4GFMA

Jak2 kinase (jh1 domain) with 2,6-dichloro-n-(2-oxo-2,5-dihydropyridin-4-yl)benzamide
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
291
structure length
289
Chain Sequence
DPTQFEERHLKFLQQLGKGNFGSVEMCRYDPLQDNTGEVVAVKKLQHSTEEHLRDFEREIEILKSLQHDNIVKYKGVCYSAGRRNLKLIMEYLPYGSLRDYLQKHKERIDHIKLLQYTSQICKGMEYLGTKRYIHRDLATRNILVENENRVKIGDFGLTKVLPQDKEKVKEPGESPIFWYAPESLTESKFSVASDVWSFGVVLYELFTYIEKSKSPPAEFMRMIGNDKQGQMIVFHLIELLKNNGRLPRPDGCPDEIYMIMTECWNNNVNQRPSFRDLALRVDQIRDNM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase/transferase inhibitor
molecule keywords Tyrosine-protein kinase JAK2
publication title Lead identification of novel and selective TYK2 inhibitors.
pubmed doi rcsb
source organism Homo sapiens
total genus 97
structure length 289
sequence length 291
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2012-08-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4gfmA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4gfmA01
5D10A 2J4ZA 3D7TB 5IH6A 2WTDA 5FDXA 2C0TA 4DFZE 4WRSA 2PSQA 3DOGA 3PIXA 3R2YA 4FKOA 4FTRA 5GJDA 3UOKA 4BCKA 5A3XA 3Q4TA 4O0XA 4I6BA 2UVYA 1UA2A 2C5XA 1JSVA 4E93A 2PZPA 4IXPA 4M69A 1PYEA 4J52A 4TT7A 2O64A 1QMZA 2PZ5A 4GV1A 1R1WA 4FGBA 4QMUA 3VW8A 4CNHA 4FSWA 3DXQA 1Y6BA 4FF8A 3DJ7A 5H8GA 4FZ7A 3WBLA 4AGCA 3NIZA 4BI2A 2GHGA 3ALNA 4XOZA 3V5PA 4CFVA 3QGWA 1W84A 1PMEA 4KAOA 3ZBFA 4XG9A 3QD2B 2VGPA 1MRYA 3DS6A 4YLLA 4AN9A 4IM0A 4IADA 5EDPA 3GFWA 2V5QA 3PA5A 3NYOA 3THBA 2P3GX 3QHWA 2LGCA 3SDJA 4HVDA 5IQFA 2XEYA 4B6LA 1RW8A 3MFUA 5EH0A 4I0RA 3QYWA 3SRVB 3KN6A 5DPVA 3LJ2A 5BVFA 2CNQA 3NW5A 4IHPA 4FSMA 4M13A 5IEXA 3T3UA 2GNJA 3AC5A 3EYGA 3O23A 4RLKA 3UG2A 5DE2A 1H25A 4CKIA 1JVPP 3ZO2A 4KBCA 5FGKA 3NAYA 3UP2A 4XLVA 4MBLA 2OWBA 4YJOA 5HO6A 3R8LA 4YURA 1B39A 4K77A 3SW4A 3QD0A 4TYJA 4FEWA 4XV9A 4DGNA 3LFSA 4BDEA 4I4EA 2UW9A 2HWOA 1KE5A 3U51A 2IZSA 4JG6A 5J1VA 2OJJA 3EQDA 3R83A 4D2WA 3R01A 3KMMA 3VBYA 2GQSA 2DWBA 1YI3A 4U8ZA 4AW5A 5L6OA 5B2LA 4OAUC 2Y7JA 4IZ5A 3ERKA 2G15A 4KNBA 5CSVA 4CLJA 2WO6A 3JVSA 1OITA 2OZAA 2PE0A 3QRKA 2WOUA 3VVHA 4OTFA 3EN7A 2OIDA 2C6KA 3BWJA 3CS9A 3TG1A 1JBPE 4M0YA 4PNIA 4FSQA 4DFBA 4FIFA 2IVTA 1Q3WA 4FSYA 2BHEA 5E92A 4V0GA 3BLHA 2OJ9A 3QTUA 3UZPA 4F7JA 4F1TA 2O3PA 1NVRA 1XHAA 3AD6A 5E90A 5F94A 4FNWA 5CWZA 3S95A 3ZZEA 4CZTA 3FI3A 2C3KA 4KA3A 3EOCA 2E2BA 4S32A 3KRWA 3IW7A 2W1HA 4R1VA 4CTBA 2VO7A 3A4OX 2Y0AA 3MBLA 3MY5A 1FBNA 3RNIA 2Y6OA 3AMYA 4G9RA 5F1ZA 4MXXA 5C9CA 5M4IA 3TEIA 1YOMA 3VUIA 3R9HA 2PUIA 2WMSA 1NY3A 3CJFA 3UJGA 5AV1A 2GSFA 5AUYA 3VS5A 5HVKA 4O82A 1Q41A 1CTPE 4U7ZA 2XIKA 5CXHA 3F82A 4BDDA 5LMAA 1Q8WA 2HY81 5JRSA 3QTQA 5L2WA 3V5LA 4FEUA 3SG8A 3IOPA 4RIYB 4XS2A 3QC9A 3F69A 4RT7A 3R00A 4TYHB 3QZGA 5E8TA 4L6QA 4CEGA 3R6XA 2WPAA 1QPCA 2VTSA 2UVXA 2O2UA 3QKMA 3I1AA 1PW2A 2A4LA 5FWKK 2BDJA 3AC8A 4QTAA 5JRQA 4WRGA 4LOPA 4XP3A 3EQRA 4KIQA 4XBUA 3WE8A 4JS8A 4YC8A 4CYJA 3BLQA 4L7FA 5AV2A 3P7AA 4LMUA 3WIKA 4N0SA 1OL2A 4MQ2A 4U40A 5DYJA 4XLIA 4O91A 1STCE 4D1XA 3DY7A 4H3PA 3PLSA 5C01A 3REPA 2C3IB 5HE3A 3P1AA 4TWNA 4WG3A 4RGJA 2UVZA 5DIAA 3V5WA 3DNDA 2FVDA 4L7SA 1PMNA 3UODA 3JPVA 4QMTA 3QXOA 2WQBA 4ZSAA 4AQCA 1KOBA 3QTXA 5FUTA 3NCGA 4KSPA 3ORTA 4RA5A 5HQ0A 5E8XA 3FMMA 3FY2A 4IWPA 4MD7E 4BTKA 4L3PA 3QTSA 2WMTA 3DNEA 2QURA 1BL7A 4QOXA 4B4LA 4EK4A 1ZY4A 2OFVA 4KKEA 4EK3A 3LCKA 3Q5IA 3O7LB 5I3RA 4FX3A 3U6JA 2YLFA 4BWKA 4A9YA 5K4JA 4BI0A 3RWPA 2R3LA 4NK9A 3UYSA 3ZC5A 4UWBA 4ZTHA 3MH1A 3BHYA 3ENHA 2JIIA 3F2AA 2EXEA 5CS6A 3LCDA 1NVSA 2ITVA 2J0JA 3L9LA 3FAAA 1J91A 4K0YA 1OIYA 3HP5A 3IDBA 3FPQA 5BVNA 4L44A 3EQPA 4D9TA 5L2IA 1EH4A 2BROA 3VQUA 4ANOA 1PRYA 3LMGA 1TQMA 4BFMA 1YI4A 3N9XA 3V6RA 3GU6A 5F95A 4J8MA 4EC9A 4ENYA 4HNFA 5A9UA 1K9AA 3UMXA 4C3PA 3UGCA 1PXKA 3ANRA 2HXQA 4FIHA 2GCDA 3GC0A 3MIYA 2VWYA 4O0UA 4X2KA 4YC6A 4BY9E 4HZRA 2OJIA 3FKNA 5HOAA 5EM5A 3UVQA 4FTAA 3HV4A 2ZB0A 4RRVA 4ZLOA 3GFEA 3D9VA 3HUBA 4J96A 5KHWA 5FM3A 4XG3A 5IQHA 2Y4IC 4L42A 1BI7A 3VUDA 2PPQA 1R3CA 3IK3A 4TWCA 4YJRA 4EH9A 1O6KA 2YCRA 3EQIA 4W8DA 3R8UA 4FKIA 1FOTA 2GNFA 2YN8A 3MVLA 3P86A 3PFQA 3Q6UA 3Q4UA 2QODA 4H36A 1ZYLA 4JRVA 5IUIA 3VJOA 5KO1A 4DEGA 5KNJA 4YPSA 3FYKX 4K9YA 4X3FC 5HIBA 3U4WA 2BUJA 5DRDA 4WOVA 4C58A 4FA2A 5GJGA 1YI6A 2UW0A 4FKSA 4IAZA 4C37A 3GOKA 3D14A 3CEKA 5B7VA 2XUUA 1ATPE 2G2IA 2J0KA 4FV2A 1WBSA 1KE6A 1UWJA 2QKWB 4IMYA 4O0WA 3V8SA 4GW8A 3MFTA 1M17A 4IBMA 2B52A 2XEZA 4BICA 4DGGA 1T45A 2G01A 4M0ZA 4IDTA 3GGFA 1IA8A 2JKMA 5K0XA 2R0IA 2XNOA 3ORLA 4S34A 2B54A 4EH6A 2G9XA 4Q5EA 5I9XA 3F3UA 3KXMA 1PHKA 2VWVA 2XNPA 5FEDA 1GAGA 2V55A 3VHEA 3W2RA 4E26A 1R0EA 5CAPA 4D2VA 3WF7A 5CEOA 4CKRA 1UVRA 4AGDA 4D5KA 4AF3A 5C8KA 2Z60A 4AZVA 4DGLC 5LMKC 4QMMA 3HKOA 4C4FA 4DGMA 4EHEA 2YABA 1Z57A 2GFCA 3C4ZA 3MA6A 4U9AA 4U44A 3ZMMA 2UZWE 3IG7A 3PXYA 3GXLA 1VZOA 1Q24A 2QOOA 4PPAA 3MPTA 2C6OA 4BCNA 2Z2WA 3P23A 3KCKA 4J71A 4JBQA 2QLUA 2HY0A 5HCZA 4K1BA 3LFQA 3FLQA 4WT6A 2C68A 2PVMA 2ESMA 3DQXA 2X9FA 4IH8A 3VBQA 3RTPA 4XX9A 4B8MA 4GRBA 4YTFA 3GC9A 4D28A 2BAJA 2WKMA 2IW9A 4ZZOA 5GZ8A 5HG5A 1H01A 4BN1A 3ULZA 2EU9A 5AAEA 5CAOA 3WZKA 2R7IA 4O0VA 3RK9A 1M2QA 4HVIA 1Q3DA 3EKNA 4C2VA 4I1ZA 3COKA 4R7BA 2WMRA 3AT2A 3UOLA 2OICA 5DT4A 4LM5A 1UKIA 2R3OA 3Q9YA 4FSZA 4FT9A 3DXPA 4U97A 4QQ5A 4FKQA 2W05A 4J98A 3RCDA 5HCYA 4AS0A 3UVPA 2XRWA 4QP2A 2UW3A 4S2ZA 5AJQA 5LARA 4CFUA 4BCOA 1G5SA 3R0TA 4D5HA 2OZOA 2BAQA 3NNXA 3NNVA 3MW1A 5FBNC 4DBNA 2HZNA 4EQMA 3PE2A 1OZ1A 4O83A 2UZVA 2XJ1A 3TUBA 2QOBA 2QNJA 4M97A 1Q4LA 3PXRA 5AP2A 4DT8A 1WFCA 3LLTA 4FSRA 1QCFA 5EI8A 3RM6A 4QMNA 4YO4A 3I6UA 2YM7A 2WEVA 4ZK5A 1ZMWA 5A4CA 2RIOA 4NEUA 2PMIA 4RIWA 5I0BA 2F49A 3OEZA 4XRLA 2BMCA 3ORMA 4J99A 2Y6MA 3CJGA 4L52A 3RPSA 3TCPA 3UMWA 4B99A 4BL1A 5DVRA 1Q62A 4I94A 1H1SA 1H4LA 3ULIA 4Y46A 2WTKB 4RLLA 3C7QA 2PZYA 2XNGA 3EFJA 3KVWA 3L1SA 4O86A 3CQEA 5JK3A 5DOSA 1VYZA 2XJ0A 2PVHA 4I0SA 1J7IA 4E7WA 1P4OA 4G3CA 4ZS0A 3PZHA 3VULA 3HL7A 5DG5A 2OI4X 3BZ3A 5HO8A 4M67A 2Z7QA 3TIYA 3OMVA 4DG0E 3QTWA 4GS6A 1NT2A 4HOKA 4IFGA 3CQUA 3VBVA 3K54A 2CKOA 4TN6A 2WGJA 4AA0A 1L8TA 3PIYA 5AM7A 1JKLA 5I9WA 2WMQA 4IAKA 3VUGA 2OLCA 3P7BA 3NPCA 4X3FA 3QBNA 3HGKA 4O7TA 2O8YA 2FGIA 5HTCA 3TJDA 4DEIA 4EC8A 4NIFA 4J7BA 2Y4PA 3F5PA 3L8XA 4AFJA 4BDHA 4ANQA 1H24A 2NPQA 4JXFA 2PULA 1AD5A 3F3TA 3GCQA 4M3QA 2BTSA 3F66A 3QRTA 4O2ZA 5ACKA 3HV5A 4A4LA 5L4QA 3MS9A 1M52A 2C3JA 4FICA 2XVDA 3LFCA 3CC6A 4JR7A 3UBDA 1O6LA 4WIHA 4ZTSA 3VS2A 2QONA 3SKCA 4NKAA 2QU5A 4M69B 3FL5A 2ZMDA 3IS5A 2VTMA 4FKGA 2WTWA 1XBCA 3LXLA 4R78A 3GU4A 2YHVA 4ZP5A 5IZFA 4W4XA 4L45A 2JDTA 2ZAZA 3ZS5A 3EZRA 5I3OA 4IM3A 3HDMA 4NUSA 5HI2A 3W2PA 2CNVA 4GFMA 4XCUA 4CQEA 4M14A 5HD7A 3EFLA 2W1EA 3TDWA 3UTOA 2ZV9A 2BDWA 3HUCA 4WO5A 4IVDA 4TXCA 3TNHA 4QMQA 3QQHA 4PTEA 4IAIA 4YNEA 3RM7A 4DEBA 1FGKA 3GUBA 4K33A 3R1YA 3R1SA 1ZOHA 3LXPA 5A54A 5BVDA 3LFDA 5DFPA 2C5OA 2J5EA 4PP9A 4R3PA 2H96A 4KS7A 4IANA 4ASEA 1Q8YA 4D0XA 4J8NA 4AZTA 5LQFA 4GU6A 3ZUVA 3LQ3A 1Q61A 4W9WA 5BNJA 5M07A 3BYSA 3QX4A 2H8HA 3G6GA 4FTIA 3KL8A 2WQOA 4FTKA 1OL1A 2X7OA 3FL4A 1MUOA 3NAXA 3LFEA 3V5JA 3P9JA 3PJ8A 4EQUA 4IAYA 5D1JA 4RFMA 3E88A 3TNQB 2ITNA 2W1IA 1H0VA 4ASZA 3C1XA 4CG9A 4EZ7A 4AOIA 3F7ZA 3HRFA 1MQBA 3E3PA 4NU1A 3NUNA 4ALWA 3H9RA 4AN3A 2XBJA 3OW3A 3UNKA 2CMWA 3ORIA 4CG8A 3R1QA 4V05A 3OCTA 5AA9A 3R21A 5AUXA 1M2RA 3EYHA 4O81A 1KV2A 5AIKA 1YOLA 4FV8A 5GIPE 4G9CA 4FKTA 4AXAA 3SG9A 4ANBA 1YWVA 4YJUA 2OH4A 4S30A 4UB7A 4OW8A 4E6DA 1H07A 4ANSA 1H1WA 5DLSA 3OY1A 3RK5A 4RG0A 3DU8A 3OWLA 3CTHA 4DH5A 3S00A 2W1GA 2ACXA 4O2PA 2JAMA 5M06A 4Z7HA 5HTBA 4EKLA 4CV9A 4V0GB 3FQEA 2JITA 3OHTA 3BYMA 3I81A 4MVFA 1ZLTA 4QRCA 2C6LA 3TT0A 2Q83A 2VWUA 1RE8A 4PTCA 4RA4A 4AGWA 4NT4A 4RJ6A 5AR4A 2QOKA 3AT4A 4YO6A 1V0BA 4XYFA 4ITIA 4MD9E 3KCFA 3R02A 4R3CA 5DT0A 5I4NA 3KRXA 4K18A 3PSCA 3LCSA 2YLEA 4IACA 4HYUA 1O6YA 3MY0A 4Q2AA 4GKIA 4IWOA 5IQEA 4QQJA 1E9HA 4A4OA 3JY0A 4M7IA 3PJ3A 2JKOA 4Y5HA 4DBXA 3OROA 2FSTX 2WFYA 4G3GA 5AX9A 4ZS4A 3S3IA 2XK9A 4O7RA 5CEIA 4ARKA 3GI3A 2GHMA 3MYGA 4USFA 4FKRA 1ZOGA 2X2LA 2WNTA 5E91A 5AV4A 4UV0A 3GQLA 5AWMA 3FLYA 5CI7A 4QP4A 2ITQA 3CQWA 4GT5A 1ZZ2A 3TN8A 3F7WA 3HMIA 1UV5A 3D15A 5A46A 2VGOA 4FEVA 5L2SA 4ZEGA 4WG5A 2GQGA 4CRLA 3KK9A 5D41A 1OKZA 4LUEA 5KKRB 2EXCX 3M1SA 4KABA 4JDIA 5HG9A 3CPBA 3DTWA 1J7LA 2OBJA 4MNFA 5EW8A 1OPLA 1M14A 2W7XA 5CT0A 4CFMA 4EBVA 5IMEA 3FZSA 2QOQA 2JIVA 2YIQA 2J0LA 5E8UA 4KBKA 3KEXA 5J87A 2WMVA 3VO3A 3VUTA 4BGGA 4BVUA 3WF9A 2YM4A 4EKKA 5IG1A 3LXKA 1OECA 3HMPA 3Q4CA 1YWRA 4E3CA 2X1NA 2AUHA 2Z02A 2AC3A 1U5RA 2GS2A 3UIBA 4U0IA 2YERA 4FG7A 2I6LA 1GZOA 1ZYDA 3DKGA 3F88A 4XRJA 5E1SA 4NM7A 3V3VA 4EH8A 3OT3A 2IW6A 1J7UA 1OIQA 3AQVA 5M4UA 2V7AA 3FMLA 2V7OA 4O7YA 4C33A 2ZM4A 3KXXA 4ZLYA 4D4VA 4I21A 1R0PA 1GZ8A 2VRXA 2C47A 1L3RE 4IIRA 4BWXA 2CKPA 4AW1A 5HESA 2PMLX 1IAHA 4RIXB 4MK0A 4O0YA 4CFWA 2XK4A 3QZIA 5K5NA 4UMRA 3OCSA 5L6PA 3ZLYA 4E5AX 5AR2A 4RC2A 2YCFA 5D7VA 4FTOA 4MXZA 4GH2A 5CLPA 4KIOA 2B4SB 4RFZA 3POOA 4L00A 3MDYA 4D2TA 2EVAA 3TUDA 2J9MA 3NYVA 3CKWA 4AOTA 3DBQA 4U6RA 1PYXA 3CR0A 3KRLA 4ZZMA 3H4JA 4BTJA 4ZTQA 4X0MA 5BX0A 3RMFA 4A7CA 3FI4A 3MI9A 5J9LA 1APME 3R7UA 4K11A 5ANOA 4MX9A 4O22A 4MXCA 3QYZA 3D0EA 5CF6A 5CSWA 2GMXA 3CXWA 3IKAA 3HV3A 4QP3A 1XH4A 4OTPA 4HCTA 2VTPA 4JX3A 4UZHA 3D83A 5LJJA 4WSYA 1WBTA 2IVUA 2ETRA 4E20A 4C3FA 3FLNC 2X7FA 3ORNA 3W8LA 4R6VA 3W2QA 4D0WA 4PDSA 3ZZWA 1DI8A 5EHLA 5JGDA 3FZOA 4IB0A 3PY1A 4EOIA 5IA0A 1B6CB 3V04A 4J53A 3OTVA 3WE4A 5L2QA 5AEPA 1VJYA 3B8QA 3GCPA 4EJNA 4A07A 3PVBA 4IC8A 4L8MA 3NVMB 4W4WA 4E4XA 1FMOE 3VHKA 4F9CA 1PMUA 3HV6A 4IJPA 3NEWA 2CGVA 3CCNA 3EN5A 3CBLA 4E6QA 2W0JA 4O6LA 1XWSA 1PXMA 3MTFA 4TRLA 4E5WA 3KF4A 4RVLA 4OGRA 5HCXA 4GK3A 4LV8A 3EL8A 4IAAA 5F4NA 3QQFA 4ZAUA 2VTTA 4IDVA 5H8BA 4BGHA 5C8NA 5E7RA 3CKXA 4HCVA 3WF6A 3PUPA 3D2KA 3UQGA 3E92A 4C3RA 2GTMA 3IGOA 4IEBA 3S4QA 5AP1A 5ETCA 2PYWA 1SVEA 2A2AA 5IQDA 5GIOE 5IQCA 3C4EA 3MWUA 4BBMA 4MYGA 2QOFA 3OWKA 3TV7A 3O8PA 3TNIA 4HNIA 3RPOA 1FPUA 4IVCA 1PF8A 3DCVA 4RJ8A 2BTRA 1FVTA 4IB3A 3VS3A 2XKEA 2JGZA 3OBJA 3U6IA 3H9FA 3L8PA 4P90A 1FGIA 3BEAA 4OBOA 5HNBA 5FXRA 1NA7A 2CLXA 3V5TA 5AR7A 4X21A 1MP8A 3FSFA 2OXXA 2BAKA 3QWJA 3R9NA 5KCVA 4G31A 1GY3A 2B9FA 4ASXA 3FBVA 4MHAA 2HIWA 2X0GA 4UX9A 4FIJA 1F0QA 3RKBA 4USDA 4HGTA 5HU9A 1ERKA 4FL1A 5HO7A 3R7YA 3QTRA 4R5SA 4NFMA 5T68A 5A6OA 4FKVA 3ZOSA 5E8SA 3GENA 5CU6A 2XM8A 5J9ZA 2FH9A 3ZH8A 1REKA 1IR3A 4MWHA 4CMOA 3LJ1A 3KF7A 2IWIA 4M66A 4K8AA 2QR8A 3VWAA 4O1PA 4QT1A 2BIYA 4JQ7A 4WD5A 5ANJA 4FIIA 4LRJA 4R7IA 3DDQA 4F63A 5HORA 3LW0A 4GUBA 5CEKA 5CXZA 3ORZA 1E1XA 3Q2MA 4CCUA 4ZTNA 3QU0A 2KULA 2VTHA 4QP6A 4YJVA 4XBRA 3TI1A 4H1JA 3ZO3A 4D4YA 5CENA 4OTIA 5KMNA 1AQ1A 5BUJA 3HAMA 3EKKA 4QMVA 3FXWA 4YC3A 3OT8A 5HVYA 4UXQA 4ALUA 3PRFA 4GK4A 3WF5A 2R9SA 4U43A 2W4OA 4G6NA 2FSMX 2X8DA 3MB7A 3OW4A 4JBOA 1VYWA 4YLKA 3GVUA 2PVNA 4F08A 5HZNA 3F2RA 4FL2A 3E8NA 4JI9A 2B7AA 2QOCA 3PYYA 3SGCA 3UNJA 5FTOA 1XH9A 5HX8A 3P78A 3PE1A 3FMEA 4RPVA 3ROCA 4UYNA 4TNDA 5IA5A 4BCPA 4EOQA 4TKSA 4DA5A 3VF9A 1Q5KA 4CZYB 4USEA 4FMQA 4YJTA 1REJA 2DS1A 2GDOA 4N6YA 5CZIA 3P5KA 2R7BA 2ZV8A 3QUPA 4KIKA 3WZEA 3VW6A 4U41A 5J7HA 3WI6A 3CD8A 4BBFA 4O27B 2Y8OA 3KA0A 2C6IA 3I0QA 4RIWB 5H2UA 3W18A 4IC7A 2O0UA 3RWQA 1KOAA 3I5ZA 4ONAA 2QI8A 2GHLA 3PSBA 2WQNA 1F3MC 1KSWA 1WBOA 2YM6A 4FODA 3UIXA 4N57A 5F20A 4C62A 3Q4ZA 3PXFA 4W4VA 4F64A 2Z7RA 4GYGA 5M44A 2OIBA 3U54A 4CFXA 2JEDA 1FINA 4FTTA 4XOYA 3TUCA 5KMJA 2WU6A 3ACKA 4O7LA 4GL9A 4Q5HA 3G0EA 3CSVA 5FBOA 2W96B 2CGXA 3Q6WA 3UE4A 4GG5A 3W1FA 2IPXA 4FT7A 4BWPA 4QTEA 2QQ7A 2WTVA 1CM8A 3W32A 5I9YA 2R3GA 5CU3A 3RPYA 3LLAA 5HBEA 2G1TA 4FTQA 5AAGA 4YGAA 5CU0A 3OVVA 2FUMA 3K3JA 2ITTA 2ZOQA 2UZTA 1I44A 3FHRA 3VRYA 2YIRA 4FKWA 4UWYA 2BCJA 2FSOX 2OK1A 5AADA 3B8RA 3PPZA 2F7EE 4RVMA 5C4KA 2WTCA 3TM0A 4I24A 1U4DA 2X6EA 4K6ZA 1GNGA 4X3FB 3R7EA 2WMUA 4BDFA 3OTUA 1YHSA 3Q2JA 2WZJA 2JKKA 3V6SA 4J1RA 4X2JA 4FE2A 4NIFB 2PTKA 5TT7A 5EYCA 3BELA 3SLSA 3UO5A 2P2IA 4CTCA 4P4CA 4DLJA 4YU2A 2A19B 5IA4A 3E8EA 2W5AA 3TXOA 3DB6A 1SZMA 4F1MA 2RKUA 4MAOA 2HXLA 1K2PA 3ZO1A 1FVVA 4IZAA 1YXUA 1JPAA 3OF0A 5AP7A 4FZFB 5M51A 3NUPA 3QXPA 4I6QA 5F9EA 1FVRA 5I9ZA 2XIRA 5IA3A 3NVKI 3QRJA 3TZ7A 4IX6A 3EQCA 1SMHA 1Z5MA 2JIUA 2YJRA 4FT3A 5AUZA 3U8WA 5GZ9A 4ACCA 5JFXA 2NRYA 4RBLA 4OTDA 3C5UA 4PF4A 2UZNA 3PY0A 4KKHA 2YA9A 2BZIB 3FSKA 3ORKA 4FVRA 5AR3A 3EH9A 5AP6A 4DFNA 2ITPA 3UIMA 3L9PA 2ZMCA 4CZUA 5G1XA 4QMZA 1PJKA 2BRBA 5IH5A 2VNWA 2XMYA 3OOMA 2W1DA 2WIHA 4HVHA 3UOJA 5BVKA 1WAKA 2WMXA 3E7OA 4MCVA 4BDAA 3ZLSA 3GP0A 3OEFX 3DGKA 3LFFA 4FG9A 4L9IA 4GIHA 4Z3VA 4QMPA 3QQUA 5EW3A 5TF9A 4ACMA 4AN2A 1BMKA 5EKNA 3AMBA 2YAAA 3UZRA 4O96A 5IMXA 3ZSGA 4XV2A 4AFEA 4O1OA 3C4XA 1KE9A 4WKQA 5LVOA 3K5VA 3R73A 1LR4A 4PTGA 4UN0C 2F57A 4AG8A 2ERZE 3GC8A 4RFYA 4JVGA 4AT5A 3KY2A 4MXYA 4EWHA 5KHXA 3FC1X 2R3NA 4EQCA 3BHHA 4AGUA 4ORKA 2QHNA 2W5BA 1Q8TA 2R3PA 3MH0A 3D5XA 4XMOA 4PDYA 3DK7A 3PDTA 2X2MA 1TVOA 4YJQA 3TZ8A 1BKXA 2UUEA 1WBPA 1P2AA 2V0DA 5C03A 1GIHA 3ZHPC 2BKZA 3LFAA 4G5JA 3HNGA 2H34A 3KVXA 2JD5A 2XB7A 3DB8A 3C4CA 4AP7A 3LJ0A 2YEXA 3ACJA 2UZLA 2AC5A 3PP1A 3QD3A 4FTLA 4YZDA 4DH7A 4XG2A 1A48A 4YSJA 1LUFA 3HRCA 4E6AA 3ZXTA 5KUPA 4GJ2A 4EL9A 4OTRA 4FI1A 1OM1A 4PPBA 5FQDC 3RPVA 5LWNA 1Q97A 3C0IA 1ZY5A 4I5MA 5FD2A 4FTJA 4DEHA 2F7XE 2XCKA 2VV9A 2ZDUA 3HMNA 4XG8A 3TV6A 3KB7A 3U9NA 4BIBA 4G3EA 4OLIA 3VBXA 2PL0A 3NUYA 1KUTA 3U6HA 3F3WA 5CX9A 5BYZA 4X6RA 3BV3A 2X81A 5M4FA 4PV0A 1A06A 1H1RA 2PE1A 3FZRA 2VTRA 4EORA 3DQWA 4RIOA 4LV5A 4NM3A 3AC3A 3UO4A 3SRVA 1YHWA 5T3QA 3H9OA 5JN2A 2F7ZE 1DS5A 3A4PA 2R3KA 2JKQA 3DK3A 4FNZA 2OF2A 5ETIA 3ZFXA 2XK8A 4QYGA 4DCEA 5HLWA 2W06A 3I5NA 4S33A 5JEBA 5IQIA 4H3BA 1PXLA 4FTMA 3PG1A 4MNEA 4YJSA 1XR1A 3V8WA 3TNPC 3GCVA 2IZRA 4O0SA 4RWJA 5IUGA 5JFWA 1IRKA 4C8BA 2WB8A 3WARA 4DFUA 2WELA 3I79A 2WMWA 1H0WA 3CTJA 4FV3A 4GK2A 2PZIA 4I23A 3MVJA 5AUVA 1OBDA 2FYSA 4FT0A 2BZKB 4EOOA 2C1BA 2VTNA 2VUWA 3NUUA 4AU8A 2BZJA 4PMPA 3EWHA 1YRPA 3Q3BA 1PXNA 3F3VA 3DLZA 4H1MA 1H27A 3OS3A 4NCTC 4C38A 5HD4A 4BHNA 4L67A 2CCHA 5CASA 2XKCA 4FTUA 3TZMA 2X8IA 4FV1A 5CT7A 5A4EA 5K5XA 4BCGA 3DJ5A 4FZDB 3HMMA 5TKDA 1CMKE 5L8JA 4BDJA 2R3QA 3KU2A 2JFLA 2PMNX 2XK7A 4UBAA 4HYSA 5HNGA 3A99A 1OUKA 2OO8X 4YTHA 1ZRZA 4WSQA 2Z7LA 3QX2A 3V51A 3UP7A 5BPYA 4CFNA 5IEVA 1JQHA 2WAJA 3CY3A 5KBRA 5KZ0A 4GIIA 2O63A 3PY3A 4FKPA 5HICA 4R3RA 2BRMA 4WBOA 4HPTE 2C5NA 3QQJA 3II5A 2C5VA 2E9OA 2XYUA 3QQGA 2VTJA 4PQNA 4TWOA 2W1FA 3FMJA 4GFOA 5M4CA 3FLZA 3K2LA 4NM0A 2WIPA 5E8YA 3SVVA 3U55A 4FZ6A 1XH7A 3QQKA 3F5XA 4F9AA 5IEYA 3MH2A 4NSTA 3KXHA 2ITWA 3MIAA 3LFNA 4QQCA 5CVGA 2R0UA 2E9NA 3SW7A 1S9IA 1IASA 2XK6A 5ANDA 3NW7A 4HYIA 3C50A 4YZCA 3O2MA 2C6DA 5CQUA 1PXJA 4NJDA 4FV6A 2CLQA 4JBPA 4PY1A 3CGFA 3FWQA 4X7QA 4EUUA 4RC4A 3KQ7A 2VTLA 4DEAA 3KXNA 3RJCA 3DA6A 2UV2A 2P55A 2WTIA 2XA4A 2YM5A 3QC4A 4TYHA 4GU9A 4F0GA 2QR7A 4QMWA 4F1OA 5AX3A 3BU3A 2XK3A 3ZEWA 2XNMA 5DA3A 2RSVA 5AIRA 3ZUUA 5EDRA 3T9TA 3ZXZA 4ZLZA 2OFUA 1ZARA 3KRJA 4GKHA 2CCIA 2YDIA 3WOWA 3MJ2A 4QMLA 3EMGA 1WVXA 3F61A 1SNXA 1PMVA 3WZDA 3FKLA 5AMNA 4A4XA 3QKKA 5K9IA 1ZWSA 3DKOA 5EFQA 2ZJWA 3OY3A 2XS0A 3QLFA 5TR6A 2I0YA 3RHKA 2ZM1A 1CKIA 3BHTA 4P2KA 4MH7A 4QMYA 3R1NA 5I5ZA 4IX5A 1GJOA 1GIIA 2C5YA 2G2FA 3IPHA 4BF2A 4EOJA 5M53A 2X39A 5E1EA 4C35A 4BC6A 5L8LA 4FV7A 4OTGA 4TZRA 3R28A 5BVOA 3DKCA 3PVWA 4BZNA 4DH1A 3Q60A 5FG8A 3O71A 4JIKA 4R8QA 1E1VA 5KBQA 5CAQA 5A6NA 2QKRA 2UW5A 1M7NA 5EYMA 3PJ1A 5LMKA 4DFXE 4LGHA 3BGZA 2BIKB 4IVBA 5JSMA 3VS6A 1LP4A 4DFYA 2VX0A 1BYGA 3H0ZA 4WHZA 1VEBA 4C4JA 1ZOEA 3JYAA 1M2PA 3DAJA 3L8VA 2GQRA 2WOTA 4WNOA 2ITYA 5CVHA 4A9RA 4MWIA 3IECA 2RG5A 3LVPA 4G3FA 5A4LA 3W10A 4H05A 3DTCA 2EB3A 1WZYA 2WEIA 4I22A 2F4JA 4LG4A 2VO6A 3AC2A 4JDHA 3SXRA 5JGAA 3FE3A 2P4IA 2QLQA 3NW6A 1URCA 2W1ZA 3EB0A 3A60A 3BX5A 4ACHA 2WTKC 4UWCA 1BX6A 4QP7A 3QRIA 2ONLC 4XP2A 4KBAA 2XYNA 4QMOA 2YZAA 3D2IA 4M84A 4NCTA 5EW9A 3R04A 3U87A 3WF8A 4CQGA 5M55A 2JC6A 4FV9A 2W17A 3BGQA 5AR8A 4Z55A 4FGRA 4QPAA 4DTBA 3HX4A 1YHVA 3WYYA 4G6OA 3BYVA 4AE9A 2BR1A 3E5AA 4U45A 4AW0A 2GS6A 2CJMA 3W2CA 3BHUA 1W7HA 4Y95A 5JZNA 3WZJA 4OT5A 4G16A 4M15A 4AAAA 2BRHA 4ENXA 4JJRA 3PP0A 3AD4A 4MXAA 4YPDA 5GJFA 5C27A 4TYEA 4B7TA 2OZAB 2I0EA 2GPHA 2QO7A 3BI6A 3FC2A 2R3IA 4FEQA 3ID6C 3MESA 4ZSEA 4F9BA 4PL5A 4FIEA 4XG4A 3BHVA 3UC3A 2RFEA 3G90X 3HDNA 3M2WA 5BYYA 2F2CB 3OXTA 5CEMA 5IH4A 2BFYA 3JR1A 2GNLA 1U54A 2UZEA 5FTQA 5CSHA 3ZO4A 2OJGA 2BILB 2XIYA 3OG7A 5DR2A 4GEOA 4M68A 4BB4A 4O7VA 3PA3A 2X9EA 1ZMVA 3HMOA 4BDBA 2QC6A 3NX8A 5DI1A 3D94A 3M11A 5CYIA 3RAIA 3MY1A 3G33A 2VTAA 4BKJA 4LRKA 4JOAA 3AT3A 4RX5A 3ZDIA 3OP5A 3RBWA 4BCFA 5JQ5A 3N51A 5LVNA 4ZZNA 4QTDA 3UPZA 5C4LA 4QTCA 4EH3A 3AMAA 4AZEA 3LMIA 2JDOA 4RC3A 3HV7A 3LCOA 2WMBA 2VWZA 5AFVA 3TKHA 4BZDA 3T8OA 2VX1A 4FG8A 3LXNA 4C4GA 4L01A 4ID7A 1GZKA 3ITZA 4BCJA 3HVCA 5FP6A 3IW6A 4BDKA 4QQTA 4LGGA 4QPSA 4DG3E 3EQGA 4XJ0A 4IW0A 4EH5A 4QO9A 1UU7A 3MN3A 3G6HA 1Q8UA 3Q96A 5M57A 3TDVA 3SQQA 3VBWA 2H6DA 4RJ5A 3F3ZA 3U9CA 2R5TA 3CTQA 1CKJA 3GCSA 2VU3A 4RZVA 1JSTA 3Q53A 4ANLA 3NUAA 2BKKA 3UPXA 2IG7A 1SVGA 4HCUA 4LOQA 3N4VA 4F9YA 3RZFA 4QMSA 3FXXA 3TV4A 4ALVA 3QUDA 4YP8A 4EK5A 2X4FA 5CALA 2XRUA 4CMUA 4FKJA 3NYXA 3ZCLA 5LOHA 3MH3A 4A9SA 4A9TA 3R8VA 5H9BA 4NW6A 4N70A 3SOAA 3CY2A 3NSZA 2IN6A 3QA0A 3QF9A 3QL8A 4JR3A 4YZMA 2HCKA 5TOZA 1B38A 3AC4A 3EJ1A 5FM2A 5CF8A 2AYPA 4JG7A 3PPKA 4JAJA 3FMHA 4EK6A 3NCZA 4GFGA 4MTAA 5IQBA 4YLJA 4OUCA 5HBHA 3K5UA 4IZ7A 3S0OA 4ZTRA 5KMOA 4BTFA 2UZDA 2CGUA 1P14A 3VUMA 2R4BA 5ANGA 4F0FA 3A7JA 2PUUA 1YXSA 2V22A 4AX8A 2GNIA 4TY1A 2VWXA 4GYIA 4KKGA 3ZBXA 4QP1A 2B9IA 4RJ7A 3E64A 3ZRKA 3LM5A 4FTCA 4BHZA 3RHXA 3I7BA 4GUEA 5BVWA 4E8AA 3OUKA 3UQCA 1V0PA 4KINA 3KK8A 3O0GA 4NH1A 4RWIA 3JVRA 3SC1A 4APCA 3COIA 4AWIA 4PUZA 3L8SA 3S1HA 4PL4A 5CY3A 3Q52A 4O6EA 4AE6A 4EOSA 2GTNA 2PY3A 4Y72A 4IE9A 3GQIA 4KD1A 4KUJA 3O96A 4YBJA 5I9UA 2Q0NA 4CSVA 1ZYSA 3AGMA 5EHOA 4QNYA 5ACBC 1QL6A 2CPKE 3W33A 2UW7A 5FLFA 4CT2A 1UU8A 5KZIA 4ZMEA 2OKRA 4HGEA 3TL8A 2ONLA 2P33A 3A7FA 4UXLA 3LFBA 4DITA 4JIAA 1IAJA 3VBTA 1WBVA 2B53A 4YJNA 1OL6A 3W16A 1BI8A 4BYIA 3FEGA 4F70A 1OPKA 3PSDA 4NTSA 5CANA 1OPJA 2NNWB 1OIUA 5C26A 3MB6A 3DZQA 3C0HA 4EI4A 3UIUA 1UNHA 3R71A 4LFIA 4YTIA 3UC4A 4F7LA 2A0CX 3MVHA 1K3AA 2JBOA 4I93A 1ZXEA 2PZRA 4X2GA 3DAEA 4D2RA 5HKMA 1UNLA 3ORPA 3V01A 5J95A 4WA9A 5EM8A 4GT4A 4D2SA 5KKRC 3UDBA 2W5HA 5EOLA 3GT8A 3H0YA 5FEQA 5L8KA 3PZEA 4IQ6A 5TO8A 3ZLXA 3HZTA 3QWKA 1V0OA 1XO2B 4D58A 2I7QA 2BFXA 3EN6A 3DBEA 4FTNA 2C6MA 2PVFA 4BDIA 4BKZA 5AP4A 3EFKA 4YNOA 4U80A 1BLXA 1KWPA 2CN5A 3NZ0A 3UZTA 1LEZA 3EL7A 1P5EA 4PMSA 3VUHA 4DLIA 2ZVAA 4NFNA 4E6CA 4E1ZA 4DEDA 3PA4A 2F9GA 2OIQA 2R2PA 5CI6A 3KULA 3RI1A 4O7WA 4BR3A 3WILA 5KMMA 4BCHA 3I6WA 4C59A 2R3RA 3LKMA 1XKKA 3AOXA 3DT1A 2QCSA 4FUXA 4HYHA 4TNBA 1H26A 3QCQA 1XH8A 3LPBA 3PPJA 5T6KA 3ZSIA 5GZAA 3HAVA 2V62A 3QKLA 3F2NA 5E8VA 5J7BA 3QCSA 5FRIA 4FOBA 5EQYA 1ZYJA 3FDNA 3ENMA 1UNGA 2P2HA 1NXKA 5CZHA 3A7IA 2QD9A 1VR2A 2QO2A 2UZOA 4Z16A 4FSNA 2B9JA 4CD0A 4EHVA 4U3YA 4GG7A 4OBQA 2R3HA 4LOOA 3DBDA 3EHAA 3E62A 4I5CA 4EHGA 2EUFB 1HCKA 1JSUA 2ZB1A 4JDKA 2HZ0A 5HG7A 3RK7A 3VS0A 1GIJA 3PXQA 4ACGA 3OD6X 4JRNA 4FNXA 4YJPA 4ERKA 3GU8A 3PRIA 4MF1A 5EM7A 3FV8A 4G2FA 4MBJA 2BVAA 2CDZA 4LYNA 4EZ3A 1FMKA 4AW2A 1Q99A 5CAUA 5CEQA 4D4RA 5HX6A 3JUHA 2VNYA 2Z7SA 3VAPA 3ZM4A 4MNEB 2JDVA 4TTHB 4AZWA 4EZ5A 3FMNA 1WVWA 4EH4A 3P0MA 1CDKA 3LIJA 4RWKA 4X3JA 3PVUA 5AP0A 2ITOA 3DDPA 1XQZA 4KRCA 3BPRA 2J5FA 4XH6A 4YSMA 2C30A 2CNUA 5DN3A 5BYLA 3FMKA 5E8ZA 4IB5A 5J79A 3QTZA 3UYTA 3MA3A 3W2OA 4G3DA 4NZWB 1U59A 3IDPA 4L3JA 4RX9A 4YTCA 1J3HA 3AG9A 4YZNA 4C02A 4JLCA 4N6ZA 5K3YA 1W82A 4QYFA 5EYKA 2YM8A 5JT2A 3KGAA 4PP7A 5C1QB 2FA2A 2XKDA 3P7CA 3ROYA 4F9WA 3LZBA 3ZUTA 4FSTA 3BBWA 1RQQA 3KN5A 2QOIA 4WUNA 3CD3A 3C4FA 4U3ZA 4YR8A 5HVJA 2YISA 3ET7A 1Y91A 4L46A 1U46A 5DEWA 5LMBA 3FZTA 4FUYA 5EDQA 2QVSE 2GNGA 1YDSE 2HZ4A 2ITUA 3KXZA 5TE0A 2YDKA 4F6UA 4FOCA 4XV3A 2G2HA 4F4PA 5IDPA 4NM5A 4U79A 4QYEA 3GCUA 3GNIB 3OZ6A 3DK6A 5EYDA 1SVHA 4PDOA 3D5UA 5HHWA 5LVPA 4J95A 4CMTA 4X6QC 4KRDA 5AP3A 4XG6A 3KFAA 2R64A 2ZDTA 2YDJA 3NUXA 5DH3A 4BCIA 4BYJA 4L68A 3TACA 3FQSA 4UMPA 3DJ6A 4FVPA 4OTWA 2RF9A 3I4BA 1BL6A 4F09A 4FYNA 1IG1A 1OGUA 2HK5A 4G5PA 4PDPA 3AC1A 3RAKA 1GZNA 3EN4A 3O17A 5BMMA 5ITAA 1JKKA 1H00A 3FLWA 3QZHA 4DF3A 1YXXA 3FI2A 5EKOA 4Y85A 4O7ZA 4ZJVA 1YXVA 4L53A 5EI6A 4XNEA 2X8EA 4ZTLA 3ZEPA 4CXAA 2YZLA 3FLSA 5CNNA 5CVFA 2I1MA 2YWPA 3H10A 4QTBA 4ANNA 4IJ9A 5LCJA 2F2UA 2Y4IB 3ALOA 4MKCA 4AOJA 4NWMA 1YOJA 3QTIA 2PVLA 5AV0A 1KE7A 4YHJA 3GBZA 5K0KA 2RFNA 4AA4A 3HYHA 3KXGA 3S2PA 3FPMA 2R3FA 3IO7A 2PVRA 4IAFA 5AM6A 5L2TA 3G9NA 2HENA 4Q9ZA 5AUUA 4NTTA 1OL7A 2Y9QA 4GMYA 4JL9A 1OUYA 3PIZA 4Y8DA 3WIGA 4E5BA 4E4NA 3N4TA 3OFMA 3SA0A 3PWYA 5D9HA 3PG3A 3JS2A 1WCCA 5CSPA 5M56A 2ZYBA 4JT3A 5HLPA 4KSQA 3QGYA 3V5QA 4O7SA 1WMKA 4WBBB 3AXWA 4H3QA 1OVEA 2Q0BA 2RG6A 3ZFYA 3PWDA 5C8MA 3IW8A 1W8CA 1BUHA 1URWA 2BALA 3R22A 5H3QA 5DMZA 5AR5A 1NW1A 2NRUA 4A06A 3MV5A 3DBCA 3O8UA 2BRNA 2VTOA 3TTIA 5IA2A 1JWHA 2XH5A 2QO9A 3NR9A 4RJ4A 4ZJIA 3RP9A 3W2SA 5CF5A 4RIXA 2OU7A 5IPJA 5JFSA 3L9MA 5D7AA 4EOLA 1JKSA 4QMXA 2VX3A 1XJDA 4MD8E 2DQ7X 3LOKA 3D5WA 2B9HA 3TJCA 4C36A 3DLSA 4D1SA 4V04A 2YAKA 3HECA 5CTPA 4E4MA 5E4HA 1ND4A 2J51A 4ZJJA 5DBXA 3MJ1A 3JXWA 1HCLA 5AV3A 2R3JA 3RAWA 1ZYCA 2C3LA 5AAFA 3R7GA 2VD5A 1IA9A 4F6SA 4CGAA 3JY9A 4UYAA 3VJNA 2HELA 1Z9XA 1Y8YA 2CGWA 2C6EA 3BYOA 3EN9A 1ZAOA 2QHMA 1KV1A 4Q9SA 4QPMA 3VNTA 3O8TA 4C34A 5KX8A 4Y73A 4YZ9A 3VS7A 2J6MA 5GNKA 4R5YA 5EQEA 2W4JA 3F9NA 4IVAA 4G1WA 5FDPA 1TQPA 5BMSA 4FR4A 5JZJA 4ZMFA 4BIEA 3UOHA 1G8AA 5CF4A 3C51A 4K2RA 5AUTA 3P08A 3PXKA 4CRSA 2OXDA 4O0TA 4W4YA 1UWHA 4EUTA 1SM2A 2YCSA 3RALA 3UQFA 3ZM9A 4UMTA 3VC4A 3TNWA 3BQRA 1JKTA 2XNEA 3O7LD 2PHKA 2WHBA 4Y5QA 4M12A 2XNBA 4PMMA 3D7TA 4JX7A 4LRMA 2O65A 2XF0A 4ZSLA 3PJCA 3Q9ZA 1Y8GA 4RQVA 3E3BX 1AGWA 3FMDA 3Q9XA 4O0RA 4RZWA 5CNOA 4AUAA 4EK8A 2ITXA 2HOGA 3MVMA 4IZYA 4ZIMA 3BE2A 3ZFMA 2WU7A 4L43A 3VQHA 3SX9A 4C61A 3VRZA 3O50A 5J9YA 5IU2A 3DBFA 2VTQA 1T46A 1MRUA 3MTLA 2WMAA 4LQMA 3FXZA 4AA5A 4CFFA 2BDFA 2C4GA 2CKEA 1H1PA 3KKVA 3SXFA 4RSSA 2B1PA 4JAIA 4JBVA 4FC0A 4LUDA 3IW4A 3V8TA 4ZY6A 1U54B 2ERKA 3F6XA 4G6LA 3TKIA 1H1QA 3P79A 3DKFA 3G2FA 5EM6A 3E7VA 4EOPA 4D2PA 1I09A 3MFSA 4FKLA 2UZUE 3DZOA 4CV8A 2OXYA 1DM2A 1M7QA 2VO0A 4HGLA 3TKUA 5IA1A 5KMIA 3L9NA 5KMLA 5LVLA 3EZVA 3RNYA 2VO3A 2WQMA 3A61A 3GEQA 2OG8A 3LQ8A 2JDSA 1G8SA 2W4KA 1LEWA 5DGZA 5E8WA 4DN5A 4W9XA 4YBKA 5EHYA 3UVRA 2PMOX 2XP2A 3EIDA 4B0GA 2NO3A 4OAVB 5EI2A 3R7IA 2XJ2A 4FZAB 2ETKA 4GCJA 4RMZA 2WD1A 1QPDA 4PPCA 5GINE 2VWIA 5HE2A 4XV1A 5A4TA 3MPMA 2VAGA 3ODZX 2A1AB 4EYMA 4JQ8A 4R1YA 1XBAA 3ZSHA 2X7GA 1J1CA 2ITZA 3IDCA 3I60A 3QQLA 4EOMA 4DHFA 1PY5A 3AD5A 1QPJA 4MQ1A 4HVGA 2H9VA 3ATSA 1MQ4A 3P4KA 5AUWA 3TTJA 2O5KA 5DEYA 1JNKA 3QUEA 3LAUA 5DNRA 4RX7A 4BDGA 4ACDA 1OI9A 2SRCA 2XM9A 1JAMA 4WNMA 1P4FA 2ZV7A 4DH8A 1LPUA 4EH7A 4YHTA 2C0OA 3CPCA 3Q04A 5JMSA 1ZMUA 3QALE 2RFDA 2PVJA 2QOHA 3OC1A 4M8TA 3H30A 5EQPA 3F5GA 3Q5ZA 4FV5A 3GOPA 4C57A 3G15A 4QYHA 4V01A 2WXVA 3NDMA 4IM2A 3POZA 5DT3A 1JOWB 1PXIA 3COHA 4HW7A 4UZDA 4ZY5A 1CKPA 1XH6A 4UEUA 3MPAA 5DRBA 4ZXTA 5HE0A 3ZDUA 1GOLA 5IQAA 3QA8A 3ZLWA 3G0FA 3C13A 3B2WA 2OW3A 2WQEA 4YHFA 4NW5A 4RWLA 4FEXA 3VS4A 4HVSA 2J0MB 4TPTA 4OBPA 3GC7A 2OH0E 2YIYA 4D1ZA 3D5VA 2JFMA 3DFCB 1G3NA 3SV0A 3R8PA 4Y83A 3R7VA 4U81A 3FQHA 5JGBA 3C9WA 4HPUE 3O51A 3ANQA 4PRJA 4PNKA 2CHLA 3WYXA 4MXOA 5JFVA 4BCMA 3G5DA 5B0XA 4I20A 4LL5A 3UNZA 5G6VA 3GU5A 5KMKA 1R78A 3PVGA 4F65A 3LMHA 1U5QA 2HYYA 3N4UA 1DI9A 2C1AA 2IZUA 5IF1A 4BTMA 3WZUA 3EQFA 4LL0A 5HBJA 4BDCA 3E87A 2YFXA 3BWFA 3R7OA 2ETMA 4IX4A 2BPMA 2XCHA 2GFSA 2Z8CA 3QZFA 4EBWA 4HZSA 4JDJA 4KS8A 3VN9A 4IFCA 3M42A 4RIYA 2J90A 3NIEA 3ODYX 3QCXA 4N4SA 3EQBA 2YJSA 3PTGA 1OKYA 4EWQA 3LHJA 4D4SA 2DUVA 3RGFA 3HA8A 4Z9LA 5IUHA 3KREA 3U4UA 3A8XA 2C0IA 4P5ZA 2J0IA 5HEZA 1V1KA 3QD4A 2GNHA 3H3CA 2NP8A 4QP9A 4QYYA 1FQ1B 2XZSA 3LQ5A 3ZTXA 4NJ3A 5LXMA 1YWNA 3NUSA 1YXTA 2OF4A 1S9JA 3BRBA 1W98A 3MFRA 4FT5A 3I0OA 4W8EA 2JBPA 4WUAA 3VS1A 2RL5A 4EOKA 4DINA 5B2KA 4ANMA 5CEPA 1ZZLA 2IVVA 4DYMA 3NWWA 1OL5A 3QCYA 4PWNA 5CU4A 2XNNA 2I40A 3I7CA 4PMTA 4D9UA 3BIZA 1O9UA 4KB8A 3R2BA 5D12A 4HGSA 5FP5A 2DYLA 5IDNA 1R39A 3UG1A 3ZONA 4EHZA 2X6DA 4ZY4A 3KRRA 3G51A 3LCTA 3RINA 1A9UA 4F7SA 4APPA 4DTAA 3C0GA 5BUIA 3UO6A 3LE6A 3TZ9A 2BRGA 2JAVA 4O7NA 5IKWA 3HP2A 4XEYA 4TW9A 3OXZA 3DV3A 2HAKA 1PXOA 2J2IB 3R9RA 1XBBA 4GVJA 4FV4A 3RPRA 5FXQA 2YCQA 4DTKA 4UMUA 3KULB 4O21A 2KTYA 4E4LA 2FO0A 3COMA 3HRBA 3IONA 4J97A 3DPKA 1UU9A 1Y6AA 3OCBA 4KIPA 5HGIA 4EH2A 5A4QA 4X2NA 5I9VA 2OJFE 2P0CA 3LM0A 2CKQA 4CLIA 5ICPA 2PVKA 5IISA 3OUNB 1OMWA 4ITJA 5HE1A 2LAVA 3E8DA 3OBGA 4DFLA 4RQKA 4FK3A 1RDQE 5EOBA 4YUQA 3A2CA 5J1WA 2PE2A 2UW4A 4GVAA 4I41A 3ZRMA 1RJBA 4DH3A 1HOWA 2C69A 1WBNA 5FXSA 3RVGA 4B9DA 4C4IA 2X4ZA 4IB1A 3R8MA 2FB8A 3BLRA 4EYJA 3ZC6A 2HZIA 3KC3A 4G17A 4F99A 1PKGA 1XH5A 4XHKB 3BKBA 1WBWA 3T9IA 4ZOGA 5CAVA 5L3AA 3B2TA 3A8WA 4EJ7A 5FEEA 4P7EA 4O84A 5JH6A 5CSXA 4R7HA 1H08A 2BZHB 4MEDA 4RVTA 3E8CA 5HIDA 3R9DA 3SAYA 5AP5A 2PVYA 3ZYAA 1KE8A 3NNUA 4WNKA 3IQ7A 1YQJA 5DR6A 3ZU7A 2YIWA 4A9UA 3C5IA 1J1BA 2B0QA 4DAWA 5D11A 1YDTE 4FV0A 4EONA 4DCAA 3ATTA 4KWPA 4AACA 2JLDA 3OWJA 4LI5A 5J5SA 3HEGA 2QG5A 3FZ1A 5ANIA 3R9OA 4P5QA 4LMNA 3SHEA 4C4EA 3FI8A 3Q9WA 4MBIA 3CGOA 4ASDA 4BRXA 2W9FB 1DAWA 2PUNA 2I0VA 3CIKA 3A62A 2YITA 4UALA 3QRUA 4BCQA 4CT1A 3VUKA 4RX8A 3BYUA 3FUPA 3FKOA 4LGDA 4ZSGA 2J50A 4RVKA 4BI1A 3DAKA 4QD6A 2X2KA 4IX3A 4YZBA 5BUEA 4CKJA 4DE4A 3G9LX 2GU8A 4U5JA 5ETAA 4BIDA 4YMJA 2PUPA 3RCJA 4R77A 1JLUE 3BV2A 4PL3A 2PWLA 3BCEA 4NL0A 2QG7A 4FYOA 3W55A 3SOCA 2W1CA 4XP0A 1UKHA 2B55A 1PXPA 3AGLA 4KIKB 4XG7A 5EG3A 2OSCA 4G34A 4FIGA 1QPEA 3T3VA 3NLBA 1UU3A 2E9PA 5A14A 2YWVA 3CLYA 3CP9A 3D4QA 3NYNA 5EK7A 4C7TA 3QAME 5JQ8A 2IJMA 5LVMA 1TQIA 2CSNA 4H39A 2IVSA 5H8EA 3VF8A 3KMUA 4EEVA 3NMUF 2OGVA 1WVYA 3F5UA 4F0IA 2ZM3A 4BZOA 5M08A 3FYJX 4NKSA 3ORXA 5HTIA 4WNPA 2QOLA 2FSLX 5ANEA 4AZFA 1Q8ZA 3IOKA 4I6FA 3C4WA 3DFAA 3NGAA 4QP8A 4ZSJA 2XIZA 4JG8A 4FNYA 2GS7A 5ETFA 2RFSA 2YM3A 3FZPA 3ZRLA 5JKGA 2EWAA 4BBEA 4CVAA 5KE0A 3ELJA 2I0HA 3RAHA 4H58A 5DHJA 3IW5A 4X2FA 4XUFA 4I3ZA 2XBAA 2HWPA 4TYGA 4AT3A 2BHHA 4C4HA 2WTJA 4DT9A 4FVQA 1PKDA 4C0TA 2QU6A 4OR5A 4IWQA 4F6WA 3W8QA 5DR9A 4JNWA 3BBTB 4HJOA 1MRVA 3K3IA 4I0TA 4MF0A 1OBGA 4Z7GA 4UMQA 4AZSA 5K4IA 4FL3A 5BQ0A 3KMWA 3BU5A 4FBXA 5CQWA 3A7GA 4UY9A 5GHVA 3OOGA 4ERWA 4DG2E 1SNUA 2HW7A 4IWDA 1YW2A 2R3MA 4DGOA 1OKVA 2VTIA 4JQEA 4OTHA 5DWRA 2RGPA 3TIZA 2C6TA 4B8LA 4I4FA 3EQHA 4I5PA 3R8ZA 2VZ6A 4TYIA 1TKIA 2E9UA 4FK6A 3SD0A 1DAYA 1OIRA 5HG8A 2E9VA 1OKWA 2YIXA 4II5A 3R63A 4ZTMA 4NYEA 5HNIX 3PXZA 3E63A 1YKRA 1X8BA 3BGPA 4S31A 4E73A 1W83A 2UW8A 4TWPA 3VIDA 5FTGA 1SYKA 1YVJA 2W99B 1NVQA 4OT6A 3FJQE 5L6WL 3PLAE 3NRMA 3BU6A 3SXSA 4D55A 4TL0A 3QHRA 3OWPA 4RJ3A 5ANKA 1CSNA 4I6HA 3OCGA 4GT3A 3NNWA 3BE9A 4O38A 4GJ3A 5CU2A 4AT4A 3OXIA 5J8IA 4FKUA 4I5HA 3A7HA 3IGGA 1H8FA 4L3LA 2CN8A 2VN9A 4FSUA 1IEPA 3QLGA 2IZTA 4I92A 5HIEA 4OTQA 2XKFA 4DC2A 5HLNA 4BKYA 3FHIA 3R30A 1F5QA 1Y57A 2UW6A 3PJ2A 2HW6A 5E9EA 4QNAA 1OB3A 2J7TA 3HA6A 4F7NA 5AA8A 3NS9A 3BQCA 3MGYA 3MSSA 3CE3A 2PK9A 3GB2A 4DEEA 1W0XC 3EFWA 5M09A 4U42A 5HU3A 5IQGA 3GU7A 3Q32A 3BEGA 2REIA 5B2MA 3QFVA 4GSBA 2PU8A 4PX6A 3HLLA 3ETAA 5BVEA 3TWJA 2XIXA 2EB2A 4BGQA 5LCKA 3FY0A 4CCBA 2VWBA 4ITHA 2YACA 2UZBA 4WG4A 2ZV2A 3DXNA 2IW8A 1H28A 5LWMA 2IO6A 3E93A 1YDRE 2W9ZB 4CYIA 3RZBA 2JDRA 4C2WA 2VWWA 2EXMA 2A27A 3D7ZA 5J5TA
chains in the Genus database with same CATH superfamily
5D10A 2J4ZA 3D7TB 5IH6A 2WTDA 5FDXA 2C0TA 4DFZE 3W0NA 4WRSA 2PSQA 3DOGA 3PIXA 3R2YA 4FKOA 4FTRA 5GJDA 3UOKA 4BCKA 5A3XA 3Q4TA 4O0XA 4I6BA 2UVYA 1UA2A 2C5XA 1JSVA 4E93A 2PZPA 4IXPA 4M69A 1PYEA 4J52A 4TT7A 2O64A 1QMZA 2PZ5A 4GV1A 1R1WA 4FGBA 4QMUA 3VW8A 4CNHA 4FSWA 3DXQA 1Y6BA 4FF8A 3DJ7A 5H8GA 4FZ7A 3WBLA 4AGCA 3NIZA 4BI2A 2GHGA 3ALNA 4XOZA 3V5PA 4CFVA 3QGWA 1W84A 1PMEA 4KAOA 3ZBFA 4XG9A 3QD2B 2VGPA 1MRYA 3DS6A 4YLLA 4AN9A 4IM0A 4IADA 5EDPA 3GFWA 2V5QA 3PA5A 3NYOA 3THBA 2P3GX 3QHWA 2LGCA 3SDJA 4HVDA 5IQFA 2XEYA 4B6LA 1RW8A 3MFUA 5EH0A 4I0RA 3QYWA 3SRVB 3KN6A 5DPVA 3LJ2A 5BVFA 2CNQA 3NW5A 4IHPA 4FSMA 4M13A 5IEXA 3T3UA 2GNJA 3AC5A 3EYGA 3O23A 4RLKA 3UG2A 5DE2A 1H25A 4CKIA 1JVPP 3ZO2A 4KBCA 5FGKA 3NAYA 3UP2A 4XLVA 4MBLA 2OWBA 4YJOA 5HO6A 3R8LA 4YURA 1B39A 4K77A 3SW4A 3QD0A 4TYJA 4FEWA 4XV9A 4DGNA 3LFSA 4BDEA 4I4EA 2UW9A 2HWOA 1KE5A 3U51A 2IZSA 4JG6A 5J1VA 2OJJA 3EQDA 3R83A 4D2WA 3R01A 3KMMA 3VBYA 2GQSA 2DWBA 1YI3A 4U8ZA 4AW5A 5L6OA 5B2LA 4OAUC 2Y7JA 4IZ5A 3ERKA 2G15A 4KNBA 5CSVA 4CLJA 2WO6A 3JVSA 1OITA 2OZAA 2PE0A 3QRKA 2WOUA 3VVHA 4OTFA 3EN7A 2OIDA 2C6KA 3BWJA 3CS9A 3TG1A 1JBPE 4M0YA 4PNIA 4FSQA 4DFBA 4FIFA 2IVTA 1Q3WA 4FSYA 2BHEA 5E92A 4V0GA 3BLHA 2OJ9A 3QTUA 3UZPA 4F7JA 4F1TA 2O3PA 1NVRA 1XHAA 3AD6A 5E90A 5F94A 4FNWA 5CWZA 3S95A 3ZZEA 4CZTA 3FI3A 2C3KA 4KA3A 3EOCA 2E2BA 4S32A 3KRWA 3IW7A 2W1HA 4R1VA 4CTBA 2VO7A 3A4OX 2Y0AA 3MBLA 3MY5A 1FBNA 3RNIA 2Y6OA 3AMYA 4G9RA 5F1ZA 4MXXA 5C9CA 5M4IA 3TEIA 1YOMA 3VUIA 3R9HA 2PUIA 2WMSA 1NY3A 3CJFA 3UJGA 5AV1A 2GSFA 5AUYA 3VS5A 5HVKA 4O82A 1Q41A 2XAMA 1CTPE 4U7ZA 2XIKA 5CXHA 3F82A 4BDDA 5LMAA 1Q8WA 2HY81 5JRSA 3QTQA 5L2WA 3V5LA 4FEUA 3SG8A 3IOPA 4RIYB 4XS2A 3QC9A 3F69A 4RT7A 3R00A 4TYHB 3QZGA 5E8TA 4L6QA 4CEGA 3R6XA 2WPAA 1QPCA 2VTSA 2UVXA 2O2UA 3QKMA 3I1AA 1PW2A 2A4LA 5FWKK 2BDJA 3AC8A 4QTAA 5JRQA 4WRGA 4LOPA 4XP3A 3EQRA 4KIQA 4XBUA 3WE8A 4JS8A 4YC8A 4CYJA 3W0OA 3BLQA 4L7FA 5AV2A 3P7AA 4LMUA 3WIKA 4N0SA 4QDVA 1OL2A 4MQ2A 4U40A 5DYJA 3BL9A 4XLIA 4O91A 1STCE 4D1XA 3DY7A 4H3PA 3PLSA 5C01A 3REPA 2C3IB 5HE3A 3P1AA 4TWNA 4WG3A 4RGJA 2UVZA 5DIAA 3V5WA 3DNDA 2FVDA 4L7SA 1PMNA 3UODA 3JPVA 4QMTA 3QXOA 2WQBA 4ZSAA 4AQCA 1KOBA 3QTXA 5FUTA 3NCGA 4KSPA 3ORTA 4RA5A 5HQ0A 5E8XA 3FMMA 3FY2A 4IWPA 4MD7E 4BTKA 4L3PA 3QTSA 2WMTA 3DNEA 2QURA 1BL7A 4QOXA 4B4LA 4EK4A 1ZY4A 2OFVA 4KKEA 4EK3A 3LCKA 3Q5IA 3O7LB 5I3RA 2ZFYA 4FX3A 3U6JA 2YLFA 4BWKA 4A9YA 5K4JA 4BI0A 3RWPA 2R3LA 4NK9A 3UYSA 3ZC5A 4UWBA 4ZTHA 3MH1A 3BHYA 3ENHA 2JIIA 3F2AA 2EXEA 5CS6A 3LCDA 1NVSA 2ITVA 2J0JA 3L9LA 3FAAA 1J91A 4K0YA 1OIYA 3HP5A 3IDBA 3FPQA 5BVNA 4L44A 3EQPA 4D9TA 5L2IA 1EH4A 2BROA 3VQUA 4ANOA 1PRYA 3LMGA 1TQMA 1TZDA 4BFMA 1YI4A 3N9XA 3V6RA 3GU6A 5F95A 4J8MA 4EC9A 4ENYA 4HNFA 5A9UA 1K9AA 3UMXA 4C3PA 3UGCA 1PXKA 3ANRA 2HXQA 4FIHA 2GCDA 3GC0A 3MIYA 2VWYA 4O0UA 4X2KA 4YC6A 4BY9E 4HZRA 2OJIA 3FKNA 5HOAA 5EM5A 3UVQA 4FTAA 3HV4A 2ZB0A 4RRVA 4ZLOA 3GFEA 3D9VA 3HUBA 4J96A 5KHWA 5FM3A 4XG3A 5IQHA 2Y4IC 4L42A 1BI7A 3VUDA 2PPQA 3ML1A 1R3CA 3IK3A 4TWCA 4YJRA 4EH9A 1O6KA 2YCRA 3EQIA 4W8DA 3R8UA 4FKIA 1FOTA 2GNFA 2YN8A 3MVLA 3P86A 3PFQA 3Q6UA 3Q4UA 2QODA 4H36A 1ZYLA 4JRVA 5IUIA 3VJOA 5KO1A 4DEGA 5KNJA 4YPSA 3FYKX 4K9YA 4X3FC 5HIBA 3U4WA 2BUJA 5DRDA 4WOVA 4C58A 4FA2A 5GJGA 1YI6A 2UW0A 4FKSA 4IAZA 4C37A 3P5JC 3GOKA 3D14A 3VONA 3CEKA 5B7VA 2XUUA 1ATPE 2G2IA 2J0KA 4FV2A 1WBSA 1KE6A 1UWJA 2QKWB 4IMYA 4O0WA 3V8SA 4GW8A 3MFTA 1M17A 4IBMA 2B52A 2XEZA 4BICA 4DGGA 1T45A 2G01A 4M0ZA 4IDTA 3GGFA 1IA8A 2JKMA 5K0XA 2R0IA 2XNOA 3ORLA 4S34A 2B54A 4EH6A 2G9XA 4Q5EA 5I9XA 3F3UA 3KXMA 1PHKA 2VWVA 2XNPA 5FEDA 1GAGA 2V55A 3VHEA 3W2RA 4E26A 1R0EA 5CAPA 4D2VA 3WF7A 5CEOA 4CKRA 1UVRA 4AGDA 4D5KA 4AF3A 5C8KA 2Z60A 4AZVA 4DGLC 5LMKC 4QMMA 3HKOA 4C4FA 4DGMA 4EHEA 2YABA 1Z57A 2GFCA 3C4ZA 3MA6A 4U9AA 4U44A 3ZMMA 2UZWE 3IG7A 3PXYA 3GXLA 1VZOA 1Q24A 2QOOA 4PPAA 3MPTA 2C6OA 4BCNA 2Z2WA 3P23A 3KCKA 4J71A 4JBQA 2QLUA 2HY0A 5HCZA 4K1BA 3LFQA 3FLQA 4WT6A 2C68A 2PVMA 2ESMA 3DQXA 2X9FA 4IH8A 3VBQA 3RTPA 4XX9A 4B8MA 4GRBA 4YTFA 3NFGB 3GC9A 4D28A 2BAJA 2WKMA 2IW9A 4ZZOA 5GZ8A 5HG5A 1H01A 4BN1A 3ULZA 2EU9A 5AAEA 5CAOA 3WZKA 2R7IA 4O0VA 3RK9A 1M2QA 4HVIA 1Q3DA 3EKNA 4C2VA 4I1ZA 3COKA 4R7BA 2WMRA 3AT2A 3UOLA 2OICA 5DT4A 4LM5A 1UKIA 2R3OA 3Q9YA 4FSZA 4FT9A 3DXPA 4U97A 4QQ5A 4FKQA 2W05A 4J98A 3RCDA 5HCYA 4AS0A 3UVPA 2XRWA 4QP2A 2UW3A 4S2ZA 5AJQA 5LARA 4CFUA 4BCOA 1G5SA 3R0TA 4D5HA 2OZOA 2BAQA 3NNXA 3NNVA 3MW1A 5FBNC 4DBNA 2HZNA 4EQMA 3PE2A 1OZ1A 4O83A 2UZVA 2XJ1A 3TUBA 1ST4A 2QOBA 2QNJA 4M97A 1Q4LA 3PXRA 5AP2A 4DT8A 1WFCA 3LLTA 4FSRA 1QCFA 5EI8A 3RM6A 4QMNA 4YO4A 3I6UA 2YM7A 2WEVA 4ZK5A 1ZMWA 5A4CA 2RIOA 4NEUA 2PMIA 4RIWA 5I0BA 2F49A 3OEZA 4XRLA 2BMCA 3ORMA 4J99A 2Y6MA 3CJGA 4L52A 3RPSA 3TCPA 3UMWA 4B99A 4BL1A 5DVRA 1Q62A 4I94A 1H1SA 1H4LA 3ULIA 4Y46A 2WTKB 4RLLA 3C7QA 2PZYA 2XNGA 3EFJA 3KVWA 3L1SA 4O86A 3CQEA 5JK3A 5DOSA 1VYZA 2XJ0A 2PVHA 4I0SA 1J7IA 4E7WA 1P4OA 4G3CA 4ZS0A 3PZHA 3VULA 3HL7A 5DG5A 2OI4X 3BZ3A 5HO8A 4M67A 2Z7QA 3TIYA 3OMVA 4DG0E 3QTWA 4LV7A 4GS6A 1NT2A 4HOKA 4IFGA 3CQUA 3VBVA 3K54A 4AXCA 2CKOA 2X0OA 4TN6A 2WGJA 4AA0A 1L8TA 3PIYA 3UDSA 5AM7A 1JKLA 5I9WA 2WMQA 4IAKA 3VUGA 2OLCA 3P7BA 3NPCA 4X3FA 3QBNA 3HGKA 4O7TA 2O8YA 1ST0A 2FGIA 5HTCA 3TJDA 4DEIA 4EC8A 4NIFA 4J7BA 2Y4PA 3F5PA 3L8XA 4AFJA 4BDHA 4ANQA 1H24A 2NPQA 4JXFA 2PULA 1AD5A 3F3TA 3GCQA 4M3QA 2BTSA 3F66A 3QRTA 4O2ZA 5ACKA 3HV5A 4A4LA 5L4QA 3MS9A 1M52A 2C3JA 4FICA 2XVDA 3LFCA 3CC6A 4JR7A 3UBDA 1O6LA 4WIHA 4ZTSA 3VS2A 2QONA 3SKCA 4NKAA 2QU5A 4M69B 3FL5A 2ZMDA 3IS5A 2VTMA 4FKGA 2WTWA 3W0RA 1XBCA 3LXLA 4DHJA 4R78A 3GU4A 2YHVA 4ZP5A 5IZFA 4W4XA 4L45A 2JDTA 2ZAZA 3ZS5A 3EZRA 2IF8A 4IM3A 3HDMA 4NUSA 5HI2A 5I3OA 3W2PA 2CNVA 4GFMA 4XCUA 4CQEA 4M14A 5HD7A 3EFLA 2W1EA 3TDWA 3UTOA 2ZV9A 2BDWA 3HUCA 4WO5A 4IVDA 4TXCA 3TNHA 4QMQA 3QQHA 4PTEA 4IAIA 4YNEA 3RM7A 4DEBA 1FGKA 3GUBA 4K33A 3R1YA 3R1SA 1ZOHA 3LXPA 5A54A 5BVDA 3LFDA 5DFPA 2C5OA 2J5EA 4PP9A 4R3PA 2H96A 4KS7A 3W0PA 4IANA 4ASEA 1Q8YA 4D0XA 4J8NA 4AZTA 5LQFA 4GU6A 3ZUVA 3LQ3A 1Q61A 4W9WA 5BNJA 5M07A 3BYSA 3QX4A 2H8HA 3G6GA 2IEWA 4FTIA 3KL8A 2WQOA 4FTKA 1OL1A 2X7OA 3FL4A 1MUOA 3NAXA 3LFEA 3V5JA 3P9JA 3PJ8A 4O4DA 4EQUA 4IAYA 5D1JA 4RFMA 3E88A 3TNQB 3O5AA 2ITNA 2W1IA 1H0VA 4ASZA 3C1XA 4CG9A 4EZ7A 4AOIA 3F7ZA 3HRFA 1MQBA 3E3PA 4NU1A 3NUNA 4ALWA 3H9RA 4AN3A 2XBJA 3OW3A 3UNKA 2CMWA 3ORIA 4CG8A 3R1QA 4V05A 3OCTA 5AA9A 3R21A 5AUXA 1M2RA 3EYHA 4O81A 1KV2A 5AIKA 1YOLA 4FV8A 5GIPE 4G9CA 4FKTA 4AXAA 3SG9A 4ANBA 1YWVA 4YJUA 2OH4A 4S30A 4UB7A 4OW8A 4E6DA 1H07A 4ANSA 1H1WA 5DLSA 3OY1A 3RK5A 4RG0A 3DU8A 3OWLA 3CTHA 4DH5A 3S00A 2W1GA 2ACXA 4O2PA 2JAMA 5M06A 4Z7HA 5HTBA 4EKLA 4CV9A 4V0GB 3FQEA 2JITA 3OHTA 3BYMA 3I81A 4AXEA 4MVFA 1ZLTA 4QRCA 2C6LA 3TT0A 2Q83A 2VWUA 1RE8A 4PTCA 4RA4A 4AGWA 4NT4A 4RJ6A 5AR4A 2QOKA 3AT4A 4YO6A 1V0BA 4XYFA 4ITIA 4MD9E 3KCFA 3R02A 4R3CA 5DT0A 5I4NA 3KRXA 4K18A 3PSCA 3LCSA 2YLEA 4IACA 4HYUA 1O6YA 3MY0A 4Q2AA 4GKIA 4IWOA 5IQEA 4QQJA 1E9HA 4A4OA 3JY0A 4M7IA 3PJ3A 2JKOA 4Y5HA 4DBXA 3OROA 2FSTX 2WFYA 4G3GA 5AX9A 4I6LA 4ZS4A 3S3IA 2XK9A 4O7RA 5CEIA 4ARKA 3GI3A 2GHMA 3MYGA 4USFA 4FKRA 1ZOGA 2X2LA 2WNTA 5E91A 5AV4A 4UV0A 3GQLA 5AWMA 3FLYA 5CI7A 4QP4A 2ITQA 3CQWA 4GT5A 1ZZ2A 3TN8A 3F7WA 3HMIA 1UV5A 3D15A 5A46A 2VGOA 4FEVA 5L2SA 4ZEGA 4WG5A 2GQGA 4CRLA 3KK9A 5D41A 1W2CA 1OKZA 4LUEA 5KKRB 2EXCX 3M1SA 4KABA 4JDIA 5HG9A 3CPBA 3DTWA 1J7LA 2OBJA 4MNFA 5EW8A 1OPLA 1M14A 2W7XA 5CT0A 4CFMA 4EBVA 5IMEA 3FZSA 2QOQA 2JIVA 2YIQA 2J0LA 5E8UA 4KBKA 3KEXA 5J87A 2WMVA 3VO3A 3VUTA 4BGGA 4BVUA 3WF9A 2YM4A 4EKKA 5IG1A 3LXKA 1OECA 3HMPA 3Q4CA 1YWRA 4E3CA 2X1NA 2AUHA 2Z02A 2AC3A 1U5RA 2GS2A 3UIBA 4U0IA 2YERA 4FG7A 2I6LA 1GZOA 1ZYDA 3DKGA 3F88A 4XRJA 5E1SA 4NM7A 3V3VA 4EH8A 3OT3A 2IW6A 1J7UA 1OIQA 3AQVA 5M4UA 2V7AA 3FMLA 2V7OA 4O7YA 4C33A 2ZM4A 3KXXA 4ZLYA 4D4VA 4I21A 1R0PA 1GZ8A 2VRXA 2C47A 1L3RE 4IIRA 4BWXA 2CKPA 4AW1A 5HESA 2PMLX 1IAHA 4RIXB 4MK0A 4O0YA 4CFWA 2XK4A 3QZIA 5K5NA 4UMRA 3OCSA 5L6PA 3ZLYA 4E5AX 5AR2A 4RC2A 2YCFA 5D7VA 4FTOA 4MXZA 4GH2A 5CLPA 4KIOA 2B4SB 4RFZA 3POOA 4L00A 3MDYA 4D2TA 2EVAA 3TUDA 2J9MA 3NYVA 3CKWA 4AOTA 3DBQA 4U6RA 1PYXA 3CR0A 3KRLA 4ZZMA 3H4JA 4BTJA 4ZTQA 4X0MA 5BX0A 3RMFA 4A7CA 3FI4A 3MI9A 5J9LA 1APME 3R7UA 4K11A 5ANOA 4MX9A 4O22A 4MXCA 3QYZA 3D0EA 5CF6A 5CSWA 2GMXA 3CXWA 3IKAA 3HV3A 4QP3A 1XH4A 4OTPA 4HCTA 2VTPA 4JX3A 4UZHA 3D83A 5LJJA 4WSYA 1WBTA 2IVUA 2ETRA 4E20A 4C3FA 3FLNC 2X7FA 3ORNA 3W8LA 4R6VA 3W2QA 4D0WA 4PDSA 3ZZWA 1DI8A 5EHLA 5JGDA 3FZOA 4IB0A 3PY1A 4EOIA 5IA0A 1B6CB 3V04A 3W0QA 4J53A 3OTVA 3WE4A 5L2QA 5AEPA 1VJYA 3B8QA 3GCPA 4EJNA 4A07A 3PVBA 4IC8A 4L8MA 3NVMB 4W4WA 4E4XA 1FMOE 3VHKA 1XMMA 4F9CA 1PMUA 3HV6A 4IJPA 3NEWA 2CGVA 3CCNA 3EN5A 3CBLA 4E6QA 2W0JA 4O6LA 1XWSA 1PXMA 3MTFA 4TRLA 4E5WA 3KF4A 4RVLA 4OGRA 5HCXA 4GK3A 4LV8A 3EL8A 4IAAA 5F4NA 3QQFA 4ZAUA 2VTTA 4IDVA 5H8BA 4BGHA 5C8NA 5E7RA 3CKXA 4HCVA 3WF6A 3PUPA 3D2KA 3UQGA 3E92A 4C3RA 2GTMA 3IGOA 4IEBA 3S4QA 5AP1A 5ETCA 2PYWA 1SVEA 4DDGA 2A2AA 5IQDA 5GIOE 5IQCA 3C4EA 3MWUA 4BBMA 4MYGA 2QOFA 3OWKA 3TV7A 3O8PA 3TNIA 4HNIA 3RPOA 1FPUA 4IVCA 1PF8A 3DCVA 4RJ8A 2BTRA 1FVTA 4IB3A 3VS3A 2XKEA 2JGZA 3OBJA 3U6IA 3H9FA 3L8PA 4P90A 1FGIA 2AQXA 3BEAA 4OBOA 5HNBA 1NA7A 5FXRA 2CLXA 2X0PA 3V5TA 5AR7A 4X21A 1MP8A 3FSFA 2OXXA 2BAKA 3QWJA 3R9NA 5KCVA 4G31A 1GY3A 2B9FA 4ASXA 3FBVA 4MHAA 2HIWA 2X0GA 4UX9A 4FIJA 1F0QA 3RKBA 4USDA 4HGTA 5HU9A 1ERKA 4FL1A 5HO7A 3R7YA 3QTRA 4R5SA 4NFMA 5T68A 5A6OA 4FKVA 3ZOSA 5E8SA 3GENA 5CU6A 2XM8A 5J9ZA 2FH9A 3ZH8A 1REKA 1IR3A 4MWHA 4CMOA 3LJ1A 3KF7A 2IWIA 4M66A 4K8AA 2QR8A 3VWAA 4O1PA 4QT1A 2BIYA 4JQ7A 4WD5A 5ANJA 4FIIA 4LRJA 4R7IA 3DDQA 4F63A 5HORA 3LW0A 4GUBA 5CEKA 5CXZA 3ORZA 1E1XA 1OGYA 3Q2MA 4CCUA 4ZTNA 3QU0A 2KULA 2VTHA 4QP6A 4YJVA 4XBRA 3TI1A 4H1JA 3ZO3A 4D4YA 5CENA 4OTIA 5KMNA 1AQ1A 5BUJA 3HAMA 3EKKA 4QMVA 3FXWA 4YC3A 3OT8A 5HVYA 4UXQA 4ALUA 3PRFA 4GK4A 3WF5A 2R9SA 4U43A 2W4OA 4G6NA 2FSMX 2X8DA 3MB7A 3OW4A 4JBOA 1VYWA 4YLKA 3GVUA 2PVNA 4F08A 5HZNA 3F2RA 4FL2A 3E8NA 4JI9A 2B7AA 2QOCA 3PYYA 3SGCA 3UNJA 5FTOA 1XH9A 5HX8A 3P78A 3PE1A 3FMEA 4RPVA 3ROCA 4UYNA 4TNDA 5IA5A 4BCPA 4EOQA 4TKSA 4DA5A 3VF9A 1Q5KA 4CZYB 4USEA 4FMQA 4YJTA 1REJA 2DS1A 2GDOA 4N6YA 5CZIA 3P5KA 2R7BA 2ZV8A 3QUPA 4KIKA 3WZEA 3VW6A 4U41A 5J7HA 3WI6A 3CD8A 4BBFA 4O27B 2Y8OA 3KA0A 2C6IA 3I0QA 4RIWB 5H2UA 3W18A 4IC7A 2O0UA 3RWQA 1KOAA 3I5ZA 4ONAA 2QI8A 2GHLA 3PSBA 2WQNA 1F3MC 1KSWA 1WBOA 2YM6A 4FODA 3UIXA 1G8KA 4N57A 5F20A 4C62A 3Q4ZA 3PXFA 4W4VA 4F64A 2Z7RA 4MUQA 4GYGA 5M44A 2OIBA 3U54A 4CFXA 2JEDA 1FINA 4FTTA 4XOYA 3TUCA 5KMJA 2WU6A 3ACKA 4O7LA 4GL9A 4Q5HA 3G0EA 3CSVA 5FBOA 2W96B 2CGXA 3Q6WA 3UE4A 4GG5A 3W1FA 2IPXA 4FT7A 4BWPA 4QTEA 2QQ7A 2WTVA 1CM8A 3W32A 5I9YA 2R3GA 5CU3A 3RPYA 3LLAA 5HBEA 2G1TA 4FTQA 5AAGA 4YGAA 5CU0A 2XAOA 3OVVA 2FUMA 3K3JA 2ITTA 2ZOQA 2UZTA 1I44A 3FHRA 3VRYA 3AKLA 2YIRA 4FKWA 4UWYA 2BCJA 2FSOX 2OK1A 5AADA 3B8RA 3PPZA 2F7EE 4RVMA 2XANA 5C4KA 2WTCA 3TM0A 4I24A 1U4DA 2X6EA 4K6ZA 1GNGA 4X3FB 3R7EA 2WMUA 4BDFA 3OTUA 1YHSA 3Q2JA 2WZJA 2JKKA 3V6SA 4J1RA 4X2JA 4FE2A 4NIFB 4O4FA 2PTKA 5TT7A 5EYCA 3BELA 3SLSA 3UO5A 2P2IA 4CTCA 4P4CA 4DLJA 4YU2A 2A19B 5IA4A 3E8EA 2W5AA 3TXOA 3DB6A 1SZMA 4F1MA 2RKUA 4MAOA 2HXLA 1K2PA 3ZO1A 1FVVA 4IZAA 1YXUA 1JPAA 3OF0A 5AP7A 4FZFB 5M51A 3NUPA 3QXPA 4I6QA 5F9EA 1FVRA 5I9ZA 2XIRA 5IA3A 3NVKI 1TFFA 3QRJA 3TZ7A 4IX6A 3EQCA 1SMHA 1Z5MA 2JIUA 2YJRA 4FT3A 5AUZA 3U8WA 5GZ9A 4ACCA 5JFXA 2NRYA 4RBLA 4OTDA 3C5UA 4PF4A 2UZNA 3PY0A 4KKHA 2YA9A 2BZIB 3FSKA 3ORKA 4FVRA 5AR3A 3EH9A 5AP6A 4DFNA 2ITPA 3BL7A 3UIMA 3L9PA 2ZMCA 4CZUA 4LDTA 5G1XA 4QMZA 1PJKA 2BRBA 5IH5A 2VNWA 2XMYA 3OOMA 2W1DA 2WIHA 4HVHA 3UOJA 5BVKA 1WAKA 2WMXA 3E7OA 4MCVA 4BDAA 3ZLSA 3GP0A 3OEFX 3DGKA 3LFFA 4FG9A 4L9IA 4GIHA 4Z3VA 4QMPA 3QQUA 5EW3A 5TF9A 4ACMA 4AN2A 1BMKA 5EKNA 3AMBA 2YAAA 3UZRA 4O96A 5IMXA 3ZSGA 4XV2A 4AFEA 4O1OA 3C4XA 1KE9A 4WKQA 5LVOA 3K5VA 3R73A 1LR4A 4PTGA 4UN0C 2F57A 4AG8A 2ERZE 3GC8A 4RFYA 4JVGA 4AT5A 3KY2A 4MXYA 4EWHA 5KHXA 3FC1X 2R3NA 4EQCA 3BHHA 4AGUA 4ORKA 2QHNA 2W5BA 1Q8TA 2R3PA 3MH0A 3D5XA 4XMOA 3PUFC 3DK7A 4PDYA 3PDTA 2X2MA 1TVOA 4YJQA 3TZ8A 1BKXA 2UUEA 1WBPA 1P2AA 2V0DA 5C03A 1GIHA 2A98A 3ZHPC 2BKZA 3LFAA 4G5JA 3HNGA 2H34A 3KVXA 2JD5A 2XB7A 3DB8A 3C4CA 4AP7A 3LJ0A 2YEXA 3ACJA 2UZLA 2AC5A 3PP1A 3QD3A 4FTLA 4YZDA 4DH7A 4XG2A 1A48A 4YSJA 1LUFA 3HRCA 4E6AA 3ZXTA 5KUPA 4GJ2A 4EL9A 4OTRA 4FI1A 1OM1A 4PPBA 5FQDC 3RPVA 5LWNA 1Q97A 3C0IA 1ZY5A 4I5MA 5FD2A 4FTJA 4DEHA 2F7XE 2XCKA 2VV9A 2ZDUA 3HMNA 4XG8A 3TV6A 3KB7A 3U9NA 4BIBA 4DHIB 4G3EA 4OLIA 3VBXA 2PL0A 3NUYA 1KUTA 3U6HA 3F3WA 5CX9A 5BYZA 4X6RA 3BV3A 2X81A 5M4FA 4PV0A 1A06A 1H1RA 2PE1A 3FZRA 2VTRA 4EORA 3DQWA 4RIOA 4LV5A 4NM3A 3AC3A 3UO4A 3SRVA 1YHWA 5T3QA 3H9OA 5JN2A 2F7ZE 1DS5A 3A4PA 2R3KA 2JKQA 3DK3A 4FNZA 2OF2A 5ETIA 3ZFXA 2XK8A 4QYGA 4DCEA 5HLWA 2W06A 3I5NA 4S33A 5JEBA 5IQIA 4H3BA 1PXLA 4FTMA 3PG1A 3PFYA 4MNEA 4YJSA 1XR1A 3V8WA 3TNPC 3GCVA 2IZRA 4O0SA 4RWJA 5IUGA 5JFWA 1IRKA 4C8BA 2WB8A 3WARA 4DFUA 2WELA 3I79A 2WMWA 1H0WA 3CTJA 4FV3A 4GK2A 2PZIA 4I23A 3MVJA 5AUVA 1OBDA 2FYSA 4FT0A 2BZKB 4EOOA 2C1BA 2VTNA 2VUWA 3NUUA 4AU8A 2BZJA 4PMPA 3EWHA 1YRPA 3Q3BA 1PXNA 3F3VA 3DLZA 4H1MA 1H27A 3OS3A 4NCTC 4C38A 5HD4A 4BHNA 4L67A 2CCHA 5CASA 2XKCA 4FTUA 3TZMA 2X8IA 4FV1A 5CT7A 5A4EA 5K5XA 4BCGA 3DJ5A 4FZDB 3HMMA 5TKDA 1CMKE 5L8JA 4BDJA 2R3QA 3KU2A 2JFLA 2PMNX 2XK7A 4UBAA 4HYSA 5HNGA 3A99A 1OUKA 2OO8X 4YTHA 1ZRZA 4WSQA 2Z7LA 3QX2A 3V51A 3UP7A 5BPYA 4CFNA 5IEVA 1JQHA 2WAJA 3CY3A 5KBRA 5KZ0A 4GIIA 2O63A 3PY3A 4FKPA 5HICA 4R3RA 2BRMA 4WBOA 4HPTE 2C5NA 3QQJA 3II5A 2C5VA 2E9OA 2XYUA 3QQGA 2VTJA 4PQNA 4TWOA 2W1FA 3FMJA 4GFOA 5M4CA 3FLZA 3K2LA 4NM0A 2WIPA 5E8YA 3SVVA 3U55A 4FZ6A 1XH7A 3QQKA 3F5XA 4F9AA 5IEYA 3MH2A 3UDZA 4NSTA 3KXHA 2ITWA 3MIAA