2CPKE

Crystal structure of the catalytic subunit of cyclic adenosine monophosphate-dependent protein kinase
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
336
structure length
333
Chain Sequence
VKEFLAKAKEDFLKKWETPSQNTAQLDQFDRIKTLGTGSFGRVMLVKHKESGNHYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMVMEYVAGGEMFSHLRRIGRFEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGFAKRVKGRTWLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFATTDWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEEEIRVINEKCGKEFTEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase(phosphotransferase)
molecule keywords cAMP-DEPENDENT PROTEIN KINASE, CATALYTIC SUBUNIT
publication title Crystal structure of the catalytic subunit of cyclic adenosine monophosphate-dependent protein kinase.
pubmed rcsb
source organism Mus musculus
total genus 102
structure length 333
sequence length 336
ec nomenclature ec 2.7.11.11: cAMP-dependent protein kinase.
pdb deposition date 1992-10-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2cpkE01
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2cpkE02
4PRJA 3TNPC 1H1SA 4MD8E 3R6XA 4OTWA 4AP7A 4BKYA 2C5VA 3RPRA 1CKPA 4WUAA 1KE7A 4LGGA 3PVGA 3DV3A 4XUFA 5AA8A 5L4QA 2XKCA 3FZRA 2WTVA 3QUEA 4A07A 5M44A 1CDKA 3VS1A 4LRMA 4FKQA 3BI6A 4L43A 3RZBA 2W1FA 4B0GA 5M55A 3A60A 5CF4A 4G3GA 4QMUA 4IWOA 4YJUA 2Z7QA 5AP2A 4PNIA 4G3EA 2Y0AA 4AOJA 3U9CA 4PMSA 3ODZX 2C1AA 4ZS0A 3DA6A 2F7EE 1GZNA 3EN7A 1PHKA 3HV3A 4AFEA 1PXNA 4FVQA 5TO8A 4FEVA 5ANEA 5TT7A 3UYTA 2BDFA 4OAVB 2XIYA 3EL7A 1UWHA 3DOGA 3QRJA 4RWLA 4EK6A 2IPXA 3PLSA 3BLHA 3LMHA 4TYHB 3BYVA 3JUHA 3FDNA 4RPVA 4U6RA 3H9RA 5FM3A 4C4GA 2UW5A 4KIKA 2XBAA 3Q5IA 3ZZWA 1P4OA 2B54A 4P5ZA 3HAVA 4FKVA 4WNKA 5E8VA 4EQCA 5GIOE 1ZWSA 2OH0E 1JBPE 4L42A 3S0OA 4D2WA 4QQ5A 3ZM4A 2G2IA 3HEGA 2W1IA 5CVHA 3VUDA 3T3UA 2WELA 4HGLA 4M84A 3D5VA 4AOIA 1V0BA 3I7CA 4FZAB 1YDSE 2NO3A 1QPEA 4GCJA 4EHGA 4EBVA 2C30A 4NT4A 3TZMA 3EIDA 5DGZA 4WG4A 4JAJA 2F57A 2Z7SA 3WE8A 4CRLA 3F3ZA 5DOSA 4AE9A 5FQDC 3HV7A 2BZIB 2YM6A 4FNZA 1WCCA 4GMYA 4RVTA 5KBQA 4YC8A 4D2VA 1G5SA 1G8AA 4L68A 1ZMUA 4Y46A 2V7AA 2UW9A 2YACA 4EH8A 3C4WA 3P4KA 3NYXA 4F6SA 4Y8DA 4AAAA 1LEZA 3ZTXA 2IVSA 4F65A 3E62A 5DPVA 4F0IA 2PWLA 4I23A 4ENXA 1B38A 3R1YA 3RHKA 3GCVA 1XO2B 2XKFA 3FYKX 4FTMA 1BI8A 2OZAA 4V0GB 1SMHA 3QZIA 1Q8TA 4FV2A 5AIKA 4RQKA 2W4OA 2WD1A 1FMOE 3MH1A 4AGDA 2QVSE 2FGIA 2GMXA 3KMMA 3O7LB 3FI3A 4UXQA 4BCQA 5KMKA 2CNUA 2WMSA 4DGOA 5KZ0A 3LXLA 3DJ5A 3KN5A 4ASDA 3F6XA 5F9EA 4PDSA 3QC4A 2R3KA 4YJVA 3BBWA 4IVBA 4KAOA 3VS5A 4YNOA 2J0JA 2QOBA 3FYJX 4RVLA 4EEVA 3ALOA 5H8GA 2CKQA 2YITA 5L2IA 2YJSA 2UZVA 3R1QA 3V5JA 4AU8A 1OZ1A 4M97A 2NNWB 3B8RA 1Q8WA 4DBXA 4I6BA 3RVGA 4TYEA 5DA3A 2VX0A 4X3FC 3DCVA 3TCPA 4IJPA 3LHJA 3OT3A 5BVDA 2B4SB 3IS5A 4BCOA 4DCEA 4EK8A 4QMXA 4YZNA 1OL6A 5EM6A 3GBZA 5IQGA 4USDA 3SRVB 4U9AA 4DAWA 4FEXA 3KEXA 1BL7A 2C6OA 3IKAA 3UBDA 5BX0A 3AC2A 2B7AA 2QQ7A 3DXNA 4RC2A 5AR4A 5AV0A 4BY9E 3VS0A 4ZZMA 5IA2A 2X2MA 4ZJVA 3DNDA 4YZBA 3Q4UA 5HTCA 3HV5A 5CSWA 2WFYA 2X7GA 1R78A 4KABA 4D28A 1O6KA 2O0UA 3FPQA 3L1SA 3MY0A 5HEZA 3NLBA 5KKRB 5I3OA 3QUPA 3BU5A 3P5KA 4TPTA 2W9FB 3KRLA 4M12A 4UN0C 3MFSA 3PSBA 2B9IA 1SNUA 4W4VA 4KKGA 5GNKA 4C3RA 2BZJA 3MJ1A 2PK9A 5HBEA 4X6RA 1K3AA 5HCYA 4GT4A 4IWQA 4PL5A 4OUCA 4I0RA 5ETAA 3VF8A 3EYGA 4FTAA 4JDIA 3UZRA 5H3QA 1O6LA 1XH8A 2QODA 4O27B 4S30A 2BMCA 3EFWA 3KN6A 4U41A 4DN5A 3KCKA 4B8MA 3BV3A 3DB6A 3PDTA 4CMUA 5H8BA 1Q8YA 3ATTA 1MUOA 5TE0A 2I1MA 4MHAA 4DEIA 3WF8A 4IE9A 5EQYA 2BRMA 4TWPA 5LOHA 2UZTA 4KIPA 3ZC6A 5IMXA 3KULB 3D15A 4X0MA 5DRBA 5F1ZA 3TIZA 3MJ2A 3NUPA 4IWDA 3OT8A 4LUDA 5IUGA 5GINE 2ITQA 2BTSA 3ZZEA 1DM2A 2O64A 4QYYA 4X2KA 4AE6A 1UNLA 5A54A 3POOA 3H10A 4RFYA 1APME 1IEPA 2QLQA 3Q9WA 4FKLA 4K8AA 5A6OA 3ACJA 3U6HA 4NYEA 4ZK5A 4CMTA 4FT9A 3QALE 4FT7A 4AUAA 5AV2A 3QTQA 3C5UA 4IB3A 5EFQA 3ZYAA 4DLIA 1MP8A 4GUEA 2BKKA 3MDYA 4QYHA 3ZONA 4BDEA 4E8AA 2BIYA 4L3LA 3RK9A 3LQ3A 2GFSA 3VIDA 3KC3A 5GZAA 3TI1A 5KMJA 2QO2A 3VUGA 4TNDA 4CKIA 4RIOA 3W1FA 1H1QA 4U44A 4ORKA 3LLAA 4M69B 4FTKA 5HKMA 3VS2A 1VJYA 2I6LA 3OWPA 4RSSA 3NMUF 2QHMA 2PULA 3UG2A 1OIYA 5DWRA 4CFMA 1TVOA 4ZY5A 1U5QA 5EI2A 2R3PA 5CANA 3TNIA 1J7IA 3FC1X 3WYXA 1Q8ZA 4F64A 3W2RA 1QPJA 3CGFA 5JH6A 1OBDA 4DYMA 4ZOGA 4BCMA 2XCKA 1PMNA 5I0BA 5CEKA 4BTMA 3LFSA 5AWMA 4KINA 3BHVA 1WBNA 3A7FA 3E93A 3SDJA 3EH9A 3ORTA 5HIDA 5C8MA 5F20A 3PRFA 3QBNA 1YXTA 3VS7A 4CCUA 4EOOA 5LMBA 3MVJA 5AIRA 4BCJA 3R73A 4OTPA 5EOBA 4BCIA 3DT1A 2VO0A 5CSVA 1UNHA 2WNTA 2JFMA 4MYGA 4R5SA 4D4SA 3N4TA 4EJ7A 3RAWA 3A2CA 3A7HA 2C6KA 5HBJA 5ITAA 3PIYA 2C4GA 5F94A 2HY81 4OW8A 5A4EA 4UYAA 1UKIA 3Q5ZA 5D11A 2IVVA 4X3FB 4W8DA 2VX1A 5E8WA 2YZLA 2HCKA 2X4FA 1X8BA 4MEDA 4QYFA 3FJQE 4BIBA 4ERKA 1DI8A 2ITOA 2OKRA 4FKWA 3VW6A 3BRBA 1IAHA 3MFUA 4XG6A 4USEA 2BUJA 2W05A 3LZBA 3FXWA 1JPAA 4J71A 5BMMA 3SC1A 4ZLZA 2XK6A 3MTLA 4HGEA 4YNEA 1CMKE 3ZLSA 2IG7A 2XJ1A 4X6QC 3MB7A 4OBQA 4CNHA 4N0SA 4PV0A 2JFLA 4J53A 2WMXA 3S4QA 4C4IA 3PFQA 2R3NA 3CQWA 5GJFA 3UO6A 2Y6MA 2I7QA 2QKRA 4IWPA 3TXOA 4O2PA 3OXIA 4PUZA 4AZWA 3DLSA 2C5XA 4GYIA 3ZLYA 5CAQA 5AV1A 3LFCA 2VTPA 3R7IA 3R7EA 3PWDA 1JLUE 3MPTA 4PP7A 3RNYA 4ZZNA 1KUTA 1YHWA 2EXCX 1CTPE 3KRWA 5HVYA 3LFAA 2PE2A 3NW7A 2W1GA 4YTFA 1NVQA 4DTBA 4IIRA 1ERKA 2GDOA 3Q32A 3GCSA 3HKOA 3KRRA 5CI7A 2UZLA 2W5AA 3MPMA 4G6NA 2WTDA 3SG8A 5HE2A 4C34A 5HLNA 2GQRA 1TKIA 3HMIA 2OXYA 2QOOA 4ZJIA 1XWSA 2P3GX 3P78A 5HTIA 4YLKA 3LKMA 3Q4TA 3E7OA 2QR8A 2B55A 4F0GA 4K11A 1ZARA 3U54A 4RZWA 3I6UA 3V5LA 4AN2A 2YAAA 5E9EA 2C69A 1XBBA 4YTCA 1ZY4A 4FMQA 4Z9LA 3D5XA 5I9YA 3PE2A 3E3BX 4E4MA 2J4ZA 2A4LA 4GVJA 3RWPA 4Y85A 5AX3A 4BGHA 1OL5A 4ALUA 5BYYA 1TQMA 4ERWA 2A19B 2R3RA 3C7QA 3KXXA 3I7BA 4FKJA 2UVZA 4JXFA 4YHJA 1JKLA 3QX2A 2WMQA 2IO6A 3QTWA 4J8MA 2WKMA 3UIXA 2BAKA 2PVLA 2XNGA 3CPBA 4J98A 4RBLA 3V8WA 4BCKA 3PVBA 4YPSA 3MY5A 5L8LA 3CGOA 3QGYA 5DNRA 2G2FA 2PU8A 2V5QA 3VS4A 3R00A 3H9FA 4J52A 4EH2A 5EKOA 3AMYA 4BIEA 4ONAA 2BAJA 4BF2A 4RIWB 4LI5A 1ZYSA 3QZGA 3Q96A 2XMYA 3ZFYA 4QQTA 4ZSJA 4UMRA 3KGAA 5EDPA 1NA7A 3LFFA 3BGPA 5FP6A 4JBOA 3BCEA 5ICPA 1PW2A 5AMNA 4FTTA 4X21A 3UIBA 4AGCA 4DCAA 3PP0A 2ITWA 5K0XA 1OGUA 4APCA 3LFBA 3PXKA 4S31A 1RJBA 2A1AB 5H2UA 1B39A 4BBFA 3WIKA 3PXFA 5CAPA 3EQPA 3GNIB 3NW5A 4FSUA 4GU6A 4JBPA 3G90X 3LLTA 4G9RA 4WO5A 4CQGA 4NFNA 3Q53A 3U4WA 3A99A 3W8LA 2W1ZA 2ONLC 1LP4A 2VD5A 3T3VA 5CAUA 3LCOA 5L2WA 3MA6A 4A9UA 3DAKA 4GJ3A 2I0VA 3PY1A 3UO5A 4UMTA 4YJTA 2P0CA 2CGVA 2YM3A 4UMPA 2OSCA 4F70A 3FMJA 4PNKA 1W0XC 4DG0E 4P5QA 2PHKA 4BFMA 4PP9A 4L3PA 3OBGA 4XG8A 4M3QA 5EW9A 3VN9A 1F3MC 4FV7A 3RINA 4DBNA 5IQEA 4BZNA 3OXTA 2YDJA 3MFTA 4QRCA 3OW4A 4NJDA 1H07A 3FKNA 1YI3A 5HNIX 5FXQA 3UC3A 3CEKA 4BHZA 4WBOA 3M2WA 1M2QA 4AX8A 3PZHA 5KE0A 4JVGA 4FSYA 2YM8A 1PRYA 2X2LA 1OB3A 1T46A 3I4BA 4RLLA 4YGAA 3QLFA 3NYNA 4UALA 3ORZA 4U79A 2ITVA 3BGQA 3D5UA 3FZOA 4EK4A 3VHEA 5HIEA 4K2RA 4MNEB 5J79A 3I1AA 3IO7A 4D1XA 4QYGA 3UMXA 5JGAA 5IQFA 3DKCA 4C02A 5A4LA 3KFAA 4I24A 4AN3A 2J5EA 3UVQA 2GNLA 3V8TA 4K77A 3DTCA 4XRJA 2W5HA 3G6GA 4NTTA 5BVWA 4BDKA 5DBXA 2Z8CA 3CQEA 2G9XA 3R71A 5E92A 5A4CA 3V01A 4AW2A 3MVMA 2X0GA 3PXZA 3PPZA 4RWJA 5JGBA 4FV6A 2B53A 4ZSAA 1R0PA 4RFMA 3GC0A 1F0QA 5A4QA 2VUWA 3ZXZA 5LQFA 3MBLA 1KOAA 2WGJA 3HZTA 4M66A 4HGTA 5EG3A 3OCTA 1URWA 1GIHA 1QPDA 2HZ0A 3KF4A 4KB8A 4Q5HA 1ZAOA 5CVFA 5EOLA 3W16A 3C5IA 4NM5A 4YLLA 4YR8A 4M0ZA 4EOIA 2PUIA 5EYMA 1WBTA 1WFCA 1YRPA 3G0FA 3SXRA 2XS0A 3UNJA 2I40A 4EKLA 3ZOSA 5CAOA 3KXMA 4FL2A 2C3KA 3QYWA 5M06A 2PMIA 3CC6A 2P55A 4G3DA 4HOKA 3A4OX 4FI1A 1IASA 2JD5A 2WTKB 3SLSA 5T3QA 1OVEA 3VAPA 2C1BA 2W4KA 4FSWA 2WTCA 4TWCA 5LVNA 5CYIA 2ITNA 4TXCA 2CPKE 4TYHA 2C68A 4ZTQA 3K2LA 5K5NA 4I4EA 3IW4A 5EKNA 5AP1A 5JMSA 4DH7A 4W9XA 3KXGA 3VQHA 2YIWA 3F5PA 2Z7LA 4BR3A 2W1CA 3ZLXA 1YOLA 1CKJA 2VTIA 3N51A 4XH6A 4FYOA 4CLJA 2QOCA 4QMWA 4NWMA 5IF1A 2BKZA 4DH5A 5J7HA 4BYIA 5IU2A 5EDRA 3OOGA 2VWBA 2W4JA 3OOMA 1Q4LA 3DAJA 2J7TA 3BPRA 5JRQA 1NW1A 3ITZA 5LWMA 3CXWA 5E8YA 5L2TA 2YIRA 3QRTA 4FKUA 4QMVA 5L8JA 2XNBA 4OT5A 4II5A 1AD5A 3CD8A 1G3NA 3QKKA 4GFMA 4GKIA 4QMMA 3GEQA 3F5UA 4I3ZA 2ITZA 3H9OA 2XUUA 3IDCA 2X8IA 3W33A 2QOIA 4MNFA 4HPUE 4MXCA 2QLUA 1PXIA 1ZYJA 4C4EA 4D4VA 5CT0A 2ZMCA 2VTQA 3MB6A 4J95A 4X3JA 5EW3A 4FTOA 3UJGA 3WYYA 1PXPA 2IZSA 4I1ZA 4N70A 4DLJA 4X2JA 4YZMA 3Q9XA 3SW4A 3PSCA 4H3BA 3MYGA 3BQRA 3HECA 1FVRA 3QQUA 5HI2A 5IEYA 2WTJA 4FODA 4EZ5A 2C3IB 3F61A 4KA3A 1PXOA 5HG7A 2HZIA 1E9HA 2O65A 4JNWA 4D2PA 2PVYA 4ACHA 3AC8A 3E5AA 3NNUA 3PIXA 4R3PA 4YHTA 2JEDA 4V0GA 4BWPA 5A9UA 3F88A 4I21A 2VNWA 2XIKA 3O7LD 2BTRA 4KNBA 2QONA 1UWJA 4FKSA 3OUNB 3HDMA 2AC3A 4R77A 2W1HA 2GQGA 3HMMA 4KRDA 4UB7A 4TRLA 4YJQA 4L7SA 2CGWA 5FWKK 4PPAA 5DEWA 2NPQA 4FTUA 3EN4A 2PMNX 1QCFA 1UV5A 3WIGA 4UZHA 2ITTA 2BPMA 4JQEA 4YLJA 4ZLOA 3P08A 4RRVA 2ZV9A 1OECA 3QCXA 3NWWA 3HMNA 4JIKA 4IW0A 5GJDA 3ZDIA 4L00A 2WMWA 2GS7A 4GU9A 3W55A 3I79A 1PXJA 2F7ZE 2PVNA 4JLCA 1JAMA 2XK4A 4FKPA 3EQRA 4D1SA 4F7LA 4ZY4A 5BUIA 4U0IA 5TF9A 5L8KA 1GNGA 1U4DA 2GQSA 1GZKA 1OL2A 3QTZA 3PY0A 2WEIA 4P2KA 2WMBA 3SRVA 3V6RA 1H00A 2GU8A 4AZFA 3C9WA 3MW1A 4TYGA 1IA8A 3HMOA 4E73A 3S3IA 4A9RA 5FTOA 3UC4A 3VBYA 4DFUA 2JGZA 2VTAA 4BC6A 4G31A 3Q9YA 4WRGA 4D2TA 3QRIA 3EN5A 5EW8A 3MI9A 1DI9A 3NUUA 2QU6A 5CY3A 5LVMA 3LOKA 3UNZA 3GU8A 2Y8OA 4L53A 3LCSA 4CXAA 1FVVA 5CENA 3UO4A 3NEWA 4BICA 3N4UA 1JOWB 5AR7A 2GTMA 4C36A 4OTRA 3UMWA 3VUMA 3RWQA 5K0KA 2VTTA 4AN9A 2W96B 3ODYX 3PXYA 1WBWA 2YIXA 3BQCA 3GENA 5JRSA 4KD1A 3CQUA 2UUEA 4DEDA 3W18A 4DG2E 3WZEA 3SVVA 4KIOA 4QMTA 2V55A 4CV9A 4NEUA 1WMKA 2X9EA 4DEGA 4QPMA 3VF9A 4A06A 4GK2A 4RX9A 3ORIA 3QCYA 1J1BA 5C01A 3F7WA 4FUYA 3EMGA 3TV6A 5H9BA 1NT2A 4HVIA 3DS6A 3VUKA 4BKJA 4WNOA 3D14A 3JS2A 4BDBA 4HZRA 4O81A 1ZOEA 5AUZA 1IR3A 4LG4A 4RIXB 2RKUA 5K3YA 3R8PA 3ACKA 2J90A 3KULA 4IM2A 5H8EA 4IJ9A 1PKGA 4JJRA 5HO6A 1MRYA 2LAVA 4FTCA 3FWQA 3DDQA 3R01A 2OJJA 4U8ZA 4XV9A 3P86A 3ZRKA 2YIYA 5LXMA 4GV1A 2KTYA 4QP9A 4U97A 4TW9A 3O8UA 3AMAA 4DFBA 3RK5A 4I0TA 3EOCA 5J7BA 3ZUUA 5CF5A 1Y6BA 3Q6WA 4ZTMA 3DY7A 1OL7A 2BRGA 3AD4A 3MIYA 3PJCA 4RMZA 4GYGA 5KKRC 4IX4A 4PMPA 4CVAA 4GT3A 3NAXA 3REPA 4NUSA 3NYVA 2HELA 5IH4A 3HDNA 4R6VA 2WO6A 4M69A 3VUHA 3VBWA 4HVGA 4DT8A 3LJ1A 4AZSA 4ANNA 4EH9A 4U7ZA 2R3FA 5CTPA 3HYHA 4FVPA 3JR1A 3HL7A 1GZOA 2C5YA 4WOVA 5GZ9A 2CSNA 5AUXA 5IDNA 3FC2A 4FOBA 4A7CA 2X39A 3LCKA 3NPCA 4W9WA 4WG3A 3PJ3A 5M4IA 1S9IA 3HNGA 3FI4A 4MWIA 2G1TA 5JK3A 3E8DA 4G2FA 3UPZA 2RGPA 4MXYA 3BEGA 3FMMA 3I0OA 5K5XA 5CQWA 4QMNA 2X4ZA 4OGRA 4F1TA 1LEWA 4FBXA 5HU3A 4Y83A 2PZIA 2E9OA 3Q3BA 3ORNA 4BCHA 3WF5A 3LMIA 4BB4A 1OKZA 4S34A 3MGYA 1Y8YA 3IGOA 2YJRA 3DPKA 3DAEA 4PL4A 2E9VA 4ITIA 3OTVA 4RC3A 2QNJA 4NTSA 3UDBA 3ZXTA 5A46A 5I9ZA 4CGAA 4EQUA 2SRCA 4EOKA 3BEAA 4X3FA 4KBKA 3HA6A 2OIBA 5CLPA 5AR3A 5FG8A 4YBJA 5K9IA 3FEGA 2VTLA 5L2SA 2GNIA 2WTWA 3NNVA 1UVRA 2XJ0A 3KXNA 5EHOA 3ZFMA 5ANGA 3MTFA 4ACDA 3E7VA 2GCDA 2IJMA 2BHHA 4L9IA 4QTAA 4MXZA 2VTMA 1Q24A 4U5JA 4JRVA 4BCGA 4MF0A 3GC8A 4QD6A 4CFNA 2XM9A 4YU2A 3KA0A 4ACCA 4QTEA 1YWNA 3LFNA 4J96A 4W4XA 3UP2A 3V3VA 3ANRA 4O6EA 4EH6A 5BQ0A 1Q8UA 3FQSA 4FKIA 3QX4A 5KUPA 2R3LA 4IB1A 5CF6A 4PDYA 3BHTA 1CKIA 3ZO4A 3BHUA 4WSQA 5HLWA 4FG9A 3EQHA 5B2KA 3NIZA 1UA2A 4AZEA 4ZTSA 5BUJA 4Y5QA 3QQGA 3ZO3A 4YBKA 4FNWA 3K3IA 5IEVA 3IONA 3SW7A 2BR1A 1UNGA 4I4FA 4NCTC 2UZNA 2XRWA 4BDJA 5IA5A 5I9UA 5AUUA 3BYMA 4JAIA 4H39A 1K2PA 2WB8A 5M08A 3VC4A 5CXZA 4YTHA 2VTOA 5HVJA 3ZLWA 4FT3A 4F9AA 3AGMA 5JEBA 2UZDA 2YCRA 2AUHA 3QD0A 4FF8A 1A48A 4GT5A 3TV4A 4ENYA 1XKKA 5L6OA 3FY2A 3JYAA 4XNEA 3UPXA 3DJ7A 4AT3A 4CFFA 5BPYA 4DEAA 2GHLA 1I09A 2UW6A 4L44A 2HWPA 1FINA 2C3JA 1XH7A 4ZSGA 4NFMA 4WD5A 2EXEA 1YHVA 2PY3A 2P2IA 4P90A 1XR1A 4RJ3A 4XEYA 5GHVA 3TWJA 4CSVA 4DC2A 5CSPA 2UW7A 4MD7E 5TR6A 5CEQA 2OICA 4WRSA 1ZMWA 2XNMA 3PRIA 3BELA 4QQJA 3T8OA 5IZFA 3BV2A 4LGHA 2YWPA 3D7ZA 4GL9A 4U40A 3DFCB 5LVPA 3L8PA 1QMZA 2W5BA 3QWJA 3C0IA 3IOPA 4YJPA 3UOLA 5B7VA 3A7GA 5I9VA 5JFXA 5J1VA 1BI7A 3R9OA 5JFVA 2ZB0A 4G9CA 3AMBA 3N4VA 3FLQA 4I5CA 4R1YA 3UP7A 4IQ6A 5CU4A 4XG2A 3TG1A 1YI4A 5CNNA 5AP5A 1UU7A 3RAHA 2RG6A 4O7ZA 2OWBA 3JY9A 4D2RA 4RIWA 3V04A 2PUUA 3IW7A 2XEYA 4CG9A 1H28A 3SOCA 3OW3A 4UWBA 3TV7A 2LGCA 3IOKA 2GS2A 4IFGA 3SXFA 4HYUA 4ZY6A 1K9AA 4FG7A 3KK8A 5B0XA 1V0PA 3JY0A 4MXOA 4E26A 5M53A 4GG7A 2CNQA 1OPLA 4H3QA 3P0MA 4GG5A 4I6QA 2BFXA 4Q9ZA 4CKJA 3FQEA 3GXLA 3RM6A 5ANKA 2QO7A 3NS9A 4DGLC 4DTAA 4O84A 4CFXA 3R63A 3O23A 3FHRA 5HNGA 3QTUA 4IB5A 4YO4A 2J0LA 4M8TA 1JKSA 4QTBA 5CZIA 4E93A 2BIKB 5HBHA 3NUYA 1GIIA 3HLLA 4QT1A 2CJMA 1JSVA 3LXPA 3OWLA 5AP0A 1A06A 3DKOA 3E3PA 3UOHA 4CFUA 4E7WA 4UEUA 1JWHA 2WIPA 4MK0A 5FBNC 2WMVA 4HPTE 4K33A 4BYJA 3MN3A 4JRNA 1YW2A 2QOQA 3ZRLA 3KQ7A 3R1NA 2GHMA 2WMRA 2QI8A 2GFCA 3FKLA 3ORKA 2GHGA 1XH9A 3NUAA 3H3CA 3V8SA 4D9TA 5EHLA 5CSHA 1OPKA 4BBMA 2R3OA 4NU1A 2DWBA 3FLZA 2BRNA 4YSJA 2X6DA 4IBMA 2CMWA 3E88A 4U3YA 4DH1A 2YM4A 1YI6A 2WMUA 2PZ5A 4EH5A 3A8XA 4CG8A 1LPUA 1JKKA 4X7QA 3ZS5A 1KOBA 3GCPA 2GPHA 3QD2B 3KY2A 3ZFXA 4CFWA 2E9PA 5HO7A 4BTFA 5DMZA 5IUIA 2VAGA 3NR9A 4BI1A 4I6FA 4YJOA 4M13A 3AT3A 2RF9A 3BE2A 2WHBA 3V51A 4MNEA 2FYSA 3P9JA 3DDPA 4TWOA 5B2LA 2IN6A 3C13A 3NX8A 3I60A 4FIGA 3PA5A 3QZFA 4MKCA 3CY2A 4BI0A 4V04A 4R7IA 4G17A 3G5DA 3R9RA 5JT2A 1OUYA 2CHLA 1OKYA 2CN8A 1J7UA 4EOMA 4ZP5A 2HK5A 3DLZA 5EHYA 2XF0A 2F2CB 2UZEA 2V22A 4O2ZA 1BKXA 2VRXA 1LR4A 1J1CA 3ZBXA 4Z16A 1UU3A 3TZ9A 1VYWA 2UV2A 2JDSA 2ZYBA 3LVPA 5AP6A 3RKBA 4JOAA 2A27A 1ND4A 5IMEA 2XKDA 3IECA 2JDRA 4RA5A 4E5BA 3WF9A 5LCJA 1YXXA 2B9HA 2WIHA 4KUJA 4PMTA 3PSDA 3L9MA 3ETAA 2C5OA 3LM0A 4QO9A 4QMSA 3VRYA 1Q99A 2EUFB 2E9UA 4C2WA 3D0EA 4O1OA 5ANJA 4BHNA 1Z5MA 2PZPA 1J7LA 3W2SA 4FL1A 5JZNA 2WAJA 2CLQA 3FI2A 2EU9A 5FTGA 5FUTA 4TL0A 1ZZ2A 4FSRA 2BCJA 4U3ZA 5AR8A 4JT3A 4APPA 4EOLA 3UZTA 4R8QA 1H4LA 3C50A 2F9GA 3FZTA 3GQLA 3LFQA 3PPKA 5E7RA 2Y9QA 4CQEA 5BVKA 4GUBA 2XNOA 2XVDA 3MY1A 4IZAA 1WVWA 4S2ZA 3UE4A 5IA0A 1SVHA 4I5PA 4B7TA 2C3LA 4B6LA 3I6WA 4YURA 2GNGA 2FH9A 2V62A 3HUCA 3M1SA 3FLWA 1KE9A 3AC5A 4JDKA 3MH2A 3DBQA 3QA8A 2E2BA 1U59A 4BCNA 3BE9A 4EKKA 1XJDA 5HE0A 1ZYCA 3TT0A 3FSKA 3W2CA 1Q41A 4ZTNA 3VULA 3RPOA 3K3JA 2X8DA 2OF2A 4I5HA 5CXHA 2IVUA 2OK1A 3HP2A 3AC4A 4MX9A 4O96A 4DGMA 2ITUA 4RWIA 4ZAUA 5IH6A 5CEMA 3M42A 4RIYB 4O7YA 1GIJA 2OW3A 3EFJA 5CF8A 4HVSA 2Y4IB 3CPCA 4IX3A 2WOTA 3MPAA 3VVHA 5B2MA 3W32A 4RZVA 2ZV7A 5KHWA 5CNOA 3POZA 5HORA 4NKAA 5JGDA 4EHZA 2QKWB 2WQNA 5J9YA 3T9IA 3CP9A 5BNJA 3TNQB 4CLIA 2ONLA 4MBLA 4W4WA 3L8VA 3VO3A 2ITYA 2JKKA 4JDHA 1NXKA 3VW8A 5IQBA 4C3FA 2WTKC 5I3RA 3EFLA 3FAAA 3MWUA 4D4YA 2HXQA 2VWIA 3NDMA 4UMUA 3OXZA 3EWHA 2OBJA 2BROA 5EI8A 1W84A 2XEZA 4PPBA 2BHEA 4OR5A 3TKIA 3EN9A 5EM5A 2QG5A 3C4ZA 4JS8A 5LVOA 3JVSA 2CN5A 1TQIA 1U54B 3JXWA 5LVLA 4CMOA 4DEBA 2G01A 3LJ0A 1OUKA 3LCDA 3OEZA 3QD3A 4WT6A 3R9DA 5DR9A 5I4NA 3GI3A 4XP3A 2VWXA 4DEEA 1SZMA 5BVEA 1M7NA 3COIA 5J87A 4F63A 5I5ZA 4XCUA 2R7IA 1KV2A 2HENA 3LPBA 3MIAA 5AR2A 3ROCA 4BTKA 2XM8A 5L6WL 3ZO2A 2ZDTA 2HYYA 2F4JA 3EQGA 3IK3A 4LL0A 1KE6A 2C0TA 2CCIA 2RFEA 1ZZLA 3FL5A 4WNPA 3DKFA 3LFEA 4LL5A 3NGAA 1HOWA 5LWNA 2PVRA 5M09A 2XRUA 4HW7A 2OU7A 1R39A 5IQAA 1KWPA 2JDVA 5DR6A 3EKKA 3BYSA 4MBIA 2A2AA 1PYEA 1GAGA 2BZHB 1FMKA 1PJKA 4GFGA 4PTEA 4O82A 2YHVA 3D7TB 1KSWA 2Q0NA 4Q5EA 4JG7A 4FEWA 4FIIA 3ZH8A 4DT9A 5KHXA 3S95A 4D5KA 3IGGA 2J5FA 4YMJA 2WPAA 5KCVA 3FMNA 3O71A 1PMUA 4XOZA 3AD5A 4BCPA 3AD6A 2H96A 3OD6X 5FTQA 1W82A 2WXVA 4KBCA 4AOTA 1RE8A 1UKHA 3MVHA 4CRSA 3AGLA 1DAYA 2PVMA 4NSTA 5AJQA 3OS3A 2R5TA 4TYJA 3HA8A 5HX6A 4RFZA 4U81A 5C27A 2FSTX 3MS9A 2C6IA 4YP8A 1ZMVA 2YDIA 3IW8A 2X9FA 4FSQA 1Q3WA 2AYPA 3FLYA 2JIVA 2XB7A 4QMLA 5HCZA 2HW7A 2C6TA 3EQDA 4O7LA 4I94A 4PTGA 4W8EA 1WBOA 3R9HA 4BL1A 3UQFA 5AR5A 3F2NA 2PZRA 3SAYA 4C4FA 4IHPA 4YPDA 2OJIA 5HLPA 2VZ6A 3G9LX 3PVUA 5HHWA 3UQCA 1XH6A 4IANA 2VWYA 2ESMA 2PVJA 3DK3A 4I92A 2G15A 4X2GA 4P4CA 4MH7A 2PYWA 2O2UA 3Q60A 2A0CX 3CIKA 4ZXTA 5L2QA 3E8CA 3WZJA 4M15A 4V01A 1YXSA 4CYJA 4F4PA 4FIFA 3DK6A 4RIXA 3EQCA 2PUPA 3DNEA 3VBTA 5HG9A 3ZC5A 1XQZA 3UTOA 2FUMA 2VNYA 5D1JA 4QP6A 2Z7RA 4XYFA 2RFDA 3GC7A 3DBEA 2EXMA 4PTCA 4RJ5A 4IC8A 3D5WA 3RK7A 1PXLA 3COMA 4K6ZA 4OBPA 4YC6A 2IW8A 3CR0A 5AUTA 4OT6A 2HAKA 3R1SA 5EH0A 3QQKA 4C57A 4AGWA 3R8MA 1GJOA 5M4UA 4R7BA 4AA5A 2C0IA 3ENHA 1PYXA 2H8HA 4RX8A 4K18A 2VWWA 3NCGA 3LQ8A 3TIYA 4ASXA 3R28A 4CTCA 3QTXA 3R2BA 4FEUA 2VO6A 4FEQA 3LAUA 4FUXA 3RPYA 4BZDA 2FA2A 3BLQA 3AXWA 2W17A 1P14A 2DS1A 2REIA 4TTHB 4W4YA 4IXPA 4J99A 5FEQA 4L3JA 5L6PA 3TN8A 2JKOA 4DH3A 3MA3A 1MRVA 4LGDA 5CT7A 3CJGA 4H1JA 4JQ8A 4L01A 3OWJA 3R7YA 3R83A 4U45A 3KVXA 2NRYA 4R5YA 2X2KA 4UWYA 3EB0A 5D41A 2UVXA 3D9VA 5HD7A 3HRFA 5CS6A 5EM8A 1REJA 3QXPA 4JG8A 4BGQA 3UVRA 4Q2AA 3DTWA 4YO6A 4BDAA 2CLXA 4RWKA 5DT0A 4ANQA 4N4SA 4Z7HA 1M2PA 5M4CA 4FSNA 3IDPA 5E8XA 5FDXA 1E1VA 4R1VA 1VEBA 2JAVA 3R22A 5DH3A 4FV8A 1M17A 5E4HA 4CD0A 3NNXA 3CD3A 3EHAA 4ZSLA 3F3UA 5KMNA 4XLVA 1PXKA 2Q0BA 2VWUA 4PQNA 2BVAA 2UZBA 5F95A 4NW5A 4EOSA 2J51A 3FHIA 2H9VA 1M14A 3HMPA 4DFYA 5E90A 4ANBA 3E64A 1TQPA 4EBWA 3S2PA 4BWXA 2XK8A 2R7BA 1BL6A 4FTIA 3GU7A 4IAKA 4P7EA 4U43A 5ANDA 1H1WA 3PA3A 4F0FA 3C4EA 3EZRA 4FT0A 4KS7A 1A9UA 5DE2A 3TZ7A 4AGUA 4DFNA 3PP1A 3A7JA 3HX4A 4QP7A 2B52A 2J9MA 1OPJA 5E8UA 3OTUA 4H3PA 4C4HA 4PY1A 1REKA 3CTJA 3QFVA 4MQ1A 4C58A 4ITJA 3R30A 5HG8A 2UZWE 4FTNA 4XOYA 4XV1A 3CS9A 4XS2A 3WI6A 5KMOA 1ZYLA 4TZRA 4GFOA 2R3JA 5CEPA 2C47A 4O21A 3FZSA 4HNFA 3R8VA 4FOCA 3KF7A 2VO3A 3FMLA 5AV3A 3GU4A 2J6MA 2X7OA 3OHTA 4G5JA 4USFA 4N57A 3QTSA 4QP4A 3D2KA 4UWCA 2UW0A 3PZEA 3FMHA 3QRKA 4NM0A 5FEDA 4CT2A 3COHA 3BU6A 3C4CA 3QXOA 1ATPE 4ARKA 5JQ8A 1H01A 3OC1A 4JDJA 5HIBA 2F7XE 3GFWA 4E1ZA 3S00A 4KIQA 5BVFA 4EK3A 4EHVA 4V05A 5E91A 4FR4A 2JBPA 1FVTA 4FX3A 3NUSA 1JNKA 5ETCA 3GFEA 4O86A 3VHKA 4I0SA 1GZ8A 1W7HA 2UZUE 2VWZA 4ZIMA 1JSTA 2XYUA 5HZNA 1M52A 2IZRA 4C37A 5E8TA 5J5TA 1ZOHA 3VUTA 1FQ1B 3HV4A 2FSMX 4RLKA 2WEVA 4G1WA 2EWAA 2Y7JA 5CEOA 4FTJA 5IQHA 2J0IA 5CX9A 2R3HA 2ACXA 5EQEA 2PZYA 3FMKA 5CWZA 4E6QA 5AUYA 3A62A 2PTKA 2WQMA 2F2UA 5LJJA 2HZ4A 2XNPA 3FV8A 3CSVA 3OZ6A 4CZYB 3PWYA 2PPQA 4PDOA 3FXXA 4IVCA 1YOMA 3DKGA 4JI9A 1AGWA 2R3IA 4J7BA 4B4LA 2FSLX 4IDTA 1ZLTA 4JR3A 4OTFA 2EB2A 5J8IA 4ZEGA 2C6MA 3VUIA 3W8QA 2J2IB 5LMAA 3B8QA 4QMOA 5DLSA 4Z7GA 4DINA 4Y5HA 5EI6A 3BGZA 5J1WA 3F5GA 3HV6A 3I81A 4LOOA 4YJSA 5IA3A 4XG4A 5FGKA 4EC8A 5BYLA 2WQBA 4DITA 4EUUA 5K4IA 2R4BA 4F09A 2B9JA 5M07A 3BU3A 2C6EA 2R3MA 3SD0A 3PG3A 2BRBA 5EK7A 4ASZA 2BDJA 3ULZA 4F1MA 3KL8A 1WVXA 2RFNA 4IZ7A 3FZPA 3SQQA 3F5XA 3DU8A 4NM7A 2YERA 1BLXA 3AG9A 4H36A 2XK9A 3RZFA 4AFJA 4LFIA 3QQJA 4WA9A 2YCSA 3Q52A 4BI2A 4R78A 1DAWA 4WIHA 4ZTLA 5BUEA 4BTJA 2OIDA 4OTDA 3SGCA 3ZUVA 3CKWA 4G6LA 2YFXA 2X7FA 4HZSA 1H0VA 3T9TA 4BVUA 2OF4A 4DTKA 4JR7A 2VTJA 2ERZE 5LMKC 4FIJA 2ZDUA 4LMNA 4O0WA 2JLDA 4OAUC 5JSMA 4AA4A 4FTQA 5ACKA 4KS8A 3GCQA 2Z02A 2HIWA 3RI1A 4EQMA 4FTLA 1YVJA 3RPVA 3U8WA 1RW8A 4FA2A 4D9UA 4Y72A 2C6DA 4PMMA 3KKVA 4LV8A 3THBA 2ZB1A 5TOZA 2WQOA 3R04A 3DQWA 2JKMA 3OY3A 2CNVA 5KMIA 5A14A 2QR7A 3L8SA 5A6NA 2GNFA 1JVPP 3GCUA 4D4RA 2XK3A 4AT5A 2ITXA 2UVYA 2X81A 1F5QA 2JKQA 4F7JA 2O8YA 5LCKA 3Q4CA 5D7AA 1KE8A 4FV1A 1PMEA 3TUCA 4MTAA 2OG8A 3TUBA 5HESA 3TZ8A 1CSNA 1Z9XA 4BKZA 2WQEA 4UY9A 2AC5A 4FIEA 5ETFA 2ETMA 4NCTA 3EKNA 5CVGA 4QMZA 4EH3A 1H27A 4IC7A 4IAIA 2O5KA 4YSMA 4AG8A 1T45A 5GIPE 1OIQA 4FK3A 4BRXA 5AADA 3O17A 4YZCA 4YHFA 4FGRA 4FT5A 4AQCA 3TJCA 3V5PA 4ACMA 3Q2JA 3SV0A 2BALA 3Q9ZA 3R8UA 4N6ZA 1L3RE 1U46A 1O9UA 3FE3A 3CBLA 3RCDA 2DUVA 4C62A 3ZO1A 3PTGA 3ZSGA 4DFZE 4E6CA 4E4NA 4ZMFA 3DBFA 3L9LA 3CY3A 5GJGA 1OIUA 4GK4A 3K5UA 2PUNA 1H26A 3FL4A 5T6KA 3U6JA 3MH0A 3G51A 4XX9A 1JQHA 3VJOA 4X2FA 3OCGA 5AEPA 4U80A 4HJOA 3LIJA 5F4NA 4WBBB 5IEXA 4ANOA 4O38A 3NIEA 2G2HA 5DEYA 5EQPA 1VR2A 3GQIA 2ZJWA 3ROYA 3WF7A 2GSFA 3FLSA 5HX8A 3G6HA 5HGIA 2XIRA 2VTSA 2JIUA 3OCSA 3GOPA 2WU7A 4KSQA 1OITA 5AV4A 2YEXA 2JDOA 3A7IA 3F3TA 3UYSA 4E5AX 2OH4A 4EK5A 4F7SA 2JITA 3OY1A 1B6CB 4RVKA 4PPCA 4RX7A 3IQ7A 3LQ5A 3BWJA 4EZ3A 4O0VA 1FOTA 3LFDA 4HNIA 4X2NA 3QZHA 2C0OA 5HE1A 4TWNA 1IA9A 2XZSA 4FKGA 3A61A 5I9WA 4KRCA 4BGGA 5DYJA 4F9WA 3H4JA 2V0DA 3ORLA 2YDKA 2YN8A 3ENMA 4MQ2A 3GGFA 2B1PA 4EYMA 1W98A 4BDDA 4F08A 1PMVA 3E8NA 1SYKA 1ZYDA 3QCSA 2HW6A 5D10A 4C8BA 5BVNA 5HD4A 4XV2A 2ITPA 1R0EA 2YABA 4WNMA 4BN1A 1R1WA 5DG5A 4K9YA 3I5NA 3O2MA 3QYZA 3HAMA 2E9NA 4C0TA 2OJ9A 2XH5A 3LM5A 3PJ1A 3VBVA 2W0JA 3A8WA 1E1XA 4RIYA 1WVYA 5CALA 2BDWA 2XNEA 5C8KA 3BHYA 4IMYA 4QNYA 2CKEA 5FDPA 4MD9E 5M57A 3ZU7A 1BMKA 1YWRA 1EH4A 2JAMA 5I9XA 3C1XA 4O0RA 3L8XA 1XH4A 4NM3A 1NVRA 1OM1A 1YDRE 3RHXA 5AAGA 5AP4A 4O22A 5KNJA 2R9SA 5AP3A 3O8TA 4QP1A 3TTJA 4B99A 4IX5A 1FPUA 3W10A 2PE1A 4GS6A 3CLYA 2IVTA 2QOFA 3FZ1A 4AA0A 4AF3A 4CZTA 4OTHA 3ORPA 4AW1A 3MESA 2XA4A 4MF1A 1BYGA 3F82A 3KRJA 4IDVA 1U54A 2FO0A 1H1RA 3V5QA 4EONA 5J5SA 3QHRA 4DGNA 1R3CA 4IB0A 1Y6AA 2CDZA 3I5ZA 2YM7A 4OBOA 3ZCLA 3VRZA 3K5VA 4JQ7A 3ANQA 4NIFB 4QP2A 3OEFX 4M0YA 5M51A 4EOQA 2JC6A 3DZQA 3GB2A 4I93A 3TEIA 3F69A 2KULA 4L46A 2IZTA 2ZVAA 3ZM9A 3ZDUA 4DGGA 2XIZA 4BCFA 4XP2A 1PXMA 2HZNA 3ZMMA 3QHWA 4MCVA 3NVKI 1LUFA 1PY5A 2Y4IC 1JSUA 4QTCA 4CV8A 3R8LA 3RM7A 3EJ1A 5J9ZA 3D7TA 4YJRA 4KWPA 4RC4A 5CU2A 4D0WA 1U5RA 4UYNA 2WMTA 4AW0A 4B9DA 3R7UA 2ZM1A 5AAFA 5CU3A 2QG7A 3QQHA 1MQ4A 4QP8A 2RG5A 2OGVA 3BLRA 4FZDB 4XV3A 2IW9A 1BUHA 2XIXA 1AQ1A 5IA1A 3AQVA 1QPCA 3KVWA 5FD2A 2YISA 1O6YA 4FKOA 3NW6A 4FV5A 2ZV8A 4QQCA 3KMWA 3UIMA 4C61A 4E20A 3EZVA 3ULIA 3PUPA 3C0HA 3RALA 3TUDA 4EOJA 4F9YA 3ORMA 3D4QA 3O50A 5DVRA 5E1SA 4DF3A 5FXSA 2YLFA 3WE4A 5DN3A 5FXRA 4G16A 4L6QA 3R7GA 4XRLA 3GOKA 3ZBFA 3ZSHA 5L3AA 5HE3A 3F2RA 2DYLA 4EC9A 4D58A 4WHZA 3QCQA 1WAKA 3ALNA 3G15A 3WOWA 1I44A 3HGKA 3R9NA 5AP7A 4BBEA 5A4TA 1GY3A 3OCBA 2UW4A 4FC0A 4A4OA 3UODA 3P7AA 4S32A 4C38A 2X6EA 3SXSA 4ZLYA 4ANSA 1WZYA 3G9NA 5DIAA 4BWKA 4QMQA 2PVHA 4GIHA 5ACBC 5AX9A 3H0ZA 3W2OA 4G34A 4OTQA 3ZEWA 4L52A 3NVMB 2H34A 2XBJA 3R2YA 4MWHA 3BWFA 3U6IA 3HUBA 5A3XA 4LOQA 5IA4A 3SOAA 4XMOA 4YC3A 3VBXA 2ZOQA 3II5A 1SVGA 1Y91A 4FYNA 2QCSA 3K54A 3GP0A 4O0TA 1Z57A 3Q6UA 4XG3A 2VO7A 3JPVA 2RL5A 4G3CA 4I5MA 2CKOA 4JL9A 3L9PA 4FE2A 3LE6A 3NUNA 5AAEA 4L8MA 4FL3A 5FEEA 4LM5A 4A9YA 5HQ0A 1M7QA 2QHNA 4XG7A 2HY0A 4IZ5A 4KIKB 5DI1A 5C26A 2Y6OA 2IZUA 1QL6A 2XP2A 1XH5A 4IM3A 1IRKA 4DFLA 5DT4A 3CE3A 2OI4X 4ITHA 3RMFA 2FB8A 3A4PA 2X1NA 3TDVA 1V0OA 2H6DA 4TY1A 3VS6A 4XBRA 3UOKA 2QO9A 3ORXA 1NY3A 5C4LA 3SHEA 4EOPA 4UX9A 3B2WA 4OLIA 4R3RA 1OKVA 1M2RA 3BHHA 3HRBA 5KMLA 3U55A 4RJ8A 4O7VA 4C3PA 1H08A 1SM2A 2WMAA 3DXPA 4IM0A 4O7WA 5AUWA 4RVMA 3WBLA 3PA4A 4IZYA 3AC1A 3GU6A 5T68A 1Q3DA 3PVWA 1OKWA 2RIOA 4HYSA 3OG7A 2Z60A 3COKA 5JFWA 1J91A 2XKEA 3WZDA 3RAKA 3UOJA 3JVRA 2C5NA 3LXKA 2YZAA 3PG1A 1YHSA 3OWKA 4HCTA 3ZSIA 5G6VA 2UW3A 4AW5A 3TM0A 3KK9A 4A4XA 4ZTRA 4ZMEA 2OZAB 2VN9A 3N9XA 3MSSA 3IW6A 3DK7A 1P4FA 4DHFA 2BILB 3RBWA 4GRBA 4IADA 5HCXA 1P5EA 4EJNA 4TYIA 3ZRMA 3EQIA 3AT2A 2JIIA 3KREA 3UIUA 2QU5A 3GUBA 4FSTA 4EL9A 2HOGA 3RTPA 3ELJA 4F7NA 2OJFE 4LMUA 4FV0A 4FZ7A 4GKHA 4O83A 2BZKB 4LOPA 4HCUA 5DRDA 4A9TA 3PXRA 4G3FA 3D83A 4H58A 5E8ZA 1YDTE 1YQJA 3D94A 3F3WA 4MXAA 4L7FA 3DFAA 4FSMA 3RP9A 3VQUA 4MBJA 5KZIA 5D9HA 4O0SA 3WF6A 1SNXA 3F3VA 4HVDA 3OFMA 3FPMA 3GT8A 4BDHA 2HXLA 4D0XA 5IQDA 4M67A 2J50A 1OI9A 1XBAA 5ETIA 4ZZOA 2W9ZB 3F66A 4PL3A 3KMUA 4FTRA 3U4UA 4JX7A 4HYIA 4I22A 2R0IA 3QTRA 5DFPA 3FXZA 4FGBA 3V5TA 3VWAA 3F9NA 5IKWA 4C35A 5HU9A 4PF4A 5JFSA 4IFCA 4NH1A 5AM7A 4A4LA 4F9CA 3QF9A 3LW0A 4EI4A 2PVKA 1FGIA 3O51A 4XBUA 2O63A 1ZOGA 2HWOA 2W7XA 2XNNA 2W1EA 3U87A 3ATSA 4WUNA 2UZOA 3R21A 4ID7A 4ANLA 4F9BA 3W2PA 4LQMA 3FUPA 4K1BA 2XCHA 4EH4A 2J0KA 3PIZA 4XLIA 4C33A 3OMVA 4IACA 4LRKA 4EYJA 4O0XA 2YCQA 3Q04A 5CU6A 2W99B 4DG3E 4FK6A 4EWHA 4GW8A 4LUEA 3QLGA 5J95A 2NRUA 3TTIA 4EWQA 4O7RA 5G1XA 4C2VA 1S9JA 2O3PA 3F7ZA 5IPJA 4RG0A 4J8NA 4Y95A 4ZTHA 5JZJA 4B8LA 5IG1A 1FGKA 5J9LA 3CTHA 5JN2A 4QYEA 3BBTB 5KO1A 1VZOA 1IAJA 4UMQA 4E4LA 4TT7A 5IISA 2P2HA 4IH8A 4OTGA 2FVDA 4L67A 3QAME 1H8FA 1MRUA 2UW8A 4ZSEA 5IDPA 5EM7A 3TACA 5EYCA 3UVPA 4CKRA 2Z2WA 5CQUA 3FBVA 3KCFA 5AUVA 4AACA 4D55A 3ZEPA 2OXXA 3G2FA 1G8SA 2YWVA 2W1DA 1P2AA 3NRMA 3NZ0A 1URCA 2RSVA 4RA4A 4QTDA 2QOLA 3I0QA 3R02A 3QA0A 3DB8A 3AOXA 3EFKA 4IAFA 4IAZA 4C4JA 4NZWB 3FI8A 1H25A 4O0YA 3W2QA 4EORA 3ZHPC 4DE4A 3GU5A 4JIAA 5LARA 3LMGA 4AT4A 4ALWA 4J1RA 4AZVA 4IX6A 1Y57A 5D7VA 3QL8A 2PMLX 2QOKA 4KBAA 4M14A 3QGWA 1V1KA 2NP8A 3E87A 1WBVA 2YLEA 2Y4PA 4Q9SA 3EN6A 2GNJA 4UZDA 3TNHA 3QWKA 4K0YA 5E1EA 3RAIA 3QU0A 3GVUA 3FMDA 2PE0A 4O6LA 4WG5A 4EHEA 3AC3A 4E5WA 4FNYA 3DBDA 3CTQA 4OTIA 5E8SA 4RJ4A 4CEGA 2B0QA 4R7HA 4G6OA 3RJCA 3KRXA 2X8EA 2YA9A 4O7SA 5FM2A 3WILA 3G33A 1J3HA 4H1MA 3FLNC 3M11A 4QOXA 4EH7A 3FY0A 2I0EA 3H0YA 2C6LA 3P7BA 3SG9A 4E3CA 1H1PA 3G0EA 4ZS4A 5BYZA 3MFRA 4GIIA 1YOJA 4ZJJA 3EQBA 4G5PA 3FQHA 4HGSA 3KB7A 3DBCA 3LJ2A 3R0TA 3VNTA 2EB3A 1Y8GA 2V7OA 3PYYA 1Q61A 4PX6A 3O0GA 4JBVA 5M56A 3UG1A 1YKRA 3QKMA 2XJ2A 4KKEA 2Q83A 4N6YA 5HVKA 3QC9A 4H05A 2GS6A 2CKPA 4JG6A 4J97A 4E4XA 4DA5A 5HO8A 3V5WA 3QD4A 3PXQA 2GNHA 4LV5A 3MV5A 2WZJA 5HICA 2OFUA 5M4FA 4BDGA 2IW6A 2VU3A 4CYIA 4LYNA 3E92A 2OO8X 1W8CA 4AZTA 4BDFA 5IUHA 1YXVA 2QD9A 2VGPA 4BDCA 1W83A 5AM6A 3R7VA 4GJ2A 4NW6A 3DJ6A 4FV4A 4R3CA 3C0GA 3SKCA 3CJFA 3VS3A 2P4IA 5K4JA 4EUTA 3C4XA 2OIQA 4RX5A 3U51A 1ZXEA 4KKHA 1H24A 2ZMDA 2PMOX 2VTHA 2YIQA 4U42A 2VTNA 3UZPA 3D2IA 4MAOA 4QNAA 1SVEA 2VX3A 4GEOA 4A9SA 3IG7A 1IG1A 4FVRA 2I0HA 4I6HA 5ANOA 3R8ZA 1VYZA 3BX5A 4IAAA 3KXZA 3NCZA 4L45A 4EZ7A 3IW5A 4GVAA 2OXDA 2VWVA 3E8EA 3PY3A 1L8TA 5C8NA 3RCJA 2WOUA 2W06A 3CKXA 4O0UA 3PLAE 4CTBA 3OROA 1H0WA 4QPAA 1YWVA 3OUKA 4WKQA 4NKSA 4FICA 2CGUA 4BZOA 5JKGA 3WZUA 3IDBA 4CFVA 2GTNA 4RJ7A 1RDQE 4KSPA 4M68A 3CCNA 5CU0A 3P23A 1ZRZA 2BAQA 2YCFA 4DH8A 1ZY5A 2J0MB 5EYKA 3Q2MA 3HVCA 4YUQA 5HG5A 4FZFB 4FKRA 3DGKA 5CI6A 1PKDA 4AXAA 4DFXE 4Z3VA 4XG9A 5FRIA 4TN6A 1OBGA 1Q97A 4JX3A 1OIRA 3H30A 3QQFA 4HYHA 2EVAA 5EDQA 3PJ8A 1XBCA 2OJGA 3ET7A 2ERKA 2RFSA 3ZUTA 2BFYA 1CM8A 4YTIA 2WTIA 3C4FA 4GK3A 3QTIA 5EYDA 2VGOA 3BYUA 4FSZA 3R7OA 5HOAA 2OFVA 3IPHA 2CCHA 4F1OA 3NAYA 5C4KA 1UU8A 3O96A 2F49A 4PDPA 4O7TA 4Y73A 1STCE 2OZOA 3TJDA 3PE1A 4WSYA 3U9NA 3L9NA 4QMPA 3RNIA 1KV1A 4FIHA 3VBQA 4Z55A 3OP5A 4NK9A 3QUDA 5BVOA 2R64A 5BMSA 3MVLA 2XYNA 4IVAA 4FNXA 4GH2A 4XP0A 5FBOA 4E6AA 3DZOA 5IQCA 4D1ZA 5JQ5A 4RQVA 3WARA 2WU6A 1JKTA 1OMWA 1RQQA 2XK7A 5C1QB 2PSQA 2DQ7X 3EL8A 1YXUA 1BX6A 1OL1A 2ETKA 2R0UA 3FKOA 3FSFA 5DR2A 3PPJA 5KBRA 3BYOA 4RGJA 4IAYA 3WZKA 2ETRA 4UBAA 4RT7A 3RGFA 4UV0A 4AS0A 2OLCA 1WBPA 4BDIA 4FKTA 3DXQA 4QP3A 4FV3A 3LXNA 4FG8A 4O91A 4YJNA 4ASEA 4NL0A 3Q4ZA 3LCTA 4D2SA 4LRJA 5CSXA 4I41A 3S1HA 3O8PA 2R3GA 4FZ6A 2VTRA 5D12A 3TNWA 2YM5A 3PJ2A 4IVDA 3QKLA 5KX8A 3QQLA 4TNBA 1KE5A 1GOLA 2CGXA 5CZHA 3RPSA 5IQIA 2ZAZA 1XHAA 3HRCA 4UXLA 4CZUA 1FBNA 3UQGA 3F2AA 3GC9A 3ID6C 4QMYA 4C7TA 2PL0A 3ERKA 3MH3A 2YAKA 4HCVA 4F6WA 2I0YA 2ZM4A 3QRUA 5FP5A 4F6UA 4I20A 5LMKA 3UGCA 3SA0A 3BZ3A 3NUXA 2FSOX 2QURA 3BKBA 2BRHA 4TKSA 4RJ6A 3NYOA 3P7CA 3HP5A 4C59A 5DT3A 2P33A 3KXHA 2QOHA 4AWIA 3TKUA 3E63A 3FMEA 4M7IA 5CAVA 4MXXA 2VV9A 4S33A 4XHKB 2R3QA 3TDWA 1DS5A 3NSZA 5TKDA 3BIZA 4BIDA 3OVVA 4CT1A 4NIFA 4NJ3A 3AT4A 4DEHA 2IWIA 3P1AA 5CASA 4D5HA 1NVSA 2QC6A 3SX9A 3B2TA 3EYHA 5C03A 4O1PA 4IEBA 4CCBA 4GSBA 5ANIA 4F99A 2JBOA 5AA9A 4XJ0A 4MVFA 3TL8A 3P79A 5IH5A 1HCKA 4FV9A 1HCLA 1Q62A 1PF8A 3KU2A 1Q5KA 2R2PA 4O7NA 3C51A 5FLFA 4PWNA 4YZ9A 3UNKA 5CEIA 3TKHA 4E6DA 5KMMA 1WBSA 5DHJA 2ZV2A 4QPSA 1MQBA 4HVHA 3EQFA 2ZM3A 2B9FA 3OF0A 4ACGA 5AFVA 4ANMA 2JDTA 3DQXA 5C9CA 3NNWA 3OBJA 4YZDA 5GZ8A 5HTBA 5HNBA 1UU9A 4JBQA 4ALVA 3V6SA 2PVFA 3VJNA
chains in the Genus database with same CATH superfamily
4PRJA 3TNPC 1H1SA 4MD8E 3R6XA 4OTWA 4AP7A 4BKYA 2C5VA 3RPRA 1CKPA 4WUAA 1KE7A 4LGGA 3PVGA 3DV3A 4XUFA 5AA8A 5L4QA 2XKCA 3FZRA 2WTVA 3QUEA 4A07A 5M44A 1CDKA 3VS1A 4LRMA 4FKQA 3BI6A 4L43A 3RZBA 2W1FA 4B0GA 5M55A 3A60A 5CF4A 4G3GA 4QMUA 4IWOA 4YJUA 2Z7QA 5AP2A 4PNIA 4G3EA 2Y0AA 4AOJA 3U9CA 4PMSA 3ODZX 2C1AA 4ZS0A 3DA6A 2F7EE 1GZNA 3EN7A 1PHKA 3HV3A 4AFEA 1PXNA 4FVQA 5TO8A 4FEVA 5ANEA 5TT7A 3UYTA 2BDFA 4OAVB 2XIYA 3EL7A 1UWHA 3DOGA 3QRJA 4RWLA 4EK6A 2IPXA 3PLSA 3BLHA 3LMHA 4TYHB 3BYVA 3JUHA 3FDNA 4RPVA 4U6RA 3H9RA 5FM3A 4C4GA 2UW5A 4KIKA 2XBAA 3Q5IA 3ZZWA 1P4OA 2B54A 4P5ZA 3HAVA 4FKVA 4WNKA 5E8VA 4EQCA 5GIOE 1ZWSA 2OH0E 1JBPE 4L42A 3S0OA 4D2WA 4QQ5A 3ZM4A 2G2IA 3HEGA 2W1IA 5CVHA 3VUDA 3T3UA 2WELA 4HGLA 4M84A 3D5VA 4AOIA 1V0BA 3I7CA 4FZAB 1YDSE 2NO3A 1QPEA 4GCJA 4EHGA 4EBVA 2C30A 4NT4A 3TZMA 1G8JA 3EIDA 5DGZA 4WG4A 4JAJA 2F57A 2Z7SA 3WE8A 4CRLA 3F3ZA 5DOSA 4AE9A 5FQDC 1W2DA 3HV7A 2BZIB 2YM6A 4FNZA 1WCCA 4GMYA 4RVTA 5KBQA 4YC8A 4D2VA 1G5SA 1G8AA 4L68A 1ZMUA 4Y46A 2V7AA 2UW9A 2YACA 4EH8A 3C4WA 3P4KA 3NYXA 4F6SA 4Y8DA 4AAAA 1LEZA 3ZTXA 2IVSA 4F65A 3E62A 5DPVA 4F0IA 2PWLA 4I23A 4ENXA 1B38A 3R1YA 3RHKA 3GCVA 1XO2B 2XKFA 3FYKX 4FTMA 1BI8A 2OZAA 4V0GB 1SMHA 3QZIA 1Q8TA 4FV2A 5AIKA 4RQKA 2W4OA 2WD1A 1FMOE 3MH1A 4AGDA 2QVSE 2FGIA 2GMXA 3KMMA 3O7LB 3FI3A 4UXQA 4BCQA 5KMKA 2CNUA 2WMSA 4DGOA 5KZ0A 3LXLA 3DJ5A 3KN5A 4ASDA 3F6XA 5F9EA 4PDSA 3QC4A 2R3KA 4YJVA 3AKLA 3BBWA 4IVBA 4KAOA 3VS5A 4YNOA 2J0JA 2QOBA 3FYJX 4RVLA 4EEVA 3ALOA 5H8GA 3P5JC 2CKQA 2YITA 5L2IA 2YJSA 2UZVA 3R1QA 3V5JA 4AU8A 1OZ1A 4M97A 2NNWB 3B8RA 1Q8WA 4DBXA 4I6BA 3RVGA 4TYEA 5DA3A 2VX0A 4X3FC 4QEBA 3DCVA 3TCPA 4IJPA 3LHJA 3OT3A 5BVDA 2B4SB 3IS5A 4BCOA 4DCEA 4EK8A 4QMXA 4YZNA 1OL6A 5EM6A 3GBZA 5IQGA 4USDA 3SRVB 4U9AA 4DAWA 4FEXA 3KEXA 1BL7A 2C6OA 3IKAA 3UBDA 5BX0A 3AC2A 2B7AA 4DDIA 2QQ7A 3DXNA 4RC2A 5AR4A 5AV0A 4BY9E 3VS0A 4ZZMA 5IA2A 2X2MA 4ZJVA 3DNDA 4YZBA 3Q4UA 5HTCA 2XAOA 3HV5A 5CSWA 2WFYA 2X7GA 1R78A 4KABA 4D28A 1O6KA 2O0UA 3FPQA 3L1SA 3MY0A 5HEZA 3NLBA 5KKRB 5I3OA 3QUPA 3BU5A 3P5KA 4TPTA 2W9FB 3KRLA 4M12A 4UN0C 3MFSA 3PSBA 2B9IA 1SNUA 4W4VA 4KKGA 5GNKA 4C3RA 2BZJA 3MJ1A 2PK9A 5HBEA 4X6RA 1K3AA 5HCYA 4GT4A 4IWQA 4PL5A 4OUCA 4I0RA 5ETAA 3VF8A 3EYGA 4FTAA 4JDIA 4MUQA 3UZRA 5H3QA 1O6LA 1XH8A 2QODA 4O27B 4S30A 2BMCA 3EFWA 3KN6A 4U41A 4DN5A 3KCKA 4B8MA 1W2FA 3BV3A 3DB6A 3PDTA 4CMUA 5H8BA 1Q8YA 3ATTA 1MUOA 5TE0A 2I1MA 4MHAA 4DEIA 3WF8A 4IE9A 5EQYA 2BRMA 3ML1A 4TWPA 5LOHA 2UZTA 4KIPA 3ZC6A 5IMXA 3KULB 3D15A 4X0MA 5DRBA 5F1ZA 3TIZA 3MJ2A 3NUPA 4IWDA 3OT8A 4LUDA 5IUGA 5GINE 2ITQA 2BTSA 3ZZEA 1DM2A 2O64A 4QYYA 4X2KA 4AE6A 1UNLA 5A54A 3POOA 3H10A 4RFYA 1APME 1IEPA 2QLQA 3Q9WA 4FKLA 4K8AA 5A6OA 3ACJA 3U6HA 4NYEA 4ZK5A 4CMTA 4FT9A 3QALE 4FT7A 4AUAA 5AV2A 3QTQA 3C5UA 4IB3A 5EFQA 3ZYAA 4DLIA 1MP8A 4GUEA 2BKKA 3MDYA 4QYHA 3ZONA 4BDEA 4E8AA 2BIYA 4L3LA 3RK9A 3LQ3A 2GFSA 3VIDA 3KC3A 5GZAA 3TI1A 5KMJA 2QO2A 3VUGA 4TNDA 4CKIA 4RIOA 3W1FA 1H1QA 4U44A 4ORKA 3LLAA 4M69B 4FTKA 5HKMA 3VS2A 1VJYA 2I6LA 3OWPA 4RSSA 3NMUF 2QHMA 2PULA 3UG2A 1OIYA 5DWRA 4CFMA 1TVOA 4ZY5A 1U5QA 5EI2A 2R3PA 5CANA 3TNIA 1J7IA 3FC1X 3WYXA 1Q8ZA 4F64A 3W2RA 1QPJA 3CGFA 5JH6A 1OBDA 4DYMA 4ZOGA 4BCMA 2XCKA 1PMNA 5I0BA 5CEKA 4BTMA 3LFSA 5AWMA 4KINA 3BHVA 1WBNA 3A7FA 3E93A 3SDJA 3EH9A 3ORTA 5HIDA 5C8MA 5F20A 3PRFA 3QBNA 1YXTA 3VS7A 4CCUA 4EOOA 5LMBA 3MVJA 5AIRA 4BCJA 3R73A 4OTPA 5EOBA 4BCIA 3DT1A 2VO0A 5CSVA 1UNHA 2WNTA 2JFMA 4MYGA 4R5SA 4D4SA 3N4TA 4EJ7A 3RAWA 3A2CA 3A7HA 2C6KA 5HBJA 5ITAA 3PIYA 4BJJB 2C4GA 5F94A 2HY81 4OW8A 5A4EA 4UYAA 1UKIA 3Q5ZA 5D11A 2IVVA 4X3FB 4W8DA 2VX1A 5E8WA 2YZLA 2HCKA 2X4FA 1X8BA 4MEDA 4QYFA 3FJQE 4BIBA 4ERKA 1DI8A 2ITOA 2OKRA 4FKWA 3VW6A 3BRBA 1IAHA 3MFUA 4XG6A 4USEA 2BUJA 2W05A 3LZBA 3FXWA 1JPAA 4J71A 5BMMA 3SC1A 4ZLZA 2XK6A 3MTLA 4HGEA 4YNEA 1CMKE 3ZLSA 2IG7A 2XJ1A 4X6QC 3MB7A 4OBQA 4CNHA 4N0SA 4PV0A 2JFLA 4J53A 2WMXA 3S4QA 4C4IA 3PFQA 2R3NA 3CQWA 5GJFA 3UO6A 2Y6MA 2I7QA 2QKRA 4IWPA 3TXOA 4O2PA 1ST4A 3OXIA 4PUZA 4AZWA 3DLSA 2C5XA 4GYIA 3ZLYA 5CAQA 5AV1A 3LFCA 2VTPA 3R7IA 3R7EA 3PWDA 1JLUE 3MPTA 4PP7A 3RNYA 4ZZNA 1KUTA 1YHWA 2EXCX 1CTPE 3KRWA 5HVYA 3LFAA 2PE2A 3NW7A 2W1GA 4YTFA 1NVQA 4DTBA 4IIRA 1ERKA 2GDOA 3Q32A 3GCSA 3HKOA 3KRRA 5CI7A 2UZLA 2W5AA 3MPMA 4G6NA 2WTDA 3SG8A 5HE2A 4C34A 5HLNA 2GQRA 1TKIA 3HMIA 2OXYA 2QOOA 4ZJIA 1XWSA 2P3GX 3P78A 5HTIA 4YLKA 3LKMA 3Q4TA 3E7OA 2QR8A 2B55A 4F0GA 4K11A 1ZARA 3U54A 4RZWA 3I6UA 3V5LA 4AN2A 2YAAA 5E9EA 2C69A 1XBBA 4YTCA 1ZY4A 4FMQA 4Z9LA 3D5XA 5I9YA 3PE2A 3E3BX 4E4MA 2J4ZA 2A4LA 4GVJA 3RWPA 4Y85A 5AX3A 4BGHA 1OL5A 4ALUA 5BYYA 1TQMA 4ERWA 2A19B 2R3RA 3C7QA 3KXXA 3I7BA 4FKJA 2UVZA 4JXFA 4YHJA 1JKLA 3QX2A 2WMQA 2IO6A 3QTWA 4J8MA 2WKMA 3UIXA 2BAKA 2PVLA 2XNGA 3CPBA 4J98A 4RBLA 3V8WA 4BCKA 3PVBA 4YPSA 3MY5A 5L8LA 3CGOA 3QGYA 5DNRA 2G2FA 2PU8A 2V5QA 3VS4A 3R00A 3H9FA 4J52A 4EH2A 5EKOA 3AMYA 4BIEA 4ONAA 2BAJA 4BF2A 4RIWB 4LI5A 1ZYSA 3QZGA 3Q96A 2XMYA 3ZFYA 4QQTA 4ZSJA 4UMRA 3KGAA 5EDPA 1NA7A 3LFFA 3BGPA 5FP6A 4JBOA 3BCEA 5ICPA 1PW2A 5AMNA 4FTTA 1XMLA 4X21A 3UIBA 4AGCA 4DCAA 2X0OA 3PP0A 2ITWA 5K0XA 1OGUA 4APCA 3LFBA 3PXKA 4S31A 1RJBA 2A1AB 5H2UA 1B39A 4BBFA 3WIKA 3PXFA 5CAPA 3EQPA 3GNIB 3NW5A 4FSUA 4GU6A 4JBPA 3G90X 3LLTA 4G9RA 4WO5A 4CQGA 4NFNA 3Q53A 3U4WA 3A99A 3W8LA 2W1ZA 2ONLC 1LP4A 2VD5A 3T3VA 5CAUA 3LCOA 5L2WA 3MA6A 4A9UA 3DAKA 4GJ3A 2I0VA 3PY1A 3UO5A 4UMTA 4YJTA 2P0CA 2CGVA 2YM3A 4UMPA 2OSCA 4F70A 3FMJA 4PNKA 1W0XC 4QDEA 4DG0E 4P5QA 2PHKA 4BFMA 4PP9A 4L3PA 3OBGA 4XG8A 4M3QA 5EW9A 3VN9A 1F3MC 4FV7A 3RINA 4DBNA 3W0NA 5IQEA 4BZNA 3OXTA 2YDJA 3MFTA 4QRCA 3OW4A 4NJDA 1H07A 3FKNA 1YI3A 5HNIX 5FXQA 3UC3A 3CEKA 4BHZA 4WBOA 3M2WA 1M2QA 4AX8A 3PZHA 5KE0A 4JVGA 4FSYA 2YM8A 1PRYA 2X2LA 1OB3A 1T46A 3I4BA 4RLLA 4YGAA 3QLFA 3NYNA 4UALA 3ORZA 4U79A 2ITVA 3BGQA 3D5UA 3FZOA 4EK4A 3VHEA 5HIEA 4K2RA 4MNEB 5J79A 3I1AA 3IO7A 4D1XA 4QYGA 3UMXA 5JGAA 5IQFA 3DKCA 4C02A 5A4LA 3KFAA 4I24A 4AN3A 2J5EA 3UVQA 2GNLA 3V8TA 4K77A 3DTCA 4XRJA 2W5HA 3G6GA 4NTTA 2A98A 5BVWA 4BDKA 5DBXA 2Z8CA 3CQEA 2G9XA 3R71A 5E92A 5A4CA 3V01A 4AW2A 3MVMA 2X0GA 3PXZA 3PPZA 4RWJA 5JGBA 4FV6A 2B53A 4ZSAA 1R0PA 4RFMA 3GC0A 1F0QA 5A4QA 2VUWA 3ZXZA 5LQFA 3MBLA 1KOAA 2WGJA 3HZTA 4M66A 4HGTA 5EG3A 3OCTA 1URWA 1GIHA 1QPDA 2HZ0A 3KF4A 4KB8A 4Q5HA 1ZAOA 5CVFA 5EOLA 3W16A 3C5IA 4NM5A 4YLLA 4YR8A 4M0ZA 4EOIA 2PUIA 5EYMA 1WBTA 3AKJA 1WFCA 1YRPA 3G0FA 3SXRA 2XS0A 3UNJA 2I40A 4EKLA 3ZOSA 5CAOA 3KXMA 4FL2A 2C3KA 3QYWA 5M06A 2PMIA 3CC6A 2P55A 4G3DA 4HOKA 3A4OX 4FI1A 1IASA 2JD5A 2WTKB 3SLSA 5T3QA 1OVEA 3VAPA 2C1BA 2W4KA 4FSWA 2WTCA 4TWCA 5LVNA 5CYIA 2ITNA 4TXCA 2CPKE 4TYHA 2C68A 4ZTQA 3K2LA 5K5NA 4I4EA 3IW4A 5EKNA 5AP1A 5JMSA 4QDVA 4DH7A 4W9XA 3KXGA 3VQHA 2YIWA 3F5PA 2Z7LA 4BR3A 2W1CA 3ZLXA 1YOLA 1TFFA 1CKJA 2VTIA 3N51A 4XH6A 4FYOA 4CLJA 2QOCA 4QMWA 4NWMA 5IF1A 2BKZA 4DH5A 5J7HA 4BYIA 5IU2A 5EDRA 3OOGA 2VWBA 2W4JA 3OOMA 1ST0A 1Q4LA 3DAJA 2J7TA 3BPRA 5JRQA 1NW1A 3ITZA 5LWMA 3CXWA 5E8YA 5L2TA 2YIRA 3QRTA 4FKUA 4QMVA 5L8JA 2XNBA 4OT5A 4II5A 1AD5A 3CD8A 1G3NA 3QKKA 4GFMA 4GKIA 4QMMA 3GEQA 3F5UA 4I3ZA 2ITZA 3H9OA 2XUUA 3IDCA 2X8IA 3W33A 2QOIA 4MNFA 4HPUE 4MXCA 2QLUA 1PXIA 1ZYJA 4C4EA 4D4VA 5CT0A 2ZMCA 2VTQA 3MB6A 4J95A 4X3JA 5EW3A 4FTOA 3UJGA 3WYYA 1PXPA 2IZSA 4I1ZA 4N70A 4DLJA 4X2JA 4YZMA 3Q9XA 3SW4A 3PSCA 4H3BA 3MYGA 3BQRA 3HECA 1FVRA 3QQUA 5HI2A 5IEYA 2WTJA 4FODA 4EZ5A 2C3IB 3F61A 4KA3A 1PXOA 5HG7A 2HZIA 1E9HA 2O65A 4JNWA 4D2PA 2PVYA 4ACHA 3AC8A 3E5AA 3NNUA 3PIXA 4R3PA 4YHTA 2JEDA 4V0GA 4BWPA 5A9UA 3F88A 4I21A 2VNWA 2XIKA 3O7LD 2BTRA 4KNBA 2QONA 1UWJA 4FKSA 3OUNB 2IEWA 3HDMA 2AC3A 4R77A 2W1HA 2GQGA 3HMMA 4KRDA 4UB7A 4TRLA 4YJQA 4L7SA 2CGWA 5FWKK 4PPAA 5DEWA 2NPQA 3VONA 4FTUA 3EN4A 2PMNX 1QCFA 1UV5A 3WIGA 4UZHA 2ITTA 2BPMA 4JQEA 4YLJA 4ZLOA 3P08A 4RRVA 2ZV9A 1OECA 3QCXA 3NWWA 3HMNA 4JIKA 4IW0A 5GJDA 3ZDIA 4L00A 2WMWA 2GS7A 4GU9A 3W55A 3I79A 1PXJA 2F7ZE 2PVNA 4JLCA 1JAMA 2XK4A 4FKPA 3EQRA 4D1SA 4F7LA 4ZY4A 5BUIA 4U0IA 5TF9A 5L8KA 1GNGA 1U4DA 2GQSA 1GZKA 1OL2A 3QTZA 3PY0A 2WEIA 4P2KA 2WMBA 3SRVA 3V6RA 1H00A 2GU8A 4AZFA 3C9WA 3MW1A 4TYGA 1IA8A 3HMOA 4E73A 3S3IA 4A9RA 5FTOA 3UC4A 3VBYA 4DFUA 2JGZA 2VTAA 4BC6A 4G31A 3Q9YA 4WRGA 4D2TA 3QRIA 3EN5A 5EW8A 3MI9A 1DI9A 3NUUA 2QU6A 5CY3A 5LVMA 3LOKA 3UNZA 3GU8A 2Y8OA 4L53A 3LCSA 4CXAA 1FVVA 5CENA 3UO4A 3NEWA 4BICA 3N4UA 1JOWB 5AR7A 2GTMA 4C36A 4OTRA 3UMWA 3VUMA 3RWQA 5K0KA 2VTTA 4AN9A 2W96B 3ODYX 3PXYA 1WBWA 2YIXA 3BQCA 3GENA 5JRSA 4KD1A 3CQUA 2UUEA 4DEDA 3W18A 4DG2E 3WZEA 3SVVA 4KIOA 4QMTA 2V55A 4CV9A 4NEUA 1WMKA 2X9EA 4DEGA 4QPMA 3VF9A 4A06A 4GK2A 4RX9A 3ORIA 3QCYA 4FJVA 1J1BA 5C01A 3F7WA 4FUYA 3EMGA 3TV6A 5H9BA 1NT2A 4HVIA 3DS6A 3VUKA 4BKJA 4WNOA 3D14A 3JS2A 3TMOA 4BDBA 4HZRA 4O81A 1ZOEA 5AUZA 1IR3A 4LG4A 4RIXB 2RKUA 5K3YA 3R8PA 3ACKA 2J90A 3KULA 4IM2A 5H8EA 4IJ9A 1PKGA 4JJRA 5HO6A 1MRYA 2LAVA 4FTCA 3FWQA 3DDQA 3R01A 2OJJA 4U8ZA 4XV9A 3P86A 3ZRKA 2YIYA 5LXMA 4GV1A 2KTYA 4QP9A 4U97A 4TW9A 3O8UA 3AMAA 4DFBA 3RK5A 4I0TA 3EOCA 5J7BA 3ZUUA 5CF5A 1Y6BA 3Q6WA 4ZTMA 3DY7A 1OL7A 2BRGA 3AD4A 3MIYA 3PJCA 4RMZA 4GYGA 5KKRC 4IX4A 4PMPA 4CVAA 4GT3A 3NAXA 3REPA 4NUSA 3NYVA 2HELA 5IH4A 3HDNA 4R6VA 2WO6A 4M69A 3VUHA 3VBWA 4HVGA 3W0QA 3LJ1A 4AZSA 4DT8A 4ANNA 4EH9A 4U7ZA 2R3FA 5CTPA 3HYHA 4FVPA 3JR1A 3HL7A 1GZOA 2C5YA 4WOVA 5GZ9A 4AXEA 2CSNA 5AUXA 5IDNA 3FC2A 4FOBA 4A7CA 2X39A 3LCKA 3NPCA 4W9WA 4WG3A 3PJ3A 4F78A 5M4IA 1S9IA 3HNGA 3FI4A 4MWIA 2G1TA 5JK3A 3E8DA 4G2FA 3UPZA 2RGPA 4MXYA 3BEGA 3FMMA 3I0OA 5K5XA 5CQWA 4QMNA 2X4ZA 4OGRA 4F1TA 1LEWA 4FBXA 5HU3A 4Y83A 2PZIA 2E9OA 3Q3BA 3ORNA 4BCHA 3WF5A 3LMIA 4BB4A 1OKZA 4S34A 3MGYA 1Y8YA 3IGOA 3W0OA 2YJRA 3DPKA 3DAEA 4PL4A 2E9VA 4ITIA 3OTVA 4RC3A 2QNJA 4NTSA 3UDBA 3ZXTA 5A46A 5I9ZA 4CGAA 4EQUA 2SRCA 4EOKA 3BEAA 4X3FA 4KBKA 3HA6A 2OIBA 5CLPA 5AR3A 5FG8A 1G8KA 4YBJA 5K9IA 3FEGA 2VTLA 5L2SA 2GNIA 2WTWA 3NNVA 1UVRA 2XJ0A 3KXNA 5EHOA 3ZFMA 5ANGA 3MTFA 4ACDA 3E7VA 2GCDA 2IJMA 2BHHA 4L9IA 4QTAA 4MXZA 2VTMA 1Q24A 4U5JA 4JRVA 4BCGA 4MF0A 3GC8A 1TZDA 4QD6A 2XM9A 4CFNA 3KA0A 4ACCA 4YU2A 4QTEA 1YWNA 3LFNA 4J96A 4W4XA 3UP2A 3V3VA 3ANRA 4O6EA 4EH6A 5BQ0A 1Q8UA 3FQSA 4FKIA 3QX4A 5KUPA 2R3LA 4IB1A 5CF6A 4PDYA 3BHTA 1CKIA 3ZO4A 3BHUA 4WSQA 5HLWA 4FG9A 3EQHA 5B2KA 3NIZA 1UA2A 4AZEA 4ZTSA 5BUJA 4Y5QA 3QQGA 3ZO3A 4YBKA 4FNWA 3K3IA 5IEVA 3IONA 3SW7A 2BR1A 1UNGA 4I4FA 4NCTC 2UZNA 2XRWA 4BDJA 5IA5A 5I9UA 5AUUA 3BYMA 4JAIA 4H39A 1K2PA 2WB8A 5M08A 3VC4A 5CXZA 4YTHA 2VTOA 5HVJA 3ZLWA 4FT3A 4F9AA 3AGMA 5JEBA 2UZDA 2YCRA 2AUHA 3QD0A 4FF8A 1A48A 4GT5A 3TV4A 4ENYA 1XKKA 5L6OA 3FY2A 3JYAA 4XNEA 3UPXA 3DJ7A 4AT3A 4CFFA 5BPYA 4DEAA 2GHLA 1I09A 2UW6A 4L44A 2HWPA 1FINA 2C3JA 1XH7A 4ZSGA 4NFMA 4WD5A 2EXEA 1YHVA 2PY3A 2P2IA 4P90A 3UDTA 1XR1A 4RJ3A 4XEYA 5GHVA 3TWJA 4CSVA 4DC2A 5CSPA 2UW7A 4MD7E 5TR6A 5CEQA 2OICA 4WRSA 1ZMWA 2XNMA 3PRIA 3BELA 4QQJA 3T8OA 5IZFA 3BV2A 4LGHA 2YWPA 3D7ZA 4GL9A 4U40A 3DFCB 5LVPA 3L8PA 1QMZA 2W5BA 3QWJA 3C0IA 3IOPA 4YJPA 3UOLA 5B7VA 3A7GA 5I9VA 5JFXA 5J1VA 1BI7A 3R9OA 5JFVA 2ZB0A 4G9CA 3AMBA 3N4VA 3FLQA 4I5CA 4R1YA 3UP7A 4IQ6A 5CU4A 4XG2A 3TG1A 1YI4A 5CNNA 5AP5A 1UU7A 3RAHA 2RG6A 4O7ZA 2X0QA 2OWBA 3JY9A 4D2RA 4RIWA 3V04A 2PUUA 3IW7A 2XEYA 4CG9A 1H28A 3SOCA 3OW3A 4UWBA 3TV7A 2LGCA 3IOKA 2GS2A 4IFGA 3SXFA 4HYUA 4ZY6A 1K9AA 4FG7A 3KK8A 5B0XA 1V0PA 3JY0A 4MXOA 4E26A 5M53A 4GG7A 2CNQA 1OPLA 4H3QA 3P0MA 4GG5A 4I6QA 2BFXA 4Q9ZA 4CKJA 3FQEA 3GXLA 3RM6A 5ANKA 2QO7A 3NS9A 2IF8A 4DGLC 4DTAA 4O84A 4CFXA 3R63A 3O23A 3FHRA 5HNGA 3QTUA 4IB5A 4YO4A 2J0LA 4M8TA 1JKSA 4QTBA 5CZIA 4E93A 2BIKB 5HBHA 3NUYA 1GIIA 3HLLA 4QT1A 2CJMA 1JSVA 3LXPA 3OWLA 5AP0A 1A06A 3DKOA 3E3PA 3UOHA 4CFUA 4E7WA 4UEUA 1JWHA 2WIPA 4MK0A 5FBNC 2WMVA 4HPTE 4K33A 4BYJA 3MN3A 4JRNA 1YW2A 2QOQA 3ZRLA 4BJJA 3KQ7A 3R1NA 2GHMA 2WMRA 2QI8A 2GFCA 3FKLA 3ORKA 2GHGA 1XH9A 3NUAA 3H3CA 3V8SA 4D9TA 5EHLA 5CSHA 1OPKA 4BBMA 2R3OA 4NU1A 2DWBA 3FLZA 2BRNA 4YSJA 2X6DA 4IBMA 2CMWA 3E88A 4U3YA 4DH1A 2YM4A 1YI6A 2WMUA 2PZ5A 4EH5A 3A8XA 4CG8A 1LPUA 4JMQA 1JKKA 4X7QA 3ZS5A 1KOBA 3GCPA 2GPHA 3QD2B 3KY2A 3ZFXA 4CFWA 2E9PA 5HO7A 4BTFA 5DMZA 5IUIA 2VAGA 3NR9A 4BI1A 4I6FA 4YJOA 4M13A 3AT3A 2RF9A 3BE2A 2WHBA 3V51A 4MNEA 2FYSA 3P9JA 3DDPA 4TWOA 5B2LA 2IN6A 3C13A 3NX8A 3I60A 4FIGA 3PA5A 3QZFA 4MKCA 3CY2A 4BI0A 4V04A 4R7IA 4G17A 3O5AA 3G5DA 3R9RA 5JT2A 1OUYA 2CHLA 1OKYA 2CN8A 1J7UA 4EOMA 4ZP5A 2HK5A 3DLZA 5EHYA 2XF0A 2F2CB 2UZEA 2V22A 4O2ZA 1BKXA 2VRXA 1LR4A 3BL7A 1J1CA 3ZBXA 4Z16A 1UU3A 3TZ9A 1VYWA 2UV2A 2JDSA 2ZYBA 3LVPA 5AP6A 3RKBA 4JOAA 2A27A 1ND4A 5IMEA 2XKDA 3IECA 2JDRA 4RA5A 4E5BA 3WF9A 5LCJA 1YXXA 2B9HA 2WIHA 4KUJA 4PMTA 3PSDA 3L9MA 3ETAA 2C5OA 3LM0A 3BL9A 4QO9A 4QMSA 3VRYA 1Q99A 2EUFB 2E9UA 4C2WA 3D0EA 4O1OA 4DHIB 5ANJA 4BHNA 1Z5MA 2PZPA 1J7LA 3W2SA 4FL1A 5JZNA 2WAJA 2CLQA 3FI2A 2EU9A 5FTGA 5FUTA 4TL0A 1ZZ2A 4FSRA 2BCJA 1W2CA 4U3ZA 5AR8A 4JT3A 4APPA 4AAYA 4EOLA 3UZTA 4R8QA 1H4LA 3C50A 2F9GA 3FZTA 3GQLA 3LFQA 3PPKA 5E7RA 2Y9QA 4CQEA 5BVKA 4GUBA 4DHJA 2XNOA 2XVDA 3MY1A 4IZAA 1WVWA 4S2ZA 3UE4A 5IA0A 1SVHA 4I5PA 4B7TA 2C3LA 4B6LA 3I6WA 4YURA 2GNGA 2FH9A 2V62A 3HUCA 3M1SA 3FLWA 1KE9A 3AC5A 4JDKA 3MH2A 3DBQA 3QA8A 2E2BA 1U59A 4BCNA 3BE9A 4EKKA 1XJDA 5HE0A 1ZYCA 3TT0A 3FSKA 3W2CA 1Q41A 4ZTNA 3VULA 3RPOA 3BLAA 3K3JA 2X8DA 2OF2A 4I5HA 5CXHA 2IVUA 2OK1A 3HP2A 3AC4A 4MX9A 4O96A 4DGMA 2ITUA 4DDGA 4RWIA 4ZAUA 5IH6A 5CEMA 3M42A 4RIYB 4O7YA 1GIJA 2OW3A 3EFJA 5CF8A 4HVSA 2Y4IB 3CPCA 4IX3A 2WOTA 3MPAA 3VVHA 3AKKA 5B2MA 3W32A 4RZVA 2ZV7A 5KHWA 5CNOA 3POZA 5HORA 4NKAA 5JGDA 4EHZA 2QKWB 2WQNA 5J9YA 3T9IA 3CP9A 5BNJA 3TNQB 4CLIA 2ONLA 4MBLA 4W4WA 3L8VA 3VO3A 2ITYA 2JKKA 4JDHA 1NXKA 3VW8A 5IQBA 4C3FA 2WTKC 5I3RA 3EFLA 3FAAA 3MWUA 4D4YA 2HXQA 2VWIA 3NDMA