CU3A 2B7AA 3QKLA 4RJ3A 2PY3A 1I09A 3IDCA 4PWNA 4JR7A 4OTHA 4D9TA 2IG7A 3KN5A 3ORNA 1WBOA 4B9DA 2Z02A 4QQCA 3E63A 3R9HA 1PY5A 1A06A 2UVYA 2WMTA 2I1MA 3LKMA 2VGPA 3OXIA 4CRLA 3MWUA 4F6UA 4O7SA 4FIJA 4ERWA 2WQBA 1KWPA 4YSMA 4DH7A 3NGAA 3CQUA 1M2PA 1P4OA 3NRMA 3NYNA 3PZHA 3ZC5A 4P5ZA 5IISA 2FUMA 3RAKA 4IAYA 5TKDA 4O4DA 4ANLA 2YDKA 4APPA 4JDIA 4ANSA 1PHKA 3RBWA 2BAKA 5EFQA 5M09A 4AQCA 4F1MA 3BU5A 5I9XA 2CNUA 3QA8A 2XARA 5DOSA 3P08A 4S30A 2WTVA 1JKKA 2OIQA 1PJKA 3ORTA 1H01A 1QPDA 3F3WA 4E73A 5CQWA 1WBTA 3JXWA 4KRDA 4BVUA 3IQ7A 3OOMA 3D7TB 5LMKA 4W9XA 3UG2A 4QYGA 3OS3A 4E5BA 3LXKA 1PW2A 5FWKK 3R2YA 1IASA 3QQJA 4WG5A 4ZP5A 2UW9A 3F2NA 5FBNC 1OKVA 3A7IA 5HG8A 4PDYA 3MJ1A 2VWIA 3WYXA 5AP3A 4C4JA 3CD3A 3RZBA 5IPJA 3DXPA 4C33A 2EXEA 4NU1A 5EYCA 3UNJA 4JBPA 3V8WA 3W10A 1H8FA 3QYZA 4AUAA 4C38A 3DU8A 4XP0A 2YWVA 4DYMA 2X39A 4DEGA 5M06A 1IR3A 3IGOA 2IEWA 2PULA 3R83A 4NFNA 1TQMA 3RALA 1JLUE 3DAEA 5FEEA 4F08A 2O5KA 4WD5A 3ETAA 3JYAA 4GEOA 4UZDA 4MKCA 2AEGA 1UNHA 3CTHA 2UZOA 3DBEA 4F6SA 2OF4A 3UVPA 4AP7A 3GCUA 3CR0A 2QLQA 4GL9A 4FSWA 3ZHPC 2UZWE 3SRVA 3OMVA 3DPKA 4BDCA 5AP7A 4DEEA 2EB3A 4E6DA 4IAZA 4Y73A 3OY3A 2FSOX 2UW4A 1YOMA 4ZSAA 3MI9A 5CNOA 4GT4A 4GG5A 3AD5A 4NEUA 3N4VA 2GNIA 4HCVA 2UZEA 1REJA 3QCXA 4HZRA 5CSHA 5AP0A 4CCBA 2IVTA 4LL5A 4XEYA 3FSKA 5FXQA 5HIBA 3RHKA 5CF8A 2C6TA 4FTTA 3OFMA 4RA4A 3OEFX 3F5GA 4BKYA 3R9OA 4FIEA 1YOJA 5HLWA 2OJIA 4P90A 5DA3A 2VO6A 3FXZA 5JGDA 3VQHA 4ALWA 2J90A 4GVAA 4W8EA 5AIRA 4C36A 4TYHB 5JQ5A 5E91A 4YZ9A 3FKOA 1URCA 2VNWA 4ZMFA 3C51A 5EYMA 3SV0A 3GB2A 5ANEA 4XJ0A 3Q9YA 3SKCA 4ZAUA 4FC0A 4EOOA 1LPUA 2VWBA 2YAKA 2JEDA 3A7FA 2GFCA 4ZTNA 3BE9A 4G9RA 1H07A 3KY2A 3ZS5A 2UZDA 3RINA 3UIUA 4B99A 4IM0A 2I6LA 3T8OA 2J0JA 4G3EA 4FSMA 3BLHA 4FSQA 3B2WA 5H8GA 2W9FB 3OOGA 5E8ZA 3PY1A 4X2NA 3T3UA 2I0HA 4DFLA 1BI8A 3DA6A 3LOKA 3QTRA 4ZZNA 4HYSA 4F7JA 1H4LA 3FLSA 3N51A 3ORIA 1ZXEA 4DGGA 4R3CA 5BUEA 3E5AA 5LWMA 5HNBA 1Q3WA 1KE7A 3EQHA 4H3PA 2PL0A 4RLKA 3SOAA 2XIZA 4D1ZA 3QRUA 4R8QA 2OO8X 4R7BA 2XNEA 2R3LA 3BHTA 3F5PA 4MXZA 4MEDA 4QQJA 5CANA 3QZHA 4FT0A 2XAOA 4JBVA 2VTIA 5T68A 3KULA 4ZSLA 4U79A 2QOLA 5ITAA 4HPTE 4M0YA 3UODA 2X6DA 3AD6A 2WHBA 4NWMA 4K2RA 3AGLA 1HCLA 5HTBA 1UNGA 4YGAA 5AEPA 2Y4IB 1X8BA 2C6KA 5KCVA 4HCTA 3GQLA 1GOLA 4Q5HA 2PZRA 1YW2A 5HX8A 5IQHA 4EWQA 1KSWA 3HRBA 5K9IA 4EZ7A 1H27A 2CN5A 4DHIB 2YZAA 4RJ6A 4L46A 1OZ1A 1ZYLA 2JKKA 2VU3A 4PL5A 2FSTX 3UO4A 1HCKA 4YJTA 4JIAA 2Z8CA 3VS5A 4F0GA 5HZNA 2GNLA 3O23A 4ONAA 2NO3A 2OGVA 1YKRA 5A4CA 3IDBA 5BVNA 3H30A 2VO3A 2JBPA 1M7QA 5LQFA 5GJDA 3R0TA 4IB1A 4F09A 3HUCA 3L8XA 1YXUA 2GHMA 5AR5A 3W0MA 2VTSA 3QKKA 3QQFA 1ERKA 3VUIA 4D4SA 5ANJA 2OXYA 2XKDA 4BDFA 3ET7A 3Q96A 5C03A 4KNBA 5I5ZA 5KMNA 3BPRA 2B55A 3PIZA 2GU8A 4X6QC 3GUBA 3RK5A 3H0YA 4LUDA 4HW7A 4RQKA 4WBOA 3ZEWA 4YPSA 2Z7QA 4ID7A 4KA3A 3VS3A 4BDEA 3COIA 4J8MA 4IX3A 1BKXA 3VO3A 1JWHA 3KRJA 3JPVA 5KBQA 4L3JA 2Y9QA 4GK2A 3OWLA 4MBJA 5DR2A 4G3FA 3CQWA 1OL7A 3F88A 2P55A 4Z9LA 3H4JA 4DGLC 1CDKA 4BL1A 1FQ1B 3LCDA 2I0EA 3TJDA 4O27B 3L8VA 4PV0A 5FUTA 2WZJA 4QP2A 4GU9A 5DI1A 1YI3A 3LFEA 4Y83A 5CSPA 3QXPA 2W06A 5LMAA 3SHEA 3LM5A 3PJ3A 1MQ4A 2A19B 3SXSA 5LVOA 1VZOA 2I7QA 3KF4A 2R3RA 3HKOA 3I0OA 2OH4A 4KRCA 2IZRA 3R8UA 5DRDA 4OBPA 2AQXA 3RK9A 3II5A 3ZTXA 3EFWA 5J5SA 5M57A 1R78A 1PRYA 5H2UA 3NZ0A 5AADA 2R5TA 4G9CA 3FMEA 4CZYB 4LGHA 2WMBA 1CM8A 3VUTA 1YXSA 4F9WA 4UXQA 3DLSA 5IU2A 4DT9A 1OIYA 5M56A 5AM6A 2C6EA 3VS0A 3DBFA 5HICA 3FC2A 3TKHA 5EYKA 4BWXA 1GNGA 4UYNA 4XLVA 3GU7A 4IE9A 3VUHA 5CI7A 5CEIA 4Q2AA 2HY0A 2HELA 2B53A 3D0EA 3PPJA 5HO8A 2P2IA 1Q4LA 4WNKA 3TWJA 2XK9A 2OXXA 2BUJA 3FWQA 3OHTA 4ACCA 5E8XA 4AW5A 4WRSA 1SVEA 3C4EA 4BTMA 1REKA 3E7OA 5A46A 1TKIA 2VO7A 4QQ5A 5LJJA 1BL7A 1RDQE 2KULA 2E9NA 3A4PA 3MIAA 5EOLA 4N6ZA 5AP6A 4QMVA 5A6OA 4JQEA 4N6YA 4M14A 3ZLWA 5TT7A 5E90A 3QGYA 5K3YA 4PDPA 4WNOA 4YBJA 5CAVA 4A9RA 4AZVA 3FQSA 3VF9A 4J1RA 3WOWA 3ZCLA 1TFFA 2CNQA 3NMUF 5CEPA 1UKHA 2I0VA 4RIXB 5B7VA 3MIYA 3UE4A 2RFNA 3SXRA 4QTEA 3HDNA 2BR1A 3LHJA 1ZMWA 5FGKA 2XJ1A 3ANRA 1WMKA 3R8ZA 3NPCA 3HV4A 2F57A 4PL3A 5ETAA 2QOBA 1Y91A 3UYSA 4ZEGA 5M44A 4HVGA 5DR9A 2QR7A 4UXLA 3NAXA 4MNEA 5HG7A 4AF3A 4BCQA 1PF8A 1WVXA 4G5PA 4MQ2A 2BTRA 2ITZA 4K0YA 1KE8A 1PXOA 3HP2A 1XMMA 2NYAA 2CGXA 5JFVA 3NUAA 1JPAA 4FOCA 3A8WA 4K9YA 4DTKA 3R7YA 3TL8A 2R7IA 5JFXA 3WZDA 3NUNA 3CTQA 5EG3A 3R73A 3O8TA 2HXLA 3E3BX 3CY2A 4FL1A 3O51A 3PWYA 3R8PA 4Y95A 4BIBA 1PKGA 2F49A 2X8DA 4QP8A 3R7VA 2C47A 4IC7A 2VTNA 2YJSA 3VUDA 3ZRLA 4EJNA 4GFOA 4D2SA 2OW3A 4IZ7A 4BJJA 3QCQA 5ANOA 4ZSEA 5I9UA 1PXIA 1BUHA 4DDGA 3E62A 2CMWA 3R8LA 2YZLA 4FR4A 5GINE 3TUDA 3OUKA 4YHTA 3RGFA 4K8AA 2X2MA 5JKGA 3QQKA 5BX0A 3R1YA 4BCPA 3NVKI 4V0GA 4ZJJA 3GT8A 1TZDA 1IEPA 3ZDIA 4D0WA 4DH8A 5BVOA 5CAOA 4IZYA 4GW8A 4BIDA 3DDPA 4O7VA 2DUVA 4U40A 3QUPA 4EH8A 5J1WA 1BYGA 5IF1A 2OLCA 3U9CA 4GVJA 4MYGA 3R8VA 3RKBA 4DCEA 4YUQA 1S9JA 1P5EA 5IDPA 1VJYA 4WUAA 1V0PA 4YJUA 2WEIA 2X8EA 4BCIA 5F4NA 3BYVA 3VBVA 4BCJA 4CYIA 4WG4A 4CLIA 2NPQA 3DB6A 4G2FA 5I9YA 2W7XA 4FSUA 5IQAA 4MQ1A 3DGKA 3AMBA 4M12A 1JSUA 5M53A 2WOTA 5LOHA 2EVAA 3QD2B 1Q97A 4FSYA 4RA5A 4ZLOA 2YIYA 4FV8A 5HEZA 5IQBA 4L45A 4FVRA 2GTNA 3OXZA 2H6DA 5CAUA 4XV9A 3HVCA 4RX5A 4QDVA 3KU2A 5DT3A 2YITA 4G6OA 2QC6A 4F99A 5EK7A 4ENYA 4D58A 3BEAA 2GPHA 4KS7A 3ODZX 4JR3A 3K3IA 1OL6A 4RIYB 5F9EA 5CU4A 3FPMA 2Y7JA 3UVRA 4DBXA 5HESA 4R3RA 2VTQA 4BDAA 1QCFA 5KHXA 3HA8A 3JVRA 4LV5A 4OGRA 3HGKA 4IM2A 4PNKA 5LVPA 1YHWA 3SVVA 3ZDUA 3K5VA 3KXZA 4CSVA 3E8NA 3RHXA 3Q6WA 2J5EA 2YFXA 4MAOA 5JSMA 4YURA 4DH1A 4EH4A 1OUKA 4U5JA 4FMQA 4C3RA 4GSBA 1V0BA 2PMOX 3CP9A 2W1HA 4AZFA 3OXTA 4EZ5A 3PIYA 3TI1A 4D55A 3LXPA 4YP8A 4EOQA 4AXFA 3FKLA 4Y8DA 3BWJA 1RJBA 2HY81 4GRBA 3GFEA 4QP4A 5FG8A 5ETFA 4YLLA 1FGIA 3LFDA 3C9WA 4FTIA 3ORLA 4YJVA 4YJNA 3VUMA 3G90X 4BTFA 2BRBA 2A98A 2J0MB 5CEQA 1F3MC 4MK0A 3FI2A 1ZY5A 5GJGA 2C3IB 4KSQA 4KIOA 4ZK5A 4CT1A 3OT3A 4WIHA 2ZJWA 4XBUA 3DK3A 3FQHA 3R7OA 3SG9A 5J9LA 3BL7A 2LGCA 3QHWA 4XYFA 3U9NA 2ERZE 4AZSA 3UMWA 5L2SA 1H1PA 1WBNA 5AAEA 4MD8E 2H34A 4IANA 3ZO4A 5AX3A 2YCQA 4TYEA 4Y72A 4IFGA 3FZ1A 3I6UA 4I6LA 3C5UA 3OCTA 3ZU7A 2VTRA 3ZBXA 5B2LA 3V01A 3KCFA 2OFUA 3ZH8A 2DQ7X 1APME 5FRIA 3ZSGA 1DI9A 3AC8A 3SQQA 3O8PA 4O0UA 5F95A 3HMMA 4FKPA 2JKQA 2WMAA 3T3VA 2C6OA 3A7HA 3CPBA 2UW7A 4FKSA 3KRWA 4NCTC 2VZ6A 4YTHA 4FV2A 4ZXTA 1W82A 1KV2A 4M13A 3EN5A 3NVMB 4IVDA 5A3XA 4NW5A 2J0IA 4FZAB 3WE4A 4ACDA 1U5RA 3TZ7A 4AW0A 5IH5A 1BX6A 2Q0NA 3ATSA 4F9YA 2R4BA 4AOJA 4J52A 4TXCA 4BKJA 4EH2A 5L2QA 5DFPA 3KMWA 4YO4A 4LQMA 5ETIA 3Q9WA 3JY9A 5EM7A 4O2PA 3Q6UA 4C4EA 1G3NA 4GV1A 3BQCA 5EOBA 3ZRMA 1WVYA 2WOUA 3CKXA 3ORKA 4RFYA 3EB0A 5ACBC 4I22A 3GCQA 4FTAA 3L9MA 4XG7A 5D7VA 3LFAA 4HGLA 4O21A 1ATPE 3E7VA 4JOAA 5TE0A 2PMNX 5CF6A 5AUXA 4CV8A 1KOAA 3QTXA 3VS1A 2QO2A 3UYTA 3ZZEA 4FG7A 3PLSA 2B52A 1VYWA 1XHAA 4ZY4A 3FPQA 3VC4A 4M69B 4F7SA 4FRFA 4A07A 2XF0A 4EQCA 5DMZA 3QA0A 3PSCA 4II5A 5JK3A 3FKNA 2J7TA 4L9IA 4L01A 4X3FA 3A2CA 4L00A 5IH6A 3POOA 4ARKA 3BI6A 4H3BA 4CMUA 4EK4A 4GKIA 2CLXA 3TZMA 5J1VA 2ZV9A 4HYIA 3ZO2A 4LOQA 2W5AA 4ZOGA 3ZLYA 2YM4A 5KMOA 4XV2A 4U97A 4NT4A 2X8IA 3EN9A 4FEWA 2WMWA 2XK8A 5IA3A 4YC3A 5CQUA 2GS6A 2X7FA 5HX6A 2BMCA 4G16A 3CS9A 3QC4A 3PYYA 1PMUA 4OLIA 5IQEA 4Y46A 4YSJA 3LMGA 2NRUA 5I3OA 4PTEA 3EL7A 4D28A 3TTIA 4CTCA 2X0GA 2XAMA 3R8MA 3TN8A 4EQMA 1SVGA 2J0LA 3A4OX 4N70A 4C2VA 5IG1A 2A4LA 1O6KA 3UTOA 5JFWA 3NEWA 4MXCA 5L2WA 3UOJA 1MRYA 3NR9A 2BRMA 5KO1A 3EZVA 3C4XA 4W8DA 4RVLA 1M14A 2QHMA 1J7LA 1UU8A 4I6HA 3Q4UA 3ROYA 5IQCA 1PXNA 3GOKA 5T6KA 4O0RA 3LFCA 5HO6A 4FL2A 2BZHB 3NYVA 2W96B 2G2FA 5A4QA 5AP5A 4LOPA 2XNPA 3FMJA 3ORZA 4AGWA 4CLJA 3V8TA 3DDQA 3T9IA 1YWVA 4MVFA 2YM3A 5A54A 5CXZA 4O82A 3O17A 4E4NA 3UC3A 1R3CA 2GHLA 5DG5A 4CFUA 4FZ6A 4PTCA 1FMKA 4ORKA 3KVXA 5DPVA 4BCMA 4D2RA 3R63A 4O0SA 5JFSA 3RPSA 1OBGA 1IAHA 2W1IA 3BV2A 4P2KA 4FKRA 2BRHA 3Q9ZA 4G6LA 4X2FA 3QTIA 4XP2A 4EC8A 1OIUA 3QCSA 4WUNA 3ZXZA 3V5JA 3QTUA 5IUGA 5JZJA 3TEIA 2ETMA 2ETKA 4QEBA 2XNNA 3IS5A 2ZV7A 3CLYA 3C0IA 3W8QA 1KE9A 3BGQA 2WTKB 5C1QB 1LP4A 4RPVA 4ZIMA 4G17A 3W2SA 3IPHA 4GIHA 2XB7A 4HNIA 5AP1A 5G6VA 3PP0A 4R1YA 5FTGA 4EH3A 4J97A 1UWHA 3QD3A 4FIGA 3K2LA 4LGGA 4PMPA 4FNXA 2GS2A 3THBA 3DKFA 5E8SA 1RE8A 5KE0A 5HTCA 4L8MA 5EM6A 5EQEA 5I4NA 4KD1A 3HX4A 4FKUA 3N4TA 5HCZA 4QMOA 4Z7HA 4X0MA 4NIFB 3TCPA 2AUHA 2QONA 3R02A 4Q9SA 2YCFA 3ALOA 4X2KA 4PDSA 2PUIA 2X6EA 2G2IA 5FD2A 2CGVA 3Q5ZA 4EH5A 4EOMA 3R28A 2YLEA 5GNKA 3P7AA 4XV3A 3BBWA 3BZ3A 3RNYA 3POZA 2WKMA 3OY1A 4H58A 4G31A 3MS9A 3PY3A 4BN1A 3AXWA 2QOCA 3ATTA 4G3CA 3C4CA 4EKKA 4C02A 4CRSA 3H0ZA 4DG0E 4YTFA 4UMQA 3W2PA 3ZFYA 5JT2A 2VN9A 3FZRA 4JDKA 2XKCA 3NIEA 4GK3A 3TMOA 3RAWA 2HK5A 1U59A 5DT4A 4ACMA 2PPQA 3QQGA 2BAQA 3HMOA 4G1WA 3PJ2A 4FKVA 3RK7A 2KTYA 1XO2B 3UGCA 3UPXA 4BB4A 1SM2A 2XUUA 2BDFA 2OBJA 2UUEA 1B6CB 4NK9A 2I0YA 2IVUA 4K77A 4OTDA 2PVHA 4IDVA 3PA3A 3C4FA 3QD0A 4IBMA 4PTGA 4CD0A 2IZTA 4LOOA 3DXQA 4AQKA 1JKSA 4FG8A 3G6GA 3WIGA 3TV6A 4IMYA 3KN6A 3TJCA 3W8LA 4BTKA 2QOKA 5HVJA 4EZ3A 2F7ZE 4M68A 5M55A 3KB