2VO0A

Structure of pka-pkb chimera complexed with c-(4-(4-chlorophenyl)-1-(7h-pyrrolo(2,3-d)pyrimidin-4-yl)piperidin-4-yl)methylamine
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
343
structure length
340
Chain Sequence
KGEQESVKEFLAKAKEDFLKKWENPAQNTAHLDQFERIKTLGTGSFGRVMLVKHMETGNHYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLTKLEFSFKDNSNLYMVMEYAPGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLMIDQQGYIKVTDFGFAKRVKGRTWLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFATTDWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEEEIRVINEKCGKEFSEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CAMP-DEPENDENT PROTEIN KINASE, ALPHA-CATALYTIC SUBUNITPROTE
publication title Identification of 4-(4-Aminopiperidin-1-Yl)-7H-Pyrrolo[2,3-D]Pyrimidines as Selective Inhibitors of Protein Kinase B Through Fragment Elaboration.
pubmed doi rcsb
source organism Bos taurus
molecule tags Transferase
total genus 108
structure length 340
sequence length 343
ec nomenclature ec 2.7.11.11: cAMP-dependent protein kinase.
pdb deposition date 2008-02-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2vo0A01
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2vo0A02
5FG8A 4BIEA 3E7OA 2ITPA 4R77A 5JFSA 2YABA 3FHRA 3AGLA 3ZUVA 4WT6A 4FMQA 1FGIA 3D7ZA 4QPMA 2R3KA 1OUKA 3BHYA 5DEYA 5L2SA 3TZ8A 4RIYB 4WG4A 1H4LA 2B53A 3BPRA 4AOTA 2GHMA 4EUUA 1MRYA 3C5IA 3BEAA 4U7ZA 4EHEA 5CF6A 4ACDA 3LCSA 3MVHA 3TKHA 5HX6A 2C6TA 1Q4LA 3R0TA 5AP5A 4BI2A 4EOPA 5HU3A 3L9LA 3ODZX 2C30A 5DN3A 4DH7A 2VWXA 3RI1A 3ZM9A 2KULA 4KRCA 4QMPA 4WRGA 5EFQA 5EOBA 4BVUA 3F5PA 1Y6AA 2JIUA 3PRIA 3A61A 2X7FA 4QQCA 4QP2A 3PXRA 5L6PA 2HW6A 5AP3A 2QHNA 3DY7A 4Y83A 2OG8A 1XR1A 2QQ7A 4O0RA 3I6UA 4O2ZA 2NNWB 3C51A 3TNPC 4GKHA 3GVUA 2OO8X 5HBEA 4BBMA 5M4UA 4S31A 1ZYLA 4RIYA 4AX8A 3CTHA 3RVGA 1H07A 3TUBA 4ZEGA 3AC5A 5IH5A 3ANQA 1ZRZA 4TWNA 3HMNA 2WELA 3RPSA 5BUEA 4LMNA 2ZV9A 1G3NA 3SQQA 2XKEA 3ACJA 2VTAA 4RC4A 2HZ0A 4IH8A 1A48A 2VO7A 3NDMA 2PSQA 1FVTA 3CS9A 3PVWA 3E62A 2F57A 2F7EE 5LQFA 3C4CA 3RCDA 4R6VA 5LVMA 2J7TA 2IVVA 4ZTNA 5IQBA 3KVXA 1STCE 2C1AA 2OIBA 5E1EA 3NR9A 5CLPA 1VYWA 3SKCA 4FTKA 2XRUA 2Z7SA 2ITYA 3LJ2A 2BTSA 3MA6A 4FSQA 5ANDA 2GCDA 5AR7A 5EM7A 4N0SA 3ZEPA 2E2BA 4XNEA 4CQGA 3GU7A 3AT2A 2XK6A 1XBAA 4P90A 5EQEA 4B9DA 1UA2A 5IDPA 3GOKA 3R73A 3IPHA 2VWWA 3OWPA 3LHJA 3QTXA 3HAVA 1ATPE 4GUBA 2VTLA 5GZ9A 4B4LA 4ZS4A 3PZHA 2Y9QA 4IBMA 4WBBB 4XG9A 4QMWA 3E87A 4ZK5A 4D0XA 1Q62A 2OH4A 4IAFA 4IAYA 4RWJA 3T9IA 2FSLX 3R8VA 4G3CA 3BKBA 4OTWA 4AA5A 5CF5A 5IISA 2QOQA 3TNIA 5AAFA 3H0ZA 1FMKA 4IFGA 5HO7A 5IQAA 4D28A 4BCPA 2WTKB 3OXZA 4N4SA 2JC6A 3PRFA 5BVEA 3QYWA 4Y5QA 4APCA 1GZKA 4CZTA 4CCUA 5C4LA 5M51A 4GYGA 3C4EA 3PP0A 3RCJA 4PWNA 4B8LA 4ZJJA 3ZFXA 2CSNA 2PULA 3WZEA 3ORMA 3Q6WA 4Y46A 5CSHA 1OL7A 2XB7A 4IDTA 4R8QA 2J50A 3RHKA 4IFCA 4N70A 3HVCA 2SRCA 3BGQA 3F69A 4LV8A 4OW8A 3O51A 4FSWA 3AD6A 4YJQA 4BRXA 2GQRA 4FEWA 4W8EA 3EQBA 5EI2A 2VAGA 3DBCA 3GFWA 4UMTA 4CCBA 4TYEA 5KHXA 4I3ZA 3U4UA 4D55A 2DYLA 1OIYA 3D94A 4HPTE 4NCTC 4ACHA 1ZYJA 4DBNA 4YU2A 1Y8YA 4X2FA 5CANA 3QQHA 4CNHA 3DOGA 4FVRA 2QO9A 4XMOA 4L42A 3DB8A 5B2LA 4XP0A 5JKGA 3QC4A 3BQCA 3SG9A 2EXMA 3D14A 4Q2AA 1PXOA 2DUVA 3LAUA 4FK3A 4HYHA 4NUSA 4NFMA 3PA4A 4ASZA 4RIXA 3AOXA 4G17A 4DF3A 5HTIA 1H1WA 2DWBA 1OITA 2WQMA 1GIIA 4O84A 5DYJA 1R0EA 2UUEA 4DT9A 3QWKA 2YM4A 4IQ6A 1R0PA 4ZZMA 3RPYA 4E6CA 5CEKA 3M2WA 2QOFA 4J8MA 2V7OA 3Q9XA 3VUIA 4UMRA 4IZ7A 2VN9A 3PJ1A 5FEQA 4QNAA 2F49A 3OY1A 4NZWB 3VQHA 5EYKA 2BILB 3FZTA 4KBKA 2WMQA 1H8FA 1U59A 3A4PA 2OLCA 3PIXA 1O6KA 2BIYA 2W0JA 1Q5KA 3II5A 2OFUA 5E4HA 3EQIA 2OJJA 5E92A 4EOLA 3TNHA 4RIWA 4BYIA 2BZIB 3R7UA 2UZLA 3MVLA 4FNYA 4FSYA 1Q99A 2RF9A 2OK1A 3DFCB 4XP3A 2BZJA 5DT3A 5B7VA 1CKPA 5AX3A 4DEAA 1RJBA 2CGWA 4K0YA 5M09A 3QXPA 1JAMA 5ETAA 2QC6A 5DBXA 1IG1A 4DCEA 4MWHA 3DJ5A 5HCYA 4BC6A 1JWHA 3N9XA 1Q8ZA 3QQUA 5H9BA 1DI8A 3KL8A 3K5VA 3PE2A 3T9TA 2XH5A 4I6FA 1XH9A 4APPA 1YOJA 1OL6A 3Q4ZA 1Z5MA 5G1XA 1SMHA 3L8SA 5HO8A 4ASEA 3ZRLA 3FMMA 2AC5A 4LFIA 4DHFA 2I1MA 3DNEA 2IJMA 5KMMA 3CP9A 3GB2A 3LXKA 1UWHA 2XS0A 3FWQA 2J4ZA 5CY3A 5EI6A 2HENA 2WD1A 3QZFA 3SX9A 5GZ8A 2JITA 5CSXA 4RX5A 2XIRA 3BV2A 3UIMA 5IG1A 3MH0A 5FP5A 3K3IA 1JKLA 4QOXA 3NUNA 2PE0A 3ET7A 3P7CA 4PRJA 2ITNA 2ZAZA 4O21A 2ZM3A 3ZSHA 4MAOA 3E88A 3ZBXA 3NS9A 3NYXA 4YZMA 2XIKA 3G51A 3SW4A 2ZDUA 2FO0A 5EI8A 2R3IA 4G31A 4Y85A 3UP7A 3RAWA 1OL1A 2BDWA 1ZOEA 2GPHA 3I0QA 4XYFA 5HORA 4L9IA 5G6VA 5T3QA 2E9UA 3CEKA 1F0QA 5LWMA 4HJOA 3E7VA 4M97A 1PYEA 3WARA 4L44A 2UZEA 4A07A 3FLWA 1GIJA 2XM9A 5EYDA 5AA8A 4J71A 4EKKA 4EOIA 4FV5A 4WBOA 3NYVA 4J95A 2QLUA 4IAZA 2QO2A 3R8PA 1YI6A 3HNGA 4ASXA 5E7RA 3IOKA 1WBOA 4KBCA 3QQGA 1OBGA 1I44A 3QD4A 1Z57A 4RX8A 3D7TB 1QMZA 4K1BA 3R22A 3QRUA 4RVLA 3MGYA 3NW5A 2W7XA 3VF9A 5LMKA 2CKEA 5CAQA 4FKRA 2I0HA 3T3UA 4HGSA 4L7SA 3F5UA 4UALA 2J0LA 1ZOHA 5LMAA 2BKZA 2PMNX 5I4NA 3ATTA 4KS7A 3G9NA 3Q4UA 3MIAA 4I6QA 4AGCA 2A19B 2VU3A 3DBEA 3BHUA 4L53A 3ORLA 5FXRA 4WNMA 3TM0A 4HYIA 1H26A 3MH2A 4MYGA 2VX3A 1F5QA 3DK6A 4JBVA 5JGAA 4YO6A 3W2QA 4TWCA 1CTPE 1FQ1B 3D7TA 4YJSA 2PE2A 5EQPA 3G5DA 2W17A 3AC3A 4JXFA 2F2UA 3B2TA 3NUAA 1BL6A 4NYEA 3Q2MA 4OUCA 4JAIA 2ZMDA 5GNKA 1CDKA 3SVVA 2J51A 3OCSA 3L8VA 2RFSA 5KMJA 4G1WA 2NRUA 4X2KA 3HRFA 5CSWA 4TTHB 2ACXA 3L8XA 4HCTA 5KE0A 3QHWA 4BWPA 5BUIA 2OXDA 4IX4A 1Q8UA 3HYHA 4QMSA 4AGUA 4YJPA 4CFUA 2YAAA 2YAKA 3ZOSA 4AA4A 5H8EA 3MH1A 4D4SA 2Z02A 4C4EA 3E5AA 2DQ7X 4GFMA 4O0SA 2A27A 2VTSA 4L3LA 4QTCA 4QYGA 3TL8A 1Y8GA 3EHAA 4G6OA 4AAAA 4ANLA 4BL1A 4BZOA 4CYJA 1Q97A 1URCA 1XKKA 3K2LA 5AP6A 4DCAA 4FTNA 4IM0A 4FKGA 4C34A 4K11A 4X6QC 5BMMA 1VYZA 4F4PA 4FNZA 5A4TA 4C61A 4GSBA 3U9CA 3GGFA 4FV4A 4F09A 2PUUA 3CBLA 3CIKA 3PPJA 3OY3A 5ANKA 2C1BA 3KCKA 4UMPA 1JKSA 3RK7A 1EH4A 5F95A 3UZRA 5EKNA 3IDBA 2XNBA 3DTWA 4XV9A 5E8WA 5I0BA 4PMSA 3BU3A 4KIOA 3DCVA 4PF4A 3P08A 2IVSA 3QKLA 4QPSA 3FZPA 4ACGA 4DN5A 1UU3A 4FSUA 3QUEA 4U8ZA 4JOAA 3VBWA 4R7BA 5DVRA 5HD4A 1T45A 3C4FA 3VHEA 3ZYAA 1YDSE 3CGFA 4N6YA 4ITJA 4O82A 3BELA 3QL8A 3DQXA 3WF7A 5KBQA 3U51A 1OMWA 2CLQA 3KVWA 4RFZA 3ZUTA 4EK8A 2NP8A 3NUUA 3K5UA 4BI0A 2ZM4A 2Y7JA 3FXWA 4QMNA 5AUUA 3G90X 5KMIA 5L2WA 1H1PA 4O96A 4FKUA 4XBUA 4YHFA 3QRKA 4FEXA 5GJFA 1YI4A 3F7WA 3MYGA 4G3GA 4NIFB 4G6NA 4TKSA 5AWMA 4BDHA 4BFMA 3RM6A 2WMVA 3FI8A 4A06A 4TN6A 4ANMA 5I3OA 4FZFB 3AG9A 4QMOA 4DEHA 4ZTSA 5KMLA 4BIBA 3UC4A 4G2FA 4ZTHA 4MBIA 4U6RA 1OI9A 2QOKA 4BTJA 3S0OA 4JRNA 4DA5A 4O2PA 4UBAA 1CSNA 5M07A 2XCHA 1IAHA 5CAPA 5JN2A 4NTSA 1E1XA 2J0KA 4CRSA 2W99B 4DG2E 1ND4A 2ITWA 2OJIA 4NFNA 2GNFA 5EDRA 4D2PA 2WO6A 4EHVA 4FKIA 4XV1A 3CD3A 5HO6A 2UVYA 4DGGA 2CGUA 5M08A 3O17A 4QP7A 2YM5A 4O0TA 2O65A 4L46A 3PIYA 5DNRA 3RHXA 5K5NA 2WMSA 4FG8A 3ZRMA 3NZ0A 3DKCA 4RC3A 2PUNA 1NW1A 4O7YA 3ORIA 4FV2A 3MJ2A 4Q9SA 3RWQA 2Z7LA 4HGEA 4BGHA 3GUBA 3ROYA 3BLHA 2JAVA 4QTEA 1ZMUA 5CQUA 2PUPA 2RFEA 2UW5A 4ZJIA 4E6QA 2VTNA 3V5WA 4FV8A 2BROA 4JDJA 3DK7A 3NW7A 4JJRA 3TZ9A 3R28A 2G2IA 4BKYA 2WXVA 5GJDA 4PUZA 3QZHA 1NT2A 1VR2A 3LCTA 2GFSA 2UW3A 5ANGA 5J95A 3P79A 4R7HA 3QZIA 3RM7A 3MPTA 3PXYA 4UYNA 4W4XA 3OMVA 3ROCA 3BWFA 3U6IA 2OI4X 2CKOA 3ZFMA 2JDOA 1RE8A 4C58A 2RKUA 3IGGA 4XG7A 4FNXA 2VV9A 2GFCA 3SAYA 1W82A 2OJGA 2CKPA 4YJOA 4IC8A 3P1AA 4QQ5A 4I5CA 2GQGA 4ZSJA 1BYGA 3Q9ZA 4XCUA 2EVAA 2XIZA 3FC2A 3QKKA 4NW6A 3Q2JA 2PVMA 4CT1A 3U6JA 2JIVA 3GCQA 1H0VA 3EFKA 1ZMWA 4DGOA 2HWOA 4TYIA 5FTGA 1O6YA 2BPMA 4C3FA 3VS6A 1JSTA 4YC6A 3LKMA 3DJ6A 2BDJA 5HG5A 1CKJA 4ANNA 5CF8A 1JBPE 4GJ2A 4QO9A 4I5PA 5DI1A 4E4LA 1PKGA 3KXNA 3KMMA 5IH6A 3R6XA 4L01A 3HRBA 4O38A 3I7BA 4IB3A 5EM5A 3QF9A 5BVOA 3D0EA 4UZDA 4O7NA 2BRMA 1B39A 1DAYA 3FI2A 4A9RA 2C69A 5IA3A 5J1WA 5D12A 1S9JA 3AC8A 5DWRA 2KTYA 3OCGA 2HZIA 3R83A 3PWDA 2OH0E 4W4WA 4ZIMA 1O9UA 1WBTA 4I4EA 5EDPA 1YKRA 3QKMA 4D1ZA 1KUTA 4KUJA 4XEYA 5IEYA 4C57A 3DV3A 3H9RA 2B0QA 2IZRA 4BCHA 5DIAA 3BYOA 5BUJA 2XVDA 3M1SA 3E93A 4OT6A 4TRLA 1OM1A 1PRYA 3OF0A 3UG1A 1Q3WA 3ZFYA 2IVTA 3PA3A 5IUHA 4KD1A 1ZLTA 3ALOA 1JPAA 4O0UA 1E1VA 3DZOA 5AX9A 3NMUF 2XCKA 4C2VA 3HA6A 3KKVA 2CCHA 4Q5HA 1IA8A 4G16A 4OTIA 2YIQA 3OD6X 4JDIA 5IKWA 4PPAA 3SW7A 4BTKA 3VUMA 4XUFA 3FZSA 5FTOA 3FY2A 3CTQA 4QPAA 2XK3A 4QT1A 4IAIA 3I5ZA 3IDCA 5E8VA 3W18A 3TZMA 4PL3A 3MY1A 1HOWA 2XNMA 4G6LA 3SXSA 5DHJA 4JT3A 5FLFA 3TIYA 2WTDA 2ONLC 2CCIA 4X7QA 5DFPA 5A6NA 4B8MA 4E5WA 3ORXA 5TT7A 4OTDA 5M56A 3DT1A 2J6MA 2QG7A 4LQMA 4JL9A 3WZKA 2UZTA 3O8TA 5AV0A 2GS2A 3BX5A 4J8NA 3RK9A 4D4VA 1QPJA 3UIXA 3WBLA 1R39A 1M7NA 3KA0A 3KY2A 3NPCA 5C03A 4OAUC 1KSWA 2PZRA 2JFLA 3T8OA 2H9VA 3BGZA 3D5WA 4FTAA 4OTFA 4RRVA 4JIKA 4YURA 5EDQA 2R3HA 5EM8A 5FEDA 1ZOGA 5IEXA 5IUGA 1URWA 2JDSA 2UW9A 4FSTA 3DBQA 2VRXA 1W8CA 5HLWA 3R63A 1ZXEA 3TKUA 2GQSA 2CHLA 5J7HA 2QCSA 4DBXA 5TOZA 3SG8A 3G33A 3F66A 2C0TA 4Q9ZA 4C8BA 2B9HA 4HZSA 4TYHA 4YP8A 3I79A 3R2BA 4IW0A 5EM6A 3NIZA 4CFXA 1H28A 3VBTA 5KMKA 4LRMA 3V01A 3QXOA 4D9UA 5AV4A 3TACA 2W5HA 2FSTX 4GV1A 3LZBA 5JSMA 5JK3A 4IX6A 4GRBA 4B6LA 3EQPA 2GNHA 3OEZA 4EJNA 3CQWA 4PTEA 5CVFA 3H9FA 3VS0A 1V0PA 3JY0A 5CNOA 4RJ4A 3TNWA 1H08A 4BCJA 5I5ZA 4IMYA 3L1SA 4NKSA 4L3JA 3Q04A 5ACKA 4E6AA 3NRMA 4IEBA 4K9YA 4IWPA 3ZMMA 3QGYA 5C27A 4LRKA 5DRDA 4EK5A 3GT8A 4NCTA 3UGCA 3VW8A 2PK9A 2PMLX 5HQ0A 3MFUA 5L2IA 3V5TA 3BZ3A 5J1VA 4FTIA 1GZNA 3NUPA 4GMYA 4YLKA 3DA6A 2I40A 3QHRA 3ZEWA 4AZWA 4KB8A 4F1TA 4RVKA 4U97A 5F9EA 4R78A 2B54A 4RVTA 4BDKA 3KQ7A 4EOMA 5EG3A 2O3PA 3F5GA 1XH8A 4WUNA 4EK3A 2YZAA 5GHVA 4CZYB 3ZDIA 1M14A 2W1GA 3UO6A 1GIHA 3GP0A 3NW6A 4YBKA 3NX8A 5AP0A 4EWHA 2HZ4A 4PL5A 3UO4A 4P4CA 2OZAB 4D58A 4ZJVA 3ACKA 5HE1A 3GCSA 4C4JA 2PWLA 3QRJA 4OTHA 3ITZA 3V5PA 3QX4A 5JQ5A 3OC1A 5L3AA 3EOCA 3FLNC 4RZVA 4EYMA 2FH9A 4CRLA 3LMIA 1FPUA 3ATSA 4MXYA 3OBJA 3UIUA 1FBNA 4FSRA 4O27B 4ZSGA 1XBCA 3TUCA 3W2PA 3DAKA 2WMAA 3GC0A 1A06A 4GU9A 1M7QA 3A8WA 5CU4A 4JQ8A 4ASDA 4LGHA 1PMEA 4TNBA 1QPDA 5HNGA 4BCGA 3G9LX 5HIEA 3BI6A 4ANQA 5L2TA 2W9ZB 2V5QA 2JBPA 2WMWA 4IX3A 1M2PA 2X2MA 4XLIA 3VVHA 1U4DA 3HV4A 4F9AA 4O7LA 2IW6A 2C6KA 1S9IA 3O8UA 4OBPA 2OZAA 2HXQA 3PIZA 1IR3A 4YJNA 4WHZA 1VEBA 5L6OA 4GT5A 3NGAA 4GL9A 2PVHA 3I4BA 1SNUA 4UV0A 2C3KA 2CGVA 3GQIA 4CFMA 4N57A 3F3ZA 2WTWA 4R3RA 3OT8A 4KKHA 4FGRA 4F08A 2RG6A 4CLIA 5IZFA 1UKHA 3HV7A 4DFBA 1UNGA 2JD5A 1YHSA 3O7LB 4U40A 3C4WA 5E8TA 4YBJA 3L9MA 1V1KA 3PXFA 5AP1A 3F2RA 4LMUA 5IQFA 3R02A 4IM2A 4PNKA 3GBZA 4GFOA 5HBHA 5HZNA 3KRJA 3PXQA 5HOAA 2OWBA 4FL2A 4H3PA 4USEA 3DAEA 1DM2A 2JDVA 2X8DA 2VWYA 4FKQA 2W4JA 5D9HA 4NM0A 5DA3A 4MNEB 5HVYA 3RJCA 2QI8A 2BFXA 2ETKA 2UZNA 2JGZA 5JT2A 3Q9WA 1YW2A 2QHMA 3QZGA 3E92A 1LR4A 3FZ1A 4JQ7A 2B9FA 2UZWE 1RW8A 1OIQA 2WTVA 3FSKA 3QRTA 4X3FC 3PPZA 4IADA 5TKDA 4D9TA 4ZMFA 2H34A 1VJYA 1G8AA 3FKOA 4JRVA 2YITA 5AMNA 3OBGA 3FEGA 3CQEA 4I20A 4IWQA 4ZTLA 1AGWA 5B2KA 3FPMA 2W1ZA 2VTOA 4G3FA 4C35A 3I7CA 4ZMEA 3FSFA 3QGWA 1FOTA 3EZVA 3NAYA 4KIKB 4RWLA 3R1YA 4QMXA 1YXVA 5CT0A 2WQBA 3ZS5A 3OUKA 4MNEA 3BYSA 4EONA 5CI7A 4AZEA 4FKTA 3OTUA 4UX9A 5L2QA 3EB0A 2VWBA 2V55A 3JXWA 3QRIA 3UBDA 4QRCA 4F6SA 3BGPA 5A46A 5JEBA 3F3TA 4JG7A 2BRBA 2JDRA 5KNJA 4IJ9A 3R9NA 4HVDA 2XKDA 2PZIA 3I81A 4YNEA 4CYIA 3IECA 3QTZA 3I60A 1Q3DA 5AP7A 1W83A 4GVJA 4CFFA 3OP5A 2A0CX 4CQEA 2UW8A 5BVWA 1KOBA 4FIIA 4XOYA 5CU2A 3UVPA 3ZXZA 2O63A 2CN8A 2VNWA 3UOJA 3HP5A 2BZHB 4TWOA 5HICA 3UG2A 1O6LA 2OZOA 2R3QA 4KIKA 3OCTA 1YHWA 3A7GA 4H36A 4ANBA 4XBRA 1PW2A 4Y72A 2E9OA 4MCVA 4LOQA 2VX1A 4RJ5A 4FV6A 3EQCA 5ETIA 4I4FA 3RAIA 4NM3A 3V8WA 3A4OX 3KXHA 4GJ3A 4UY9A 4O6EA 4DFLA 4ZZOA 4OTPA 3LW0A 3G6GA 3FMHA 3HGKA 3KRLA 3LE6A 4QMYA 4BZDA 4D2TA 5CASA 5CEIA 3TI1A 2QOLA 3ORTA 4TYGA 3BQRA 4C0TA 2GNIA 1V0OA 3CCNA 3FXZA 4A4LA 4YJVA 4FGBA 2EB2A 3ENHA 4L8MA 4AOJA 2RFNA 4F9YA 4O81A 4W8DA 2BHEA 1GJOA 2G15A 5BVFA 3PZEA 2O2UA 4Y5HA 5CXZA 3KMWA 4FV9A 4FV1A 4I94A 3EN9A 4W4VA 2G2HA 4GG7A 4FKLA 4XP2A 3FMNA 1Z9XA 1E9HA 2YWVA 2XIYA 2OFVA 4F0FA 5M53A 2ETMA 4AGWA 3QLFA 5J9LA 5LVPA 4GT4A 4YZBA 5F4NA 3HMMA 4ZY6A 5LOHA 1XH5A 3H30A 1W84A 5AIKA 4EOQA 1CM8A 3UIBA 4D2SA 4DG0E 4AFEA 3AGMA 4BKJA 4C02A 5BYYA 4AT5A 1H25A 1KE9A 3I0OA 4KA3A 4QP3A 1KE7A 2G1TA 4MH7A 4FVPA 5AJQA 5EW3A 3QTRA 3EQGA 4C7TA 3ZXTA 3O50A 2CKQA 1GZ8A 5AUWA 2YLFA 4A4XA 3IS5A 4EH9A 3H9OA 3QLGA 3MTFA 2AUHA 4YLLA 5K9IA 3SGCA 3UMWA 3UYTA 3FYKX 5EYCA 4YUQA 4IAKA 5IPJA 4I1ZA 4DH8A 5HIBA 3KMUA 3MB6A 2C3IB 3JUHA 4Z3VA 4F7LA 4RJ3A 2QVSE 2ERZE 5C9CA 4EH6A 3BRBA 4I5MA 2PU8A 2WGJA 3VNTA 4AXAA 4ANSA 4J53A 1WBSA 2PVJA 2EU9A 3VBVA 3MVJA 3UPXA 4I5HA 4M12A 5CZIA 2J2IB 3ZO3A 4A7CA 3ALNA 3GCPA 3IKAA 2Y0AA 3ZC5A 5CZHA 1YHVA 3PG1A 3GI3A 2ERKA 3HZTA 3QAME 4QNYA 4YJUA 2VTHA 4GG5A 3VO3A 3R7VA 3VBXA 4DEIA 5IU2A 5CTPA 5E8SA 2J0JA 3BU6A 5AUZA 2WB8A 3WE4A 3I6WA 1YOLA 4A4OA 5JFVA 1P2AA 4XJ0A 3LFFA 3F3UA 1KV2A 4JX3A 5J7BA 2VO3A 3UNKA 1OVEA 2ITOA 2F7ZE 3WYXA 1PY5A 1J7LA 3KF4A 3BYMA 4FVQA 4RC2A 4PMTA 5EHYA 3PY3A 4KRDA 2IPXA 3HA8A 4G3EA 3KC3A 4GFGA 1BL7A 2BCJA 3A7IA 3HMIA 2UW7A 4XH6A 5ETFA 4AN3A 4S33A 5IMXA 5E8UA 5L6WL 2IW9A 3AT4A 2VTPA 4KIPA 1UU9A 4IC7A 4OR5A 5AA9A 4C4IA 1YXUA 4V01A 3EWHA 2JKOA 4PL4A 3UYSA 4FF8A 4D1XA 1KOAA 3QQFA 4ALWA 5LARA 3OW4A 3UVQA 5CSVA 4F7SA 2W4OA 5B0XA 3VUDA 5KBRA 3FMEA 3EL7A 3TV6A 4HCVA 3PY0A 4E7WA 3ZLSA 4CG8A 2WQEA 4L7FA 4MNFA 3QCXA 3AT3A 4NJ3A 2UZOA 1G8SA 5FDXA 2X4FA 4FT7A 2ZM1A 5HVJA 4U0IA 3H10A 3LJ1A 5CQWA 2QOIA 1G5SA 3HV3A 4CFWA 5IF1A 4J96A 3KULB 5D11A 5K0KA 5HE3A 3SD0A 3AC1A 3UJGA 2I0VA 3CR0A 2G9XA 2V7AA 5LVNA 1QL6A 5FEEA 3WZDA 3ZSGA 1F3MC 2WMUA 3SHEA 4P7EA 4U80A 3E8CA 4MEDA 4FG9A 5L4QA 2YFXA 4CSVA 3H4JA 4DINA 4USDA 5T68A 3V3VA 4ZLYA 4FIHA 2C6IA 1UV5A 2E9VA 3LFEA 3WE8A 2VO6A 2WTIA 5KO1A 3AC2A 3N51A 4BY9E 3EN4A 3A99A 1YWVA 3ZDUA 3LJ0A 3DKFA 4FSZA 5ANOA 3A2CA 3SA0A 4M66A 4O1PA 4XG6A 1NA7A 3KULA 4C37A 5KKRC 4RLKA 4GK2A 1JLUE 2R0IA 3BYVA 1TQMA 2OF2A 4CEGA 4EK6A 2WMXA 4MXCA 4FL1A 5CAOA 5GJGA 1L8TA 2PZ5A 2PE1A 5D41A 4TT7A 5HVKA 3T3VA 3IGOA 5JZNA 5H8GA 5B2MA 4FTQA 4E3CA 3QTSA 5JFXA 2Z7RA 2YIYA 5HTCA 1X8BA 4R3CA 1NVSA 4FT0A 2C0OA 3KN6A 2IO6A 3GENA 5A14A 5BMSA 3HAMA 1QPEA 4RX9A 2NPQA 2YJSA 5AAGA 4RVMA 1OKWA 3QUDA 3V5QA 4YZDA 4IVBA 2PL0A 5CNNA 2X7OA 3W32A 2YIRA 3MH3A 2OU7A 5CU6A 2DS1A 5E8XA 3UQGA 3B8QA 3FMKA 5AIRA 3AXWA 2VWZA 4MQ1A 4U3ZA 4BDCA 2CNVA 5EYMA 4DFNA 4HVSA 2ITVA 3RNIA 4CKJA 1WVYA 2QNJA 5AFVA 1W0XC 2E9PA 4DE4A 3R9HA 4HW7A 5A54A 1AD5A 2RSVA 5CWZA 1XWSA 3ZBFA 4F0IA 4FC0A 3Q4TA 4DITA 4KWPA 5EKOA 3VHKA 4GH2A 2PVFA 3MB7A 2QKWB 4GUEA 5HG9A 1M52A 3RPVA 5CAVA 4EI4A 2XNGA 4K18A 3TV7A 3NVMB 4BBEA 4EHZA 2BTRA 2YJRA 3ZLWA 3KK8A 5LXMA 3DXQA 5K0XA 3QQLA 4AZTA 3D5UA 4MXXA 3MPAA 4J1RA 5E90A 2B55A 1IASA 4L6QA 5HEZA 2WIPA 3LCOA 2YM7A 5FTQA 3R7IA 2ONLA 4I22A 1XHAA 3H0YA 3PE1A 4Z16A 3NEWA 2XF0A 2EXCX 2YDJA 4K2RA 1CKIA 4DGNA 5DR6A 5HIDA 4RBLA 3DZQA 3LOKA 4R7IA 3CQUA 4H1MA 3CKXA 4FTRA 3PSDA 3FI3A 4O83A 3N4VA 1ZMVA 2X6EA 1OZ1A 3CPBA 3DBDA 2PZYA 4F0GA 5ITAA 3BYUA 4EKLA 2A1AB 4QMMA 2PPQA 4HGTA 3OOGA 2YDIA 3LFQA 3BLRA 3NSZA 3PG3A 2QKRA 3B2WA 2B1PA 3HDMA 5E8YA 3UZTA 3RZFA 1QPCA 4BDBA 4RZWA 4FR4A 4FUYA 4G9CA 3ZTXA 4E8AA 3DLZA 2GHGA 3KXZA 3WILA 4EL9A 5TE0A 4JG8A 2B52A 5CT7A 5LWNA 4U42A 3C13A 5M44A 1JKTA 1Y91A 2VGOA 3ORZA 5EW9A 4BGGA 4ERWA 3ZCLA 4O91A 5JMSA 1TQPA 3DS6A 1XQZA 4M8TA 4PDYA 1H0WA 2C6EA 4LOOA 2RFDA 1RQQA 2ZYBA 1WBPA 1ZAOA 3FMDA 3W55A 2JIIA 3KN5A 1J91A 2RG5A 4YNOA 2HOGA 1QCFA 1YI3A 3LLAA 3RALA 5JFWA 4JS8A 4FKSA 4IVAA 3RK5A 3N4TA 4F6WA 3LXNA 3PYYA 5IQDA 3WZUA 3GU8A 3S2PA 2YA9A 4TY1A 2F9GA 2R7BA 4NH1A 4YC3A 1SVEA 3EFWA 3O96A 3FMJA 4NIFA 5E8ZA 1B6CB 2P3GX 4FEVA 2GNJA 4NM7A 4Q5EA 5LVOA 2XEZA 1Q24A 1ZYCA 4BCMA 3V04A 5HLNA 5J9ZA 3OXIA 4D5KA 2EWAA 5BVDA 5AM7A 4ORKA 3PTGA 5M4FA 3CPCA 3EN5A 2IVUA 2XUUA 3ANRA 4J99A 4QQJA 4E5AX 3KXMA 5M4CA 3EQHA 3QA8A 3A7FA 4E5BA 3DFAA 4J7BA 4BWKA 3R9RA 4FSNA 4C4HA 2R3GA 4DH5A 4HZRA 2JEDA 2QR8A 4RFYA 3G15A 4FK6A 1U46A 4F70A 4GIIA 5DR9A 5LJJA 1PXMA 4BDGA 4JNWA 1JQHA 2WMRA 4BTFA 4ZLZA 2W05A 4H05A 1SM2A 4WNKA 3DPKA 2XP2A 4AE9A 4FUXA 3FPQA 2PMIA 4IHPA 5D1JA 2BALA 2XNNA 4D2RA 3G2FA 3FKLA 4ZLOA 4EC8A 5HTBA 4FTCA 4H1JA 2XBJA 4OBOA 1R1WA 4XV2A 4PDSA 2E9NA 4IACA 3NNXA 4NT4A 3U55A 1I09A 5AP4A 3VQUA 4DEBA 4YTCA 1GY3A 3SOCA 4LGDA 4B0GA 3PUPA 5JH6A 5CU0A 3NYOA 2YM6A 4E93A 4EK4A 4EJ7A 5AR2A 4XHKB 3K54A 2B9IA 1REKA 1XH4A 2XEYA 3PP1A 4S34A 2WU7A 5M55A 3C0IA 3CJGA 4FV7A 2X2KA 1T46A 4RX7A 4X3FB 3AMYA 3ZO4A 2UVXA 1LP4A 3BIZA 1UU8A 3M11A 5D7VA 2C0IA 4NU1A 3JVRA 3TTIA 4D4RA 4I24A 1NVRA 3TT0A 3WF9A 2GTMA 5AV2A 4BF2A 4E4NA 1NVQA 3ORPA 4AW5A 1OPJA 3G6HA 3Q60A 5FXSA 2J5EA 3F82A 2YCRA 1WAKA 1OKVA 3DNDA 2C4GA 5AR3A 4FT9A 3LMGA 2ITQA 5KZIA 1IAJA 5EOLA 2P2IA 4QQTA 2XYNA 3BBTB 2OGVA 2XMYA 5M57A 3E64A 2XJ1A 4ANOA 2C47A 2VUWA 2ZDTA 4TPTA 4TNDA 3ZM4A 3KRXA 4ZTMA 5BQ0A 2W06A 3SDJA 4YHJA 4RJ8A 4D5HA 3MSSA 2BVAA 4X3FA 1OPKA 3DQWA 4QYYA 4IAAA 3UZPA 3VJOA 4GYIA 4MTAA 5IDNA 1GZOA 1MQ4A 4X0MA 5CSPA 3VS2A 2CGXA 3OEFX 4X21A 1WCCA 3MBLA 3R7YA 4RWIA 2XK4A 2VGPA 1OB3A 3C9WA 2OF4A 4IE9A 4WSQA 4V04A 5AV1A 4EYJA 2GS7A 2ZV8A 3UQCA 4HOKA 1YDRE 4QYFA 5D7AA 4RA5A 1GNGA 4AG8A 4JBOA 4PQNA 2IN6A 2NO3A 4F64A 4IVCA 4KKGA 3VRYA 5DRBA 5J79A 3GC9A 5AEPA 4DEDA 4L68A 2VTMA 2R64A 5AR5A 3V8SA 3FLZA 1SNXA 4ENYA 3CC6A 2H96A 2BMCA 3ZZWA 4MWIA 4HGLA 3BE2A 4BB4A 4O7TA 1H24A 1VZOA 2W96B 4E20A 2GTNA 4C4GA 2QO7A 3MI9A 5DE2A 1XH6A 3JPVA 3HUBA 2OKRA 3ULIA 2OJ9A 3TEIA 4IJPA 3IOPA 1SYKA 3WZJA 2OJFE 1HCKA 2ITUA 2PVYA 3ZO1A 4M0ZA 4AF3A 4UMUA 3VJNA 2XNPA 3PFQA 3EN7A 5I9UA 4UYAA 4YC8A 2G2FA 4CFVA 3TTJA 4AA0A 3BHVA 4JLCA 5DR2A 4ZTRA 3QD3A 2QOBA 2ESMA 3FYJX 5CENA 3ULZA 4EBVA 4EOSA 1B38A 1UNHA 4S30A 3VS5A 4OTGA 1P4OA 3C1XA 3W10A 2QU5A 4MF0A 5C8MA 4E26A 2HZNA 3PLSA 2C3LA 4C3PA 4F9WA 3U4WA 1KE5A 5M4IA 4LI5A 3F9NA 4FODA 2YIXA 4USFA 1YXSA 4FI1A 1MRUA 3ENMA 2CMWA 3NUSA 2HIWA 2OIDA 2ITZA 2QG5A 2OXXA 1W7HA 3FC1X 4XS2A 1YOMA 1ZZLA 4X2NA 3MJ1A 3W33A 3UOKA 2W1FA 2UW0A 3COMA 1JVPP 4I21A 1ZY5A 3VS1A 1R3CA 4DC2A 2IG7A 2YISA 3DKGA 3GFEA 4AN2A 4U81A 3VN9A 3P23A 5GZAA 4FYNA 3QFVA 2BUJA 3G0FA 3MS9A 4I23A 5K3YA 2FVDA 4YZ9A 5K5XA 3RBWA 2PVKA 4FKVA 3VS3A 3VW6A 2BZKB 3GU4A 3MW1A 4AQCA 4BYJA 4EQUA 2QOHA 4D2WA 4I92A 3RGFA 4GKIA 3FQHA 2O64A 3Q9YA 3TDVA 4FTOA 3RAHA 4LL5A 3TWJA 5FQDC 4UXLA 2X6DA 5C8KA 4OTQA 3R1QA 3F6XA 3BBWA 4YPSA 4LV5A 3HLLA 3OVVA 1MP8A 4PMMA 3FMLA 2VZ6A 2W1IA 1J1BA 4YMJA 4O0VA 2JFMA 3E8DA 3O8PA 5A4CA 3ETAA 4W4YA 2OW3A 4AW0A 3BLQA 1J7UA 4BICA 2Z2WA 3F3VA 5E1SA 3GNIB 2IZUA 5KMNA 3R71A 3BHHA 3WOWA 1J7IA 2YZLA 1H27A 4CVAA 3Q6UA 3UP2A 4Z7HA 4EH8A 2XK8A 3EFLA 4AZVA 2WMTA 3MWUA 4TZRA 3KXXA 3OS3A 3R2YA 5TF9A 5TR6A 4QTDA 3POOA 3R8UA 4FEQA 4XRJA 4GS6A 5HE2A 2UVZA 2V0DA 4FT5A 4BDIA 1Y6BA 1JKKA 3FQEA 4AZFA 4DGLC 5A6OA 4FIJA 4TWPA 3FBVA 4M14A 4U44A 4BWXA 4WG5A 1WBVA 3HV5A 2OIQA 2B4SB 5BYLA 4QYHA 3D5XA 4QTAA 2Q83A 3NUYA 4G3DA 3SOAA 5J5TA 1J1CA 3DU8A 3KEXA 3RPRA 2VTRA 4RIOA 2CLXA 4YHTA 5BPYA 5CF4A 4GVAA 4U3YA 3PLAE 3MV5A 2R3PA 3OWKA 1OIUA 5CS6A 2YM8A 1M17A 2CNQA 4Z9LA 5J9YA 3LQ3A 5L8KA 2Z7QA 1U5QA 1FINA 3DAJA 1YXTA 1IA9A 3OWJA 3M42A 4E1ZA 3UQFA 2WFYA 3QWJA 3VBQA 3AMAA 2R2PA 3IW4A 2R4BA 5ANIA 4D4YA 5I9VA 2YN8A 5KUPA 4KSPA 2BKKA 3R9OA 4FKJA 3SC1A 1PXJA 5ICPA 1WZYA 3HKOA 5H3QA 4WNPA 3CY3A 4WUAA 4TYJA 3HECA 4CV9A 2Y6OA 1YDTE 2J0IA 3HL7A 4UWYA 4F65A 2X8IA 3RINA 1XJDA 4FYOA 1Q8TA 4B7TA 2YCQA 5KKRB 4U5JA 5EHOA 4FL3A 4ZY5A 3TUDA 4GCJA 1H01A 3COIA 3CY2A 4AOIA 3FL4A 5IQEA 2YACA 3PJCA 4ACMA 4RT7A 5HBJA 3ID6C 3AMBA 2GNLA 3RTPA 2J90A 2QOCA 3EH9A 4H39A 3QA0A 4NM5A 3C0GA 2UV2A 5I9YA 3OTVA 3FAAA 4FKOA 4X2JA 3FKNA 5T6KA 4LRJA 4F1OA 4NL0A 3AQVA 1NY3A 4A9UA 3QALE 1NXKA 4FEUA 5HU9A 4V0GB 3W2CA 2R3LA 1BX6A 3BCEA 4P2KA 2QR7A 3UC3A 4BIDA 2XNOA 4CG9A 4UZHA 3KK9A 2B9JA 3F5XA 5HD7A 5KZ0A 1YWNA 2WU6A 3IW8A 5DH3A 1U5RA 3VIDA 5H2UA 2XZSA 3QUPA 4PP9A 1WFCA 3Q3BA 4GK3A 4K6ZA 2X81A 4HPUE 5JGBA 2ZOQA 4WD5A 3RPOA 5I9XA 1DS5A 5KHWA 3HMOA 2C6MA 4PTGA 5FM2A 4YZCA 4CLJA 3IO7A 2ZB0A 4ZTQA 4YTHA 1Q8YA 5HGIA 3DJ7A 3KB7A 3NWWA 3R04A 1UNLA 2HY81 4FT3A 3VRZA 3TXOA 4ITHA 4V0GA 2QLQA 4CMUA 1KV1A 3F7ZA 5HKMA 3SRVB 3N4UA 1GOLA 2QODA 3IQ7A 3E3BX 3EIDA 5FRIA 2Y4IC 3LXLA 2LGCA 3QCQA 4BCQA 3VC4A 4KKEA 1ZYDA 3GCUA 4J52A 4U9AA 4XX9A 4QMUA 4DFYA 4V05A 4I0RA 4EH2A 1AQ1A 2HK5A 2W9FB 2ZMCA 4I0SA 4LG4A 4CZUA 1TKIA 1DAWA 3GQLA 3RWPA 3H3CA 3K3JA 3NCZA 2IWIA 2V62A 1IEPA 3KU2A 4K8AA 4NW5A 5J87A 4QMQA 3PSCA 2VD5A 3GCVA 5I3RA 2C5VA 4IVDA 4GK4A 3KCFA 1BKXA 1H1QA 3DXNA 1OIRA 2FYSA 4TXCA 1BLXA 1JSUA 1PXKA 3HEGA 3EKNA 3AD4A 4BCNA 4KAOA 1WBWA 1K9AA 5CEOA 3P0MA 4NK9A 3SRVA 4C59A 2I7QA 3NCGA 4FV3A 4RIXB 3MN3A 4IX5A 4X2GA 5HHWA 4XV3A 5F94A 4EH7A 5EW8A 4HNIA 4X6RA 1REJA 5JRQA 3DK3A 4QP4A 4UWCA 4ARKA 3OOMA 3NUXA 2PTKA 4BDJA 5IQCA 1MRVA 2Y8OA 3OROA 4EEVA 4C3RA 2WTJA 4EORA 2O5KA 1ZARA 2QONA 4KINA 3TV4A 4AN9A 1PMNA 3U54A 4UEUA 4XLVA 5HI2A 4BGQA 4GIHA 4QP8A 1XO2B 2P4IA 5IH4A 3WF5A 4BTMA 2R5TA 3A8XA 3LFNA 3OHTA 4C36A 5CVHA 5FUTA 3FE3A 3KRRA 3R9DA 4OBQA 3FLQA 4MKCA 4RIWB 2BIKB 3W2RA 4NWMA 4ZP5A 2HY0A 4FE2A 3MFTA 4U43A 3ZSIA 2XJ0A 4ERKA 3R1NA 1APME 5LVLA 1K3AA 4J98A 2ITTA 2OBJA 3EN6A 4PNIA 3EKKA 5BX0A 3UTOA 3OW3A 3R00A 2YWPA 4E6DA 2HW7A 3QC9A 2GNGA 4ZSLA 2FSMX 2EUFB 2GHLA 4P5QA 4PDPA 3UOHA 4DYMA 3NAXA 4FKPA 4O7ZA 3CSVA 5GIPE 3ELJA 2YEXA 2J5FA 1PXPA 4EWQA 4QMZA 1U54B 3FV8A 4ZSAA 4PPCA 3LCDA 4JIAA 1WVWA 4HNFA 2C3JA 3NYNA 4DAWA 5IQGA 4W9WA 2C5NA 4EZ3A 2P55A 4L45A 3CD8A 3WIKA 3O0GA 2ZJWA 2UW4A 4FZDB 4I0TA 3C4ZA 4FZ6A 2WPAA 1ZY4A 4EQMA 2F4JA 4M68A 1BI7A 2GDOA 4MBJA 2JKQA 4OT5A 1P14A 3OWLA 1SVHA 2UZVA 3VBYA 3PVUA 4BDDA 4EH5A 4GT3A 5JZJA 4FTJA 3FHIA 1R78A 2I0YA 3UNJA 3MESA 4A9YA 2YM3A 4O22A 4II5A 4YZNA 1U54A 5C8NA 3P9JA 3QTUA 4K77A 3R7OA 3RAKA 1KE8A 1OECA 4IANA 1PF8A 3NIEA 2RGPA 4M69B 4CMTA 3E8EA 3FY0A 4K33A 4BDEA 4BDAA 3GU5A 1MUOA 2ZB1A 3LVPA 4B99A 4JDKA 3LFBA 5F20A 4DTBA 3HMPA 2WEVA 3O71A 4KABA 1WVXA 5CX9A 3TCPA 4ITIA 5KMOA 4TL0A 1W98A 1HCLA 2WIHA 4I6BA 4YSJA 2X9EA 5LMBA 2XRWA 3EYHA 1M2RA 4F6UA 3PJ3A 2RIOA 5DLSA 3JYAA 2RL5A 5A4LA 2FGIA 3R1SA 3UOLA 1UKIA 5FDPA 2HWPA 3PWYA 1FVRA 3EJ1A 4RWKA 2PY3A 3FQSA 3HX4A 4RSSA 3R7EA 2Z60A 5C26A 2ZV7A 3QYZA 3QU0A 4HVHA 3ZLXA 3TZ7A 2Y4PA 2UZDA 5FBNC 4M69A 4BCFA 4IIRA 4Y95A 3DKOA 4JG6A 3ZUUA 5AR8A 2EXEA 2W4KA 2R3MA 3GEQA 3EL8A 3WF6A 3S1HA 3KF7A 1BMKA 2FA2A 2JDTA 4IDVA 3I1AA 3EFJA 5D10A 3TG1A 3PY1A 3P86A 4H58A 3MIYA 4IB0A 3CE3A 4FIEA 4FIFA 3UE4A 2C5OA 1UVRA 3DTCA 5TO8A 3RZBA 3ZO2A 4BHNA 3V5LA 3MTLA 4MD8E 2WNTA 4EZ7A 1XH7A 3LXPA 3ZHPC 2QU6A 2PZPA 4ZSEA 2XA4A 4PTCA 3JR1A 1PJKA 4QYEA 4JR3A 4CT2A 4DFZE 4ZZNA 5A4EA 1MQBA 4QMTA 4S2ZA 3WF8A 3C7QA 5CAUA 4O6LA 2C6OA 4DGMA 5DG5A 4F9BA 4QP6A 3MA3A 3U87A 2BDFA 2VO0A 3ZONA 1ZWSA 4E73A 4N6ZA 2BAQA 3ERKA 4D0WA 3D2KA 3LIJA 4OTRA 3JY9A 5JGDA 4QP1A 3R8LA 2X2LA 3QD2B 4BCOA 5DOSA 4ZOGA 2I6LA 2WTCA 3Q32A 5FGKA 3V5JA 5IA0A 3SLSA 2PVLA 3C4XA 4KSQA 4RQVA 5IQIA 3BWJA 5BVKA 3TDWA 2BFYA 3FUPA 2XK9A 2X8EA 3S4QA 4PMPA 3HP2A 2WOTA 2I0EA 4BHZA 4D2VA 3MDYA 2WZJA 5CU3A 4U41A 3IG7A 4DFUA 2VX0A 3ORKA 4WG3A 1V0BA 2YHVA 3PVGA 1KE6A 3Q5ZA 2R3RA 4IB5A 2VWVA 4RJ7A 1K2PA 4YJRA 1FMOE 5AP2A 3VUHA 2XYUA 2HXLA 4UB7A 1OPLA 2XBAA 3JVSA 4MD7E 3F2NA 4R3PA 4AACA 2XNEA 4BCKA 2ZVAA 4AGDA 4YO4A 5AUVA 3FJQE 3KRWA 4O1OA 4AU8A 2VNYA 4CD0A 1YRPA 3GC8A 4C2WA 4DTAA 4DEGA 1JNKA 3GXLA 2CN5A 2CPKE 4FICA 4OLIA 4WO5A 4AT3A 4AFJA 4H3QA 2X4ZA 3COKA 4XRLA 5DT4A 4ZY4A 2H6DA 2FUMA 2R3NA 4XOZA 2WTKC 4AT4A 4CKIA 2YIWA 4O0WA 3SXRA 2VTJA 3OG7A 3WIGA 4ZAUA 2W1DA 5AUTA 3OXTA 4WKQA 4H3BA 4R5SA 2YERA 1XBBA 5CYIA 4EBWA 4PX6A 3P78A 4AW1A 4CV8A 4EOKA 3LFSA 3V6SA 3Q53A 4PDOA 2P33A 2WQNA 4Z7GA 4CTCA 4FKWA 4O86A 4ID7A 3BHTA 4AWIA 4JI9A 1ZZ2A 5ANEA 1L3RE 4J97A 3UNZA 2IZSA 3A7JA 3VF8A 4IZ5A 2QURA 4EQCA 3DLSA 4R5YA 4MX9A 3PVBA 3GC7A 4GEOA 2X0GA 5HNBA 3OZ6A 3VUKA 2WHBA 2PVRA 5FBOA 4ACCA 4E4MA 4EUTA 2W1HA 4QMVA 3W2SA 5C01A 3MY0A 4PY1A 5DPVA 4RQKA 3D9VA 5DEWA 3SV0A 4F9CA 3CKWA 3TNQB 5IA4A 3NNWA 4MXOA 1BUHA 3PJ2A 3F3WA 4YGAA 3QTWA 2LAVA 1BI8A 2R9SA 4RGJA 1UWJA 2JBOA 2R3OA 1Q61A 4A9TA 4ONAA 2J0MB 2UZBA 3UVRA 1YWRA 2C6DA 4KS8A 4DEEA 4DT8A 4LUDA 1WBNA 3VAPA 4YTFA 4F99A 3HUCA 4M84A 3DDQA 2YLEA 5BYZA 4RFMA 4MXAA 4QP9A 2WAJA 2XK7A 5HCXA 2R3JA 5IA5A 3ZH8A 3F88A 1Q41A 3EQDA 1OUYA 3EYGA 4MXZA 3QCSA 4JDHA 3TJDA 5GIOE 4YR8A 2QD9A 4O0YA 3VUTA 5IA1A 3CGOA 5IUIA 2PMOX 3NNVA 4S32A 1ERKA 4QD6A 3BV3A 3WYYA 3LM5A 3LMHA 2XJ2A 2Q0NA 5GINE 3TKIA 2JAMA 3QCYA 5ACBC 3RNYA 3L8PA 2A2AA 3QTIA 2PHKA 4IB1A 4KBAA 3AD5A 4LYNA 3EMGA 4MBLA 2VTTA 4CGAA 3KFAA 4G34A 5E91A 4MHAA 4NTTA 2XKCA 1PXIA 5DGZA 5DT0A 3RMFA 3D2IA 1GAGA 4L67A 4QTBA 4DLIA 5IEVA 4U79A 5AM6A 5J5SA 2YCSA 3CTJA 3V6RA 3CJFA 5AUYA 2PVNA 3KXGA 3W2OA 4AZSA 3FDNA 1OBDA 2WQOA 4IZYA 5IQHA 3P5KA 4KIQA 2C68A 2Z8CA 2F7XE 3OCBA 4R1YA 5LCKA 5KCVA 3U8WA 3U6HA 5EK7A 1H1RA 5ANJA 3ZZEA 2BHHA 5JRSA 4C62A 4PPBA 2PUIA 3BEGA 3IW6A 4A9SA 4F63A 5EQYA 4M13A 3D4QA 1YQJA 3QD0A 1LEWA 3EQFA 2GMXA 4ENXA 1H00A 3HV6A 4DG3E 3ORNA 3IONA 3CLYA 3UDBA 2ITXA 3REPA 5CEQA 3W8LA 4F7NA 3GU6A 1FVVA 3LQ5A 4FOCA 3MFSA 4EHGA 2XM8A 4HVIA 5HESA 3ZC6A 3QQJA 1P4FA 4IWOA 4W9XA 4MD9E 4CFNA 2UZUE 1CMKE 4UWBA 5AR4A 3LLTA 4CXAA 3NLBA 4M3QA 4CTBA 4Y8DA 4BZNA 3BU5A 3PA5A 1OGUA 1JSVA 2FB8A 4FX3A 5H8BA 4YPDA 2BR1A 4EOJA 2CNUA 2C6LA 1A9UA 4O7WA 3LFDA 2REIA 3VWAA 1TVOA 5C1QB 2R0UA 4UN0C 4L00A 5HCZA 2HYYA 5HG7A 5EH0A 1DI9A 3Q96A 2JKMA 3LCKA 4LL0A 1PMUA 3RKBA 4BN1A 4EH3A 2C5XA 3OFMA 4M67A 3DXPA 1Q8WA 1UU7A 3CXWA 5HX8A 3E8NA 4DFXE 5LMKC 3QX2A 5F1ZA 4XG8A 4JQEA 5CI6A 4IXPA 3MPMA 2W1CA 3U9NA 5CALA 3DGKA 4HYSA 2WOUA 4WSYA 4BCIA 4GW8A 2C5YA 5L8LA 4G5PA 4M7IA 1JOWB 5K4IA 3AC4A 4ALUA 3F61A 4HVGA 5LCJA 3S00A 2YDKA 2JKKA 4FBXA 2PYWA 3F2AA 3PPKA 2Y6MA 4I93A 3P7AA 1RDQE 1Y57A 2W5AA 2BAJA 3D5VA 3KREA 4NSTA 4TW9A 4NEUA 2X9FA 4FTUA 4IM3A 4MQ2A 5IA2A 4NJDA 3C0HA 4EC9A 3UPZA 5E9EA 3LM0A 3ZRKA 1ZYSA 4D1SA 4DH3A 5AADA 4C38A 2YCFA 2G01A 3VULA 4FNWA 4DH1A 4F7JA 4EOOA 4L43A 3S3IA 2A4LA 3NNUA 2OSCA 1PXNA 3BE9A 4WOVA 2WEIA 4JAJA 2ZV2A 5HNIX 4OAVB 2V22A 4GU6A 5I9WA 4EZ5A 2QOOA 3Q5IA 1LEZA 2O0UA 4AUAA 3R30A 5BNJA 2VWIA 1YXXA 2X39A 1SVGA 4F1MA 3TN8A 4YLJA 2Q0BA 4LGGA 3P4KA 2CJMA 3TJCA 4YSMA 1PXLA 4HCUA 3ODYX 4FTTA 4LM5A 4ALVA 2Y4IB 2GSFA 3PXZA 5CXHA 5I9ZA 3IK3A 3DDPA 2W5BA 1OL2A 3PSBA 3ZU7A 3KGAA 1OKZA 5FP6A 4WIHA 2VTIA 3S95A 5JQ8A 4O7RA 3THBA 3LFAA 4FOBA 5DMZA 4ZS0A 4TYHB 3QQKA 2XIXA 3QBNA 3O7LD 4E4XA 3LPBA 5M06A 4FG7A 3MY5A 4C33A 1LUFA 5FXQA 3G0EA 4Z55A 3NVKI 5HE0A 1PKDA 3VS4A 3L9NA 4BI1A 3A60A 4FA2A 3VS7A 4BR3A 1TQIA 3D15A 3IW7A 4P5ZA 4JVGA 2BRGA 4XG2A 4X3JA 4LOPA 1FGKA 2VTQA 5AUXA 4CKRA 3V51A 3FLYA 4FZAB 3UO5A 4WNOA 4R1VA 1H1SA 4O7SA 1WMKA 4FZ7A 3UODA 4FSMA 3LQ8A 4MF1A 3HDNA 1LPUA 2H8HA 2P2HA 3GOPA 3PXKA 5L8JA 2OXYA 2OICA 5A3XA 3L9PA 3Q52A 4DLJA 2R7IA 3POZA 4DTKA 4AS0A 5HG8A 2WKMA 3IW5A 4I41A 4JR7A 4ZXTA 1IRKA 1OL5A 2O8YA 2P0CA 3IDPA 5AV3A 4RLLA 4L3PA 3W8QA 4BBFA 1P5EA 3DBFA 4JBPA 5CEMA 2HAKA 2XKFA 5J8IA 3UMXA 4AW2A 3E63A 4LUEA 3R7GA 1M2QA 2AYPA 2IW8A 2VWUA 4G9RA 2EB3A 3P7BA 4QMLA 2JLDA 4YJTA 4FIGA 4RG0A 1PMVA 2GS6A 4L52A 4KNBA 4O0XA 2WMBA 3EQRA 3FZOA 3O2MA 5ETCA 3RP9A 3V8TA 5K4JA 4I6HA 3EZRA 4MVFA 4PV0A 3HRCA 4XG3A 3FXXA 3FLSA 3R01A 3MFRA 4Y73A 4G5JA 2BRHA 4CMOA 2B7AA 3WI6A 3PJ8A 2AC3A 2HCKA 4WA9A 3W16A 5A9UA 4UMQA 3TIZA 1SZMA 3B8RA 5FWKK 4YTIA 2X7GA 5CEPA 4O7VA 4XG4A 3R21A 3MVMA 2HELA 4FV0A 5BVNA 4MK0A 1PHKA 4RMZA 2F2CB 2J9MA 2CDZA 2UW6A 4FTMA 5CVGA 5EHLA 3E3PA 3OT3A 5A4QA 1YVJA 3A7HA 3C5UA 4FTLA 4NKAA 4RJ6A 3R8MA 4IWDA 3D83A 5AAEA 4JBQA 3PDTA 3FI4A 3QTQA 1OKYA 2R3FA 3FZRA 3COHA 2ETRA 3FL5A 4U45A 3OUNB 4BDFA 2BRNA 3Q4CA 4HYUA 4M0YA 5IMEA 2NRYA 5FM3A 3R8ZA 4BKZA 5KX8A 3C50A 4IZAA 3A62A 5HLPA 5C4KA 3VUGA 2BAKA 2FSOX 4EH4A 4RPVA 2GU8A 4M15A 3SXFA 4PP7A 3O23A 4JX7A 1J3HA 2X1NA 3ZLYA 3I5NA 3JS2A 2W1EA 3W1FA 4AP7A 3LFCA 4WRSA 2IZTA 4OGRA 1KWPA 1PYXA 5FD2A 4UXQA 4RA4A 4AE6A 3DB6A 4C4FA
chains in the Genus database with same CATH superfamily
5FG8A 4BIEA 3E7OA 2ITPA 4R77A 5JFSA 2YABA 3FHRA 3AGLA 3ZUVA 4WT6A 4FMQA 1FGIA 3D7ZA 4QPMA 2R3KA 1OUKA 3BHYA 5DEYA 5L2SA 3TZ8A 4RIYB 4WG4A 1H4LA 2B53A 3BPRA 4AOTA 2GHMA 4EUUA 1MRYA 3C5IA 3BEAA 4U7ZA 4EHEA 5CF6A 4ACDA 3LCSA 3MVHA 3TKHA 5HX6A 2C6TA 1Q4LA 3R0TA 5AP5A 4BI2A 4EOPA 5HU3A 3UDZA 3L9LA 3ODZX 2C30A 5DN3A 4DH7A 2VWXA 3RI1A 3ZM9A 2KULA 4KRCA 4QMPA 4WRGA 5EFQA 5EOBA 4BVUA 3F5PA 1Y6AA 2JIUA 3PRIA 3A61A 2X7FA 4QQCA 4QP2A 3PXRA 5L6PA 2HW6A 5AP3A 2QHNA 3DY7A 4Y83A 2OG8A 1XR1A 2QQ7A 4O0RA 3I6UA 4O2ZA 2NNWB 3C51A 3TNPC 4GKHA 3GVUA 2OO8X 5HBEA 4BBMA 5M4UA 4S31A 1ZYLA 4RIYA 4AX8A 3CTHA 3RVGA 1H07A 3TUBA 4ZEGA 3AC5A 5IH5A 3ANQA 1ZRZA 4TWNA 3HMNA 2WELA 3PUFC 3RPSA 5BUEA 4LMNA 3PFYA 2ZV9A 1G3NA 3SQQA 2XKEA 3ACJA 2VTAA 4RC4A 2HZ0A 4IH8A 1A48A 2VO7A 3NDMA 2PSQA 1FVTA 3CS9A 3PVWA 3E62A 2F57A 2F7EE 5LQFA 3C4CA 3RCDA 4R6VA 5LVMA 2J7TA 2IVVA 4ZTNA 5IQBA 3KVXA 1STCE 2C1AA 2OIBA 5E1EA 3NR9A 5CLPA 1VYWA 3SKCA 4FTKA 2XRUA 2Z7SA 2ITYA 3LJ2A 2BTSA 3MA6A 4FSQA 5ANDA 2GCDA 5AR7A 4MUQA 5EM7A 4N0SA 3ZEPA 2E2BA 4XNEA 4CQGA 3GU7A 3AT2A 2XK6A 1XBAA 4P90A 5EQEA 4B9DA 1UA2A 5IDPA 3GOKA 3R73A 3IPHA 2VWWA 3OWPA 3LHJA 3QTXA 3HAVA 1ATPE 4GUBA 2VTLA 5GZ9A 4B4LA 4ZS4A 3PZHA 2Y9QA 4IBMA 4WBBB 4BJJA 4XG9A 4QMWA 3E87A 4ZK5A 4D0XA 1Q62A 2OH4A 4IAFA 3VONA 4IAYA 4RWJA 3T9IA 2FSLX 3R8VA 4G3CA 3BKBA 4OTWA 4AA5A 5CF5A 5IISA 2QOQA 3TNIA 5AAFA 3H0ZA 1FMKA 4IFGA 5HO7A 5IQAA 4D28A 4BCPA 2WTKB 3OXZA 4N4SA 2JC6A 3PRFA 5BVEA 3QYWA 4Y5QA 4APCA 1GZKA 4CZTA 4CCUA 5C4LA 5M51A 4GYGA 3C4EA 3PP0A 3RCJA 4PWNA 4B8LA 4ZJJA 3ZFXA 2CSNA 2PULA 3WZEA 3ORMA 3Q6WA 4Y46A 5CSHA 2AQXA 1OL7A 2XB7A 4IDTA 4R8QA 2J50A 3RHKA 4IFCA 4N70A 3HVCA 2SRCA 3BGQA 3F69A 4LV8A 4OW8A 3O51A 4FSWA 3AD6A 4YJQA 4BRXA 2GQRA 4FEWA 4W8EA 3EQBA 5EI2A 4JMQA 2VAGA 3DBCA 3GFWA 4UMTA 4CCBA 4TYEA 5KHXA 4I3ZA 3U4UA 4D55A 2ZFYA 2XARA 2DYLA 1OIYA 3D94A 4HPTE 4NCTC 4ACHA 1ZYJA 4DBNA 4YU2A 1Y8YA 4X2FA 5CANA 3QQHA 4CNHA 3DOGA 4FVRA 2QO9A 4XMOA 4L42A 3DB8A 5B2LA 4XP0A 5JKGA 3QC4A 3BQCA 3SG9A 2EXMA 3D14A 4Q2AA 1PXOA 2DUVA 3LAUA 4FK3A 4HYHA 4NUSA 4NFMA 3PA4A 4ASZA 4RIXA 3AOXA 4G17A 4DF3A 5HTIA 1H1WA 2DWBA 1OITA 2WQMA 1GIIA 4O84A 5DYJA 1R0EA 2UUEA 4DT9A 3QWKA 2YM4A 4IQ6A 1R0PA 4ZZMA 3RPYA 4E6CA 5CEKA 3M2WA 2QOFA 4J8MA 2V7OA 3Q9XA 3VUIA 4UMRA 4IZ7A 2VN9A 3PJ1A 5FEQA 4QNAA 2F49A 3OY1A 4NZWB 3VQHA 5EYKA 2BILB 3FZTA 4KBKA 2WMQA 1H8FA 1U59A 3A4PA 2OLCA 3PIXA 1O6KA 2BIYA 2W0JA 1Q5KA 3II5A 2OFUA 5E4HA 3EQIA 2OJJA 5E92A 4EOLA 3TNHA 4RIWA 4BYIA 2BZIB 3R7UA 2UZLA 3MVLA 4FNYA 4FSYA 1Q99A 2RF9A 2OK1A 3DFCB 4XP3A 2BZJA 5DT3A 5B7VA 1CKPA 5AX3A 4DEAA 1RJBA 2CGWA 4K0YA 5M09A 3QXPA 1JAMA 5ETAA 2QC6A 5DBXA 1IG1A 4DCEA 4MWHA 3DJ5A 5HCYA 4BC6A 1JWHA 3N9XA 1Q8ZA 3QQUA 5H9BA 1DI8A 3KL8A 3K5VA 3PE2A 3T9TA 2XH5A 4I6FA 1XH9A 4APPA 1YOJA 1OL6A 3Q4ZA 1Z5MA 5G1XA 1SMHA 3L8SA 5HO8A 4ASEA 3ZRLA 3FMMA 2AC5A 4LFIA 4DHFA 2I1MA 3DNEA 2IJMA 5KMMA 3CP9A 3GB2A 3LXKA 1UWHA 2XS0A 3FWQA 2J4ZA 5CY3A 5EI6A 2HENA 2WD1A 3QZFA 3SX9A 5GZ8A 2JITA 5CSXA 4RX5A 2XIRA 3BV2A 3UIMA 5IG1A 3MH0A 4FJVA 5FP5A 3K3IA 1JKLA 4QOXA 3NUNA 2PE0A 3ET7A 3P7CA 4PRJA 2ITNA 2ZAZA 4O21A 2ZM3A 3ZSHA 4MAOA 3E88A 3ZBXA 3NS9A 3NYXA 4YZMA 2XIKA 3G51A 3SW4A 2ZDUA 2FO0A 5EI8A 2R3IA 4G31A 4Y85A 3UP7A 3RAWA 1OL1A 2BDWA 1ZOEA 2GPHA 3I0QA 4XYFA 5HORA 4L9IA 5G6VA 5T3QA 2E9UA 3CEKA 4LDTA 1F0QA 5LWMA 4HJOA 3E7VA 4M97A 1PYEA 3WARA 4L44A 2UZEA 4A07A 3FLWA 1GIJA 2XM9A 5EYDA 5AA8A 4J71A 4EKKA 4EOIA 4FV5A 4WBOA 3NYVA 4J95A 2QLUA 4IAZA 2QO2A 3R8PA 1YI6A 3HNGA 4ASXA 5E7RA 3IOKA 1WBOA 4KBCA 3QQGA 1OBGA 1I44A 3QD4A 1Z57A 4RX8A 3D7TB 1QMZA 4K1BA 3R22A 3QRUA 4RVLA 3MGYA 3NW5A 2W7XA 3VF9A 5LMKA 2CKEA 5CAQA 4FKRA 2I0HA 3T3UA 4HGSA 4L7SA 3F5UA 4UALA 2J0LA 1ZOHA 5LMAA 2BKZA 2PMNX 5I4NA 3ATTA 4KS7A 3G9NA 3Q4UA 3MIAA 4I6QA 4AGCA 4AXCA 2A19B 2VU3A 3DBEA 3BHUA 4L53A 3ORLA 5FXRA 4WNMA 3TM0A 4HYIA 1H26A 3MH2A 4MYGA 2VX3A 1F5QA 3DK6A 4JBVA 5JGAA 5BV3A 4YO6A 3W2QA 4TWCA 1CTPE 1FQ1B 3D7TA 4YJSA 2PE2A 5EQPA 3G5DA 2W17A 3AC3A 4JXFA 2F2UA 3B2TA 1G8JA 3NUAA 1BL6A 4NYEA 3Q2MA 4OUCA 4JAIA 2ZMDA 5GNKA 1CDKA 3SVVA 2J51A 3OCSA 3L8VA 2RFSA 5KMJA 4G1WA 2NRUA 4X2KA 3HRFA 5CSWA 4TTHB 2ACXA 3L8XA 4HCTA 5KE0A 2X0OA 3QHWA 4BWPA 5BUIA 2OXDA 4IX4A 1Q8UA 3HYHA 4QMSA 4AGUA 4YJPA 4CFUA 2YAAA 2YAKA 3ZOSA 4AA4A 5H8EA 3MH1A 4D4SA 2Z02A 4C4EA 3E5AA 2DQ7X 4GFMA 4O0SA 2A27A 2VTSA 4L3LA 4QTCA 4QYGA 3TL8A 1Y8GA 3EHAA 4G6OA 4AAAA 4ANLA 4BL1A 4BZOA 4CYJA 1Q97A 1URCA 1XKKA 3K2LA 5AP6A 3W0NA 4FTNA 4IM0A 4DCAA 4FKGA 4C34A 4K11A 4X6QC 5BMMA 1VYZA 4F4PA 4FNZA 5A4TA 4C61A 4GSBA 3U9CA 3GGFA 4FV4A 4F09A 2PUUA 3CBLA 3CIKA 3PPJA 3OY3A 5ANKA 2C1BA 3KCKA 4UMPA 1JKSA 3RK7A 1EH4A 5F95A 3UDSA 3UZRA 5EKNA 3IDBA 2XNBA 3DTWA 4XV9A 5E8WA 5I0BA 4PMSA 3BU3A 4KIOA 3DCVA 4PF4A 3P08A 2IVSA 3QKLA 4QPSA 3FZPA 4ACGA 4DN5A 1UU3A 4FSUA 3QUEA 4U8ZA 4JOAA 3VBWA 4R7BA 5DVRA 5HD4A 1T45A 3C4FA 3VHEA 3ZYAA 1YDSE 3CGFA 4N6YA 4ITJA 4O82A 3BELA 3QL8A 3DQXA 3WF7A 5KBQA 3U51A 1OMWA 2CLQA 3KVWA 4RFZA 3ZUTA 4EK8A 2NP8A 3NUUA 3K5UA 4BI0A 2ZM4A 2Y7JA 3FXWA 4QMNA 5AUUA 3G90X 5KMIA 5L2WA 1H1PA 4O96A 4FKUA 4XBUA 4YHFA 3QRKA 4FEXA 5GJFA 1YI4A 3F7WA 3MYGA 4G3GA 4NIFB 4G6NA 4TKSA 5AWMA 4BDHA 4BFMA 3RM6A 2WMVA 3FI8A 4A06A 4TN6A 4ANMA 5I3OA 4FZFB 3AG9A 4QMOA 4DEHA 4ZTSA 5KMLA 4BIBA 3UC4A 4G2FA 4ZTHA 4MBIA 4U6RA 1OI9A 2QOKA 4BTJA 3S0OA 4JRNA 4DA5A 4O2PA 4UBAA 1CSNA 5M07A 2XCHA 1IAHA 5CAPA 5JN2A 4NTSA 1E1XA 2J0KA 4CRSA 2W99B 4DG2E 1ND4A 2ITWA 2OJIA 4NFNA 2GNFA 5EDRA 4D2PA 2WO6A 4QEBA 4EHVA 4FKIA 4XV1A 3CD3A 5HO6A 2UVYA 4DGGA 2CGUA 5M08A 3O17A 4QP7A 2YM5A 4FRFA 2O65A 4L46A 3PIYA 4O0TA 5DNRA 3RHXA 5K5NA 2WMSA 4FG8A 3ZRMA 3NZ0A 3DKCA 4RC3A 2PUNA 1NW1A 4O7YA 3ORIA 4FV2A 3MJ2A 4Q9SA 3RWQA 2Z7LA 4HGEA 4BGHA 3GUBA 3ROYA 3BLHA 2JAVA 4QTEA 1ZMUA 5CQUA 2PUPA 2RFEA 2UW5A 4ZJIA 4E6QA 3P5JC 2VTNA 3V5WA 4FV8A 2BROA 4JDJA 3DK7A 3NW7A 4JJRA 3TZ9A 3R28A 2G2IA 4BKYA 2WXVA 5GJDA 4PUZA 3QZHA 1NT2A 1VR2A 3LCTA 2GFSA 2UW3A 5ANGA 5J95A 3P79A 4R7HA 3QZIA 3RM7A 3MPTA 3PXYA 4UYNA 4W4XA 3OMVA 3ROCA 3BWFA 3U6IA 2OI4X 2CKOA 2XALA 3ZFMA 2JDOA 1RE8A 4C58A 2RKUA 3IGGA 4XG7A 4FNXA 2VV9A 2GFCA 3SAYA 1W82A 2OJGA 2CKPA 4YJOA 4IC8A 3P1AA 4QQ5A 4I5CA 2GQGA 4ZSJA 1BYGA 3Q9ZA 4XCUA 2EVAA 2XIZA 3FC2A 3QKKA 4NW6A 3Q2JA 2PVMA 4CT1A 3U6JA 2JIVA 3GCQA 1H0VA 3EFKA 1ZMWA 4DGOA 2HWOA 4TYIA 5FTGA 1O6YA 2BPMA 4C3FA 3VS6A 1JSTA 4YC6A 3LKMA 3DJ6A 2BDJA 5HG5A 1CKJA 4ANNA 5CF8A 1JBPE 4GJ2A 4QO9A 4I5PA 5DI1A 4E4LA 1PKGA 3KXNA 3KMMA 5IH6A 3R6XA 4L01A 3HRBA 4O38A 3I7BA 4IB3A 5EM5A 3QF9A 5BVOA 3D0EA 4UZDA 4O7NA 2BRMA 1B39A 1DAYA 3FI2A 4A9RA 2C69A 5IA3A 5J1WA 5D12A 1S9JA 3AC8A 5DWRA 2KTYA 2AEGA 3OCGA 2HZIA 3R83A 3PWDA 2OH0E 4W4WA 4ZIMA 1O9UA 1WBTA 4I4EA 5EDPA 1YKRA 3QKMA 4D1ZA 1KUTA 4KUJA 4XEYA 2NYAA 5IEYA 4C57A 3DV3A 3H9RA 2B0QA 2IZRA 4BCHA 5DIAA 3BYOA 5BUJA 2XVDA 3M1SA 3E93A 4OT6A 4TRLA 1OM1A 1PRYA 3OF0A 3UG1A 1Q3WA 3ZFYA 2IVTA 3PA3A 5IUHA 4KD1A 1ZLTA 3ALOA 1JPAA 4O0UA 1E1VA 3DZOA 5AX9A 1W2DA 3NMUF 2XCKA 4C2VA 3HA6A 3KKVA 2CCHA 4Q5HA 1IA8A 4G16A 4OTIA 2YIQA 3OD6X 4JDIA 5IKWA 4PPAA 3SW7A 4BTKA 3VUMA 4XUFA 3FZSA 5FTOA 1XMMA 3FY2A 3CTQA 4QPAA 2XK3A 4QT1A 4IAIA 3I5ZA 3IDCA 5E8VA 3W18A 3TZMA 4PL3A 3MY1A 1HOWA 2XNMA 4G6LA 3SXSA 5DHJA 4JT3A 5FLFA 3TIYA 2WTDA 2ONLC 2CCIA 4X7QA 5DFPA 5A6NA 4B8MA 4E5WA 3ORXA 5TT7A 4OTDA 5M56A 3DT1A 2J6MA 2QG7A 4LQMA 4JL9A 3WZKA 2UZTA 3O8TA 5AV0A 2GS2A 3BX5A 4J8NA 3RK9A 4D4VA 1QPJA 3UIXA 3WBLA 1R39A 1M7NA 3KA0A 3KY2A 3NPCA 5C03A 4OAUC 1KSWA 2PZRA 2JFLA 3T8OA 2H9VA 3BGZA 3D5WA 4FTAA 4OTFA 4RRVA 4JIKA 4YURA 5EDQA 2R3HA 5EM8A 5FEDA 1ZOGA 5IEXA 5IUGA 1URWA 2JDSA 2UW9A 4FSTA 3DBQA 2VRXA 1W8CA 5HLWA 3R63A 1ZXEA 3TKUA 2GQSA 2CHLA 5J7HA 2QCSA 4DBXA 5TOZA 3SG8A 3G33A 3F66A 2C0TA 4Q9ZA 4C8BA 2B9HA 4HZSA 4TYHA 4YP8A 3I79A 3R2BA 4IW0A 5EM6A 3NIZA 4CFXA 1H28A 3VBTA 5KMKA 4LRMA 3V01A 3QXOA 4D9UA 5AV4A 3TACA 2W5HA 2FSTX 4GV1A 3LZBA 5JSMA 5JK3A 4IX6A 4GRBA 4B6LA 3EQPA 2GNHA 3OEZA 4EJNA 3CQWA 4PTEA 5CVFA 3H9FA 3VS0A 1V0PA 3JY0A 5CNOA 4RJ4A 3TNWA 1H08A 4BCJA 5I5ZA 4IMYA 3L1SA 4NKSA 4L3JA 3Q04A 5ACKA 4E6AA 3NRMA 4IEBA 4K9YA 4IWPA 3UDTA 3ZMMA 3QGYA 5C27A 4LRKA 5DRDA 4EK5A 3GT8A 4NCTA 3UGCA 3VW8A 2PK9A 2PMLX 5HQ0A 3MFUA 5L2IA 3V5TA 3BZ3A 5J1VA 4FTIA 4AXEA 1GZNA 3NUPA 4GMYA 4YLKA 3DA6A 2I40A 3QHRA 3ZEWA 4AZWA 4KB8A 4F1TA 4RVKA 4U97A 5F9EA 4R78A 2B54A 4RVTA 4BDKA 3KQ7A 4EOMA 5EG3A 2O3PA 3F5GA 1XH8A 4WUNA 4EK3A 2YZAA 5GHVA 4CZYB 3ZDIA 1M14A 2W1GA 3UO6A 1GIHA 3GP0A 3NW6A 4YBKA 3NX8A 5AP0A 4EWHA 2HZ4A 4PL5A 3UO4A 4P4CA 2OZAB 4D58A 4ZJVA 3ACKA 5HE1A 3GCSA 4C4JA 2PWLA 3QRJA 4OTHA 3ITZA 3V5PA 3QX4A 5JQ5A 3OC1A 5L3AA 3EOCA 3FLNC 4RZVA 4EYMA 2FH9A 4CRLA 3LMIA 1FPUA 3ATSA 4MXYA 3OBJA 3UIUA 1FBNA 4FSRA 4O27B 4ZSGA 1XBCA 3TUCA 3W2PA 3DAKA 3W0SA 2WMAA 3GC0A 1A06A 4GU9A 1M7QA 3A8WA 5CU4A 4JQ8A 4ASDA 4LGHA 1PMEA 4TNBA 1QPDA 5HNGA 4BCGA 3G9LX 5HIEA 3BI6A 4ANQA 5L2TA 2W9ZB 2V5QA 2JBPA 2WMWA 4IX3A 1M2PA 2X2MA 4XLIA 3VVHA 1U4DA 3HV4A 4F9AA 4O7LA 2IW6A 2C6KA 1S9IA 3O8UA 4OBPA 2OZAA 2HXQA 3PIZA 1IR3A 4YJNA 4WHZA 1VEBA 5L6OA 4GT5A 3NGAA 4GL9A 2PVHA 3W0QA 3I4BA 1SNUA 4UV0A 2C3KA 2CGVA 3GQIA 4CFMA 4N57A 3F3ZA 2WTWA 4R3RA 3OT8A 4KKHA 4FGRA 4F08A 2RG6A 4CLIA 5IZFA 1UKHA 3HV7A 4DFBA 1UNGA 1W2CA 2JD5A 1YHSA 3O7LB 4U40A 3C4WA 5E8TA 4YBJA 3L9MA 1V1KA 3PXFA 5AP1A 3F2RA 4LMUA 5IQFA 3R02A 4IM2A 4PNKA 3GBZA 4GFOA 5HBHA 5HZNA 3KRJA 3PXQA 4I6LA 5HOAA 2OWBA 4FL2A 4H3PA 4USEA 3DAEA 1DM2A 2JDVA 2X8DA 2VWYA 4FKQA 2W4JA 5D9HA 4NM0A 5DA3A 4MNEB 5HVYA 3RJCA 2QI8A 3BL7A 2BFXA 2ETKA 2UZNA 2JGZA 5JT2A 3Q9WA 1YW2A 2QHMA 3QZGA 3E92A 1LR4A 3FZ1A 4JQ7A 2B9FA 2UZWE 1RW8A 1OIQA 2WTVA 3FSKA 3QRTA 4X3FC 3TMOA 3PPZA 4IADA 5TKDA 4D9TA 4ZMFA 2H34A 1VJYA 1G8AA 3FKOA 4JRVA 2YITA 5AMNA 3OBGA 3FEGA 3CQEA 4I20A 4IWQA 4ZTLA 4DDIA 1AGWA 5B2KA 3FPMA 2W1ZA 2VTOA 4G3FA 4C35A 3I7CA 4ZMEA 3FSFA 3QGWA 1FOTA 3EZVA 3NAYA 4KIKB 4RWLA 3R1YA 4QMXA 1YXVA 5CT0A 2WQBA 3ZS5A 3OUKA 4MNEA 3BYSA 4EONA 5CI7A 4AZEA 4FKTA 3OTUA 4UX9A 5L2QA 3EB0A 2VWBA 2V55A 3JXWA 3QRIA 3UBDA 4QRCA 4F6SA 3BGPA 5A46A 5JEBA 3F3TA 4JG7A 2BRBA 2JDRA 5KNJA 4IJ9A 3R9NA 4HVDA 2XKDA 2PZIA 3I81A 4YNEA 4CYIA 3IECA 3QTZA 3I60A 1Q3DA 5AP7A 1W83A 4GVJA 4CFFA 3OP5A 2A0CX 4CQEA 2UW8A 5BVWA 1KOBA 4FIIA 4XOYA 5CU2A 3UVPA 3ZXZA 2O63A 1W2FA 2CN8A 2VNWA 3UOJA 3HP5A 2BZHB 4TWOA 5HICA 3UG2A 1O6LA 2OZOA 2R3QA 4KIKA 3OCTA 1YHWA 3A7GA 4H36A 4ANBA 4XBRA 1PW2A 4Y72A 2E9OA 4MCVA 4LOQA 2VX1A 4RJ5A 4FV6A 3EQCA 5ETIA 4I4FA 3RAIA 4NM3A 3V8WA 3A4OX 3KXHA 4GJ3A 4UY9A 4O6EA 4DFLA 4ZZOA 4OTPA 3LW0A 3G6GA 3FMHA 3HGKA 3KRLA 3LE6A 4QMYA 4BZDA 4D2TA 5CASA 5CEIA 3TI1A 2QOLA 3ORTA 4TYGA 3BQRA 4C0TA 2GNIA 1V0OA 3CCNA 3FXZA 4A4LA 4YJVA 4FGBA 2EB2A 3ENHA 4L8MA 4O4EA 4AOJA 2RFNA 4F9YA 4O81A 4W8DA 2BHEA 1GJOA 2G15A 5BVFA 3PZEA 2O2UA 4Y5HA 5CXZA 3KMWA 4FV9A 4FV1A 4I94A 3EN9A 4W4VA 2G2HA 4GG7A 4FKLA 4XP2A 3FMNA 1Z9XA 1E9HA 2YWVA 2XIYA 2OFVA 4F0FA 5M53A 2ETMA 4AGWA 3QLFA 5J9LA 5LVPA 4GT4A 4YZBA 5F4NA 3HMMA 4ZY6A 5LOHA 1XH5A 3H30A 1W84A 5AIKA 4EOQA 1CM8A 3UIBA 4D2SA 4DG0E 4AFEA 3AGMA 4BKJA 4C02A 5BYYA 4AT5A 1H25A 1KE9A 3I0OA 4KA3A 4QP3A 1KE7A 2G1TA 4MH7A 4FVPA 5AJQA 5EW3A 3QTRA 3EQGA 4C7TA 3ZXTA 3O50A 2X0PA 2CKQA 1GZ8A 5AUWA 2YLFA 4A4XA 3IS5A 4EH9A 3H9OA 3QLGA 3MTFA 2AUHA 4YLLA 5K9IA 3SGCA 3UMWA 3UYTA 3FYKX 5EYCA 4YUQA 4IAKA 5IPJA 4I1ZA 4DH8A 5HIBA 3KMUA 3MB6A 2C3IB 3JUHA 4Z3VA 4F7LA 4RJ3A 2QVSE 2ERZE 5C9CA 4EH6A 3BRBA 4I5MA 2PU8A 2WGJA 3VNTA 4AXAA 4ANSA 4J53A 1WBSA 2PVJA 2EU9A 3VBVA 3MVJA 3UPXA 4I5HA 4M12A 5CZIA 2J2IB 3ZO3A 4A7CA 3ALNA 3GCPA 3IKAA 2Y0AA 3ZC5A 5CZHA 1YHVA 3PG1A 3GI3A 2ERKA 3HZTA 3QAME 4QNYA 4YJUA 2VTHA 4GG5A 3VO3A 3R7VA 3VBXA 4DEIA 5IU2A 5CTPA 5E8SA 2J0JA 3BU6A 5AUZA 2WB8A 3WE4A 3I6WA 1YOLA 4A4OA 5JFVA 1P2AA 4XJ0A 3LFFA 3F3UA 1KV2A 4JX3A 5J7BA 2VO3A 3UNKA 1OVEA 2ITOA 2F7ZE 3WYXA 1PY5A 2XAMA 1J7LA 3KF4A 3BYMA 4FVQA 4RC2A 4PMTA 5EHYA 3PY3A 4KRDA 2IPXA 3HA8A 4G3EA 3KC3A 4GFGA 1BL7A 2BCJA 3A7IA 3HMIA 2UW7A 4XH6A 5ETFA 4AN3A 4S33A 5IMXA 5E8UA 5L6WL 2IW9A 3AT4A 2VTPA 4KIPA 1UU9A 4IC7A 4OR5A 5AA9A 4DHJA 4C4IA 1YXUA 4V01A 3EWHA 2JKOA 4PL4A 3UYSA 4FF8A 4D1XA 1KOAA 3QQFA 4ALWA 5LARA 3OW4A 3UVQA 5CSVA 4F7SA 2W4OA 5B0XA 3VUDA 5KBRA 3FMEA 3EL7A 3TV6A 4HCVA 3PY0A 4E7WA 4AAYA 3ZLSA 4CG8A 2WQEA 4L7FA 4MNFA 3QCXA 3AT3A 4NJ3A 2UZOA 1G8SA 5FDXA 2X4FA 4FT7A 2ZM1A 5HVJA 4U0IA 4O4DA 3H10A 3LJ1A 5CQWA 2QOIA 1G5SA 3HV3A 4CFWA 5IF1A 2XANA 4J96A 3KULB 5D11A 5K0KA 5HE3A 3SD0A 3AC1A 3UJGA 2I0VA 3CR0A 2G9XA 2V7AA 5LVNA 1QL6A 5FEEA 3WZDA 3ZSGA 1F3MC 2WMUA 3SHEA 4P7EA 4U80A 3E8CA 4MEDA 4FG9A 5L4QA 2YFXA 4CSVA 3H4JA 4DINA 4USDA 5T68A 3V3VA 4ZLYA 4FIHA 2C6IA 1UV5A 2E9VA 3LFEA 3WE8A 2VO6A 2WTIA 5KO1A 3AC2A 3N51A 4BY9E 3EN4A 3A99A 1YWVA 3ZDUA 3LJ0A 3DKFA 4FSZA 5ANOA 3A2CA 4QDVA 3SA0A 4M66A 4O1PA 4XG6A 1NA7A 3KULA 4C37A 5KKRC 4RLKA 4GK2A 1JLUE 2R0IA 3BYVA 1TQMA 2OF2A 4CEGA 4EK6A 2WMXA 4MXCA 4FL1A 5CAOA 5GJGA 1L8TA 2PZ5A 2PE1A 5D41A 4TT7A 5HVKA 3T3VA 3IGOA 5JZNA 5H8GA 5B2MA 4FTQA 4E3CA 3QTSA 5JFXA 2Z7RA 2YIYA 5HTCA 1X8BA 4R3CA 1NVSA 4FT0A 2C0OA 3KN6A 2IO6A 3GENA 5A14A 5BMSA 3HAMA 1QPEA 4RX9A 2NPQA 2YJSA 5AAGA 4RVMA 1OKWA 3QUDA 3V5QA 4YZDA 4IVBA 2PL0A 5CNNA 2X7OA 3W32A 2YIRA 3MH3A 2OU7A 5CU6A 2DS1A 5E8XA 3UQGA 3B8QA 3FMKA 5AIRA 3AXWA 2VWZA 4MQ1A 4U3ZA 4BDCA 2CNVA 5EYMA 4DFNA 4HVSA 2ITVA 3RNIA 4CKJA 1WVYA 2QNJA 5AFVA 1W0XC 2E9PA 4DE4A 3R9HA 4HW7A 5A54A 1AD5A 2RSVA 5CWZA 1XWSA 3ZBFA 4F0IA 4FC0A 3Q4TA 4DITA 4KWPA 5EKOA 3VHKA 4GH2A 2PVFA 3MB7A 2QKWB 4GUEA 5HG9A 1M52A 3RPVA 5CAVA 4EI4A 2XNGA 4K18A 3TV7A 3NVMB 4BBEA 4EHZA 2BTRA 2YJRA 3ZLWA 3KK8A 5LXMA 3DXQA 5K0XA 3QQLA 4AZTA 3D5UA 4MXXA 3MPAA 4J1RA 5E90A 2IF8A 2B55A 1IASA 4L6QA 5HEZA 2WIPA 3LCOA 2YM7A 5FTQA 3R7IA 2ONLA 4I22A 1XHAA 3H0YA 3PE1A 4Z16A 3W0OA 3NEWA 2XF0A 2EXCX 2YDJA 4K2RA