2CPKE

Crystal structure of the catalytic subunit of cyclic adenosine monophosphate-dependent protein kinase
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
336
structure length
333
Chain Sequence
VKEFLAKAKEDFLKKWETPSQNTAQLDQFDRIKTLGTGSFGRVMLVKHKESGNHYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMVMEYVAGGEMFSHLRRIGRFEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGFAKRVKGRTWLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFATTDWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEEEIRVINEKCGKEFTEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords cAMP-DEPENDENT PROTEIN KINASE, CATALYTIC SUBUNIT
publication title Crystal structure of the catalytic subunit of cyclic adenosine monophosphate-dependent protein kinase.
pubmed rcsb
source organism Mus musculus
molecule tags Transferase(phosphotransferase)
total genus 102
structure length 333
sequence length 336
ec nomenclature ec 2.7.11.11: cAMP-dependent protein kinase.
pdb deposition date 1992-10-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2cpkE01
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2cpkE02
2WQNA 2PUIA 1R1WA 2UZTA 4D5KA 1H1SA 5BYLA 2XBJA 1URCA 3C0HA 3HX4A 2IZSA 3O8TA 3L9NA 2ZV2A 4M13A 3E8NA 3IONA 4RC4A 1YWRA 4APPA 1PKDA 2V7OA 4WNPA 3NUPA 5KBRA 3LCSA 4UBAA 3QUEA 5CZIA 5E7RA 4GS6A 2XNGA 3QX4A 3IK3A 3CGFA 4M97A 2X2KA 5E8ZA 4AA4A 1QPCA 4MF0A 1XBCA 3C4FA 2PZPA 3PSDA 4RWJA 3MH3A 4F08A 3VUKA 4RC3A 2YHVA 3CD8A 1BLXA 3B2TA 2J0MB 3BHVA 4XBRA 5CNNA 1JKTA 4UY9A 5CLPA 3GC9A 3EOCA 2JFLA 4AOTA 4C3FA 4BR3A 4FL2A 5AP7A 3ZZEA 4H36A 3UNKA 5DT3A 3AD4A 3EQPA 4USDA 4FG9A 4FKRA 2A27A 4OLIA 4X2FA 4E5BA 4R3PA 2LGCA 2RFSA 5HNBA 2C6EA 2FSTX 4HYSA 5F20A 3R7UA 3KEXA 3E62A 2YCRA 1CDKA 3FI8A 1LP4A 3LLAA 2J2IB 5I3RA 3MI9A 2OK1A 3G9NA 3NNXA 2R2PA 2O64A 3DDPA 5CS6A 1ZYJA 2VTPA 2WHBA 3BBTB 3PE1A 1Q8ZA 1ATPE 3QRJA 4IE9A 2AC5A 3DCVA 1Q61A 1G8AA 4IHPA 1YWVA 4JJRA 3QGWA 4V0GB 3BV3A 3QD0A 2W5AA 3EB0A 1X8BA 3ZSHA 4UV0A 2ZYBA 4TTHB 3QRTA 4JRVA 2OFUA 3D14A 3Q9ZA 3BYMA 2X9FA 3TDVA 3NYOA 2ETRA 4IAAA 1Q99A 2W4JA 4IAIA 2DUVA 3KB7A 4L43A 4FKJA 4FEQA 4XG9A 2XNEA 5JFVA 5HOAA 2VTMA 2ZJWA 3NYVA 4FUYA 2BUJA 4FTIA 2GFSA 3GCUA 3Q04A 4HYHA 5C01A 5IQAA 3LCTA 5A4CA 2XK3A 1YI6A 5JSMA 4PNIA 2CCIA 3WZKA 1KE9A 3LFNA 3BQRA 3LE6A 4I20A 3R8PA 4UMRA 2ERZE 4FTNA 4FV1A 1IAHA 1Z5MA 4BYJA 3LZBA 4IAKA 4S30A 4YJSA 3PPJA 4GRBA 4L42A 4QPAA 2B9IA 4H39A 3T8OA 4KKEA 2A19B 3C1XA 2QLQA 3EYGA 3WF9A 4I1ZA 2GHGA 1VJYA 5AP3A 4IVBA 4A4XA 2EU9A 2F9GA 5AP5A 3VN9A 4A4LA 2VWUA 4QTDA 4WKQA 1H00A 3QKLA 4GYIA 5AX9A 4CD0A 4E4XA 3PY3A 2A4LA 2WTKB 4I41A 4J8NA 4O38A 2UZEA 4J53A 4YJVA 4M67A 4LRKA 5LVLA 3U55A 2BRBA 3VNTA 2B9JA 2JBPA 3GP0A 3CKWA 4PPBA 4BTJA 5JRQA 4EWQA 3I6WA 4EL9A 4YMJA 4CG8A 3UQFA 3U6HA 2E9NA 5AM6A 2VV9A 5HCZA 4F7LA 3R02A 1YVJA 4XRJA 2OSCA 4UZDA 1MQ4A 2BKZA 5FG8A 3RGFA 4CZTA 5AADA 5IEVA 4C3RA 2W17A 3QCYA 2OF4A 3V3VA 1Q8UA 4TNBA 3Q32A 4YLLA 3RALA 3PJ2A 4Q2AA 3FHIA 4FKOA 4EZ3A 1OITA 5EQYA 4K1BA 5C9CA 2W1GA 3BWJA 1YOLA 3R8VA 5M09A 3M2WA 1R3CA 4PMMA 1WBPA 1ZYLA 2O65A 5A9UA 4GU9A 1ZY5A 4ASZA 4V04A 4WG4A 3TZMA 3E3BX 3D2KA 4WG5A 4XS2A 2XA4A 3LFEA 3NCZA 2JKKA 1KE8A 3MIAA 2OZAB 1RW8A 2HK5A 4NL0A 3UQGA 2R64A 1UWJA 2XKFA 3M1SA 4AWIA 4R3CA 5FP5A 3SQQA 3U87A 1E1XA 2C3IB 4II5A 2PTKA 4PMSA 2XIKA 3AQVA 2ITTA 4JDHA 1IASA 4E93A 1ZLTA 4QYFA 3QTXA 4EYJA 4I0RA 3IOPA 3OS3A 4FV9A 1G5SA 3OOMA 5EI8A 4LG4A 5M55A 4EOMA 4FA2A 4FTKA 3DK6A 3QTQA 4FSMA 4PP7A 1J7IA 3CJFA 1V0OA 1ZOEA 3PVBA 2XZSA 4LGDA 2VTLA 4X3JA 4EH2A 3PJCA 3SG9A 3FKLA 3MJ1A 1P4OA 2VRXA 3FUPA 4L8MA 1T46A 3DLSA 4FOBA 3C50A 1UKHA 2XM8A 3PJ8A 4BKZA 4HJOA 3O71A 5BMMA 2C6IA 2RGPA 4BDJA 4DH8A 2RSVA 3MS9A 2FSMX 3ATSA 4BBEA 3TUDA 2OXDA 4X2NA 3ZFXA 4GKIA 3UO6A 2YA9A 5EH0A 4OBPA 4EH6A 3FI4A 4O7VA 3S3IA 4I5HA 3DGKA 1O6LA 2J7TA 3BLHA 1WMKA 3VUMA 3O23A 3ZRLA 4NFMA 3CXWA 3FEGA 2REIA 2F57A 3S2PA 4QMPA 2YABA 2ZM4A 5AA8A 4BL1A 1XR1A 3IW4A 4NM3A 4F09A 3ZSIA 3FI3A 4TPTA 1KE5A 3QF9A 5EI2A 3VUIA 4X2JA 3FPMA 4D9UA 2HXLA 1ZYDA 2WD1A 3GVUA 3QTWA 4UB7A 3ZLXA 3K2LA 4FKVA 3A7FA 4C36A 1PYEA 2V62A 1YXXA 4DGGA 1OL1A 3RMFA 4Z7HA 1FVVA 2YN8A 4OTIA 4YSJA 3QLFA 1W0XC 1M7QA 3BGZA 4FOCA 4XG6A 1Q3WA 2E9UA 4MQ2A 3M42A 4OW8A 3QUDA 3GB2A 2NP8A 4G2FA 4JVGA 2R3HA 1H25A 4Z7GA 2ZM3A 1JSTA 4E4MA 1SZMA 3PRFA 2QR7A 3D5WA 3MVLA 3FZ1A 3FAAA 4AW0A 4BDFA 4C4HA 5DMZA 4BZDA 4UX9A 2OZOA 4FSNA 1YI3A 5T6KA 2B52A 2B9FA 4X21A 4DG2E 2W1FA 3IW7A 5D9HA 4QTBA 5ACBC 5M07A 3DT1A 4KA3A 4QP9A 3OWKA 5CU3A 5GIPE 3R30A 1UU3A 4ORKA 1UV5A 3BBWA 5L4QA 2PULA 4OTPA 3UIXA 1ND4A 4DCEA 4NM7A 4FG7A 5IEXA 5LMKC 3F82A 2W1ZA 4AUAA 5K5XA 3FLQA 4BI0A 1E1VA 4ZTLA 2GHMA 4WT6A 3V6SA 4RC2A 2C3KA 2E9OA 3LMIA 3GFWA 3LFFA 3N4VA 2X1NA 3H3CA 4FKPA 4R8QA 4QQCA 3DDQA 4EK4A 4EH9A 5BUEA 3G9LX 2J50A 4ZIMA 4NKSA 4CKJA 1QMZA 1YKRA 4E6CA 4JAJA 4RFZA 3UYTA 4QMXA 5EYMA 2XNOA 5D7VA 3ZFMA 4DA5A 3EN4A 2BAJA 3REPA 3L9LA 2ITPA 4FSRA 5EM5A 3TNPC 4CYIA 1JOWB 4XP0A 3QZGA 3FYKX 4LOQA 1DAWA 4XV9A 3A4PA 5AR4A 3KXHA 4CFFA 4GK3A 3U51A 1PY5A 2E9PA 3FXWA 4EOIA 4DFBA 3CEKA 3AMAA 3W16A 4S33A 5JFXA 4EQUA 4FZAB 4TYJA 4J95A 4NU1A 5CU6A 5CAOA 4LL0A 3SA0A 4RG0A 1JSVA 3NPCA 3AXWA 4WNMA 5EW9A 1OIQA 5AR7A 2J90A 1CMKE 3LJ1A 3Q2MA 5KHXA 1OUKA 4BB4A 3G0EA 4Q5HA 4QMSA 4TYHA 3RPVA 4EORA 3O8UA 4U5JA 4EK8A 3CSVA 3R28A 4FGBA 4BGGA 3GGFA 3SDJA 1XH6A 3ZS5A 4PTGA 4CVAA 4XJ0A 3JY0A 3MVMA 4CQGA 3ZZWA 2P55A 3AC8A 3SOCA 3IO7A 3A4OX 4X3FC 2GDOA 5FTOA 3NLBA 3TV6A 1MUOA 4W4YA 3ZFYA 3CQUA 4GUBA 1OZ1A 3COIA 4RJ5A 4YO4A 1M2RA 5CSWA 5HNGA 2VWBA 2BDJA 2EWAA 4O22A 2X8DA 1DM2A 4W4XA 3IW8A 2QOOA 3I7BA 4DG3E 4DGLC 3EL7A 1GJOA 3CLYA 4ZLYA 4FNXA 4NCTC 5J9YA 3NSZA 3UP2A 3ZOSA 3TDWA 1G3NA 3RKBA 5EQPA 3EWHA 2QKWB 3O50A 4KWPA 3FXXA 2I7QA 4YUQA 1GOLA 2CGXA 1AQ1A 3VHKA 4AW2A 3P08A 3GENA 3HRCA 3OCSA 4PDOA 4QMVA 2Z7LA 4IJPA 3GOKA 3R7YA 3VQUA 5BX0A 4C02A 2R3MA 4IW0A 2XKDA 5AEPA 2KTYA 4ZK5A 1UA2A 3U9CA 3IOKA 5L2SA 3FY2A 1SM2A 4B0GA 2OGVA 4CFMA 2IJMA 5AUZA 4AX8A 4RIWB 2P3GX 2YCQA 4EBVA 1Y8YA 3NX8A 1O9UA 4R7BA 3I81A 2HY81 4L44A 3NAXA 1ZZ2A 3P78A 4HCVA 5CNOA 2XVDA 3NUUA 4GG5A 4I6BA 2X81A 3LFSA 4C4EA 4I6QA 3I6UA 2X8IA 4FZ6A 3NRMA 4Y85A 2Z8CA 3ZRMA 4A07A 5JQ5A 3MY5A 4PP9A 4RIXA 5I3OA 3GC0A 4M8TA 3Q96A 3OUNB 4AACA 1YXUA 3VS1A 3Q5IA 1GZKA 4V0GA 2XK4A 2I0EA 4LRJA 3PIZA 3LIJA 3DU8A 2XJ1A 5DLSA 4FSYA 3ZMMA 2ZMCA 2WPAA 2FA2A 3EZVA 3RAHA 4U40A 4HVHA 3P0MA 5AM7A 2B4SB 1S9JA 4YTCA 3ENMA 3QCQA 4G6NA 4R77A 2ITUA 2FB8A 3F61A 4NWMA 3KRRA 4G6OA 5KNJA 5E90A 3K5VA 3QZIA 4G16A 5IA1A 2GQRA 5IUHA 4O0RA 4U7ZA 4QP1A 4YGAA 3GOPA 1YDSE 2JIVA 3FC2A 3OZ6A 3QBNA 4KNBA 4KS8A 3BGPA 1Y57A 4RPVA 1E9HA 2UZLA 3VQHA 2X6DA 4BCGA 4CMTA 2CKPA 4O81A 5LOHA 4C38A 3U4WA 2G01A 2BILB 4KD1A 4DF3A 3Q9WA 1JSUA 5F1ZA 3ZM4A 4ASDA 4DLIA 4ENXA 5BNJA 1WBWA 1H1WA 3KY2A 5AWMA 3RJCA 4QP4A 1TQMA 3MFSA 3VRZA 4CRSA 1W83A 3SVVA 4D2SA 5L6OA 3DLZA 1GY3A 2VTOA 1UWHA 3DPKA 4YZBA 1DS5A 3OFMA 5HE0A 1UNHA 5CI6A 3BKBA 4YJOA 2OXXA 1U59A 2ITXA 3HKOA 2F49A 2G2IA 4LFIA 2A0CX 4PF4A 1ZYCA 2PK9A 5AV2A 4C4GA 4D1ZA 3KRWA 4MD8E 3R1YA 4HVGA 3ZSGA 2HOGA 4O91A 4EHVA 2CLXA 2Y7JA 4PMPA 1J7LA 3V8SA 4FTQA 3FY0A 2DS1A 3NVKI 4ZMFA 4EOQA 3LHJA 5KX8A 4MBLA 4M84A 2PMIA 4U0IA 2YISA 4QQJA 5H8BA 3OVVA 2YLFA 4P4CA 2Z2WA 3EHAA 4I4FA 3VJOA 4EUUA 3KULB 4I23A 2Z60A 4JDJA 2W96B 1O6YA 3QYWA 4XP3A 5JZNA 3EQCA 2VO0A 2ZDTA 5J7BA 5KMJA 3OUKA 1XBBA 3PZEA 3WE4A 5C4LA 4WA9A 3K54A 3UO5A 4MAOA 4GIHA 1U54B 2JDSA 4BTFA 3ZBXA 3GNIB 5EQEA 2CCHA 1LEZA 3QZFA 2OLCA 1VEBA 4XOZA 3AD6A 5I5ZA 1KSWA 5HU3A 2PZIA 4MWIA 3KXNA 4GT4A 4R3RA 5A54A 5CXZA 3HRBA 5BVOA 5CT7A 1IA9A 2FO0A 4I6FA 2W4KA 1GNGA 4J71A 2V55A 4FSUA 3ANRA 1OPJA 2PMOX 3TNIA 3QA0A 1Q5KA 4WBOA 2C5YA 3CGOA 4TWCA 4I4EA 3K3IA 3KA0A 3H0ZA 5CU0A 3ZO2A 4AF3A 2QOHA 5HTIA 5LQFA 3UMWA 5J1VA 1H24A 3QCSA 2QHNA 3ROCA 4TY1A 3BV2A 3E87A 1W8CA 4L53A 4EH5A 5AUUA 3PWDA 2WEVA 4E6DA 2QVSE 3COKA 3CS9A 3D5UA 4QMLA 4RIYB 3JVRA 2YFXA 5J8IA 4BDKA 3RWQA 4IZAA 2R3JA 2X2LA 4K0YA 4DGOA 2X4FA 5DIAA 4O6EA 4YLKA 3LQ5A 3NUAA 1CKPA 5LARA 3F3WA 3V8TA 4FSTA 3VW8A 4XLIA 4EH4A 4W8DA 4C8BA 2DQ7X 1NVSA 5AP4A 1Q8YA 2F7EE 2QLUA 3NNVA 2CMWA 4QP7A 4RZVA 4BGQA 2HCKA 1VYZA 5CF6A 5CY3A 4HYIA 1OIYA 5M4FA 3R63A 3T9IA 3PA5A 4BIEA 5CSXA 4RRVA 3UOJA 3FLWA 3V5WA 2UW8A 1ERKA 2H34A 2VU3A 4JLCA 4FK6A 2QOLA 4K77A 1JWHA 5CVHA 4OBOA 3UVQA 1H1RA 1ZWSA 3NDMA 4CFNA 2HW6A 4IXPA 5IH4A 4LV5A 5IA2A 4F99A 2YM8A 3IW6A 4OAVB 4D0XA 4D1XA 1WFCA 5CX9A 3VUDA 1Q97A 2ZAZA 2YIRA 3HDMA 1BI8A 4GIIA 4EZ5A 2B0QA 3PA3A 5D1JA 3TZ7A 1H27A 1YWNA 3ATTA 3AT3A 4IX3A 2WELA 4O96A 5HE2A 4FT3A 4Y72A 2GQSA 3NYNA 3CTJA 3R1NA 5E8WA 5K9IA 3SAYA 4IC8A 3AMBA 4HGLA 4EK5A 4HVIA 4FKQA 4ANOA 3FZOA 4RMZA 2I40A 2ONLA 1NA7A 2H96A 3AC3A 5TF9A 3WIGA 3FMHA 2Q0BA 2WOTA 4JX7A 3DAKA 5BPYA 3QQLA 3ZUUA 5G6VA 3GU8A 4UZHA 2W9FB 3R04A 2O63A 5E1SA 4F1OA 1U5QA 3FLYA 3TXOA 4ZZNA 2VTAA 1ZY4A 3EL8A 4BCHA 4ZY5A 4N4SA 3EH9A 5JQ8A 4O7RA 3H4JA 2ITOA 4KKHA 5BMSA 5IA0A 1LEWA 1WCCA 4MD9E 3EKNA 4EQCA 4JOAA 4F7NA 3S00A 3QQGA 5IQEA 5BVFA 2JDVA 1FGKA 3D0EA 3POZA 3BI6A 3JXWA 5AP2A 5LVNA 1SMHA 2QI8A 4B7TA 5KKRC 2WFYA 5EDRA 1KE6A 5F95A 5KO1A 3R9OA 3OF0A 2J6MA 2IZTA 2QG5A 2OJIA 2WMRA 4I92A 4AT4A 5ANIA 5KCVA 3D2IA 3P23A 3FL5A 3C4XA 4TKSA 3BU6A 4XV3A 2W06A 4A9TA 1FMOE 1BI7A 3LKMA 3CPCA 1S9IA 3RAKA 4JT3A 3ODZX 4QPSA 4QYHA 1WBVA 3PXYA 3OCTA 3C7QA 2X7GA 3FMMA 3DJ6A 4IFGA 4RJ3A 4EHGA 1HOWA 2VD5A 3E8EA 4HNFA 3WYYA 3DB8A 3OG7A 3PIXA 3V5PA 4PDYA 2JD5A 2XIYA 4RA4A 5ANJA 1OB3A 5ANKA 3V5TA 4UYAA 5H3QA 3DBFA 5FEDA 3WZDA 1WVYA 3E8CA 3O96A 5AA9A 4FI1A 4ZTSA 4ZJIA 4DITA 3UG1A 2G15A 4M14A 4PL4A 4TWPA 3MWUA 4M0YA 3DAJA 4IEBA 4EBWA 3SW7A 5ICPA 2VTRA 5EW3A 4FEVA 2PZRA 2ESMA 4G9RA 3R7IA 2GNHA 2ETKA 4C58A 3FMKA 1OPKA 3OBGA 3SX9A 2GHLA 4CFWA 1OKWA 2X9EA 4YC6A 3OBJA 3PXQA 4ZSEA 2O5KA 2WMVA 4AU8A 2YZLA 4JL9A 2WMBA 2IW9A 4G34A 1W7HA 2YIXA 4AOJA 3NYXA 1GAGA 3LLTA 2J9MA 3GEQA 4CTBA 3PZHA 3OEZA 3MN3A 3GC7A 4FZFB 3MFUA 4TYEA 5JH6A 5A6NA 4QOXA 1JAMA 1XH4A 4FTCA 1QPJA 2XM9A 1KE7A 3Q4UA 5T68A 2OJFE 3ZXTA 2DWBA 3JVSA 2UZVA 4FV2A 4LOPA 4AS0A 4TRLA 5AUYA 3TUBA 2BZKB 5ANDA 1H0WA 4C57A 3CY3A 2PY3A 3ETAA 3P1AA 4M66A 1GIIA 5C8MA 4U42A 1VZOA 1Q8WA 2VWXA 4BN1A 1R0EA 4O7WA 1XH9A 4MQ1A 3FBVA 4FKLA 4O0YA 1W98A 1STCE 3VJNA 2WTDA 2WQBA 4YPDA 1SVEA 1I44A 4F9BA 2X7OA 3JY9A 4ACCA 4CQEA 5CXHA 5T3QA 4BI2A 3ELJA 3DKFA 2BTSA 4X2KA 5ETCA 4J52A 5B2KA 2R0UA 4AA5A 4FMQA 3P7AA 3PP1A 1XO2B 3ZXZA 4ZTHA 4IB1A 3R7EA 3FQHA 3FV8A 3PXZA 1DI8A 3NUSA 3FZPA 4FIEA 4RIWA 3SC1A 4CRLA 4KS7A 4FV4A 2P2IA 5HVJA 4ACMA 2PVRA 2WMQA 2YDJA 3HVCA 3I1AA 5FDPA 5CF5A 2VN9A 2YJRA 4AZTA 3MVJA 4FV3A 3IG7A 4U3YA 4BHNA 4O1OA 1GZNA 2R0IA 4WO5A 5LMAA 4CT1A 2ZVAA 3WF7A 2RG6A 4EHZA 5I0BA 4OTWA 4R5YA 2QQ7A 5JN2A 3U6IA 1XBAA 2W7XA 1J7UA 1J1BA 5CAPA 4ITHA 4AFJA 2C4GA 2WTJA 5M08A 4QP8A 2QOBA 3R7GA 4O7TA 3H9FA 4USFA 3KK9A 1OL6A 4M68A 5IG1A 2PU8A 5KMIA 3PUPA 2XK8A 1CKIA 2EXMA 5CYIA 4ZAUA 4K33A 3OXTA 2WTIA 3WF6A 5AUWA 4EOSA 4I22A 5HZNA 2RL5A 4GVJA 4UWYA 4BYIA 3F88A 2QURA 3D9VA 3VS3A 3ZDUA 2CNUA 3D7TB 4K9YA 2QO2A 3L9MA 3VBYA 3VHEA 4MKCA 5AV4A 5E9EA 3ZRKA 3D4QA 4W8EA 4YZCA 2ZB1A 4L01A 4R7IA 4W4WA 4WRGA 1KWPA 3EQHA 4LGHA 3GU6A 3TCPA 4BTKA 4WIHA 1M14A 4FTJA 2P33A 4PRJA 2QU6A 4FTAA 2C3JA 2J0LA 3PE2A 3TUCA 3IECA 1H28A 1RJBA 2PE0A 3TJDA 3H10A 4XYFA 4B99A 4FL3A 5F94A 4F9WA 4PV0A 4CGAA 2PE1A 2OF2A 2WU6A 2UZUE 4O0XA 3IKAA 3E88A 3MFRA 2XRUA 5C1QB 3ZCLA 3V5JA 4IWDA 2WTCA 3F2RA 3V5QA 2ETMA 4CLJA 3PWYA 2CN8A 2C6MA 1UU8A 2VWYA 2W0JA 2QO7A 4QMQA 4Z9LA 5CT0A 2HAKA 2UVYA 5E92A 4CYJA 5AAEA 2R3NA 4BCJA 3COHA 1H26A 1XWSA 3V51A 3BEAA 5AUTA 4U8ZA 1K3AA 5A14A 5BUJA 1CM8A 2J4ZA 5BVWA 2W1HA 1Q62A 1P5EA 3JS2A 4MK0A 4L9IA 3LQ3A 4X3FB 4GSBA 3DNEA 5DHJA 3NGAA 4XMOA 3UODA 1NXKA 3GCSA 2O0UA 4RLLA 4BDBA 3KULA 3GC8A 1OIUA 1JKKA 2XKEA 3R22A 3P9JA 4UWCA 3VUGA 3TZ8A 3BRBA 4AE6A 4GW8A 4MXYA 1LPUA 3OT8A 4GCJA 2RFEA 1YW2A 4I0SA 4AQCA 4XP2A 1YRPA 4TWOA 5HBHA 1K9AA 4MHAA 5AP6A 4UEUA 2CGWA 2XCKA 4IVCA 2R4BA 4DFLA 2BROA 3SLSA 2OG8A 2YITA 4ZY6A 3PPKA 3EKKA 3LCKA 3MPAA 2IPXA 4H1JA 2UW9A 4EOJA 1G8SA 3WZJA 2VO7A 3LQ8A 4JXFA 1BKXA 3HV7A 3GFEA 4KIPA 3OD6X 5HIEA 5H8EA 5HLNA 5AAGA 2QOCA 2GQGA 4O2PA 3LFAA 2C69A 4F9YA 2OI4X 4Z3VA 3QTSA 4XHKB 3R7VA 2QR8A 2QCSA 5FRIA 3FQSA 3GXLA 2A2AA 4W4VA 3DFAA 4DN5A 1TVOA 3WILA 4A9UA 4HPUE 3S95A 1TKIA 3RAWA 2H6DA 3VF8A 1REKA 4D4SA 4NEUA 2WO6A 3G5DA 5BVDA 3PJ1A 1MRUA 1J91A 4MXAA 4G6LA 3E7VA 3TJCA 4QRCA 2QHMA 2PVLA 5ETFA 1OL5A 3DB6A 3NIEA 3UO4A 4P5QA 5HO6A 4O27B 4KAOA 2XNMA 4O0TA 3W1FA 2QOFA 3IW5A 4FNYA 1IEPA 4KRCA 4PUZA 5CASA 4ZMEA 2JITA 3HV3A 4C35A 3CQWA 4YBKA 5AR2A 4FKWA 3JUHA 5EKOA 2CHLA 1BL6A 4NK9A 3QD2B 4RVLA 5B2LA 5JGDA 3HV4A 3ORTA 4IC7A 3ORMA 5DFPA 4MCVA 4JBVA 3KVWA 4RX8A 3THBA 5TOZA 4K18A 4ERKA 4F6UA 4XG8A 1WAKA 5DT4A 3P86A 5GHVA 3G51A 4FV6A 4D9TA 1SNXA 4IWOA 2VTHA 2QG7A 1KUTA 5CEMA 4BDIA 4G17A 3N4TA 2CDZA 3IDCA 2I0VA 4JBOA 4EH3A 5LVPA 3HL7A 4B6LA 4G5PA 4AP7A 5BYZA 3RK7A 3KMWA 3W8QA 4DFZE 4EONA 2UZOA 1XH5A 3TWJA 4FR4A 2VNWA 2YIYA 4O0WA 2JAMA 3DKCA 5E8VA 3DKOA 4AA0A 3ZLSA 2W9ZB 2WMAA 3EQIA 2WMWA 2IZUA 3OHTA 4Z16A 5HBJA 3RNIA 3DY7A 5A6OA 2X6EA 4WRSA 3HV6A 1JPAA 4L7FA 3RPOA 4JG6A 3ZO3A 2VO3A 2R3IA 4YTFA 1ZRZA 4TXCA 4O7YA 2EVAA 3R8MA 2XYNA 4LM5A 2WIHA 5DR9A 2UW0A 4V01A 5A4EA 1YDRE 1IG1A 3KQ7A 5DBXA 3DK7A 4CZUA 2VTIA 4F7JA 3PXKA 2IWIA 3KRXA 2YERA 3TNWA 4K6ZA 5TE0A 1QPEA 5I9XA 2Y9QA 5FTGA 4AN3A 5L8LA 3D5VA 4KIKA 3W2RA 4D28A 2FSOX 3UOHA 5EK7A 3HMOA 3ORIA 4D55A 3LVPA 4OTHA 4M69B 4O0SA 4NIFB 2BR1A 2OU7A 4A9YA 5H2UA 3Q6WA 3LPBA 1YOMA 3D5XA 1MQBA 4TZRA 2BHHA 3IQ7A 1ZOHA 3NW6A 2XP2A 4I0TA 3V6RA 4BCNA 2UUEA 2C0IA 4NYEA 4X0MA 3E3PA 4YC3A 4H58A 1SNUA 3H9RA 2WU7A 2PE2A 3A7JA 1UKIA 3BCEA 4FTMA 4TNDA 5ANGA 3RNYA 5HCYA 1PF8A 5DN3A 3DBQA 3EN6A 3KF4A 3IDBA 4QQTA 4DHFA 3AGMA 2VO6A 5GZ9A 3DBEA 5KZIA 4JG8A 4DAWA 1B6CB 2O2UA 4NM0A 2ACXA 4A9SA 5EYDA 4OBQA 3QWJA 3BIZA 5IMEA 4MYGA 1ZMUA 3TN8A 4C2VA 4KABA 4ZLOA 4F7SA 4E5WA 2YACA 3KXGA 4RQKA 2X39A 5FXRA 5J9ZA 2FH9A 1FVRA 3PLSA 3Q6UA 1PXIA 2YM3A 3L8PA 4RT7A 3QA8A 1YXTA 2BIKB 4TW9A 5CAUA 4L67A 4XG3A 4J97A 3UOLA 2VGOA 1A48A 4EH7A 3H0YA 4USEA 3EN7A 2BIYA 4FSQA 4ASXA 2HIWA 4U43A 4ENYA 5AV3A 3KCFA 3BELA 4D2PA 4F63A 4M7IA 2WAJA 4QMTA 4U6RA 4QNAA 1OGUA 4MX9A 5HU9A 3ANQA 2OIDA 3O7LD 2YJSA 4FK3A 4JG7A 4OUCA 2F7ZE 3TTIA 3VWAA 4AG8A 2PVHA 4E3CA 4XOYA 5LCJA 3MV5A 3EN5A 1U5RA 1OKYA 4A4OA 4FZ7A 4IFCA 1PJKA 3DOGA 3SGCA 5JKGA 2PVKA 4UXQA 4EYMA 1APME 1UNLA 4DG0E 2UW7A 2VX3A 4QQ5A 1OKVA 2C30A 1B38A 3W18A 2GU8A 3QAME 5AUVA 2J5FA 3FSFA 5L2IA 3A99A 3R2YA 3GCQA 3MSSA 3D83A 4EC9A 4RX5A 4EOKA 3CQEA 2BFYA 1DAYA 3LAUA 2WMTA 4G3FA 4BTMA 2QOKA 3EMGA 3F66A 5K0KA 5H9BA 3DQWA 4G3CA 3Q2JA 3DS6A 2YWVA 1NVQA 3V01A 1PHKA 5HIDA 2WMUA 4J1RA 5TKDA 1Q24A 5CSHA 5E8YA 4HPTE 3FXZA 3SXSA 2HXQA 2IO6A 1OM1A 3C0IA 4FT9A 2OO8X 3PSCA 4RLKA 2WXVA 3EFLA 3TNHA 3AC1A 3FMLA 4CMOA 4BWKA 5BUIA 3HZTA 3ZU7A 3LFBA 3UNZA 2ZMDA 3OTUA 4DFXE 2PVYA 3QGYA 5DG5A 3WIKA 4EKLA 3GBZA 4OR5A 2GNFA 3BGQA 3QD3A 4QTCA 4BCPA 4FEUA 5F4NA 3PIYA 3BLQA 3OTVA 3F2AA 4UXLA 1SVHA 3OC1A 5J1WA 1Z9XA 2XRWA 4ID7A 3A8XA 3HP5A 4BCQA 2OXYA 3Q4ZA 3SV0A 3QQUA 3IGOA 5KKRB 3F3TA 5IQDA 5JMSA 4XBUA 3EYHA 3FLZA 5AR3A 4Z55A 4RJ4A 5LMKA 1WBNA 3OXIA 4NH1A 4BDCA 4M0ZA 2IG7A 3E64A 5HBEA 4DEIA 4PPCA 4ZJVA 3CCNA 3UZPA 4E4LA 1M17A 2CKEA 3RTPA 3WOWA 4FNZA 5ETAA 5GJFA 3S4QA 2BALA 2P4IA 4ZTMA 3NMUF 4BIBA 3D7TA 4CKIA 4UMQA 3R9HA 3FQEA 2WNTA 2JDOA 3DV3A 4MNEB 4CFUA 3OY3A 4YPSA 5HICA 1F0QA 3HECA 2JIIA 3QUPA 2IZRA 3FMNA 3NW7A 3NWWA 2R3FA 4HNIA 2R3OA 4V05A 3KGAA 4WD5A 5FEEA 5K3YA 3SD0A 4IADA 5AP0A 4ANNA 4FX3A 1JBPE 5M4CA 5CANA 3ALNA 3W2SA 4YSMA 3F5PA 4GVAA 1P4FA 1AGWA 5CEIA 1H1PA 2CGUA 4XH6A 3TZ9A 4A06A 2HYYA 2BMCA 4KINA 1WBTA 2VWZA 2GFCA 3FKOA 3HDNA 4BKJA 2IW8A 4O6LA 1ZARA 2GNIA 3BHUA 4LV8A 4U79A 5AUXA 3Q52A 4U41A 1IRKA 1YXVA 2SRCA 4YZNA 5LWNA 3KRLA 2IVTA 1NY3A 2CKQA 2E9VA 1BX6A 4YNOA 5JRSA 1FMKA 4GJ2A 4DEGA 4ZSAA 1T45A 4XRLA 3EQRA 5CVFA 4FBXA 2OBJA 3QU0A 2PVMA 3O2MA 4ZJJA 4JDKA 2ONLC 3HAMA 4S32A 5E8XA 5CTPA 3VIDA 2WB8A 2YCSA 4IZ7A 5FXQA 2W1CA 4OTQA 5TT7A 3WARA 1XKKA 2PVJA 4B9DA 5HNIX 3ORLA 4C7TA 3FLSA 3FZTA 3UJGA 5J5SA 5KUPA 3ODYX 4RFYA 5JFSA 4G3EA 5C4KA 4KB8A 3FDNA 3A7IA 2PL0A 3WYXA 4E6AA 3UMXA 2ZV9A 4Q9SA 3NCGA 3DQXA 3FC1X 4BDDA 3IGGA 2GSFA 2HW7A 2OZAA 4Y73A 2VTSA 2R3QA 2Z7SA 4AZVA 2OWBA 3LCOA 4FICA 3QFVA 3R7OA 5KBQA 2WTWA 4O0UA 3LXLA 3SRVB 5AFVA 1B39A 2R3GA 3R21A 2W05A 1PW2A 4NSTA 3FZSA 2GCDA 3BPRA 3ITZA 3QYZA 4BRXA 3Q3BA 4XV2A 5E4HA 1ZYSA 3U9NA 3T9TA 3PG3A 2X4ZA 1H8FA 5IU2A 3UDBA 2BRGA 3R8ZA 3DFCB 4O83A 3ZTXA 3W55A 1XJDA 4B8MA 5FD2A 1Y6AA 1YHVA 3B8QA 3VS5A 4FVRA 4CEGA 2ITVA 3HMNA 3L8XA 5ETIA 4EK6A 5IUGA 4GFOA 4CFXA 2YDKA 3DXPA 5LWMA 4NTSA 3ZEWA 2BPMA 1DI9A 2GS2A 2WMXA 5EDPA 4DTKA 2LAVA 3I5NA 3UTOA 3RCDA 2BDWA 2VTTA 5IA4A 3M11A 1PMVA 2XK6A 3NUNA 4FSZA 2JKQA 4RIOA 1PKGA 3VS4A 2QD9A 5M4UA 1UNGA 3UPXA 3ZH8A 5AJQA 3VBWA 5HG8A 3BYOA 1PXJA 2YM4A 4QTEA 4D4VA 4GT3A 4QMUA 5GINE 4IDTA 1LR4A 1YQJA 4C62A 3MY1A 4BWPA 3E7OA 4BF2A 3RM6A 4R6VA 5M06A 3SKCA 3QKMA 5CSPA 1GZ8A 2X2MA 4ZTNA 3G15A 2NRUA 3W10A 2PUNA 5FGKA 3KMMA 4NFNA 3QX2A 3G2FA 5GJGA 3MW1A 2CKOA 4XX9A 1UVRA 2HELA 5DR2A 4H1MA 2QNJA 3LM0A 3KXMA 3AC5A 2GS6A 4OTGA 4P90A 3RBWA 3RI1A 4G1WA 3QALE 5HVKA 4GJ3A 2CLQA 2QODA 4O84A 2WQMA 4FT5A 2H9VA 2UW3A 2WQEA 3F5UA 3HYHA 2J51A 2PVNA 4WUAA 2VX0A 3I5ZA 3G90X 5EOLA 5AR8A 3FMDA 3ZC6A 1IA8A 2R3PA 5KMMA 3K5UA 3F69A 4KBKA 1LUFA 3HNGA 5J5TA 5CU4A 1I09A 1JQHA 5CEKA 2PPQA 3F3ZA 4EJ7A 2XNBA 3E8DA 5EYCA 5JFWA 3L9PA 3QZHA 3OT3A 1RDQE 2BCJA 3LM5A 4M69A 4JR7A 4NIFA 4ZZOA 2CNQA 2XYUA 1PMUA 3R00A 2W4OA 5M57A 4JIKA 2R9SA 4IZ5A 4K8AA 4RWIA 4F0IA 3BHYA 3I0OA 3ORKA 4FODA 4FV8A 1P2AA 5AP1A 2CPKE 3RK9A 3W2OA 4BICA 4E1ZA 1IR3A 2H8HA 3R01A 4FF8A 2XBAA 2Q0NA 2BAQA 3ZDIA 2JIUA 3EFJA 5CAQA 4BIDA 3MJ2A 3FZRA 3QXPA 4QMNA 4O7NA 3SOAA 5IQFA 3FWQA 2UZDA 4XCUA 3CPBA 4MEDA 5C8KA 5I9VA 4EZ7A 2C6TA 3ZO4A 2XS0A 2AYPA 1ZOGA 2ZOQA 3NAYA 2IVVA 4AGDA 4D2TA 4AOIA 2PSQA 2IN6A 3N9XA 2R3RA 2YEXA 3QKKA 4CZYB 1BYGA 3KF7A 4E5AX 4PNKA 1EH4A 5A4LA 3CKXA 5HD7A 3UNJA 3QRIA 4JX3A 4ZSGA 3LFCA 5CVGA 4E73A 3KXZA 3C4WA 1R78A 4GEOA 2QU5A 3IS5A 4LRMA 2XF0A 4PDSA 5AV0A 4FIGA 3MVHA 4PL3A 4BCFA 4ANLA 5BQ0A 3QHWA 3PRIA 4BDHA 4MBIA 1Q41A 3SXRA 4AE9A 4AXAA 3HRFA 2ITYA 4Y5HA 2Y4IB 4FZDB 4BBFA 2XUUA 3QC4A 5BYYA 5FM2A 2Z02A 5IF1A 1FOTA 5KZ0A 4L6QA 4ZZMA 3QTRA 3CBLA 2VAGA 4GU6A 5C03A 3UZTA 4GL9A 4O2ZA 4F70A 4C61A 5HVYA 4UMUA 4S31A 2JKOA 2XIXA 5FDXA 4GV1A 3TL8A 3EQDA 4QMYA 4AZSA 4DCAA 4DTAA 1M2PA 3RAIA 4DH7A 2VWWA 4K2RA 1M7NA 2R7BA 4WHZA 2BRNA 4DH5A 4FTLA 4QYYA 2JFMA 2X0GA 5HCXA 2G2HA 1YOJA 3E5AA 1Q3DA 4ITJA 3RK5A 4D2VA 3QLGA 3KMUA 4FIHA 4D58A 4RQVA 1BL7A 3ZUVA 5JK3A 3TI1A 3GUBA 4R1VA 4TYHB 5DRDA 4NM5A 2GMXA 5HG7A 5K4JA 4ITIA 4DEAA 5JGAA 2PUUA 3RWPA 3O51A 4LOOA 3OXZA 4AZFA 3NR9A 3LXKA 1ZXEA 3PPZA 4C4JA 1CKJA 3BX5A 5CU2A 2R7IA 1U46A 3P4KA 4PMTA 4F64A 4XEYA 1H01A 2C0OA 4BC6A 1JNKA 3VRYA 3QQFA 4C3PA 5LJJA 2JAVA 3QRUA 5J87A 3OMVA 2UVZA 5KMKA 2A1AB 5FBOA 4X6RA 4RX9A 3G33A 3RPYA 4QP3A 4DBNA 3LCDA 4F1TA 4IAZA 2I6LA 4TYGA 4RVTA 2B54A 2VUWA 3HEGA 4DBXA 3Q9XA 4FVQA 3VUHA 1R39A 2Y4PA 3WF8A 1M52A 3MPTA 3AGLA 2YM5A 4J8MA 5K4IA 3L1SA 2HY0A 2IW6A 3UQCA 4XUFA 2VTQA 2OW3A 3KCKA 4R5SA 5EYKA 4CV9A 3LW0A 3ORXA 4AAAA 4C59A 4F9CA 2HZNA 3HV5A 4IWPA 3IDPA 2HZIA 4DE4A 3F5GA 4AGWA 4G3DA 4C0TA 1KOAA 2VTJA 4H3BA 5BVKA 4Q9ZA 3DTCA 5IISA 3U8WA 2C6OA 4C37A 2YAAA 1H0VA 1J1CA 3NUXA 2E2BA 5HESA 5ANOA 2EXEA 3EIDA 2RKUA 3ENHA 4R7HA 5EHOA 2XCHA 4O7ZA 3NW5A 4HW7A 1NVRA 2WTVA 3A7HA 4KSQA 3L8SA 4L3JA 3PY1A 4NZWB 4APCA 2BZHB 5CEOA 2G2FA 4RIXB 3QC9A 4YZDA 4EEVA 5CAVA 4QMMA 4L3PA 4MNEA 4HZRA 4D4RA 1H1QA 4ZS4A 4YR8A 3CTHA 4FYOA 2ITNA 1JVPP 3ZC5A 3DZOA 4DEHA 3CY2A 4CLIA 3BYUA 5D11A 4CTCA 4DH1A 3POOA 3CR0A 3C51A 4ANSA 4PWNA 1SYKA 4O21A 1A9UA 4IMYA 4L3LA 2EXCX 2UW6A 3A61A 2R5TA 3FLNC 4JI9A 2NNWB 4TYIA 3KC3A 2PMLX 4ZSJA 3BHHA 3TV4A 3SG8A 4I5PA 4RVKA 3V5LA 4BCKA 3BQCA 3HGKA 1Y91A 3C5UA 4XV1A 1WBOA 1YHSA 3HA8A 2QONA 3WZEA 4ARKA 4MNFA 1FVTA 5B2MA 4JR3A 2HZ4A 1PXKA 3RINA 4GFMA 3U6JA 4IX6A 5HHWA 2EB3A 2WZJA 5DT0A 1PYXA 4JBPA 1URWA 4IDVA 4U3ZA 3MDYA 3GU7A 1YHWA 4FUXA 3R6XA 3ACJA 5JGBA 4YZ9A 2I0YA 5AIRA 5A4QA 3K3JA 3MBLA 4AN9A 4E8AA 4FV0A 5KMLA 3NUYA 4Y46A 5E8UA 4EK3A 2CJMA 1KOBA 4BFMA 2Z7QA 2UZBA 3B8RA 1W82A 3CP9A 4F4PA 5L8JA 3QQJA 4G9CA 1ZMVA 4DGNA 1U54A 4FEXA 4CT2A 4ZLZA 3ID6C 3HMPA 4AW5A 4UMTA 4QP6A 2B1PA 3AC4A 4HGSA 4QYEA 3AT4A 1H4LA 4N0SA 1TQPA 3LJ0A 2C0TA 3B2WA 4NTTA 4Y5QA 4MD7E 4G31A 4IJ9A 2Y0AA 3F6XA 3PVUA 5LVMA 2QO9A 3HUBA 4C4IA 5GZ8A 3A7GA 4DGMA 4NJ3A 3EZRA 3W32A 3FE3A 5CSVA 3KFAA 2KULA 4W9XA 4PY1A 4QMZA 5HEZA 5IUIA 4UMPA 5HTBA 3SRVA 2W5BA 4DH3A 3RP9A 4X6QC 4YC8A 3TACA 3UZRA 4HZSA 2FYSA 4JNWA 1FINA 4HVDA 2C1BA 3LFDA 4RIYA 3OEFX 4IZYA 2VGPA 4BCMA 2BRMA 3MB7A 2GS7A 4P2KA 5D10A 1OKZA 2JGZA 2C1AA 2XK7A 1PMEA 2XNNA 4IB0A 4S2ZA 3Q53A 5FP6A 3KL8A 5C26A 3GU5A 1O6KA 4E26A 2Y4IC 5KMNA 2ZDUA 2GPHA 1H08A 4GYGA 3P5KA 4BGHA 4L46A 2CN5A 3C4ZA 4WSYA 3VS0A 4DT8A 4Y8DA 5FQDC 3R8UA 4XG7A 5L2WA 4N6ZA 4Q5EA 4D4YA 4YJRA 5HGIA 4KBCA 5IQIA 4HCUA 5M53A 5TO8A 3NS9A 4MTAA 2WKMA 3BYSA 4HYUA 4FKIA 4FNWA 5CF8A 2Z7RA 3GCPA 3BU5A 3OWPA 4LMUA 4TWNA 4C4FA 4EI4A 2PUPA 4AT5A 2BAKA 3A60A 2C6DA 3GI3A 5IQCA 4N6YA 4YTHA 4F0FA 2OIBA 2PMNX 4ASEA 4I21A 4PPAA 4CCBA 4AGUA 2NO3A 4FKSA 1K2PA 4RX7A 4RSSA 1MRYA 2XEZA 1OUYA 1YI4A 3PG1A 2Y6MA 3O17A 4GK2A 4BCIA 1OBGA 3KN5A 4IAYA 5KHWA 3Q4TA 4IVAA 3FHRA 4UN0C 1Q8TA 3CJGA 1BUHA 2PVFA 3RCJA 4YNEA 5EG3A 3ORZA 3TIYA 4MF1A 3V04A 3VO3A 3FL4A 2P2HA 4XG4A 4YJUA 5FM3A 2C3LA 4IACA 4X2GA 3UPZA 3KXXA 2XMYA 2FUMA 4D1SA 3KN6A 3AG9A 4PX6A 3DXQA 3O8PA 2Y6OA 5KMOA 3AD5A 4HOKA 2ERKA 5DRBA 3I60A 5AIKA 2XJ2A 3VULA 4FV7A 5FLFA 3F7WA 2F4JA 5FXSA 4FG8A 4NT4A 4YHTA 3U4UA 3UYSA 5IH5A 2JC6A 4MXCA 4LYNA 5EKNA 3LXPA 3N4UA 4JQEA 4XNEA 4L45A 4QO9A 4RGJA 3BYVA 2V22A 3R83A 5EW8A 1R0PA 3E93A 5HX8A 4NW6A 5DPVA 3RM7A 4PQNA 5GZAA 4IM2A 3OWLA 2EB2A 2OJ9A 3DK3A 4ACGA 4GMYA 5JZJA 3I0QA 1BMKA 4YTIA 2Y8OA 5M56A 1OPLA 3E92A 4ZOGA 5M51A 3BWFA 3TNQB 3C4CA 3EQFA 4GUEA 3ERKA 4PDPA 3R1SA 4Y95A 4KRDA 2GTNA 2BHEA 3ZONA 2BKKA 3OWJA 1H07A 5DI1A 3WZUA 3WF5A 3OW4A 5M4IA 5FUTA 2RIOA 4AT3A 4QYGA 4IQ6A 4YURA 3A62A 3JR1A 1SVGA 5DA3A 3QCXA 5E8TA 2PYWA 3PJ3A 4YJNA 4IAFA 3H9OA 3TV7A 3C4EA 1OMWA 4TL0A 3VBQA 3I79A 3ZO1A 3EN9A 4R1YA 3ZLWA 4RA5A 4DLJA 5FEQA 2BVAA 2C5OA 4C34A 4RFMA 5CEQA 5IDPA 3ZM9A 5CZHA 4NJDA 3MB6A 3SXFA 4BWXA 3BE9A 5DWRA 1NT2A 4O1PA 3Q9YA 2VTNA 3DNDA 4JRNA 3PYYA 3W2QA 4H3PA 1ZZLA 4I94A 3U54A 2ITQA 3CD3A 1F5QA 3R2BA 5HKMA 2OH4A 3FKNA 3BU3A 3WE8A 4D5HA 3ZEPA 1FGIA 4QMOA 4HGTA 4RWLA 1PXOA 3ZYAA 3T3UA 3PVGA 5L2TA 1QL6A 4NKAA 4DC2A 1WVWA 2NRYA 4YZMA 4QT1A 3ZUTA 5DGZA 5DNRA 4DFNA 5I4NA 3ZHPC 3GU4A 4XLVA 2O8YA 3O0GA 4YLJA 4ZTQA 3ULIA 4EOLA 4DTBA 5FWKK 3C0GA 3FMEA 3IPHA 2IVUA 2J0JA 2OJJA 1UU9A 1UU7A 3GT8A 3PXRA 4FE2A 5IQHA 2AUHA 5L3AA 3VUTA 2B9HA 2RFDA 2X7FA 3FPQA 4D0WA 3KRJA 5GJDA 5GIOE 4EH8A 4ALUA 1L3RE 4M12A 4R78A 4AN2A 1AD5A 4ANQA 3H30A 3DTWA 4IANA 3OP5A 3BLRA 4RWKA 3QXOA 2WTKC 3AMYA 2ZB0A 3UBDA 3Q5ZA 2FGIA 5DEWA 2ZV8A 2ITWA 4RBLA 3FJQE 1CTPE 2R3LA 4F6WA 2QOQA 2UVXA 5EM8A 4CXAA 4ZS0A 4WSQA 3BHTA 3LMHA 2C6KA 4AFEA 2QC6A 3ALOA 2B55A 5F9EA 3RHXA 2QKRA 2FVDA 2OICA 4F65A 2ITZA 3R9DA 2O3PA 4L00A 3NNUA 1OL7A 2XJ0A 2JEDA 4BKYA 4MH7A 4ZY4A 1PRYA 5M44A 3FMJA 2XH5A 2V7AA 2UV2A 4ALWA 3MTLA 2JDTA 3EJ1A 3PY0A 3RZBA 5B7VA 2BZIB 3UVRA 1Y8GA 3P7BA 3R73A 4QD6A 2C5VA 4H3QA 5HIBA 4O86A 3VAPA 4FKUA 1QCFA 3LFQA 4TT7A 5IA5A 3R8LA 3W8LA 5ACKA 4KUJA 2C5NA 4IIRA 3ACKA 4FGRA 3R1QA 1RQQA 4YBJA 3VBXA 5HX6A 1V0BA 3O7LB 4IBMA 2BRHA 4GFGA 2J0IA 2W1DA 4FVPA 4MXOA 4M15A 4JQ8A 4KIOA 3I7CA 5GNKA 4DYMA 4YU2A 3LMGA 4GK4A 4N70A 3PFQA 4I6HA 1Y6BA 4OT6A 5JT2A 2RFNA 3PLAE 2XIRA 4PTCA 4KBAA 4CG9A 4FSWA 5K5NA 4FTRA 5CQWA 3QQKA 3S1HA 2XEYA 5L6PA 5BVNA 4IB3A 4PL5A 3NEWA 4FKGA 3N51A 3P7CA 4MVFA 1FBNA 1U4DA 2OFVA 3R9RA 4J96A 2OKRA 1XHAA 3NNWA 5CEPA 3CTQA 5HO8A 1REJA 1JKLA 4FC0A 2JDRA 5E8SA 4ANBA 3UIBA 4J99A 5I9ZA 4LQMA 2HZ0A 1XH7A 2WGJA 4AZEA 3CE3A 3QHRA 4CCUA 4FIIA 5LMBA 4FV5A 4IX4A 1PXNA 1VYWA 4DFYA 1VR2A 2YLEA 3HA6A 4IX5A 3R71A 3GCVA 4AZWA 4RJ7A 4RZWA 3WBLA 1V0PA 4X7QA 4DEDA 3L8VA 4I93A 2VWIA 3D94A 4O0VA 4XG2A 4BCOA 4QNYA 5FBNC 3VBVA 2W1EA 1HCKA 4RJ6A 5AAFA 1A06A 4FT0A 2EUFB 3LXNA 3TIZA 4DEBA 5L6WL 4CKRA 3D15A 1PMNA 4WBBB 3TKHA 1PXLA 1XH8A 5ANEA 4GKHA 3RVGA 5ITAA 3JPVA 2VWVA 5CWZA 4DEEA 5DE2A 4E7WA 3F2NA 2P0CA 4JAIA 4FTTA 3DAEA 4N57A 4X3FA 4D2WA 1MP8A 4P5ZA 4EQMA 3HAVA 5AMNA 4FYNA 3F7ZA 4HGEA 3F3UA 4ONAA 3UIUA 3E63A 4EOPA 4U97A 5D41A 4FT7A 5DYJA 4J98A 4LGGA 4G5JA 5LCKA 4F9AA 5E91A 4FKTA 3QTUA 4NCTA 1PXMA 5DH3A 3EFKA 2YAKA 4YJPA 5CF4A 4QPMA 3HP2A 3V8WA 3OY1A 3QQHA 3VBTA 4F0GA 3HMMA 3QD4A 1OI9A 4I5MA 1GIHA 3HLLA 4RVMA 5EHLA 4FIFA 4B4LA 4IVDA 2J0KA 4MBJA 5HE3A 4BZNA 5HLWA 1HCLA 2IVSA 5AV1A 3A2CA 3ET7A 4QP2A 4AW1A 3OW3A 3OCBA 4OGRA 1OBDA 5KE0A 2OH0E 5HORA 1PXPA 3VS7A 5HTCA 4CSVA 5EDQA 2CGVA 3BEGA 4MXXA 3DJ5A 3DKGA 2HENA 3C13A 5CENA 3TG1A 2G9XA 2XK9A 1ZAOA 2F2UA 2VX1A 3RZFA 4CMUA 3PTGA 2B7AA 2UW4A 3UC3A 5G1XA 2FSLX 3MFTA 5HG5A 3JYAA 3DBDA 4FIJA 2DYLA 4OTFA 4EKKA 5IDNA 3FYJX 4B8LA 4ZP5A 4OTRA 3MH0A 4LUDA 2YDIA 1YXSA 2BDFA 2C47A 5HE1A 3NVMB 4Y83A 4LL5A 5B0XA 2QOIA 3A8WA 4U9AA 5EHYA 3VF9A 4E20A 3UP7A 3MH2A 4UALA 3FI2A 3OOGA 4WOVA 3ORPA 1Z57A 4WNOA 3RPRA 4HCTA 2BTRA 5D12A 3W2PA 2YM6A 4ERWA 5EI6A 2CNVA 1YDTE 3UIMA 4IM3A 4FL1A 2XB7A 3D7ZA 3Q4CA 5CI7A 2PZYA 3MIYA 4ZXTA 3R0TA 4QTAA 5TR6A 5LXMA 3UC4A 4I5CA 5D7AA 1GIJA 5E1EA 3PA4A 4ZTRA 4K11A 4TN6A 5IMXA 3W33A 3PVWA 4KSPA 4A9RA 5EM6A 4DT9A 1NW1A 2BFXA 2GTMA 2I0HA 4JS8A 3TKUA 2JBOA 4YJTA 3PSBA 4IB5A 2XIZA 2XNPA 2C68A 3SW4A 3UOKA 4GH2A 1JLUE 4ACHA 3MYGA 4BI1A 3HUCA 2YM7A 3QTZA 3W2CA 4C2WA 5HQ0A 3QWKA 3CC6A 3UG2A 5H8GA 5LVOA 5A46A 1P14A 3AC2A 3CIKA 4DINA 3PDTA 2VNYA 4EWHA 4D2RA 1OIRA 3KVXA 3T3VA 4QMWA 4BVUA 5BVEA 3EFWA 4WUNA 3MY0A 3EQBA 3II5A 1KV2A 4YJQA 2HWOA 2YIQA 3ZLYA 2F2CB 4CFVA 2G1TA 2R3KA 5EM7A 4H05A 1KV1A 3LJ2A 5HD4A 2V5QA 5DEYA 3VS2A 3TEIA 2RF9A 4FTUA 5I9UA 4AGCA 4E4NA 4IWQA 4NW5A 3OROA 3TTJA 1WZYA 5A4TA 2YWPA 4DFUA 3G6GA 3PP0A 3DJ7A 4I24A 4C33A 4HVSA 5HLPA 4P7EA 1OVEA 1L8TA 4A7CA 4BZOA 5L8KA 1J3HA 4WNKA 4LMNA 5J7HA 2WOUA 4UYNA 1RE8A 2VZ6A 4BHZA 4CNHA 3DXNA 2WMSA 3GQIA 2XKCA 4F6SA 5IZFA 4MWHA 5IEYA 1F3MC 3KREA 2F7XE 3QL8A 1OL2A 3Q60A 4LUEA 2C5XA 5DVRA 4JDIA 2V0DA 3GQLA 1XQZA 3P79A 3RHKA 4EJNA 5HO7A 4ZEGA 2C6LA 2X8EA 4G3GA 3DBCA 3F9NA 3FSKA 3MGYA 4KIKB 3KKVA 2YCFA 3G0FA 5DOSA 5EFQA 2PHKA 3ULZA 4ANMA 5IPJA 1Q4LA 2Q83A 5EOBA 3BE2A 4FTOA 5C8NA 2OJGA 3QRKA 4U44A 3ZBFA 3MESA 2AC3A 2JKMA 3C5IA 3EQGA 3QTIA 5AR5A 4IH8A 4FEWA 4KKGA 1QPDA 2GNLA 3VW6A 3VC4A 4ACDA 5IA3A 2UZWE 3F3VA 2W1IA 4OTDA 2GNJA 3UE4A 2BZJA 2ZV7A 3ROYA 3WI6A 4YO6A 4YP8A 2WQOA 3MA6A 5J79A 2GNGA 4OAUC 4YHFA 4L7SA 1FPUA 5IQBA 5IH6A 1ZMWA 4BDAA 1CSNA 3MPMA 1IAJA 3DA6A 1OECA 2UW5A 4W9WA 4O7SA 1W84A 5DR6A 3KK8A 2HWPA 3NIZA 3OCGA 3UGCA 5CQUA 3R9NA 1FQ1B 5HG9A 3MH1A 4BBMA 2PWLA 4IM0A 4U80A 4JBQA 4ZSLA 4GT5A 2J5EA 5C27A 3S0OA 3AT2A 5AX3A 4EHEA 5I9WA 1M2QA 3TM0A 3KU2A 4L68A 3RPSA 1MRVA 4J7BA 4PTEA 4EUTA 1TQIA 4ALVA 5K0XA 3COMA 4UWBA 3BZ3A 3TT0A 2YZAA 3HMIA 5IQGA 4S34A 2WEIA 3DZQA 2RG5A 5FTQA 3G6HA 2I1MA 4L52A 4MXZA 4OT5A 5L2QA 4BDEA 4EOOA 5I9YA 1JKSA 3AOXA 4JQ7A 3PXFA 1WBSA 1GZOA 3ORNA 4YHJA 3VVHA 5JEBA 2W5HA 3UVPA 4BDGA 4GG7A 2PZ5A 4U81A 4EC8A 2WIPA 3LOKA 3SHEA 3MTFA 4O7LA 4CV8A 4BY9E 4KIQA 2W99B 2B53A 4LI5A 2JLDA 2OIQA 2YIWA 2ZM1A 4F1MA 3VS6A 4M3QA 4JIAA 5J95A 2UZNA 3I4BA 3TKIA 4O82A 5HI2A 5IKWA 4I3ZA 4E6QA 5CALA 3C9WA 4NUSA 5A3XA 4RJ8A 4WG3A 4U45A 3NZ0A 1WVXA 1V1KA 2NPQA 3F5XA 2CSNA 3MA3A 5J9LA
chains in the Genus database with same CATH superfamily
2WQNA 2PUIA 1R1WA 2UZTA 4D5KA 1H1SA 5BYLA 2XBJA 1URCA 3C0HA 3HX4A 2IZSA 3O8TA 3L9NA 2ZV2A 4M13A 3E8NA 3IONA 4RC4A 1YWRA 4APPA 1PKDA 2V7OA 4WNPA 3NUPA 5KBRA 3LCSA 4UBAA 3QUEA 5CZIA 5E7RA 4GS6A 2XNGA 3QX4A 3IK3A 3CGFA 4M97A 2X2KA 5E8ZA 4AA4A 1QPCA 4FJVA 4MF0A 1XBCA 3C4FA 2PZPA 3PSDA 4RWJA 3MH3A 4F08A 3VUKA 4RC3A 2YHVA 3CD8A 1BLXA 3B2TA 2J0MB 3BHVA 4XBRA 5CNNA 1JKTA 4UY9A 5CLPA 3GC9A 3EOCA 2JFLA 4AOTA 4C3FA 4BR3A 4FL2A 5AP7A 3ZZEA 4H36A 3UNKA 5DT3A 3AD4A 3EQPA 4USDA 4FG9A 4FKRA 2A27A 4OLIA 4X2FA 4E5BA 4R3PA 2LGCA 2RFSA 5HNBA 2C6EA 2FSTX 4HYSA 5F20A 3R7UA 3KEXA 3E62A 2YCRA 1CDKA 3FI8A 1LP4A 3LLAA 2J2IB 5I3RA 3MI9A 2OK1A 3G9NA 3NNXA 2R2PA 2O64A 3DDPA 5CS6A 1ZYJA 2VTPA 2WHBA 3BBTB 3PE1A 1Q8ZA 1ATPE 3QRJA 4IE9A 2AC5A 3DCVA 1Q61A 1G8AA 4IHPA 1YWVA 4JJRA 3QGWA 4V0GB 3BV3A 3QD0A 2W5AA 3EB0A 1X8BA 3ZSHA 4UV0A 2ZYBA 4TTHB 3QRTA 4JRVA 2OFUA 3D14A 3Q9ZA 3BYMA 2X9FA 3TDVA 3NYOA 2ETRA 4IAAA 1Q99A 2W4JA 4IAIA 2DUVA 3KB7A 4L43A 4FKJA 4FEQA 4XG9A 2XNEA 5JFVA 5HOAA 2VTMA 2ZJWA 3NYVA 4FUYA 2BUJA 4FTIA 2GFSA 3GCUA 3Q04A 4HYHA 5C01A 5IQAA 3LCTA 5A4CA 2XK3A 1YI6A 5JSMA 4PNIA 2CCIA 3WZKA 1KE9A 3LFNA 3BQRA 3LE6A 4I20A 3R8PA 4UMRA 2ERZE 4FTNA 4FV1A 1IAHA 1Z5MA 4BYJA 3LZBA 4IAKA 4S30A 4YJSA 3PPJA 4GRBA 4L42A 4QPAA 2B9IA 4H39A 3T8OA 4KKEA 2A19B 3C1XA 2QLQA 3EYGA 3WF9A 4I1ZA 2GHGA 1VJYA 5AP3A 4IVBA 4A4XA 2EU9A 2F9GA 5AP5A 3VN9A 4A4LA 2VWUA 4QTDA 4WKQA 1H00A 3QKLA 4GYIA 5AX9A 4CD0A 4E4XA 3PY3A 2A4LA 2WTKB 4I41A 4J8NA 4O38A 2UZEA 4J53A 4YJVA 4M67A 4LRKA 5LVLA 3U55A 2BRBA 3VNTA 2B9JA 2JBPA 3GP0A 3CKWA 4PPBA 4BTJA 5JRQA 4EWQA 4I6LA 3I6WA 4EL9A 4YMJA 4CG8A 3UQFA 3U6HA 2E9NA 5AM6A 2VV9A 5HCZA 4F7LA 3R02A 1YVJA 4XRJA 2OSCA 4UZDA 1MQ4A 2BKZA 5FG8A 3RGFA 4CZTA 5AADA 5IEVA 4C3RA 2W17A 3QCYA 2OF4A 3V3VA 1Q8UA 4TNBA 3Q32A 4YLLA 3RALA 3PJ2A 4Q2AA 3FHIA 4FKOA 4EZ3A 1OITA 5EQYA 4K1BA 5C9CA 2W1GA 3BWJA 1YOLA 3R8VA 5M09A 3M2WA 1R3CA 4PMMA 1WBPA 1ZYLA 2O65A 5A9UA 4GU9A 1ZY5A 4ASZA 4V04A 4WG4A 3TZMA 3E3BX 3D2KA 4WG5A 4XS2A 2XA4A 3LFEA 3NCZA 2JKKA 1KE8A 2X0OA 2OZAB 1RW8A 2HK5A 3MIAA 4NL0A 3UQGA 2R64A 1UWJA 2XKFA 3M1SA 4AWIA 4R3CA 5FP5A 3SQQA 3U87A 1E1XA 2C3IB 4II5A 2PTKA 4PMSA 2XIKA 3AQVA 2ITTA 4JDHA 1IASA 4E93A 1ZLTA 4QYFA 3QTXA 4EYJA 4I0RA 3IOPA 3OS3A 4FV9A 1G5SA 3OOMA 5EI8A 4LG4A 5M55A 4EOMA 4FA2A 4FTKA 3DK6A 3QTQA 4FSMA 4PP7A 1J7IA 3CJFA 1V0OA 1ZOEA 3PVBA 2XZSA 4LGDA 2VTLA 4X3JA 4EH2A 3PJCA 3SG9A 3FKLA 3MJ1A 1P4OA 2VRXA 3FUPA 4L8MA 1T46A 3DLSA 4FOBA 3C50A 1UKHA 2XM8A 3PJ8A 4BKZA 4HJOA 3O71A 5BMMA 2C6IA 2RGPA 4BDJA 4DH8A 2RSVA 3MS9A 2FSMX 3ATSA 4BBEA 3TUDA 2OXDA 4X2NA 3ZFXA 4GKIA 3UO6A 2YA9A 5EH0A 4OBPA 4EH6A 3FI4A 4O7VA 3S3IA 4I5HA 3DGKA 1O6LA 2J7TA 3BLHA 1WMKA 3VUMA 3O23A 3ZRLA 4NFMA 3CXWA 3FEGA 2REIA 2F57A 3S2PA 4QMPA 2YABA 2ZM4A 5AA8A 4BL1A 1XR1A 3IW4A 4NM3A 4F09A 3ZSIA 3FI3A 4TPTA 1KE5A 3QF9A 5EI2A 3VUIA 4X2JA 3FPMA 4D9UA 2HXLA 1ZYDA 2WD1A 3GVUA 3QTWA 4UB7A 3ZLXA 3K2LA 4FKVA 3A7FA 4C36A 1PYEA 2V62A 1YXXA 4DGGA 1OL1A 3RMFA 4Z7HA 1FVVA 2YN8A 4OTIA 4YSJA 3QLFA 1W0XC 1M7QA 3BGZA 4FOCA 4XG6A 1Q3WA 2E9UA 4MQ2A 3M42A 4OW8A 3QUDA 3GB2A 2NP8A 4G2FA 4JVGA 2R3HA 1H25A 4Z7GA 4DHIB 2ZM3A 1JSTA 4E4MA 1SZMA 3PRFA 2QR7A 3D5WA 3MVLA 3FZ1A 3FAAA 4AW0A 4BDFA 4C4HA 5DMZA 4BZDA 4UX9A 2OZOA 4FSNA 1YI3A 5T6KA 2B52A 2B9FA 4X21A 4DG2E 2W1FA 3IW7A 5D9HA 4QTBA 5ACBC 5M07A 3DT1A 4KA3A 4QP9A 3OWKA 5CU3A 5GIPE 3R30A 1UU3A 4ORKA 1UV5A 3BBWA 5L4QA 2PULA 4OTPA 3UIXA 1ND4A 4DCEA 4NM7A 4FG7A 5IEXA 5LMKC 3F82A 2W1ZA 4AUAA 5K5XA 3FLQA 4BI0A 3PUFC 1E1VA 4ZTLA 2GHMA 4WT6A 3V6SA 4RC2A 2C3KA 2E9OA 3LMIA 3GFWA 3LFFA 3N4VA 2X1NA 3H3CA 4FKPA 4R8QA 4QQCA 3DDQA 4EK4A 4EH9A 5BUEA 3G9LX 2J50A 4ZIMA 4NKSA 4CKJA 1QMZA 1YKRA 4E6CA 4JAJA 4RFZA 3UYTA 4QMXA 5EYMA 2XNOA 5D7VA 3ZFMA 4DA5A 3EN4A 2BAJA 3REPA 3L9LA 2ITPA 4FSRA 5EM5A 3TNPC 4CYIA 1JOWB 4XP0A 3QZGA 3FYKX 4LOQA 1DAWA 4XV9A 3A4PA 5AR4A 3KXHA 4CFFA 4GK3A 3U51A 1PY5A 2E9PA 3FXWA 4EOIA 4DFBA 3CEKA 3AMAA 3W16A 4S33A 5JFXA 4EQUA 4FZAB 4TYJA 4J95A 4NU1A 5CU6A 5CAOA 4LL0A 3SA0A 4RG0A 1JSVA 3NPCA 3AXWA 4WNMA 5EW9A 1OIQA 5AR7A 2J90A 1CMKE 3LJ1A 3Q2MA 5KHXA 1OUKA 4BB4A 3G0EA 4Q5HA 4QMSA 4TYHA 3RPVA 4EORA 3O8UA 4U5JA 4EK8A 3CSVA 3R28A 4FGBA 4BGGA 3GGFA 3SDJA 1XH6A 3ZS5A 4PTGA 4CVAA 4XJ0A 3JY0A 3MVMA 4CQGA 3AKKA 3ZZWA 2P55A 3AC8A 3SOCA 3IO7A 3A4OX 4X3FC 2GDOA 5FTOA 3NLBA 3TV6A 1MUOA 4W4YA 3ZFYA 3CQUA 4GUBA 1OZ1A 3COIA 4RJ5A 4YO4A 1M2RA 5CSWA 5HNGA 2VWBA 2BDJA 2EWAA 4O22A 2X8DA 1DM2A 4W4XA 3IW8A 2QOOA 3I7BA 4DG3E 4DGLC 3EL7A 1GJOA 3CLYA 4ZLYA 4FNXA 4NCTC 5J9YA 3NSZA 3UP2A 3ZOSA 3TDWA 1G3NA 5BV3A 3RKBA 5EQPA 3EWHA 2QKWB 3O50A 4KWPA 3FXXA 2I7QA 4YUQA 1GOLA 2CGXA 1AQ1A 3VHKA 4AW2A 3P08A 3GENA 3HRCA 3OCSA 4PDOA 4QMVA 2Z7LA 4IJPA 3GOKA 3R7YA 3VQUA 5BX0A 4C02A 2R3MA 4IW0A 2XKDA 5AEPA 2KTYA 4ZK5A 1UA2A 3U9CA 3IOKA 5L2SA 3FY2A 1SM2A 4B0GA 2OGVA 4CFMA 2IJMA 5AUZA 3W0NA 4AX8A 4RIWB 2P3GX 2YCQA 4EBVA 1Y8YA 3NX8A 1O9UA 4R7BA 3I81A 2HY81 4L44A 3NAXA 1ZZ2A 3P78A 4HCVA 2AEGA 5CNOA 2XVDA 3NUUA 4GG5A 4I6BA 2X81A 3LFSA 4C4EA 4I6QA 3I6UA 2X8IA 4FZ6A 3NRMA 4Y85A 2Z8CA 3ZRMA 4A07A 5JQ5A 3MY5A 4PP9A 4RIXA 5I3OA 3GC0A 4M8TA 3Q96A 3OUNB 4AACA 1YXUA 3VS1A 3Q5IA 1GZKA 4V0GA 2XK4A 2I0EA 4LRJA 3PIZA 3LIJA 3DU8A 2XJ1A 5DLSA 4FSYA 3ZMMA 2ZMCA 2WPAA 2FA2A 3EZVA 3RAHA 4U40A 4HVHA 4LV7A 3P0MA 5AM7A 2B4SB 1S9JA 4YTCA 3ENMA 3QCQA 4G6NA 4R77A 2ITUA 2FB8A 3F61A 4NWMA 3KRRA 4G6OA 5KNJA 5E90A 3K5VA 3QZIA 4G16A 5IA1A 2GQRA 5IUHA 4O0RA 4U7ZA 4QP1A 4YGAA 3GOPA 1YDSE 2JIVA 3FC2A 3OZ6A 3QBNA 4KNBA 4KS8A 3BGPA 1Y57A 4RPVA 1E9HA 2UZLA 3VQHA 2X6DA 4BCGA 4CMTA 2CKPA 4O81A 4DHJA 5LOHA 4C38A 3U4WA 2G01A 2BILB 4KD1A 4DF3A 1W2DA 1JSUA 3Q9WA 5F1ZA 3ZM4A 4ASDA 4DLIA 4ENXA 5BNJA 1WBWA 1H1WA 3KY2A 5AWMA 3RJCA 4QP4A 1TQMA 3MFSA 3VRZA 4CRSA 1W83A 3SVVA 4D2SA 5L6OA 3DLZA 1GY3A 2VTOA 1UWHA 3DPKA 4YZBA 1DS5A 3OFMA 5HE0A 1UNHA 5CI6A 3BKBA 4YJOA 2OXXA 1U59A 2ITXA 3HKOA 2F49A 2G2IA 4LFIA 2A0CX 4PF4A 1ZYCA 2PK9A 5AV2A 4C4GA 4D1ZA 3KRWA 4MD8E 3R1YA 4HVGA 3ZSGA 2HOGA 4O91A 4EHVA 2CLXA 2Y7JA 4PMPA 1J7LA 3V8SA 4FTQA 3FY0A 2DS1A 3NVKI 4ZMFA 4EOQA 3LHJA 5KX8A 4MBLA 4M84A 2PMIA 4U0IA 2YISA 4QQJA 5H8BA 3OVVA 2YLFA 4P4CA 2Z2WA 3EHAA 4I4FA 3VJOA 4EUUA 3KULB 4I23A 2Z60A 4JDJA 2W96B 1O6YA 3QYWA 4XP3A 5JZNA 3EQCA 2VO0A 2ZDTA 5J7BA 5KMJA 3OUKA 1XBBA 3PZEA 3WE4A 5C4LA 4WA9A 3K54A 3UO5A 4MAOA 4GIHA 1U54B 2JDSA 4BTFA 3ZBXA 3GNIB 5EQEA 2CCHA 1LEZA 3QZFA 2OLCA 1VEBA 4XOZA 3AD6A 5I5ZA 1KSWA 5HU3A 2PZIA 4MWIA 3KXNA 4GT4A 4R3RA 5A54A 5CXZA 3HRBA 5BVOA 5CT7A 1IA9A 2FO0A 4I6FA 2W4KA 1GNGA 4J71A 2V55A 4FSUA 3ANRA 1OPJA 2PMOX 3TNIA 3QA0A 1Q5KA 4WBOA 4BJJA 2C5YA 3CGOA 4TWCA 4I4EA 3K3IA 3KA0A 3H0ZA 5CU0A 3ZO2A 4AF3A 2QOHA 5HTIA 5LQFA 3UMWA 5J1VA 2ZFYA 1H24A 3QCSA 2QHNA 3ROCA 4TY1A 3BV2A 3E87A 1W8CA 4L53A 4EH5A 5AUUA 3PWDA 2WEVA 4E6DA 2QVSE 3COKA 3CS9A 3D5UA 4QMLA 4RIYB 3JVRA 2YFXA 5J8IA 4BDKA 3RWQA 4IZAA 2R3JA 2X2LA 4K0YA 4DDGA 4DGOA 2X4FA 5DIAA 4O6EA 3AKJA 4YLKA 3LQ5A 3NUAA 1CKPA 5LARA 3F3WA 3V8TA 4FSTA 3VW8A 4XLIA 4EH4A 4W8DA 4C8BA 2DQ7X 1NVSA 5AP4A 1Q8YA 2F7EE 2QLUA 3NNVA 2CMWA 4QP7A 4RZVA 4BGQA 2HCKA 1VYZA 5CF6A 5CY3A 4HYIA 1OIYA 5M4FA 3R63A 3T9IA 3PA5A 4BIEA 5CSXA 4RRVA 3UOJA 3FLWA 3V5WA 2UW8A 1ERKA 2H34A 2VU3A 4F78A 4JLCA 2AQXA 2QOLA 4FK6A 1JWHA 4K77A 5CVHA 4OBOA 3UVQA 1H1RA 1ZWSA 3NDMA 4CFNA 2HW6A 4IXPA 5IH4A 4LV5A 5IA2A 4F99A 2YM8A 3IW6A 4OAVB 4D0XA 4D1XA 1WFCA 5CX9A 3VUDA 1Q97A 2ZAZA 2YIRA 3HDMA 1BI8A 4GIIA 4EZ5A 2B0QA 3PA3A 5D1JA 3TZ7A 1H27A 1YWNA 3ATTA 3AT3A 4IX3A 2WELA 4O96A 5HE2A 4FT3A 4Y72A 2GQSA 3NYNA 3CTJA 3R1NA 5E8WA 5K9IA 3SAYA 4IC8A 3AMBA 4HGLA 4EK5A 4HVIA 4FKQA 4ANOA 3FZOA 4RMZA 2I40A 2ONLA 1NA7A 2H96A 3AC3A 5TF9A 3WIGA 3FMHA 2Q0BA 2WOTA 4JX7A 3DAKA 5BPYA 3QQLA 3ZUUA 5G6VA 3GU8A 4UZHA 2W9FB 3R04A 2O63A 5E1SA 4F1OA 1U5QA 3FLYA 3TXOA 4ZZNA 2VTAA 1ZY4A 3EL8A 4BCHA 4ZY5A 4N4SA 3EH9A 5JQ8A 4O7RA 3H4JA 2ITOA 4KKHA 5BMSA 5IA0A 1LEWA 1WCCA 4MD9E 3EKNA 4EQCA 4JOAA 4F7NA 3S00A 3QQGA 5IQEA 5BVFA 2JDVA 1FGKA 3D0EA 3POZA 3BI6A 3JXWA 5AP2A 5LVNA 1SMHA 2QI8A 4B7TA 5KKRC 2WFYA 5EDRA 1KE6A 5F95A 5KO1A 3R9OA 3OF0A 2J6MA 2IZTA 2QG5A 2OJIA 2WMRA 4I92A 4AT4A 5ANIA 5KCVA 3D2IA 3P23A 3FL5A 3C4XA 4TKSA 3BU6A 4XV3A 2W06A 4A9TA 1FMOE 1BI7A 3LKMA 3CPCA 1S9IA 3RAKA 4JT3A 3ODZX 4QPSA 4QYHA 1WBVA 3PXYA 3OCTA 3C7QA 2X7GA 3FMMA 3DJ6A 4IFGA 4RJ3A 4EHGA 1HOWA 2VD5A 3E8EA 4HNFA 3WYYA 3DB8A 3OG7A 3PIXA 3V5PA 4PDYA 2JD5A 2XIYA 4RA4A 5ANJA 1OB3A 5ANKA 3V5TA 4UYAA 5H3QA 3DBFA 5FEDA 3WZDA 1WVYA 3E8CA 3O96A 5AA9A 4FI1A 3NFFB 4ZTSA 4ZJIA 4DITA 3UG1A 2G15A 4M14A 4PL4A 4TWPA 3MWUA 4M0YA 3DAJA 4IEBA 4EBWA 3SW7A 5ICPA 2VTRA 5EW3A 4FEVA 2PZRA 2ESMA 4G9RA 4QDVA 3R7IA 2GNHA 2ETKA 4C58A 3FMKA 1OPKA 3OBGA 3SX9A 2GHLA 4CFWA 1OKWA 4LDTA 2X9EA 4YC6A 3OBJA 3PXQA 4ZSEA 2O5KA 2WMVA 4AU8A 2YZLA 4JL9A 2WMBA 2IW9A 4G34A 1W7HA 2YIXA 4AOJA 3NYXA 1GAGA 3LLTA 2J9MA 3GEQA 4CTBA 3PZHA 3OEZA 3MN3A 3GC7A 4FZFB 3MFUA 4TYEA 5JH6A 5A6NA 4DDIA 4QOXA 1JAMA 1XH4A 4FTCA 1QPJA 2XM9A 1KE7A 3Q4UA 5T68A 2OJFE 3ZXTA 2DWBA 3JVSA 2UZVA 4FV2A 4LOPA 4AS0A 4TRLA 5AUYA 3TUBA 2BZKB 5ANDA 1H0WA 4C57A 3CY3A 2PY3A 3ETAA 3P1AA 4M66A 1GIIA 5C8MA 4U42A 1VZOA 1Q8WA 2VWXA 4BN1A 1R0EA 4O7WA 1XH9A 4MQ1A 3FBVA 4FKLA 4O0YA 1W98A 1STCE 3VJNA 2WTDA 2WQBA 4YPDA 1SVEA 1I44A 4F9BA 2X7OA 3JY9A 4ACCA 4CQEA 5CXHA 5T3QA 4BI2A 3ELJA 3DKFA 2BTSA 4X2KA 5ETCA 4J52A 5B2KA 2R0UA 4AA5A 4FMQA 3P7AA 3PP1A 1XO2B 3ZXZA 4ZTHA 4IB1A 3R7EA 3FQHA 3FV8A 3PXZA 1DI8A 3NUSA 3FZPA 4FIEA 4RIWA 3SC1A 4CRLA 4KS7A 4FV4A 2P2IA 5HVJA 4ACMA 2PVRA 2WMQA 2YDJA 3HVCA 3I1AA 5FDPA 5CF5A 2VN9A 2YJRA 4AZTA 3MVJA 4FV3A 3W0SA 3IG7A 4U3YA 4BHNA 4O1OA 1GZNA 2R0IA 4WO5A 5LMAA 4CT1A 2ZVAA 3WF7A 2RG6A 4EHZA 5I0BA 4OTWA 4R5YA 2QQ7A 5JN2A 3U6IA 1XBAA 2W7XA 1J7UA 1J1BA 5CAPA 4ITHA 4AFJA 2C4GA 2WTJA 5M08A 4QP8A 2QOBA 3R7GA 4O7TA 3H9FA 4USFA 3KK9A 1OL6A 4M68A 5IG1A 2PU8A 5KMIA 3PUPA 2XK8A 1CKIA 2EXMA 5CYIA 3ML1A 4ZAUA 4K33A 3OXTA 2WTIA 3WF6A 5AUWA 4EOSA 4I22A 5HZNA 2RL5A 4GVJA 4UWYA 4BYIA 3F88A 2QURA 3D9VA 3VS3A 3ZDUA 2CNUA 3D7TB 4K9YA 2QO2A 3L9MA 3VBYA 3VHEA 4MKCA 5AV4A 5E9EA 3ZRKA 3D4QA 4W8EA 4YZCA 2ZB1A 4L01A 4R7IA 4W4WA 4WRGA 1KWPA 3EQHA 4LGHA 3GU6A 3TCPA 4BTKA 4WIHA 1M14A 4FTJA 2P33A 4PRJA 2QU6A 4FTAA 2C3JA 2J0LA 3PE2A 3TUCA 3IECA 1H28A 1RJBA 2PE0A 3TJDA 3H10A 4XYFA 4B99A 4FL3A 5F94A 4F9WA 4PV0A 4CGAA 2PE1A 2OF2A 2WU6A 2UZUE 4O0XA 3IKAA 3E88A 3MFRA 2XRUA 5C1QB 3ZCLA 3V5JA 4IWDA 2WTCA 3F2RA 3V5QA 2ETMA 4CLJA 2XANA 3PWYA 2CN8A 2C6MA 1UU8A 2VWYA 2W0JA 2QO7A 4QMQA 4Z9LA 5CT0A 2HAKA 2UVYA 5E92A 4CYJA 5AAEA 2R3NA 4BCJA 3COHA 1H26A 1XWSA 3V51A 3BEAA 5AUTA 4U8ZA 1K3AA 5A14A 5BUJA 1CM8A 2J4ZA 5BVWA 2W1HA 1Q62A 1P5EA 3JS2A 4MK0A 4L9IA 3LQ3A 4X3FB 4GSBA 3DNEA 5DHJA 3NGAA 4XMOA 3UODA 1NXKA 3GCSA 2O0UA 4RLLA 4BDBA 3KULA 3GC8A 1OIUA 1JKKA 2XKEA 3R22A 3P9JA 4UWCA 3VUGA 3TZ8A 3BRBA 4AE6A 4GW8A 4MXYA 1LPUA 3OT8A 4GCJA 2RFEA 1YW2A 4I0SA 4AQCA 4XP2A 1YRPA 4TWOA 5HBHA 1K9AA 4MHAA 5AP6A 4UEUA 2CGWA 2XCKA 4IVCA 2R4BA 4DFLA 2BROA 3SLSA 2OG8A 2YITA 4ZY6A 3PPKA 3EKKA 3LCKA 3MPAA 2IPXA 4H1JA 2UW9A 4EOJA 1G8SA 3WZJA 2VO7A 3LQ8A 4JXFA 1BKXA 3HV7A 3GFEA 4KIPA 3OD6X 5HIEA 5H8EA 5HLNA 5AAGA 2QOCA 2GQGA 4O2PA 3LFAA 2C69A 4F9YA 2OI4X 4Z3VA 3QTSA 4XHKB 3R7VA 2QR8A 2QCSA 5FRIA 3FQSA 3GXLA 3BLAA 2A2AA 4W4VA 3DFAA 4DN5A 1TVOA 3WILA 4A9UA 4HPUE 3S95A 1TKIA 3RAWA 2H6DA 3VF8A 1REKA 4D4SA 4NEUA 2WO6A 3G5DA 5BVDA 3PJ1A 1MRUA 1J91A 4MXAA 1W2CA 4G6LA 3E7VA 3TJCA 4QRCA 2QHMA 2PVLA 5ETFA 1OL5A 3DB6A 3NIEA 3UO4A 4P5QA 5HO6A 4O27B 4KAOA 2XNMA 4O0TA 3W1FA 2QOFA 3IW5A 4FNYA 1IEPA 4KRCA 4PUZA 5CASA 4ZMEA 2JITA 3HV3A 4C35A 3CQWA 4YBKA 5AR2A 4FKWA 3JUHA 5EKOA 2CHLA 1BL6A 4NK9A 3QD2B 4RVLA 5B2LA 5JGDA 3HV4A 3ORTA 4IC7A 3ORMA 5DFPA 4MCVA 4JBVA 3KVWA 4RX8A 1XMLA 3THBA 5TOZA 4K18A 4ERKA 4F6UA 4XG8A 1WAKA 5DT4A 3P86A 5GHVA 3G51A 4FV6A 4D9TA 1SNXA 4IWOA 2VTHA 2QG7A 1KUTA 5CEMA 4BDIA 4G17A 3N4TA 2CDZA 3IDCA 2I0VA 4JBOA 4EH3A 5LVPA 3HL7A 4B6LA 4G5PA 4AP7A 5BYZA 3RK7A 3KMWA 3W8QA 4DFZE 4EONA 2UZOA 1XH5A 3TWJA 4FR4A 2VNWA 2YIYA 4O0WA 2JAMA 3DKCA 5E8VA 3DKOA 4AA0A 3ZLSA 2W9ZB 2WMAA 3EQIA 2WMWA 2IZUA 3OHTA 4Z16A 5HBJA 3RNIA 3DY7A 5A6OA 2X6EA 4WRSA 3HV6A 1JPAA 4L7FA 3RPOA 4JG6A 3ZO3A 2VO3A 2R3IA 4YTFA 1ZRZA 4TXCA 4O7YA 2EVAA 3R8MA 2XYNA 4LM5A 2WIHA 5DR9A 2UW0A 4V01A 5A4EA 1YDRE 1IG1A 3KQ7A 5DBXA 3DK7A 4CZUA 2VTIA 4F7JA 3PXKA 2IWIA 3KRXA 2YERA 3TNWA 3W0QA 4AXEA 4K6ZA 5TE0A 1QPEA 5I9XA 2Y9QA 4O4BB 3TMOA 5FTGA 4AN3A 5L8LA 3D5VA 4KIKA 3W2RA 4D28A 2FSOX 3UOHA 5EK7A 3HMOA 3ORIA 4D55A 3LVPA 4OTHA 4M69B 4O0SA 4NIFB 2BR1A 2OU7A 4A9YA 5H2UA 3Q6WA 3LPBA 1YOMA 3D5XA 1MQBA 4TZRA 2BHHA 3IQ7A 1ZOHA 3NW6A 2XP2A 4I0TA 3V6RA 4BCNA 2UUEA 2C0IA 4NYEA 4X0MA 3E3PA 4YC3A 4H58A 1SNUA 3H9RA 2WU7A 2PE2A 3A7JA 1UKIA 3BCEA 4FTMA 4TNDA 5ANGA 3RNYA 5HCYA 1PF8A 5DN3A 3DBQA 3EN6A 3KF4A 3IDBA 4QQTA 3KIOC 3W0PA 4DHFA 3AGMA 2VO6A 5GZ9A 3DBEA 5KZIA 4JG8A 4DAWA 1B6CB 2O2UA 4NM0A 2ACXA 4A9SA 5EYDA 2X0PA 4OBQA 3QWJA 3BIZA 5IMEA 4MYGA 1ZMUA 3TN8A 4C2VA 4KABA 4ZLOA 4F7SA 3W0OA 4E5WA 2YACA 3KXGA 4RQKA 2X39A 5FXRA 5J9ZA 2FH9A 1FVRA 3PLSA 3Q6UA 1PXIA 2YM3A 3L8PA 4RT7A 3P5JC 3QA8A 1YXTA 2BIKB 4TW9A 5CAUA 4L67A 4XG3A 4J97A 3UOLA 2VGOA 1A48A 4EH7A 3H0YA 4USEA 3EN7A 2BIYA 4FSQA 4ASXA 2HIWA 4U43A 4ENYA 5AV3A 4QDEA 3KCFA 3BELA 4D2PA 4F63A 4M7IA 2WAJA 4QMTA 4U6RA 4QNAA 1OGUA 4MX9A 5HU9A 3ANQA 2OIDA 3O7LD 2YJSA 4FK3A 4JG7A 4OUCA 2F7ZE 3TTIA 3VWAA 4AG8A 2PVHA 4E3CA 4XOYA 5LCJA 3MV5A 3EN5A 1U5RA 1OKYA 4A4OA 4FZ7A 4IFCA 1PJKA 3DOGA 4QEBA 3SGCA 5JKGA 2PVKA 4UXQA 4EYMA 1APME 1UNLA 4DG0E 2UW7A 2VX3A 4QQ5A 1OKVA 2C30A 1B38A 3W18A 2GU8A 3QAME 5AUVA 2J5FA 3FSFA 5L2IA 3A99A 3R2YA 3GCQA 3MSSA 3D83A 4EC9A 4RX5A 4EOKA 3CQEA 2BFYA 1DAYA 3LAUA 2WMTA 4G3FA 4BTMA 2QOKA 3EMGA 3F66A 5K0KA 5H9BA 3DQWA 4G3CA 3Q2JA <