4GFMA

Jak2 kinase (jh1 domain) with 2,6-dichloro-n-(2-oxo-2,5-dihydropyridin-4-yl)benzamide
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
291
structure length
289
Chain Sequence
DPTQFEERHLKFLQQLGKGNFGSVEMCRYDPLQDNTGEVVAVKKLQHSTEEHLRDFEREIEILKSLQHDNIVKYKGVCYSAGRRNLKLIMEYLPYGSLRDYLQKHKERIDHIKLLQYTSQICKGMEYLGTKRYIHRDLATRNILVENENRVKIGDFGLTKVLPQDKEKVKEPGESPIFWYAPESLTESKFSVASDVWSFGVVLYELFTYIEKSKSPPAEFMRMIGNDKQGQMIVFHLIELLKNNGRLPRPDGCPDEIYMIMTECWNNNVNQRPSFRDLALRVDQIRDNM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Tyrosine-protein kinase JAK2
publication title Lead identification of novel and selective TYK2 inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 97
structure length 289
sequence length 291
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2012-08-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4gfmA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4gfmA01
3OCGA 4GKHA 2GFSA 3NCGA 4N6YA 5L8LA 2WQMA 4FX3A 4K77A 4BDHA 4I93A 2VUWA 4QYEA 4X2FA 4U5JA 2GNFA 3D5VA 3OG7A 4BBFA 2LGCA 4OR5A 2OKRA 2R3MA 5DBXA 4I5CA 3R8VA 4FKVA 4ITJA 3HV6A 3S00A 2W9FB 5EHOA 2VTAA 3NGAA 4TWOA 3UVQA 5I9YA 2P55A 4BDKA 3Q2MA 1ZLTA 1ZYSA 4C4JA 3AT4A 4IX4A 4Y5QA 4IB0A 4N4SA 2C6IA 5C4LA 2PVNA 2YM7A 2XBJA 4MXAA 4M13A 5E8SA 5JK3A 3BLRA 1Y6BA 3BE9A 2YLFA 4O21A 5HI2A 1SYKA 2QD9A 2CCIA 4NTTA 4D4YA 2YWPA 4K9YA 4BKZA 2C6KA 5LVOA 5HLPA 1H26A 2GQSA 2WMRA 3P4KA 4UEUA 3T3VA 3BYUA 4BCHA 3VAPA 4M3QA 3HP5A 4IB5A 4C2VA 2H34A 1Q3DA 5LMKA 4QP4A 2J7TA 4F7NA 4O6EA 1UU8A 1OPKA 3IS5A 1KSWA 4MYGA 2VWXA 5FWKK 4QYYA 3F9NA 3ZONA 1FPUA 4FGBA 4CXAA 3KULA 2OXYA 4RJ5A 3ACKA 3R1NA 5HTBA 2Q83A 3BGQA 3FLQA 5IG1A 4F9WA 5LXMA 3K2LA 3F82A 3GU7A 1XR1A 4BDDA 5IUHA 4BFMA 2W99B 3N51A 4AA4A 1XBCA 2QNJA 4BYIA 4TRLA 4CRSA 2VWUA 2J0KA 3F2RA 3ORIA 4G5JA 3G51A 4GK4A 4BCIA 3GENA 4IAIA 5IQDA 3MYGA 3PA4A 2I0YA 4BICA 2WQOA 3FQEA 2X39A 3GVUA 5IQFA 5CSXA 2O8YA 4F1OA 5EM7A 3TWJA 3QGWA 2YAKA 5CSWA 3F5UA 3O23A 3Q6WA 4FK3A 4FNYA 5DR2A 5HIBA 2YCFA 3H30A 5GZAA 2GDOA 1CSNA 5L2QA 4D1XA 5HIDA 4AOJA 2WOUA 4ZTQA 4QMQA 4FKTA 2QO2A 3HECA 5FEQA 4AN2A 2BCJA 2E2BA 3CBLA 4BZNA 4R3CA 4AGUA 3V51A 3NNXA 4JIKA 4Y83A 3AGMA 4EKLA 3ORKA 4YU2A 5CQUA 3ZDUA 5EYMA 4D55A 4C4GA 1KE8A 1PXNA 2RFNA 2UZOA 4F08A 5DMZA 3V6SA 1PXIA 1XWSA 4V0GA 3ZO4A 1YHVA 3UO5A 5ANEA 4RWJA 1H07A 3EZVA 4KIOA 4NL0A 2ONLC 3LCOA 4OW8A 5EHYA 4C62A 5ANGA 3D9VA 2PZ5A 4TL0A 3F61A 4JG6A 3EN9A 4E26A 3OXTA 2G2IA 2W7XA 3C0GA 4WUAA 2WTCA 4S34A 1Q41A 4IHPA 3A7HA 3G0EA 3SKCA 4DFZE 4FKOA 4RVMA 3H0YA 4ANBA 1OL7A 3RK9A 1FVRA 3DAEA 5HBEA 1NVSA 4UZDA 3RPSA 3F66A 5L2WA 3F5XA 1F3MC 2HCKA 1WFCA 4FVPA 4EK6A 3W8LA 3VS0A 1B6CB 1JSTA 3T9IA 3DV3A 5BQ0A 3LCDA 4ALWA 5AR4A 3UBDA 1M7NA 2BZHB 4QMSA 4AGCA 5A6OA 1XBAA 2JD5A 2P3GX 4RX9A 4BR3A 3H9FA 5IQBA 5C4KA 4FT9A 5TE0A 4XRJA 3GQIA 4RVLA 4RC3A 5IMEA 5JQ8A 4C7TA 2QHNA 2PUIA 3HZTA 3IGOA 4GK3A 3L9LA 3PWYA 3JPVA 4Q9SA 3UNJA 3GC0A 3BZ3A 3VUMA 5JFXA 5E8ZA 5DPVA 1UU9A 2REIA 5A46A 3U87A 4F4PA 2OO8X 3FUPA 3E92A 2VZ6A 2W1IA 5D41A 3OMVA 5AR8A 3OY1A 4JDKA 3BGZA 5IA2A 2NRYA 3KF7A 3LFFA 3VC4A 5AUXA 3TKIA 3IDPA 3VS7A 4UYAA 5TO8A 3TV6A 3VBWA 3AXWA 2QKRA 3QTWA 4O1PA 4XLVA 4H36A 5CVFA 5HCYA 4WA9A 5E8XA 2ITPA 3QQJA 4RJ7A 4D2TA 5EM5A 4RX7A 4K2RA 4Q2AA 3CCNA 3SXRA 2R3KA 3AC3A 4K0YA 4QP2A 2W1FA 2XMYA 2OLCA 3DDPA 3R63A 3BV3A 3KMMA 4AE6A 3R28A 2JKQA 4L52A 1H00A 2I0VA 3EFLA 3ENMA 5BYZA 1WBOA 1IAJA 3BV2A 3E5AA 4NT4A 5HBHA 3C13A 4AN3A 4KBKA 4RLKA 5JQ5A 2FUMA 4QT1A 5M09A 4E4XA 1SVGA 1OBGA 2PZRA 4L53A 4AXAA 5E8UA 3PVBA 4XLIA 3LE6A 4E6DA 1U59A 2VAGA 3AC2A 2QG7A 5C03A 3F3ZA 3V5WA 3S0OA 3L9MA 1L8TA 3QKKA 3P1AA 4BDGA 4E5AX 2YCQA 2CGWA 3BHVA 3KCKA 4G6OA 3UP7A 4FZAB 3ORLA 3GUBA 5KMIA 4OTWA 2GFCA 2VD5A 2XJ0A 5CI7A 2B4SB 2C5XA 5EM6A 5I0BA 5CEIA 5DNRA 2GQGA 4RJ6A 1Q5KA 1FMKA 4QYGA 2JIUA 5M06A 4S31A 4XBUA 4B7TA 3R7YA 2XNPA 3L8XA 5JGDA 1PMEA 5DE2A 1Q8TA 3MJ2A 3ZZEA 4ASZA 4ASXA 4RA5A 5KKRB 3R83A 3HEGA 5HKMA 3HMIA 5HVKA 2BILB 3IW4A 5LWNA 5D7AA 4LQMA 5J1VA 4FSYA 3R8PA 4DC2A 3KRLA 1YI3A 3QUDA 4QP3A 1OPLA 2YIXA 3W32A 2HOGA 3DGKA 1OIYA 4MXYA 4DEDA 4JBQA 3QCXA 4O7SA 3TNIA 3Q32A 2OZAB 4Z7GA 3FZ1A 4L7FA 3FYJX 3OXIA 4YO4A 2QOBA 2VTNA 4CKRA 4U3YA 4ERWA 4ZEGA 4ZIMA 3VJNA 3LMGA 4P5ZA 4PMPA 2RFSA 4ENXA 3R9RA 4G9CA 4FC0A 5JGBA 3C9WA 2Z8CA 3PIZA 2JKKA 2QR8A 2SRCA 3L9NA 3P9JA 2OH0E 1UVRA 4LM5A 3R8UA 3SAYA 5CU2A 4MX9A 2IPXA 4BCNA 4NM3A 4GEOA 2Y7JA 3A99A 5LMKC 5BVWA 2YCSA 3RCDA 4K8AA 4EH3A 5HE0A 2XCHA 3OWKA 4FIFA 3AT2A 4FGRA 4NW5A 5DN3A 4YHFA 3TUDA 2C5VA 2XEYA 3VBYA 1AQ1A 2WQBA 5B7VA 4DEGA 4RZWA 3FC1X 2XIRA 3OT3A 3WZKA 1J7UA 1UKIA 4F9YA 2I6LA 3ETAA 5GJDA 5AUVA 5K9IA 4YUQA 3HV5A 2Y6OA 4I23A 4FTMA 4KB8A 4MXZA 2EXMA 4E20A 3O2MA 5M08A 4A4OA 3EQDA 1YHWA 2HZNA 3H0ZA 4IWQA 4MNEB 4GYIA 2PYWA 3ATSA 2YLEA 4DN5A 4GS6A 5G6VA 3PPZA 3PA5A 1YHSA 2NP8A 3GU4A 3NYOA 5FEDA 2RFDA 3ZXZA 4BB4A 1W0XC 3FMKA 3QQGA 2VTIA 3G9NA 4O0RA 2CHLA 4QMUA 4U42A 1FQ1B 3WOWA 4HOKA 2WU6A 3DTCA 5HORA 2FVDA 4FTKA 2WOTA 2V22A 2IVSA 3S3IA 4ASEA 5KO1A 4I0SA 2W1GA 2GHLA 3FMEA 4C38A 3P5KA 1O6YA 1CTPE 4NEUA 4IJPA 5CYIA 4YURA 3SRVB 2W1EA 3PXQA 4I5PA 5KZ0A 2E9PA 3MI9A 2HW7A 4GJ3A 1OKWA 5I9ZA 4YJVA 3WARA 4CQEA 5E8VA 5B2MA 4NYEA 3PIXA 1U46A 4EYMA 3QYZA 4F0GA 5FD2A 4MXCA 4JS8A 1HOWA 2ACXA 4I6BA 3OY3A 5KNJA 2GCDA 2XK7A 1NVQA 4FVRA 5FDXA 1JBPE 2UW0A 4II5A 2OZAA 4HW7A 3D0EA 4GIHA 4ZY6A 4N6ZA 4V04A 3T8OA 1H24A 2O5KA 1PXMA 3EQGA 3KK8A 4FG7A 4I4FA 4WKQA 4YLJA 2QOIA 5BNJA 3FZRA 5M51A 4O27B 3C0HA 5CEPA 4O7YA 5DHJA 4L46A 2YZLA 1KOBA 4G3FA 4ORKA 1ZARA 1M2RA 2WTWA 3ZLWA 4AGWA 3RVGA 5JRSA 4IVCA 1ZMVA 1R3CA 4FNWA 2JC6A 2ITYA 4AOIA 3QC4A 3VS2A 2JAMA 3HRCA 4YLLA 4CFUA 2FO0A 3KVWA 4XS2A 1G3NA 4OTIA 4V05A 2ETMA 2XNMA 3NUXA 2PULA 4O7ZA 2W4KA 4XG2A 2KULA 2PWLA 2GNHA 1YDSE 2FB8A 3FXWA 4MQ1A 2C6LA 4TN6A 2PMIA 3PXFA 2BRBA 4ZAUA 5J8IA 2W0JA 1YVJA 4GSBA 4NKAA 2YAAA 4O38A 4YZNA 3QD0A 4PDPA 2FA2A 5DWRA 3H10A 3UDBA 3NDMA 2WTVA 4ENYA 3UE4A 3PZHA 3AOXA 2XVDA 3GQLA 4I6FA 3C0IA 1ZYJA 4D2VA 2JITA 4KAOA 2VNYA 3ELJA 4GMYA 4KABA 3LFQA 2IVVA 1OGUA 3IO7A 4FT0A 4HGEA 4MNEA 5CU6A 3QBNA 4YNEA 4BDAA 5CASA 5IF1A 2XK6A 4AP7A 3O8TA 1NXKA 2F4JA 3NUSA 5HZNA 4L3JA 3B2TA 1OM1A 3RKBA 4CFFA 3VO3A 4QO9A 2PZYA 3OFMA 2OBJA 2GNGA 3DKFA 4I4EA 4L45A 4RC2A 4O91A 4DEHA 4NWMA 1YDRE 4AE9A 1PMNA 3DBQA 4XH6A 4DCEA 5JFWA 4G2FA 3ZS5A 3KK9A 1YOMA 4D2RA 3HMOA 5EOBA 4E4LA 4ID7A 2B52A 2C1BA 4GFGA 5AUZA 4MKCA 2YIWA 2GS7A 2XIYA 3NYXA 3VJOA 3FL5A 5ETFA 4PL3A 4EBWA 2PE2A 2YDJA 1U5RA 1A9UA 4PWNA 3SRVA 3UC3A 3UPXA 2BAKA 3R73A 2OIQA 3H9RA 3UZPA 5DR9A 2YM6A 2QOHA 4Q5EA 3F3WA 2G01A 4YO6A 4AF3A 1F0QA 1ZOEA 5AAGA 2Q0BA 4MXOA 4O96A 1BI8A 3HUCA 4W8EA 5C1QB 3I7BA 4U43A 4I20A 2PVFA 4FTQA 3U8WA 1GY3A 2OF4A 2J0IA 4FG9A 3U6HA 2P2HA 2OG8A 2FYSA 4TYGA 4PNKA 3DNDA 4FV7A 2FSOX 3MH0A 3MA3A 5DG5A 5F4NA 3QU0A 5EYCA 2WQEA 1Y8YA 2E9UA 4AUAA 4HNFA 3U9NA 1PY5A 3K5UA 3W2SA 4F9AA 4GT4A 4J8MA 4ZSJA 4I94A 4ZTHA 5H8BA 5A4QA 2GTMA 3FSKA 4FZFB 2I40A 3K3IA 2C6TA 4W4VA 1UU3A 2VTRA 2X2LA 3NUUA 3R04A 3PDTA 2Z7QA 2VWZA 3BBWA 4WD5A 1OMWA 2QR7A 2W5BA 1WVWA 5E9EA 1Q3WA 3FKLA 3JY9A 4ANSA 3R7EA 2YJRA 3QCYA 5FXRA 2IZUA 5A3XA 2BHEA 4AZWA 3OOGA 4WG4A 4OLIA 4AG8A 3OCTA 2BPMA 1PW2A 3MY0A 3R8LA 3FV8A 4FL2A 5D12A 3FI8A 4QTBA 4M0YA 1FGKA 3ROCA 3NW5A 3ANQA 3DDQA 3ORXA 4TY1A 4QMVA 4EOOA 4BI0A 5BVNA 5IKWA 2Z7RA 2VWVA 4U3ZA 3N4VA 1BI7A 4RIXB 3U54A 4APPA 3WIKA 3HDNA 2VTSA 5FBNC 3ZXTA 5T68A 4Q5HA 4IW0A 4ZMFA 4G6LA 4GT5A 3COMA 1GJOA 3OBGA 5FM2A 3W10A 4BL1A 4H39A 2J50A 3E7OA 4ZZNA 5ANDA 4Y8DA 3IW8A 2WMXA 5K5XA 2BZIB 3OXZA 4FKLA 4IE9A 4PNIA 2QLQA 1YWRA 2BKZA 4BTKA 2OZOA 4QMLA 4J8NA 3TTJA 4A9SA 3V8WA 4BGQA 3SG8A 4ERKA 3FSFA 3KA0A 5I4NA 2WXVA 3TKUA 5CAPA 2ZB0A 5A9UA 4RVKA 3MN3A 4AW0A 1MQBA 2AYPA 4CFMA 4FE2A 2W1CA 2XJ1A 4EBVA 5JH6A 2X9FA 2J0MB 2C68A 5KCVA 2IW6A 5EYDA 5L6PA 1B39A 4ZJJA 3MTLA 1V0OA 4YHJA 4EH5A 3PXKA 5IEVA 3PUPA 1UU7A 4WT6A 5AP0A 4DGMA 4IZYA 1R0EA 1Z9XA 3HA8A 3RWPA 3DBFA 1S9IA 3A62A 4WBBB 1YKRA 4M67A 5DRBA 2B0QA 5IQAA 5IA0A 3D7TB 3G6GA 4KA3A 3QYWA 4NU1A 3H3CA 3MIYA 1Q97A 4BC6A 4FIIA 3QQFA 5JFSA 3OBJA 5BVKA 3EFWA 4YJUA 5F95A 4ITIA 4YMJA 4B99A 2YISA 4HYSA 4AFEA 5CF5A 5IDPA 4GUBA 4XP3A 4NTSA 5DT3A 4JOAA 2YIQA 4FTTA 2YHVA 3CD3A 4LMUA 4YP8A 3WIGA 5J1WA 3MESA 3HNGA 1OL1A 4ANNA 2XH5A 5LWMA 2PY3A 4FYOA 4W4WA 3SOAA 4BDBA 4Z16A 3D5WA 4S33A 4AGDA 4CG9A 4G9RA 3LQ5A 2C3LA 2YZAA 5CZIA 5BUJA 3AC4A 4PP9A 1QMZA 3LXLA 4MBLA 4FNXA 4DG2E 2PE1A 5CXHA 4XOZA 5J9YA 4IIRA 4BWKA 5M07A 4FV6A 4AQCA 3HRFA 1REKA 1J3HA 3CIKA 3HA6A 3Q9YA 3K54A 5IZFA 2CPKE 5KX8A 5KE0A 4YJSA 3R30A 4K1BA 4J52A 4GVAA 2X7OA 3WZJA 4UZHA 5EYKA 5L8KA 4B6LA 5K0XA 5H9BA 2BUJA 2ESMA 2EB2A 4M15A 4YTCA 4RGJA 3KKVA 3NNUA 5GJFA 5HO8A 4FSMA 3DK6A 4MTAA 1OBDA 3NEWA 2J5FA 3QC9A 4IX6A 4CFNA 3ZSHA 5I3RA 4I1ZA 3UQFA 5J95A 4IWPA 4BWPA 4CT2A 2Z7LA 3A7IA 1MRUA 2GTNA 4JBVA 5CU4A 3TNHA 3UQCA 3LFBA 3Q6UA 4DEBA 3RPRA 5E8YA 2QU6A 4CMOA 5IA3A 4LOPA 4S30A 4XJ0A 2HWOA 3OD6X 3W2QA 5CWZA 4D0WA 3C4CA 4K33A 1OL2A 3NRMA 4V01A 3VBTA 3D7TA 4HZSA 3LCSA 4O2ZA 1GIJA 2IZTA 3BLQA 4OTFA 2WMSA 4PRJA 5GHVA 4QQTA 2PVMA 2BDJA 3NR9A 3S1HA 3KC3A 4EC9A 1W7HA 3OTVA 2C5YA 4Y73A 1PXKA 2Y4IB 1YWVA 5JEBA 3VUDA 3VUTA 3KRWA 3BE2A 5AR7A 5HICA 1R0PA 3TTIA 1ZMWA 5EI8A 2G15A 2OJIA 3MPTA 3QRJA 2X8DA 4IH8A 4TNBA 2YDIA 3BYOA 3D4QA 4FNZA 3VQHA 3DNEA 5HVYA 2F57A 1UWJA 1YRPA 1Q8ZA 4RIWB 3TG1A 4TYJA 2IW9A 5HHWA 3DXPA 4GVJA 4E3CA 3VN9A 4KRDA 3HUBA 3SV0A 4JXFA 4IZ7A 4H3PA 4WIHA 3FE3A 2VO3A 5J5SA 3EH9A 3R2YA 1H0WA 3CPBA 3IDCA 4HYUA 4WG3A 4KIKA 3TCPA 5KHWA 1XH9A 4QQCA 2A1AB 3BHYA 4U45A 3TEIA 2V55A 4FSWA 5K4IA 4YZCA 3RAHA 5FQDC 2XKCA 4U44A 3SQQA 4F0FA 3IOKA 3JVRA 4IB1A 3THBA 3ZMMA 2OU7A 4IACA 5A4LA 5F9EA 3TUBA 3KMWA 5LARA 3G0FA 1YQJA 5CVHA 3C4WA 5CLPA 4RJ4A 2JAVA 2UZUE 4AZFA 3MSSA 3OOMA 3OCBA 5ITAA 4YLKA 2WTKB 2XCKA 1SMHA 3KF4A 3ZCLA 2CNQA 4EOLA 2Z02A 3CKXA 3LIJA 2ITNA 3CY3A 4KD1A 3LPBA 4Y72A 3BHTA 5HD4A 3BBTB 3O96A 1JVPP 3MH1A 4HPTE 1H25A 3VS3A 2NPQA 3G33A 4IMYA 4GJ2A 2HW6A 4D9TA 2C6DA 3FHIA 5IUGA 4CGAA 1UV5A 1PKDA 4FV3A 2JIVA 2UW4A 1ZWSA 2E9NA 3DB6A 2QHMA 3GU6A 3NX8A 2A2AA 4J1RA 4UMPA 4J71A 1FVVA 2DWBA 3EFKA 3HV3A 5A4TA 3GCUA 3A7FA 4CZUA 2QO7A 1QCFA 3CTHA 4O0WA 3D2KA 4LRJA 3ZRMA 1AD5A 4P2KA 4HVGA 2CLXA 1XBBA 2B9IA 4QPSA 2IJMA 5HD7A 4M12A 4P7EA 3SLSA 4BIDA 3QA8A 2VO0A 4K11A 3PYYA 3UTOA 1H27A 5EK7A 4R7BA 4CZYB 3TJCA 1STCE 2RG6A 3NVMB 3Q9WA 3VUIA 3IKAA 4R3PA 3UO6A 3E64A 3ULZA 2X4FA 4YJTA 5AP4A 5LQFA 2HIWA 3RHKA 1JPAA 2E9OA 2F7XE 5AM7A 3GT8A 5EI2A 4WNKA 4DTKA 3QZFA 5CSPA 4RIOA 3RM6A 4RIWA 4QQJA 3UGCA 4L6QA 2I0EA 3HX4A 3PTGA 3FY2A 4UBAA 3VRZA 3QUPA 4DG3E 2F9GA 3F3TA 3PY1A 5J7BA 4FTAA 1H4LA 4XV3A 4PDOA 1JKSA 1IG1A 3TIZA 4G3EA 4JX7A 3Q04A 1GIHA 1OUYA 4J53A 5ETAA 1Q61A 1ZY5A 4F6UA 4KBAA 5JZNA 3ZLYA 4FR4A 4YJOA 3P86A 3BHHA 1BKXA 3F3UA 3EOCA 4IWDA 1H0VA 4DHFA 4ZMEA 2GQRA 2F7EE 3DA6A 3CXWA 3E3PA 4XCUA 5CS6A 3D7ZA 2DUVA 3E8DA 3JVSA 4PMSA 4QPAA 5TF9A 2QLUA 3RTPA 1LEZA 1J91A 1CM8A 4JIAA 3VULA 2YIRA 4NZWB 4E4NA 1FGIA 1FVTA 5GZ8A 4GL9A 5JFVA 4W9WA 5L6WL 4HGSA 2VTOA 3RAKA 4AU8A 4LV5A 1ERKA 4TTHB 5M4CA 2R2PA 5HOAA 5EI6A 1Q4LA 3V5PA 5H3QA 4FTCA 3POZA 3QD2B 4ANOA 2JIIA 4JBOA 2O65A 4C33A 1H28A 4E6QA 3LMHA 2WO6A 3KXNA 3KXXA 4KSPA 3UJGA 4BGGA 3M2WA 2ZM3A 3D2IA 5K0KA 3ID6C 4UN0C 4JDIA 3TIYA 5JT2A 3BHUA 4BHNA 2OF2A 4BZOA 2NO3A 1IAHA 4W8DA 4X6QC 2R3NA 4C3FA 4C57A 3IW7A 3O50A 4BZDA 2C5NA 1YXSA 3FXXA 3LFNA 3V8SA 3RPOA 3SG9A 3QL8A 4FTNA 4CT1A 3FMDA 4EZ5A 3MY5A 3FPQA 4TPTA 3CD8A 4EORA 3VF8A 4EHVA 5HCZA 1PF8A 4ZJVA 3BELA 2CN5A 2VTQA 3KRJA 2A0CX 3WF7A 5AR5A 2VTTA 4FOCA 2BIKB 3DCVA 4U41A 2BFXA 2R3JA 3KL8A 3QTXA 4FKGA 2B9FA 3QTIA 4CV8A 1OB3A 5L6OA 1KUTA 4RSSA 1I09A 2QOFA 5CEQA 3Q96A 5DI1A 3R7IA 3OWJA 2UW6A 4QYHA 2ITOA 3GB2A 4RG0A 4QTDA 3UZRA 4X2KA 4MAOA 2QONA 3IK3A 3ZDIA 5LJJA 3GI3A 3KY2A 4R5YA 4M0ZA 4F6SA 4PV0A 5AP3A 3PG3A 2OIDA 4R77A 3GEQA 5EW9A 1ND4A 3DS6A 4A9UA 3RHXA 2XEZA 5TT7A 4BY9E 3Q9ZA 4FSUA 4EH9A 2XIXA 4QMNA 3M11A 4GW8A 1WMKA 5BVEA 1BYGA 4RLLA 3SW7A 2HXLA 1RW8A 3LFCA 4DYMA 5KUPA 4BHZA 5HTIA 3RAIA 3PZEA 3KB7A 5H8EA 3V5QA 2WKMA 1XO2B 2ITVA 3MVMA 4IC7A 2YWVA 4S2ZA 3REPA 1BL6A 3C4XA 2VN9A 3WZEA 5ANIA 3ALNA 3BKBA 1ZYCA 2WMQA 4O0YA 3AT3A 4FKWA 5KMMA 4DH3A 4CFVA 1JKKA 3LZBA 1OITA 1BL7A 2HENA 3WYXA 3QX4A 1XH5A 3COIA 3ZBFA 4BCQA 3L8VA 1VYZA 2OJ9A 3ZSGA 3Q4TA 3NLBA 3RZFA 4BKYA 3BEGA 2E9VA 2QCSA 5AIKA 2H96A 3QTQA 5LVLA 3TM0A 4RWIA 4B0GA 2CJMA 5IEYA 1KE5A 3DXQA 3U4UA 3HKOA 2X8IA 4FUYA 4UXLA 2W4JA 3ZHPC 4ASDA 3UYSA 3PJCA 4L8MA 2QU5A 2PSQA 2F2UA 1XH4A 4TWPA 5FTQA 1BMKA 2H6DA 1MRVA 3CY2A 2HAKA 4IWOA 2PUNA 4M7IA 4IVAA 4XBRA 5HG5A 2BRGA 3UVRA 4G17A 2X2KA 3FLZA 3LQ3A 4OTDA 4J98A 4FUXA 1YW2A 3Q4ZA 2W4OA 4OUCA 4KWPA 3ORTA 4FV5A 4PMTA 2JDRA 2QQ7A 3L1SA 4FEWA 4O0TA 2JDTA 3HMMA 3AGLA 3T3UA 3V04A 3Q9XA 2QURA 2R3OA 3RCJA 3W8QA 4C58A 4KKEA 3PJ1A 3V3VA 4BGHA 3ZEWA 3AC5A 1SVHA 3FHRA 3ZFMA 1YDTE 3ERKA 4C4HA 4XYFA 3FLYA 4X3FB 4L9IA 3F5PA 4D2PA 3E93A 2QOKA 3I5NA 3F88A 1XH7A 4XP2A 4HVSA 2I0HA 3V5LA 5EG3A 4GV1A 4O83A 5HG7A 3Q2JA 5D1JA 3RINA 2QI8A 5F1ZA 2YM5A 3R22A 2WD1A 3EN6A 4CTBA 4NFMA 4UWBA 5IA1A 4XV2A 4ZOGA 3GCSA 5CY3A 4OTRA 4WRSA 4C8BA 3DKCA 3DBCA 4AW2A 2BAQA 5CENA 5EKOA 4IBMA 4ZTSA 3UO4A 4F99A 5BVDA 5M44A 2RL5A 3LXPA 1MP8A 2ZV2A 4TWNA 2R3IA 4YPDA 5KZIA 1FMOE 3A8WA 4L3LA 5DVRA 1WBWA 4JBPA 3SC1A 1J1CA 3W2RA 5I9VA 4ZSEA 2J0LA 1Y6AA 5DT4A 4NM0A 1E1XA 4WSYA 4X3JA 1UA2A 4EQCA 1J7LA 3D5XA 4LL5A 5B2KA 3FDNA 3NNWA 3RAWA 3HV7A 3RZBA 3ZC6A 4ANMA 4BTFA 1JSVA 3DJ6A 1PJKA 2J6MA 3ENHA 3KEXA 5E90A 3Q60A 4QP7A 4DLIA 4ZY5A 5BVOA 4C4IA 3HLLA 4PTEA 5CTPA 2C3JA 3LCKA 4NW6A 3RBWA 5ANKA 4TYEA 5HG8A 3O71A 3HL7A 5M4IA 2WTKC 5CF4A 1LUFA 1W8CA 3O8PA 5E91A 5FP5A 4O0SA 4AZTA 4A07A 4M8TA 1GZ8A 1BLXA 3K3JA 3QZHA 1SM2A 3IQ7A 4RRVA 4TKSA 4BCKA 4FT3A 4D1SA 2X81A 2HZ0A 5DEWA 4CEGA 1UNLA 2PE0A 3AMBA 4XRLA 3VVHA 2VRXA 1W84A 4WRGA 2J0JA 4CCBA 5FDPA 4AW5A 3JXWA 4E6AA 5EQPA 3CGOA 5HNGA 1GNGA 4R78A 1BX6A 2UVZA 2XB7A 2C0IA 3R6XA 3MFTA 1IA9A 1K3AA 2C47A 3ZRLA 2ITWA 3HGKA 4G6NA 1O6LA 4XG3A 4EHGA 4FSZA 4GKIA 3C50A 5AUUA 2JGZA 5TKDA 2J5EA 5EW8A 3A60A 3EL7A 3LFEA 2WTDA 4LL0A 1OL5A 1MRYA 1O6KA 2GNIA 2RKUA 3CQEA 3WF5A 4XV1A 2ZDUA 3GNIB 2QKWB 4ZXTA 3WYYA 4BCGA 5IA5A 2B1PA 4EOMA 2YM8A 4MWIA 4ZTLA 1PHKA 4UXQA 1QPDA 4RFZA 3U9CA 1OVEA 2PMLX 4PL5A 3QKMA 4X3FA 3QTZA 3IOPA 3HP2A 2YFXA 4FIEA 5D9HA 3W55A 4EOJA 3CJFA 4KIPA 4F09A 4GRBA 2CKOA 4QD6A 2BVAA 4KINA 1OKYA 1V1KA 2H8HA 3F7ZA 4EOSA 1YXXA 4MVFA 5CNOA 3UZTA 2DS1A 5CAOA 3UOKA 3VW8A 4FZ6A 2X8EA 3QZIA 4YGAA 1K9AA 1DAWA 2C6OA 2R4BA 4FV4A 3ZFYA 2BIYA 3IECA 2XK8A 3M42A 1YOJA 3FLWA 1OECA 4R8QA 3W16A 4EJNA 3TDVA 3FMLA 3CP9A 1JSUA 1CMKE 2XYUA 3ET7A 4U40A 4DT9A 4H58A 2ITTA 5BPYA 2WIHA 3UIMA 3PWDA 4D4SA 5AP5A 3AMYA 3O7LD 4LG4A 4P4CA 4NIFB 4WNMA 4YTHA 4FKIA 2JKMA 3BYSA 5GINE 5IU2A 3KMUA 4P90A 2HWPA 4YR8A 3S95A 2WMBA 3QFVA 2BAJA 1Q8WA 1KE7A 3PXRA 3R1YA 3BIZA 4LRKA 3HMNA 2OW3A 3ULIA 4ACGA 4YJQA 2B55A 4HGLA 4WBOA 4FT7A 1OIRA 3ZO3A 3GU8A 3GOPA 2CCHA 2O2UA 2C5OA 3N4TA 4IQ6A 2XP2A 3PP1A 4TNDA 2YJSA 5AX9A 4R6VA 2IN6A 3QXPA 1OI9A 4FT5A 2EXEA 4Y85A 4AT4A 4FIGA 1ZAOA 3GCVA 3TNWA 4TYIA 4BN1A 4JT3A 4NK9A 2XM9A 3VHKA 3F69A 3E8CA 4PTGA 5CNNA 3L9PA 4BIBA 2B54A 4KIQA 4JDJA 3JS2A 2AUHA 4TT7A 2XM8A 2Y6MA 3DJ5A 4YC8A 5HEZA 3AG9A 5AAEA 4DE4A 3I81A 3CPCA 4J99A 4AAAA 1EH4A 4CKJA 1NW1A 5AEPA 3P7AA 2P2IA 5LOHA 4R5SA 3LLAA 2C3IB 3D5UA 3DJ7A 3GC7A 2OJGA 2PTKA 3KFAA 4DFYA 4IM0A 2EB3A 4PX6A 1OUKA 3G90X 1KV2A 1H8FA 2W5AA 4PF4A 4EOIA 3R1QA 4KKGA 3TV7A 4ARKA 1A06A 3UG2A 3MPMA 1T46A 2HY0A 3RK5A 4FL3A 3PRFA 4MD8E 3UOJA 3AC1A 4XUFA 3OS3A 4CVAA 1UWHA 1H1WA 4JG8A 1W83A 1VYWA 4AFJA 4DGLC 1H1SA 1T45A 4EK3A 5HQ0A 5CAUA 3TI1A 4AA5A 3A4PA 3COKA 1JLUE 5HX6A 4DBXA 3GBZA 5HVJA 4DLJA 4IADA 4EONA 5DEYA 3KXMA 3DXNA 1NT2A 4QRCA 4DFBA 5DOSA 1H01A 3DQXA 5AWMA 2UW5A 3D14A 4IM3A 5F20A 1YWNA 2ITXA 4M69B 4JAJA 2Y9QA 4O0UA 4ANQA 1GZKA 4JJRA 4IVBA 4RA4A 3RNYA 2R3PA 4HCTA 4BBMA 5HCXA 4G16A 4KRCA 4IZAA 5ICPA 4BDEA 2IVUA 3LAUA 4QTEA 1FBNA 5JZJA 2ZV9A 2VO7A 3O8UA 2YIYA 3R9DA 4DH1A 2XK4A 5FEEA 3UMXA 3UMWA 2XIZA 2XRUA 3EHAA 2B7AA 5ANJA 5T3QA 2W1HA 3FKOA 3ORNA 4G34A 2QOCA 5AA8A 2QOQA 2BTSA 4IJ9A 4BCFA 1QPEA 4IAZA 2XNGA 4U81A 1ZRZA 3EQCA 3FQHA 4B9DA 3FMJA 1PKGA 4TYHB 4ZTRA 5KKRC 4L01A 3GOKA 2FSLX 5M4UA 3P78A 5I9XA 4Z9LA 4C2WA 5AADA 3G2FA 4X7QA 1OZ1A 3OEZA 2V5QA 4GFMA 3OZ6A 4HVDA 2RIOA 4FTRA 2VX0A 2OH4A 2XIKA 3I1AA 3WILA 3MWUA 4C37A 2PVJA 4LGHA 3MA6A 3DKGA 4IX3A 5AV2A 3ZUTA 5FGKA 4DA5A 5GJGA 2A19B 3MS9A 4E8AA 4QP6A 1W98A 1ZZ2A 2WMUA 4DAWA 2R3HA 5C8KA 3FZSA 3EYHA 5K4JA 4ZLOA 2X4ZA 3FZPA 3LVPA 5DH3A 4IDVA 3LW0A 3PSDA 3A7GA 1HCLA 5D7VA 5GNKA 2Z2WA 2VTJA 3MPAA 3II5A 2OFUA 2F49A 3NWWA 3AQVA 4AZVA 4YHTA 4DGNA 4UMTA 4RIXA 1R39A 4OBQA 5L8JA 3ZBXA 4FMQA 4B4LA 3MB6A 4IX5A 4CMUA 4M68A 1V0BA 2CMWA 5H8GA 4MQ2A 2GHMA 3IW6A 3CQWA 3QX2A 3V01A 4HYIA 2YN8A 4UWCA 5C9CA 5HIEA 3RP9A 2CKEA 3WF8A 4DFLA 2KTYA 3NW7A 4GFOA 2B9HA 5JGAA 1GAGA 3GC8A 4AX8A 3EFJA 1YXTA 3EKNA 3DTWA 3RJCA 3ZO1A 3COHA 4Y95A 1YI4A 3PPKA 4M14A 3FYKX 4PPCA 5CF8A 2BTRA 4MCVA 4QQ5A 4WO5A 3UIBA 4M69A 4D28A 2ZM1A 2V7AA 3DK3A 1Q62A 1JAMA 2W05A 2IVTA 5EQEA 1CDKA 2CLQA 4JRNA 3R7OA 3CGFA 1PXLA 4X3FC 4WUNA 3BX5A 4FKPA 3PXYA 4M84A 3C7QA 2OJFE 4ACDA 4XP0A 3F7WA 3W1FA 3QTRA 5AP1A 4RMZA 2JFLA 4NKSA 4PY1A 5TOZA 3OW4A 4FICA 4MBIA 4S32A 1OL6A 4YNOA 4C4FA 4Z3VA 2XUUA 5CF6A 4IDTA 4N70A 2GNLA 3WF6A 2PMNX 2UUEA 1TQMA 4YSMA 3FI3A 3QQHA 4PTCA 4E6CA 1JOWB 3PJ2A 5AP2A 5LVNA 1Q99A 2F2CB 3FEGA 2XRWA 3NPCA 4FSRA 4H3BA 4RIYB 5J87A 3TZMA 4AN9A 3R2BA 1WBPA 2FSMX 5FP6A 4XG9A 2CSNA 4FF8A 3PE1A 3LOKA 4CZTA 1O9UA 3KULB 4IM2A 3TNQB 5AP6A 4D5KA 5EDQA 1Q8YA 2LAVA 1A48A 5BYYA 3OROA 4BBEA 4BCPA 4KS8A 1WCCA 2PMOX 2CNVA 5CEOA 1CKPA 2BKKA 2XNOA 1UKHA 3OWPA 3BU5A 3GCPA 1LEWA 2R7BA 4GG7A 4RZVA 3T9TA 3FL4A 4HZRA 4O7NA 4OTGA 4BWXA 1Q8UA 2XNEA 3E8EA 1RQQA 3KQ7A 2YM3A 1Y91A 4O7VA 4EH4A 5C26A 2OXXA 4BIEA 3QHRA 3LFAA 4BDFA 1MQ4A 2ERKA 4FTJA 5ACKA 5CVGA 2P4IA 3R7VA 4EUUA 3PIYA 4O7LA 4DH8A 2R3GA 4JLCA 4I41A 2AC3A 3OUKA 5IDNA 5IQIA 4EI4A 4Y5HA 5TR6A 2V62A 2UW7A 3U55A 3C4EA 5CX9A 4AACA 4U0IA 3EJ1A 3I7CA 4GIIA 4TZRA 1ZY4A 4FOBA 5LMBA 3OHTA 4X2JA 5FG8A 2CGVA 5CU3A 4FKUA 3DLSA 4O0XA 4ZTNA 3ZU7A 4FV9A 3QLGA 4IAKA 2RSVA 3SD0A 3VHEA 3HMPA 3R21A 1DI8A 4OBPA 3VUKA 5J7HA 1XH6A 5HE1A 4YJRA 3I0OA 4V0GB 2I1MA 4BCJA 4CNHA 3G15A 4CKIA 2WMWA 2UW8A 4DFUA 1BUHA 4JR7A 2WIPA 4HCUA 3UP2A 1P5EA 3UNZA 3MVLA 3PY3A 4O0VA 4RWKA 4I3ZA 1U54B 2Q0NA 3NYNA 4TXCA 3NS9A 1YI6A 4YBJA 4M66A 3R9NA 5FTGA 4X2GA 4C35A 5DFPA 5A4CA 5GIPE 4GUEA 4FEVA 5LVPA 3FAAA 3MB7A 5JN2A 1Z5MA 4UYNA 4EL9A 2JBOA 3CE3A 4PPAA 3U4WA 4USFA 4GU9A 5JKGA 2R3RA 2IZRA 2VGOA 4ZLYA 1Y8GA 4RC4A 1JKLA 3PY0A 2YCRA 2ZV8A 4WSQA 4C02A 3E3BX 3Q4CA 3OT8A 3QD3A 4A9RA 4WG5A 5J79A 2OIBA 4OAVB 3O51A 4IVDA 4JX3A 2DQ7X 3DLZA 3SDJA 1G8SA 2PL0A 2Y0AA 4RIYA 4C0TA 3VUHA 3TXOA 2HELA 4I6HA 4BDIA 4DGGA 4I0RA 2QOOA 2UZTA 2UZNA 3ORMA 2UW9A 4YZMA 4IAYA 5EDRA 2IG7A 2R3LA 4EZ7A 3R01A 5AX3A 3ZZWA 4AWIA 1GZOA 4USDA 4XX9A 1NY3A 3QWJA 4GU6A 4JQ7A 4W9XA 3EQHA 4DT8A 5KMLA 3ZTXA 3VRYA 4D2WA 3HYHA 4DCAA 3VBQA 4FKRA 3RNIA 3P7BA 4G1WA 4O6LA 3Q4UA 4MF0A 2HYYA 4QMTA 5KMJA 4AW1A 4F9CA 1M17A 4U9AA 4UMUA 4U97A 3I6UA 3EWHA 3RPYA 3CTJA 3QKLA 5HO6A 2G9XA 1OKZA 2PVHA 4GH2A 3UODA 3ZUVA 4OAUC 2WTIA 5F94A 3DBDA 2VTLA 5C8MA 1JWHA 3BYVA 4L43A 5HU3A 5IQHA 1WAKA 4F63A 2EXCX 3OW3A 1VR2A 2UVYA 2BALA 2FSTX 3PJ3A 3QTSA 2W96B 4EEVA 3VS1A 3VW6A 3OP5A 3FJQE 4C34A 3A61A 3PP0A 2QO9A 5HX8A 3Q3BA 4CQGA 2CGUA 3W2PA 1X8BA 5E8WA 2ZB1A 3FI2A 5EDPA 1GOLA 4EK4A 3MTFA 4X0MA 4HNIA 2XKFA 3F2NA 4L68A 5K3YA 4YZBA 5FM3A 4UV0A 4QP9A 3ALOA 2XBAA 5AR3A 3TT0A 4R3RA 5HBJA 5HTCA 2VWBA 3FMMA 4IEBA 4JI9A 2R64A 3AC8A 3O17A 5B2LA 2C69A 2O0UA 4ZS0A 5E1EA 5HGIA 4HPUE 4QMMA 4QYFA 4FVQA 2JEDA 1ZYDA 1PYXA 1URWA 2HXQA 3ZFXA 3R7UA 5L2TA 3MVHA 3SVVA 4JL9A 4BI1A 1U54A 3MFUA 2GSFA 4JQEA 3B8RA 3ZM4A 3IDBA 4JG7A 3MFRA 2IW8A 5D10A 2C0OA 2R0IA 4FTIA 3R0TA 3DAJA 4IC8A 3W2CA 3FLNC 2G2HA 2X6EA 1P4FA 3OUNB 3KXHA 5CSHA 4NM7A 4YSJA 4BCMA 3QGYA 3K5VA 3DY7A 3TZ9A 2PVRA 5E1SA 1IR3A 5HLWA 3C5IA 3RALA 5E8TA 5D11A 1UNGA 3NYVA 3G9LX 4AT5A 2XS0A 2W5HA 3C1XA 1XQZA 2GS6A 1HCKA 3V5JA 1MUOA 4QTAA 3V8TA 3EKKA 5E4HA 3L8SA 1RE8A 1TQPA 2HK5A 3PFQA 3R8ZA 2VV9A 1XJDA 3B8QA 2ZM4A 3JY0A 1JNKA 4G5PA 4IFCA 4EZ3A 4ZLZA 4M97A 4OTHA 5T6KA 5CT0A 5CU0A 4YJNA 2X9EA 3OVVA 1UNHA 3I79A 3MFSA 3VNTA 2WMAA 4ACHA 2XKEA 5IQGA 5DA3A 2ZAZA 5CT7A 1U4DA 2XA4A 3F5GA 2R3QA 2UZWE 4RQKA 5FLFA 3ZUUA 4E5BA 1TVOA 4QMPA 3E87A 2BRNA 4B8MA 4ZSAA 3C51A 3I4BA 5EFQA 4D2SA 3BU3A 4K18A 4D1ZA 4P5QA 4DITA 4QOXA 5ETCA 5M56A 4I0TA 4EOQA 2ZOQA 3PA3A 4JAIA 2PUUA 4YJPA 4HVIA 1PYEA 4MHAA 4IXPA 2WEVA 1R1WA 2GS2A 3ZLSA 4GK2A 3UIUA 3KGAA 1IA8A 1ZZLA 3GGFA 4FSQA 4LUDA 4BCOA 4E4MA 5L3AA 2QC6A 3QXOA 2WEIA 3LFSA 5CZHA 1B38A 5JMSA 3AD6A 1XH8A 4EH7A 1V0PA 3I6WA 3DZOA 2BROA 5BUEA 3FXZA 3ZOSA 2JFMA 1M7QA 1OKVA 1DS5A 2HY81 2VTPA 2BR1A 4BDJA 1WVXA 4YC3A 1IRKA 4XG8A 4XV9A 5CAQA 3BU6A 3FMNA 3EIDA 3NIEA 3GP0A 4RVTA 4J96A 4D58A 3KU2A 3M1SA 3BQCA 2O3PA 1WBTA 5EM8A 2A27A 3O0GA 5BMMA 2XKDA 3TDWA 3P08A 3QRIA 1H08A 2PK9A 3DU8A 4KKHA 3NUNA 4QNYA 3VBXA 4BF2A 2PZPA 3F3VA 4OBOA 4XOYA 2NNWB 2UZLA 2X7FA 2ZJWA 3D83A 4QMXA 5IH4A 4EWHA 4NCTA 5A14A 4FODA 4LV8A 3TL8A 3QRTA 3C4ZA 4HVHA 5DLSA 1KE6A 5CSVA 3LM5A 3DFAA 2CNUA 3VBVA 2VWYA 2X1NA 3O7LB 4RFYA 3ROYA 3OC1A 4C3PA 3PLAE 5ANOA 1FINA 4N0SA 5E92A 3AD4A 4E73A 1QL6A 2RG5A 3DAKA 2P0CA 4EUTA 2V0DA 3DBEA 1WBVA 3EQBA 4H1JA 4JRVA 3QRUA 4BTJA 4EH6A 4U6RA 5BUIA 4NUSA 3B2WA 5HG9A 2W9ZB 1ZMUA 4LYNA 5EKNA 3AD5A 2B53A 4R7HA 4AS0A 2C4GA 3SXSA 2DYLA 2YITA 3R7GA 1ATPE 2FGIA 4MH7A 3EMGA 1R78A 3Q5IA 2C0TA 4BKJA 5AV4A 3R9OA 2YDKA 4AZSA 3FKNA 3MDYA 3IONA 4DFXE 3KRRA 3QD4A 3ODYX 3LJ0A 3QCSA 2YM4A 4I21A 3GFWA 2CDZA 2J51A 5IH6A 4PDSA 3W2OA 4FI1A 4ACCA 3UVPA 2X6DA 3QLFA 5ETIA 1WVYA 3DQWA 3LJ1A 5HO7A 3DPKA 3CSVA 3MBLA 1OIUA 3KN6A 2Y4IC 3NIZA 4O7TA 3FZOA 2IWIA 4LI5A 4QMOA 2EU9A 4NSTA 4IB3A 2UZDA 4F6WA 2OJJA 4XG4A 2GU8A 3N9XA 5J9LA 1J1BA 2ITZA 3H9OA 5GZ9A 3FZTA 3NUAA 4EC8A 4PDYA 1REJA 5C01A 4LOQA 4APCA 4XNEA 2GPHA 4EQMA 3DZQA 3Q52A 5KHXA 2RGPA 4G31A 2YABA 3CQUA 3N4UA 4DF3A 3PVGA 1LP4A 1VEBA 3U6JA 1PMUA 2OICA 4RJ3A 5JSMA 2WQNA 3FMHA 2HZ4A 2XZSA 2J9MA 5AUTA 3OEFX 1Z57A 3UIXA 2HZIA 2XYNA 5FBOA 2BHHA 2VO6A 4FKJA 2WZJA 5DIAA 3WF9A 2P33A 2OGVA 2G2FA 1PRYA 4U8ZA 2X7GA 4CD0A 4E7WA 2WMTA 4F1MA 1APME 5AV1A 3ZH8A 5C8NA 4O7RA 3KRXA 4CFXA 1PMVA 3BRBA 2XJ2A 3KCFA 3LJ2A 4BVUA 5AP7A 4MD7E 3HRBA 1E9HA 3RPVA 4JQ8A 4CLIA 1RJBA 2G1TA 3W33A 4O7WA 4N57A 4FIJA 4ALVA 3SGCA 3D94A 1P14A 3MY1A 2OSCA 3HAMA 3DB8A 4MF1A 1ZOGA 3GCQA 3UOLA 5B0XA 2ZVAA 3Q53A 4CG8A 3QRKA 4QMYA 4FTUA 2W06A 4GYGA 4EKKA 2J90A 3EQPA 5KMOA 5M57A 4UX9A 3C5UA 3P79A 3CC6A 4FV2A 4GG5A 4LGDA 2UZEA 3UPZA 1LPUA 1PXJA 3TKHA 5EW3A 3NW6A 5LMAA 3BGPA 4EOPA 4I24A 4O84A 3ZLXA 2WTJA 2Z7SA 3QAME 4L44A 4DBNA 3ZM9A 5IQEA 5CALA 2R9SA 1PXOA 4FK6A 4IAAA 4ONAA 3IGGA 3BWFA 4A4XA 5L2IA 1ZXEA 1M14A 4BTMA 4CSVA 5KBQA 3PSBA 3ATTA 3FQSA 3WBLA 3QQLA 4YBKA 3LM0A 3P7CA 2J2IB 5DT0A 2JKOA 3DT1A 4YTFA 3CJGA 2YEXA 5AUYA 3KN5A 2WB8A 3A8XA 5DGZA 1G5SA 3WE8A 4ACMA 5BYLA 5G1XA 1JKTA 3F2AA 5FXSA 2UV2A 1CKIA 4A7CA 4DTAA 1XKKA 1IASA 3UQGA 3PVWA 4RFMA 4G3GA 4CFWA 4ZY4A 2ZV7A 2QVSE 4KBCA 5AUWA 2O64A 5J5TA 2VTHA 4Q9ZA 2W1DA 1KE9A 3BYMA 2V7OA 3IPHA 5EHLA 5FXQA 2WHBA 3W18A 4A9YA 3A7JA 3ZEPA 5AM6A 4NM5A 2A4LA 3QQUA 2WPAA 1SNXA 3QHWA 3RWQA 4W4XA 3VS4A 2OI4X 1G8AA 4O81A 5FUTA 1OIQA 3SXFA 4TW9A 4C61A 4IZ5A 2WFYA 4F9BA 2R0UA 1I44A 5AMNA 1JQHA 5EQYA 4RQVA 4FEUA 4FV0A 4H3QA 4CTCA 4DEEA 4OGRA 4UB7A 5A54A 2VGPA 4L42A 1E1VA 3VS5A 1WBNA 4YZDA 5A6NA 3SA0A 4JR3A 4RPVA 1QPCA 3DKOA 5LCKA 2W17A 1S9JA 3LCTA 3MIAA 4RJ8A 3U51A 2JBPA 4EK8A 2PHKA 3QWKA 3R9HA 4RWLA 4IFGA 4FEXA 5L4QA 2F7ZE 2ITQA 4L00A 4DGOA 3QALE 2OWBA 3RI1A 3SHEA 5IH5A 3KREA 3R1SA 3PVUA 3L8PA 4F64A 5IA4A 5ACBC 4DG0E 5LCJA 4YTIA 3WZUA 1H1PA 1NVRA 2GHGA 5IQCA 4GCJA 2QODA 4QMWA 5CXZA 4U7ZA 3OCSA 4H05A 3MVJA 4D4VA 5I9WA 1YOLA 4E5WA 3CLYA 4B8LA 5AFVA 3NNVA 4HYHA 3PE2A 3BPRA 4WNOA 5IPJA 4R1VA 3GC9A 4L7SA 2CN8A 4D5HA 2VTMA 1K2PA 3LQ8A 1IEPA 4U79A 5KMKA 4EK5A 3QTUA 4PQNA 4FZ7A 3AMAA 4CRLA 4FSTA 2ETKA 3DOGA 4LOOA 1SNUA 3TNPC 3A2CA 4F7SA 1M52A 4UMQA 4XEYA 3RGFA 1NA7A 4NCTC 5HESA 3TJDA 4MWHA 4EOKA 4EH8A 1FOTA 3QZGA 3TZ7A 4CYJA 3NZ0A 2Y4PA 4J95A 3GU5A 4MD9E 3ORPA 4JNWA 3LHJA 4DEIA 3CTQA 3P0MA 4ZSLA 4BRXA 3CEKA 4TWCA 5DR6A 4PMMA 1SVEA 4EQUA 2JDSA 3EYGA 4FZDB 3MGYA 2BDFA 2BZKB 3LXKA 3QCQA 4ALUA 2R5TA 3FPMA 2H9VA 4QP1A 2QOLA 2R7IA 4UY9A 3UG1A 3RMFA 2QG5A 1SZMA 4U80A 2X0GA 2J4ZA 4ZZOA 4OT6A 1TKIA 1W82A 3CR0A 3CKWA 3NAXA 3R00A 4I6QA 5DYJA 4WNPA 4EH2A 1H1RA 2Z60A 4X2NA 4MEDA 1QPJA 1WZYA 4DFNA 5IISA 1J7IA 5FRIA 4G3CA 3JYAA 3HV4A 4RX8A 3ACJA 4G3DA 4IANA 4F1TA 5BX0A 3PPJA 4FG8A 4ZP5A 3NVKI 3ODZX 4PL4A 3V5TA 1DM2A 4KNBA 4ITHA 4A9TA 4UALA 3NUYA 1H1QA 4QMZA 5J9ZA 4EYJA 5CQWA 3VUGA 2BFYA 3A4OX 3ZRKA 3UNKA 4F0IA 3TZ8A 4EJ7A 3R02A 2CGXA 1DI9A 4GT3A 3GFEA 2C30A 3OTUA 4J97A 1GIIA 3WI6A 3BQRA 3FY0A 4YZ9A 1M2QA 2EUFB 2ETRA 4FYNA 4O2PA 2YA9A 3I0QA 5IUIA 2WAJA 2EVAA 3CS9A 3EQIA 3S4QA 4A4LA 4NJDA 5C27A 1F5QA 5CANA 5DRDA 3U6IA 4NIFA 3E8NA 4F65A 4MBJA 2XNNA 3SOCA 4H1MA 5HE3A 4CV9A 4EHZA 3PG1A 1LR4A 3ZSIA 2C1AA 3KVXA 2XK9A 5AV3A 3POOA 4UWYA 4XG7A 4QNAA 2WNTA 4BI2A 3VIDA 2PVYA 4R7IA 4KSQA 1ZOHA 1KOAA 3FBVA 5BMSA 3JR1A 3NAYA 5E7RA 4A06A 3PJ8A 4ZSGA 4RT7A 4O1OA 2ZMDA 2PUPA 4DTBA 4NH1A 2OXDA 4WHZA 4XG6A 4Y46A 3OF0A 4LUEA 3TV4A 4RX5A 2B9JA 2BMCA 5EH0A 1U5QA 3DFCB 2VWIA 2XNBA 3EQRA 3NSZA 5BVFA 2CKPA 3BCEA 4ZJIA 3ZC5A 4UMRA 5HNIX 3DK7A 4X6RA 4PPBA 1GZNA 3IW5A 5CI6A 3LMIA 2O63A 4OT5A 4ZTMA 5CEMA 2RFEA 1URCA 2C6MA 4HCVA 4W4YA 3QUEA 4E1ZA 5L2SA 3NMUF 1P4OA 4FBXA 2ITUA 2YACA 4LMNA 4FTOA 4C4EA 1OPJA 3BEAA 3UYTA 4R1YA 3KXZA 1CKJA 1XHAA 3HVCA 4NFNA 5KMNA 4I92A 4ZS4A 3QA0A 4BYJA 4F70A 4CLJA 4QPMA 4Z55A 5EOLA 2PPQA 4FV1A 2W1ZA 1WBSA 3ANRA 1VJYA 3H4JA 4C59A 4YC6A 1YXVA 5CAVA 5HLNA 3I60A 2ONLA 3TUCA 4O82A 2ZDTA 2C3KA 4MK0A 4ZZMA 2VWWA 4DINA 5M4FA 4FV8A 1L3RE 3BWJA 4FIHA 3MH3A 4MNFA 3EB0A 4FKQA 2VX3A 4I5MA 4JDHA 3V6RA 4LFIA 3ORZA 2JDVA 3P23A 4DH7A 3JUHA 3NCZA 2WELA 2ZYBA 2IO6A 4D9UA 3EN5A 5CEKA 5IEXA 3MH2A 5AV0A 3FLSA 1P2AA 5I9UA 1Q24A 4KIKB 4ANLA 3I5ZA 2WGJA 4JVGA 1Y57A 3C4FA 4IAFA 3VWAA 4FA2A 5GIOE 3LKMA 2WMVA 2UZBA 4OTPA 2UVXA 4YPSA 1RDQE 5HU9A 4CYIA 4XMOA 1ZYLA 2UW3A 2BDWA 3EN4A 3OWLA 4CCUA 4NJ3A 3GXLA 2BZJA 3F6XA 2VU3A 3R8MA 4FTLA 4DH5A 4O86A 2OFVA 3D15A 3LFDA 4KS7A 3TACA 3ZYAA 4FSNA 1VZOA 3BI6A 3PRIA 5I3OA 2YERA 3MW1A 2ZMCA 4C3RA 2CKQA 2NRUA 5JRQA 3RM7A 4BDCA 5HNBA 3QQKA 4ZK5A 5AAFA 2XK3A 4EWQA 5H2UA 5AJQA 2OK1A 5K5NA 4I22A 4LRMA 3MJ1A 5I5ZA 2BRHA 3FC2A 3EZRA 5HE2A 3HAVA 2ERZE 5FTOA 4L67A 4TYHA 4Z7HA 3VF9A 4PUZA 4D4RA 1M2PA 4D0XA 3S2PA 5AA9A 4O22A 1PXPA 4OTQA 2AC5A 3G6HA 2GNJA 3FI4A 4PP7A 2I7QA 5M53A 3VS6A 2X2MA 4MXXA 2JLDA 3PLSA 3MV5A 5M55A 3LLTA 4RBLA 5LVMA 4HJOA 3E62A 4I5HA 4QTCA 3RK7A 3TN8A 5AR2A 3PSCA 4F7LA 5KBRA 5A4EA 4F7JA 3EQFA 4WOVA 2PVLA 2BRMA 3UC4A 1DAYA 2PVKA 4DEAA 1TQIA 4AOTA 5IMXA 5AIRA 3IG7A 1AGWA 4J7BA 4K6ZA 3R71A 3SX9A 3E63A 3EN7A 3KXGA 2VNWA 3G5DA 4EHEA 4AT3A 4USEA 3NUPA 3SW4A 3E88A 4L3PA 4XHKB 4KUJA 3VQUA 2RF9A 4LGGA 4E93A 3LXNA 3WE4A 2VX1A 1KWPA 2UZVA 1KV1A 4AA0A 3Q5ZA 2EWAA 4C36A 3FWQA 1YXUA 2IZSA 3HDMA 4QP8A 2C6EA 3WZDA 3UOHA 4FEQA 3QF9A 2GMXA 3E7VA 4FKSA 3ZO2A 4HGTA 2Y8OA 2FH9A 2PZIA 4FL1A 3ITZA 2WU7A 2XF0A 3PXZA 4AZEA 4CMTA 2PU8A 4X21A 2JDOA 3EL8A 3BLHA 2R3FA
chains in the Genus database with same CATH superfamily
3OCGA 4GKHA 2GFSA 3NCGA 4N6YA 5L8LA 2WQMA 4FX3A 4K77A 4BDHA 4I93A 2VUWA 4QYEA 4X2FA 4U5JA 2GNFA 3D5VA 3OG7A 4BBFA 2LGCA 4OR5A 2OKRA 2R3MA 5DBXA 4I5CA 3R8VA 4FKVA 4ITJA 3HV6A 3S00A 2W9FB 5EHOA 2ZFYA 2VTAA 3NGAA 4TWOA 3UVQA 5I9YA 2P55A 4BDKA 3Q2MA 1ZLTA 1ZYSA 4C4JA 3AT4A 4IX4A 3KIOC 4Y5QA 4IB0A 4N4SA 2C6IA 5C4LA 2PVNA 2YM7A 2XBJA 4MXAA 4M13A 5E8SA 5JK3A 3BLRA 1Y6BA 3BE9A 4AXFA 2YLFA 4O21A 5HI2A 1SYKA 2QD9A 2CCIA 4NTTA 4D4YA 2YWPA 4K9YA 4BKZA 2C6KA 5LVOA 5HLPA 1H26A 2GQSA 2WMRA 3P4KA 4UEUA 3T3VA 3BYUA 4BCHA 3VAPA 4M3QA 3HP5A 4IB5A 4C2VA 2H34A 1Q3DA 5LMKA 4QP4A 2J7TA 4F7NA 4O6EA 1UU8A 1OPKA 3IS5A 1KSWA 4MYGA 2VWXA 5FWKK 4QYYA 3F9NA 3ZONA 2X0OA 1FPUA 4FGBA 4CXAA 3W0NA 3KULA 2OXYA 4RJ5A 3ACKA 3R1NA 5HTBA 2Q83A 3BGQA 3FLQA 5IG1A 4F9WA 5LXMA 3K2LA 3F82A 3GU7A 1XR1A 4BDDA 5IUHA 4BFMA 2W99B 3N51A 4AA4A 1XBCA 2QNJA 4BYIA 4TRLA 4CRSA 2VWUA 2J0KA 3F2RA 3ORIA 4G5JA 3G51A 4GK4A 4BCIA 3GENA 4IAIA 5IQDA 3MYGA 3PA4A 2I0YA 4BICA 2WQOA 3FQEA 2X39A 3GVUA 5IQFA 5CSXA 2O8YA 4F1OA 5EM7A 3TWJA 3QGWA 2YAKA 5CSWA 3F5UA 3O23A 3Q6WA 4FK3A 4FNYA 5DR2A 5HIBA 2YCFA 3H30A 5GZAA 2GDOA 1CSNA 5L2QA 4D1XA 5HIDA 4AOJA 2WOUA 4ZTQA 4QMQA 4FKTA 2QO2A 3HECA 5FEQA 4AN2A 2BCJA 2E2BA 3CBLA 4BZNA 4R3CA 4AGUA 3V51A 3NNXA 4JIKA 4Y83A 3AGMA 4EKLA 3ORKA 4YU2A 5CQUA 3ZDUA 5EYMA 4D55A 4C4GA 1KE8A 1PXNA 2RFNA 2UZOA 4F08A 5DMZA 3V6SA 1PXIA 1XWSA 4V0GA 3ZO4A 1YHVA 3UO5A 5ANEA 4RWJA 1H07A 3EZVA 4KIOA 4NL0A 2ONLC 3LCOA 4OW8A 5EHYA 4C62A 5ANGA 3D9VA 2PZ5A 4TL0A 3F61A 4JG6A 3EN9A 4E26A 3OXTA 2G2IA 2W7XA 3C0GA 4WUAA 2WTCA 4S34A 1Q41A 4IHPA 3A7HA 3G0EA 3SKCA 4DFZE 4FKOA 4RVMA 3H0YA 4ANBA 1OL7A 3RK9A 1FVRA 3DAEA 5HBEA 1NVSA 4UZDA 3O5AA 3RPSA 3F66A 5L2WA 3F5XA 1F3MC 2HCKA 1WFCA 4FVPA 4EK6A 3W8LA 3VS0A 1B6CB 1JSTA 3T9IA 3DV3A 5BQ0A 3LCDA 4ALWA 5AR4A 3UBDA 1M7NA 2BZHB 4QMSA 4AGCA 5A6OA 1XBAA 2JD5A 2P3GX 4RX9A 4BR3A 3H9FA 5IQBA 5C4KA 4FT9A 5TE0A 4XRJA 3GQIA 4RVLA 4RC3A 5IMEA 5JQ8A 4C7TA 2QHNA 2PUIA 3HZTA 3IGOA 4GK3A 3L9LA 3PWYA 3JPVA 4Q9SA 3UNJA 3GC0A 3BZ3A 3VUMA 5JFXA 5E8ZA 5DPVA 1UU9A 2REIA 5A46A 3U87A 4F4PA 2OO8X 3FUPA 3E92A 2VZ6A 2W1IA 5D41A 3OMVA 5AR8A 3OY1A 4JDKA 3BGZA 5IA2A 2NRYA 3KF7A 3LFFA 3VC4A 5AUXA 3TKIA 3IDPA 3VS7A 4UYAA 5TO8A 3TV6A 3VBWA 3AXWA 2QKRA 3QTWA 4O1PA 4XLVA 4H36A 5CVFA 5HCYA 4WA9A 5E8XA 2ITPA 3QQJA 4RJ7A 4D2TA 5EM5A 4RX7A 4K2RA 4Q2AA 3CCNA 3SXRA 2R3KA 3AC3A 4K0YA 4QP2A 2W1FA 2XMYA 2OLCA 2IEWA 3DDPA 2XAMA 3R63A 3BV3A 3KMMA 4AE6A 3R28A 2JKQA 4L52A 1H00A 2I0VA 3EFLA 3ENMA 5BYZA 1WBOA 1IAJA 3BV2A 3E5AA 4NT4A 5HBHA 3C13A 4AN3A 4KBKA 4RLKA 5JQ5A 2A98A 2FUMA 4QT1A 5M09A 4E4XA 1SVGA 1OBGA 2PZRA 4L53A 4AXAA 5E8UA 3PVBA 4XLIA 3LE6A 4E6DA 1U59A 2VAGA 3AC2A 2QG7A 5C03A 3F3ZA 3V5WA 3S0OA 3L9MA 1L8TA 3QKKA 3P1AA 4BDGA 4E5AX 2YCQA 2CGWA 3BHVA 3KCKA 4G6OA 3UP7A 4FZAB 3ORLA 3GUBA 5KMIA 4OTWA 2GFCA 2VD5A 2XJ0A 5CI7A 2B4SB 2C5XA 5EM6A 5I0BA 5CEIA 5DNRA 2GQGA 4RJ6A 1Q5KA 1FMKA 4QYGA 2JIUA 5M06A 4S31A 4XBUA 4B7TA 3R7YA 2XNPA 3L8XA 5JGDA 1PMEA 5DE2A 1Q8TA 3MJ2A 3ZZEA 4ASZA 4ASXA 4RA5A 5KKRB 3R83A 3HEGA 5HKMA 3HMIA 5HVKA 2BILB 3IW4A 5LWNA 5D7AA 4LQMA 5J1VA 4FSYA 3R8PA 4DC2A 3KRLA 1YI3A 3QUDA 4QP3A 1OPLA 2YIXA 3W32A 2HOGA 3DGKA 1OIYA 4MXYA 4DEDA 4JBQA 3QCXA 4O7SA 3TNIA 3Q32A 2OZAB 4Z7GA 3FZ1A 4L7FA 3FYJX 3OXIA 4YO4A 2QOBA 2VTNA 4CKRA 4U3YA 1XMLA 4ERWA 4ZEGA 4ZIMA 3VJNA 3LMGA 4P5ZA 4PMPA 2RFSA 4ENXA 3R9RA 4G9CA 4FC0A 5JGBA 3C9WA 2Z8CA 3PIZA 2JKKA 2QR8A 2SRCA 3L9NA 3P9JA 2OH0E 1UVRA 4LM5A 3R8UA 3SAYA 5CU2A 4MX9A 2IPXA 4BCNA 4BJJB 4NM3A 4GEOA 2Y7JA 3A99A 5LMKC 5BVWA 2YCSA 3RCDA 4K8AA 4EH3A 5HE0A 2XCHA 3OWKA 4FIFA 3AT2A 4FGRA 4NW5A 5DN3A 4YHFA 3TUDA 2C5VA 2XEYA 3VBYA 1AQ1A 2WQBA 5B7VA 4DEGA 4RZWA 3FC1X 2XIRA 3OT3A 3WZKA 1J7UA 1UKIA 4F9YA 2I6LA 3ETAA 5GJDA 5AUVA 5K9IA 4YUQA 3HV5A 2Y6OA 4I23A 3TYKA 4FTMA 4KB8A 4MXZA 2EXMA 4E20A 3O2MA 5M08A 4A4OA 3EQDA 1YHWA 2HZNA 3H0ZA 4IWQA 4MNEB 4GYIA 2PYWA 3ATSA 2YLEA 4DN5A 4GS6A 5G6VA 3PPZA 3PA5A 1YHSA 2NP8A 3GU4A 3NYOA 5FEDA 2RFDA 3ZXZA 4BB4A 1W0XC 3FMKA 3QQGA 2VTIA 3G9NA 4O0RA 2CHLA 4QMUA 4U42A 1FQ1B 3WOWA 4HOKA 2WU6A 3DTCA 5HORA 2FVDA 4FTKA 2WOTA 2V22A 2IVSA 3S3IA 4ASEA 5KO1A 4I0SA 2W1GA 2GHLA 3FMEA 4C38A 3P5KA 1O6YA 1CTPE 4NEUA 4IJPA 5CYIA 4YURA 3BL7A 3SRVB 2W1EA 3PXQA 4I5PA 3W0RA 5KZ0A 2E9PA 3MI9A 2HW7A 4GJ3A 1OKWA 5I9ZA 4YJVA 3WARA 4CQEA 5E8VA 5B2MA 4NYEA 3PIXA 1U46A 4EYMA 3QYZA 4F0GA 5FD2A 4MXCA 4JS8A 1HOWA 2ACXA 4I6BA 3OY3A 5KNJA 2GCDA 2XK7A 1NVQA 4FVRA 5FDXA 1JBPE 2UW0A 4II5A 2OZAA 4HW7A 3D0EA 4GIHA 4ZY6A 4N6ZA 4V04A 3T8OA 1H24A 2O5KA 1PXMA 3EQGA 3KK8A 4FG7A 4I4FA 4WKQA 4YLJA 2QOIA 5BNJA 3FZRA 5M51A 4O27B 3C0HA 5CEPA 4O7YA 5DHJA 4L46A 2YZLA 1KOBA 4G3FA 4ORKA 1ZARA 1M2RA 2WTWA 3ZLWA 4AGWA 3RVGA 5JRSA 4IVCA 1ZMVA 2IF8A 1R3CA 4FNWA 2JC6A 2ITYA 4AOIA 3QC4A 3VS2A 2JAMA 3HRCA 4YLLA 4CFUA 2FO0A 3KVWA 4XS2A 1G3NA 4OTIA 4V05A 2ETMA 2XNMA 3NUXA 2PULA 4O7ZA 2W4KA 4XG2A 2KULA 2PWLA 2GNHA 1YDSE 2FB8A 3FXWA 4MQ1A 2C6LA 4TN6A 2PMIA 3PXFA 2BRBA 4ZAUA 5J8IA 2W0JA 2X0QA 1YVJA 4GSBA 4NKAA 2YAAA 4O38A 4YZNA 3QD0A 4PDPA 2FA2A 5DWRA 3H10A 3UDBA 3NDMA 2WTVA 4ENYA 3UE4A 3PZHA 3AOXA 2XVDA 3GQLA 4I6FA 3C0IA 1ZYJA 4D2VA 2JITA 4KAOA 2VNYA 3ELJA 4GMYA 4KABA 3LFQA 2IVVA 1OGUA 3IO7A 4FT0A 4HGEA 4MNEA 5CU6A 3QBNA 4YNEA 4BDAA 5CASA 5IF1A 2XK6A 4AP7A 3O8TA 1NXKA 2F4JA 3NUSA 5HZNA 3PFYA 4L3JA 3B2TA 1OM1A 3RKBA 4CFFA 3VO3A 4QO9A 2PZYA 3OFMA 2OBJA 2GNGA 3DKFA 4I4EA 4L45A 4RC2A 4O91A 4DEHA 4NWMA 1YDRE 4AE9A 1PMNA 3DBQA 4XH6A 4DCEA 5JFWA 4G2FA 3ZS5A 3KK9A 1YOMA 4D2RA 3HMOA 5EOBA 4E4LA 4ID7A 2B52A 2C1BA 4GFGA 5AUZA 4MKCA 2YIWA 2GS7A 2XIYA 3NYXA 3VJOA 3FL5A 5ETFA 4PL3A 4EBWA 2PE2A 2YDJA 1U5RA 1A9UA 4PWNA 3SRVA 3UC3A 3UPXA 2BAKA 3R73A 2OIQA 3H9RA 3UZPA 5DR9A 2YM6A 2QOHA 4Q5EA 3F3WA 2G01A 4YO6A 4AF3A 1F0QA 1ZOEA 5AAGA 2Q0BA 4MXOA 4O96A 1BI8A 3HUCA 4W8EA 5C1QB 3I7BA 4U43A 4I20A 2PVFA 4FTQA 3U8WA 1GY3A 2OF4A 2J0IA 4FG9A 3U6HA 2P2HA 2OG8A 2FYSA 4TYGA 4PNKA 3DNDA 4FV7A 2FSOX 3MH0A 3MA3A 5DG5A 5F4NA 3QU0A 5EYCA 2WQEA 1Y8YA 2E9UA 4AUAA 4HNFA 3U9NA 1PY5A 3K5UA 3W2SA 4F9AA 4GT4A 4J8MA 4ZSJA 4I94A 4ZTHA 5H8BA 5A4QA 2GTMA 3FSKA 4FZFB 2I40A 3K3IA 2C6TA 4W4VA 1UU3A 2VTRA 2X2LA 3NUUA 3R04A 3PDTA 2Z7QA 2VWZA 5BV3A 3BBWA 4WD5A 1OMWA 2QR7A 2W5BA 1WVWA 5E9EA 1Q3WA 3FKLA 3JY9A 4ANSA 3R7EA 2YJRA 3QCYA 5FXRA 2IZUA 5A3XA 2BHEA 4AZWA 3OOGA 4WG4A 4OLIA 4AG8A 3OCTA 2BPMA 1PW2A 3MY0A 3R8LA 3FV8A 4FL2A 5D12A 3FI8A 4QTBA 4M0YA 1FGKA 3ROCA 3NW5A 3ANQA 3DDQA 3ORXA 4TY1A 4QMVA 4EOOA 4BI0A 5BVNA 5IKWA 2Z7RA 2VWVA 4U3ZA 3N4VA 1BI7A 4RIXB 4DHZA 3U54A 4APPA 3WIKA 3HDNA 2VTSA 5FBNC 3ZXTA 5T68A 4Q5HA 4IW0A 4ZMFA 4G6LA 4GT5A 3COMA 1GJOA 3OBGA 5FM2A 3W10A 4BL1A 4H39A 2J50A 3E7OA 4ZZNA 5ANDA 4Y8DA 3IW8A 2WMXA 5K5XA 2BZIB 3OXZA 4FKLA 4IE9A 4PNIA 2QLQA 1YWRA 2BKZA 4BTKA 2OZOA 4QMLA 4J8NA 3TTJA 4A9SA 3V8WA 4BGQA 3SG8A 4ERKA 3FSFA 3KA0A 5I4NA 2WXVA 3TKUA 5CAPA 2AQXA 2ZB0A 5A9UA 2XAOA 4RVKA 3MN3A 4AW0A 1MQBA 2AYPA 4CFMA 4FE2A 2W1CA 2XJ1A 4EBVA 5JH6A 2X9FA 2J0MB 2C68A 5KCVA 2IW6A 5EYDA 5L6PA 1B39A 4ZJJA 3MTLA 1V0OA 4YHJA 4EH5A 3PXKA 5IEVA 3PUPA 1UU7A 4WT6A 5AP0A 4DGMA 4IZYA 1R0EA 1Z9XA 3HA8A 3RWPA 3DBFA 1S9IA 3A62A 4WBBB 1YKRA 4M67A 5DRBA 2B0QA 5IQAA 5IA0A 3D7TB 3G6GA 4KA3A 3QYWA 4NU1A 3H3CA 3MIYA 1Q97A 4BC6A 4FIIA 3QQFA 5JFSA 3OBJA 5BVKA 3EFWA 4YJUA 5F95A 4ITIA 4YMJA 4B99A 2YISA 4HYSA 4AFEA 5CF5A 5IDPA 4GUBA 4XP3A 4NTSA 5DT3A 4JOAA 2YIQA 4FTTA 2YHVA 3CD3A 4LMUA 4YP8A 3WIGA 5J1WA 3MESA 3HNGA 1OL1A 4ANNA 2XH5A 5LWMA 4AXDA 2PY3A 4FYOA 4W4WA 3SOAA 4BDBA 4Z16A 3D5WA 4S33A 4AGDA 4CG9A 4G9RA 3LQ5A 2C3LA 2YZAA 5CZIA 5BUJA 3AC4A 4PP9A 1QMZA 3LXLA 4MBLA 4FNXA 4DG2E 2PE1A 5CXHA 4XOZA 5J9YA 4IIRA 4BWKA 5M07A 4FV6A 4LDTA 4AQCA 3HRFA 1REKA 1J3HA 3CIKA 3HA6A 3Q9YA 3K54A 5IZFA 2CPKE 5KX8A 5KE0A 4YJSA 3R30A 4K1BA 4J52A 4GVAA 2X7OA 3WZJA 4UZHA 5EYKA 5L8KA 4B6LA 5K0XA 5H9BA 2BUJA 2ESMA 2EB2A 4M15A 4YTCA 4RGJA 3KKVA 3NNUA 5GJFA 5HO8A 4FSMA 1XMMA 3DK6A 4MTAA 1OBDA 3NEWA 2J5FA 3QC9A 4IX6A 4CFNA 3ZSHA 5I3RA 4I1ZA 3UQFA 2X0PA 5J95A 4IWPA 4BWPA 4CT2A 2Z7LA 3A7IA 1MRUA 2GTNA 4JBVA 5CU4A 3TNHA 3UQCA 3LFBA 3Q6UA 4DEBA 3RPRA 5E8YA 2QU6A 4CMOA 5IA3A 4LOPA 4S30A 4XJ0A 2HWOA 3OD6X 3W2QA 5CWZA 4D0WA 3C4CA 4K33A 1OL2A 3NRMA 4V01A 3VBTA 3D7TA 4HZSA 3LCSA 4O2ZA 1GIJA 2IZTA 3BLQA 4OTFA 2WMSA 4PRJA 5GHVA 4QQTA 2PVMA 2BDJA 3NR9A 3S1HA 3KC3A 4EC9A 1W7HA 3OTVA 2C5YA 4Y73A 1PXKA 2Y4IB 1YWVA 5JEBA 3VUDA 3VUTA 3KRWA 3BE2A 5AR7A 5HICA 1R0PA 3TTIA 1ZMWA 5EI8A 2G15A 2OJIA 3MPTA 3QRJA 2X8DA 4IH8A 4TNBA 2YDIA 3BYOA 3D4QA 4FNZA 3VQHA 3DNEA 5HVYA 2F57A 1UWJA 1YRPA 1Q8ZA 4RIWB 3TG1A 4TYJA 2IW9A 5HHWA 2NYAA 4GVJA 4E3CA 3DXPA 3VN9A 4KRDA 3HUBA 3SV0A 4JXFA 4IZ7A 4H3PA 4WIHA 3FE3A 2VO3A 5J5SA 3EH9A 3R2YA 1H0WA 3CPBA 3IDCA 4HYUA 4WG3A 4KIKA 3TCPA 5KHWA 1XH9A 4QQCA 2A1AB 3BHYA 4U45A 3TEIA 2V55A 4FSWA 5K4IA 4YZCA 3RAHA 5FQDC 2XKCA 4U44A 3SQQA 4F0FA 3IOKA 3JVRA 4IB1A 3THBA 3ZMMA 2OU7A 4IACA 5A4LA 4DDIA 5F9EA 3TUBA 3KMWA 5LARA 3G0FA 1YQJA 5CVHA 3C4WA 5CLPA 4RJ4A 2JAVA 2UZUE 4AZFA 3MSSA 3OOMA 3OCBA 5ITAA 4YLKA 2WTKB 2XCKA 1SMHA 3KF4A 3ZCLA 2CNQA 4EOLA 2Z02A 3CKXA 3LIJA 2ITNA 3CY3A 4KD1A 3LPBA 4Y72A 3BHTA 5HD4A 3BBTB 3O96A 1JVPP 3MH1A 4HPTE 1H25A 3VS3A 2NPQA 3G33A 4IMYA 4GJ2A 2HW6A 4D9TA 2C6DA 3FHIA 5IUGA 4CGAA 1UV5A 1PKDA 4FV3A 2JIVA 2UW4A 1ZWSA 2E9NA 3DB6A 3ML1A 2QHMA 3GU6A 3NX8A 2A2AA 4J1RA 4UMPA 4J71A 1FVVA 2DWBA 3EFKA 3HV3A 5A4TA 1TZDA 3A7FA 3GCUA 4CZUA 2QO7A 1QCFA 3CTHA 4O0WA 3D2KA 4LRJA 3ZRMA 1AD5A 4P2KA 4HVGA 2CLXA 1XBBA 2B9IA 4QPSA 2IJMA 5HD7A 4M12A 4P7EA 3SLSA 4BIDA 3QA8A 2VO0A 4K11A 3PYYA 3UTOA 1H27A 5EK7A 4R7BA 4CZYB 3TJCA 1STCE 2RG6A 3NVMB 3Q9WA 3VUIA 3IKAA 4R3PA 3UO6A 3E64A 3ULZA 4QDVA 2X4FA 4YJTA 5AP4A 5LQFA 2HIWA 3RHKA 1JPAA 2E9OA 2F7XE 5AM7A 3GT8A 5EI2A 4WNKA 4DTKA 3QZFA 5CSPA 4RIOA 3RM6A 4RIWA 4QQJA 3UGCA 4L6QA 2I0EA 3HX4A 3PTGA 3FY2A 4UBAA 3VRZA 3QUPA 4DG3E 2F9GA 3F3TA 3PY1A 5J7BA 4FTAA 1H4LA 4XV3A 4PDOA 1JKSA 1IG1A 3TIZA 4G3EA 4JX7A 3Q04A 1GIHA 1OUYA 4J53A 5ETAA 1Q61A 1ZY5A 4F6UA 4KBAA 5JZNA 3ZLYA 4FR4A 4YJOA 3P86A 3BHHA 1BKXA 3F3UA 3EOCA 4IWDA 1H0VA 4DHFA 1TFFA 4ZMEA 2GQRA 2F7EE 3DA6A 3CXWA 3E3PA 4QDEA 4XCUA 5CS6A 3D7ZA 2DUVA 3E8DA 3JVSA 4PMSA 4QPAA 5TF9A 2QLUA 3RTPA 1LEZA 1J91A 1CM8A 4JIAA 3VULA 2YIRA 4NZWB 4E4NA 1FGIA 1FVTA 5GZ8A 4GL9A 5JFVA 4W9WA 5L6WL 4HGSA 2VTOA 3RAKA 4AU8A 4LV5A 1ERKA 4TTHB 5M4CA 2R2PA 5HOAA 5EI6A 1Q4LA 3V5PA 5H3QA 4FTCA 3POZA 3QD2B 4ANOA 2JIIA 4JBOA 2O65A 4C33A 1H28A 4E6QA 3LMHA 2WO6A 3KXNA 3KXXA 4KSPA 3UJGA 4BGGA 3M2WA 2ZM3A 3D2IA 5K0KA 3ID6C 4UN0C 4JDIA 3TIYA 5JT2A 3BHUA 4BHNA 2OF2A 4BZOA 2NO3A 1IAHA 4W8DA 4X6QC 2R3NA 4C3FA 4C57A 3IW7A 3O50A 4BZDA 2C5NA 1YXSA 3FXXA 3LFNA 3V8SA 3RPOA 3SG9A 3QL8A 4FTNA 4CT1A 3FMDA 4EZ5A 3MY5A 3FPQA 4TPTA 3CD8A 4EORA 3VF8A 4EHVA 5HCZA 1PF8A 4ZJVA 4DHJA 3BELA 2CN5A 2VTQA 3KRJA 2A0CX 3WF7A 5AR5A 2VTTA 4FOCA 2BIKB 3DCVA 4U41A 2BFXA 2R3JA 3KL8A 3QTXA 4FKGA 2B9FA 3QTIA 4CV8A 1OB3A 5L6OA 1KUTA 4RSSA 1I09A 2QOFA 5CEQA 3Q96A 5DI1A 3R7IA 3OWJA 2UW6A 4QYHA 2ITOA 3GB2A 4RG0A 4QTDA 3UZRA 4O4EA 4X2KA 4MAOA 2QONA 3IK3A 3ZDIA 5LJJA 3GI3A 3KY2A 4R5YA 4M0ZA 4QEBA 4F6SA 4PV0A 5AP3A 3PG3A 2OIDA 4R77A 3GEQA 5EW9A 1ND4A 3DS6A 4A9UA 3RHXA 2XEZA 5TT7A 4BY9E 3Q9ZA 4FSUA 4EH9A 2XIXA 4QMNA 3M11A 4GW8A 1WMKA 5BVEA 1BYGA 4RLLA 3SW7A 2HXLA 1RW8A 3LFCA 4DYMA 5KUPA 4BHZA 5HTIA 3RAIA 3PZEA 3KB7A 5H8EA 3V5QA 2WKMA 1XO2B 2ITVA 3MVMA 4IC7A 2YWVA 4S2ZA 3REPA 1BL6A 3C4XA 2VN9A 3WZEA 5ANIA 3ALNA 3BKBA 1ZYCA 2WMQA 4O0YA 3AT3A 4FKWA 3W0MA 5KMMA 4DH3A 4CFVA 1JKKA 3LZBA 1OITA 1BL7A 2HENA 3WYXA 3QX4A 1XH5A 3COIA 3ZBFA 4BCQA 3L8VA 1VYZA 2OJ9A 3ZSGA 3Q4TA 3NLBA 3RZFA 4BKYA 3BEGA 2E9VA 2QCSA 5AIKA 2H96A 3QTQA 5LVLA 3BLAA 3TM0A 4RWIA 4B0GA 2CJMA 5IEYA 1KE5A 3DXQA 3U4UA 3HKOA 2X8IA 4FUYA 4UXLA 2W4JA 3ZHPC 4ASDA 3UYSA 3PJCA 4L8MA 2QU5A 2PSQA 2F2UA 1XH4A 3P5JC 4TWPA 5FTQA 1BMKA 2H6DA 1MRVA 2HAKA 3CY2A 4IWOA 2PUNA 4M7IA 4IVAA 4XBRA 5HG5A 2BRGA 3UVRA 4G17A 2X2KA 3FLZA 3LQ3A 4OTDA 4J98A 4FUXA 1YW2A 3Q4ZA 2W4OA 4OUCA 4KWPA 3ORTA 4FV5A 4PMTA 2JDRA 2QQ7A 3L1SA 4FEWA 4O0TA 2JDTA 3HMMA 3AGLA 3T3UA 3V04A 3Q9XA 2QURA 2R3OA 3RCJA 3W8QA 4C58A 4KKEA 3PJ1A 3V3VA 4BGHA 3ZEWA 3AC5A 1SVHA 3FHRA 3ZFMA 1YDTE 3ERKA 4C4HA 4XYFA 3FLYA 4X3FB 4L9IA 3F5PA 4D2PA 3E93A 2QOKA 3I5NA 3F88A 1XH7A 4XP2A 4HVSA 2I0HA 3V5LA 5EG3A 4GV1A 4O83A 5HG7A 3Q2JA 5D1JA 3RINA 2QI8A 5F1ZA 2YM5A 3R22A 2WD1A 3EN6A 4CTBA 4NFMA 4UWBA 5IA1A 4XV2A 4ZOGA 3GCSA 5CY3A 4OTRA 4WRSA 4C8BA 3DKCA 3DBCA 4AW2A 2BAQA 5CENA 5EKOA 4IBMA 4ZTSA 3UO4A 4F99A 5BVDA 5M44A 4DHIB 2RL5A 3LXPA 1MP8A 2ZV2A 3AKJA 4TWNA 2R3IA 4YPDA 5KZIA 1FMOE 3A8WA 4L3LA 5DVRA 1WBWA 4JBPA 3SC1A 1J1CA 3W2RA 5I9VA 2AEGA 4ZSEA 2J0LA 1Y6AA 5DT4A 4NM0A 1E1XA 4WSYA 4X3JA 1UA2A 4EQCA 1J7LA 3D5XA 4LL5A 5B2KA 3FDNA 3NNWA 3RAWA 3HV7A 3RZBA 3ZC6A 4ANMA 4BTFA 1JSVA 4AAYA 3DJ6A 1PJKA 2J6MA 3ENHA 3KEXA 5E90A 3Q60A 4QP7A 4DLIA 4ZY5A 5BVOA 4C4IA 3HLLA 4PTEA 5CTPA 2C3JA 3LCKA 4NW6A 3RBWA 5ANKA 4TYEA 5HG8A 3O71A 3HL7A 5M4IA 2WTKC 5CF4A 1LUFA 1W8CA 3O8PA 5E91A 5FP5A 4O0SA 4AZTA 4A07A 4M8TA 4O4DA 4BJJA 1GZ8A 1BLXA 3K3JA 3QZHA 1SM2A 3IQ7A 4RRVA 4TKSA 4BCKA 4FT3A 4D1SA 2X81A 2HZ0A 5DEWA 4CEGA 4JMQA 1UNLA 2PE0A 3AMBA 4XRLA 3VVHA 2VRXA 1W84A 4WRGA 2J0JA 4CCBA 5FDPA 4AW5A 3JXWA 4E6AA 5EQPA 3CGOA 5HNGA 1GNGA 4R78A 1BX6A 2UVZA 2XB7A 2C0IA 3R6XA 3MFTA 1IA9A 1K3AA 2C47A 3ZRLA 2ITWA 3HGKA 4G6NA 1O6LA 4XG3A 4EHGA 4FSZA 4GKIA 3C50A 5AUUA 2JGZA 5TKDA 2J5EA 5EW8A 3A60A 3EL7A 3LFEA 2WTDA 4LL0A 1OL5A 1MRYA 1O6KA 2GNIA 2RKUA 3CQEA 3WF5A 4XV1A 2ZDUA 3GNIB 2QKWB 4ZXTA 3WYYA 4BCGA 5IA5A 2B1PA 4EOMA 2YM8A 4MWIA 4ZTLA 1PHKA 4UXQA 1QPDA 4RFZA 3U9CA 1OVEA 2PMLX 4PL5A 3QKMA 4X3FA 3QTZA 3IOPA 3HP2A 2YFXA 4FIEA 5D9HA 3W55A 4EOJA 3CJFA 4KIPA 4F09A 4GRBA 2CKOA 4QD6A 2BVAA 4KINA 1OKYA 1V1KA 2H8HA 3F7ZA 4EOSA 1YXXA 4MVFA 5CNOA 3UZTA 2DS1A 5CAOA 3UOKA 4FRFA 3VW8A 4FZ6A 2X8EA