2CPKE

Crystal structure of the catalytic subunit of cyclic adenosine monophosphate-dependent protein kinase
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
336
structure length
333
Chain Sequence
VKEFLAKAKEDFLKKWETPSQNTAQLDQFDRIKTLGTGSFGRVMLVKHKESGNHYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMVMEYVAGGEMFSHLRRIGRFEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGFAKRVKGRTWLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFATTDWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEEEIRVINEKCGKEFTEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords cAMP-DEPENDENT PROTEIN KINASE, CATALYTIC SUBUNIT
publication title Crystal structure of the catalytic subunit of cyclic adenosine monophosphate-dependent protein kinase.
pubmed rcsb
source organism Mus musculus
molecule tags Transferase(phosphotransferase)
total genus 102
structure length 333
sequence length 336
ec nomenclature ec 2.7.11.11: cAMP-dependent protein kinase.
pdb deposition date 1992-10-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2cpkE01
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2cpkE02
3Q9ZA 4XG4A 4ENXA 4XG9A 3KREA 4LOPA 4FKVA 4HPUE 3U87A 4ASZA 4AW5A 2QU5A 1R3CA 4ZTHA 4FG7A 4DFLA 5M57A 4V04A 3ORLA 4FTUA 5D7AA 4ZTQA 2YIYA 3F6XA 5TKDA 2BRBA 4BIBA 3PRFA 4BHZA 4U3YA 4RIOA 5EQPA 4HGLA 3SOCA 3W8QA 2QOHA 2E9UA 5CF6A 2ZB0A 3IONA 4BZDA 3LM0A 3CY3A 4QPSA 2E2BA 5JFXA 2B9JA 5K9IA 2UZOA 3R01A 4GUBA 1H0WA 4EQMA 3QHRA 5HVKA 2ZV2A 4R5SA 3NNUA 2GQGA 2WMXA 3FLWA 4MXZA 5M07A 4D2SA 5IA1A 4OR5A 1GNGA 3SRVB 5JSMA 4LGGA 2FUMA 3MI9A 5DHJA 3FZOA 2W9FB 4YO6A 5LVMA 2ZYBA 3U6IA 3Q2MA 2BMCA 2QVSE 2ZV7A 4HGSA 1PYXA 2BRHA 4DEGA 2XS0A 3CP9A 2ZMDA 4NM3A 4MBJA 4QMXA 4PRJA 3EQGA 4O1PA 4XH6A 3F2NA 4YJOA 3BZ3A 4BWKA 4AWIA 5I9ZA 5HO7A 2YACA 4GYIA 4BCOA 5A4EA 2FSMX 3LFSA 3NEWA 1PMNA 4DC2A 2UW0A 1YDSE 3E7OA 1IAJA 4GK2A 3LXLA 3HA6A 1BYGA 3CIKA 3EFLA 4BCFA 3UGCA 5AA9A 3RPRA 4AG8A 2Z2WA 4EOSA 3RGFA 2B9FA 2ITOA 4NKSA 2ZAZA 1YWRA 4LL0A 4Z9LA 3QX4A 3ZLYA 3G6HA 4MQ2A 4Y72A 3COIA 2O5KA 2IJMA 3DDPA 3E92A 2VTJA 2UW8A 3ORIA 4RJ8A 4N70A 5JZJA 3WARA 2O0UA 2W9ZB 3VO3A 2YM3A 3EYHA 4WKQA 3V5PA 3V01A 2YIWA 3ZCLA 3MB6A 3C4FA 4YSMA 2CNUA 4FOCA 4AE9A 3MTFA 3V6SA 5AP2A 2QR7A 3GBZA 2C3LA 5E8VA 4FVPA 4G2FA 4E5WA 4NUSA 4KINA 3VQUA 1P2AA 3QKMA 4AOIA 1YXSA 3Q4TA 3OW4A 3U55A 2X8DA 4M69A 3D14A 2IVUA 4YC8A 1WBNA 3DOGA 5EDPA 5C01A 2C0OA 4G16A 1K9AA 4YSJA 4HYSA 4ACHA 3MVHA 4YJPA 4YZNA 2OU7A 4DA5A 3NLBA 4F65A 3QL8A 4HCVA 2NO3A 4FL3A 1Q97A 2XYNA 5CY3A 4B8LA 2UZLA 4O2ZA 2WD1A 3ZO4A 4PTCA 4P5QA 2IW6A 3CGFA 5ACBC 4I23A 4CTCA 3F3VA 4EBVA 4K11A 2ZM4A 3G51A 2X39A 4FK6A 4QMLA 2C68A 4BKJA 5IU2A 1B39A 2HAKA 3AC1A 3QUDA 4LOQA 4LV8A 3LFCA 2VTTA 3QQHA 4LMNA 4RWKA 3OWJA 4KRCA 4P90A 2Q0NA 5CU4A 1H1WA 3FZSA 4DG3E 2NNWB 5KNJA 4C35A 4I3ZA 4N6ZA 3ZTXA 3MFUA 4GIIA 5KO1A 3MW1A 4DFUA 3NYOA 3OEFX 4NJDA 3I0QA 3HV6A 2C0TA 2XVDA 3ENHA 2XIKA 3FLQA 4P2KA 2Z7LA 4QP8A 3R7OA 3SLSA 4R77A 4BCPA 2PPQA 5EG3A 1PXOA 2X8IA 4P5ZA 3D15A 2ONLA 5GJFA 3TV4A 4A7CA 3TDWA 4TZRA 1Q99A 3M11A 5DA3A 3KXGA 4C3PA 4MVFA 5IQEA 3AXWA 2R3KA 5BVWA 4DGGA 4FUXA 4BIDA 3CR0A 5I3OA 4EONA 1H08A 2XNBA 1FVRA 2P2HA 2GNJA 4FV3A 1NVSA 4W9XA 3ZUUA 2B53A 5LMBA 5AV3A 5DE2A 2CJMA 4UALA 3AMBA 1BMKA 4WT6A 5C9CA 4AFEA 5CSPA 4F9AA 1VR2A 4BICA 4FKUA 2GS2A 2UUEA 3FPMA 3SHEA 4NZWB 3CPBA 4R3CA 1KWPA 5JN2A 2IVTA 3LFEA 3IDCA 2HZNA 4BDKA 4O7YA 3HV4A 5DN3A 3TIYA 4F1OA 2G15A 4AA4A 1HCKA 2YM7A 5EFQA 2UW7A 1B6CB 1UWJA 4IC7A 4NCTA 3V8TA 4IXPA 3JYAA 4RJ4A 4R5YA 4I93A 4AN2A 3M42A 4C62A 2WTVA 2F7ZE 2ZM3A 3F66A 3I6UA 3Q4UA 5CI7A 1LEZA 4C7TA 3COHA 3QTWA 2ITXA 3C4CA 4MNFA 3KMUA 3W18A 2VO0A 4EK5A 4WRGA 4M3QA 4KSPA 1XH9A 2YLEA 4RIWA 1DM2A 4FNZA 3TKIA 4JR3A 4CT1A 3WYYA 3DY7A 2FYSA 4KIOA 4YZDA 2YDJA 3G90X 4AZWA 4NM5A 4XP2A 4II5A 1Z57A 2OJ9A 4Y5QA 3FQSA 4TYHA 3E3BX 2RGPA 3P79A 4DT9A 4I0SA 1M14A 2R3QA 4BYIA 2XJ1A 3DFCB 2XNEA 3KY2A 2WQOA 3MIAA 5E7RA 5E8YA 5M51A 3C5IA 2P33A 2QHMA 3QCXA 4EH6A 3JY0A 4DLIA 5LXMA 4L7SA 3DDQA 4HVDA 4FKTA 3TJDA 3TV6A 5TOZA 5HNBA 1BI8A 3A99A 3QTSA 4S30A 3QRIA 2XJ2A 3MA3A 2AC5A 1XR1A 2BDFA 4QQJA 4W4VA 4YBKA 5AUXA 4BCJA 2GQRA 4YLKA 3BRBA 3RKBA 2VWBA 2IN6A 3S1HA 4O1OA 3FUPA 4Z7GA 3ZSGA 4O38A 2R3RA 4JDKA 3PXRA 4BDJA 1YI6A 1FBNA 4QO9A 2CLXA 5C4KA 3ZC6A 4AN3A 4ZAUA 2QOLA 5EM6A 3EFWA 1CKIA 5M4CA 1ZXEA 4JBOA 3LFDA 5IA4A 4I4FA 5C8NA 4I92A 3GVUA 3R0TA 2UVZA 4FYNA 3WOWA 5JGBA 4TXCA 2JIVA 3ITZA 3OCBA 2V0DA 2VO3A 3BIZA 1WBWA 3A7GA 4OT5A 4GH2A 3ZXTA 2BTSA 5CSWA 2VTIA 3E87A 1Q8ZA 3QTIA 4LV5A 4F9CA 2PUPA 4L53A 4EH7A 4GKHA 3MIYA 5AP5A 4BTKA 4CSVA 3CPCA 5CEMA 4D4SA 3IECA 2CMWA 3R8UA 5AA8A 3JUHA 2VZ6A 3KRJA 4NYEA 5CYIA 5A3XA 4C8BA 2OICA 4XP3A 4M67A 5CLPA 3PWYA 1H26A 4AP7A 2CKPA 3MSSA 4QMMA 3GU8A 3VWAA 5FEDA 3ZO2A 3NSZA 2C47A 5FBNC 3ATSA 1Q8WA 1H0VA 3VJNA 3FJQE 3CY2A 3NCZA 3PUPA 1JPAA 2YAAA 3P4KA 3PY1A 3HUCA 4ZXTA 3WILA 5B2LA 1WVYA 2Y4PA 5BMSA 4GSBA 4R6VA 4K2RA 5IQCA 4J8NA 3HRBA 3NUUA 5I9XA 3U51A 1M2RA 5ICPA 3BV2A 1OL7A 3R1QA 3EFKA 2UW5A 4I20A 3E8NA 4RRVA 2OFVA 2QQ7A 4PTGA 5JH6A 2DUVA 2QG7A 3ZM9A 4XV3A 4DEBA 4EOOA 4WG4A 4R7IA 4BCNA 4CXAA 1ZMUA 1PJKA 2XIRA 1ZYSA 4D1SA 2CN8A 3ZM4A 4JG8A 3UQCA 3TV7A 2R0UA 3QX2A 2GHLA 5CVHA 4MNEA 3RAKA 2HW6A 4D4RA 5A46A 4JBVA 3FYJX 4KBCA 4EHVA 1P4OA 2BROA 3DXQA 2CCIA 2F7EE 4OTPA 4I1ZA 4PMTA 1SVHA 4MBLA 4A9SA 4DEHA 4OTGA 5M55A 4YLLA 3BLHA 4BDCA 4YZMA 3R9NA 2X0GA 4O86A 2HXLA 5M4FA 4AW1A 2RFSA 2OJFE 1BUHA 1BI7A 2W4OA 4FEWA 2WMAA 2XYUA 2W17A 4WOVA 1YDTE 5IA5A 3GC9A 4OBOA 4U97A 5JRQA 3EWHA 3CC6A 3VS4A 2BZIB 1J1CA 4B0GA 2VWXA 5EDRA 4EC8A 4FEQA 3EN9A 4QP7A 3CKXA 4E73A 3PXZA 4JVGA 4AOTA 3LLAA 3PIXA 3A7IA 4RZWA 5KCVA 4QMTA 3F69A 3QKKA 5KMMA 2JD5A 2W0JA 4F9YA 2GS6A 3HMOA 2W4KA 3LFNA 4ZSEA 1F0QA 1PXLA 4IVDA 3UJGA 4DFZE 2BHHA 5HCZA 3EMGA 4BWXA 4NFMA 2QOBA 4WIHA 2WMRA 3TCPA 2G2HA 1PMUA 3V5QA 1CSNA 2OBJA 3QFVA 4NM7A 5HVJA 3PVBA 2A4LA 2BALA 3E8EA 4L45A 2C6MA 4I5PA 4W8EA 5K3YA 3G9NA 5HNGA 3BGPA 2J2IB 2VO7A 4JQ7A 3FMEA 3HP2A 4FKLA 1M7QA 1PMVA 3A62A 3EL7A 4ZJIA 5T3QA 2FVDA 4E20A 3U8WA 4GVAA 4I41A 2RSVA 4G5PA 2JAVA 4GL9A 1PXKA 2REIA 3RK5A 3W16A 3F88A 3MH2A 3BQCA 2W1IA 5GJGA 1OL1A 3D5VA 3DU8A 4IHPA 4NSTA 4QMWA 3BLQA 3ZOSA 5LWNA 5DT3A 5L8JA 4AT5A 5HIEA 1SMHA 2W1FA 3UIBA 4ZY5A 2JEDA 4E7WA 3UVQA 2YAKA 4MHAA 4BCGA 2YERA 3RAIA 3I6WA 3VS1A 5M53A 4YJRA 2A1AB 5LMKA 3DJ6A 2X4FA 1XBBA 3PJ2A 3PVWA 4EZ3A 4WO5A 5DFPA 3TEIA 1M7NA 4QMUA 3PJ1A 1ZMVA 4UZHA 4ZSJA 5CAPA 4JDJA 2XRWA 3MFSA 4EJNA 4RWJA 2X7GA 1W84A 4C38A 2XCHA 5LVPA 5EK7A 5B7VA 4I6FA 3KK9A 1ZZ2A 4CZUA 3H9FA 5EKNA 2EUFB 3E62A 3NPCA 3QC9A 4Y83A 5BUJA 1WBTA 3ET7A 3R1NA 4U6RA 5H3QA 3UNKA 1ZOGA 1SYKA 4FV6A 2J5EA 3OEZA 4JRNA 4FT9A 2VWYA 4WD5A 2RFNA 3IG7A 5DPVA 5FDXA 4D5KA 1UV5A 3SW7A 3R7UA 3IPHA 5DRDA 2R3FA 2WMSA 4G17A 4IW0A 3R7IA 3Q9XA 5EH0A 5AV4A 5HO8A 4WUNA 3OXTA 2IW8A 3O51A 4KIKB 4ZZOA 3QRKA 4FTTA 4J8MA 3CTQA 4KIQA 5J95A 4ITIA 4C4EA 4XHKB 3V8WA 2G1TA 2NRYA 3R1YA 2JBOA 4M97A 4C4IA 5IEVA 3R8LA 5AUWA 2F2CB 4M0ZA 1U5RA 4XP0A 2VTHA 2WPAA 4ACDA 4MXOA 3ID6C 4RJ7A 4DH3A 5AAFA 3E5AA 4D0XA 3AQVA 4IX3A 2J9MA 3A4OX 3QGYA 4A9YA 2PHKA 1BX6A 5CVGA 2PZ5A 5GZ9A 3GUBA 2FSLX 4FSUA 4XG7A 3GCSA 4FGRA 3B2WA 3NRMA 3ORNA 3TJCA 4U0IA 4EK8A 3S00A 3QTRA 4TN6A 4X7QA 3QTXA 4E93A 4PMPA 4AGCA 5EQEA 5D10A 3LCOA 2B1PA 4PDYA 3RWQA 1H4LA 2Y0AA 5M4UA 3SVVA 2O64A 5ACKA 4DBXA 3BGZA 4LRKA 4YNEA 3F61A 1XH8A 4DH8A 4BDHA 4U44A 4C3FA 3Q6UA 1OPLA 3K5VA 5FLFA 3SA0A 3NUSA 4W4WA 3T9IA 3OROA 5CALA 1G8SA 3ZDIA 4NWMA 1Q8UA 2YLFA 4JBPA 4M7IA 3LAUA 3R2YA 3QA8A 4C02A 4QQCA 3W2CA 5AUUA 5HEZA 2C3JA 3O23A 5E1SA 4F70A 3PIZA 5IQGA 1ZAOA 4WBOA 3PWDA 2BIKB 4FEUA 1J7UA 1T46A 4E4NA 4BI2A 2OH0E 2C1BA 3D0EA 1XQZA 3QALE 3OF0A 4X3JA 3SRVA 2F7XE 2QR8A 4MQ1A 3MJ2A 1OECA 3LMGA 4DH5A 5LQFA 3VUMA 2OZAB 3HRFA 3N51A 4FKJA 4M68A 4EK6A 1MRVA 3A7HA 1YKRA 4NH1A 5ETCA 3CE3A 1FMKA 4M84A 1FPUA 2XBJA 3DBCA 3FHIA 4O83A 5L2TA 2PVRA 2WTDA 2ITYA 3TNPC 4BGHA 2VX1A 3AGMA 3CTJA 4AW2A 1J7LA 4DGOA 3MFTA 2RFEA 3E8DA 2PVHA 2WEVA 2FH9A 4IM0A 4KIPA 4KRDA 4HVSA 3EIDA 4HYIA 3RVGA 3ATTA 1QCFA 1H1SA 4U43A 3VUIA 2HK5A 1LPUA 2GS7A 3FL5A 5ANJA 3R8PA 1RE8A 3KC3A 4S31A 2C6EA 5CEIA 1Y6BA 3H0YA 3IK3A 5I9YA 2BIYA 1BLXA 3FE3A 4TWCA 4ZOGA 1AGWA 4RSSA 5IZFA 2WTCA 2C6TA 3PJ3A 3VUDA 5AP7A 2UVYA 5HZNA 3E7VA 3LM5A 3T8OA 3C51A 3OTVA 1FGKA 3PXFA 2VTSA 5L8KA 2B54A 3QQKA 4YPSA 1BL7A 3KVXA 5DIAA 4AOJA 4MK0A 3DK3A 4HGEA 2OW3A 5CI6A 3NUYA 5D7VA 3ZFYA 2OG8A 4FSTA 4GJ2A 3OG7A 4FBXA 1KE5A 4H3QA 5CU0A 3LCTA 2Z02A 4IADA 1FQ1B 2XZSA 1J1BA 3TNWA 4CZYB 5KMIA 4BY9E 4AW0A 2G2IA 4UMRA 3SDJA 3MS9A 3E93A 3G33A 1JSUA 3BQRA 4GT5A 4K18A 1DI8A 4RMZA 4XNEA 3PG1A 4RVKA 3SV0A 4BL1A 2X4ZA 3Q5IA 4CQGA 4D2WA 2PE2A 4FKSA 4EOJA 1H25A 5EW3A 3VJOA 4PV0A 3KXZA 4CRLA 3VBVA 2J0MB 4G3EA 3UIMA 3PSCA 5HG9A 2A2AA 3DTCA 3O0GA 4FTIA 4RIYB 3RTPA 3L8XA 3FQHA 3RPYA 4Z3VA 3G2FA 4RZVA 2HOGA 3EQIA 3W55A 2UVXA 5G1XA 5KKRC 3EQDA 4ERKA 3WE4A 3HZTA 5EI6A 2ONLC 4QYFA 5B0XA 2BPMA 4ARKA 2E9PA 2ZV9A 3AD5A 3VVHA 2IPXA 4BI0A 3RMFA 4FTCA 3QTZA 4D5HA 4C33A 2PK9A 5CSXA 1KE9A 3HGKA 4DTKA 3I4BA 2I6LA 4FODA 3GB2A 3O8TA 4DH1A 5IQDA 3QC4A 4IAFA 5HICA 4RFMA 3TUBA 1UVRA 4FIFA 2H9VA 4R1YA 3R7YA 3AT2A 1XBAA 4I5HA 3JPVA 4IX4A 4IEBA 3GP0A 2BRMA 3D7ZA 5AR5A 4AZVA 3L9NA 1OGUA 1OKWA 3L8VA 2E9VA 3BHTA 3F3TA 3FYKX 3CTHA 4TT7A 4G3GA 2W5HA 4EH9A 4IACA 2WMQA 3ACJA 3PPKA 3BE2A 3TZ8A 2CHLA 5F95A 2IZUA 2VTNA 5E8ZA 4OBPA 3FMNA 1PYEA 3QZGA 4FVQA 5CEPA 4DAWA 4NL0A 4G3DA 1O6KA 4O2PA 4U5JA 4GV1A 3A8WA 2Y4IB 3ZFMA 2HW7A 5JQ8A 2QD9A 2PVFA 5KBQA 3DGKA 5FWKK 4YLJA 2W99B 5LCJA 3AC5A 4WNKA 1SZMA 3DZOA 3NUNA 1H00A 3VC4A 3DB6A 2EB2A 4MF0A 4S34A 4BC6A 3VS6A 3CQUA 3NX8A 5AR2A 4BR3A 3VAPA 3VW8A 2C69A 4ORKA 4L67A 5DBXA 2WIPA 3HMPA 3W33A 2X2MA 3ZONA 4YZ9A 1IR3A 3GT8A 2VTLA 3L9MA 3NCGA 3FXZA 5HVYA 3E3PA 4M0YA 4AN9A 5IA3A 4FTLA 3D2IA 4FNXA 5ETIA 4EOPA 1H24A 2XP2A 4WUAA 5AP3A 5DYJA 3VBWA 5AUVA 1Z9XA 3IW6A 1P14A 4MBIA 3ULIA 3GQLA 4YBJA 1UKIA 5EI8A 1OL2A 3P86A 5L2SA 3PA3A 4QMNA 1YOLA 1S9IA 2Y9QA 3E8CA 3IW5A 2WTJA 2AUHA 4RC3A 4FGBA 3ENMA 4ALWA 5C8KA 5IQHA 1XH7A 5FG8A 2B7AA 2J4ZA 5FBOA 2RIOA 4E5AX 3TTIA 5AAGA 4CYIA 5IISA 5DVRA 2HZIA 4ERWA 4NIFB 3ZMMA 2WU7A 3ZXZA 3FDNA 5CEKA 4PL5A 3LMHA 4CMUA 3MB7A 3Q53A 4IJ9A 4AGWA 1Y6AA 2RF9A 1MP8A 4YTIA 4DT8A 2B52A 1PMEA 3ZFXA 5HIDA 2E9NA 3D83A 4FC0A 2VX3A 3TL8A 5I0BA 3NWWA 4GT4A 4IWQA 4E5BA 5EYCA 2WXVA 3O8UA 2R3IA 3VULA 2YN8A 1SNXA 2BR1A 3G9LX 3M2WA 5HHWA 1VEBA 4AZEA 1O6YA 3GQIA 5AV1A 5EDQA 3R9DA 2ETMA 3OWLA 1OIRA 4G6OA 3DKOA 5CWZA 1YOMA 1A9UA 1ZRZA 2AYPA 3DNEA 1PXNA 5D1JA 4U45A 5IQBA 1G3NA 4X2FA 3B2TA 4R1VA 4U42A 3EZVA 2DWBA 4ANNA 5LCKA 3O50A 3QHWA 4HYHA 4GRBA 4C4HA 3MH0A 1UWHA 2QOKA 3JVSA 2QURA 3KRRA 4CZTA 4AAAA 3A4PA 5GIOE 2BRGA 4IWOA 4BCKA 3UZRA 3NIEA 2WOUA 3W2PA 3K54A 5CAQA 5C27A 5BVNA 3OBGA 5IUGA 3A61A 2AC3A 5T68A 3QQGA 3GGFA 5IKWA 4XJ0A 5IEXA 4BTJA 4KB8A 5BVOA 4DHFA 4FTRA 1UU8A 4KNBA 4ID7A 4QQTA 1TQPA 2ITTA 4IX5A 4BWPA 3HMNA 5A6NA 3OW3A 3B8RA 4IM2A 3KCFA 3VUHA 4J7BA 3ROCA 3OC1A 3TZ9A 1ZOEA 4O7NA 1S9JA 5CENA 5JFSA 4JQEA 2JGZA 2J5FA 5C4LA 4RQKA 5CF4A 3NYXA 3PE2A 4WG5A 3UZTA 2YCQA 2HZ4A 4YR8A 5CXZA 4JJRA 1YXXA 2OH4A 3V8SA 4LGDA 3DS6A 4Y46A 2V62A 5H8BA 3DCVA 4QMZA 4Y73A 5H9BA 1U54B 3FI8A 1NT2A 1QPCA 4EHZA 3TNQB 3UZPA 3QCQA 5IH4A 4LYNA 4TL0A 1CM8A 2DQ7X 4GYGA 2WQNA 4XLVA 1GZ8A 4P4CA 2XNMA 3R8ZA 5J1VA 2JIUA 4EQCA 4C4FA 4I5CA 5J87A 3I5NA 5M4IA 5JZNA 3LCSA 4K33A 1J7IA 2J6MA 1LP4A 4C0TA 3NNWA 3ODYX 5ITAA 3S95A 4H1JA 4KS8A 3OY1A 5JKGA 4GEOA 2LGCA 2DYLA 2PMIA 4UMQA 3NR9A 3RAWA 4U79A 4F6WA 5KMNA 3ERKA 1H1QA 2WAJA 5CAVA 4W4YA 2GTMA 1JKSA 5HIBA 4X2JA 2J0KA 4BGGA 4FTAA 3C4XA 3EJ1A 4W9WA 4CD0A 3C4WA 1W0XC 2R3OA 3LW0A 3R00A 4DCEA 2XK6A 2ZOQA 4LQMA 3II5A 4S33A 3NNVA 2PZPA 3FC1X 4DEIA 3LMIA 2X9EA 1KE7A 3KB7A 1GZKA 4IAAA 2IZRA 4MH7A 4YTFA 4BCQA 4DCAA 3IO7A 1K2PA 2P0CA 4IWDA 3F5XA 3V6RA 4NKAA 2Q83A 4PDSA 3UTOA 2HXQA 2G2FA 3EOCA 2Z7SA 3NGAA 1VYZA 1XBCA 3QGWA 4E6QA 5HD4A 3NW5A 4C37A 3ZU7A 4QP1A 2VWUA 2WMTA 1E1XA 3R02A 4O0UA 4G34A 3A60A 2IWIA 4L3PA 2PUNA 4WBBB 3DKFA 3FV8A 2X2KA 3BU6A 3ZO3A 2J7TA 2Z60A 3QQJA 3Q3BA 4ANBA 4M15A 1YVJA 2C6OA 2YCFA 2C6IA 2JAMA 3CLYA 4IQ6A 3A7FA 4XRLA 3L8PA 1UU7A 3TZMA 4D4VA 3DBEA 4USFA 3KA0A 3O7LB 5L6WL 4FVRA 3BI6A 4J98A 2XKDA 3ANRA 5EOBA 3R7GA 4FICA 4TYJA 4PPAA 4PUZA 5LMKC 5FP6A 3FWQA 1TQIA 3KULB 3AC4A 3GI3A 4UV0A 5GZ8A 1H01A 1AQ1A 1RW8A 2XF0A 2R3PA 1QPEA 4FL1A 3ZHPC 2RKUA 3KKVA 3RK7A 5DGZA 1NW1A 3EH9A 3DBFA 4YPDA 4BIEA 3HAVA 3L9LA 2VWZA 2HIWA 2ESMA 5AM6A 4EK4A 4ZY6A 3ZYAA 3S3IA 2UV2A 1WVWA 4EH3A 3UMWA 2GTNA 3P78A 4ZMFA 4QYGA 5AR3A 4OTHA 4EUTA 3IQ7A 4FSRA 4YJSA 5FD2A 2I1MA 4IFCA 2C1AA 3GCVA 2UW9A 3PZEA 4JL9A 5BPYA 3IS5A 2OGVA 5HLNA 2XM8A 4ONAA 4XMOA 3WF6A 4PNIA 4PMMA 5JEBA 4K1BA 4FTNA 4BBEA 3PY0A 2BZKB 2GFCA 2OJIA 2PTKA 3R9OA 1JBPE 2C4GA 3P5KA 2ZDTA 4YURA 3FHRA 3ULZA 1RQQA 4MTAA 1BL6A 2A0CX 4EL9A 3W32A 4HVHA 5DEYA 3QU0A 3R1SA 3PJ8A 3BYVA 4USDA 3IOPA 4FKPA 2CGUA 3C9WA 5FEQA 3BGQA 4LGHA 3V3VA 5HE1A 1UU9A 3Q9YA 4CCUA 4MXCA 2UW4A 4IB1A 3ORTA 4IWPA 2QLUA 3NUPA 4O96A 3WF9A 2IZSA 2QNJA 4BTFA 4ZLOA 4PF4A 4BCHA 4JOAA 4EC9A 3HECA 2VO6A 4RG0A 4WA9A 1OPKA 5K5XA 4RQVA 4QMVA 3ZO1A 4BN1A 3RCDA 3ZEWA 4UWBA 5ANIA 4ANSA 2ITZA 3DZQA 3G0EA 3G5DA 4PL4A 4UBAA 1IG1A 4PMSA 1R78A 4J97A 2WOTA 3FMDA 4KIKA 3BWJA 4OBQA 5BQ0A 4EBWA 2SRCA 2ETKA 4V0GB 2GNFA 3VF8A 4EUUA 5A4CA 1OIQA 2W1GA 4GG7A 5LMAA 5IQFA 1XO2B 4OUCA 2WO6A 5HCYA 2PUUA 3QZHA 5DT4A 3ZRKA 3MVLA 4TYIA 4Q5HA 4MXXA 4G6LA 4RJ6A 4IE9A 3PP0A 3EKKA 3MDYA 2R3LA 4CFWA 4ZEGA 3PLSA 4EOMA 3NS9A 3PSBA 2YJSA 2OJGA 3E63A 3V5JA 4F63A 4YUQA 1J3HA 2I0HA 3LFFA 3Q60A 2YDKA 3DAEA 4YU2A 4AZFA 3AG9A 3R30A 3KMWA 3O8PA 4L44A 2PE0A 4E1ZA 3Q52A 3KL8A 3QKLA 4RIXB 5E8SA 2PVLA 4UXQA 4IAYA 4GFGA 1JLUE 3C5UA 2QOQA 2GNGA 4FG9A 4K6ZA 2BDJA 3DAJA 4D2VA 2V22A 2VX0A 3FAAA 4IZYA 4FK3A 4BB4A 1YHVA 2J0IA 1ZY5A 2WGJA 2ZB1A 3EQRA 3RAHA 3GCQA 4BDIA 4QP4A 4TYEA 2YWPA 3F9NA 4R3PA 3ZS5A 4H1MA 5HU9A 4YJQA 4EQUA 1EH4A 5KMJA 5KE0A 1YI4A 2YISA 3SG9A 3KVWA 4IVAA 4RA5A 3BKBA 1OPJA 4MAOA 4CKIA 4WG3A 1JOWB 3KN5A 1Q4LA 1XJDA 3D94A 4QMOA 2A19B 2PVKA 4JQ8A 2PVJA 3PYYA 4JI9A 4HJOA 4JDHA 4L68A 5CEQA 3CGOA 4HPTE 1OIYA 3FKLA 4Z55A 1GIHA 3MPTA 3PPZA 5H8EA 4QTEA 5AP0A 4IFGA 4QMYA 2HWOA 3KU2A 2XM9A 3CJFA 5E8WA 4B99A 2VD5A 3IKAA 4UMTA 3WIGA 3F5UA 4O7WA 4FNYA 2I40A 2V5QA 2Y6OA 4O0TA 4YJVA 4BVUA 4RVLA 3F82A 3LXNA 2OZAA 2X9FA 5C8MA 1Q24A 5LOHA 2BZJA 3MJ1A 2QO2A 4FZFB 3LQ3A 5CU2A 4V01A 5FXQA 4GW8A 3BCEA 4IC8A 4BBMA 3HAMA 3WZEA 4H3BA 3UO5A 3BHYA 1BKXA 4TKSA 5E91A 5KMKA 3S0OA 3EN6A 4GU9A 3RM7A 3ORPA 2XBAA 2PSQA 4QYHA 4AZSA 3EN5A 4OW8A 3L8SA 3UC3A 1ZZLA 4X6RA 3ORKA 3OS3A 2JFLA 3HDNA 4R3RA 2VGPA 3TN8A 4L43A 4PX6A 1R39A 4FV2A 4EHGA 2ZM1A 4BCIA 4BHNA 5HD7A 4ZTMA 3IW8A 5CQWA 4D2PA 5AX3A 3UPXA 3PZHA 3AC2A 5BX0A 2JDRA 3CEKA 3EQBA 3V5LA 3MY5A 2W1DA 1F3MC 4TWNA 1STCE 2F49A 3D5XA 4YO4A 4EHEA 4A06A 3DPKA 3HP5A 4MXAA 2JKQA 4BZNA 5EW8A 2OIQA 4F0IA 3RWPA 1XH5A 1AD5A 3RZBA 3WZKA 1VZOA 2BKZA 4O6EA 2WU6A 5A4QA 5HE3A 2HWPA 3BU3A 4H58A 1FOTA 4IBMA 3SW4A 3T3VA 2I0EA 4HCUA 2OIBA 3K3IA 5A54A 3NVKI 1KE6A 4WSYA 4QOXA 2CKOA 2F4JA 3POOA 4AFJA 3OHTA 1OVEA 4QT1A 4X3FB 3PY3A 3I1AA 3OT8A 3P0MA 2Y8OA 1GZOA 5EHYA 1J91A 3FLYA 3LFBA 4PDPA 3K5UA 3W8LA 5I9WA 1KE8A 2CGWA 2VU3A 4DYMA 3TXOA 4U81A 2JDSA 4EOIA 1NY3A 4ANMA 4C36A 3K3JA 4RIYA 3WI6A 3ALOA 3ORMA 3RCJA 3VS5A 3U6JA 1YDRE 3F5GA 4FL2A 5E4HA 2A27A 5JGDA 2C0IA 1H1PA 3RI1A 3UC4A 5J5TA 4OTQA 2H8HA 3VS3A 4NU1A 4ZLYA 2OK1A 1B38A 4LRJA 3F2RA 3QRJA 4F1TA 3QD4A 3UBDA 2JITA 4YHJA 4P7EA 3JY9A 4D4YA 4JRVA 3P7AA 3TDVA 3O17A 4FNWA 4D9UA 2PMOX 5TO8A 5AUYA 3S4QA 4A9UA 3GOKA 1ZMWA 3GFEA 3G0FA 5ETFA 3VF9A 4CFMA 4LL5A 3DQXA 3UVRA 1CTPE 3OOGA 4ASXA 3EKNA 4W4XA 1Y8GA 1U46A 1XH4A 2YIRA 4MEDA 4YJNA 3A8XA 1PXIA 2XK8A 3QD3A 3UOLA 4YZBA 4FV1A 2QG5A 4UMUA 2O2UA 1QPJA 4YNOA 3FKNA 3BPRA 2HZ0A 2QLQA 4I0TA 5AV2A 5DLSA 1MQBA 2GHMA 1YQJA 4EZ7A 2Z8CA 5DRBA 2JIIA 2QONA 3I0OA 5K0KA 3DB8A 3UO4A 4DG0E 3EZRA 5CAOA 4IZAA 1FMOE 3NW7A 4FIJA 4HVGA 2QC6A 4I6HA 4M13A 4IJPA 3MTLA 2JC6A 1LUFA 3LZBA 3OXZA 4APCA 1O9UA 5J7HA 2VTOA 4FV7A 2C3KA 3UQGA 4ACGA 4GJ3A 3O96A 3Q5ZA 2R3MA 4AU8A 5DH3A 1ZLTA 3D5WA 3MN3A 4BBFA 3PTGA 4FSZA 2OSCA 4D58A 4C3RA 3R7EA 3FMJA 1PY5A 1REKA 3DFAA 4F9WA 2CN5A 4BTMA 1OB3A 3LJ2A 4IM3A 3I5ZA 1T45A 4DTAA 2XK3A 2BAJA 5C1QB 4E4MA 5J7BA 1JKKA 5L6PA 1CMKE 2BCJA 5K0XA 4F99A 3OUKA 1M2QA 2IVVA 2XIYA 3GNIB 2XEZA 3R83A 5FTGA 2WQMA 3I7BA 2JDVA 2XK9A 3NW6A 2JLDA 3TUCA 2KULA 2YCRA 1KOAA 2QOFA 2XNNA 1WCCA 4GG5A 4K9YA 3MY0A 2VNWA 4OTFA 4EH5A 3P7CA 4A4LA 2WMUA 2C5YA 3OVVA 3FZTA 1URCA 4F7SA 5HTIA 4L3JA 5KZ0A 4CMOA 2UZBA 3BYSA 5T6KA 5HTBA 2Y7JA 4NIFA 5FTOA 3UNZA 5AIRA 5D12A 3R2BA 3FI2A 5DMZA 1A48A 1ZYCA 4AA5A 5CNOA 3D2KA 4MXYA 3UVPA 4EJ7A 3LHJA 5E8TA 4O0VA 2WTKC 4YJTA 4NM0A 5CT7A 3BHVA 4FTOA 5JMSA 2J0LA 5IUIA 3NVMB 5B2MA 3OZ6A 3TWJA 3HV7A 5ANOA 5C03A 2PVMA 2PU8A 2VAGA 3NYNA 5CVFA 3UIXA 3MA6A 4H05A 4AS0A 2FSOX 1G8AA 5HORA 4JX7A 5DEWA 2J90A 5ETAA 3QUPA 5HKMA 1FINA 4KSQA 4C57A 5EKOA 2G01A 5HX6A 4JIAA 1QL6A 4NJ3A 5J79A 4APPA 4GU6A 4AGDA 2BFXA 4ZIMA 1JSTA 4CRSA 4ZTSA 4I94A 3C4ZA 3TUDA 5HGIA 2R9SA 2VRXA 2PY3A 3IDPA 4FEVA 5HESA 5HG8A 3FMMA 3A2CA 3THBA 4FSWA 1FVTA 3H3CA 1UKHA 2OI4X 4L01A 4RX5A 1JNKA 4GVJA 2UZDA 4Q5EA 2W4JA 3ZC5A 2QCSA 4L9IA 4QMPA 3PG3A 2PUIA 1OL5A 4CFXA 3ZZWA 4D28A 3R04A 4C2WA 2UZEA 3V5WA 5BVDA 2OF2A 2YA9A 2R5TA 4QRCA 4FF8A 1NVRA 1Q3DA 5JT2A 3R8VA 4CLJA 3C1XA 4X21A 2VN9A 5A14A 3KXHA 3HMIA 5TF9A 5I9VA 4ZSGA 4DFXE 2GSFA 1L8TA 3CBLA 5HE2A 3POZA 3TKHA 4UN0C 4FKWA 4PPCA 3OOMA 2R4BA 4QPAA 4U7ZA 1GY3A 3IOKA 5LWMA 4DINA 5AR7A 4G9CA 4JS8A 4DFBA 3JXWA 4QP3A 3IW7A 5DNRA 1U54A 2VWIA 3I60A 4FKIA 3Q4ZA 3QWKA 4FSQA 4CLIA 4F7LA 5HOAA 4FT3A 4J99A 4CKRA 5AR4A 1JVPP 3KF4A 1SVGA 3PVGA 3HDMA 4DFNA 5BVKA 2DS1A 1W83A 4OGRA 4TNDA 4OTWA 4FSYA 5HQ0A 2ACXA 5EI2A 5FUTA 1GOLA 5M09A 2XUUA 4MKCA 3H10A 5AADA 2VTRA 2ITUA 2BUJA 3KQ7A 1JQHA 4FEXA 3NYVA 3OY3A 3I81A 3Q9WA 1OBGA 2OLCA 3QLGA 4XCUA 1W7HA 4L8MA 5M08A 4RX7A 3LQ5A 2VTAA 2XKFA 2F2UA 4LG4A 2CPKE 1YHSA 1W82A 3FC2A 4IAZA 2B9IA 2PWLA 4AZTA 3LKMA 4AF3A 4O27B 2O8YA 3QD2B 4RC2A 3SAYA 1ZYLA 2CSNA 3LJ1A 3NAYA 3KEXA 2CGVA 4GFMA 5LVLA 3GC7A 4BI1A 5A4TA 1YXUA 5IQAA 1WBOA 4PL3A 4G9RA 3UOHA 3D7TB 3P1AA 4RA4A 5FEEA 2HY81 1V0PA 1TVOA 3AOXA 3QD0A 3ZLSA 4AQCA 5IQIA 3C4EA 4M14A 2GDOA 2BHEA 2VNYA 5KX8A 2QKWB 3CCNA 4BKYA 4DFYA 3QBNA 5HBHA 3U4UA 4I6BA 4HYUA 3RALA 2O3PA 5J9ZA 4ZLZA 4NCTC 3LOKA 4FKOA 3KXNA 1OM1A 2OJJA 4XOYA 4C4GA 4I5MA 5EYKA 3EQPA 2FA2A 4FZ6A 1Q8YA 2EXEA 3D9VA 1URWA 5I5ZA 1YWNA 2WQEA 5ANDA 1CKPA 2WQBA 4OTRA 2YZLA 4O7LA 5EM8A 1OKVA 2PZRA 1YW2A 4EI4A 4S2ZA 5HO6A 2BDWA 4BKZA 4UX9A 4G1WA 4G5JA 2H96A 3CD8A 3O7LD 4GKIA 3ZH8A 4JXFA 4KWPA 4RJ5A 3C0GA 4F08A 2YEXA 1Q62A 4BF2A 3QUEA 5K4IA 1UU3A 4ENYA 4RWLA 3RP9A 4FT5A 3EQFA 4A9RA 1JWHA 3DJ7A 3BHHA 4UYNA 5BVFA 1KV2A 3KULA 4JX3A 4ZTLA 3VS2A 4YHFA 5AP4A 3FLNC 4EH8A 4PQNA 4Y85A 5I3RA 3NAXA 4QTDA 3KGAA 4DLJA 4GFOA 2HCKA 3Q96A 4NW6A 2ZMCA 4GS6A 5J9LA 2EXCX 4J53A 5CZIA 3UE4A 4CFFA 4E8AA 3U9CA 4RGJA 2LAVA 2ITVA 3ZRMA 1ZY4A 4I4EA 4CFVA 5IA2A 3Q04A 3R6XA 3VNTA 4U9AA 2UW6A 3QWJA 3ORZA 1PRYA 3TIZA 1Z5MA 2V7AA 4RBLA 2C6DA 2UZWE 3MPMA 5EM7A 2VWWA 3CD3A 4DGMA 1WBSA 4WSQA 4O81A 4JAIA 3A7JA 4ZS0A 5CANA 2WMBA 1YHWA 4MD9E 3ZBXA 2R3NA 4ACCA 5EHLA 5EM5A 4RX9A 4EK3A 3BEGA 2JFMA 3MWUA 3PJCA 4L52A 3DT1A 3DBQA 2W1EA 4M12A 1WMKA 3BLRA 5HE0A 4FIGA 4FIHA 3BBWA 4IAIA 3SKCA 4EKKA 1YRPA 3BYMA 4JT3A 3H4JA 3OMVA 4D9TA 5KHWA 3O2MA 4J52A 3CSVA 3R71A 4QTAA 1HCLA 3R8MA 3DXNA 3ELJA 1MUOA 3N4TA 2PVNA 2YDIA 3SC1A 4JR7A 4FIEA 3ODZX 4KBAA 3FKOA 3JS2A 3JVRA 3RINA 4BGQA 5JFWA 5L4QA 4TW9A 3MH1A 4WHZA 4U41A 3QQUA 2IW9A 4A9TA 3FY0A 5J8IA 3VBYA 1PF8A 4K0YA 4AGUA 3C0HA 4WNMA 3BHUA 5JGAA 3PA5A 5J9YA 3UNJA 3LXPA 2WTWA 1O6LA 2X1NA 2YM5A 3BX5A 3OBJA 3KRWA 3OT3A 4FG8A 1OITA 4FIIA 4QPMA 1IEPA 4IZ5A 4V0GA 2WMVA 5FRIA 5IUHA 3DV3A 4DGNA 4QP6A 2PVYA 2WHBA 4H3PA 4I0RA 5CSHA 4L6QA 3VW6A 5HBJA 1IAHA 2RG5A 4GK4A 4YMJA 3DK6A 2CNVA 1YXVA 3DBDA 5HLWA 3IGOA 4C58A 1Q3WA 3F3ZA 2W06A 3WYXA 5F9EA 4RJ3A 1WZYA 2OFUA 4FKRA 4BFMA 2P2IA 4BDBA 3H9RA 2I7QA 5K4JA 1ERKA 5LARA 2R7BA 3WF5A 4D0WA 4UMPA 1MRYA 3HVCA 4YZCA 1MRUA 3CKWA 1PHKA 3RPVA 3QCSA 3F7WA 4RIXA 4L42A 3PE1A 3HEGA 5L2QA 3HYHA 2JKKA 2X6EA 2OXYA 4FKQA 5L2IA 2JKOA 3OCTA 1ATPE 5GJDA 2WNTA 3R28A 3QYWA 3W1FA 2BFYA 3CQWA 4C61A 2C5XA 4XS2A 5TR6A 3DJ5A 1TQMA 1OZ1A 3R21A 3RNIA 3VUGA 3Q4CA 3VUKA 4MYGA 3C50A 3VS7A 1R0PA 1KUTA 4FTMA 3KFAA 4L46A 4DEDA 4F9BA 1NA7A 4HZRA 5GNKA 3QA0A 5DWRA 4ASEA 5DI1A 1QPDA 4I6QA 3DTWA 4ALVA 4ZS4A 5HI2A 3QTUA 3HL7A 4USEA 3HA8A 2PULA 2FSTX 3VRYA 3HX4A 2R3JA 3FZRA 4WNOA 2XEYA 4B6LA 4BDFA 3KXXA 4YC3A 4EKLA 3KXMA 1DS5A 2QHNA 5AP1A 5KZIA 4NFNA 4AA0A 4E6CA 2CCHA 3DK7A 4Y8DA 3FLZA 2XH5A 4X2KA 3ORXA 3ACKA 2BAQA 2W96B 3QYZA 3M1SA 4EH4A 2WEIA 4RFZA 2WMWA 3GU7A 3LQ8A 2VUWA 3BBTB 4IIRA 4TWOA 4XBUA 1IA9A 5E90A 4F6SA 3SX9A 3FSFA 5K5NA 3R9HA 3R73A 3UP2A 4X0MA 1UNLA 1YWVA 3HUBA 1U5QA 4RLLA 4Y95A 4AT4A 4F0GA 4X6QC 4CV9A 4DGLC 1DI9A 4Q9SA 2OXXA 3MFRA 4HGTA 5DR2A 3OTUA 2CNQA 2UW3A 2WELA 3F3UA 4JNWA 4EYMA 5D11A 4O7SA 4IVBA 4F64A 5CASA 1JSVA 2P55A 4CYJA 3PXYA 3ZEPA 2GNHA 4XV2A 4A07A 3CS9A 2PL0A 3BV3A 3D4QA 3DQWA 3DA6A 4ITJA 5LJJA 3VUTA 2P4IA 2CKEA 3ETAA 3PSDA 5DT0A 4B7TA 5IF1A 4YTHA 4O84A 2PMLX 1JKLA 1P5EA 5A9UA 2C3IB 1R0EA 3H0ZA 4RVMA 1GIJA 1DAWA 5IDNA 4YC6A 3K2LA 2X81A 2FGIA 1CKJA 5H8GA 3UODA 4FV0A 3HMMA 4FOBA 3WZDA 5E8XA 3GEQA 3S2PA 2W7XA 3ALNA 1M52A 2IVSA 2OXDA 3AT4A 3LFQA 4AE6A 1H27A 1CDKA 2R3HA 1SNUA 1Q8TA 1REJA 4HOKA 4JDIA 5EW9A 4ANQA 4EOQA 2QO9A 4QNYA 4Z7HA 3DLSA 3BU5A 3KMMA 5EYDA 5H2UA 2XK4A 4X2GA 4KS7A 3F3WA 3C13A 4MX9A 4X3FA 4HZSA 5AX9A 3TT0A 1PW2A 4XLIA 5CS6A 3HKOA 3VBTA 4UZDA 2C5NA 3C0IA 3LIJA 4KAOA 4ACMA 2XJ0A 3RHXA 3T9TA 4AUAA 4FZ7A 4H36A 4D55A 3ANQA 4XYFA 2VTPA 4G3CA 4ITHA 4FSNA 2ETRA 4OAVB 3EQHA 4O82A 4B4LA 2JKMA 3REPA 4TY1A 4WRSA 2HENA 2XB7A 5E9EA 3OUNB 1A06A 2C6LA 4U8ZA 2OKRA 4FUYA 3UOJA 4OAUC 1WVXA 2Y4IC 4OTDA 4GUEA 4N4SA 3GCUA 1XH6A 4IB5A 4ZK5A 3EL8A 3GC8A 4RLKA 2WIHA 1IA8A 3RPOA 2JBPA 1YXTA 3GCPA 2W1HA 4OT6A 4W8DA 5ANGA 5FXSA 5F94A 1GZNA 3KN6A 5I4NA 1I44A 4E6DA 3IW4A 5A4LA 5KBRA 2O65A 3UDBA 3QF9A 4ASDA 2C6KA 3OCSA 3KK8A 4UWYA 1PKDA 4F7JA 3DNDA 5CAUA 4X2NA 3R7VA 1V0OA 1Y57A 3DKCA 5CTPA 5IMEA 4TNBA 4AT3A 4DBNA 3P08A 5HG7A 2PE1A 2BTRA 3OD6X 1V1KA 3VS0A 1SVEA 5AUTA 4MF1A 5HNIX 5LVOA 4CT2A 3VBXA 4RWIA 3MV5A 4BRXA 4EEVA 5IDPA 4HVIA 3VN9A 4CVAA 5AMNA 3O71A 3LPBA 3WE8A 4XG2A 5TE0A 3V04A 3NUXA 2GHGA 1ND4A 3PDTA 4R7BA 3WZJA 4N57A 3TTJA 4O6LA 5HG5A 3JR1A 4QYYA 5EHOA 3DLZA 2R2PA 3HV3A 4XV1A 2EB3A 3UP7A 4CEGA 4E6AA 5HLPA 1KSWA 3VHKA 3EFJA 3NDMA 3ZSHA 3HNGA 2WTKB 2GQSA 3FQEA 3LXKA 4D2TA 3T3UA 4PWNA 1W8CA 3FY2A 3PPJA 4J96A 3W2RA 4JLCA 5AM7A 3AGLA 4QNAA 3MVJA 1H1RA 5JQ5A 5AV0A 4Q9ZA 1GJOA 2GCDA 3Q2JA 1LEWA 1RJBA 3AD6A 2QI8A 4KKGA 5KMLA 4GK3A 2YCSA 3U4WA 1FGIA 1TKIA 3H9OA 3IDBA 3TACA 3PIYA 4KD1A 3ZBFA 4LUEA 3ZUTA 4HCTA 4PNKA 5KUPA 5AEPA 1ZYDA 5CU3A 4UXLA 4F0FA 2RL5A 3GU6A 3LVPA 4AX8A 3SXRA 4QP9A 3FI4A 5EOLA 5ANEA 1Y8YA 4NT4A 4Y5HA 3WF7A 4M69B 3RHKA 4ANLA 3QTQA 2ITWA 3EB0A 3COMA 3BYOA 1UNGA 2EWAA 2YITA 3EN4A 3FXXA 4KKEA 5FP5A 2OWBA 4ZTRA 3W2OA 4S32A 1U59A 3TZ7A 3NUAA 5I9UA 5BUIA 2BILB 2XKEA 4N0SA 5CEOA 5DOSA 3SXSA 4O0WA 3SOAA 5M06A 1K3AA 3L9PA 4YTCA 4FKGA 4UWCA 4L00A 2YM6A 1Q41A 3TG1A 4ANOA 2XNPA 2Z7RA 5FXRA 2ITNA 2NP8A 2YHVA 3AC3A 1OL6A 3HRCA 4JBQA 4MCVA 2X6DA 4N6YA 3AC8A 4FR4A 1LR4A 5CNNA 3ZLWA 4E3CA 2P3GX 4ZSAA 3WF8A 4FV9A 4IB0A 2B4SB 2OO8X 4QYEA 1XHAA 1V0BA 1FVVA 4FX3A 4F6UA 3NNXA 3W2QA 4NK9A 2VWVA 2I0VA 4CTBA 4CG8A 4R8QA 1HOWA 2VTQA 3TI1A 1ZYJA 4J71A 1DAYA 3FZ1A 4RVTA 3FZPA 2X7FA 4FYOA 4DN5A 5IMXA 5KKRB 4YGAA 4M66A 4QD6A 3LLTA 3HV5A 2PZIA 1Q61A 3DKGA 3UMXA 2UZUE 5KHXA 4B8MA 3Q6WA 3AMAA 5L6OA 3OP5A 3FMLA 4M8TA 4JG7A 4DH7A 3BWFA 2CLQA 2OZOA 4XEYA 2V55A 2HELA 4F09A 3FMKA 5M44A 4I22A 3UG2A 4GT3A 2XNOA 4ZTNA 4RT7A 1GIIA 3CQEA 5JRSA 2YFXA 2VTMA 5AP6A 4QMQA 5KMOA 3QXOA 4CFUA 1JKTA 3QZFA 2XKCA 5FGKA 2GNIA 3FSKA 1IASA 3VIDA 3KRXA 2ZDUA 4AXAA 3R9RA 4FTJA 4CG9A 2ITPA 2XMYA 3FEGA 2R0IA 3OWPA 4ZZNA 3VBQA 3TM0A 2ZVAA 3U6HA 5HBEA 1VYWA 4OLIA 4D2RA 4ZSLA 5BUEA 3MVMA 3ZDUA 5IH6A 3PLAE 4ZY4A 4F7NA 2GFSA 4YP8A 3R22A 1U4DA 3SXFA 2R64A 4D1ZA 1ZARA 4FT7A 4MWIA 3EN7A 4XOZA 4RIWB 3RBWA 3OCGA 4EYJA 3PXKA 5AWMA 4EWHA 5CT0A 3FLSA 4RPVA 5AUZA 5DG5A 3TNIA 5GHVA 4UYAA 4ZMEA 4F4PA 1E1VA 3GENA 4J95A 4TYHB 3HLLA 5GZAA 3NMUF 2YJRA 2YABA 4H39A 4DF3A 2I0YA 5JK3A 2IO6A 3BYUA 4IVCA 4Q2AA 1Y91A 5AIKA 2O63A 1YI3A 3D7TA 3QCYA 4EOLA 2BKKA 3VHEA 5L2WA 4CFNA 1E9HA 4PP9A 2UZNA 3GXLA 3MGYA 5CSVA 4QMSA 4UEUA 5E8UA 5D9HA 4BDDA 3H30A 2BRNA 5BVEA 4ZJVA 5GINE 2Z7QA 2NRUA 3COKA 2GU8A 4IMYA 1F5QA 4CMTA 5TT7A 4TTHB 4XG8A 5BYZA 3G6GA 2B9HA 2R7IA 2H6DA 1P4FA 1QMZA 5CU6A 4I24A 3DXPA 3B8QA 4GIHA 3QQLA 1M17A 4LI5A 4UB7A 4DG2E 1H28A 5CF5A 3PVUA 2ERKA 4FTQA 5HCXA 4YJUA 4LRMA 4QP2A 3PRIA 1WBVA 4XRJA 4FA2A 3GOPA 4V05A 4GMYA 3CXWA 5D41A 3QRUA 2XA4A 4O22A 4E26A 1MQ4A 4IB3A 4O91A 3QZIA 1XWSA 3N9XA 4Z16A 4EWQA 2H34A 3MY1A 4U3ZA 1NVQA 4D1XA 2YWVA 3FMHA 4K8AA 4L7FA 4G3FA 3GFWA 5DR6A 1WBPA 3OWKA 3U9NA 2W1ZA 3UOKA 4OTIA 2W5BA 4R78A 4FZAB 4C2VA 2XCKA 3V51A 4RX8A 2EVAA 3FXWA 2WKMA 5CQUA 1YOJA 2KTYA 4EOKA 5E1EA 3LCDA 5HU3A 2GMXA 2CGXA 2IZTA 2W1CA 4FE2A 3MESA 1GAGA 3MBLA 3NZ0A 4KBKA 5FQDC 4BDAA 5CF8A 3F5PA 5FM3A 1H8FA 4DEEA 5FDPA 2X2LA 1PKGA 5E92A 1OKZA 1I09A 5AR8A 2PZYA 4LUDA 4TRLA 2J0JA 3OXIA 3I7CA 5AFVA 3I79A 4LOOA 4DE4A 2F57A 3PP1A 3P23A 3FL4A 3LE6A 4R7HA 4YHTA 4B9DA 5A6OA 1R1WA 4EORA 4O7ZA 2QOCA 5HX8A 5IPJA 4PTEA 5LVNA 4DITA 2HYYA 5IH5A 4RC4A 1OI9A 4O0YA 1WAKA 3RZFA 4I21A 3ZRLA 4IZ7A 2WFYA 2XK7A 5IA0A 1NXKA 3ZZEA 4GCJA 3W2SA 1PXMA 4NW5A 4TYGA 2J50A 3WZUA 3ZSIA 2B55A 4PP7A 2NPQA 2ZV8A 4A4OA 4NTTA 4KUJA 3SG8A 3RPSA 4MNEB 4XG6A 4G6NA 1KOBA 2B0QA 2XIZA 4F1MA 4E4XA 2ZJWA 1OUYA 5EYMA 4HNFA 4EH2A 4ZP5A 4K77A 2EXMA 5HTCA 3E88A 2CKQA 4ALUA 3ZUVA 2IG7A 3FBVA 4XG3A 3C7QA 3ZLXA 3BE9A 2YM4A 1WFCA 3PA4A 4KKHA 4PPBA 4BYJA 4PY1A 3RK9A 5GIPE 2F9GA 3WIKA 4KA3A 2JDTA 5ANKA 5IEYA 2QODA 4CNHA 2PMNX 3IGGA 5BYYA 4MD7E 4O7TA 1KV1A 3U54A 4IDVA 1PXPA 5G6VA 3QQFA 4IANA 4TWPA 4MD8E 4WNPA 4JG6A 4BZOA 4KABA 3TKUA 5AAEA 3EQCA 4FT0A 4PDOA 2W05A 3UYSA 4G31A 5F1ZA 3VRZA 3UG1A 3KCKA 3RM6A 2WTIA 4LFIA 4O21A 3UPZA 4CQEA 2ERZE 4UY9A 3EYGA 5CXHA 2X8EA 2BZHB 4TPTA 4C4JA 1OBDA 1PXJA 5L3AA 3MYGA 4QTBA 2XIXA 3N4UA 4JAJA 4IX6A 4CV8A 3F2AA 3F7ZA 4A4XA 5DR9A 3UO6A 3AT3A 1XKKA 2J51A 2X7OA 1RDQE 2GNLA 4NEUA 2YZAA 5J1WA 2W5AA 3FPQA 3BELA 1APME 4U80A 4O7RA 5IG1A 3R63A 4FZDB 2QOIA 2Y6MA 1JAMA 2QO7A 3AMYA 2QOOA 3V5TA 4O7VA 3AD4A 3SQQA 3OFMA 4HW7A 3G15A 1OIUA 1VJYA 2CDZA 3EHAA 2OIDA 4MWHA 4CCBA 2C5VA 2E9OA 2JDOA 2WB8A 4O0RA 4C59A 5BYLA 1IRKA 2WZJA 4XBRA 4FI1A 2GPHA 5F4NA 3ROYA 4E4LA 1Q5KA 2FB8A 1ZOHA 2YIXA 3NIZA 1X8BA 3LJ0A 1M2PA 2G9XA 2RG6A 4LMUA 2HY0A 1H07A 1ZWSA 4BCMA 2ITQA 4LM5A 4J1RA 4AACA 3P7BA 3N4VA 2UZTA 3W10A 5J5SA 4CKJA 2RFDA 4U40A 5L8LA 2XRUA 2UZVA 3UYTA 2YM8A 3GC0A 5C26A 3MH3A 3QRTA 3KF7A 3GU4A 3PFQA 2VGOA 4FV8A 5BMMA 2V7OA 1SM2A 3TNHA 2Q0BA 3QLFA 3WBLA 3L1SA 4IAKA 4NTSA 3Q32A 4FV4A 4FSMA 2FO0A 1OKYA 4L3LA 1UNHA 3LFAA 3SGCA 2C5OA 3FI3A 4FMQA 4ZZMA 4HNIA 4IDTA 3LCKA 3D5UA 2QKRA 5FTQA 4X3FC 5F20A 2EU9A 2VV9A 3E64A 4FTKA 4QTCA 4BDEA 4CGAA 3GU5A 3PXQA 3UQFA 3QAME 2YIQA 5EQYA 3BEAA 3SD0A 4XX9A 1W98A 4XUFA 3KRLA 2R3GA 2BVAA 3CJGA 3RNYA 4FV5A 3VQHA 4QQ5A 2C30A 3P9JA 1G5SA 1UA2A 4RFYA 4O0SA 4O0XA 4C34A 2BAKA 3DAKA 5CX9A 3UIUA 3MPAA 5FM2A 4BDGA 4DEAA 3RJCA 4JIKA 5M56A 1OMWA 5BNJA 5CZHA 1OUKA 4XV9A 2XNGA 5JFVA 5AJQA 4ZJJA 2PYWA 5B2KA 4EZ5A 4IH8A 1L3RE 3QXPA 2OF4A 2QU6A 4DTBA
chains in the Genus database with same CATH superfamily
3Q9ZA 4XG4A 4ENXA 4XG9A 3KREA 4LOPA 4FKVA 4HPUE 3U87A 4ASZA 4AW5A 2QU5A 1R3CA 4ZTHA 4FG7A 4DFLA 5M57A 4V04A 3ORLA 4FTUA 5D7AA 4ZTQA 2YIYA 4MUQA 3F6XA 5TKDA 2BRBA 4BIBA 3PRFA 4BHZA 4U3YA 4RIOA 5EQPA 4HGLA 3SOCA 3W8QA 2QOHA 2E9UA 5CF6A 2ZB0A 3IONA 4BZDA 3LM0A 3CY3A 4QPSA 2E2BA 5JFXA 2B9JA 5K9IA 2UZOA 3R01A 4GUBA 1H0WA 4EQMA 3QHRA 5HVKA 2ZV2A 4R5SA 3NNUA 2GQGA 2WMXA 3FLWA 4MXZA 5M07A 4D2SA 5IA1A 4OR5A 1GNGA 3SRVB 5JSMA 4LGGA 2FUMA 3MI9A 5DHJA 3FZOA 2W9FB 4YO6A 5LVMA 2ZYBA 3U6IA 3Q2MA 2BMCA 2QVSE 2ZV7A 4HGSA 1PYXA 2BRHA 4DEGA 2XS0A 3CP9A 2ZMDA 4NM3A 4MBJA 4QMXA 4PRJA 3EQGA 4O1PA 4XH6A 3F2NA 4YJOA 3BZ3A 4BWKA 4AWIA 5I9ZA 5HO7A 2YACA 4GYIA 4BCOA 5A4EA 2FSMX 3LFSA 3NEWA 1PMNA 4DC2A 2UW0A 1YDSE 3E7OA 1IAJA 4GK2A 3LXLA 3HA6A 3TYKA 1BYGA 3CIKA 3EFLA 4BCFA 3UGCA 5AA9A 3RPRA 4AG8A 2Z2WA 4EOSA 3RGFA 2B9FA 2ITOA 4NKSA 2ZAZA 1YWRA 4LL0A 4Z9LA 3QX4A 3ZLYA 3G6HA 4MQ2A 4Y72A 3COIA 2O5KA 2IJMA 3DDPA 3E92A 2VTJA 2UW8A 3ORIA 4RJ8A 4N70A 5JZJA 3WARA 2O0UA 2W9ZB 3VO3A 2YM3A 3EYHA 4WKQA 3V5PA 3V01A 2YIWA 3ZCLA 3MB6A 3C4FA 4YSMA 2CNUA 4FOCA 4AE9A 3MTFA 3V6SA 5AP2A 2QR7A 3GBZA 2C3LA 5E8VA 4FVPA 4G2FA 4E5WA 4NUSA 4KINA 3VQUA 1P2AA 3QKMA 4AOIA 1YXSA 3Q4TA 3OW4A 3U55A 2X8DA 4M69A 3D14A 2IVUA 4YC8A 1WBNA 3DOGA 4FRFA 5EDPA 5C01A 2C0OA 4G16A 1K9AA 4YSJA 4HYSA 4ACHA 3MVHA 4YJPA 4YZNA 2OU7A 4DA5A 3NLBA 4F65A 3QL8A 4HCVA 2NO3A 4FL3A 1Q97A 2XYNA 5CY3A 4B8LA 2UZLA 4O2ZA 2WD1A 3ZO4A 4PTCA 4P5QA 2IW6A 3CGFA 5ACBC 4I23A 4CTCA 3F3VA 4EBVA 4K11A 2ZM4A 3G51A 2X39A 4FK6A 4QMLA 2C68A 4BKJA 5IU2A 1B39A 2HAKA 3AC1A 3QUDA 4LOQA 4LV8A 3LFCA 2VTTA 3QQHA 4LMNA 4RWKA 3OWJA 4KRCA 4P90A 2Q0NA 5CU4A 1H1WA 3FZSA 4DG3E 2NNWB 5KNJA 4C35A 4BJJB 4I3ZA 4N6ZA 3ZTXA 3MFUA 4GIIA 5KO1A 3MW1A 4DFUA 3NYOA 3OEFX 4NJDA 3I0QA 3HV6A 2C0TA 2XVDA 3ENHA 2XIKA 3FLQA 4P2KA 2Z7LA 4QP8A 3R7OA 3SLSA 4R77A 4BCPA 2PPQA 5EG3A 1PXOA 2X8IA 4P5ZA 3D15A 2ONLA 5GJFA 3TV4A 4A7CA 3TDWA 4TZRA 1Q99A 3M11A 5DA3A 3KXGA 4C3PA 4MVFA 5IQEA 3AXWA 2R3KA 5BVWA 4DGGA 4FUXA 4BIDA 3CR0A 5I3OA 4EONA 1H08A 2XNBA 1FVRA 2P2HA 2GNJA 4FV3A 1NVSA 4W9XA 3ZUUA 2B53A 5LMBA 5AV3A 5DE2A 2CJMA 4O4CA 3AMBA 1BMKA 4UALA 4WT6A 5C9CA 4AFEA 5CSPA 4F9AA 1VR2A 4BICA 4FKUA 2GS2A 2UUEA 3FPMA 3SHEA 4NZWB 3CPBA 4R3CA 1KWPA 5JN2A 2IVTA 3LFEA 3IDCA 2HZNA 4BDKA 4O7YA 3HV4A 5DN3A 3TIYA 4F1OA 2G15A 4AA4A 1HCKA 2YM7A 5EFQA 2UW7A 1B6CB 1UWJA 4IC7A 4NCTA 3V8TA 3KIOC 4IXPA 3JYAA 4RJ4A 4R5YA 4I93A 4AN2A 3M42A 4C62A 2WTVA 2F7ZE 2ZM3A 3F66A 3I6UA 3Q4UA 5CI7A 1LEZA 4C7TA 3COHA 3QTWA 2ITXA 3C4CA 4MNFA 3KMUA 3W18A 2VO0A 4EK5A 4WRGA 4M3QA 4KSPA 1XH9A 2YLEA 4RIWA 1DM2A 4FNZA 3TKIA 4JR3A 4CT1A 3WYYA 3DY7A 2FYSA 4KIOA 4YZDA 2YDJA 3G90X 4AZWA 4NM5A 4XP2A 4II5A 1Z57A 2OJ9A 4Y5QA 3FQSA 4TYHA 3E3BX 2RGPA 3P79A 4DT9A 4I0SA 1M14A 2R3QA 4BYIA 2XJ1A 3DFCB 2XNEA 3KY2A 2WQOA 3MIAA 5E7RA 5E8YA 3W0OA 5M51A 3C5IA 2P33A 2QHMA 3QCXA 4EH6A 3JY0A 4DLIA 5LXMA 4L7SA 3DDQA 4HVDA 4FKTA 3TJDA 3TV6A 5TOZA 5HNBA 1BI8A 3A99A 3QTSA 4S30A 1XMMA 3QRIA 4QEBA 2XJ2A 3MA3A 2AC5A 1XR1A 2BDFA 4QQJA 4W4VA 4YBKA 5AUXA 4BCJA 2GQRA 4YLKA 4AAYA 3BRBA 3RKBA 2VWBA 2IN6A 3S1HA 4O1OA 3FUPA 4Z7GA 3ZSGA 4O38A 2R3RA 4JDKA 3PXRA 4BDJA 1YI6A 1FBNA 4QO9A 2CLXA 5C4KA 3ZC6A 4AN3A 4ZAUA 2QOLA 5EM6A 3EFWA 1CKIA 5M4CA 1ZXEA 4JBOA 3LFDA 5IA4A 4I4FA 5C8NA 4I92A 3GVUA 3R0TA 2UVZA 4FYNA 3WOWA 5JGBA 4TXCA 2JIVA 3ITZA 3OCBA 2V0DA 2VO3A 3BIZA 3A7GA 1WBWA 4OT5A 4GH2A 3ZXTA 2BTSA 5CSWA 2VTIA 3E87A 1Q8ZA 3QTIA 4LV5A 4F9CA 2PUPA 4L53A 4EH7A 4GKHA 3MIYA 5AP5A 4QMOA 4BTKA 4CSVA 3CPCA 5CEMA 4D4SA 3IECA 2CMWA 3R8UA 5AA8A 3JUHA 2VZ6A 3KRJA 4NYEA 5CYIA 5A3XA 4C8BA 2OICA 4XP3A 4M67A 5CLPA 3PWYA 1H26A 4AP7A 2CKPA 3MSSA 4QMMA 3GU8A 3VWAA 5FEDA 3ZO2A 3NSZA 2C47A 5FBNC 3ATSA 1Q8WA 1H0VA 3VJNA 3FJQE 3CY2A 3NCZA 3PUPA 1JPAA 2YAAA 3P4KA 3PY1A 3HUCA 4ZXTA 3WILA 5B2LA 1WVYA 2Y4PA 5BMSA 4GSBA 4R6VA 4K2RA 5IQCA 4J8NA 3HRBA 3NUUA 5I9XA 3U51A 1M2RA 5ICPA 3BV2A 1OL7A 3R1QA 3EFKA 2UW5A 4I20A 3E8NA 4RRVA 2OFVA 1W2FA 2QQ7A 4PTGA 2DUVA 5JH6A 2QG7A 3ZM9A 4XV3A 4DEBA 4EOOA 4WG4A 4R7IA 4BCNA 4CXAA 1ZMUA 1PJKA 2XIRA 1ZYSA 4D1SA 2CN8A 3ZM4A 4JG8A 3UQCA 3TV7A 4O4EA 2R0UA 3QX2A 2GHLA 5CVHA 4MNEA 3RAKA 2HW6A 1G8KA 4D4RA 5A46A 4JBVA 3FYJX 4KBCA 4EHVA 1P4OA 2BROA 3DXQA 2CCIA 2F7EE 4OTPA 4I1ZA 4PMTA 1SVHA 4MBLA 4A9SA 4DEHA 4OTGA 5M55A 4YLLA 3BLHA 4BDCA 4YZMA 3R9NA 2X0GA 4O86A 2HXLA 5M4FA 4AW1A 2RFSA 2OJFE 2XARA 1BUHA 1BI7A 2W4OA 4FEWA 2WMAA 2XYUA 2W17A 4WOVA 1YDTE 5IA5A 3GC9A 4OBOA 4U97A 5JRQA 3EWHA 3CC6A 3VS4A 2BZIB 1J1CA 4B0GA 2VWXA 5EDRA 4EC8A 4FEQA 3EN9A 4QP7A 3CKXA 4E73A 3PXZA 4JVGA 4AOTA 3LLAA 3PIXA 3A7IA 4RZWA 5KCVA 4QMTA 3F69A 3QKKA 5KMMA 2JD5A 2W0JA 4F9YA 2GS6A 3HMOA 2W4KA 3LFNA 4ZSEA 1F0QA 1PXLA 4IVDA 3UJGA 4DFZE 2BHHA 5HCZA 3EMGA 4BWXA 4NFMA 2QOBA 4WIHA 2WMRA 3TCPA 2G2HA 1PMUA 3V5QA 1CSNA 2OBJA 3QFVA 4NM7A 5HVJA 3PVBA 2A4LA 2BALA 3E8EA 4L45A 2C6MA 4I5PA 4W8EA 5K3YA 3G9NA 5HNGA 3BGPA 2J2IB 2VO7A 4JQ7A 3FMEA 3HP2A 4FKLA 1M7QA 1PMVA 3A62A 3EL7A 4ZJIA 5T3QA 2FVDA 4E20A 3U8WA 4GVAA 4I41A 2RSVA 4G5PA 2JAVA 4GL9A 1PXKA 2REIA 3RK5A 3W16A 3F88A 3MH2A 3BQCA 2W1IA 5GJGA 1OL1A 3D5VA 3DU8A 4IHPA 4NSTA 4QMWA 3BLQA 3ZOSA 5LWNA 5DT3A 5L8JA 4AT5A 5HIEA 1SMHA 2W1FA 3UIBA 4ZY5A 2JEDA 4E7WA 3UVQA 2YAKA 4MHAA 4BCGA 2YERA 3RAIA 3I6WA 3VS1A 5M53A 4YJRA 2A1AB 5LMKA 3DJ6A 2X4FA 1XBBA 3PJ2A 3PVWA 4EZ3A 4WO5A 5DFPA 3TEIA 1M7NA 4QMUA 3PJ1A 1ZMVA 4UZHA 4ZSJA 5CAPA 4JDJA 2XRWA 3MFSA 4EJNA 4RWJA 2X7GA 1W84A 4C38A 2XCHA 5LVPA 5EK7A 5B7VA 4I6FA 3KK9A 1ZZ2A 4CZUA 3H9FA 5EKNA 2EUFB 3E62A 3NPCA 3QC9A 4Y83A 5BUJA 1WBTA 3ET7A 3R1NA 4U6RA 5H3QA 3UNKA 1ZOGA 1SYKA 4FV6A 2J5EA 3OEZA 4JRNA 4FT9A 2VWYA 4WD5A 2RFNA 3IG7A 5DPVA 5FDXA 4D5KA 1UV5A 3SW7A 3R7UA 3IPHA 5DRDA 2R3FA 2WMSA 4G17A 4IW0A 3R7IA 3Q9XA 5EH0A 5AV4A 5HO8A 4WUNA 3OXTA 2IW8A 3O51A 3UDSA 4KIKB 4ZZOA 3QRKA 4FTTA 4J8MA 3CTQA 4KIQA 5J95A 4ITIA 4C4EA 4XHKB 3V8WA 2G1TA 2NRYA 3R1YA 2JBOA 4M97A 4C4IA 5IEVA 3R8LA 5AUWA 2F2CB 4M0ZA 1U5RA 4XP0A 2VTHA 2WPAA 4ACDA 4MXOA 3ID6C 3O5AA 3W0MA 4RJ7A 4DH3A 5AAFA 3E5AA 4D0XA 3AQVA 4IX3A 3ML1A 2J9MA 3A4OX 3QGYA 4A9YA 2PHKA 1BX6A 5CVGA 2PZ5A 5GZ9A 3GUBA 2FSLX 4FSUA 4XG7A 3GCSA 4FGRA 3B2WA 3NRMA 3ORNA 3TJCA 4U0IA 4EK8A 3S00A 3QTRA 4TN6A 4X7QA 3QTXA 4E93A 4PMPA 4AGCA 5EQEA 5D10A 3LCOA 2B1PA 4PDYA 3RWQA 1H4LA 2Y0AA 5M4UA 3SVVA 2O64A 5ACKA 4DBXA 3BGZA 4LRKA 4YNEA 3F61A 1XH8A 4DH8A 4BDHA 4U44A 4C3FA 3Q6UA 1OPLA 3K5VA 5FLFA 3SA0A 3NUSA 4W4WA 3T9IA 3OROA 5CALA 1G8SA 3ZDIA 3W0QA 4NWMA 1Q8UA 2YLFA 4JBPA 4M7IA 3LAUA 3R2YA 3QA8A 4C02A 4QQCA 3W2CA 5AUUA 5HEZA 2C3JA 3O23A 5E1SA 4F70A 3PIZA 5IQGA 1ZAOA 4WBOA 3PWDA 2BIKB 4FEUA 1J7UA 1T46A 4E4NA 4BI2A 2OH0E 2C1BA 3D0EA 1XQZA 3QALE 3OF0A 4X3JA 3SRVA 2F7XE 2QR8A 4MQ1A 3MJ2A 1OECA 3LMGA 4DH5A 5LQFA 3VUMA 2OZAB 3HRFA 3N51A 4FKJA 4M68A 4EK6A 1MRVA 3A7HA 1YKRA 4NH1A 5ETCA 3CE3A 1FMKA 4M84A 3AKJA 1FPUA 2XBJA 3DBCA 3FHIA 4O83A 5L2TA 2PVRA 2WTDA 2ITYA 3TNPC 4BGHA 2VX1A 3AGMA 3CTJA 4AW2A 1J7LA 4DGOA 3MFTA 2RFEA 3E8DA 2PVHA 2WEVA 2FH9A 4IM0A 4KIPA 4KRDA 4HVSA 3TMOA 3EIDA 4HYIA 3RVGA 3ATTA 1QCFA 1H1SA 4U43A 3VUIA 2HK5A 1LPUA 2GS7A 3FL5A 5ANJA 3R8PA 1RE8A 3KC3A 4S31A 2C6EA 5CEIA 1Y6BA 3H0YA 3IK3A 5I9YA 2BIYA 1BLXA 3FE3A 4TWCA 4ZOGA 1AGWA 4RSSA 5IZFA 2WTCA 2C6TA 3PJ3A 3VUDA 5AP7A 2UVYA 5HZNA 3E7VA 3LM5A 3T8OA 3C51A 3OTVA 1FGKA 3PXFA 2VTSA 5L8KA 2B54A 3QQKA 4YPSA 1BL7A 3KVXA 5DIAA 4AOJA 4MK0A 2IEWA 3DK3A 4HGEA 2OW3A 5CI6A 3NUYA 5D7VA 3ZFYA 3NFFB 2OG8A 4FSTA 4GJ2A 3OG7A 4FBXA 1KE5A 4H3QA 5CU0A 3LCTA 2Z02A 4IADA 1FQ1B 4DHZA 2XZSA 1J1BA 3TNWA 4CZYB 5KMIA 4BY9E 4AW0A 2G2IA 4O4DA 4UMRA 3SDJA 3MS9A 3E93A 3G33A 1JSUA 3BQRA 4GT5A 4K18A 1DI8A 4RMZA 4XNEA 3PG1A 4RVKA 3SV0A 4BL1A 2X4ZA 3Q5IA 4CQGA 4D2WA 2PE2A 4FKSA 3UDZA 4EOJA 1H25A 5EW3A 3VJOA 4PV0A 3KXZA 4CRLA 3VBVA 2J0MB 4G3EA 3UIMA 3PSCA 5HG9A 2A2AA 3DTCA 3O0GA 4FTIA 4O4FA 4RIYB 3RTPA 3L8XA 3FQHA 3RPYA 4Z3VA 3G2FA 4RZVA 2HOGA 3EQIA 3W55A 2UVXA 5G1XA 5KKRC 3EQDA 4ERKA 3WE4A 3HZTA 5EI6A 2ONLC 4QYFA 5B0XA 2BPMA 4ARKA 2E9PA 2ZV9A 3AD5A 3VVHA 2IPXA 4BI0A 3RMFA 4FTCA 3QTZA 4D5HA 4C33A 2ZFYA 2PK9A 5CSXA 1KE9A 3HGKA 4DTKA 3I4BA 2I6LA 4FODA 3GB2A 3O8TA 4DH1A 5IQDA 3QC4A 4IAFA 5HICA 4RFMA 3TUBA 1UVRA 4FIFA 2H9VA 4R1YA 3R7YA 3AT2A 1XBAA 4I5HA 3JPVA 4IX4A 4O4BB 4IEBA 3GP0A 2BRMA 3D7ZA 5AR5A 4AZVA 3L9NA 1OGUA 1OKWA 3L8VA 2E9VA 1OGYA 3BHTA 3F3TA 3FYKX 3CTHA 4TT7A 4G3GA 4FJVA 2W5HA 4EH9A 4IACA 1W2CA 4BJJA 2WMQA 3ACJA 3PPKA 3BE2A 3TZ8A 2CHLA 5F95A 2IZUA 2VTNA 5E8ZA 4OBPA 3FMNA 1PYEA 3QZGA 4FVQA 5CEPA 4DAWA 4NL0A 4G3DA 1O6KA 4O2PA 4U5JA 4GV1A 3A8WA 2Y4IB 3ZFMA 2HW7A 5JQ8A 2QD9A 2PVFA 5KBQA 3DGKA 5FWKK 4YLJA 2W99B 5LCJA 3AC5A 4WNKA 1SZMA 3DZOA 3NUNA 1H00A 3VC4A 3DB6A 2EB2A 4MF0A 4S34A 4BC6A 3VS6A 3CQUA 3NX8A 5AR2A 4BR3A 3VAPA 3VW8A 2C69A 4ORKA 4L67A 5DBXA 2WIPA 3HMPA 3W33A 2X2MA 3ZONA 4YZ9A 1IR3A 3GT8A 2VTLA 3L9MA 3NCGA 3FXZA 5HVYA 3E3PA 4M0YA 4AN9A 5IA3A 4FTLA 3D2IA 4FNXA 5ETIA 4EOPA 1H24A 2XP2A 4WUAA 5AP3A 5DYJA 3VBWA 5AUVA 1Z9XA 3IW6A 1P14A 4MBIA 3ULIA 3GQLA 4AXFA 4YBJA 1UKIA 5EI8A 1OL2A 3P86A 5L2SA 3PA3A 4QMNA 1YOLA 1S9IA 2Y9QA 3E8CA 3IW5A 2WTJA 2AUHA 4RC3A 4FGBA 3ENMA 4ALWA 5C8KA 5IQHA 1XH7A 5FG8A 2B7AA 2J4ZA 5FBOA 2RIOA 4E5AX 3TTIA 5AAGA 4CYIA 5IISA 5DVRA 2HZIA 4ERWA 4NIFB 3ZMMA 2WU7A 3ZXZA 3FDNA 5CEKA 4PL5A 3LMHA 4CMUA 3MB7A 3Q53A 4IJ9A 4AGWA 1Y6AA 2RF9A 1MP8A 4YTIA 4DT8A 2B52A 1PMEA 3ZFXA 5HIDA 2E9NA 3D83A 4FC0A 2VX3A 3TL8A 5I0BA 3NWWA 4GT4A 4IWQA 4E5BA 5EYCA 2WXVA 3O8UA 2R3IA 3VULA 2YN8A 1SNXA 2BR1A 3G9LX 3M2WA 5HHWA 1VEBA 4AZEA 1O6YA 3GQIA 5AV1A 5EDQA 3R9DA 2ETMA 3OWLA 1OIRA 4G6OA 3DKOA 5CWZA 1YOMA 1A9UA 1ZRZA 2AYPA 3DNEA 1PXNA 5D1JA 4U45A 5IQBA 1G3NA 4X2FA 3B2TA 4R1VA 4U42A 3EZVA 2DWBA 4ANNA 5LCKA 3O50A 3QHWA 4HYHA 4GRBA 4C4HA 3MH0A 1UWHA 2QOKA 3JVSA 2QURA 3KRRA 4CZTA 4AAAA 3A4PA 5GIOE 2BRGA 4IWOA 4BCKA 3UZRA 3NIEA 2WOUA 3W2PA 1W2DA 3K54A 5C27A 5BVNA 5CAQA 3OBGA 5IUGA 3A61A 2AC3A 5T68A 3QQGA 3GGFA 5IKWA 4XJ0A 5IEXA 4BTJA 4KB8A 5BVOA 4DHFA 4FTRA 1UU8A 4KNBA 4ID7A 4QQTA 1TQPA 2ITTA 4IX5A 4BWPA 3HMNA 5A6NA 3OW3A 3B8RA 4IM2A 3KCFA 3VUHA 4J7BA 3ROCA 3OC1A 3TZ9A 1ZOEA 4O7NA 1S9JA 5CENA 5JFSA 4QDEA 4JQEA 2JGZA 2J5FA 5C4LA 4RQKA 5CF4A 3NYXA 3PE2A 4WG5A 3UZTA 2YCQA 2HZ4A 4YR8A 5CXZA 4JJRA 1YXXA 2OH4A 3V8SA 4LGDA 3DS6A 4Y46A 2V62A 5H8BA 3DCVA 4QMZA 4Y73A 5H9BA 1U54B 3FI8A 1NT2A 1QPCA 4EHZA 3TNQB 3UZPA 3QCQA 5IH4A 4LYNA 4TL0A 1CM8A 2DQ7X 4GYGA 2WQNA 4XLVA 1GZ8A 4P4CA 2XNMA 3R8ZA 5J1VA 2JIUA 4EQCA 4C4FA 4I5CA 5J87A 3I5NA 5M4IA 5JZNA 3LCSA 4K33A 1J7IA 2J6MA 1LP4A 4C0TA 3NNWA 3ODYX 5ITAA 3S95A 4H1JA 4KS8A 3OY1A 5JKGA 4GEOA 2LGCA 2DYLA 2PMIA 4UMQA 3NR9A 3RAWA 4U79A 4F6WA 5KMNA 3ERKA 1H1QA 2WAJA 5CAVA 4W4YA 2GTMA 1JKSA 5HIBA 4X2JA 2J0KA 4BGGA 4FTAA 3C4XA 3EJ1A 4W9WA 4CD0A 3C4WA 1W0XC 2R3OA 3LW0A 3R00A 4DCEA 2XK6A 2ZOQA 4LQMA 3II5A 4S33A 3NNVA 2PZPA 3FC1X 4DEIA 3LMIA 2X9EA 1KE7A 3KB7A 1GZKA 4IAAA 2IZRA 4MH7A 4YTFA 4BCQA 4DCAA 3IO7A 4AXDA 1K2PA 2P0CA 4IWDA 3F5XA 3V6RA 4NKAA 2Q83A 4PDSA 3UTOA 2HXQA 2G2FA 3EOCA 2Z7SA 3NGAA 1VYZA 1XBCA 3QGWA 4E6QA 5HD4A 3NW5A 4C37A 3ZU7A 4QP1A 2VWUA 2WMTA 1E1XA 3R02A 4O0UA 2XAOA 4G34A 3AKKA 3A60A 2IWIA 4L3PA 2PUNA 4WBBB 3DKFA 3FV8A 2X2KA 3BU6A 3ZO3A 2J7TA 2Z60A 3QQJA 3Q3BA 4ANBA 4M15A 1YVJA 2C6OA 2YCFA 2C6IA 2JAMA 3CLYA 4IQ6A 3A7FA 4XRLA 3L8PA 1UU7A 3TZMA 4D4VA 3DBEA 4USFA 3KA0A 3O7LB 5L6WL 4FVRA 3BI6A 4J98A 2XKDA 3ANRA 5EOBA 3R7GA 4FICA 4TYJA 4PPAA 4PUZA 5LMKC 5FP6A 3FWQA 1TQIA 3KULB 3AC4A 3GI3A 4UV0A 5GZ8A 1H01A 1AQ1A 1RW8A 2XF0A 2R3PA 1QPEA 4FL1A 3ZHPC 2RKUA 3KKVA 3RK7A 5DGZA 1NW1A 3EH9A 3DBFA 4YPDA 4BIEA 3HAVA 3L9LA 2VWZA 2HIWA 2ESMA 5AM6A 4EK4A 4ZY6A 3ZYAA 3S3IA 2UV2A 1WVWA 4EH3A 3UMWA 2GTNA 3P78A 4ZMFA 4QYGA 5AR3A 4OTHA 4EUTA 3IQ7A 4FSRA 4YJSA 5FD2A 2I1MA 4IFCA 2C1AA 3GCVA 2UW9A 3PZEA 4JL9A 5BPYA 3IS5A 2OGVA 5HLNA 2XM8A 4ONAA 4XMOA 3WF6A 4PNIA 4PMMA 5JEBA 4K1BA 4FTNA 4BBEA 3PY0A 2BZKB 2GFCA 2OJIA 2PTKA 3R9OA 1JBPE 2C4GA 3P5KA 2ZDTA 4YURA 3FHRA 3ULZA 1RQQA 4MTAA 1BL6A 2A0CX 4EL9A 3W32A 4HVHA 5DEYA 3QU0A 3R1SA 3PJ8A 3BYVA 4USDA 3IOPA 4FKPA 2CGUA 3C9WA 5FEQA 3BGQA 4LGHA 3V3VA 5HE1A 1UU9A 3Q9YA 4CCUA 4MXCA 2UW4A 4IB1A 3ORTA 4IWPA 2QLUA 3NUPA 4O96A 3WF9A 2IZSA 2QNJA 4BTFA 4ZLOA 4PF4A 4BCHA 2XANA 4JOAA 4EC9A 3HECA 2VO6A 4RG0A 4WA9A 1OPKA 5K5XA 4DDIA 4RQVA 4QMVA 3ZO1A 4BN1A 3RCDA 3ZEWA 4UWBA 5ANIA 4ANSA 2ITZA 3DZQA 3G0EA 3G5DA 4PL4A 4UBAA 1IG1A 4PMSA 1R78A 4J97A 2WOTA 3FMDA 4KIKA 3BWJA 4OBQA 5BQ0A 4EBWA 2SRCA 2ETKA 4V0GB 2GNFA 3VF8A 4EUUA 5A4CA 1OIQA 2W1GA 4GG7A 5LMAA 5IQFA 1XO2B 4OUCA 2WO6A 5HCYA 2PUUA 3QZHA 5DT4A 3ZRKA 3MVLA 4TYIA 4Q5HA 4MXXA 4G6LA 4RJ6A 4IE9A 3PP0A 3EKKA 3MDYA 2R3LA 4CFWA 4ZEGA 3PLSA 4EOMA 3NS9A 3PSBA 2YJSA 2OJGA 3E63A 3V5JA 4F63A 4YUQA 1J3HA 2I0HA 3LFFA 3Q60A 2YDKA 4JMQA 3DAEA 4YU2A 4AZFA 3AG9A 3R30A 3KMWA 3O8PA 4L44A 2PE0A 4E1ZA 3Q52A 3KL8A 3QKLA 4RIXB 5E8SA 2XALA 2PVLA 4UXQA 4IAYA 4GFGA 1JLUE 3C5UA 2QOQA 2GNGA 4FG9A 4K6ZA 2BDJA 3DAJA 4D2VA 2V22A 2VX0A 3FAAA 4IZYA 4FK3A 4BB4A 1YHVA 2J0IA 1ZY5A 2WGJA 2ZB1A 3EQRA 3RAHA 3GCQA 4BDIA 4QP4A 4TYEA 4F78A 2YWPA 3F9NA 4R3PA 3ZS5A 4H1MA 5HU9A 4YJQA 4EQUA 1EH4A 5KMJA 5KE0A 1YI4A 2YISA 3SG9A 3KVWA 4IVAA 4RA5A 3BKBA 1OPJA 4MAOA 4CKIA 4WG3A 1JOWB 2X0OA 1Q4LA 1XJDA 3D94A 3KN5A 2A19B 2PVKA 2X0PA 2PVJA 3PYYA 4JI9A 4HJOA 4JDHA 4JQ8A 4L68A 5CEQA 3CGOA 4HPTE 1OIYA 3FKLA 4Z55A 1GIHA 3MPTA 3PPZA 5H8EA 4QTEA 5AP0A 4IFGA 4QMYA 2HWOA 3KU2A 2XM9A 3CJFA 5E8WA 4B99A 2AEGA 4QDVA 2VD5A 3IKAA 4UMTA 3WIGA 3F5UA 4O7WA 4FNYA 2I40A 2V5QA 2Y6OA 4O0TA 4YJVA 4BVUA 4RVLA 3F82A 3LXNA 2OZAA 2X9FA 5C8MA 1Q24A 5LOHA 2BZJA 3MJ1A 2QO2A 4FZFB 3LQ3A 5CU2A 4V01A 5FXQA 4GW8A 3BCEA 4IC8A 4BBMA 3HAMA 3WZEA 3BL7A 4H3BA 3UO5A 3BHYA 1BKXA 4TKSA 5E91A 5KMKA 3S0OA 3EN6A 4GU9A 3RM7A 3ORPA 2XBAA 2PSQA 4QYHA 4AZSA <