2VO0A

Structure of pka-pkb chimera complexed with c-(4-(4-chlorophenyl)-1-(7h-pyrrolo(2,3-d)pyrimidin-4-yl)piperidin-4-yl)methylamine
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
343
structure length
340
Chain Sequence
KGEQESVKEFLAKAKEDFLKKWENPAQNTAHLDQFERIKTLGTGSFGRVMLVKHMETGNHYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLTKLEFSFKDNSNLYMVMEYAPGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLMIDQQGYIKVTDFGFAKRVKGRTWLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFATTDWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEEEIRVINEKCGKEFSEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords CAMP-DEPENDENT PROTEIN KINASE, ALPHA-CATALYTIC SUBUNITPROTE
publication title Identification of 4-(4-Aminopiperidin-1-Yl)-7H-Pyrrolo[2,3-D]Pyrimidines as Selective Inhibitors of Protein Kinase B Through Fragment Elaboration.
pubmed doi rcsb
source organism Bos taurus
total genus 108
structure length 340
sequence length 343
ec nomenclature ec 2.7.11.11: cAMP-dependent protein kinase.
pdb deposition date 2008-02-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2vo0A01
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2vo0A02
4FKLA 3DAEA 2ZAZA 3OCBA 2YDJA 4RIYA 5FTQA 1R39A 3FY0A 4IM3A 4EC8A 5L2QA 4O0VA 5CU4A 3ZFMA 4EQCA 2ITXA 4PMTA 2DYLA 1HOWA 3Q4ZA 2Q0NA 2WMAA 3C0HA 3BKBA 2GSFA 2XNMA 1Q61A 5L2TA 2PWLA 1FMKA 2W4OA 3OY1A 5DN3A 1JKKA 2VTAA 3EH9A 4FK3A 4RVTA 3TNWA 5J1VA 5M4CA 4ZY5A 5AIKA 5EDQA 1ZOEA 2XNPA 2PMOX 2ITWA 4JOAA 2QQ7A 2RFSA 4YJRA 4ZZMA 4IX4A 3ATSA 1PKDA 4XEYA 3IW7A 4UMQA 3BPRA 3VS5A 5HORA 3PXZA 4UZHA 4R8QA 3IG7A 2P0CA 5HCXA 3VC4A 2XIYA 2QO9A 4IDTA 3W18A 4CMUA 1PF8A 4D28A 3CQEA 4D2TA 3A7JA 4R7IA 4A4OA 4G6OA 4MEDA 3I5ZA 3PXRA 4PMSA 3IDPA 4J1RA 4R3PA 5IA2A 2E9NA 3RP9A 2XIKA 2GNHA 2W1EA 4EHGA 4QMQA 4GV1A 4W4XA 5HVJA 5AAFA 4I4FA 4I5PA 2GNJA 2E9OA 4O21A 3UO6A 4F7JA 5CAUA 2QKWB 2R3PA 1RDQE 2X7OA 4PPAA 5HBJA 1SNXA 4DGLC 1WBVA 1SM2A 4JDJA 4PQNA 2FSLX 5HVKA 1JWHA 3BCEA 3VBWA 4BYIA 4O7YA 1YWVA 3BV3A 2YM4A 2XZSA 2R3HA 4R77A 3F3UA 3NYXA 3W2QA 3EN5A 4C58A 3IDCA 4EC9A 5EM5A 3D14A 1JNKA 5LMKA 3V04A 1NVRA 3CGFA 5HTCA 4DG0E 1IAJA 4FKRA 3NUYA 5IQCA 4HYIA 3RNIA 4RRVA 3CY3A 4TKSA 3MJ1A 3SQQA 5B7VA 3PVGA 5K5XA 4KRCA 1OL1A 5JGAA 5FD2A 2OJGA 2XVDA 3F61A 1XQZA 2UZTA 4QQCA 4XJ0A 3AOXA 2IW8A 4ASZA 3PSDA 3C5UA 2W7XA 4M84A 3MI9A 3LLAA 2HZ4A 4DTBA 1B38A 2UZWE 1LPUA 1NVSA 1FGIA 2YIRA 3A99A 3QD4A 3QQGA 3U6IA 2QR8A 5D41A 3QLGA 4FUXA 3LFAA 2VO7A 4FIGA 3TKIA 3SXSA 1P14A 3CKWA 2GS7A 4JAJA 4AN2A 1M2PA 2QOFA 4GG7A 4NM7A 3TKUA 4QNAA 3UYSA 3Q6WA 4OTDA 1XHAA 4MBIA 4FF8A 4O81A 5L8KA 3OOMA 4H05A 3PTGA 4QP1A 1H07A 4TWPA 5ANGA 2JC6A 3E8EA 5IA3A 3A7GA 5F1ZA 4WOVA 3WF7A 5IH6A 5K9IA 4X2FA 3N51A 5IQAA 2I1MA 5H2UA 5I3RA 4IAKA 2BHEA 2PHKA 3BYOA 2UZLA 4XBRA 4BDCA 4O7SA 4YMJA 5IA0A 3QTIA 4KB8A 4EHEA 2JDTA 5E8ZA 1M2RA 3RZBA 3OD6X 2BMCA 2HZNA 2XNBA 4L3JA 5FTGA 4E6QA 2X9FA 4YTHA 3TIYA 4JG7A 4O0SA 5DG5A 4BI0A 4UYAA 3ZO2A 5CASA 3HMMA 2YDIA 5IQFA 2HY81 2C1BA 4J53A 3OXTA 4KABA 5FDPA 5KMJA 3G9LX 2OXDA 3QD2B 3R9OA 4U40A 1UKHA 4IWQA 4FC0A 4FIFA 4H3QA 4FTQA 4I92A 2PYWA 3ORIA 1UU3A 2JEDA 3EN6A 4DTKA 2VTHA 4D58A 3O0GA 1PW2A 3CY2A 5D7VA 5DNRA 4DG2E 2XJ2A 4HJOA 4NIFB 5G1XA 3W33A 2BFYA 3BLQA 3ZLWA 2KTYA 2RFEA 2F7EE 2Z8CA 4ALWA 1W98A 3R2BA 3IW6A 2UZOA 4G3CA 4U42A 5DT3A 5TO8A 3ORNA 5HG7A 2ITZA 2OH0E 5AA8A 3RAIA 5C01A 2ONLA 4C4GA 3HZTA 1GY3A 4FIIA 4FTNA 3ZUTA 5BVFA 1Q99A 3GU6A 3EFJA 3QXPA 3LOKA 1XKKA 4RJ6A 4YJPA 1JKLA 3WIGA 2PK9A 3A8WA 3R7GA 4GIIA 4HPUE 3PJ2A 2BZHB 2I0VA 4RT7A 2OFUA 4J7BA 5EQPA 5GIOE 3PA3A 3ULIA 3QQHA 2UZBA 2R3FA 3A7HA 2ZDUA 5A6NA 2OKRA 3NUUA 5IZFA 4GUEA 4NJ3A 4TY1A 3E7VA 3RKBA 4GK3A 3UIUA 3UP7A 4EK6A 3H30A 3TDVA 2IVSA 4EK5A 4ZK5A 4RJ3A 2YWVA 2OW3A 4L6QA 5HEZA 4USEA 3VBXA 4O7VA 2F4JA 2IZRA 4ZS0A 3UIBA 3W2CA 5ICPA 3NCZA 4ITHA 2OJFE 3P08A 2GTMA 1BYGA 4FT9A 4AW5A 3BEAA 4C8BA 2VTNA 1YHWA 3M42A 3COIA 2HCKA 1IAHA 1PXNA 3AGMA 2QVSE 4TYEA 2FVDA 3SG8A 2BCJA 2XYNA 1YOJA 3KF4A 5A54A 1MRVA 2ETMA 5KBRA 5BUIA 4O7LA 2JKMA 2UW6A 4FG8A 4I21A 3ZH8A 4ACMA 5A4TA 1J1CA 4MKCA 3V5LA 1SMHA 3AC2A 4NT4A 3R7OA 3MA6A 4CG9A 4GU9A 3BWFA 1I44A 3C4WA 3PE1A 5EOBA 4GW8A 4TYGA 3FXXA 4QMZA 3Q6UA 2G2FA 4K8AA 1A9UA 3GQLA 4A06A 3EHAA 4EBVA 3SGCA 1QPJA 2CGXA 3VUKA 4D2VA 3CEKA 2HWPA 3FPMA 4G6NA 3EYHA 3NSZA 2OI4X 4UWBA 3FC1X 2BUJA 3ORMA 4U43A 2B9HA 1B39A 4J97A 2QU5A 3IW5A 4BZOA 4DYMA 5KHWA 2VWXA 5AADA 4D1XA 4O38A 3DB6A 3DKFA 3Q5ZA 3QWJA 4KA3A 4MWIA 3WF8A 3HRBA 4JDIA 4CGAA 2X8IA 3CCNA 3EWHA 3TZ8A 2IZUA 4UWYA 5AV4A 2F49A 1XH4A 4O1OA 2YITA 4YZCA 4EYJA 3A8XA 2QR7A 5CQUA 4ZTLA 4AT5A 1V0BA 4AW1A 1KE6A 2W0JA 1G3NA 5CZHA 4E7WA 3L9LA 3CTJA 3MPMA 1MUOA 4ANLA 4AT4A 4ONAA 4RIWB 3ZU7A 4XOZA 5ANEA 2GTNA 4C4EA 1YXTA 1JSUA 4K2RA 4O27B 4B0GA 2JBOA 3CSVA 2FGIA 4JLCA 4EOPA 3Q9WA 5CT0A 1Q8UA 4NEUA 4TYHA 1ZXEA 3SOAA 3G51A 3O7LD 4LFIA 3NUSA 1E1XA 4QMNA 5LCKA 3HV6A 2H96A 4HGEA 2CKQA 4FI1A 5HESA 4HOKA 2YCFA 3TKHA 4EONA 1URWA 3Q9ZA 2GS6A 4XHKB 1OIYA 5EDPA 4OW8A 4D5KA 4BFMA 3H9FA 3O50A 3ATTA 2C3JA 2CCHA 2W5AA 3OOGA 2IJMA 2XNGA 3ODYX 3R7VA 3UMWA 4ZSGA 4DH3A 2GS2A 5JFWA 4FL3A 4L52A 1IASA 2VWIA 2PZRA 5C8NA 3BGPA 5CALA 5BNJA 5AV1A 5K0KA 1T45A 4LM5A 4WHZA 1PHKA 2H9VA 3CPBA 3KULA 5HG9A 5CS6A 2O64A 4BTKA 4EOIA 1Y8YA 4KSPA 1OM1A 4PUZA 1FPUA 2JKQA 1RW8A 3EL8A 2XBAA 4AOJA 3II5A 4TPTA 3HMNA 4LRJA 4IZ7A 2PE2A 4BCQA 3GOKA 2BALA 2B0QA 1PXPA 1R0EA 3LFQA 3FI8A 4EK4A 5FQDC 3NUNA 1BKXA 3MJ2A 2NP8A 4FKTA 3V51A 2V55A 5H3QA 5EW9A 2XMYA 3GT8A 1FQ1B 3CXWA 3FZRA 2C4GA 5M4UA 4R1YA 3TTIA 1BMKA 3LXLA 5EKNA 2VTJA 4FX3A 4QYFA 3H9OA 2R7BA 4PTEA 4AP7A 2YM3A 2ETKA 4FK6A 5CXZA 5LMKC 1IA9A 1AQ1A 3SG9A 3KFAA 4JR7A 3TIZA 3ANQA 1KV2A 4YPSA 4O22A 3FLZA 3TUBA 5EH0A 4I5MA 3BYVA 1GAGA 4PDPA 3KGAA 5IQGA 3RINA 3K3IA 2YA9A 5DR6A 5IQHA 3ZUUA 3RI1A 5AUYA 4FV9A 1ZYDA 3LVPA 3UG1A 4L46A 3D5VA 4BGHA 5JN2A 4FEWA 4HNFA 5DYJA 4FGBA 5E9EA 4BBMA 1GZOA 4DF3A 2XK8A 1XH8A 5HIBA 4EKLA 2VWBA 5I9WA 2XRWA 4OT6A 4ZSJA 2WMQA 5FRIA 5CYIA 2WTDA 4E4MA 1H8FA 3KU2A 4G3FA 5CSVA 1MRUA 3ORXA 1IRKA 4AFJA 4CNHA 5CVHA 2OICA 5FP5A 1JBPE 1WFCA 5AEPA 4ZJIA 5LVOA 2ZDTA 1XBCA 1VYZA 3UBDA 2XJ0A 4FSUA 2EWAA 4L9IA 1QMZA 2RSVA 3GB2A 2W1IA 2R3IA 4RJ5A 4XG6A 5M51A 3NAXA 4BDKA 2JKKA 3SLSA 3WE4A 2OFVA 2UW5A 2WQEA 3AT4A 4KRDA 4FTMA 2EXMA 3F82A 3SVVA 5DWRA 5TKDA 2XKFA 2ITNA 3NVMB 5GIPE 3HL7A 5ANDA 2DWBA 4MXCA 2YLEA 2C5VA 4EL9A 3BHVA 4E4NA 2WFYA 5AR7A 4JG6A 4NM0A 3E88A 2J2IB 3PLAE 4FGRA 3NUPA 3FC2A 2W5BA 4CSVA 2GNLA 3OCSA 4EQUA 5KCVA 3R8PA 3R63A 3F66A 3LZBA 3SX9A 3BHYA 2JIVA 5FBNC 4AZSA 4HVGA 2J6MA 1HCKA 4ZIMA 5J79A 5CI7A 4EYMA 4MX9A 2JIUA 4F6WA 2W4JA 4TRLA 5L4QA 3Q4CA 2GNGA 3JXWA 4IB5A 3AMBA 3KN5A 3PJ8A 4RVKA 2X8DA 5HTIA 3G33A 1Z9XA 2WQMA 5E1SA 3QUDA 2XNNA 1F3MC 3PWDA 5KNJA 4JX7A 4LOQA 4CZYB 2QO2A 4M0YA 5E1EA 3UOHA 2ZB1A 4BL1A 4C34A 5AUVA 5DH3A 3GCQA 3DOGA 3B8RA 5M09A 4QPAA 4G9RA 5HBEA 1IR3A 2QO7A 3L8SA 4BCKA 4N57A 1HCLA 4XBUA 2ONLC 3SV0A 5EFQA 4AW2A 4BCJA 3HV5A 3MBLA 1BI8A 2WOUA 5EI2A 2Y7JA 3VUGA 3CPCA 2QCSA 2VX1A 3PIZA 5I0BA 1PXLA 4OT5A 5AJQA 4UBAA 3KRRA 4A7CA 5AR4A 4QYEA 1Q8ZA 2WELA 3FLWA 4F70A 3VO3A 2PZ5A 1MQ4A 4AA5A 4GJ3A 4HVSA 3NUAA 5DIAA 1YHSA 3B2TA 3C0GA 4HCTA 1O6LA 2GHMA 3CBLA 3QUEA 3BHTA 3PXFA 4WG3A 4OTFA 4NWMA 3OWPA 3OEZA 4HYHA 5E8UA 3TCPA 3AC1A 4AQCA 4JT3A 4AA4A 2ZOQA 3FLYA 4RIXB 1M7NA 3W55A 4PTCA 5CEOA 5F95A 4F1TA 3DU8A 4U3ZA 5AR2A 3BGQA 3QKMA 4JQEA 4Y5QA 3V8SA 2UZDA 4AE6A 4HCVA 5L2SA 1UNHA 3RPOA 4A4XA 4YZBA 4ENXA 4D4VA 5DMZA 1GIIA 3B8QA 4EORA 3KC3A 5JEBA 4I4EA 4R5YA 4FTUA 2XBJA 4I3ZA 4BHZA 3GCPA 3E62A 5CXHA 3MH2A 1YXXA 4H39A 5BYLA 4QQJA 4G17A 3NCGA 1J3HA 1PMNA 3EKNA 4M3QA 3CR0A 2X4FA 4WNMA 4GFMA 4ANMA 3BIZA 1VR2A 4CYIA 4NM5A 5EHLA 4EH6A 3TV4A 5CSPA 3FQEA 4FICA 5C9CA 4GKHA 3F5GA 3Q04A 4OTQA 4KSQA 1YDTE 3LE6A 2HW6A 2CPKE 2B53A 3UPXA 3HV4A 4IZYA 2C6TA 3ZXTA 2WU7A 1P5EA 5L8JA 3MFUA 3R7UA 3UQCA 3QRUA 4X7QA 3R01A 4FV3A 1KE9A 4AA0A 3V8TA 3L9PA 4K77A 5CENA 2H34A 3LCOA 5L8LA 5EQEA 2W05A 2WMUA 4C3FA 3EQFA 2BIYA 3SW4A 3G0EA 3R6XA 3TNPC 4J52A 4BB4A 1FBNA 4YP8A 4XV9A 4EOJA 4WNPA 4YJNA 2G2IA 4AACA 2J50A 4Q2AA 4PDSA 3OW3A 3ZOSA 2V0DA 2GHLA 5AP7A 4BR3A 2OF2A 3TV6A 5CWZA 4F0IA 4EJ7A 4RX7A 4CFUA 4FT5A 4FSNA 3E93A 3A62A 2W1ZA 3MH1A 4AXAA 2WKMA 3O2MA 3C51A 5J8IA 1ZYLA 3ENHA 2RG5A 3C5IA 5CEKA 2RIOA 2Z60A 5JRQA 1FMOE 1MP8A 4BDHA 3G2FA 1OL5A 3DT1A 3R73A 3R1SA 5DT0A 2WTWA 3UVRA 3V5PA 3GCSA 4F64A 4CXAA 2VTPA 4CCUA 1P4FA 4C36A 5L6PA 3PZHA 4F9AA 3DY7A 2WMWA 3RK5A 4DE4A 1REKA 1Y57A 4FG9A 2Y6MA 4WSYA 4BCGA 3LXPA 4YO4A 3HDMA 5AUUA 1WBPA 4P7EA 4USDA 5GZ8A 3OFMA 4O83A 4NW6A 3R04A 4CV8A 1P2AA 3QTRA 5KE0A 4AOIA 4IH8A 2R3RA 3R8MA 4O0RA 4BI2A 3MVMA 2CNVA 2BRHA 3QF9A 5IA5A 3O96A 4FSZA 5CT7A 5CNNA 5DA3A 2PVKA 1H08A 3QHRA 3QTZA 5AX9A 4X21A 4Q9SA 2GU8A 5BVNA 4X3FA 5FXRA 3POOA 2YJRA 3A61A 3HV3A 4OBQA 2HY0A 1ZYSA 4I0TA 4QMTA 3ZRKA 1GZNA 4E6AA 4E5WA 3LXNA 4IX3A 4PDOA 4FKPA 4N0SA 3QAME 4USFA 4YZNA 4EQMA 4ZMEA 1IA8A 2B9JA 3C13A 4K9YA 2R3LA 3KXXA 4U97A 5DBXA 4CTBA 4I23A 5DFPA 3LMIA 4TNDA 2B52A 4QMMA 1XBAA 5T6KA 4MD8E 2J51A 4C3RA 3D2IA 1UNLA 4F7LA 3FAAA 4D5HA 1WBOA 4IVCA 4YJVA 3NNUA 4LYNA 1TQMA 3O8PA 2WXVA 2FSMX 2WQOA 2BZJA 5J87A 4I5HA 4IAYA 2GFSA 5A6OA 3FMEA 5EYDA 3QTWA 4NCTA 3PA4A 3I7CA 2YZAA 2BAKA 4FTKA 3FLNC 4XP2A 3OBJA 3DJ5A 4HZSA 4H3PA 3D9VA 2WTKB 4S33A 3RAWA 2CCIA 3DTWA 1KOBA 5A4LA 4BIDA 3RNYA 4A9YA 2IG7A 1ZMUA 2OBJA 3QZHA 4DH8A 1YDRE 4UYNA 3HP5A 3QYZA 2YERA 4AX8A 4X2NA 4RJ8A 1FGKA 3FE3A 3AC4A 4ANBA 3HA6A 4Y72A 5AAEA 4LGGA 4AN9A 4CKIA 3P86A 4C59A 2CGUA 1JSTA 4XS2A 2PPQA 2UW7A 3MGYA 2ZM4A 3PY1A 1OVEA 4ERWA 1OKZA 4U45A 4F99A 4PX6A 1PYEA 1BUHA 2R3QA 3D7ZA 5J5TA 1GZ8A 2GCDA 3P4KA 5F4NA 4RWLA 4MK0A 5HICA 4PL4A 3D83A 4LOOA 4G5PA 3T3UA 3F69A 2X1NA 4N6YA 4FR4A 3HRCA 3UOJA 1Q8YA 3BU3A 3ZO4A 3PZEA 3BI6A 2YHVA 3RPRA 4Y85A 1BLXA 4MXYA 4B4LA 2QG5A 3ZHPC 4DA5A 4JAIA 2PTKA 1YI4A 2X6EA 3MA3A 4HYUA 3RMFA 1SVGA 4JQ8A 3LKMA 3BWJA 4QOXA 4UWCA 3S0OA 4DT8A 4MNEB 4IAAA 4OTRA 3W10A 4FL2A 5FEQA 4IIRA 2FUMA 2PVRA 4WRGA 3ZFYA 2ZM3A 3PLSA 4QQ5A 1DI9A 1U5QA 3VBYA 4N70A 4FVRA 4YSMA 1PMUA 2XUUA 2C3KA 2CKEA 4FG7A 3TG1A 5EK7A 4CT1A 2AUHA 3C1XA 2WZJA 4YC8A 3QZGA 4QTAA 4ZTSA 3ZUVA 4WNKA 3IOPA 4DFYA 1F5QA 3TV7A 2PY3A 3EQHA 4PL5A 3N4VA 3DK7A 2QOOA 4HGLA 4ZY4A 2XNOA 4QMLA 4E73A 2O0UA 4ALVA 1OBGA 4IFGA 3VS0A 3QX2A 4BDAA 4BTJA 4OAVB 3OEFX 5GJDA 5LWNA 3GU8A 5IH5A 3FYKX 3G9NA 4FNWA 3RHKA 3SD0A 3DJ7A 1F0QA 5HU9A 2C47A 1Q8WA 3TWJA 4AT3A 3GEQA 3EB0A 1YVJA 4FT0A 3FV8A 4KIQA 3HAVA 4DEAA 4H58A 2EXEA 4RX9A 1J7IA 3VN9A 2KULA 3SAYA 4OLIA 1K9AA 4NH1A 2C5OA 5HLWA 4FV2A 4L01A 3S2PA 2R3GA 2YWPA 4AGCA 2V5QA 4RSSA 1ZRZA 3UVQA 3W1FA 1FVRA 2ITUA 4F1MA 3ANRA 5E8XA 4WG5A 3FZSA 4A9RA 2REIA 2B9FA 3KXNA 4NKAA 3ZYAA 3WZDA 4BVUA 3TUDA 4V04A 4JRVA 3FL4A 4RVLA 2BPMA 4FIEA 5HU3A 3R7YA 4CFNA 1I09A 4ASXA 3EFWA 4EKKA 1H1WA 3OWKA 4PV0A 4S31A 3ROYA 4BTMA 2O63A 3EMGA 3VS2A 4U7ZA 2OXXA 3WZUA 3Q9XA 3HKOA 4LV5A 4RJ4A 5GJGA 3V01A 5KMOA 3OTVA 1O9UA 4JQ7A 4IHPA 4IVBA 3KRWA 2R3JA 4AZEA 4V0GB 2R7IA 4FV6A 3DNDA 5KO1A 1QCFA 4ANNA 3U6JA 4BZNA 2C5YA 4PMMA 4UMTA 5ANIA 3VBQA 4ZMFA 1OL2A 4B8LA 1DAWA 2UZUE 4OTPA 4QMPA 4M69A 4FTLA 3ZS5A 4F4PA 3WARA 3GGFA 4JXFA 2RGPA 5BUJA 4P5ZA 4L3PA 2OZAB 1VZOA 5LWMA 3SW7A 4Z3VA 3E8CA 4E93A 3QTXA 1Q24A 2WPAA 3HUBA 4X0MA 4O91A 2X2MA 2EVAA 3EOCA 4RJ7A 5B2LA 3TT0A 4YBKA 2Y4PA 3Q60A 1RQQA 4HCUA 4QTBA 4CZUA 3QX4A 4EHZA 2C0OA 4UMRA 1Z5MA 3U6HA 3Q3BA 3F7WA 3KCKA 2IPXA 4NZWB 4U8ZA 3AXWA 4XP3A 3EQDA 5EKOA 2HXQA 4U41A 4DEDA 3UVPA 3Q53A 4QTDA 4XRLA 4YU2A 5LMBA 4PPCA 2WEVA 2QOCA 4L45A 3CP9A 2VUWA 3IQ7A 1T46A 3QUPA 5A46A 4RQKA 2FSOX 3FMKA 5I9YA 2RFNA 4AW0A 2XK9A 4D4YA 5M08A 3HNGA 2WD1A 2GQGA 4H1MA 5JT2A 3ORPA 3LAUA 4AAAA 3BV2A 3ITZA 2XM9A 3UJGA 3VS4A 3HECA 2HYYA 3CJGA 4OGRA 4C33A 2Q83A 4KD1A 3VJNA 5HX6A 3F5UA 2WNTA 4GT4A 3R1YA 4IB0A 3D15A 5E4HA 3TNHA 4ZY6A 4C38A 3GFWA 5ANOA 3LCDA 1J7LA 2X39A 3O8UA 4L8MA 4KBKA 4O0YA 4R6VA 3NPCA 4D0WA 3DKOA 3PSCA 3PXKA 3T9TA 4DGOA 3BRBA 1X8BA 1URCA 5DPVA 3QZFA 5JGBA 4KIOA 1ND4A 4BCPA 3ZCLA 3LQ3A 3I6UA 3JY9A 2YCRA 4BIBA 5BYYA 4PWNA 5ETFA 2OO8X 5H9BA 3AD5A 5FBOA 3RK9A 3R8LA 2OIQA 4QP4A 2XKEA 3H10A 3L8XA 3WBLA 2VN9A 4ERKA 5JQ5A 2XA4A 1WBSA 4U81A 4X3FC 1PYXA 3E7OA 5AUZA 1S9JA 5KKRC 2SRCA 3FI3A 1G8SA 1OIUA 3C9WA 5FLFA 4PPBA 3S4QA 4BRXA 1Q5KA 4RVMA 2R64A 3ZFXA 4YJOA 4D55A 2AYPA 1H26A 2W9ZB 1YXSA 2C5NA 2OZOA 4DH1A 3P78A 4KINA 3ZC6A 1H00A 3AD4A 3M11A 1ERKA 3CLYA 3BELA 4JS8A 4TXCA 1XO2B 4XG2A 4A9UA 3GOPA 3I0QA 5BMSA 4BY9E 1IG1A 4A4LA 3W16A 4DINA 2BRBA 3ETAA 3IPHA 3Q4TA 5E8WA 3EQPA 3WF5A 5DRDA 3UGCA 5LJJA 2PVHA 2HAKA 5HI2A 5CZIA 3I4BA 2UW8A 4MAOA 5E8YA 4DC2A 2YN8A 3TL8A 5LQFA 4J8NA 2X7FA 4NK9A 4NCTC 4C3PA 4NUSA 4YZDA 4EK3A 3DXQA 4I93A 1TQIA 3LCTA 2VV9A 3OG7A 2VO3A 3CQWA 3QC9A 3ORKA 4RA4A 3KEXA 2IZSA 4ZSAA 3K3JA 3JUHA 5I3OA 3VS3A 4QTEA 4P2KA 3BQRA 2HZ0A 5M57A 3LHJA 1J91A 3I5NA 3FMNA 4FTCA 4YNOA 3PJ1A 4XH6A 4MYGA 4TWCA 3S3IA 4LG4A 1WAKA 3G6GA 4B8MA 4C61A 4YTCA 1WCCA 3DTCA 1BL6A 4EI4A 2XKDA 5EYMA 5IQDA 1PXMA 5C03A 2CLQA 4I0RA 4IAIA 3NYNA 3GXLA 3R2YA 4KIKB 3VRZA 5JSMA 5AM6A 3UO5A 4IMYA 3P79A 4TT7A 2YLFA 3AT2A 3KMWA 3KVWA 1J7UA 5M07A 1R78A 1YHVA 1YXVA 3MTFA 4RMZA 4NYEA 1ZY4A 3UOKA 3R30A 3AC8A 4ZTQA 4EWHA 2C6LA 5DVRA 5CSHA 3JYAA 3IONA 1ZYJA 3G6HA 3GC0A 3R02A 2JGZA 4FZAB 3AC3A 4F9YA 3PA5A 2QODA 3PPJA 3U9NA 1GIJA 3R0TA 3RHXA 5ETCA 4GRBA 3MIYA 4MH7A 1V1KA 5C27A 2VD5A 4FTIA 5JFVA 4NU1A 5GNKA 5JZJA 4K1BA 3ZSIA 3NUXA 5ACBC 2PU8A 5IH4A 3IO7A 2C6MA 5FG8A 5HLNA 4HW7A 3ORTA 4W4VA 1H01A 3EKKA 3PWYA 4EOOA 3C7QA 2W4KA 4LQMA 4EOLA 4ZSLA 4ZXTA 2E9VA 4UMPA 3RZFA 3NVKI 3R8VA 2PZPA 4AZWA 4F6UA 4NTTA 2ZV9A 4CEGA 4M15A 1W83A 5DR9A 4XNEA 1SVEA 2FH9A 3QXOA 3WI6A 3IOKA 3LLTA 4QYYA 2BKZA 3MTLA 1PXIA 1U54A 3ORZA 4IXPA 4IZ5A 4QO9A 3MFRA 4XOYA 4B99A 4FZ6A 5ETAA 4BC6A 4IQ6A 4TL0A 4DGNA 4TTHB 1ATPE 3F88A 3TZ9A 4XMOA 4L42A 1JVPP 2WMSA 4QP6A 4Y5HA 1H1SA 3DNEA 5AV2A 1O6YA 4BI1A 3UQFA 4G1WA 3JR1A 1OIRA 2UZVA 4ACDA 5M44A 1OMWA 4D0XA 4E6DA 5LMAA 4CMTA 1KUTA 3JY0A 3VJOA 5CEPA 4G3GA 4F0FA 2PZIA 3I0OA 3HYHA 4GT5A 4FKUA 3NX8A 4IZAA 2RF9A 4ORKA 5KMIA 3E92A 4QT1A 4BDFA 5LXMA 4L7FA 4HGTA 4WIHA 4M67A 2X8EA 1R3CA 4QQTA 4AGDA 4BGQA 2UW4A 5CTPA 1MQBA 2XNEA 4I0SA 5J9ZA 5KMLA 3OT8A 3H9RA 2BAJA 3KB7A 4MXZA 4EJNA 2XKCA 4GVAA 4IADA 4YJQA 4ITIA 5IU2A 4CRLA 3G0FA 3WF6A 3FJQE 3GC7A 5DEWA 3SDJA 1KE7A 3QRKA 4L7SA 4ZAUA 3GNIB 3POZA 3ROCA 4Z7HA 4D2RA 3QU0A 5BX0A 3T3VA 2XF0A 5HO8A 1E9HA 4ITJA 5DR2A 1CDKA 1JQHA 4GG5A 5CVFA 5AP0A 4FE2A 4LL5A 2VU3A 2I0EA 2GHGA 4NFMA 1W0XC 2J0LA 1YOMA 4X6QC 3UZPA 3QCQA 3PJCA 1W82A 3DBFA 2ITTA 1RJBA 2OH4A 4APPA 5CAQA 3OTUA 4CYJA 4K0YA 3QKLA 4MNEA 4U5JA 4QNYA 3SRVB 4DBXA 3C4EA 1M2QA 5HE0A 4A9TA 4IBMA 5DRBA 3VUDA 4CTCA 2ZVAA 4D9TA 5D11A 1P4OA 3A7IA 5AM7A 3EQGA 3R7IA 5IUGA 5GJFA 3OUKA 4FKWA 3KMMA 3COMA 3R8UA 5E92A 5J95A 3OUNB 3I79A 3DBQA 3TM0A 5LVPA 1PMEA 1ZARA 2QI8A 4GK2A 1JKSA 4PF4A 4CFMA 2WTCA 5BVKA 3H3CA 2VTIA 1GOLA 2VO0A 1ZYCA 4GUBA 3HMOA 4RX5A 1H4LA 4NW5A 1NW1A 2UUEA 3DXPA 2JDOA 3OMVA 3DLZA 3RM6A 3G15A 5T68A 2X0GA 3HV7A 2ERKA 3QKKA 5M56A 4FL1A 4L53A 5DOSA 1H24A 3DKGA 3FZTA 4WKQA 4YZMA 4B9DA 2XIXA 3KCFA 3GCUA 2EUFB 4JIKA 1ZY5A 3OXZA 3B2WA 3VW6A 5IUIA 5DT4A 1H0VA 2JLDA 2XJ1A 4RWIA 3TTJA 5HZNA 4LMUA 2QOHA 4E4XA 5E8SA 5BYZA 3ZLSA 3NZ0A 4PL3A 5J7BA 2CN8A 4M13A 3TJDA 2OJJA 3OP5A 2ACXA 2HXLA 2P33A 3OZ6A 2ZMDA 4RFYA 4GKIA 1Q8TA 1E1VA 5BUEA 2O2UA 4RGJA 3ZXZA 3OXIA 4KS7A 2WMTA 4ZOGA 3RAHA 5HG5A 2JFMA 5J9LA 1H28A 3EQBA 3D2KA 3CD8A 5BMMA 4UV0A 1JSVA 3FWQA 3HVCA 1G5SA 3MWUA 1NVQA 4IX6A 5HGIA 4DFLA 3PY0A 4L68A 3Q9YA 3R9HA 3GBZA 5FGKA 3TUCA 5D1JA 3R21A 5HOAA 4HYSA 4IB1A 2G01A 3C4CA 4W8DA 2YACA 4GYGA 2QOQA 4DFXE 4JDKA 1PXOA 3IS5A 1BI7A 4V0GA 2R4BA 2YIXA 3H4JA 4BN1A 5EHOA 3OVVA 3K54A 3PRFA 3QGYA 4JNWA 3NEWA 3CS9A 4EH2A 3FXZA 2QC6A 5KMKA 3FL5A 4BDDA 1YW2A 2HELA 3CJFA 4EZ3A 3MDYA 4B7TA 4E20A 2OJIA 4TW9A 3QA0A 5GZ9A 4EUUA 3A2CA 4AFEA 2UW0A 5L2IA 2PVFA 4FYOA 3QGWA 4L3LA 3FQSA 4MF0A 4JBQA 2B4SB 4IE9A 1FINA 5I9UA 5AWMA 3BX5A 3Q4UA 1BX6A 3SC1A 3F2AA 4QPSA 5IG1A 3TNQB 2YEXA 3FZ1A 4XV1A 1CTPE 5J7HA 2R0UA 1YI3A 5EI6A 3R1NA 1STCE 2DQ7X 3GU4A 3QTUA 5AP6A 3LFEA 3ZEPA 3W2OA 4DFZE 4OR5A 4IWOA 1UU9A 4O1PA 5CEIA 2PSQA 5KUPA 5IPJA 2YCQA 1OECA 2ZYBA 3PYYA 2PL0A 3R00A 3RCDA 3LMGA 3M2WA 4U3YA 4K33A 1OITA 5M4FA 4CG8A 4FV4A 2JITA 5HVYA 2YM6A 3FBVA 4H36A 1LP4A 1UNGA 2CGVA 3FEGA 2VTRA 5JRSA 4NSTA 1M17A 2JKOA 2WMBA 3U51A 2QHNA 3WZJA 5HTBA 3L8PA 3EYGA 3A4OX 2RFDA 4EHVA 2VWVA 3FPQA 1Q3WA 3CC6A 4IJPA 4HVHA 4GMYA 4GVJA 4HNIA 4DEIA 5IUHA 4NIFA 5KX8A 1B6CB 2VX0A 3DV3A 1WVXA 3WYYA 3IW8A 5HKMA 3U9CA 3KRLA 2FO0A 1XR1A 4IAZA 1GZKA 2V7OA 5CVGA 5AFVA 1NXKA 4KS8A 3ET7A 5HE3A 3E3PA 1YOLA 5TOZA 4YHFA 4I6QA 5IA1A 4MCVA 1Q41A 4QP8A 3M1SA 3FHIA 4O7ZA 3HEGA 2WTIA 1S9IA 3BBTB 3KXGA 4FKGA 4FKOA 2IW9A 1Q97A 5FEEA 2P55A 4FTRA 3COKA 2A1AB 4FZ7A 3EZRA 4FV7A 4JBVA 4PP9A 4OUCA 2OG8A 5K5NA 4GL9A 4MTAA 2NPQA 4BCFA 3GU7A 3DQXA 3KXMA 3QQKA 2V7AA 4RG0A 4RX8A 2IVUA 2OLCA 2YIQA 3F6XA 4I41A 2ITOA 3R28A 1H27A 3QRIA 1JAMA 4WNOA 3VBVA 4M68A 2VAGA 3DLSA 3QCYA 4UB7A 4G16A 3BHUA 4XG9A 5EW8A 4O7RA 2YIYA 4UEUA 3VS7A 4QMYA 4J71A 4RWKA 4RFZA 4PY1A 1L3RE 3MB6A 5ACKA 1UU8A 5HO7A 2UV2A 5F20A 5ANKA 4F7SA 4OBOA 5BVDA 1YRPA 3MH0A 3A7FA 2YIWA 3LM5A 4L67A 1XJDA 3DDPA 2C30A 4RQVA 1JKTA 2E9PA 5KHXA 2R3KA 3D7TB 3GI3A 4W4WA 3EFLA 4KWPA 1A48A 4NTSA 2BDJA 3CKXA 2W06A 1PY5A 3EN7A 4ANOA 3MY1A 4ASEA 4BBEA 2WOTA 4RIOA 3DJ6A 1KV1A 3I7BA 5AP1A 5CU2A 3RWPA 4EEVA 3D5UA 3KL8A 4F0GA 2C6IA 5CEMA 1K2PA 1GNGA 3DQWA 4P4CA 3P1AA 4NKSA 2I6LA 3RM7A 5LCJA 3HRFA 2WHBA 5AV0A 3WF9A 5DLSA 4FVQA 1TQPA 5IKWA 3R9NA 4FKQA 1OGUA 1H25A 4FV0A 4BWPA 1A06A 5AUWA 4Q9ZA 1AD5A 4KIKA 2ZV2A 3D5XA 4I6FA 4M0ZA 5D10A 1PJKA 2Y4IC 1ZLTA 3NR9A 4D2WA 4M8TA 3SA0A 3BYUA 3PDTA 2OXYA 3LMHA 2BILB 2PZYA 3P7CA 2R9SA 4DN5A 4R5SA 3ENMA 2VTLA 5H8EA 3MS9A 2IN6A 4FSWA 4KKHA 3V5TA 4CLIA 3PIYA 3UO4A 4WT6A 2CKOA 2W9FB 4RIWA 3H0YA 2F2CB 1PRYA 1OZ1A 3HGKA 5AR8A 1WMKA 2UZNA 3PXQA 5HIEA 4R7HA 2GPHA 1ZOHA 2C0TA 2OSCA 3VUTA 5A4CA 4OBPA 2HK5A 2E9UA 4FEQA 2C3IB 3PVWA 4AGUA 3ID6C 2XYUA 4FTTA 3VIDA 3ZBFA 4CV9A 2CNUA 3VUIA 1CKJA 3FMHA 4R1VA 4CFXA 1ZZ2A 2I40A 2VWYA 2VZ6A 4YLKA 5JFXA 4FMQA 4DFUA 1W84A 4I1ZA 5JGDA 4YPDA 3VF9A 3WE8A 1JLUE 4ZJJA 4G3EA 3RPYA 4RC3A 4RPVA 1NT2A 2J9MA 2W1HA 2I0HA 1VEBA 2EB2A 4J98A 5EM7A 5FM3A 4ZSEA 3U4WA 3VRYA 2VTQA 3HAMA 3PG1A 4IVAA 3G90X 4EH4A 2W1GA 4HZRA 3FQHA 3K2LA 4QTCA 4ACHA 2VNYA 4C4JA 5F9EA 5L6OA 4C2WA 4PNIA 1XH9A 3DFAA 3LCKA 3LPBA 3P0MA 4GU6A 2R2PA 1PXKA 3F2RA 3FI2A 4FTAA 4O2PA 4HVIA 5HNBA 2W1DA 2XK4A 1O6KA 3KKVA 5A3XA 3LFSA 3E87A 3MW1A 3IECA 3PIXA 3LJ0A 5KZIA 4DITA 4QPMA 3LFFA 4DAWA 4BWKA 3F3VA 3FKLA 4ZP5A 4JDHA 4EH5A 5LVMA 3HMPA 2EB3A 3PVBA 4YHTA 4FNXA 1U4DA 5HE1A 4CQGA 3BYMA 3QQFA 2OIBA 2PVJA 5JKGA 1WVYA 3ZRLA 1W8CA 2VTTA 3E63A 3QTSA 3LJ2A 3OHTA 1L8TA 3NW7A 3V3VA 4E4LA 4KNBA 4RA5A 3LM0A 3RPVA 2C6OA 1YKRA 4R7BA 4YJUA 4QMXA 4ANQA 3LFBA 4J99A 5H8BA 5KMNA 2C5XA 5FTOA 5L6WL 2QNJA 2A27A 3MPTA 4FIJA 4BIEA 1DAYA 5FWKK 5M4IA 2ITYA 3MVLA 3RVGA 2Y9QA 1TKIA 1OBDA 5CU3A 4L44A 3BU6A 4N6ZA 4AE9A 4DCAA 1GJOA 4FSRA 4DBNA 1OUYA 3NRMA 1UA2A 2WEIA 4R3RA 3OWLA 3FMJA 3LXKA 3RBWA 2J0MB 4RFMA 4EH3A 4FA2A 4CCBA 3VS1A 2PE1A 1ZAOA 3QHWA 4XUFA 4J95A 4NL0A 5EQYA 3KREA 5TE0A 5CF6A 4OTGA 4LRKA 4XG8A 5ANJA 3SRVA 4F08A 1QPDA 1SYKA 4I24A 3ODZX 3U54A 2PMIA 2X6DA 2F7XE 3TZ7A 2A19B 5KBQA 5EM6A 4K11A 3U8WA 3Q2MA 4MNFA 3BE9A 4AN3A 5CAOA 2XEZA 2CNQA 2P2IA 4G3DA 3AMAA 4BCMA 1K3AA 3KMUA 4EZ7A 3RTPA 1Q3DA 4DGMA 4I5CA 5HQ0A 2ZV8A 5E91A 3NWWA 4GJ2A 2YAKA 5CY3A 3U4UA 4FV8A 5I9ZA 2PMNX 4FEVA 4KKEA 5AR5A 3I81A 4FIHA 4RLKA 2JDVA 2J5EA 4FVPA 3F3WA 5LARA 1JPAA 2CHLA 2NRYA 4IJ9A 1Z57A 2YZLA 1VYWA 3KQ7A 4XP0A 2XB7A 3R9RA 3L1SA 5TR6A 2IVVA 1XWSA 4C4FA 4FBXA 2C6DA 4E8AA 2W96B 1SNUA 4MXXA 3NNVA 3V6RA 2GNFA 1OI9A 4DG3E 3QC4A 2JAVA 5IDPA 3W8QA 4FNZA 4OAUC 2PUNA 2VX3A 2R0IA 4JJRA 4ZEGA 4XG3A 4JR3A 2Z02A 1Q4LA 2VWWA 4EK8A 2O8YA 4FSMA 4LUEA 2OJ9A 4P90A 5TT7A 5HBHA 2G2HA 2QURA 2VTMA 3PY3A 2WIHA 4FT7A 5HE2A 3BZ3A 4TZRA 4P5QA 2C0IA 4ZTRA 2C6EA 1XBBA 1J1BA 3MV5A 2WIPA 2BDWA 4GSBA 4YR8A 5J5SA 2FB8A 5CU6A 1MRYA 5CEQA 3SXRA 4YUQA 3UZTA 1OIQA 2G15A 5HNGA 4YSJA 4CLJA 2PULA 4O7WA 4FT3A 4XG7A 2PMLX 3JVSA 3UTOA 1LEWA 4IC8A 4HVDA 4Z16A 2VRXA 1KOAA 3TDWA 3IK3A 4RC4A 4D2PA 3DFCB 2YISA 4CQEA 4O84A 1OPKA 3FMDA 3D5WA 4KAOA 2UVZA 5T3QA 3SKCA 2EU9A 2Y6OA 3F9NA 5BQ0A 3AMYA 4MWHA 3HX4A 4YTFA 4LOPA 3VBTA 3NGAA 4C2VA 3FKOA 3AG9A 3ZSHA 4O86A 3LFCA 2E2BA 4DCEA 1LEZA 2J0IA 3PUPA 3QTQA 4FKJA 2J90A 3UG2A 3VF8A 1OUKA 2XS0A 3KY2A 3OWJA 4FTOA 5DEYA 3ZO1A 4ZLZA 3RCJA 2QD9A 4RIXA 4ZS4A 3VUMA 1KSWA 3PRIA 3UP2A 2QONA 1ZMWA 3G5DA 5KMMA 4BDJA 3GUBA 3IW4A 3KRJA 2F7ZE 5TF9A 1Y6BA 1KE5A 3C4XA 3LFNA 5IQEA 5EOLA 3CGOA 3TI1A 3O23A 1YXUA 4YJSA 3KK9A 1OB3A 3AGLA 4EWQA 4Y46A 5JQ8A 4O82A 3HDNA 3DBEA 4QMSA 4XCUA 5AP3A 2LAVA 4BF2A 5CANA 4OTHA 3EN9A 3QZIA 4EOQA 1FVTA 5A14A 3ZBXA 1ZWSA 4KIPA 5D9HA 3OF0A 3DAJA 3FI4A 3GENA 3NW6A 5HNIX 4KUJA 5CSXA 4O0XA 3Q2JA 3COHA 4QD6A 3RJCA 3ACJA 4EBWA 4CKRA 5EHYA 2GQSA 4O0UA 4JBOA 4D4SA 3AT3A 3D0EA 5FUTA 3PE2A 3CTQA 1REJA 3QQJA 4F9BA 2WMVA 5AAGA 4QP2A 3FKNA 5A9UA 3EIDA 3W32A 5EYKA 4A9SA 4ZLOA 4ZTNA 4FKIA 3UIMA 2A0CX 3RK7A 2ITVA 3QLFA 2HZIA 2ZJWA 4C02A 4O7NA 3PPZA 3ZLYA 4DEHA 1LR4A 3W8LA 2QG7A 2JDRA 5K3YA 4UXLA 4IAFA 2Z7RA 2JAMA 5L3AA 3R22A 4K18A 4FKVA 5HCZA 4AWIA 5M53A 3DS6A 3QQUA 2BRNA 3HUCA 3ZM9A 4BCNA 4D1SA 4DLIA 3F5PA 3OBGA 4NFNA 4BDBA 2GMXA 3ZTXA 4Y83A 2QLQA 1PXJA 3IGOA 4TWNA 4DEBA 3V5QA 2BZIB 3DXNA 3V6SA 3VUHA 4UX9A 3ZZWA 2ZM1A 3HMIA 4EH7A 5HD4A 2F2UA 5CLPA 3QWKA 5AUXA 3P5KA 4IC7A 3DA6A 3EQCA 2Z7QA 2O65A 3BGZA 4PTGA 4APCA 4U6RA 3ZSGA 5JFSA 2XM8A 4QYHA 3LCSA 3ORLA 4TN6A 4TWOA 4EZ5A 5IQIA 5BPYA 4I94A 4U80A 5K4IA 2Z7SA 4ZJVA 4GK4A 4LI5A 4Z55A 2CLXA 2ETRA 2JD5A 3PG3A 2ITPA 4FOBA 4FNYA 3VULA 4DEEA 5A4QA 1CKIA 1YWNA 4DEGA 2Z2WA 5CF8A 1ZOGA 4G34A 1V0OA 4G5JA 2YM8A 4UZDA 3GC9A 4FV5A 4BCIA 3F3TA 4WBBB 5JK3A 2G1TA 4MBLA 4X3FB 5HIDA 1JOWB 4BDIA 2QOLA 4Z7GA 5KKRB 4YNEA 2BAQA 5M06A 4S32A 4X6RA 3NDMA 3VWAA 2Q0BA 4XLVA 1OPLA 4ZZNA 3K5VA 4X2GA 5AIRA 2NRUA 4C4IA 5BVWA 4CKJA 5AP4A 2ITQA 3WZKA 4FZDB 2J5FA 3REPA 5GINE 3C4ZA 4KKGA 3D7TA 4IW0A 4BZDA 3CE3A 2R3NA 3FMMA 3KN6A 5AV3A 4C62A 4C0TA 2XRUA 4LRMA 2PUIA 3LW0A 4AS0A 4WD5A 2GDOA 4E1ZA 5CQWA 2DS1A 4G2FA 4QMUA 4E26A 1OKVA 5ETIA 3DK6A 3Q5IA 5ITAA 2B54A 1YWRA 4WO5A 1Q62A 3LJ1A 3BLHA 4G31A 3V8WA 4FEUA 2WU6A 3UIXA 3PP1A 2UVYA 4D1ZA 4C35A 1CSNA 3DZQA 4JBPA 3HA8A 2X2LA 4NJDA 5A4EA 5K4JA 4LL0A 2Z7LA 3RGFA 4CFFA 3UDBA 2G9XA 3R9DA 5C26A 2BKKA 3TZMA 4FEXA 3EFKA 5DI1A 5LVNA 2X81A 3VHKA 3QRJA 4IANA 5HLPA 3NYOA 4WUNA 2W1FA 4HGSA 4M12A 1WBNA 3GQIA 4Q5EA 3MVHA 4QYGA 1VJYA 2VGPA 3DKCA 3MY0A 4KBAA 1WBTA 4BKJA 2CSNA 2XCKA 3OC1A 3NIEA 4MD7E 2BDFA 4BCHA 5HHWA 2J0KA 3ALNA 5AX3A 4RC2A 4YTIA 3I1AA 5H8GA 3ZO3A 3E3BX 3VS6A 4IM0A 1QL6A 3UYTA 4YC3A 3RPSA 5L2WA 4X3JA 4ZTHA 2BZKB 5FP6A 2XCHA 4F9WA 2J4ZA 5EG3A 5HX8A 3KRXA 2HW7A 2WO6A 1NY3A 4XRJA 3SOCA 2AC3A 4RIYB 3FXWA 3UZRA 2X7GA 2WMXA 5EM8A 1KE8A 2PUUA 4JRNA 3FSKA 1SVHA 1QPEA 4IVDA 2XIZA 4WA9A 3UMXA 5IEYA 4FKSA 2YAAA 3F3ZA 3S95A 4IEBA 5CSWA 2QU6A 3F2NA 3EZVA 5AP5A 5BVEA 4EH9A 5C4LA 4JIAA 3KVXA 4Z9LA 4J96A 4W8EA 1DM2A 4DTAA 4JX3A 3E5AA 5CX9A 4XV3A 2JBPA 4BYJA 1U46A 4M97A 2UW3A 2VTSA 5C4KA 3ZEWA 2BFXA 2XEYA 4FTJA 4I20A 5LVLA 4ALUA 3BE2A 3PP0A 3U55A 1UVRA 2RL5A 2PUPA 3A4PA 4S30A 4UN0C 3E64A 2ERZE 4RLLA 4Y95A 5BVOA 2OIDA 1KWPA 2V62A 4X2JA 5D7AA 4O6LA 4OTWA 2GNIA 3GCVA 3R7EA 4O6EA 3HP2A 1WZYA 3MN3A 2BRMA 3I60A 2BIKB 3EL7A 2CN5A 4YLLA 5IMEA 4ARKA 2UVXA 4GS6A 4YC6A 4BDEA 1APME 5C8MA 1M52A 3QA8A 3EN4A 4Y73A 4XG4A 1UU7A 4W9XA 3L8VA 4E6CA 2FA2A 5I5ZA 4DH7A 5AUTA 5J1WA 4UXQA 3DPKA 2OWBA 3P23A 4FSYA 4LGDA 3OROA 3MB7A 2BHHA 3KK8A 4EOSA 4N4SA 2I0YA 1R1WA 1AGWA 1YI6A 3QQLA 4FV1A 4R3CA 2C69A 3O51A 3ZDUA 4MQ1A 2GFCA 1DI8A 4WSQA 5AMNA 5E8TA 3IKAA 2Y0AA 4PNKA 2C1AA 4DH5A 5CF4A 4XX9A 5HO6A 3FYJX 3IDBA 4AG8A 1M14A 3ZC5A 4BWXA 4F7NA 2NNWB 3GVUA 4FSQA 4IDVA 5GZAA 3R8ZA 5HCYA 1NA7A 2PE0A 4BKYA 3WIKA 2FYSA 4WG4A 4CRSA 5K0XA 3EJ1A 3L9NA 2PVMA 4II5A 2YFXA 4BBFA 2YDKA 2YM5A 3V5JA 3PPKA 3A60A 2ZMCA 4JG8A 3JPVA 4BTFA 4MD9E 4YZ9A 4F09A 4C4HA 2JDSA 4Y8DA 1CM8A 3R83A 3KXZA 2QLUA 4AUAA 5IEXA 5E7RA 3TXOA 2I7QA 3OY3A 3O71A 2IVTA 4WUAA 4M69B 3W2RA 3DK3A 3F7ZA 4LGHA 4TYJA 3SHEA 2YJSA 1U5RA 3H0ZA 2B55A 2JIIA 3QYWA 4MBJA 1XH6A 4FUYA 3THBA 4D9UA 5E90A 4UMUA 4AZFA 1V0PA 3AD6A 1WBWA 4F9CA 3QRTA 5B0XA 3GC8A 4YGAA 5FDXA 2QOIA 4RZWA 4MXAA 4ACGA 3ELJA 1PKGA 3FZOA 1UWJA 4BKZA 3UOLA 1U59A 3FUPA 1OL7A 5IF1A 3UPZA 2W5HA 2C68A 2VWZA 5B2MA 2F57A 2HENA 2WMRA 4XYFA 4IB3A 2OZAA 4MQ2A 4UALA 1H1PA 3JVRA 3DAKA 5I9XA 3RAKA 4GH2A 4M14A 4YLJA 5DE2A 2W99B 4R78A 2BVAA 1OKYA 5HG8A 5CF5A 4U9AA 2W17A 2IWIA 3W2SA 5FXSA 2X9EA 3ERKA 5J9YA 1CKPA 5E8VA 2IW6A 2QKRA 3UODA 4PRJA 3T9IA 5GHVA 1ZZLA 5EW3A 2P4IA 5CAPA 1ZMVA 2J7TA 4JVGA 3D94A 4C7TA 2A4LA 5DGZA 4LV8A 3TEIA 3VAPA 1DS5A 4GEOA 3MFSA 3VHEA 4CT2A 5I9VA 3FLSA 3NNXA 1FVVA 2DUVA 1QPCA 2P3GX 3MESA 3U87A 5M55A 3ZMMA 4BCOA 4ZTMA 2WQNA 1CMKE 5EDRA 3QFVA 4YJTA 4CMOA 4BGGA 2WQBA 4DFNA 3R71A 3ZM4A 1BL7A 2YCSA 4IFCA 3P7AA 4HPTE 4GIHA 4F6SA 5FXQA 4E3CA 4AOTA 2XK7A 3PSBA 4FODA 1UV5A 4O96A 3VQUA 2VWUA 4AU8A 4GYIA 4FOCA 1PMVA 3FZPA 2F9GA 3C4FA 3EQIA 3FDNA 3UNZA 2UW9A 4I6HA 2OU7A 2RKUA 1TVOA 2PVNA 4E5AX 5AA9A 1H0WA 4L43A 4DT9A 2R3MA 2WAJA 4YO6A 1FOTA 4J8MA 4V01A 4V05A 5KZ0A 2RG6A 2VGOA 4EUTA 3C50A 4NM3A 3MY5A 1RE8A 1IEPA 3OCTA 3P7BA 3WOWA 2BTRA 4IWDA 1Y6AA 4AF3A 4O7TA 3DCVA 3CQUA 1H1RA 2PVYA 2BROA 3GU5A 1XH5A 3DBCA 3R1QA 5IEVA 3NIZA 3NNWA 3PFQA 3BQCA 2FSTX 4MF1A 3AC5A 3D4QA 2HWOA 4EOMA 3ACKA 1M7QA 3OW4A 4FSTA 5HD7A 3E8DA 3MFTA 3MIAA 4FZFB 3VW8A 2UZEA 1YQJA 4RZVA 3HLLA 4W4YA 3N4UA 3TN8A 4IM2A 4E5BA 3WZEA 3WYXA 2ZB0A 3T8OA 3CIKA 4JI9A 1EH4A 3PVUA 4O0WA 5AR3A 3QD0A 2ESMA 3NMUF 1Y91A 3I6WA 3FSFA 2A2AA 4QMVA 2YABA 4GT3A 4GFGA 2NO3A 2CMWA 3UQGA 3UC4A 3BU5A 4CFWA 3P9JA 4I6BA 2WGJA 3BLRA 5EYCA 4I22A 3FHRA 4EOKA 4L00A 4DLJA 3MPAA 4YURA 1R0PA 2YM7A 1W7HA 4X2KA 4D4RA 3MH3A 2V22A 5JMSA 2CDZA 2XK3A 3PJ3A 3EQRA 3N9XA 3QCXA 3ZLXA 3ZONA 2VO6A 2WB8A 3QD3A 5IDNA 4AZVA 5JH6A 3LIJA 4EH8A 2WTKC 4U44A 5G6VA 5IMXA 2JFLA 4FYNA 1G8AA 4ID7A 1Y8GA 4WBOA 4A07A 2X2KA 3CTHA 2ZV7A 3MSSA 3DGKA 3O7LB 3PXYA 5FM2A 4QP3A 3NS9A 4G9CA 4S34A 3MYGA 4MVFA 3ZDIA 5C1QB 3AQVA 3OT3A 2QHMA 2VTOA 3ZZEA 3V5WA 4WRSA 5IISA 4IWPA 5D12A 5CI6A 4H3BA 2C6KA 2J0JA 3ALOA 4BHNA 2CJMA 4OTIA 3MVJA 4TYHB 3LFDA 2GQRA 2BR1A 2XP2A 4UY9A 3W2PA 3VNTA 5I4NA 2XIRA 4W9WA 4BDGA 3OCGA 4K6ZA 4PP7A 3F5XA 5CNOA 3Q96A 4LUDA 4GFOA 4QP7A 4F65A 1WVWA 3BEGA 2OGVA 3NLBA 4O0TA 1UWHA 2HOGA 5FEDA 3UC3A 3BBWA 3Q32A 3DZOA 3FLQA 5AP2A 3CD3A 1SZMA 5JZNA 3Q52A 4LMNA 1YDSE 4BICA 4C57A 3UE4A 3ZRMA 4ACCA 3KA0A 3S1HA 4U0IA 3DBDA 4TYIA 4ANSA 5B2KA 2XK6A 2B7AA 4IX5A 3QCSA 4CVAA 2QOKA 4ASDA 4F63A 2B1PA 1LUFA 3DDQA 4DGGA 4ZLYA 4MXOA 4CD0A 5C8KA 3K5UA 4H1JA 4B6LA 4D2SA 2O5KA 2PVLA 3S00A 5IQBA 3WILA 3ULZA 1U54B 2BRGA 3KULB 2XH5A 2LGCA 3TNIA 1H1QA 4ENYA 2OK1A 3NYVA 2IO6A 5CU0A 4DHFA 1GIHA 3FMLA 4QMWA 3RWQA 4C37A 4S2ZA 2H8HA 3GFEA 3OS3A 3QALE 4IACA 4YBJA 3VQHA 3C0IA 4KBCA 4RBLA 4U79A 4PMPA 4Q5HA 2QOBA 3IGGA 4AZTA 1OPJA 5IA4A 1OKWA 4QP9A 2IZTA 3E8NA 4YHJA 2H6DA 2Y8OA 3BYSA 3GP0A 2P2HA 2BTSA 3JS2A 4M66A 4QMOA 3SXFA 4MHAA 2OF4A 3NAYA 4G6LA 2VNWA 4RWJA 4TNBA 4DFBA 3FY2A 4F1OA 3VVHA 4AGWA 2CGWA 2AC5A 1OL6A 2HIWA 4O2ZA 4XV2A 5DHJA 3TJCA 4JL9A 5CAVA 2C3LA 3O17A 1XH7A 3N4TA 2W1CA 2CKPA 2O3PA 2R5TA 3UNJA 5LOHA 3RALA 3TACA 4M7IA 2EXCX 3KXHA 3LQ5A 4GCJA 2B9IA 2Y4IB 3BHHA 4XLIA 4CZTA 2R3OA 4CFVA 3NW5A 1UKIA 4ZZOA 3DB8A 5F94A 2X4ZA 4PDYA 5EI8A 2WTVA 3L9MA 3QBNA 3KF7A 3O8TA 3UNKA 3LQ8A 3QL8A 4QRCA 2WTJA
chains in the Genus database with same CATH superfamily
4FKLA 3DAEA 2ZAZA 3OCBA 2YDJA 4RIYA 5FTQA 1R39A 3FY0A 4IM3A 4EC8A 5L2QA 4O0VA 5CU4A 3ZFMA 4EQCA 2ITXA 4PMTA 2DYLA 1HOWA 3Q4ZA 2Q0NA 2WMAA 3C0HA 3BKBA 2GSFA 2XNMA 1Q61A 5L2TA 2PWLA 3AKLA 1FMKA 2W4OA 3OY1A 5DN3A 1JKKA 2VTAA 3EH9A 4FK3A 4RVTA 3TNWA 5J1VA 5M4CA 4ZY5A 5AIKA 5EDQA 1ZOEA 2XNPA 2PMOX 2ITWA 4JOAA 2QQ7A 2RFSA 4YJRA 4ZZMA 4IX4A 3ATSA 1PKDA 4XEYA 3IW7A 4UMQA 3BPRA 3VS5A 5HORA 3PXZA 4UZHA 4R8QA 3IG7A 2P0CA 5HCXA 3VC4A 2XIYA 2QO9A 4IDTA 3W18A 4CMUA 1PF8A 4D28A 3CQEA 4D2TA 3A7JA 4R7IA 4A4OA 4G6OA 4MEDA 3I5ZA 3PXRA 4PMSA 3IDPA 4J1RA 4R3PA 5IA2A 2E9NA 3RP9A 2XIKA 2GNHA 2W1EA 4EHGA 4QMQA 4GV1A 4W4XA 5HVJA 5AAFA 4I4FA 4I5PA 2GNJA 2E9OA 4O21A 3UO6A 4F7JA 5CAUA 2QKWB 2R3PA 1RDQE 2X7OA 4PPAA 5HBJA 1SNXA 4DGLC 1WBVA 1SM2A 4JDJA 4PQNA 4BJJA 2FSLX 5HVKA 1JWHA 3BCEA 3VBWA 4BYIA 1TZDA 1YWVA 3BV3A 2YM4A 4O7YA 2XZSA 2R3HA 4R77A 3F3UA 3NYXA 3W2QA 3EN5A 4C58A 3IDCA 4EC9A 5EM5A 3D14A 4QEBA 1JNKA 5LMKA 3V04A 1NVRA 3CGFA 5HTCA 4DG0E 1IAJA 4FKRA 3NUYA 5IQCA 4HYIA 3RNIA 4RRVA 2NYAA 3CY3A 4TKSA 3MJ1A 3SQQA 5B7VA 3PVGA 5K5XA 4KRCA 1OL1A 5JGAA 5FD2A 2OJGA 2XVDA 3F61A 1XQZA 2UZTA 4QQCA 4XJ0A 3AOXA 2IW8A 4ASZA 3PSDA 3C5UA 2W7XA 4M84A 3MI9A 3LLAA 2HZ4A 4DTBA 1B38A 2UZWE 1LPUA 1NVSA 1FGIA 2YIRA 3A99A 3QD4A 3QQGA 3U6IA 2QR8A 5D41A 3QLGA 4FUXA 3LFAA 2VO7A 4FIGA 3TKIA 3SXSA 1P14A 3CKWA 2GS7A 4JAJA 4AN2A 1M2PA 2QOFA 4GG7A 4NM7A 3TKUA 4QNAA 3UYSA 3Q6WA 4OTDA 1XHAA 4MBIA 4FF8A 4O81A 5L8KA 3OOMA 4H05A 3PTGA 4QP1A 1H07A 4TWPA 5ANGA 2JC6A 3E8EA 4AXCA 5IA3A 3A7GA 5F1ZA 4WOVA 3WF7A 5IH6A 5K9IA 4X2FA 3N51A 5IQAA 2I1MA 5H2UA 5I3RA 4IAKA 2BHEA 2PHKA 3BYOA 2UZLA 4XBRA 4BDCA 4O7SA 4YMJA 5IA0A 3QTIA 4KB8A 4EHEA 2JDTA 5E8ZA 1M2RA 3RZBA 3OD6X 2BMCA 2HZNA 2XNBA 4L3JA 5FTGA 4E6QA 2X9FA 4YTHA 3TIYA 4JG7A 4O0SA 5DG5A 4BI0A 4LV7A 4UYAA 3ZO2A 5CASA 3HMMA 2YDIA 5IQFA 2HY81 2C1BA 4J53A 3OXTA 4KABA 5FDPA 5KMJA 3G9LX 2OXDA 3QD2B 3R9OA 4U40A 1UKHA 4IWQA 4FC0A 2A98A 4FIFA 4H3QA 4FTQA 4I92A 2PYWA 3ORIA 1UU3A 2JEDA 3EN6A 4DTKA 2VTHA 4D58A 3O0GA 1PW2A 3CY2A 5D7VA 5DNRA 4DG2E 2XJ2A 4HJOA 4NIFB 5G1XA 3W33A 2BFYA 3BLQA 3ZLWA 2KTYA 2RFEA 2F7EE 2Z8CA 4ALWA 1G8KA 1W98A 3R2BA 3IW6A 2UZOA 4G3CA 4U42A 5DT3A 5TO8A 3ORNA 5HG7A 2ITZA 2OH0E 5AA8A 3RAIA 5C01A 2ONLA 4C4GA 3HZTA 1GY3A 4FIIA 4FTNA 3ZUTA 5BVFA 1Q99A 3GU6A 3EFJA 3QXPA 3LOKA 1XKKA 4RJ6A 4YJPA 1JKLA 3WIGA 2PK9A 3A8WA 3R7GA 4GIIA 4HPUE 3PJ2A 2BZHB 2I0VA 4RT7A 2OFUA 4J7BA 5EQPA 5GIOE 3PA3A 3ULIA 3QQHA 2UZBA 2R3FA 3A7HA 2ZDUA 5A6NA 2OKRA 3NUUA 5IZFA 4GUEA 4NJ3A 4TY1A 3E7VA 3RKBA 4GK3A 3UIUA 3UP7A 4EK6A 3H30A 3TDVA 2IVSA 4EK5A 4ZK5A 4RJ3A 2YWVA 2OW3A 4L6QA 5HEZA 4USEA 3VBXA 4O7VA 2F4JA 2IZRA 4ZS0A 3UIBA 3W2CA 5ICPA 3NCZA 4ITHA 2OJFE 3P08A 2GTMA 1BYGA 4FT9A 4AW5A 3BEAA 4C8BA 2VTNA 1YHWA 3M42A 3COIA 2HCKA 1IAHA 1PXNA 3AGMA 2QVSE 4TYEA 2FVDA 3SG8A 2BCJA 2XYNA 1YOJA 3KF4A 5A54A 1MRVA 2ETMA 5KBRA 5BUIA 4O7LA 2JKMA 2UW6A 4FG8A 4I21A 3ZH8A 4ACMA 5A4TA 1J1CA 4MKCA 3V5LA 1SMHA 3AC2A 4NT4A 3R7OA 3MA6A 4CG9A 4GU9A 3BWFA 1I44A 3C4WA 3PE1A 5EOBA 4GW8A 4TYGA 3FXXA 4QMZA 3Q6UA 2G2FA 4K8AA 1A9UA 3GQLA 4A06A 3EHAA 4EBVA 3SGCA 1QPJA 2CGXA 3VUKA 4D2VA 3CEKA 2HWPA 3FPMA 4G6NA 3EYHA 3NSZA 2OI4X 4UWBA 3FC1X 2BUJA 3ORMA 4U43A 2B9HA 1B39A 4J97A 2QU5A 3IW5A 4BZOA 4DYMA 5KHWA 2VWXA 5AADA 4D1XA 4O38A 3DB6A 3DKFA 3Q5ZA 3QWJA 4KA3A 4MWIA 3WF8A 3HRBA 4JDIA 4CGAA 2X8IA 3CCNA 3EWHA 3TZ8A 2IZUA 4UWYA 5AV4A 2F49A 1XH4A 4O1OA 2YITA 4YZCA 4EYJA 3A8XA 2QR7A 5CQUA 4ZTLA 4AT5A 1V0BA 4AW1A 1KE6A 2W0JA 1G3NA 5CZHA 4E7WA 3L9LA 3CTJA 3MPMA 1MUOA 4ANLA 4AT4A 4ONAA 4RIWB 3ZU7A 4XOZA 5ANEA 2GTNA 4C4EA 1YXTA 1JSUA 4K2RA 4O27B 4B0GA 3W0RA 2JBOA 4DHJA 3CSVA 2FGIA 4JLCA 4EOPA 3Q9WA 5CT0A 1Q8UA 4NEUA 4TYHA 1ZXEA 3SOAA 3G51A 3O7LD 4LFIA 3NUSA 1E1XA 4QMNA 5LCKA 3HV6A 2H96A 4HGEA 2CKQA 4FI1A 1W2DA 5HESA 4HOKA 2YCFA 3TKHA 4EONA 1URWA 3Q9ZA 2GS6A 4XHKB 1OIYA 5EDPA 4OW8A 4D5KA 4BFMA 3H9FA 3O50A 3ATTA 2C3JA 2CCHA 2W5AA 3OOGA 2IJMA 2XNGA 3ODYX 3R7VA 3UMWA 4ZSGA 4DH3A 2GS2A 5JFWA 4FL3A 4L52A 1IASA 2VWIA 2PZRA 5C8NA 3BGPA 5CALA 5BNJA 5AV1A 5K0KA 1T45A 4LM5A 4WHZA 1PHKA 2H9VA 3CPBA 3KULA 5HG9A 5CS6A 2O64A 4BTKA 4EOIA 1Y8YA 4KSPA 1OM1A 4PUZA 1FPUA 2JKQA 1RW8A 3EL8A 2XBAA 4AOJA 3II5A 4TPTA 3HMNA 4LRJA 4IZ7A 2PE2A 4BCQA 3GOKA 2BALA 2B0QA 1PXPA 1R0EA 3LFQA 3FI8A 4EK4A 5FQDC 3NUNA 1BKXA 3MJ2A 2NP8A 4FKTA 3V51A 2V55A 5H3QA 5EW9A 2XMYA 3GT8A 1FQ1B 3CXWA 3FZRA 2C4GA 5M4UA 4R1YA 3TTIA 1BMKA 3LXLA 5EKNA 2VTJA 4FX3A 4QYFA 3H9OA 2R7BA 4PTEA 4AP7A 2YM3A 2ETKA 4FK6A 5CXZA 5LMKC 1IA9A 1AQ1A 3SG9A 3KFAA 4JR7A 3TIZA 3ANQA 1KV2A 4YPSA 4O22A 3FLZA 3TUBA 5EH0A 4I5MA 3BYVA 1GAGA 4PDPA 3KGAA 5IQGA 3RINA 3K3IA 2YA9A 5DR6A 5IQHA 3ZUUA 3RI1A 5AUYA 4FV9A 1ZYDA 3LVPA 3UG1A 4L46A 3D5VA 4BGHA 5JN2A 4FEWA 4HNFA 5DYJA 4FGBA 5E9EA 4BBMA 1GZOA 4DF3A 2XK8A 1XH8A 5HIBA 4EKLA 3BL7A 2VWBA 5I9WA 2XRWA 4OT6A 4ZSJA 2WMQA 5FRIA 5CYIA 2WTDA 4E4MA 1H8FA 3KU2A 4G3FA 5CSVA 1MRUA 3ORXA 1IRKA 4AFJA 4CNHA 5CVHA 2OICA 5FP5A 1JBPE 1WFCA 5AEPA 4ZJIA 5LVOA 2ZDTA 1XBCA 1VYZA 3UBDA 2XJ0A 4FSUA 2EWAA 4L9IA 1QMZA 2RSVA 3GB2A 2W1IA 2R3IA 4RJ5A 4XG6A 5M51A 3NAXA 4BDKA 2JKKA 3SLSA 3WE4A 2OFVA 2UW5A 2WQEA 3AT4A 4KRDA 1G8JA 4FTMA 2EXMA 3F82A 3SVVA 5DWRA 5TKDA 2XKFA 2ITNA 3NVMB 5GIPE 3HL7A 5ANDA 2DWBA 4MXCA 2YLEA 2C5VA 4EL9A 3BHVA 4E4NA 2WFYA 5AR7A 4JG6A 4NM0A 3E88A 2J2IB 3PLAE 4FGRA 3NUPA 3FC2A 2W5BA 4CSVA 2GNLA 3OCSA 4EQUA 5KCVA 3R8PA 3R63A 3F66A 3LZBA 3SX9A 3BHYA 2JIVA 5FBNC 4AZSA 4HVGA 2J6MA 1HCKA 4ZIMA 5J79A 5CI7A 4EYMA 4MX9A 2JIUA 4F6WA 2W4JA 4TRLA 5L4QA 3Q4CA 2GNGA 3JXWA 4IB5A 3AMBA 3KN5A 3PJ8A 4RVKA 2X8DA 5HTIA 3G33A 1Z9XA 2WQMA 5E1SA 3QUDA 2XNNA 1F3MC 3PWDA 5KNJA 4JX7A 2XALA 4LOQA 4CZYB 2QO2A 4M0YA 5E1EA 3UOHA 2ZB1A 4BL1A 4C34A 5AUVA 5DH3A 3GCQA 3DOGA 3B8RA 5M09A 4QPAA 4G9RA 5HBEA 1IR3A 2QO7A 3L8SA 4BCKA 4N57A 1HCLA 4XBUA 2ONLC 3SV0A 5EFQA 4AW2A 4BCJA 3HV5A 3MBLA 1BI8A 2WOUA 5EI2A 2Y7JA 3VUGA 3CPCA 2QCSA 2VX1A 3PIZA 5I0BA 1PXLA 4OT5A 5AJQA 4UBAA 3KRRA 4A7CA 5AR4A 4QYEA 4AXFA 1Q8ZA 2WELA 3FLWA 4F70A 3VO3A 2PZ5A 1MQ4A 4AA5A 4GJ3A 4HVSA 3NUAA 5DIAA 1YHSA 3B2TA 3C0GA 4HCTA 1O6LA 2GHMA 3CBLA 3QUEA 3BHTA 3PXFA 4WG3A 4OTFA 4NWMA 3OWPA 3OEZA 4HYHA 5E8UA 3TCPA 3AC1A 4AQCA 4JT3A 4AA4A 2ZOQA 3FLYA 4RIXB 1M7NA 3W55A 4PTCA 5CEOA 5F95A 4F1TA 3DU8A 4U3ZA 5AR2A 3BGQA 3QKMA 4JQEA 4Y5QA 3V8SA 2UZDA 4AE6A 4HCVA 5L2SA 1UNHA 3RPOA 4A4XA 4O4FA 4YZBA 4ENXA 4D4VA 5DMZA 1GIIA 3B8QA 4EORA 3KC3A 5JEBA 4I4EA 4R5YA 4FTUA 2XBJA 4I3ZA 4BHZA 3GCPA 3E62A 5CXHA 3MH2A 1YXXA 4H39A 5BYLA 4QQJA 4G17A 3NCGA 1J3HA 1PMNA 3EKNA 4M3QA 3CR0A 2X4FA 4WNMA 4GFMA 4ANMA 3BIZA 1VR2A 4CYIA 4NM5A 5EHLA 4EH6A 3TV4A 5CSPA 3FQEA 4FICA 5C9CA 4GKHA 3F5GA 3Q04A 4OTQA 4KSQA 1YDTE 3LE6A 2HW6A 2CPKE 2B53A 3UPXA 3HV4A 4IZYA 2C6TA 3ZXTA 2WU7A 1P5EA 5L8JA 3MFUA 3R7UA 3UQCA 3QRUA 2X0PA 4X7QA 3R01A 4FV3A 1KE9A 4AA0A 3V8TA 3L9PA 4K77A 5CENA 2H34A 3LCOA 5L8LA 5EQEA 2W05A 2WMUA 4C3FA 3EQFA 2BIYA 3SW4A 3G0EA 3R6XA 3TNPC 4J52A 4BB4A 1FBNA 4YP8A 4XV9A 4EOJA 4WNPA 4YJNA 2G2IA 4AACA 2J50A 4Q2AA 4PDSA 3OW3A 3ZOSA 2V0DA 2GHLA 5AP7A 3W0QA 4BR3A 4FRFA 2OF2A 3TV6A 3NFGB 5CWZA 4F0IA 4EJ7A 4RX7A 4CFUA 2XARA 4FT5A 4FSNA 3E93A 3A62A 2W1ZA 3MH1A 4AXAA 2WKMA 3O2MA 3C51A 5J8IA 1ZYLA 3ENHA 2RG5A 3C5IA 5CEKA 2RIOA 2Z60A 5JRQA 1FMOE 1MP8A 4BDHA 3G2FA 1OL5A 3DT1A 3R73A 3R1SA 5DT0A 2WTWA 3UVRA 3V5PA 3GCSA 4F64A 4CXAA 2VTPA 4CCUA 1P4FA 4C36A 5L6PA 3PZHA 4F9AA 3DY7A 2WMWA 3RK5A 4DE4A 1REKA 1Y57A 4FG9A 2Y6MA 4WSYA 4BCGA 3LXPA 4YO4A 3HDMA 5AUUA 1WBPA 4P7EA 4USDA 5GZ8A 3OFMA 4O83A 4NW6A 3R04A 4CV8A 1P2AA 3QTRA 5KE0A 4AOIA 4IH8A 2R3RA 3R8MA 4O0RA 4BI2A 3MVMA 2CNVA 2BRHA 3QF9A 5IA5A 3O96A 4FSZA 5CT7A 5CNNA 5DA3A 2PVKA 1H08A 3QHRA 3QTZA 5AX9A 4X21A 4Q9SA 2GU8A 5BVNA 4X3FA 5FXRA 3POOA 2YJRA 3A61A 3HV3A 4OBQA 2HY0A 1ZYSA 4I0TA 4QMTA 3ZRKA 1GZNA 4E6AA 4E5WA 3LXNA 4IX3A 4PDOA 4FKPA 4N0SA 3QAME 4USFA 4YZNA 4EQMA 4ZMEA 1IA8A 2B9JA 3C13A 4K9YA 2R3LA 3KXXA 4U97A 5DBXA 4CTBA 4I23A 5DFPA 3LMIA 4TNDA 2B52A 4QMMA 1XBAA 1W2CA 5T6KA 4MD8E 2J51A 4C3RA 3D2IA 1UNLA 4F7LA 3FAAA 4D5HA 1WBOA 4IVCA 4YJVA 3NNUA 4LYNA 1TQMA 3O8PA 2WXVA 2FSMX 2WQOA 2BZJA 5J87A 4I5HA 4IAYA 2GFSA 5A6OA 3FMEA 5EYDA 3QTWA 4NCTA 3PA4A 3I7CA 2YZAA 2BAKA 4FTKA 3FLNC 4XP2A 3OBJA 3DJ5A 4HZSA 4H3PA 3D9VA 2WTKB 4S33A 3RAWA 2CCIA 4I6LA 3DTWA 1KOBA 5A4LA 4BIDA 3RNYA 4A9YA 2IG7A 1ZMUA 2OBJA 3QZHA 4DH8A 1YDRE 4UYNA 3HP5A 3QYZA 2YERA 4AX8A 4X2NA 4RJ8A 1FGKA 3FE3A 3AC4A 4ANBA 3BLAA 3HA6A 4Y72A 5AAEA 4LGGA 4AN9A 4CKIA 3P86A 4C59A 2CGUA 1JSTA 4XS2A 2PPQA 2UW7A 3MGYA 2ZM4A 3PY1A 1OVEA 4ERWA 1OKZA 4U45A 4F99A 4PX6A 1PYEA 1BUHA 2R3QA 3D7ZA 5J5TA 1GZ8A 2GCDA 3P4KA 5F4NA 4RWLA 4MK0A 5HICA 4PL4A 3D83A 4LOOA 4G5PA 3T3UA 2XAOA 3F69A 2X1NA 4N6YA 4FR4A 3HRCA 3UOJA 1Q8YA 3BU3A 3ZO4A 3PZEA 3AKJA 3BI6A 2YHVA 3RPRA 4Y85A 1BLXA 4MXYA 4B4LA 2QG5A 3ZHPC 4DA5A 4JAIA 2PTKA 1YI4A 2X6EA 3MA3A 4HYUA 3RMFA 1SVGA 4JQ8A 3LKMA 3BWJA 4QOXA 4UWCA 3S0OA 4DT8A 4MNEB 4IAAA 4OTRA 3W10A 4FL2A 5FEQA 4IIRA 2FUMA 2PVRA 4WRGA 3ZFYA 2ZM3A 3PLSA 4QQ5A 1DI9A 1U5QA 3VBYA 4N70A 4FVRA 4YSMA 1PMUA 2XUUA 2C3KA 2CKEA 4FG7A 3TG1A 5EK7A 4CT1A 3W0MA 2AUHA 3C1XA 2WZJA 4YC8A 3QZGA 4QTAA 4ZTSA 3ZUVA 4WNKA 3IOPA 4DFYA 1F5QA 3TV7A 2PY3A 3EQHA 4PL5A 3N4VA 3DK7A 2QOOA 4HGLA 4ZY4A 2XNOA 4QMLA 4E73A 2O0UA 4ALVA 1OBGA 4IFGA 3VS0A 3QX2A 4BDAA 4BTJA 4OAVB 3OEFX 5GJDA 5LWNA 3GU8A 5IH5A 3FYKX 3G9NA 4FNWA 3RHKA 3SD0A 3DJ7A 1F0QA 5HU9A 2C47A 1Q8WA 3TWJA 4AT3A 3GEQA 3EB0A 1YVJA 4FT0A 3FV8A 4KIQA 3HAVA 4DEAA 4H58A 2EXEA 4RX9A 1J7IA 3VN9A 2KULA 3SAYA 4OLIA 1K9AA 4NH1A 2C5OA 5HLWA 4DDIA 4FV2A 4L01A 3S2PA 2R3GA 2YWPA 4AGCA 2V5QA 4RSSA 1ZRZA 3UVQA 3W1FA 1FVRA 2ITUA 4F1MA 3ANRA 5E8XA 4WG5A 3FZSA 4A9RA 2REIA 2B9FA 3KXNA 4NKAA 3ZYAA 3WZDA 4BVUA 3TUDA 4V04A 4JRVA 3FL4A 4RVLA 2BPMA 4FIEA 5HU3A 3R7YA 4CFNA 1I09A 4ASXA 3EFWA 4EKKA 1H1WA 3OWKA 4PV0A 4S31A 3ROYA 4BTMA 2O63A 3EMGA 3VS2A 4U7ZA 2OXXA 3WZUA 3Q9XA 3HKOA 4LV5A 4RJ4A 5GJGA 3V01A 5KMOA 3W0OA 3OTVA 1O9UA 4JQ7A 4IHPA 4IVBA 3KRWA 2R3JA 4AZEA 4V0GB 2R7IA 4FV6A 3DNDA 5KO1A 1QCFA 4ANNA 3U6JA 4BZNA 2C5YA 4PMMA 4UMTA 5ANIA 3VBQA 4ZMFA 1OL2A 4B8LA 1DAWA 2UZUE 4OTPA 4QMPA 4M69A 4FTLA 3ZS5A 4F4PA 3WARA 3GGFA 4JXFA 2RGPA 5BUJA 4P5ZA 4L3PA 2OZAB 1VZOA 5LWMA 3SW7A 4Z3VA 3E8CA 4E93A 3QTXA 1Q24A 2WPAA 3HUBA 4X0MA 4O91A 2X2MA 2EVAA 3EOCA 4RJ7A 5B2LA 3TT0A 4YBKA 2Y4PA 3Q60A 1RQQA 4HCUA 4QTBA 4CZUA 3QX4A 4EHZA 2C0OA 4UMRA 1Z5MA 3U6HA 3Q3BA 3F7WA 3KCKA 2IPXA 4NZWB 4U8ZA 3AXWA 4XP3A 3EQDA 5EKOA 2HXQA 4U41A 4DEDA 3UVPA 3Q53A 4QTDA 4XRLA 4YU2A 5LMBA 4PPCA 2WEVA 2QOCA 4L45A 3CP9A 2VUWA 3IQ7A 1T46A 3QUPA 5A46A 4RQKA 2FSOX 3FMKA 5I9YA 2RFNA 4AW0A 2XK9A 4D4YA 5M08A 3HNGA 2WD1A 2GQGA 4H1MA 5JT2A 3ORPA 3LAUA 4AAAA 3BV2A 3ITZA 2XM9A 3UJGA 3VS4A 3HECA 2HYYA 3CJGA 4OGRA 4C33A 2Q83A 4KD1A 3VJNA 5HX6A 3F5UA 2WNTA 4GT4A 3R1YA 4IB0A 3D15A 5E4HA 3TNHA 4ZY6A 4C38A 3GFWA 5ANOA 3LCDA 1J7LA 2X39A 3O8UA 4L8MA 4KBKA 4O0YA 4R6VA 3NPCA 4D0WA 3DKOA 3PSCA 3PXKA 3T9TA 4DGOA 3BRBA 1X8BA 1URCA 5DPVA 3QZFA 5JGBA 4KIOA 1ND4A 4BCPA 3ZCLA 3LQ3A 3I6UA 3JY9A 2YCRA 4BIBA 5BYYA 4PWNA 5ETFA 2OO8X 5H9BA 3AD5A 5FBOA 3RK9A 3R8LA 2OIQA 4QP4A 2XKEA 3H10A 3L8XA 3WBLA 2VN9A 4ERKA 5JQ5A 2XA4A 1WBSA 4U81A 4X3FC 1PYXA 3E7OA 5AUZA 1S9JA 5KKRC 2SRCA 3FI3A 1G8SA 1OIUA 3C9WA 5FLFA 4PPBA 3S4QA 4BRXA 1Q5KA 4RVMA 2R64A 3ZFXA 4YJOA 4D55A 2AYPA 1H26A 2W9ZB 1YXSA 2C5NA 2OZOA 4DH1A 3P78A 4KINA 3ZC6A 1H00A 3AD4A 3VONA 3M11A 1ERKA 3CLYA 3BELA 4JS8A 4TXCA 1XO2B 4XG2A 4A9UA 3GOPA 3I0QA 5BMSA 4BY9E 1IG1A 4A4LA 3W16A 4DINA 2BRBA 3ETAA 3IPHA 3Q4TA 5E8WA 3EQPA 3WF5A 5DRDA 3UGCA 5LJJA 2PVHA 2HAKA 5HI2A 5CZIA 3I4BA 2UW8A 4MAOA 5E8YA 4DC2A 2YN8A 3TL8A 5LQFA 4J8NA 2X7FA 5BV3A 4NK9A 4NCTC 4C3PA 4NUSA 4YZDA 4EK3A 3DXQA 4I93A 1TQIA 3LCTA 2VV9A 3OG7A 2VO3A 3CQWA 3QC9A 3ORKA 4RA4A 3KEXA 2IZSA 4ZSAA 3K3JA 3JUHA 5I3OA 3VS3A 4QTEA 4P2KA 3BQRA 2HZ0A 5M57A 3LHJA 1J91A 3I5NA 3FMNA 4FTCA 4YNOA 3PJ1A 4XH6A 4MYGA 4TWCA 3S3IA 4LG4A 1WAKA 3G6GA 4B8MA 4C61A 4YTCA 1WCCA 3DTCA 1BL6A 4EI4A 2XKDA 5EYMA 5IQDA 1PXMA 5C03A 2CLQA 4I0RA 4IAIA 3NYNA 3GXLA 3R2YA 4KIKB 3VRZA 5JSMA 5AM6A 3UO5A 4IMYA 3P79A 4TT7A 2YLFA 3AT2A 3KMWA 3KVWA 1J7UA 5M07A 1R78A 1YHVA 4O4EA 1YXVA 3MTFA 4RMZA 4NYEA 1ZY4A 3UOKA 3R30A 3AC8A 4ZTQA 4EWHA 2C6LA 5DVRA 5CSHA 4DHZA 3JYAA 3IONA 1ZYJA 3G6HA 3GC0A 3R02A 2JGZA 4FZAB 3AC3A 4F9YA 3PA5A 2QODA 3PPJA 3U9NA 1GIJA 3R0TA 3RHXA 5ETCA 4GRBA 3MIYA 4MH7A 1V1KA 5C27A 2VD5A 4FTIA 5JFVA 4NU1A 5GNKA 5JZJA 4K1BA 3ZSIA 3NUXA 5ACBC 2PU8A 5IH4A 3IO7A 2C6MA 5FG8A 5HLNA 4HW7A 3ORTA 4W4VA 1H01A 3EKKA 3PWYA 4EOOA 3C7QA 2W4KA 4LQMA 4EOLA 4ZSLA 2XANA 4ZXTA 2E9VA 4UMPA 3RZFA 3NVKI 3R8VA 2PZPA 4AZWA 4F6UA 4NTTA 2ZV9A 4CEGA 4M15A 4MUQA 1W83A 5DR9A 4XNEA 1SVEA 2FH9A 3QXOA 3WI6A 3IOKA 3LLTA 4QYYA 2BKZA 3MTLA 1PXIA 1U54A 3ORZA 4IXPA 4IZ5A 4QO9A 3MFRA 4XOYA 4B99A 4FZ6A 5ETAA 4BC6A 4IQ6A 4TL0A 4DGNA 4TTHB 1ATPE 3F88A 3TZ9A 4XMOA 4L42A 1JVPP 2WMSA 4QP6A 4Y5HA 1H1SA 3DNEA 5AV2A 1O6YA 4BI1A 3UQFA 4G1WA 3JR1A 1OIRA 2UZVA 4ACDA 5M44A 1OMWA 4D0XA 4E6DA 5LMAA 4CMTA 1KUTA 3JY0A 3VJOA 5CEPA 4G3GA 4F0FA 2PZIA 3I0OA 3HYHA 4GT5A 4FKUA 3NX8A 4IZAA 2RF9A 4ORKA 5KMIA 3E92A 4QT1A 4BDFA 5LXMA 4L7FA 4HGTA 4WIHA 4M67A 2X8EA 1R3CA 4QQTA 4AGDA 4BGQA 2UW4A 5CTPA 1MQBA 2XNEA 4I0SA 5J9ZA 5KMLA 3OT8A 3H9RA 2BAJA 3KB7A 4MXZA 4EJNA 2XKCA 4GVAA 4IADA 4YJQA 4ITIA 5IU2A 4CRLA 3G0FA 3WF6A 3FJQE 3GC7A 5DEWA 3SDJA 1KE7A 3QRKA 4L7SA 4ZAUA 3GNIB 3POZA 3ROCA 4Z7HA 4D2RA 3QU0A 5BX0A 3T3VA 2XF0A 5HO8A 1E9HA 4ITJA 5DR2A 1CDKA 1JQHA 4GG5A 5CVFA 5AP0A 1XMLA 4FE2A 4LL5A 2VU3A 2I0EA 2GHGA 4NFMA 1W0XC 2J0LA 1YOMA 4AXDA 3AKKA 4X6QC 3UZPA 3QCQA 3PJCA 1W82A 3DBFA 2ITTA 1RJBA 2OH4A 4APPA 5CAQA 3OTUA 4CYJA 4K0YA 3QKLA 4MNEA 4U5JA 4QNYA 3SRVB 4DBXA 3C4EA 1M2QA 5HE0A 4A9TA 4IBMA