2VO0A

Structure of pka-pkb chimera complexed with c-(4-(4-chlorophenyl)-1-(7h-pyrrolo(2,3-d)pyrimidin-4-yl)piperidin-4-yl)methylamine
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
343
structure length
340
Chain Sequence
KGEQESVKEFLAKAKEDFLKKWENPAQNTAHLDQFERIKTLGTGSFGRVMLVKHMETGNHYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLTKLEFSFKDNSNLYMVMEYAPGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLMIDQQGYIKVTDFGFAKRVKGRTWLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFATTDWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEEEIRVINEKCGKEFSEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CAMP-DEPENDENT PROTEIN KINASE, ALPHA-CATALYTIC SUBUNITPROTE
publication title Identification of 4-(4-Aminopiperidin-1-Yl)-7H-Pyrrolo[2,3-D]Pyrimidines as Selective Inhibitors of Protein Kinase B Through Fragment Elaboration.
pubmed doi rcsb
source organism Bos taurus
molecule tags Transferase
total genus 108
structure length 340
sequence length 343
ec nomenclature ec 2.7.11.11: cAMP-dependent protein kinase.
pdb deposition date 2008-02-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2vo0A01
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2vo0A02
2OF2A 1ZYDA 1YHWA 5DT3A 4DTBA 2X39A 4JJRA 4JS8A 4X3FB 2YM8A 4X21A 4CFNA 3OC1A 3NCZA 4I4EA 4YPSA 5C03A 2RKUA 3KVXA 4RJ3A 3W33A 1ZYSA 5IA2A 1QPEA 2UVXA 1ZOHA 2CKEA 5EQYA 4HPUE 4DEAA 2F57A 4QYYA 3SRVA 2CHLA 2HXLA 4BCQA 4CD0A 3N4TA 1FGIA 4RIWB 3RI1A 4B9DA 3DPKA 3KREA 3GEQA 5CF8A 3IQ7A 5HESA 4CQGA 3LQ8A 3O17A 2W4KA 1J1CA 3RK7A 4XJ0A 5B2LA 2NP8A 2YIYA 4YTFA 4FTOA 2XNGA 5IEVA 3ZRKA 3OS3A 4Z55A 3RZBA 3VBTA 3TCPA 5IMXA 4EQCA 1XH7A 3R7VA 4FTTA 5J1WA 5LARA 3R01A 3OY3A 4A9YA 3LXNA 4AUAA 2PUIA 5AFVA 1JKTA 3GOPA 3EQGA 2ONLC 3O8TA 3OROA 4M13A 1QCFA 4BI0A 2CN8A 1OPLA 3PZHA 3LFEA 4BHNA 4AGWA 3RINA 3FQEA 3C5IA 2J9MA 4GU9A 5LVMA 4YC6A 4I1ZA 1UU3A 5EI2A 3TTIA 2V55A 1CKIA 4UYAA 4QP4A 4FEUA 3A2CA 3RP9A 5BQ0A 4DEBA 1VEBA 3MBLA 2FUMA 4ZK5A 4O22A 1CKJA 3QQUA 4MBIA 4FSTA 2YZAA 4BRXA 4GK2A 3ORLA 4D4VA 2H6DA 4CFMA 2PVFA 1ND4A 4U42A 2GHLA 5E8TA 2GDOA 4R3RA 4E93A 3HDNA 2BDFA 2BRMA 4FICA 3P4KA 3QUDA 1JKSA 3FKOA 3O50A 3MYGA 4FZ7A 2E9PA 3HZTA 5E8XA 3PE2A 3E63A 3QALE 1CDKA 1UNGA 3LXLA 4E20A 3OD6X 4I94A 4ACDA 5I9VA 2YCFA 5JFWA 4YTIA 4BFMA 2G01A 4RZVA 5M44A 3FI4A 1ZMUA 2BALA 2BIKB 3DQXA 3GOKA 1H07A 1BKXA 4IFGA 4C3PA 4C4IA 3FKNA 3GT8A 4ZTLA 4BKZA 3QBNA 2GPHA 2PVKA 4F09A 4E5WA 4AA0A 2R7BA 1U5RA 2RG6A 3NZ0A 2OK1A 4L52A 4I20A 5IKWA 4O7TA 2IPXA 4Y85A 5H3QA 3EOCA 3BLQA 2HY0A 5AP0A 3KXHA 3IS5A 1JNKA 2UZTA 4X0MA 3U6JA 3QRUA 3DT1A 4HOKA 4CKRA 5J95A 3DXQA 4FTLA 5A14A 1XBBA 3SRVB 3FMMA 4CLJA 2VWZA 2YHVA 5IF1A 2ZM1A 2GSFA 2ZMCA 4CCBA 2XIKA 3HMPA 4QP2A 5EOBA 3WZKA 2YWVA 5H2UA 4DN5A 4FSMA 4FC0A 3R02A 5E92A 4DT9A 2XYUA 4Z3VA 4OAVB 3C1XA 1H08A 4RIOA 2YM5A 3BHVA 3HA8A 5G6VA 5BNJA 1Q8YA 4ZOGA 3TKHA 3KMWA 5C1QB 1SM2A 1SNXA 3R8LA 4G34A 4CGAA 3ATTA 4FTNA 1Q62A 2IVUA 2QOFA 3GCUA 2ZDTA 4BTFA 3HMIA 1KE8A 4MBLA 3ZSGA 5HD4A 1H1QA 4NEUA 5CX9A 4MWHA 3IDCA 4IXPA 1IEPA 5CZHA 5BVFA 3C4EA 3ZM9A 2J4ZA 4DG0E 4PMSA 2JFLA 3Q3BA 3VUIA 2UZOA 5LJJA 2VO7A 4TXCA 1K9AA 3IW5A 5CI7A 5M56A 2GMXA 3LJ2A 4FVQA 1ZLTA 4O91A 3ATSA 3BGPA 5HTIA 3I79A 3RAIA 1PMUA 2X7FA 4D2VA 2CNVA 3BE9A 3BYOA 3CKXA 2WTKB 1XBCA 4IX6A 4N70A 2C30A 3FSKA 1QPDA 2UW8A 2JIIA 3E88A 1WVYA 5KMOA 2SRCA 3SD0A 4DFNA 5EW8A 2V7AA 4GRBA 1W0XC 4KBKA 3UO4A 2W96B 5CT7A 2ZVAA 5HIEA 5C01A 4R3CA 4IVBA 4RJ7A 2R7IA 4UXLA 4TPTA 2JIUA 2PVMA 5M08A 5HE2A 3AGLA 3DS6A 3KK9A 3JXWA 4DGMA 4ANLA 3ZMMA 3V04A 4F9CA 3CTQA 5E8WA 5ACBC 5K3YA 2Y9QA 4I93A 3R7YA 4IAAA 5AV4A 3LAUA 1OKYA 4XYFA 4BBMA 3F88A 2JBPA 5EQEA 3ZDIA 3KCKA 4BZNA 3CBLA 3NDMA 2W1DA 5IEXA 4QYFA 5A4LA 4ZLOA 2OH4A 3FZRA 1F5QA 3VUKA 2CCIA 4FIFA 2YAAA 3TDVA 1JKKA 4YGAA 4NW6A 1ZRZA 5CEOA 3P5KA 2RFNA 1KOAA 4ARKA 4LGHA 4R1VA 2QHMA 4C62A 3TZ7A 3W10A 5AUTA 1Q61A 3M42A 4UEUA 5HI2A 2W7XA 5F95A 4G1WA 4J8NA 2UW4A 3A7GA 4BI1A 3TDWA 2QOKA 4W4XA 4OTWA 3EFLA 2YACA 1WZYA 4G31A 4ACGA 3TNIA 4TYIA 5CVGA 3SOCA 3LM5A 3ZYAA 4C34A 4ZY4A 5EW9A 1J91A 1Q41A 2P4IA 3L9NA 3MY0A 3Q9WA 5CEPA 2AC3A 3HNGA 2UW9A 3QZFA 3REPA 4LRMA 3RPYA 4A7CA 3CE3A 5E9EA 3D83A 4YSJA 2CNUA 4L9IA 2WO6A 3ORNA 4J71A 4RFZA 5AR2A 5HEZA 4AU8A 3B8QA 1DM2A 3FMKA 3ZONA 5K0XA 3C0HA 1BYGA 3EYGA 3PRFA 4CMTA 2FSTX 3OFMA 5BYYA 2HXQA 2UZVA 1JAMA 3EFWA 1OBDA 3DU8A 4FTMA 3IW6A 1VYZA 2R3IA 5HO8A 1IAJA 2BAKA 4FZFB 4BI2A 3JYAA 3BQRA 4IWOA 4KINA 4QMPA 3D0EA 4YLKA 4RWIA 2FSOX 5DT0A 2I7QA 2BZKB 1YWNA 5J79A 4NK9A 2JDRA 3FL4A 4NW5A 4F0IA 3W2QA 1KE6A 2AUHA 3DKFA 3FMJA 2G2FA 3FLSA 3ODZX 4DG3E 3AXWA 5EYDA 3UGCA 4LV5A 4MNEA 5GNKA 2WTVA 4BC6A 3EFKA 3UNKA 3PJCA 1J7LA 1UNHA 2ERZE 3MB6A 4EJNA 5B2MA 4P2KA 3SV0A 3ZEPA 4D58A 3ETAA 1H1PA 3MY1A 5AUYA 2JC6A 3DKOA 3GGFA 1OL1A 5CF4A 3QCXA 2BPMA 4J8MA 2XP2A 4PP9A 2WB8A 3KMMA 5FBNC 1R0PA 3QA8A 4AT5A 3DBEA 3JY9A 2CKOA 3AC2A 2QCSA 3F69A 4ZEGA 2BFYA 4BTJA 4QMXA 3UVQA 4JX7A 3LLTA 3VUHA 5CAPA 3ENHA 4TWOA 4M7IA 3VUGA 5LVOA 4GCJA 1Q8WA 4EHGA 2WHBA 4L3JA 3EL8A 3NYNA 4YZCA 5JGBA 5JK3A 4FTQA 4LM5A 2ZV7A 2VO0A 2VX0A 4RX9A 4ANBA 3TM0A 4ZSLA 4MD8E 3LJ1A 3UC3A 4F6WA 2IZSA 4JBOA 4NFNA 4WNMA 3MVHA 4FKVA 4O6LA 5EHOA 3ZTXA 2XYNA 4FTUA 4L43A 2YM3A 4F9WA 3W55A 5CALA 2BFXA 4G17A 3JR1A 1HOWA 4I3ZA 4K1BA 1LEZA 4S33A 2PMIA 4PPAA 2GNLA 4YTCA 1PRYA 2YM7A 5FQDC 4D2SA 4AW0A 2X81A 5DWRA 3Q4TA 3ORXA 3E92A 2HZ4A 2OF4A 2R5TA 3AOXA 2QKWB 1Y6BA 4GFMA 4R5YA 4GV1A 1OMWA 1U46A 4USDA 2GNHA 1B6CB 1PY5A 1XO2B 5E90A 4HYIA 2OLCA 1X8BA 3UZTA 2C6MA 4H3QA 4N57A 1PKDA 3NLBA 5CZIA 4C4GA 3R2YA 3VS5A 3ANQA 5HLWA 4HGTA 3UG2A 4G3EA 4WO5A 3R9OA 1YXUA 2V22A 3POZA 4QP6A 4RBLA 2YAKA 5ANJA 3LQ5A 1PJKA 3LCKA 3R1SA 3A61A 4FK3A 5DEYA 3A7JA 4R6VA 5J87A 4ZLZA 5GJGA 1ZZ2A 4ALVA 1NVRA 1OPKA 2W9FB 4IDTA 4II5A 1OGUA 4NTTA 3QFVA 4ZJJA 5IA1A 2XH5A 3PJ8A 2RFSA 4MNEB 1FPUA 1M2PA 3FE3A 4JLCA 5A9UA 3R30A 3ZEWA 4BDAA 5CXZA 3VW8A 4O82A 3ACJA 1DI9A 2YIXA 3MSSA 3MJ2A 5BVDA 4E73A 3PXKA 5BMMA 5JKGA 2VWUA 2A0CX 1JLUE 2R3FA 2UVYA 4OTDA 3QLFA 4QYHA 4RJ8A 2BRHA 5BUEA 4PRJA 3VW6A 3MFRA 4HGLA 4S32A 5D10A 5KMNA 3ORMA 4EH2A 4MKCA 3SDJA 2NNWB 1U54B 5EKOA 5AR5A 2FSLX 2AC5A 4YNEA 4O7ZA 2B1PA 3NGAA 5DT4A 4DG2E 5HZNA 1YXSA 5KMKA 2UZEA 4EUUA 3DXNA 1WBOA 3DFAA 3QKLA 4X2JA 5DN3A 5BYZA 2KULA 4EWHA 3LCTA 4RQVA 4WKQA 3PPKA 2FA2A 4IAFA 4DEDA 5I0BA 1FINA 5CEQA 4PTGA 1MUOA 5AUVA 3DZOA 3MFSA 4CG8A 3ACKA 1M7NA 3FYJX 2IW9A 3GU6A 4DBNA 2XM9A 1F0QA 4OGRA 2B9HA 4A9UA 4ENXA 3R9DA 1U5QA 4BCHA 3P9JA 1KV1A 4EWQA 2C6OA 3QD3A 3UVPA 4D4YA 3N9XA 3HECA 5B7VA 3LQ3A 2O2UA 3DQWA 3RAHA 3VO3A 4RX7A 2IW6A 3R8VA 3UIMA 2XEZA 2WTIA 1OL5A 4BCGA 5HX6A 3KL8A 4ANNA 2F2CB 4AP7A 2C6IA 2A2AA 3L8XA 4FNXA 3F3WA 4I5MA 4AZWA 3LZBA 2R3MA 4TY1A 3ORZA 5CXHA 4C36A 3V01A 4E6AA 2YZLA 2VTRA 1YI6A 5CANA 4EH4A 3L1SA 4C59A 5HBJA 2UW7A 1YXVA 3R7UA 1PXIA 3VBVA 2P3GX 1OECA 2F9GA 3GFWA 3FI8A 1DS5A 4NU1A 2CCHA 3R28A 4FOCA 4AZFA 1O9UA 2OXDA 3P86A 3VUMA 2EB2A 3E8CA 3OEFX 3ZU7A 5CWZA 2YJRA 4FV1A 5AR4A 1SNUA 3NUPA 4EZ3A 3KA0A 4IZ7A 3HGKA 2PUUA 4L3LA 3D2IA 3FLNC 5M57A 2QR7A 3SXRA 2XIZA 1B38A 1KE9A 2BUJA 5I9ZA 4YZNA 4HYSA 3ZM4A 2W1HA 3MV5A 3LM0A 3QCYA 3VS3A 3NIEA 4AFEA 4AOJA 5JMSA 2UZUE 2C68A 3CP9A 2PMLX 2WAJA 4F63A 5AA8A 1J1BA 3PFQA 2OW3A 4EOKA 4WUAA 4ZZMA 5L8KA 3FZOA 3OOGA 4O27B 4XV3A 3MIAA 4C3FA 4YJPA 2WTDA 3IG7A 1H4LA 4GSBA 1W98A 3UOKA 4JDHA 4IWDA 3UQCA 2X4FA 2QOHA 3QZIA 3OUKA 2A27A 2JKKA 5EM7A 5CF5A 1GZKA 5AEPA 5LVPA 2ITVA 2ZMDA 4CRLA 4C3RA 5A4TA 5CU4A 3NVMB 4I0TA 4LMUA 3FMLA 1EH4A 3OBJA 2W05A 2VZ6A 2IW8A 3FAAA 4MK0A 2ITQA 3U54A 2VWBA 1OZ1A 1ZAOA 3AC3A 4YZ9A 3W2CA 5AADA 2BKZA 5LMBA 3QQFA 4J98A 4B6LA 3CQWA 1IA8A 2OG8A 2C47A 3BBTB 3MDYA 4FG8A 4FL1A 4AT3A 4GT3A 1XH4A 2REIA 4FG9A 4I5PA 3K3IA 4ITHA 4AG8A 3MWUA 3P78A 4BYIA 2HZ0A 2YLFA 3RPOA 2LGCA 3DOGA 3SC1A 4NT4A 4A4LA 4JVGA 2A4LA 3IW4A 3NS9A 5IQHA 1U4DA 3WF6A 3ZLSA 3PDTA 2X8EA 3R7GA 4K11A 3SG9A 5HQ0A 3AMAA 1YHVA 2OU7A 4QTBA 3KXGA 4CZYB 3TT0A 3DZQA 5DR2A 2XK4A 3UMWA 1GOLA 4EHZA 1VR2A 2JDSA 4AA5A 4BYJA 4IHPA 5E8UA 4G16A 2J0MB 4GEOA 5HG8A 4BTMA 4IBMA 2XKCA 2DQ7X 3ELJA 4D2PA 3W2SA 3F5UA 2J0LA 4XBUA 5HU9A 1I44A 4C0TA 2BRGA 3UG1A 4I23A 5AA9A 3Q60A 2JAVA 4XOYA 5HBEA 5KX8A 3VRZA 4ZS0A 4FT0A 3AD5A 3FZ1A 1PKGA 3NMUF 5M4IA 2F7ZE 2R2PA 3F3VA 4JDJA 4OBQA 2XRWA 3QGWA 5CAOA 1LEWA 4GL9A 4R7IA 4LL0A 3VF9A 4IX5A 2C6TA 1Y6AA 2PVRA 3AQVA 4N4SA 1OB3A 3NW7A 4HVIA 5K9IA 2J5EA 1UVRA 3Q9YA 2YERA 4BCIA 4U41A 4IQ6A 4KA3A 3DNEA 3COHA 5H8GA 1WAKA 2IWIA 3NNUA 4ANOA 3DNDA 5J7HA 4MXCA 3EN4A 2IO6A 5DLSA 4C61A 4EH8A 2XNNA 4KIPA 3H9RA 4IC8A 1YOLA 4B8LA 3NUUA 3DAKA 3PJ2A 4WBOA 3W2OA 3ZLXA 5EFQA 5AV2A 2V0DA 1Q4LA 4MXAA 3F2AA 4RC4A 4CYJA 3TV4A 3UC4A 5HO6A 4XG6A 3OT3A 5KMLA 4PL3A 4RX8A 3POOA 5F9EA 2BROA 5BPYA 2YFXA 1J3HA 2ZM3A 4C8BA 3BWFA 3KEXA 3EQDA 1Q24A 3I7CA 2PK9A 3EQPA 1NVSA 3N51A 4O0UA 1FQ1B 4FNWA 4RJ6A 5F1ZA 3FDNA 2GHMA 3GU7A 4IAYA 1XR1A 4KIKA 5GZAA 4DEGA 1JPAA 3HMNA 2QODA 5EDRA 3Q4UA 3W18A 4KB8A 4H3PA 4JDIA 4GG5A 4D1SA 4RRVA 3COKA 3T8OA 1Y91A 2QOBA 3D15A 4GKIA 3MY5A 4XG7A 4YP8A 4O81A 5CSWA 3GNIB 4EOOA 2R3OA 4EC8A 2CLQA 4KS7A 5GZ8A 4FSQA 5FD2A 1M2RA 4D1ZA 3TNWA 4C7TA 3UMXA 2HW6A 5DOSA 4FTRA 4RWJA 2PE2A 3PSCA 5EM8A 4BDHA 2PZ5A 1V0OA 2OWBA 4F64A 1JBPE 2OXXA 2V62A 4FVPA 4MEDA 3F5PA 3RPVA 1PMNA 4A9SA 4ACMA 3HV6A 4QQ5A 4RGJA 3FQHA 5HX8A 2FB8A 4FKSA 4A4XA 4BDFA 4JT3A 4D28A 3MS9A 4I6QA 2WMSA 1OL6A 2ITXA 4CFXA 4FV5A 3S00A 4FV3A 4P5ZA 5EYMA 1H8FA 3G9LX 4QYEA 2HW7A 4QTCA 2PSQA 4GKHA 4I5HA 4DLIA 4IWPA 4YJOA 2WTWA 1XKKA 5T68A 3R8ZA 3G5DA 3EQBA 4M8TA 4AN3A 4BWKA 5KO1A 2RFDA 3A7FA 4H36A 3SKCA 3HUCA 1XH6A 4GT4A 3SHEA 3DB8A 2UZNA 5TR6A 1KE7A 4AACA 4EBVA 4HW7A 2XK8A 4IW0A 5IQIA 3FKLA 3PA4A 5DBXA 3TIYA 4MXZA 3L9MA 4K9YA 2QD9A 1YVJA 4I5CA 3MIYA 4XRJA 5DR6A 4FV6A 3L9PA 4EH9A 3TXOA 2C69A 1PHKA 2JFMA 5KZ0A 4DEEA 2WXVA 4NSTA 4WD5A 3DLZA 5C8NA 5CSXA 3TNPC 2YEXA 2JD5A 5TOZA 3I5NA 2GQGA 2ETKA 2J90A 3BLRA 4JQ8A 3H30A 4LOQA 2G2IA 2WEVA 2X7GA 4ZAUA 4YTHA 3HKOA 3AMBA 4ALUA 2A19B 2WQEA 5HBHA 1M14A 3SX9A 4EYJA 2GFCA 2XIXA 5GHVA 3A4OX 1GZ8A 3DGKA 4K33A 4AE9A 4LQMA 5LVNA 3EHAA 2B4SB 1TVOA 1J7IA 2PZYA 3JVRA 4BGHA 3H4JA 4KIKB 3IONA 4FTAA 3D14A 1V0BA 5I9XA 3WI6A 5C4LA 2ONLA 4FYNA 3DBQA 4FK6A 5D41A 5BVOA 5CU0A 3A99A 1P4OA 4ZTMA 1PXJA 4O7VA 5M06A 5D7AA 3AGMA 3F2RA 2HK5A 3BGZA 3THBA 4XP2A 5HG7A 3R8MA 3HRCA 3MN3A 5LXMA 3E93A 4R5SA 3ZLYA 3DDPA 1OVEA 5ETFA 1BL7A 3TUCA 2QLQA 2H9VA 2J0KA 5AUXA 4F0FA 3O23A 3OBGA 4OTQA 4PPCA 4YZBA 3QX2A 4BCOA 1FMKA 3PXQA 3FPMA 1P4FA 2VTLA 4J99A 2OSCA 4O2PA 4CFUA 5L2TA 3V3VA 4JOAA 5M4CA 3BYVA 4FKOA 2RIOA 5BVNA 4Y8DA 5EG3A 3NNVA 3IO7A 1CMKE 3PY3A 3R71A 4X6QC 4HYUA 4E7WA 3VVHA 4PDOA 3PG3A 2PHKA 1KWPA 3VBXA 4D2WA 2RSVA 3JS2A 4RLLA 2B9FA 2PVYA 3ENMA 4FL3A 5ETIA 2VTAA 2GFSA 3LFBA 4CFFA 3ZXZA 3ID6C 3U6IA 3NNWA 3KU2A 3ZO1A 3LFSA 4FZAB 1Y57A 3OXIA 4GUEA 4HGSA 4O0YA 5CNOA 4ZIMA 4O83A 4YSMA 3V51A 5HHWA 4YUQA 2XS0A 3E3PA 4KKGA 4KKEA 1YQJA 3PWYA 2GCDA 4IE9A 2C3JA 4NJ3A 3AT2A 3I5ZA 5CQUA 2HYYA 5I9YA 1Z57A 4FX3A 2B52A 4U0IA 3CR0A 5AV0A 4Q2AA 3NUAA 4NM0A 1M2QA 2PU8A 3MTFA 3V5TA 1OKWA 2O64A 5D12A 4ZSGA 4K18A 2BRNA 3O8UA 4E4LA 5LWNA 3QQJA 5IQCA 5EDPA 3W2RA 4ZY6A 5J5TA 2ZM4A 2WTJA 4TKSA 3CCNA 4GMYA 1JWHA 4OW8A 4YLLA 4HJOA 3AD4A 1Q99A 4ORKA 2IJMA 4GJ3A 1V0PA 4L6QA 1E1XA 3IW7A 3AD6A 4QP3A 4RVTA 5GZ9A 3KRJA 2BDJA 4BVUA 2R0UA 1L8TA 4RJ5A 3CSVA 1F3MC 2YWPA 2FO0A 3FI3A 3RALA 2HWOA 4DH1A 3PWDA 4MQ2A 3U6HA 3V5PA 1GNGA 4IVCA 4EOQA 3E62A 3KRLA 4MXYA 5D1JA 1YXTA 4XG4A 2XUUA 3ZS5A 3ITZA 4ZZNA 4IANA 4GT5A 2HAKA 3G2FA 4D9UA 3ZCLA 3IPHA 4M68A 2PY3A 3NIZA 4I6HA 3OCTA 3DAJA 4H3BA 3W8QA 5IDPA 2Q83A 3WE8A 2PMOX 3SQQA 1NXKA 2O65A 4BGGA 4YMJA 3Q6WA 2EUFB 4BDGA 5LOHA 2CGUA 2R9SA 4RIXA 2YABA 1WBNA 3F3UA 4MF0A 3LW0A 4PPBA 4RFYA 4RT7A 5KNJA 3K54A 2HELA 3LXKA 4CEGA 3RTPA 5IQAA 4FV8A 4LV8A 5JFXA 3KXXA 4ZTNA 4W8DA 5IUGA 5JRQA 2XNOA 2GHGA 1OIUA 2G15A 2JDOA 3ZSIA 3OG7A 5LVLA 3MPTA 4M67A 4PNKA 4R78A 5C27A 3U55A 2R4BA 3LJ0A 2WEIA 3UQFA 4GJ2A 4CMUA 3RZFA 2BAQA 4GVJA 3HA6A 1H27A 3UOLA 4MVFA 5H9BA 3QQHA 4QMWA 4ZJIA 3BV3A 4QPAA 2R64A 4O21A 2WGJA 1REKA 1PYXA 3WF9A 3NEWA 1GJOA 5F4NA 5KBQA 4Y73A 4D0XA 1G8AA 3EFJA 2W99B 4C33A 5FTGA 3FQSA 2XMYA 2ERKA 3PPJA 3QAME 5TKDA 4TL0A 5CLPA 4UMRA 4ZY5A 4M84A 5IA4A 5TF9A 3UPZA 2Q0BA 1VYWA 1ERKA 4IM3A 2EXMA 4FEQA 2FYSA 2KTYA 1GAGA 3FMHA 4FSWA 2EVAA 4EK6A 2OIBA 3EWHA 1OL2A 4AN9A 5L6WL 1T45A 3CY3A 3I7BA 3M1SA 3DJ6A 3TACA 1Q8TA 4QTAA 4KIOA 4CZUA 3EN6A 3GU4A 4UALA 2WU7A 2XIRA 4TRLA 3ZBXA 3NUYA 3QTRA 3GFEA 5HLPA 3WF8A 1ZXEA 3HL7A 4UMUA 2WMTA 4JRNA 3RPRA 3BWJA 3G90X 3WF5A 4IC7A 4AZEA 2WIPA 4E5AX 4G3CA 1BLXA 3QD0A 4O2ZA 4F0GA 4OTIA 1OUKA 4FV7A 2QOCA 2OFVA 4N6YA 1A48A 1NT2A 1CKPA 3SW4A 4F9AA 3P7AA 5FWKK 3UQGA 1KE5A 3ZXTA 2Y0AA 5IH5A 5IUHA 2W17A 2C5XA 4HGEA 3Q96A 2WU6A 5A6NA 5L8LA 3ZUVA 5KZIA 4ANSA 3DKCA 4QP9A 2I40A 5CASA 2YCRA 2C3IB 5JGAA 3RGFA 1FGKA 4L7SA 2ZB0A 5CEKA 4BCJA 4ALWA 2VAGA 2C3LA 4JR7A 4RIXB 5J9ZA 2CDZA 4R7BA 1QPJA 3FV8A 3OW4A 2VGOA 5E1SA 4X2GA 2E9OA 2PVHA 3IOKA 4O0SA 5LMKC 3KXZA 4IADA 2J5FA 5JSMA 3R1YA 4KWPA 2XCKA 3OF0A 3P0MA 2GTMA 4J52A 4S30A 5FEQA 5JGDA 1XQZA 2BCJA 1ZYJA 4HVDA 4QP8A 1NVQA 3IOPA 4FTJA 5AM6A 4CT1A 4PX6A 4F4PA 5HIBA 4CKIA 3KULA 3R21A 5ANDA 2E2BA 3UOJA 4QMQA 1OI9A 1SYKA 4JG7A 3FY0A 3LFQA 5I9UA 2Z7LA 4G3GA 4WNOA 4XBRA 4XG9A 5JEBA 4QMUA 2BIYA 3HEGA 3QD2B 4NWMA 4XV9A 3K5VA 3PVGA 2PMNX 3NYVA 4EK8A 3QRKA 3ZDUA 3WF7A 5IH6A 3CGFA 2J50A 3PLAE 2UZWE 2WMUA 2JGZA 3L8SA 4L46A 3UP2A 4AT4A 4AFJA 2VTJA 5HO7A 4M0ZA 5J8IA 3R7EA 2E9UA 5ETAA 3VBWA 3R63A 1U54A 4JRVA 4S2ZA 4IAZA 4FT5A 4I6FA 2E9VA 4B0GA 2R3GA 4W8EA 3ZBFA 3RWPA 4OBOA 4CT2A 5I3OA 3GCQA 4RWLA 1PXMA 1WBSA 5ETCA 4IWQA 5CS6A 3I6UA 5IISA 3F5GA 5CSHA 4BKYA 2HZNA 2UZBA 4QNYA 3RMFA 3VWAA 3DB6A 3WARA 4BWXA 2YJSA 4HZRA 3R7OA 2QG5A 5KKRC 1OIRA 4QP1A 2W4OA 5BVEA 4U45A 5IG1A 4FV0A 4JDKA 5AMNA 2W5BA 3TJDA 3U9CA 1WBTA 3UNJA 3BU6A 3P79A 5M53A 4YJSA 3KB7A 3BE2A 2HZIA 2XNMA 2B9JA 2IZTA 3O51A 4RFMA 2OZAA 3FLWA 4KAOA 1XWSA 4M15A 4IDVA 4LRJA 4ASEA 5L2WA 2X6EA 2I0EA 3D5WA 2XJ1A 4A9RA 4HCUA 3FXXA 5KHXA 2GNFA 4BDJA 1PXOA 5HICA 5M51A 3W2PA 4D0WA 4QRCA 4RIYA 5JN2A 1M7QA 5DA3A 3R8PA 4RG0A 5A6OA 2JAMA 4OUCA 2F49A 3UDBA 3PE1A 2R3NA 4YJRA 4ZS4A 4TZRA 4TWPA 4E8AA 4PDYA 5EI8A 1Q3DA 2C0OA 4D1XA 4BDDA 3C9WA 2P33A 3WYYA 3ULZA 5K5NA 3EQRA 3DFCB 4GK4A 5E8VA 3U9NA 3P7CA 3C4CA 3LIJA 1IA9A 3KRRA 3KRWA 4IH8A 3BHTA 2X0GA 2BDWA 4IX3A 3HAVA 3LFCA 4UX9A 1E1VA 5IA5A 2XZSA 4YJTA 5BX0A 1FVVA 3HDMA 5DRDA 1OBGA 5K4IA 2W1ZA 3UYSA 3V5WA 4FTCA 3JPVA 5L6OA 4O7LA 5JQ5A 4ZJVA 2OJJA 5ANOA 5FEDA 3GXLA 3OTVA 3UO5A 3R22A 3CTHA 4TNBA 3KULB 2UW0A 4U44A 3BU5A 2X1NA 5AAGA 2RFEA 3GCVA 3PIYA 3CLYA 4XRLA 2W1CA 3VBYA 3S95A 5E7RA 3Q9ZA 4H1MA 4OTPA 5D11A 3RBWA 3HAMA 3H9OA 4C4FA 4GUBA 3RAKA 4R3PA 2PUPA 4GFOA 3LFNA 3QL8A 4BDBA 2Z2WA 1GZOA 2WTCA 4FOBA 4FT3A 4X2KA 5GJFA 2XF0A 3QX4A 4Q5HA 3IDPA 4M69A 5L3AA 3ZLWA 3M2WA 3MI9A 1GZNA 4F7SA 3P08A 3RHXA 2YCQA 4ZSEA 3U4WA 1P5EA 4UB7A 5AV1A 3QTWA 2IVSA 5LCJA 2Z60A 3R0TA 4JNWA 5H8EA 2I1MA 2GU8A 1YKRA 1Y8GA 2IVTA 4G6NA 4RA5A 3R9NA 4FZ6A 3T9TA 2EWAA 2DYLA 5IQBA 3DDQA 3V5QA 1NY3A 3I1AA 4M0YA 1WBPA 4G9RA 5HTCA 4IFCA 4L01A 3AMYA 3EMGA 4C35A 2OZAB 3QTUA 4DH5A 4F9YA 3QTSA 2R3LA 4AOIA 5ITAA 4EQMA 4UZHA 4P4CA 5IZFA 1UKHA 3WZJA 1JSVA 1YWRA 5AUZA 3VIDA 1JSUA 4CQEA 4ZTRA 5E8ZA 3MH1A 4IIRA 4YBJA 4D9TA 1PW2A 4MAOA 2W06A 4DFLA 5HNGA 4BDCA 3SG8A 4LGDA 4RIYB 3IGOA 4O7NA 3VUDA 2YLEA 3C4WA 3CPBA 3HVCA 3VF8A 1W83A 3BPRA 4GFGA 2NO3A 2YCSA 3NYXA 5HIDA 4D2RA 4DFXE 5L6PA 2QU6A 2VTMA 3GI3A 4BZDA 3V5LA 2XRUA 5E8YA 1MRUA 4HZSA 3COIA 4QMYA 4YHTA 4K6ZA 3U87A 2Z7SA 2XBJA 3GB2A 5CI6A 2PE0A 3WOWA 4EHEA 5AP3A 2V5QA 1OM1A 3TEIA 3R7IA 3F61A 3UP7A 2HENA 3F5XA 5EYCA 4NIFA 2OIQA 4DYMA 4O0XA 2UUEA 1Q5KA 4ACCA 5EYKA 3B2TA 2DUVA 4XS2A 1WBWA 2C1BA 4IB3A 2QOQA 2VWXA 2YDKA 3I0QA 3LCSA 3PSDA 3LLAA 2Y8OA 3PA5A 3WZDA 3Q2MA 2C0IA 1BI7A 3UJGA 2GQRA 3V6SA 4F1OA 4RPVA 4FKUA 3CKWA 4F9BA 5IA0A 5HNBA 1S9IA 3E87A 3PJ3A 4GYGA 1ZYCA 1KSWA 4YC8A 3VS0A 2PZIA 2VTIA 4JAJA 1PXKA 2C6LA 5EW3A 5HG9A 3DA6A 1FVTA 3HP5A 4M3QA 3ZSHA 4FODA 5CT0A 3G0FA 1E9HA 2NRYA 3QUPA 2YN8A 2HY81 5CEMA 4DHFA 3A7IA 4ENYA 3BHUA 5IQEA 1XH9A 4NCTC 3JUHA 3ET7A 1YHSA 4EH7A 4M69B 2ZV2A 4YLJA 3EKNA 4FEXA 3ZO2A 4EEVA 4ITIA 3S0OA 2RG5A 1IAHA 2Z7QA 3UIUA 3KY2A 1MRVA 5FGKA 2FH9A 2X9FA 3ERKA 4E1ZA 4E4XA 3TV6A 4L45A 1JVPP 3VUTA 3NSZA 3FZTA 3H3CA 4OLIA 2C5OA 3F6XA 4KRCA 4AA4A 3UTOA 4Y72A 3ZRLA 4O1PA 2X8DA 3BV2A 3C5UA 1ZY5A 3C0IA 5AWMA 5C26A 3BHHA 4LI5A 5CVHA 3II5A 2QU5A 5HCZA 4GG7A 3BYSA 4U40A 2PZRA 3DLSA 3R2BA 5E1EA 4JXFA 3RJCA 4DH8A 4AF3A 4CNHA 3QZGA 4YR8A 3H0ZA 4L3PA 4DC2A 1UV5A 4WBBB 5G1XA 4CTBA 4WSYA 4EJ7A 1RJBA 2YM4A 2FGIA 2ZV9A 3VS6A 4ZTHA 2C5NA 3G6HA 2R3HA 4PV0A 3ZHPC 3KKVA 3ZC5A 1GIJA 3ZFXA 1DAWA 2X4ZA 1JSTA 2WD1A 2F4JA 3EN5A 4EOLA 5JFVA 5IDNA 2XKDA 3NW6A 5DMZA 2EU9A 3L8PA 3S1HA 3LVPA 3HRFA 2YM6A 3Q04A 4IACA 5BUIA 2VTHA 5AP2A 5AM7A 2BMCA 5AIKA 3BQCA 1DI8A 3QF9A 3GC8A 1QPCA 4P90A 2VTNA 3KXMA 4ZP5A 1H0VA 2BKKA 4ZMFA 4PF4A 4FIGA 4R77A 5HE3A 4AOTA 2PZPA 4WT6A 3DXPA 4MHAA 4NIFB 2WIHA 3QWJA 3ZUTA 4FG7A 3QTQA 3SA0A 3CY2A 4R7HA 1GIIA 2I0HA 4L8MA 4FIIA 5HVKA 2RL5A 2B7AA 4CSVA 3PY0A 3G6GA 1HCLA 1OIYA 2VWYA 3DTWA 2UW5A 3LCDA 2QC6A 4MF1A 3A7HA 4RSSA 3HRBA 4WG4A 3LKMA 4LL5A 3QGYA 4FSNA 5EM6A 2VTSA 3I6WA 3BGQA 1H25A 5FM2A 3GENA 4WUNA 3UBDA 4BDKA 4MBJA 4KSPA 3S3IA 3NVKI 3ROCA 4U3ZA 3TZMA 5I3RA 4X3FC 3TWJA 2PVNA 1Z9XA 2BZHB 3MFUA 1H28A 3FMEA 3NR9A 4IMYA 4V01A 4D4RA 1PMEA 2ZYBA 5EK7A 1K3AA 1M52A 3M11A 5EHYA 3RM7A 5AV3A 3AC4A 3W1FA 3MB7A 1YRPA 2NPQA 3LXPA 1PXLA 4EKKA 2OFUA 1OPJA 2J6MA 1P14A 4DH7A 2VNYA 2X2KA 2IZUA 2J0IA 4QNAA 2J0JA 5DEWA 5AP7A 2X2MA 5FP6A 3CGOA 4D5HA 4EORA 2XNBA 3TNHA 4F7NA 1KUTA 4QOXA 3UZRA 5J9YA 4MNFA 4L44A 4XG2A 4E4NA 4YO6A 4M12A 5DR9A 4NKAA 3ZUUA 5L2SA 2XK6A 1FOTA 2YIQA 2QQ7A 4G9CA 4XLIA 5CAUA 1YXXA 4AE6A 4TN6A 4YU2A 4C4HA 3PP1A 4ZMEA 4D55A 3IGGA 2WKMA 3AT4A 3LMIA 5FXSA 2XKEA 3F7ZA 5CQWA 1XJDA 4J95A 5FXRA 1SVHA 3BCEA 3PXZA 4J97A 4O6EA 2CGXA 2WOUA 2W1EA 4I92A 3OZ6A 4U7ZA 1O6YA 2W5HA 1PMVA 3KMUA 4G3FA 4OT6A 1J7UA 3PLSA 2F7XE 4KRDA 4BTKA 4B7TA 1G3NA 1T46A 5AAFA 4Z9LA 2Y7JA 3EKKA 5ANEA 4E4MA 4UBAA 3TKIA 3JY0A 4RVKA 3VULA 3QA0A 4HNFA 5KMMA 3D2KA 3AC1A 3MW1A 3OT8A 3MH2A 4ZSJA 5FDXA 3UO6A 3FMNA 3ORIA 2UZLA 4QMLA 4UV0A 4FV2A 4MTAA 2QHNA 4X6RA 5J9LA 1A9UA 2W0JA 2VU3A 1A06A 2OO8X 4FBXA 4AN2A 3ULIA 1STCE 4IZ5A 4S31A 3LPBA 3KN6A 1XH5A 5EHLA 4C38A 4DCAA 3FSFA 3OEZA 4BKJA 4NZWB 2ETRA 1QMZA 4IVDA 3NNXA 2XK9A 4C02A 3TI1A 5HE0A 5HOAA 3PXRA 3H9FA 5IEYA 1UU8A 2ITOA 2QOLA 2OZOA 3IKAA 4FTKA 4Y5QA 3ZC6A 2ZDUA 2GQSA 2JKQA 1UWJA 5FTQA 3VNTA 4EK5A 4HPTE 4WSQA 5KCVA 4U6RA 3D4QA 4NM3A 1MQBA 2QR8A 3BEAA 4A4OA 4HVSA 4LYNA 4HVHA 4BN1A 2I0YA 2C4GA 1YOJA 3EN7A 3LOKA 3R00A 3C50A 4RC2A 4YBKA 5L2QA 2PPQA 3BYMA 1H24A 3KF4A 3U51A 1TQPA 4RLKA 4NTSA 4A9TA 3VRYA 3CC6A 4TYHA 2ITTA 3VS4A 3PY1A 2W4JA 4FT9A 3C7QA 4ANQA 1NW1A 3N4VA 4NFMA 2WPAA 4FV4A 3SXFA 1ZMVA 1VZOA 3OVVA 4FKIA 2PL0A 3LHJA 5LQFA 2G1TA 2H8HA 2VO6A 3GU5A 3HMMA 3Q52A 3SOAA 3DV3A 3E8EA 4QMSA 5C8MA 4CLIA 2BTRA 4BIBA 3VQHA 5DI1A 4NYEA 4FSZA 3AC5A 3VAPA 1SMHA 4IZAA 4BDIA 4ITJA 5HCYA 4OBPA 2VN9A 5FP5A 1M17A 3KRXA 2C6DA 3QHRA 4IM2A 4S34A 4D5KA 2BZIB 4Z7HA 1H1SA 2R3JA 5CF6A 5IPJA 3BBWA 5E8SA 2YIWA 3BELA 2FSMX 2H96A 3E8NA 3B2WA 4YPDA 4FSYA 3BIZA 3HV3A 3QD4A 3CIKA 3OP5A 1AD5A 4JBVA 4ASDA 4UMPA 1I09A 4DEIA 3FHIA 3V5JA 4EK4A 4FEVA 4JR3A 4O86A 4J53A 1AQ1A 2JIVA 5DNRA 4JG8A 2YDIA 4Q9SA 4TYGA 2JKOA 3W8LA 5A3XA 3EQCA 4LFIA 5HGIA 1H26A 4KBCA 5JQ8A 3FLQA 4CZTA 4KUJA 3H0YA 4I6BA 4BCPA 3RPSA 4QTDA 5AP5A 3UE4A 1YWVA 4TTHB 2ZJWA 4Q9ZA 3FZSA 5DYJA 5HKMA 2QO7A 2WTKC 3UZPA 4L68A 1REJA 4EI4A 4DF3A 3UYTA 4MD9E 4AGCA 2BR1A 5HVJA 4JAIA 4QO9A 3GUBA 3VHKA 3PXFA 4CCUA 4EQUA 5E4HA 3NRMA 3SVVA 4DGOA 2C5VA 4G5JA 2VX3A 3Q2JA 3BEGA 2W1IA 2J2IB 2ITYA 3EJ1A 4RZWA 3ANRA 3LFFA 4J7BA 3KC3A 4DITA 4LG4A 4GU6A 3FWQA 3MFTA 2XJ2A 4YJUA 3FC1X 3VS1A 4CV9A 1WMKA 1QL6A 2A1AB 4LOOA 2X2LA 2G9XA 5K0KA 3RCJA 5ANIA 4FKTA 4Y83A 4C2WA 3QC4A 3VS7A 2C3KA 4AWIA 3UIBA 4HCTA 5IMEA 2UZDA 3F66A 4K8AA 3FJQE 2OBJA 3O2MA 4H58A 3LMHA 4AGDA 4PL5A 3PPZA 1AGWA 3OW3A 3BHYA 2FVDA 3OCSA 4UZDA 4OTRA 4RVLA 4EH6A 1NA7A 1GIHA 2WMWA 1LUFA 5BUJA 2O5KA 4GH2A 4HVGA 1BX6A 4FKRA 4TYHB 3FEGA 4O96A 4JQ7A 2YA9A 3F82A 4AW5A 4CKJA 4IAKA 5AR7A 4YC3A 2I6LA 4FVRA 2C6KA 5L2IA 4NL0A 4AZSA 3R8UA 4ERWA 2BZJA 4FUYA 3RNIA 5GJDA 5K5XA 4DFBA 5DE2A 4EOSA 4RMZA 3MH0A 4O38A 5EM5A 1H1WA 4FE2A 2Q0NA 2B0QA 4XP0A 3JVSA 3T9IA 3DBCA 4XUFA 5FXQA 4I0SA 4FI1A 1WFCA 2OJIA 2X7OA 1BL6A 3MPAA 3V8WA 4WA9A 1XBAA 3FI2A 4FIJA 3HX4A 5DG5A 4CMOA 5JT2A 1PXPA 5EI6A 4CRSA 1UU9A 1R0EA 2ETMA 4FIEA 4JIKA 2HIWA 4TYJA 5HU3A 5M07A 5GIOE 3VBQA 1PYEA 2P0CA 5L8JA 4XOZA 3MH3A 4YO4A 1Q8UA 3CEKA 4IM0A 4NH1A 3NUSA 4PL4A 5CU3A 3LCOA 5AR8A 4ZLYA 1ZWSA 4UXQA 5CEIA 3RHKA 4TWCA 4WNPA 5H8BA 2O8YA 2GS6A 4W4VA 5I5ZA 3D9VA 4GIHA 5FLFA 5EKNA 4RA4A 3CTJA 4FKLA 2Y4PA 2AYPA 2V7OA 4I41A 5CY3A 3GCPA 4ZSAA 4U80A 3GC7A 3MGYA 4GS6A 4R1YA 2QNJA 3GCSA 3OUNB 3QRJA 4FKJA 4WIHA 5CU2A 3B8RA 4RJ4A 3KFAA 4GK3A 5EDQA 1JOWB 4E26A 2CKPA 4UMQA 2GS7A 4FNYA 5ACKA 1OKZA 2OI4X 3ZRMA 3EQFA 4B4LA 4DTAA 3CXWA 3HLLA 4BZOA 1XH8A 5C9CA 5A4EA 3G33A 4EHVA 3COMA 4O7YA 1R78A 4TNDA 2CSNA 3L9LA 4DGGA 2CJMA 2CLXA 2DWBA 2P2HA 3A8WA 5DFPA 2GTNA 4PMPA 5M4UA 4LOPA 4IX4A 1FBNA 4IJPA 4QMOA 3FC2A 4QQTA 3DAEA 1BI8A 3HV5A 4V0GA 4BB4A 3ORKA 2VWIA 4AZVA 3HUBA 3HP2A 3Q5IA 5CYIA 4AAAA 4YJVA 4RC3A 3Q4CA 2BVAA 4G2FA 2W9ZB 4HNIA 5HG5A 2Y6OA 2XA4A 3D7TA 4C2VA 3T3VA 3O8PA 4AW2A 2QVSE 3EZVA 4F99A 3WYXA 4FA2A 4QD6A 4OR5A 3KF7A 5KHWA 3EYHA 3MA3A 3L8VA 4KIQA 2E9NA 4XG3A 2W5AA 4KD1A 4CFVA 1Q97A 3WE4A 3HYHA 4F6UA 2W1FA 4G6LA 4D4SA 4ZTSA 3IW8A 1IASA 2JLDA 5EOLA 1CM8A 2O3PA 3ZOSA 3MA6A 1R39A 2BAJA 3BZ3A 3EH9A 4DGNA 5A4QA 4W4WA 1W7HA 4QQCA 1S9JA 5FBOA 2H34A 2R3RA 2VX1A 3AT3A 3DY7A 1IR3A 4PY1A 4CVAA 4EBWA 2J7TA 5FM3A 3OY1A 3QYWA 4AW1A 4G5PA 4XCUA 1Z5MA 3K2LA 1OITA 1YDRE 5DH3A 2VD5A 2WQBA 4BGQA 4KBAA 3PVWA 5IQDA 1CSNA 2VWVA 4IAIA 5KUPA 3NUXA 5HNIX 5AX3A 5LMKA 3QHWA 5HCXA 3R6XA 4KSQA 2ACXA 2P55A 4MXOA 5T6KA 4FUXA 3I4BA 3DK3A 3D94A 4N6ZA 1O6KA 3FBVA 3IDBA 4PP7A 4Z16A 3RNYA 4CFWA 5C4KA 4PTEA 1IG1A 1W84A 4FT7A 2ITNA 3CJFA 1ZMWA 3LFAA 5HTBA 5J1VA 3G15A 4FL2A 3Q32A 4YHJA 3D5XA 2JDVA 2WFYA 1L3RE 2ZV8A 1UA2A 4XNEA 5JH6A 3P1AA 3UIXA 1H1RA 2UW6A 3Q6UA 3OWJA 4OT5A 2B54A 4XX9A 4YNOA 2WMRA 3PVUA 4Y5HA 3D7ZA 2PVJA 5T3QA 2EB3A 4EOIA 5JZJA 2UVZA 3O96A 1URWA 3VJNA 3BX5A 2OJGA 2HWPA 3C51A 3TIZA 5ANGA 4CXAA 2JKMA 5D9HA 3IK3A 1GY3A 5IQGA 4U81A 4DEHA 3NYOA 3KGAA 3TV7A 3MESA 2WMQA 4DA5A 3ORPA 4UWCA 2VTPA 3ZZEA 3C4XA 4FNZA 2LAVA 3CJGA 2CGVA 2PVLA 3QUEA 2B9IA 4JIAA 4AS0A 4J96A 2R3QA 2ITZA 2C5YA 4W9WA 5M55A 4UY9A 4BIDA 4V0GB 1YDTE 3PXYA 4FTIA 5ANKA 4Z7GA 1ZZLA 1LR4A 3KVWA 2J51A 1YW2A 2OH0E 2QOOA 2VUWA 2XM8A 3D7TB 1UNLA 4NKSA 4UYNA 5LCKA 4WHZA 3V8TA 4DLJA 4EH5A 4QP7A 1PXNA 2OJFE 4JI9A 2O63A 4QMTA 5CSPA 3TUBA 3TG1A 1APME 3AC8A 1BUHA 1P2AA 4MCVA 1WCCA 3BYUA 4XG8A 4YZMA 4X7QA 5JZNA 4E6DA 5LWMA 3CS9A 4IB1A 4ZZOA 3RCDA 4EOJA 1OL7A 3DBDA 3KN5A 3R1NA 5I4NA 2ITPA 3TZ8A 5CVFA 3ZZWA 4AGUA 4CG9A 5FG8A 1BMKA 2WQMA 3ALNA 2QKRA 3BU3A 3NW5A 5B0XA 1K2PA 1SZMA 2EXEA 3OWKA 4PDPA 4F7LA 3QXOA 2WNTA 2XB7A 2ZB1A 5AP4A 5JFSA 2ITWA 1JKLA 3E7OA 4IEBA 2VV9A 4U3YA 4F6SA 4LRKA 4EZ5A 2I0VA 4BBFA 3GVUA 2YISA 5DIAA 3Q53A 4XH6A 3GU8A 3FY2A 4ONAA 4Y95A 4MD7E 5K4JA 4C37A 4BCKA 4DGLC 4E6QA 5BYLA 4DE4A 4O7RA 3UODA 1TKIA 2ESMA 4P7EA 4BCMA 3SXSA 1OKVA 4B99A 5C8KA 1WVXA 3VJOA 2QG7A 4XHKB 4JBPA 3O7LB 4PWNA 4YJNA 2WQOA 2IZRA 2GS2A 4W4YA 5TE0A 5CAQA 2GNGA 1RDQE 3Q5ZA 2XNEA 3OMVA 4DBXA 3PVBA 3UOHA 1Y8YA 5HORA 2IVVA 3RKBA 3FXWA 2IN6A 1Q3WA 4G6OA 5F94A 4EKLA 4DFUA 5HD7A 3PA3A 4GW8A 4KS8A 5FUTA 3SGCA 3G9NA 4WRGA 4PDSA 4XLVA 4QPSA 3D5UA 2ZAZA 3A60A 3E7VA 2Y4IC 1VJYA 3EB0A 4RWKA 1TQIA 2WMXA 2VWWA 5CAVA 4BICA 5KE0A 3DJ5A 3IECA 4USFA 3U8WA 1JQHA 1Q8ZA 3FHRA 4IB5A 1OUYA 5IUIA 3N4UA 1OIQA 3RM6A 4CV8A 4EK3A 3OOMA 2VRXA 5TT7A 3CD8A 2F7EE 4HYHA 3A62A 5HE1A 3PG1A 2QONA 5KKRB 3UVRA 3QQGA 4JQEA 2PWLA 4TT7A 2ZOQA 4FV9A 5A54A 1RW8A 2VNWA 2XKFA 4QPMA 4X3JA 3K5UA 4MQ1A 4OTHA 3DK6A 2BILB 4YZDA 4F1TA 4EZ7A 4TWNA 1RE8A 3ODYX 4QMNA 1ZY4A 4NM7A 3S4QA 4FYOA 3E8DA 4PQNA 3RWQA 2PYWA 4U8ZA 4L7FA 2QURA 5J5SA 2NRUA 3NPCA 3GBZA 4FKPA 4ZTQA 3W16A 2PE1A 4FR4A 3PUPA 4GIIA 4L42A 3MJ1A 5DRBA 4BWPA 2QO2A 4O0VA 3NAYA 3K3JA 2XVDA 5CSVA 4APCA 3S2PA 5IA3A 3ZO4A 5M4FA 4MX9A 2Y6MA 3I60A 3BRBA 4K77A 5FDPA 2CMWA 1W8CA 3TUDA 2B53A 2BRBA 3CQEA 4J1RA 3TJCA 2X6DA 2YITA 3Q9XA 1ZOEA 1ZYLA 3KQ7A 3G0EA 4P5QA 2WELA 4BY9E 2OKRA 3MPMA 1G5SA 2JEDA 4EL9A 3NAXA 5IQFA 3ZFYA 3HMOA 4Y46A 4QQJA 5BVWA 3NUNA 3SAYA 3FZPA 5FTOA 5KMIA 4O0WA 4K0YA 2CGWA 1U59A 3QZHA 4EYMA 1WVWA 3RK9A 2PUNA 4LMNA 3QC9A 3R04A 4WG3A 3F2NA 4U5JA 4TYEA 2R3KA 2RGPA 2XK3A 4I21A 2VTTA 3TTJA 4FKQA 2XNPA 3QU0A 3FMDA 4BHZA 4Q5EA 5KBRA 3U4UA 4ANMA 3ALOA 1RQQA 3W32A 4BDEA 3PIZA 3A8XA 5AJQA 2PULA 4AQCA 2W1GA 3A4PA 3QXPA 1W82A 3CD3A 2P2IA 3AG9A 3P7BA 3PSBA 4K2RA 3NCGA 3F7WA 4BCFA 5D7VA 5FRIA 3TN8A 1G8SA 2XIYA 4LUDA 2HOGA 3DK7A 4XV1A 5BVKA 2Y4IB 1H0WA 2JBOA 2XEYA 3MTLA 4YJQA 4EOMA 4FSUA 1B39A 1H00A 3EQHA 3P23A 4NCTA 4JBQA 4EH3A 5A4CA 3Q4ZA 3R9HA 3WZEA 4I4FA 3D5VA 5GIPE 4UMTA 3HV7A 2C0TA 2CNQA 1PF8A 4WOVA 4FSRA 1YI3A 4U79A 3SW7A 2X9EA 3NWWA 3C0GA 3QWKA 4F65A 3QCSA 4QTEA 3O71A 4ASZA 3V6RA 3ZFMA 3C13A 2PTKA 4WNKA 5I9WA 4I24A 5KMJA 3MVLA 3C4ZA 4M14A 2ITUA 3F3TA 2C1AA 3RAWA 4OAUC 3DBFA 2Z7RA 3ORTA 4QMZA 5HLNA 3OWPA 3LFDA 3PTGA 3FPQA 3VS2A 4E5BA 4O1OA 4NJDA 4LGGA 3R1QA 4H1JA 4DFZE 1KV2A 4WG5A 2WMVA 3RK5A 4M97A 2QO9A 4H39A 4DAWA 2YIRA 4C57A 4ERKA 5CU6A 5AP6A 5CENA 4RX5A 3FLZA 4OTGA 4QYGA 5B2KA 5ICPA 3DJ7A 3QYZA 5IH4A 4O7WA 2R0IA 4EONA 4N0SA 2IG7A 3QKKA 4DCEA 3GC9A 3WZUA 4FGBA 3OTUA 4U9AA 4G3DA 3O7LD 3WBLA 2GNJA 5FEEA 4V05A 3MVJA 3QTXA 3GC0A 4AXAA 3E5AA 4HCVA 4XEYA 4FIHA 4KABA 4L00A 4FF8A 2RF9A 4FKGA 4MXXA 3LMGA 3WIKA 2QLUA 4EUTA 3ZO3A 4XP3A 4C4JA 4OTFA 3OCGA 3EIDA 3PRIA 3F9NA 1SVGA 3C4FA 4TW9A 4USEA 2Z02A 5CNNA 3GQIA 4DTKA 2R3PA 2DS1A 4QT1A 3QLGA 4E3CA 3QTIA 3WIGA 3TZ9A 2EXCX 4IZYA 3KXNA 3TNQB 3VC4A 4CYIA 5AAEA 2UV2A 5BMSA 4FZDB 4RQKA 4GYIA 4UN0C 4M66A 3VQUA 2UW3A 2BHEA 4RVMA 1MRYA 3UPXA 4F1MA 2XCHA 3OCBA 3PZEA 4U97A 2QOIA 5F20A 1UKIA 2JDTA 2JITA 4I0RA 4EOPA 3O0GA 4IB0A 3BLHA 3FL5A 3R73A 4BIEA 4X3FA 3RVGA 4X2FA 4BCNA 1ATPE 2VTOA 1TQMA 4JG6A 5J7BA 5JRSA 3EQIA 1R1WA 2Z8CA 4WRSA 3DTCA 2XJ0A 5HVYA 4V04A 1DAYA 3PJ1A 4BF2A 1UWHA 4A07A 3NX8A 5DHJA 1YI4A 3H10A 2VTQA 4PTCA 4BBEA 4FKWA 5A46A 4RIWA 2X8IA 4LUEA 4PMTA 4QMVA 2HCKA 4X2NA 2G2HA 4ACHA 4BR3A 5AIRA 3WILA 1KOBA 4ZXTA 4UWBA 4XV2A 3QQLA 4BL1A 1URCA 4KKHA 5AR3A 4H05A 1FMOE 1MQ4A 2OJ9A 2XBAA 2OIDA 4FMQA 3TL8A 4E6CA 4F08A 3FYKX 4U43A 3DKGA 5M09A 4ID7A 1HCKA 4NM5A 1YOMA 4UWYA 3EN9A 3QKMA 4F7JA 4YURA 4FGRA 1UU7A 5EH0A 4MYGA 3ZH8A 4DFYA 5AX9A 3SLSA 3EL7A 3E3BX 3LE6A 3T3UA 4FEWA 1FVRA 2QI8A 1WBVA 3FLYA 4DT8A 5DVRA 2BTSA 3TKUA 3KCFA 4EC9A 3MVMA 2WOTA 5DGZA 4CTCA 3PIXA 2WMAA 5DPVA 4W9XA 3E64A 4YHFA 4IJ9A 3HV4A 2CPKE 3DCVA 4JX3A 3BKBA 1LPUA 4PNIA 4D2TA 3FXZA 4B8MA 4IVAA 5AUWA 4PMMA 2CKQA 3QTZA 1IRKA 3V8SA 1CTPE 4ASXA 4I22A 3I81A 4F70A 3QRTA 4L53A 1H01A 3CPCA 3ROYA 4A06A 4XMOA 2F2UA 2OICA 4AX8A 2WMBA 4C58A 2GNIA 1MP8A 5AP1A 1YDSE 3GP0A 4JL9A 3FUPA 3VN9A 3EZRA 5E91A 5IU2A 2XK7A 4NUSA 3KK8A 3PP0A 4O84A 3I0OA 2WQNA 4O0RA 1ZARA 2OGVA 5EQPA 3G51A 1XHAA 2VO3A 3CQUA 3QCQA 3GQLA 4GVAA 4MH7A 4PUZA 5TO8A 2WZJA 4APPA 3VHEA 4O7SA 1V1KA 3F3ZA 2C6EA 1ZOGA 2CN5A 4C4EA 2OXYA 3BI6A 1R3CA 4O0TA 2B55A 3PYYA 5CTPA 2YDJA 4DINA 1O6LA 3QQKA 3R9RA 3UNZA 3OXZA 1LP4A 5GINE 2VGPA 5LMAA 4DH3A 3OXTA 4AZTA 3OHTA 5L4QA 5AUUA 3R83A 4KNBA 4L67A 2O0UA 3OWLA 1SVEA 4R8QA 4QMMA 4MWIA 2BHHA 3QRIA
chains in the Genus database with same CATH superfamily
2OF2A 1ZYDA 1YHWA 5DT3A 4DTBA 2X39A 4JJRA 4JS8A 4X3FB 2YM8A 4X21A 4CFNA 3OC1A 3NCZA 4I4EA 4YPSA 5C03A 2RKUA 3KVXA 4RJ3A 3W33A 1ZYSA 5IA2A 1QPEA 2UVXA 1ZOHA 2CKEA 5EQYA 4HPUE 4DEAA 2F57A 4QYYA 3SRVA 2CHLA 2HXLA 4BCQA 4CD0A 3N4TA 1FGIA 4RIWB 3RI1A 4B9DA 3DPKA 3KREA 3GEQA 5CF8A 3IQ7A 3AKJA 5HESA 4CQGA 3LQ8A 3O17A 2W4KA 3UDSA 1J1CA 3RK7A 4XJ0A 5B2LA 2NP8A 2YIYA 4YTFA 4FTOA 2XNGA 5IEVA 3ZRKA 3OS3A 4Z55A 3RZBA 3VBTA 3TCPA 5IMXA 4EQCA 1XH7A 3R7VA 4FTTA 5J1WA 5LARA 3R01A 3OY3A 4A9YA 3LXNA 4AUAA 2PUIA 5AFVA 1JKTA 3GOPA 3EQGA 2ONLC 3O8TA 3OROA 4M13A 1QCFA 4BI0A 2CN8A 1OPLA 3PZHA 3LFEA 4BHNA 4AGWA 3RINA 3FQEA 3C5IA 2J9MA 4GU9A 5LVMA 4YC6A 4I1ZA 1UU3A 5EI2A 3TTIA 2V55A 1CKIA 4UYAA 4QP4A 4FEUA 3A2CA 3RP9A 5BQ0A 4DEBA 1VEBA 3MBLA 2FUMA 4ZK5A 4O22A 1CKJA 3QQUA 4MBIA 4FSTA 2YZAA 4BRXA 4GK2A 3ORLA 4D4VA 2H6DA 4CFMA 2PVFA 1ND4A 4U42A 2GHLA 4LV7A 5E8TA 2GDOA 4R3RA 4E93A 3HDNA 4QDEA 2BDFA 2BRMA 4FICA 3P4KA 3QUDA 1JKSA 3FKOA 3O50A 3MYGA 4FZ7A 2E9PA 3HZTA 5E8XA 3PE2A 3E63A 3QALE 1CDKA 1UNGA 3LXLA 4E20A 3OD6X 4I94A 4ACDA 5I9VA 2YCFA 5JFWA 4YTIA 4BFMA 2G01A 4RZVA 5M44A 3FI4A 1ZMUA 2BALA 4F78A 2BIKB 3DQXA 3GOKA 1H07A 1BKXA 4IFGA 4C3PA 4C4IA 3FKNA 3GT8A 4ZTLA 4BKZA 1XMMA 3QBNA 2GPHA 2PVKA 4F09A 4E5WA 4AA0A 2R7BA 1U5RA 2RG6A 3NZ0A 2OK1A 4L52A 4I20A 5IKWA 4O7TA 2IPXA 4Y85A 5H3QA 3EOCA 3BLQA 2HY0A 5AP0A 3KXHA 3IS5A 1JNKA 2UZTA 4X0MA 3U6JA 3QRUA 3DT1A 4HOKA 4CKRA 5J95A 3DXQA 4FTLA 5A14A 1XBBA 3SRVB 3FMMA 4CLJA 2VWZA 2YHVA 5IF1A 2ZM1A 2GSFA 3W0QA 2ZMCA 4CCBA 2XIKA 3HMPA 4QP2A 5EOBA 3WZKA 2YWVA 5H2UA 4DN5A 4FSMA 4FC0A 3R02A 5E92A 4DT9A 2XYUA 4Z3VA 4OAVB 3C1XA 1H08A 4RIOA 2YM5A 3BHVA 3HA8A 5G6VA 5BNJA 1Q8YA 4ZOGA 3TKHA 3KMWA 5C1QB 1SM2A 1SNXA 3R8LA 4G34A 4CGAA 3ATTA 4FTNA 1Q62A 2IVUA 2QOFA 3GCUA 2ZDTA 4BTFA 3HMIA 1KE8A 4MBLA 3ZSGA 5HD4A 1H1QA 4NEUA 5CX9A 4MWHA 3IDCA 4IXPA 1IEPA 5CZHA 5BVFA 3C4EA 3ZM9A 2J4ZA 4DG0E 4PMSA 2JFLA 3Q3BA 3VUIA 2UZOA 5LJJA 2VO7A 4TXCA 1K9AA 3IW5A 5CI7A 5M56A 2GMXA 3LJ2A 4FVQA 1ZLTA 4O91A 3ATSA 3BGPA 5HTIA 3I79A 3RAIA 2X0QA 1PMUA 2X7FA 4D2VA 2CNVA 3BE9A 3BYOA 3CKXA 2WTKB 1XBCA 4IX6A 4N70A 2C30A 3FSKA 1QPDA 2UW8A 2JIIA 3E88A 1WVYA 5KMOA 2SRCA 3SD0A 4DFNA 5EW8A 2V7AA 4GRBA 1W0XC 4KBKA 3UO4A 2W96B 5CT7A 2ZVAA 5HIEA 5C01A 4R3CA 4IVBA 4RJ7A 2R7IA 4UXLA 4TPTA 2JIUA 2PVMA 5M08A 5HE2A 3AGLA 3DS6A 3KK9A 3JXWA 4DGMA 4ANLA 3ZMMA 3V04A 4F9CA 3CTQA 5E8WA 5ACBC 5K3YA 2Y9QA 4I93A 3R7YA 4IAAA 5AV4A 3LAUA 1OKYA 4XYFA 4BBMA 3F88A 2JBPA 5EQEA 3ZDIA 3KCKA 4BZNA 3CBLA 3NDMA 3W0RA 2W1DA 5IEXA 4QYFA 5A4LA 4ZLOA 2XAOA 2OH4A 3FZRA 1F5QA 3VUKA 2CCIA 4FIFA 2YAAA 3TDVA 1JKKA 4YGAA 4NW6A 1ZRZA 5CEOA 3P5KA 2RFNA 1KOAA 4ARKA 4LGHA 4R1VA 2QHMA 4C62A 3TZ7A 3W10A 5AUTA 1Q61A 3M42A 4UEUA 5HI2A 2W7XA 4JMQA 3TYKA 5F95A 4G1WA 4J8NA 2UW4A 3A7GA 4BI1A 3TDWA 2QOKA 4W4XA 4OTWA 3EFLA 2YACA 1WZYA 4G31A 4ACGA 3TNIA 4TYIA 5CVGA 3SOCA 3LM5A 3ZYAA 4C34A 4ZY4A 5EW9A 1J91A 1Q41A 2P4IA 3L9NA 3MY0A 3Q9WA 5CEPA 2AC3A 3HNGA 2UW9A 3QZFA 3REPA 4LRMA 3RPYA 4A7CA 3CE3A 5E9EA 3D83A 4YSJA 2CNUA 4L9IA 2WO6A 3ORNA 4J71A 4RFZA 5AR2A 5HEZA 4AU8A 3B8QA 4I6LA 2XANA 1DM2A 3FMKA 3ZONA 5K0XA 3C0HA 1BYGA 3EYGA 3PRFA 4CMTA 2FSTX 3OFMA 5BYYA 2HXQA 2UZVA 1JAMA 3EFWA 1OBDA 3DU8A 4FTMA 3IW6A 1VYZA 2R3IA 5HO8A 1IAJA 2BAKA 4FZFB 4BI2A 3JYAA 3BQRA 4IWOA 4KINA 4QMPA 3D0EA 4YLKA 4RWIA 2FSOX 5DT0A 2I7QA 2BZKB 1YWNA 5J79A 4NK9A 2JDRA 3FL4A 4NW5A 4F0IA 3W2QA 1KE6A 2AUHA 3DKFA 3FMJA 2G2FA 3FLSA 3ODZX 4DG3E 3AXWA 5EYDA 3UGCA 4LV5A 4MNEA 5GNKA 2WTVA 4BC6A 3EFKA 3UNKA 3PJCA 1J7LA 1UNHA 2ERZE 3MB6A 4EJNA 5B2MA 4P2KA 3SV0A 3ZEPA 4D58A 3ETAA 1H1PA 3MY1A 5AUYA 2JC6A 3DKOA 3GGFA 1OL1A 5CF4A 3QCXA 2BPMA 4J8MA 2XP2A 4PP9A 2WB8A 3KMMA 5FBNC 1R0PA 3QA8A 4AT5A 3DBEA 3JY9A 2CKOA 3AC2A 2QCSA 3F69A 4ZEGA 2BFYA 4BTJA 4QMXA 3UVQA 4JX7A 3LLTA 3VUHA 5CAPA 3ENHA 4TWOA 4M7IA 3VUGA 5LVOA 4GCJA 1Q8WA 4EHGA 2WHBA 4L3JA 3EL8A 3NYNA 4YZCA 5JGBA 5JK3A 4FTQA 4LM5A 2ZV7A 2VO0A 2VX0A 4RX9A 4ANBA 3TM0A 4ZSLA 4MD8E 3LJ1A 3UC3A 4F6WA 2IZSA 4JBOA 4NFNA 4WNMA 3MVHA 4FKVA 4O6LA 5EHOA 3ZTXA 2XYNA 4FTUA 4L43A 2YM3A 4F9WA 3W55A 5CALA 2BFXA 4G17A 3JR1A 1HOWA 4I3ZA 4K1BA 1LEZA 4S33A 2PMIA 4PPAA 2GNLA 4YTCA 1PRYA 2YM7A 5FQDC 4D2SA 4AXCA 4AW0A 2X81A 5DWRA 3Q4TA 3ORXA 3E92A 2HZ4A 2OF4A 2R5TA 3AOXA 2QKWB 1Y6BA 4GFMA 4R5YA 4GV1A 1OMWA 1U46A 4USDA 2GNHA 1B6CB 1PY5A 1XO2B 5E90A 4HYIA 2OLCA 1X8BA 3UZTA 2XAMA 1VLRA 2C6MA 4H3QA 4N57A 4DHZA 1PKDA 3NLBA 5CZIA 4C4GA 3R2YA 3VS5A 3ANQA 5HLWA 4HGTA 3UG2A 4G3EA 4WO5A 3R9OA 1YXUA 2V22A 3POZA 4QP6A 4RBLA 2YAKA 5ANJA 3LQ5A 1PJKA 3LCKA 3R1SA 3A61A 4FK3A 5DEYA 3A7JA 4R6VA 5J87A 4ZLZA 3KIOC 5GJGA 1ZZ2A 4ALVA 1NVRA 1OPKA 2W9FB 4IDTA 4II5A 1OGUA 4NTTA 3QFVA 4ZJJA 5IA1A 2XH5A 2XALA 3PJ8A 2RFSA 4MNEB 1FPUA 1M2PA 3FE3A 4JLCA 5A9UA 3R30A 3ZEWA 4BDAA 5CXZA 3VW8A 4O82A 3ACJA 1DI9A 2YIXA 3MSSA 3MJ2A 5BVDA 4E73A 3PXKA 5BMMA 5JKGA 2VWUA 2A0CX 1JLUE 2R3FA 2UVYA 4OTDA 3QLFA 4QYHA 4RJ8A 2BRHA 5BUEA 4PRJA 3VW6A 3MFRA 4HGLA 4S32A 5D10A 5KMNA 3ORMA 4EH2A 4MKCA 3SDJA 2NNWB 1U54B 5EKOA 5AR5A 2FSLX 2AC5A 4YNEA 4O7ZA 2B1PA 3NGAA 5DT4A 4DG2E 5HZNA 1YXSA 5KMKA 2UZEA 4EUUA 3DXNA 1WBOA 3DFAA 3QKLA 4X2JA 5DN3A 5BYZA 2KULA 4EWHA 3LCTA 4RQVA 4WKQA 3PPKA 2FA2A 4IAFA 4DEDA 5I0BA 1FINA 5CEQA 4PTGA 1MUOA 5AUVA 3DZOA 3MFSA 4CG8A 3ACKA 1M7NA 3FYJX 2IW9A 3GU6A 4DBNA 2XM9A 1F0QA 4OGRA 2B9HA 4A9UA 4ENXA 3R9DA 1U5QA 4BCHA 3P9JA 1KV1A 4EWQA 2C6OA 3QD3A 3UVPA 4D4YA 3N9XA 3HECA 5B7VA 3LQ3A 2O2UA 3DQWA 3RAHA 3VO3A 4RX7A 2IW6A 3R8VA 3UIMA 2XEZA 2WTIA 1OL5A 4BCGA 5HX6A 3KL8A 3UDTA 4ANNA 2F2CB 4AP7A 2C6IA 2A2AA 3L8XA 4FNXA 3F3WA 4I5MA 4AZWA 3LZBA 2R3MA 4TY1A 3ORZA 5CXHA 4C36A 3V01A 4E6AA 2YZLA 2VTRA 1YI6A 5CANA 4EH4A 3L1SA 4C59A 5HBJA 2UW7A 1YXVA 3R7UA 1PXIA 3VBVA 2P3GX 1OECA 2F9GA 3GFWA 3FI8A 1DS5A 4NU1A 2CCHA 3R28A 4FOCA 4AZFA 1O9UA 2OXDA 3P86A 3VUMA 2EB2A 3E8CA 3OEFX 3ZU7A 5CWZA 2YJRA 4FV1A 5AR4A 1SNUA 3NUPA 4EZ3A 3KA0A 4IZ7A 3HGKA 2PUUA 4L3LA 3D2IA 3FLNC 5M57A 2QR7A 3SXRA 2XIZA 1B38A 1KE9A 2BUJA 5I9ZA 4YZNA 4HYSA 3ZM4A 2W1HA 3MV5A 3LM0A 3QCYA 3VS3A 3NIEA 4AFEA 4AOJA 5JMSA 2UZUE 2C68A 3CP9A 2PMLX 2WAJA 4F63A 5AA8A 1J1BA 3PFQA 2OW3A 4EOKA 4EORA 4WUAA 4ZZMA 5L8KA 3FZOA 3OOGA 4O27B 4XV3A 3MIAA 4C3FA 4YJPA 2WTDA 3IG7A 1H4LA 4GSBA 1W98A 3UOKA 4JDHA 4IWDA 3UQCA 2X4FA 2QOHA 3QZIA 3OUKA 2A27A 2JKKA 5EM7A 5CF5A 1GZKA 5AEPA 5LVPA 2ITVA 2ZMDA 4CRLA 4C3RA 5A4TA 5CU4A 3NVMB 4I0TA 4LMUA 3FMLA 1EH4A 3OBJA 2W05A 2VZ6A 2IW8A 3FAAA 4MK0A 2ITQA 3U54A 2VWBA 1OZ1A 1ZAOA 3AC3A 4YZ9A 3W2CA 5AADA 2BKZA 5LMBA 3QQFA 4J98A 4B6LA 3CQWA 1IA8A 2OG8A 2C47A 3BBTB 3MDYA 4FG8A 4FL1A 4AT3A 4GT3A 1XH4A 2REIA 4FG9A 4I5PA 3K3IA 4ITHA 4AG8A 3MWUA 3P78A 4BYIA 2HZ0A 2YLFA 3RPOA 2LGCA 3DOGA 3SC1A 4NT4A 4A4LA 4JVGA 2A4LA 3IW4A 3NS9A 5IQHA 1U4DA 3WF6A 3ZLSA 3PDTA 2X8EA 3R7GA 4K11A 3SG9A 5HQ0A 1TZDA 3AMAA 1YHVA 2OU7A 4QTBA 3KXGA 4CZYB 3TT0A 3DZQA 5DR2A 2XK4A 3UMWA 1GOLA 4EHZA 1VR2A 2JDSA 4AA5A 4BYJA 4IHPA 5E8UA 4G16A 2J0MB 4GEOA 5HG8A 4BTMA 4IBMA 2XKCA 2DQ7X 3ELJA 4D2PA 3W2SA 3F5UA 2J0LA 4XBUA 5HU9A 1I44A 4C0TA 2BRGA 3UG1A 4I23A 5AA9A 3Q60A 2JAVA 4XOYA 5HBEA 5KX8A 3VRZA 4ZS0A 4FT0A 3AD5A 3FZ1A 1PKGA 3NMUF 5M4IA 2F7ZE 2R2PA 3F3VA 4JDJA 4OBQA 2XRWA 3QGWA 5CAOA 1LEWA 4GL9A 4R7IA 4LL0A 3VF9A 4IX5A 2C6TA 1Y6AA 2PVRA 3AQVA 4N4SA 1OB3A 3NW7A 4HVIA 5K9IA 2J5EA 1UVRA 3Q9YA 2YERA 4BCIA 4U41A 4IQ6A 4KA3A 3DNEA 3COHA 5H8GA 1WAKA 2IWIA 3NNUA 4ANOA 3DNDA 5J7HA 4MXCA 3EN4A 2IO6A 5DLSA 4C61A 4EH8A 2XNNA 4KIPA 3H9RA 4IC8A 1YOLA 4B8LA 3NUUA 3DAKA 3PJ2A 4WBOA 3W2OA 3ZLXA 5EFQA 5AV2A 2V0DA 1Q4LA 4MXAA 3F2AA 4RC4A 4CYJA 3TV4A 3UC4A 5HO6A 4XG6A 3OT3A 5KMLA 4PL3A 4RX8A 3POOA 5F9EA 2BROA 5BPYA 2YFXA 1J3HA 2ZM3A 4C8BA 3BWFA 2ZFYA 3KEXA 3EQDA 1Q24A 3I7CA 2PK9A 3EQPA 1NVSA 3N51A 4O0UA 1FQ1B 4FNWA 4RJ6A 5F1ZA 3FDNA 2GHMA 3GU7A 4IAYA 1XR1A 4KIKA 5GZAA 4DEGA 1JPAA 3HMNA 2QODA 5EDRA 3Q4UA 3W18A 4KB8A 4H3PA 4JDIA 4GG5A 4D1SA 4RRVA 4O4BB 3COKA 3T8OA 1Y91A 2QOBA 3D15A 4GKIA 3MY5A 4XG7A 4YP8A 4O81A 5CSWA 3GNIB 4EOOA 2R3OA 4EC8A 2CLQA 4KS7A 5GZ8A 4FSQA 5FD2A 1M2RA 4D1ZA 3TNWA 4C7TA 3UMXA 2HW6A 5DOSA 4FTRA 4RWJA 2PE2A 3PSCA 5EM8A 4BDHA 2PZ5A 1V0OA 2OWBA 4F64A 1JBPE 2OXXA 2V62A 4FVPA 4MEDA 3F5PA 3RPVA 1PMNA 4A9SA 4ACMA 3HV6A 4QQ5A 4RGJA 3FQHA 5HX8A 2FB8A 4FKSA 4A4XA 4BDFA 4JT3A 4D28A 3MS9A 4I6QA 2WMSA 1OL6A 2ITXA 4CFXA 3W0MA 4FV5A 3S00A 4FV3A 4P5ZA 5EYMA 1H8FA 3G9LX 4QYEA 2HW7A 4QTCA 2PSQA 4GKHA 4I5HA 4DLIA 4IWPA 4YJOA 2WTWA 1XKKA 5T68A 3R8ZA 3G5DA 3EQBA 4M8TA 4AN3A 4BWKA 5KO1A 2RFDA 3A7FA 4H36A 3SKCA 3HUCA 1XH6A 4GT4A 3SHEA 3DB8A 2UZNA 5TR6A 3AKLA 1KE7A 4AACA 4EBVA 4HW7A 2XK8A 4IW0A 5IQIA 3FKLA 3PA4A 5DBXA 3TIYA 4MXZA 3L9MA 4K9YA 2QD9A 1YVJA 4I5CA 3MIYA 4XRJA 5DR6A 4FV6A 3L9PA 4EH9A 3TXOA 2C69A 1PHKA 2JFMA 5KZ0A 4DEEA 2WXVA 4NSTA 4WD5A 3DLZA 5C8NA 5CSXA 3TNPC 2YEXA 2JD5A 5TOZA 3I5NA 2GQGA 3W0PA 2ETKA 2J90A 3BLRA 4JQ8A 3H30A 4LOQA 2G2IA 2WEVA 2X7GA 4ZAUA 4YTHA 3HKOA 3AMBA 4ALUA 2A19B 2WQEA 5HBHA 1M14A 3SX9A 4EYJA 2GFCA 2XIXA 5GHVA 3A4OX 1GZ8A 3DGKA 4K33A 4AE9A 4LQMA 5LVNA 3EHAA 2B4SB 1TVOA 1J7IA 2PZYA 3JVRA 4BGHA 3H4JA 4KIKB 3IONA 4FTAA 3D14A 1V0BA 5I9XA 3WI6A 5C4LA 2ONLA 4FYNA 3DBQA 4FK6A 5D41A 5BVOA 5CU0A 3A99A 1P4OA 4ZTMA 1PXJA 4O7VA 5M06A 5D7AA 3AGMA 3F2RA 2HK5A 3BGZA 3THBA 4XP2A 5HG7A 3R8MA 3HRCA 3MN3A 5LXMA 3E93A 4R5SA 3ZLYA 3DDPA 1OVEA 5ETFA 1BL7A 3TUCA 2QLQA 2H9VA 2J0KA 5AUXA 4F0FA 3O23A 3OBGA 4OTQA 4PPCA 4YZBA 3QX2A 4BCOA 1FMKA 3PXQA 3FPMA 1P4FA 2VTLA 4J99A 2OSCA 4O2PA 4CFUA 5L2TA 3V3VA 4JOAA 5M4CA 3BYVA 4FKOA 2RIOA 5BVNA 4Y8DA 5EG3A 3NNVA 3IO7A 1CMKE 3PY3A 3R71A 4X6QC 4HYUA 4E7WA 3VVHA 4PDOA 3PG3A 2PHKA 1KWPA 3VBXA 4D2WA 2RSVA 3JS2A 4RLLA 2B9FA 2PVYA 3ENMA 4FL3A 5ETIA 2VTAA 2GFSA 3LFBA 4CFFA 3ZXZA 3ID6C 3U6IA 3NNWA 3KU2A 3ZO1A 3LFSA 4FZAB 1Y57A 3OXIA 4GUEA 4HGSA 4O0YA 5CNOA 4ZIMA 4O83A 4YSMA 3V51A 5HHWA 4YUQA 2XS0A 3E3PA 4KKGA 4KKEA 1YQJA 3PWYA 2GCDA 4IE9A 2C3JA 4NJ3A 3AT2A 3I5ZA 5CQUA 2HYYA 5I9YA 1Z57A 4FX3A 2B52A 4U0IA 3NFGB 3CR0A 5AV0A 4Q2AA 1TFFA 3NUAA 4NM0A 1M2QA 2PU8A 3MTFA 3V5TA 1OKWA 2O64A 5D12A 4ZSGA 4K18A 2BRNA 3O8UA 4E4LA 5LWNA 3QQJA 5IQCA 5EDPA 3W2RA 4ZY6A 5J5TA 2ZM4A 2WTJA 4TKSA 3CCNA 4GMYA 1JWHA 4OW8A 4YLLA 4HJOA 3AD4A 1Q99A 4ORKA 2IJMA 4GJ3A 1V0PA 4L6QA 1E1XA 3IW7A 3AD6A 4QP3A 4RVTA 5GZ9A 3KRJA 2BDJA 4BVUA 2R0UA 1L8TA 4RJ5A 3CSVA 1F3MC 2YWPA 2FO0A 3FI3A 3RALA 2HWOA 4DH1A 3PWDA 4MQ2A 3U6HA 3V5PA 1GNGA 4IVCA 4EOQA 3E62A 3KRLA 4MXYA 5D1JA 1YXTA 4XG4A 2XUUA 3ZS5A 3ITZA 4ZZNA 4IANA 4GT5A 2HAKA 3G2FA 4D9UA 3ZCLA 3IPHA 4M68A 2PY3A 3NIZA 2AEGA 4I6HA 3OCTA 3DAJA 4H3BA 3W8QA 5IDPA 2Q83A 3WE8A 2PMOX 3SQQA 1NXKA 2O65A 4BGGA 4YMJA 4BJJA 3Q6WA 2EUFB 4BDGA 5LOHA 2CGUA 2R9SA 4RIXA 2YABA 1WBNA 3F3UA 4MF0A 3LW0A 4PPBA 4RFYA 4RT7A 5KNJA 3K54A 2HELA 3LXKA 4CEGA 3RTPA 5IQAA 4FV8A 4LV8A 5JFXA 3KXXA 4ZTNA 4W8DA 5IUGA 5JRQA 2XNOA 2GHGA 1OIUA 2G15A 2JDOA 3ZSIA 3OG7A 5LVLA 3MPTA 4M67A 4PNKA 1OGYA 5C27A 4R78A 2R4BA 3LJ0A 2WEIA 3U55A 3UQFA 4GJ2A 4CMUA 3RZFA 2BAQA 4GVJA 3HA6A 1H27A 3UOLA 4MVFA 5H9BA 3QQHA 4QMWA 4ZJIA 3BV3A 4DHJA 4QPAA 2R64A 4O21A 2WGJA 5BV3A 1REKA 1PYXA 3WF9A 3NEWA 1GJOA 5F4NA 5KBQA 4Y73A 4D0XA 1G8AA 3EFJA 2W99B 4C33A 5FTGA 3FQSA 2XMYA 2ERKA 3PPJA 3QAME 5TKDA 4TL0A 5CLPA 4UMRA 4ZY5A 4M84A 5IA4A 5TF9A 3UPZA 2Q0BA 1VYWA 1ERKA 4IM3A 2EXMA 4FEQA 2FYSA 2KTYA 1GAGA 3FMHA 4FSWA 2EVAA 4EK6A 2OIBA 3BL9A 3EWHA 1OL2A 4AN9A 5L6WL 1T45A 3CY3A 3I7BA 3M1SA 3DJ6A 3TACA 1Q8TA 4QTAA 4KIOA 4CZUA 3EN6A 3GU4A 4UALA 4LDTA 2WU7A 2XIRA 4TRLA 3ZBXA 3NUYA 3QTRA 3GFEA 5HLPA 3WF8A 1ZXEA 3HL7A 4UMUA 2WMTA 4JRNA 3RPRA 3BWJA 3G90X 3WF5A 4IC7A 4AZEA 2WIPA 4E5AX 4G3CA 1BLXA 3QD0A 4O2ZA 4F0GA 4OTIA 1OUKA 4FV7A 2QOCA 2OFVA 4N6YA 1A48A 1NT2A 1CKPA 3SW4A 4F9AA 3P7AA 5FWKK 3UQGA 1KE5A 3ZXTA 2Y0AA 5IH5A 5IUHA 2W17A 2C5XA 4HGEA 3Q96A 2WU6A 5A6NA 5L8LA 3ZUVA 5KZIA 4ANSA 3DKCA 4QP9A 2I40A 5CASA 2YCRA 2C3IB 5JGAA 3RGFA 1FGKA 4L7SA 2ZB0A 5CEKA 4BJJB 4BCJA 4ALWA 2VAGA 2C3LA 4JR7A 4RIXB 2IEWA 2CDZA 5J9ZA 4R7BA 1QPJA 3FV8A 3OW4A 2VGOA 5E1SA 4X2GA 2E9OA 2PVHA 3IOKA 3NFFB 4O0SA 5LMKC 3KXZA 4IADA 2J5FA 5JSMA 3R1YA 4KWPA 2XCKA 3OF0A 3P0MA 2GTMA 4J52A 4S30A 5FEQA 5JGDA 1XQZA 2BCJA 1ZYJA 4HVDA 4QP8A 1NVQA 3IOPA 4FTJA 5AM6A 4CT1A 4PX6A 4F4PA 5HIBA 4CKIA 3KULA 3R21A 5ANDA 2E2BA 3UOJA 4QMQA 1OI9A 1SYKA 4JG7A 3FY0A 3LFQA 5I9UA 2Z7LA 4G3GA 4WNOA 4XBRA 4XG9A 5JEBA 4QMUA 2BIYA 3HEGA 3QD2B 4NWMA 4XV9A 3K5VA 3PVGA 2PMNX 3NYVA 4EK8A 3QRKA 3ZDUA 3WF7A 5IH6A 3CGFA 2J50A 3TMOA 3PLAE 2UZWE 2WMUA 2JGZA 3L8SA 4L46A 3UP2A 4AT4A 4AFJA 2VTJA 5HO7A 4M0ZA 4QDVA 5J8IA 3R7EA 2E9UA 5ETAA 3VBWA 3R63A 1U54A 4JRVA 4S2ZA 4IAZA 4FT5A 4I6FA 2E9VA 4B0GA 2R3GA 4W8EA 3ZBFA 3RWPA 4OBOA 4CT2A 5I3OA 3GCQA 4RWLA 1PXMA 1WBSA 5ETCA 4IWQA 5CS6A 3I6UA 5IISA 3F5GA 5CSHA 4BKYA 2HZNA 2UZBA 4QNYA 3RMFA 3VWAA 3DB6A 3WARA 4BWXA 2YJSA 4HZRA 3R7OA 2QG5A 5KKRC 1OIRA 4QP1A 2W4OA 5BVEA 4U45A 5IG1A 4FV0A 4JDKA 5AMNA 2W5BA 3TJDA 3U9CA 1WBTA 3UNJA 3BU6A 3P79A 5M53A 4YJSA 3KB7A 3BE2A 2HZIA 2XNMA 2B9JA 2IZTA 3O51A 4RFMA 2OZAA 3FLWA 4KAOA 1XWSA 4M15A 4IDVA 4LRJA 4ASEA 5L2WA 2X6EA 2I0EA 3D5WA 2XJ1A 2X0OA 4HCUA 3FXXA 4A9RA 5KHXA 2GNFA 4BDJA 1PXOA 5HICA 5M51A 3W2PA 4D0WA 4QRCA 4RIYA 5JN2A 1M7QA 5DA3A 3R8PA 4RG0A 5A6OA 2JAMA 4OUCA 2F49A 3UDBA 3PE1A 2R3NA 4YJRA 4ZS4A 4TZRA 4TWPA 4E8AA 4PDYA 5EI8A 1Q3DA 2C0OA 4D1XA 4BDDA 3C9WA 2P33A 3WYYA 3ULZA 5K5NA 3EQRA 3DFCB 4GK4A 5E8VA 3U9NA 3P7CA 3C4CA 3LIJA 1IA9A 3KRRA 3KRWA 4IH8A 3BHTA 2X0GA 2BDWA 4IX3A 3HAVA 3LFCA 4UX9A 1E1VA 5IA5A 2XZSA 4YJTA 5BX0A 1FVVA 3HDMA 5DRDA 1OBGA 5K4IA 2W1ZA 3UYSA 3V5WA 4FTCA 3JPVA 5L6OA 4O7LA 4FRFA 5JQ5A 4ZJVA 2OJJA 5ANOA 5FEDA 3GXLA 3OTVA 3UO5A 3R22A 3CTHA 4FJVA 4TNBA 3KULB 2UW0A 4U44A 3BU5A 2X1NA 5AAGA 2RFEA 3GCVA 3PIYA 3CLYA 4XRLA 2W1CA 3VBYA 3S95A 5E7RA 3Q9ZA