3A7GA

Human mst3 kinase
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
290
structure length
289
Chain Sequence
GLPGMQNLKADPEELFTKLEKIGKGSFGEVFKGIDNRTQKVVAIKIIDLEEAEDEIEDIQQEITVLSQCDSPYVTKYYGSYLKDTKLWIIMEYLGGGSALDLLEPGPLDETQIATILREILKGLDYLHSEKKIHRDIKAANVLLSEHGEVKLADFGVAGQLTDTQIKRNFVGTPFWMAPEVIKQSAYDSKADIWSLGITAIELARGEPPHSELHPMKVLFLIPKNNPPTLEGNYSKPLKEFVEACLNKEPSFRPTAKELLKHKFILRNAKKTSYLTELIDRYKRWKAEQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of human MST3 kinase in complex with adenine, ADP and Mn2+.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Serine/threonine kinase 24 (STE20 homolog, yeast)
total genus 87
structure length 289
sequence length 290
chains with identical sequence B
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2009-09-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3a7gA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3a7gA01
4KKEA 4WRSA 5DNRA 4LL5A 3WYYA 1DS5A 2QR7A 4JG7A 1OPJA 4GK3A 2O2UA 3COIA 4M69A 3PE2A 4I3ZA 4ZTNA 4BTMA 2VO6A 3V8TA 3H0YA 3UNZA 4EOJA 3ELJA 4FIJA 2XNBA 5A14A 1SNXA 2ZM1A 4RIOA 3TZMA 3QQLA 2PZPA 3E93A 1B6CB 3QCQA 4KRDA 4Z9LA 4U40A 1TKIA 4FVRA 4GFOA 4IMYA 3R7OA 1E9HA 3LCSA 3GT8A 4EUTA 4DGMA 3QALE 4PF4A 2BHEA 4X7QA 4ZTQA 1JKSA 3LPBA 5HD4A 5J79A 2YEXA 2QLQA 2HY0A 4AZWA 4QNAA 3MS9A 5A6OA 4W4XA 3BU3A 5HTIA 5EI8A 4G34A 3CLYA 3IGGA 4NM5A 3QBNA 2B9HA 4EH4A 5DGZA 4G3FA 3HP2A 3ID6C 3IDBA 2HXLA 5CAUA 4RJ3A 4YC6A 1P5EA 1G5SA 1XO2B 3NIEA 4FTCA 5ETCA 1VEBA 3BHVA 4BRXA 1U5RA 4AGUA 5CLPA 4K6ZA 2XJ1A 5CSHA 3OTVA 4B6LA 3IW6A 3R83A 5JFWA 3U4WA 3U6IA 4KINA 2OJ9A 1CMKE 4AW2A 4CV9A 5IH4A 4QTAA 2HWOA 3HMIA 4I24A 3C13A 3WARA 2VWVA 4AZVA 4AZEA 5ANIA 5CANA 5BUIA 2JDTA 1UU3A 4PMTA 4FKSA 3UE4A 1WBVA 3FXWA 5ANOA 4GT3A 2JBPA 2I7QA 4CZUA 2OGVA 2J51A 2YFXA 4FZAB 4MNEB 4FSMA 3NW5A 4MEDA 3F5GA 3G51A 4RIYB 3LXPA 3PFQA 4JOAA 3CQUA 3SRVB 1M7QA 3VO3A 4BDJA 3D7ZA 2Y4IC 4EKLA 3PXKA 2X39A 3PY1A 2OXDA 2OIBA 2JDOA 3NR9A 3KRRA 4DEAA 2JBOA 5F4NA 2WEIA 2PUIA 2B54A 3P7BA 4HJOA 5H2UA 3BX5A 4C4HA 4E6DA 4F9CA 5FTQA 2UW7A 1IR3A 3CR0A 4F7SA 1OL7A 4P5ZA 4OTFA 3VJNA 5HNBA 1QMZA 4NWMA 3QWJA 4P2KA 4M97A 3KGAA 2O8YA 4A9SA 4JIKA 4RG0A 3ZUVA 4WKQA 4M84A 4AZSA 1ZZLA 3TDVA 1FGKA 4S32A 1B39A 3IW8A 4I23A 3CC6A 5GJFA 3SRVA 1REKA 3OS3A 5E1EA 3ZDUA 5DH3A 2BZKB 2X2KA 3NAXA 3QTZA 4RVLA 5LOHA 1H4LA 4QQCA 3BYOA 3C50A 2F57A 2IN6A 3QRUA 5HTCA 3LZBA 4JX7A 3QXOA 4GJ3A 4CFXA 2YISA 3BYUA 3BBTB 2PE1A 1JBPE 2GSFA 5AR3A 5HGIA 2BIKB 5IISA 4JLCA 4TYHA 5ANEA 4YPSA 1H1PA 1XH6A 4KUJA 1O9UA 3O23A 4NTTA 3WE8A 3UMWA 1WMKA 4W9XA 3EQHA 4IB0A 3VQHA 1PMEA 1ZZ2A 3AOXA 3CTQA 2Y4IB 1Q3WA 3T8OA 3W10A 5EDQA 4BBMA 3FZTA 4LRJA 4HOKA 1OKZA 5DVRA 2W9FB 2XJ2A 2OZAB 4YJOA 3CQEA 4EOMA 2WIHA 1IA8A 4FKOA 1ERKA 3KU2A 3DBQA 5JK3A 5K9IA 4I5HA 1T46A 4GYIA 3HL7A 4FX3A 4UN0C 3CGOA 3TXOA 3I5ZA 5IH6A 5A9UA 4DN5A 1UVRA 2YLEA 4TRLA 4PNKA 2PVYA 4C2VA 2XK6A 1BUHA 4EOQA 2JDSA 1H26A 3GU6A 2Y8OA 1A9UA 2H9VA 3BE2A 4JVGA 3VUGA 4BTJA 4DCEA 4F9AA 5IPJA 3H3CA 3P08A 5CXHA 3SA0A 4Y5HA 4DFZE 1SMHA 4PMSA 5B0XA 5AV0A 3S4QA 4NU1A 2O3PA 3O0GA 4I93A 4PRJA 4U43A 5FBOA 2CJMA 3JVSA 3DAEA 3COHA 3UZRA 4ZZOA 4EQCA 3DXQA 3Q9ZA 4JDKA 3PXYA 4BCPA 5AM7A 5HTBA 4QMZA 4EBVA 3DK7A 2XK4A 3T9IA 4DINA 3D5VA 3O8TA 5IEXA 3QL8A 4FKTA 2PZ5A 2W17A 2RFNA 3HEGA 4ZTLA 4TT7A 5A4EA 5L6OA 2R0IA 3MBLA 3MPAA 3N4TA 2YZAA 1UWJA 4QQTA 1UU9A 2UZBA 2LAVA 1Z57A 3MGYA 5CU3A 4BTFA 4U7ZA 4C4FA 4RX8A 3HDNA 5HIBA 3PJ3A 3GU5A 2VGPA 2BDWA 3VS3A 3RK5A 3EQFA 4C4JA 2ITTA 3O96A 3FLNC 4O2PA 4RFZA 5EHLA 2DYLA 3OHTA 4IZ5A 4PX6A 2WMWA 2X4ZA 2ONLC 3AC4A 3LFBA 3TJCA 3RAKA 4QP6A 3SG8A 2ZMCA 4FTOA 4U41A 3CTHA 3NRMA 4FKLA 4DH7A 4L01A 2PZRA 3QUDA 4GIHA 3SQQA 4ANSA 3MESA 2P2IA 3QXPA 2VTLA 4NFNA 3RAHA 2R64A 3TTIA 2BR1A 3FUPA 4XLVA 4CKIA 4ANBA 2ZV8A 2VU3A 4LL0A 2WMRA 4MVFA 5GNKA 3ZSIA 4O22A 3II5A 4FTIA 5A6NA 3PA5A 5L2QA 5KZIA 3RPOA 2PVKA 1SVHA 1OI9A 2JIUA 3MFUA 3W2RA 4ALWA 5ANJA 1FINA 1W83A 3HMNA 4LYNA 3B2TA 1KV2A 3T9TA 1GIHA 1W82A 2WMBA 3V5JA 5JFSA 5L2WA 4FV9A 4BCKA 3EYHA 4RSSA 5D41A 4D28A 4RVKA 4BF2A 3RVGA 4BN1A 3VF8A 3OBGA 3HAMA 3NNVA 1LR4A 5JMSA 3MJ1A 3ZFMA 5DT3A 2XK9A 5GJGA 1QCFA 3DQXA 1LUFA 3RM6A 1QL6A 1Y6BA 2BRNA 3ZBFA 1XBCA 4AGDA 1JOWB 4IC7A 3VS1A 5J1VA 1IAHA 4MQ1A 1APME 3A60A 4IVBA 5CF5A 2YM7A 2JD5A 2JKKA 3FPMA 2OFUA 4YHFA 3R8LA 3RI1A 2CKOA 4EH8A 3M42A 2I1MA 4XBRA 2WMQA 1OB3A 5EW8A 4BDKA 4HYHA 3NVMB 3E63A 4ANQA 3WYXA 4OAUC 2QONA 1P2AA 3ZRLA 4BCJA 1PRYA 4X0MA 2VTJA 4QMPA 4XRLA 1ZXEA 3ORKA 3ZSHA 4GUBA 3ZRKA 4BYJA 5E91A 3U8WA 4GU9A 5ETIA 3FMKA 3HNGA 4KA3A 4UBAA 4CRSA 5I9XA 2BILB 4MF1A 1LEZA 3ZOSA 1Q8TA 2X7FA 5CY3A 3NCZA 4JI9A 2GFCA 4EOOA 4OTQA 4FTNA 2O64A 2XBAA 3GCPA 4QMVA 2QOBA 4PPBA 2XYUA 5CNNA 4WNKA 2YDJA 1ZARA 2OZAA 3LQ5A 3RHKA 3TG1A 4V04A 3UC3A 3GI3A 3COMA 4RC3A 3VBVA 2XBJA 3QTRA 5C27A 4L46A 4MX9A 4RWLA 2I40A 4GUEA 4IZ7A 2W1ZA 4QP4A 4G17A 4ZJVA 3F69A 3RPSA 4O7ZA 4NZWB 3Q04A 4AF3A 5AUUA 4ANLA 2SRCA 1S9IA 2AC5A 2XIYA 4TY1A 5CU4A 5L8JA 4IW0A 5HEZA 3PSDA 4FKGA 3PUPA 2EXCX 3QX2A 3HUBA 4PY1A 4MXYA 5CXZA 2WXVA 1MRVA 4TNBA 5CI7A 1XH9A 1XJDA 3QRTA 1IG1A 1SZMA 5AV3A 4HYSA 2JFMA 3FMMA 4C37A 5KHWA 2XUUA 3I7CA 2ZJWA 3ZM4A 3WF5A 4N6YA 2Z8CA 3AT3A 3H9FA 4PPCA 3LVPA 5DA3A 4IZYA 5HLWA 5DLSA 1YOMA 4LGGA 2CKEA 2YWVA 2NNWB 5K3YA 5FGKA 3LM0A 3ORZA 2XK8A 1SM2A 3NYOA 2WQMA 4QNYA 3VW8A 5LCJA 3WZJA 3QHWA 3SXRA 4C34A 1YRPA 3O7LB 3DOGA 3HVCA 3G9NA 3OCTA 5FXSA 5C26A 2GNHA 4JG8A 3UQCA 3ORTA 3OC1A 4J8NA 4PNIA 3FI4A 2ESMA 2IWIA 3L1SA 2NP8A 4UWCA 4FBXA 4EWHA 2CLQA 4LUEA 1EH4A 4RLKA 2XP2A 3EN6A 5FM2A 2VD5A 4HGTA 3EN4A 2PVHA 3OXTA 4L43A 4WHZA 3RBWA 4DLJA 3MB6A 4QMMA 5TO8A 3GCSA 1OUKA 3TKUA 4MCVA 4RRVA 2V5QA 2WMUA 1OL1A 3RPYA 4IE9A 4Y85A 2G9XA 4DGGA 4JRVA 3PIZA 2NRUA 4NT4A 3UOLA 4EZ3A 3GOKA 4WUNA 5H8EA 2WGJA 2OBJA 3VNTA 3QKMA 4GEOA 5LVLA 3V5PA 2O5KA 4IAKA 3CEKA 2UW9A 2QHMA 3FMHA 2JKQA 3OY3A 3ROYA 4CFFA 5M51A 1Z9XA 4GFGA 4CRLA 4AGCA 4DF3A 3EQGA 3ZFYA 2GNLA 2WFYA 5IQFA 4FKUA 3FYKX 3Q4ZA 2BALA 4FZFB 3MPTA 4KSPA 4C7TA 3ZONA 5CEKA 4ZLOA 4YZCA 4ID7A 2W1GA 5K5NA 4ASZA 3R9NA 5E1SA 3LAUA 3FDNA 4M12A 5BQ0A 5LVMA 4GG7A 2Q83A 2Y4PA 1R0EA 3LFCA 4YBJA 5CENA 2QOHA 3R30A 4H3BA 5CU2A 4O1OA 3TTJA 3UOKA 5FEEA 4FTKA 3PXRA 2CGVA 1PW2A 3ZO4A 5HKMA 4QYYA 2C5OA 4RVMA 5C1QB 2JIVA 3T3UA 3A7JA 5EH0A 4X2FA 3RMFA 4BI1A 5BVFA 2ACXA 2J5EA 4FG9A 3UIMA 4FC0A 4L3LA 3RCJA 4K0YA 4DC2A 2J6MA 4O0TA 2NO3A 4GG5A 5EDRA 1Q61A 4YJVA 5ITAA 1FMOE 4NM3A 1V0PA 4EI4A 4J95A 3L9PA 2O63A 2YN8A 3DXPA 3RWQA 3AD4A 3TNIA 4I6BA 3PXZA 4I6QA 4Y5QA 5CTPA 5FTGA 4DEDA 1HCKA 1G3NA 4IHPA 3TI1A 3ZCLA 3DKOA 1NT2A 2Y7JA 4TZRA 4EK4A 5KUPA 2ERZE 4HPUE 4DLIA 4GV1A 1H1RA 5F9EA 3UQFA 4O81A 3G6GA 3KVXA 3DKFA 1J91A 4EUUA 3CCNA 3VAPA 4G3GA 3BYSA 4XV9A 3ZYAA 4U5JA 5HLNA 5HCZA 4FL2A 3ACKA 4FZ6A 4QTEA 4OTIA 2R3KA 2YM6A 1PXMA 4OT6A 4XCUA 4ZP5A 4EK3A 4ITIA 4H05A 4C4EA 3FQSA 2GDOA 2IZRA 3NNXA 4QTBA 3AG9A 4TXCA 2H34A 4X21A 1RQQA 3VVHA 2BMCA 2J2IB 5HICA 5EQPA 1IA9A 1Q97A 5DR2A 4O1PA 2OU7A 3D2KA 4BCIA 3E87A 3PIXA 4I92A 4Q5EA 4O6EA 4BDFA 1WBPA 3GVUA 2JLDA 3HECA 3OWKA 3QKKA 4NK9A 3D83A 4O6LA 5CVGA 2WNTA 3EN9A 1OIUA 1PMUA 1XQZA 4XUFA 5HNIX 2BAQA 3R7GA 4Z7GA 5FWKK 2A0CX 5HBJA 4O82A 1XWSA 2YM5A 4KIQA 2C6OA 4O0RA 4RIXA 5HG8A 4L7FA 5KE0A 4C4IA 4YJPA 4HGEA 3FQHA 4GT4A 3W55A 4KIKB 4U42A 1H08A 3PP1A 4L8MA 2QKWB 2YM3A 3D7TB 3D5WA 3LLTA 4Q5HA 2ITPA 3DJ5A 4XYFA 5KMNA 1GZ8A 4PPAA 4XMOA 4EQUA 2JAVA 4IZAA 4TWNA 3SVVA 2W5HA 5AAGA 2WZJA 3MFRA 3UPXA 4M15A 4RX9A 4UMQA 4EL9A 2R3NA 2YIQA 5HX6A 4XP3A 5A3XA 5FUTA 2X8EA 3ANRA 2VTPA 4B8LA 3UNKA 5JGBA 1PKDA 4E20A 4RZVA 3GFEA 4UMUA 4JBPA 2B55A 4YNOA 5L4QA 2B7AA 3FKLA 4F9BA 3BHYA 3W32A 4EONA 3QZGA 4UXQA 4AU8A 4PMMA 3DLZA 1WBWA 1GZKA 2RIOA 4FSQA 3QA8A 4JR7A 3C4CA 3L8PA 4IWPA 4M3QA 5CSXA 2WO6A 4XG2A 4YHTA 3BWFA 4R3CA 3UP7A 1B38A 3ORPA 3QQFA 4ZZNA 4USFA 5M4UA 4E73A 1OIYA 4IANA 4C36A 1ZOEA 3JY9A 2PU8A 1R0PA 3E92A 4LGDA 2PUPA 4CXAA 5DI1A 4AA5A 3QTXA 3ZU7A 5I9ZA 3OT3A 4C3RA 2C3KA 2REIA 3SKCA 1M14A 2FGIA 4KKHA 4HYIA 4BDGA 3OCSA 3U9NA 2F2CB 3Q4TA 4K18A 1PXNA 2ZAZA 1UNHA 2WKMA 3Q9YA 4EK5A 4FIFA 4J1RA 3RK9A 2ZB1A 4KIPA 2ZMDA 4C38A 2O0UA 3TKIA 1U54A 5AA8A 2GMXA 3BQRA 2W99B 3LJ0A 4JX3A 4E8AA 4D1ZA 3IPHA 3I5NA 2XRWA 3ENMA 5EW3A 3LCTA 4ACCA 3BWJA 3ULIA 4OBPA 3UODA 3MI9A 5JN2A 3NGAA 3VUIA 4X2KA 5EFQA 5J5TA 2HY81 5AP3A 4IWOA 4QPAA 4FNWA 4ZTHA 4GKHA 4MH7A 4A06A 5I4NA 5C01A 5KMOA 4AZTA 5DR6A 3NW6A 3GBZA 3PWDA 5EOBA 2JFLA 1W98A 4IAFA 1V0BA 3F3VA 5C9CA 3W8QA 4FV3A 3UG1A 5AUTA 5LCKA 1J3HA 3DBCA 3FXZA 3GENA 5AR2A 4U8ZA 4GL9A 3R8MA 4B4LA 2UUEA 5F20A 2QU5A 4BBEA 1GZNA 2IZTA 4L9IA 4MK0A 1ZYSA 2WIPA 4NIFB 4Y83A 3TV4A 5AAFA 4CYJA 3HDMA 4NFMA 4F6SA 4AOIA 4K1BA 3ZLYA 3E62A 4XV2A 1YXTA 2VWIA 2EU9A 3TIYA 1ZLTA 1LPUA 1KE9A 4MHAA 4QD6A 3R7YA 4MNEA 2YDIA 2WAJA 3DGKA 5AR7A 4RX5A 1Q8YA 4PDPA 3CY2A 3K5UA 1PKGA 4XOZA 2JDVA 4EHVA 3V8SA 3MA6A 4C02A 3AC3A 1P4OA 2PWLA 4UWBA 2BAJA 3ATTA 3PP0A 2GPHA 1FPUA 3P79A 4W4YA 4FT3A 5ANKA 2BAKA 4QYEA 5BPYA 3REPA 2P4IA 3E7VA 5ACBC 3NYVA 3PJ2A 2X81A 5HG5A 4CG9A 1BLXA 2BKZA 2C4GA 3F5PA 5E8XA 3VC4A 4PL3A 5AP6A 3UO6A 3DT1A 4E26A 2E2BA 2R2PA 4LM5A 4X2JA 4E6QA 2Y6OA 3VQUA 3FLSA 3DKGA 3AC1A 4S31A 2IW6A 4MXZA 3PPZA 3R7EA 4BKJA 1SYKA 4CCBA 5M06A 1PXIA 3OWPA 3P86A 2XEYA 4IXPA 5J9YA 3VHEA 4YTCA 1YXSA 2OF2A 1YW2A 3DK3A 5EQEA 5C03A 5TKDA 3B8QA 5L2IA 5IG1A 4HCVA 4RZWA 3UIXA 3UPZA 3F66A 5HBHA 3I0QA 3F9NA 4F0GA 3HMOA 2BTSA 3AGMA 3GUBA 4NH1A 4IADA 5E90A 5ACKA 4O0VA 2GNIA 4AQCA 4FKJA 4BDAA 4BZDA 2JKMA 2F49A 3OD6X 4H36A 4O0UA 4YC3A 2BCJA 2R3MA 4R7HA 4QQ5A 2XKEA 4FNXA 4F99A 2CLXA 5DMZA 2XM9A 3IW4A 5E7RA 1OBGA 2PVFA 2ITZA 4ZXTA 3QTWA 4O2ZA 2FSMX 5GINE 4P90A 5IA3A 1E1XA 2QOKA 5HO7A 4J52A 3IONA 4AN9A 2BRBA 4FGRA 1PXJA 4Z16A 2YIYA 4FZDB 1YWNA 4K33A 5KKRB 5AV1A 4U0IA 3ALOA 3DB8A 2OWBA 3E64A 1YHWA 5LARA 3EN7A 3S00A 4XHKB 1PF8A 4W8DA 4IM3A 4TL0A 2WMVA 1OPLA 3V5TA 1CSNA 2J9MA 4K9YA 3DDQA 4U44A 4E4NA 4RJ6A 4IH8A 2C1AA 5CF6A 4ORKA 4F6WA 2VUWA 5BNJA 3LMHA 4G6NA 4OLIA 2W4JA 4YZ9A 3A62A 2BZIB 4D1SA 4BDBA 3WZEA 4JNWA 1CTPE 2VN9A 4FVPA 4PDSA 4WG3A 1Q4LA 3W2CA 5TF9A 5CSPA 2W96B 2GQSA 2YCFA 3FLYA 3MY5A 2GNGA 4BKYA 1R1WA 3MA3A 3NIZA 4XG3A 3B8RA 4PUZA 4YURA 3IW5A 2G1TA 3DZOA 3EFJA 1BKXA 5LWMA 2CDZA 4A7CA 3SX9A 3RAWA 4LRKA 4IEBA 3R8UA 5EYDA 3FHRA 3NUUA 2ZYBA 3R1YA 2PVJA 4FSZA 3KVWA 5GZ9A 4O84A 5HE3A 2XNPA 4TW9A 5BVKA 4FV1A 1M2RA 5KZ0A 3QGYA 1KWPA 3V5WA 2XB7A 2QNJA 5KKRC 3Q60A 3VBYA 2BUJA 4QYGA 3KMMA 5AV2A 4NKAA 4TWPA 4WOVA 3P7CA 4TYIA 4CNHA 4HNIA 3V8WA 3E8EA 4OAVB 3BV2A 3A4OX 4IB1A 4O21A 5CU0A 4O0YA 4EOIA 4QMNA 2ZM4A 4FT0A 3MFTA 4BGHA 5JZNA 4BC6A 4EEVA 4JAJA 3C5IA 5C4KA 3DBDA 2X6DA 3DFCB 2F2UA 4OTRA 3NEWA 3U4UA 5A4LA 1DI8A 3FLWA 3POOA 4X3FC 2YIRA 4XG6A 3SDJA 1BI7A 1DI9A 2BHHA 4CQGA 4QMWA 4FG7A 4TYEA 4G2FA 5KMIA 1FQ1B 2C6TA 5DEYA 2B4SB 3TNPC 4LG4A 4PMPA 1H1SA 3L9NA 5FEDA 3ERKA 5T6KA 3RPRA 5M53A 4XG8A 3DZQA 2VRXA 4NW5A 3IOKA 3MY0A 4RC2A 2LGCA 5D9HA 1V0OA 2X2MA 2W5BA 4M13A 4YNEA 1YXVA 4Y72A 3TZ9A 4A4LA 2R7IA 5BUJA 2YACA 3NUXA 3AGLA 4ZS0A 1W0XC 5AUWA 3WOWA 1NVQA 3R73A 3RAIA 2WTKC 3MY1A 1JSTA 4YBKA 4FK6A 3F3TA 2DS1A 5JGAA 4TPTA 4XJ0A 4DTKA 4V01A 1REJA 2HELA 2DQ7X 5HG9A 4HNFA 1QPJA 3W2SA 4UMTA 3QX4A 2GS2A 2YLFA 2OZOA 3NUPA 3IKAA 2V22A 4MXOA 3EZVA 5H9BA 3CSVA 4MBIA 4FODA 3FL5A 4ERWA 5KHXA 3C9WA 1JPAA 4PP9A 4EH5A 2QO7A 2VO7A 4FG8A 2PYWA 4XLIA 4FK3A 2OJJA 5EI6A 4IX4A 4JBQA 4CFNA 5AR4A 4AOJA 5DPVA 1WCCA 4NUSA 5HE1A 4JR3A 5E8WA 1WZYA 2R0UA 3DTWA 4FICA 3U51A 4KKGA 3RNIA 4FT9A 3PE1A 1ZYCA 4LV5A 4E6CA 2X6EA 2ZDUA 4R5SA 5BYYA 3PVBA 4FKWA 5AP5A 1CKJA 3ZM9A 4HZRA 3R01A 4NW6A 5AP4A 4FV6A 4E5AX 5HX8A 2P33A 3HA8A 2GU8A 2YAAA 4IDVA 4QT1A 2PVLA 4ZLYA 2BFYA 1ZYJA 1NVSA 3HP5A 3KRWA 4DGOA 2CMWA 1FVRA 5E8VA 5IQDA 4L6QA 4RWJA 4UXLA 2VO3A 3F6XA 2GNJA 2G2FA 2ITNA 3VS0A 5E8TA 3WF7A 3DKCA 2AYPA 5FRIA 4ZJIA 1JNKA 3CP9A 4IX6A 1CDKA 4CV8A 3HRFA 3Q96A 5HQ0A 3GCUA 4U80A 4DG2E 1VYWA 2C6MA 2V55A 3PLAE 1PMVA 4BCQA 4L3JA 3BHHA 3ACJA 4XV1A 2OKRA 4I94A 3QTUA 4A9UA 3JPVA 4BL1A 2XIRA 2VAGA 5LQFA 2J50A 4AA0A 4C59A 4D0XA 2C3JA 3F3UA 4X3FA 3ULZA 3UVRA 3ZHPC 4FV2A 3M2WA 1GJOA 4ZSAA 3QFVA 3Q6UA 1JKLA 3Q32A 3R7UA 2ZV9A 4ERKA 5J7BA 5CNOA 2WU6A 3DTCA 1K2PA 2XCKA 2XVDA 3G0EA 3NS9A 3LQ8A 2C6IA 4YJRA 4I5CA 1ZMWA 4FEWA 4BR3A 1I09A 3PRIA 4AFJA 2PVMA 5B7VA 3TUCA 4KS8A 5AAEA 2J90A 2GHLA 3EQBA 3KXGA 2GNFA 3G33A 4JQ7A 3TN8A 4E93A 2W06A 4DT8A 4C58A 3L8VA 1TQMA 2GHGA 3P0MA 5CAQA 5CI6A 2PK9A 1DM2A 4F7JA 2R3GA 4L67A 2YHVA 2VTNA 2G01A 2BIYA 2VTOA 4LMNA 4CMTA 4FTTA 4A9YA 4EZ5A 2I0YA 2F7ZE 3BU6A 3E3BX 4RJ8A 1GIJA 1Q99A 5HI2A 3VUDA 5AUXA 4GJ2A 4I41A 1H1QA 3C4EA 4ZSLA 3VS2A 3QAME 4D4SA 4EK6A 4DE4A 2ZV2A 1ZY4A 3D14A 2ZDTA 3GC0A 3QD0A 5DRDA 3ZEPA 4C0TA 3NMUF 2UZTA 1NXKA 4D1XA 4OTGA 5M09A 5CVHA 5BVEA 4FIGA 3KN6A 4EHZA 2UZEA 4LOPA 2QCSA 1NVRA 4D55A 4EWQA 5KMJA 4MD9E 2BDJA 3ORXA 3HV7A 5G1XA 1ZAOA 2BZHB 3R9DA 4H58A 3VUMA 4CCUA 1OKWA 2F9GA 5H3QA 3LJ1A 1WBNA 3NDMA 3LXNA 2VTQA 4FSTA 1LEWA 4L00A 4QP3A 5HNGA 2XNMA 3ZO1A 4CFUA 3EHAA 4L44A 5HESA 5FG8A 4QMLA 5GZ8A 5J1WA 3LXLA 2ETMA 4GW8A 3Q2JA 3F3ZA 3I7BA 3O17A 3OWJA 4DFLA 4W9WA 2VZ6A 4ACMA 4E5WA 4RVTA 2QQ7A 5L8KA 4KWPA 4P5QA 4ASXA 2X4FA 3WIKA 4D5HA 3GGFA 3O2MA 4EJ7A 2BFXA 4A9TA 3I81A 2F7XE 3KEXA 5H8BA 4AW5A 4IJPA 1VZOA 5LMBA 3KK9A 1XH5A 5A4QA 3TM0A 3V04A 3RALA 2R4BA 2XCHA 1H28A 3D9VA 3FE3A 3VS5A 3QCYA 2G2IA 5AP7A 4EYMA 3S0OA 4MD8E 2I0EA 4N0SA 2WHBA 4FA2A 4QTDA 3RWPA 5ICPA 2PE0A 4WIHA 3I60A 2AUHA 5EYCA 4DYMA 4NL0A 1XR1A 5L2TA 2OFVA 3FC1X 2VWBA 4F70A 2VGOA 2X7GA 2XKCA 5KCVA 3HMMA 3PRFA 3IK3A 3GNIB 3E8NA 2ETKA 3MH2A 2HZ4A 5AX9A 5E92A 3ZTXA 4BDEA 5JEBA 2XKFA 5FEQA 1TVOA 4PP7A 3QGWA 2W1HA 4I5PA 5C8NA 3VF9A 3DPKA 2W4KA 3TNQB 5BVOA 3L9LA 3DNEA 4CMUA 4CT1A 3C0HA 2IW9A 4IFCA 5EYMA 5DEWA 3PZEA 4WNOA 2UZDA 1S9JA 4TYJA 2OJIA 3PY0A 2OIQA 5DIAA 4BWPA 3AC8A 2YCRA 3LFQA 2X1NA 3QUPA 1JVPP 4HVHA 3NYXA 4NTSA 1RDQE 5IQEA 2J4ZA 1IASA 4DEBA 3FZSA 2HYYA 4G6LA 2WTDA 3QD2B 4IQ6A 4W4WA 2ZB0A 4JDHA 1YXUA 4Y8DA 1U46A 5CQWA 4RQKA 2JIIA 3DLSA 1Q8UA 5HOAA 2YJRA 4LI5A 2B52A 3HGKA 5CX9A 4AA4A 4F9WA 1W7HA 3AMAA 3FI2A 3N4UA 3KMWA 3O50A 3P1AA 4HCTA 5L6WL 4RJ5A 3TIZA 4HVIA 3P5KA 4XH6A 3E3PA 3CD3A 3ODYX 3NUNA 1YDTE 1SVGA 4L7SA 4W8EA 3QQUA 5D1JA 2XA4A 2XMYA 2X9FA 1OKVA 5AWMA 2H6DA 4U97A 4BI0A 3C7QA 5CU6A 3BGPA 4MWIA 3MTFA 4RA5A 4RIXB 3L8XA 3EIDA 1OITA 5GZAA 1VJYA 2VNYA 2R3OA 5IQHA 3ODZX 3NUAA 1RJBA 3QWKA 5IQBA 3O71A 3RTPA 2FUMA 2QVSE 4FEQA 4DEHA 5LJJA 3QD3A 5FP6A 1HOWA 4E4XA 2ITVA 2V7AA 3G2FA 3MDYA 3W2OA 1OBDA 3D2IA 4IFGA 4DH3A 4B9DA 4X6RA 3W2PA 4CKJA 4GIIA 3TWJA 3RJCA 1Y91A 4HVGA 4EOPA 3ZS5A 4HVSA 4CSVA 4BDIA 4IM2A 3MH1A 3R7IA 3ZUUA 4LUDA 1J7IA 3EKNA 3LQ3A 4QRCA 4U45A 4AOTA 1SNUA 1BL6A 4I0TA 5IMEA 5KNJA 1P4FA 4F09A 3WF8A 3KXXA 4X3JA 4JQEA 1OMWA 2QOQA 4FL1A 2FSOX 4ZK5A 5B2MA 1U5QA 3KRLA 1YVJA 4KNBA 4YZDA 2ITXA 3GFWA 2VNWA 1H27A 4DH8A 4M8TA 4LV8A 2FSLX 3JYAA 4DTAA 2YM8A 4I4FA 5EHOA 4U6RA 3N51A 1KE8A 3GU4A 4OTHA 4O7VA 1WAKA 2RGPA 5KMKA 4QP2A 5EI2A 4NJDA 5EM6A 2C30A 3AXWA 2WMTA 3SOAA 2X0GA 2Z7QA 3ATSA 5AX3A 3DV3A 3OROA 2ETRA 4FV0A 5AIKA 2IVTA 3UMXA 4E6AA 1YHSA 4AT4A 2QO9A 3FMLA 3LIJA 4ZS4A 5CEIA 5CALA 3R8PA 4G5PA 3C4ZA 3SAYA 4TTHB 2W1DA 1H8FA 2YCQA 4IWQA 1OL2A 3HX4A 3QLFA 4MWHA 4ZMEA 1M2QA 3WIGA 5CAVA 1Q24A 5CEOA 3FY2A 3OCGA 3QD4A 3ZLWA 5I9YA 5CSWA 4UZHA 4XS2A 5CVFA 4M0YA 3MVHA 5KMMA 2WQOA 5GIPE 3FJQE 2XRUA 2YERA 3EL8A 3G90X 4L68A 5E8SA 2F7EE 2XNEA 3PXQA 4FF8A 1PMNA 3R9RA 3QZIA 3KXNA 5AA9A 3OG7A 2WOUA 2CSNA 4D0WA 5HORA 1H1WA 3KCFA 1JWHA 2HIWA 4IVDA 2R3RA 2PVNA 3B2WA 3NZ0A 4NJ3A 2FH9A 4BCGA 4QYFA 2UW8A 1F3MC 4JXFA 4QTCA 1I44A 3TNWA 5G6VA 2ITYA 5IH5A 3IS5A 5FBNC 3UO4A 1Q62A 2EB3A 1X8BA 5DOSA 4BDDA 2WMXA 5K0XA 2OO8X 3JR1A 1CKIA 1Q41A 4CZYB 4EJNA 4HW7A 2YIXA 4UALA 2C6EA 3QRIA 2WB8A 4EH7A 5JRQA 1GZOA 2PMNX 2ITQA 2PMOX 4RGJA 4WUAA 4D2TA 2FO0A 1YWRA 5DN3A 5J5SA 2WMSA 3F7WA 1OL6A 3MH3A 3AT4A 5HU9A 4O7WA 3PG1A 3EQPA 5AM6A 4DT9A 4FL3A 2OLCA 5L8LA 1MP8A 2C68A 3OXIA 1ZWSA 4M69B 3VW6A 4C61A 4ENYA 3GQLA 3W2QA 4ZTRA 2BDFA 4F08A 1W8CA 1JSVA 1H0VA 2YCSA 4R8QA 3WI6A 3F5XA 5IQAA 3ANQA 3DA6A 2WTKB 3IG7A 3OXZA 3QHRA 2RSVA 3O8PA 3W33A 3IO7A 4UY9A 1UKIA 3AD6A 3I6UA 3MVJA 4O0WA 3HA6A 1PXLA 3FC2A 4G1WA 4YLJA 4ZAUA 2B9JA 2J5FA 2VTSA 2WOTA 2CN5A 4HYUA 3ETAA 3FKNA 3Q3BA 3FMDA 5TOZA 1UU8A 3DBFA 4ASDA 3KMUA 3NUSA 4L42A 2C5YA 3ZXZA 2R5TA 3EFLA 3H10A 2HZIA 2QD9A 2VX3A 5IDPA 2IVSA 4AUAA 2P3GX 4ZY6A 2RFEA 2X2LA 3MV5A 4U79A 5HLPA 4JBVA 4O0SA 3QF9A 4CMOA 4FEVA 1PY5A 2J0KA 3D94A 3ORMA 4JDIA 5BYZA 5E4HA 1PYXA 4J53A 1V1KA 4KRCA 4UYAA 3UYTA 4DEIA 2YIWA 2GS6A 4IBMA 2I0VA 2Y6MA 4NSTA 3NPCA 4L3PA 5F94A 2YABA 4RBLA 4IVAA 4IB5A 3ROCA 2BVAA 2C1BA 3A2CA 1OZ1A 3E88A 4RWKA 4DFUA 4ITHA 2OXXA 5D10A 4CTBA 5AADA 1MQ4A 3DJ6A 2WD1A 2BKKA 4I1ZA 3VBQA 3DDPA 4FIIA 3TV7A 5FDXA 3UC4A 4ACDA 2QHNA 3PVWA 2Y0AA 4FYOA 4WG5A 3MVLA 4K77A 1GY3A 5EM8A 1ZY5A 2J7TA 5A54A 5KO1A 3KRJA 4X2NA 3C1XA 3OTUA 3Q5ZA 4AT3A 2RL5A 5AP0A 3GXLA 1BMKA 3LHJA 3RGFA 3TUDA 3VUHA 4R5YA 4FTQA 5M57A 4I4EA 3U9CA 3AT2A 2Z7LA 4BHZA 2OG8A 1XKKA 2A27A 3FV8A 1OIRA 3CXWA 2AC3A 3ZFXA 4J99A 3SG9A 2X8IA 3N9XA 1H24A 1UNLA 2R3JA 2VTIA 2PUNA 4DAWA 2ONLA 4CT2A 4WSYA 3LFDA 3PJCA 3R22A 3QYWA 1JLUE 2PHKA 4R1VA 5FXQA 3DY7A 2OIDA 4DFNA 1URWA 4D2VA 1PXKA 4ARKA 2QODA 3I6WA 2C0OA 5B2LA 2O65A 4BCMA 4TKSA 3KCKA 5F95A 4WD5A 4CTCA 3CPCA 4AWIA 1ZOGA 1G8SA 4RFYA 5HZNA 4DTBA 3R28A 3GOPA 4GVJA 4MBLA 3QQKA 1YI6A 3MW1A 1BI8A 5BVDA 3OZ6A 1VR2A 3CBLA 3RM7A 1R3CA 4O38A 2C69A 4FTJA 4X2GA 5I3RA 2PSQA 3QCXA 4RWIA 3CD8A 3CE3A 1BYGA 4XG4A 3FY0A 5J9LA 3H4JA 4G6OA 2BRHA 4GKIA 1UWHA 5IA0A 2CN8A 4NKSA 4BIDA 3IQ7A 2GQRA 3KB7A 3ALNA 4MTAA 4CGAA 4OTWA 5KBQA 4UWYA 1Y57A 1Y6AA 3MB7A 5LVNA 4F4PA 2CPKE 2R3IA 3HZTA 3U6JA 2KTYA 5TT7A 3PIYA 3POZA 2ERKA 1O6LA 3IOPA 4CG8A 2W0JA 4IX3A 3LFSA 3C4FA 4FTLA 4XEYA 4D4YA 3U55A 1PHKA 2OJFE 4F63A 3JY0A 4FEXA 5LVPA 2B9IA 3JS2A 4YJQA 3QYZA 4EC8A 2WU7A 2V0DA 3QTIA 2GQGA 4GYGA 4YLLA 2C5XA 2OI4X 5KMLA 1O6KA 4GRBA 4IAZA 5M07A 3GC9A 3LLAA 1YOJA 2FA2A 5IMXA 2QURA 1PJKA 3UBDA 2QI8A 2HWPA 4X6QC 2CCIA 4G3EA 1YXXA 2JC6A 2IZSA 4CLIA 4F6UA 3TJDA 4UMPA 5KX8A 1XHAA 4YSJA 3QCSA 3R6XA 4BHNA 3PVUA 5LWNA 1SVEA 3QC9A 4GS6A 4ZOGA 4O7SA 1GIIA 4TYHB 3VBWA 1OM1A 4C62A 3K2LA 4UV0A 2B1PA 3VBXA 2CNQA 3OF0A 4C8BA 4FSUA 1UKHA 2P55A 4M68A 5CEQA 4O7LA 5BVWA 3PA3A 3FPQA 3TKHA 3WBLA 4IX5A 3BYVA 4DG3E 5CEPA 3A7FA 5M4FA 4IDTA 5IQGA 5FTOA 1ZYDA 3NWWA 4IIRA 1QPDA 1FMKA 3A8WA 5E9EA 3UDBA 3W16A 2RG6A 4MF0A 4XBUA 4O7TA 3FI3A 3KY2A 2OF4A 5HCXA 3SW4A 3PTGA 3D0EA 3QU0A 3WF9A 2IG7A 3UJGA 1Y8GA 4U3YA 3SLSA 3FI8A 3R0TA 2JGZA 4EOKA 3RPVA 3RHXA 4UMRA 5L2SA 2E9NA 1AGWA 2XM8A 4WRGA 4FNZA 4YP8A 4YMJA 3UTOA 3THBA 5CZHA 2OXYA 4YGAA 3ZZEA 3C51A 3M1SA 2GS7A 3PZHA 2UVXA 2XNOA 3FZ1A 3GCQA 1ZOHA 3EWHA 2ZM3A 3Q4CA 2GFSA 4WNMA 2CGWA 5DBXA 4OTDA 2Z60A 3OEFX 3WE4A 4Z55A 1ZMVA 2WMAA 3LCOA 2UW6A 4CZTA 2VTRA 5DWRA 2XS0A 5M56A 3T3VA 2PZYA 2QC6A 4MD7E 4ALVA 5IDNA 5JQ5A 5JKGA 3KXMA 3PSCA 3UG2A 3KULB 4FE2A 2VTTA 5AMNA 1Z5MA 3SXFA 4XNEA 3FMJA 5A4CA 4DGNA 2IW8A 5HE0A 4RX7A 5CF4A 4TWCA 2GTNA 1J1BA 5J95A 3PG3A 4EH3A 4U81A 3IGOA 3G0FA 3EQRA 3OMVA 4XRJA 2UW4A 4FKIA 4PWNA 3RNYA 5C4LA 4J71A 1Y8YA 4KAOA 4UB7A 3K3JA 4JBOA 1FVVA 4YJUA 4WNPA 3K3IA 3QTSA 4IWDA 1AQ1A 4JRNA 5I0BA 3BCEA 1K3AA 3A4PA 1YHVA 3EQCA 3TACA 4AN2A 2G2HA 1OGUA 5M4CA 2A1AB 3DXNA 4RQVA 3TCPA 1BL7A 3SGCA 2R3LA 2E9UA 3HLLA 4FV5A 4Y46A 3W8LA 2PULA 2X8DA 4PV0A 5BYLA 4KS7A 4NEUA 5TE0A 3KQ7A 4EZ7A 1YOLA 2BRMA 5HIDA 3MN3A 3ORIA 3UVQA 5DR9A 1KE6A 3TNHA 4AT5A 2W1EA 3VS6A 3LFFA 3EH9A 3G9LX 3WZKA 4A4OA 4BZNA 4C33A 2X9EA 4YJNA 2C5NA 4FMQA 1F5QA 2NPQA 3D15A 4O96A 4EORA 4JS8A 2ZVAA 2XKDA 3RP9A 5I3OA 5L3AA 3F88A 4RFMA 4LRMA 1E1VA 3EOCA 2QOOA 3BV3A 4HGSA 4X3FB 4GK2A 4E7WA 4GCJA 2B0QA 4FIHA 3EJ1A 1XH8A 4RLLA 5AR8A 3PVGA 5EOLA 3JVRA 4D5KA 3D4QA 1JKKA 2ITWA 5B2KA 5E8UA 3NUYA 3ZC5A 5DRBA 3HRBA 5JT2A 4N6ZA 5I9WA 4CFVA 3RZBA 5CEMA 3UVPA 3FHIA 2Q0NA 1IEPA 4YC8A 4YJSA 2IPXA 3PLSA 4ZJJA 2WPAA 3EYGA 3OFMA 2C0TA 1LP4A 4EH6A 5C8KA 5FP5A 4H3PA 2VO0A 4FT5A 3CKWA 4OT5A 2W1IA 3MFSA 3EL7A 3BIZA 4UZDA 4D9TA 3FAAA 3Q9XA 5CAPA 4AE9A 3FL4A 1ZMUA 5K4JA 2C5VA 2C6DA 4BVUA 3LW0A 4L45A 5CSVA 1GAGA 3AQVA 4OBQA 3C0IA 3DB6A 4C3PA 5JFVA 4JQ8A 1M7NA 1U59A 3QQHA 4NIFA 3QZHA 3R8ZA 3ORNA 4I20A 2QR8A 4USDA 2CKQA 4PDYA 4R7IA 3PY3A 1WVWA 3ORLA 2VTAA 3EZRA 1IRKA 1XBBA 3KXZA 3HV5A 5D12A 3F3WA 3OP5A 4DHFA 2HZNA 1WVYA 2HXQA 3COKA 3FZPA 4JT3A 4YO6A 1NY3A 4FKPA 3P23A 3LCKA 2A4LA 4DH1A 1H25A 2YDKA 3NYNA 2GCDA 5E8ZA 4Q9ZA 4F9YA 3PXFA 2PUUA 4PTEA 4FV7A 4ALUA 3LFEA 4EHGA 3RKBA 1UV5A 2B53A 4FV4A 3P78A 2XNNA 4QP1A 4YSMA 3CTJA 4S30A 2A2AA 2Z2WA 3OOMA 4I0RA 5CASA 3F2RA 3TV6A 3KA0A 3PSBA 4O86A 4YHJA 2XIZA 3VN9A 3ZSGA 4XG9A 4H1MA 2HK5A 4U9AA 5J7HA 4BIBA 4DEGA 2YM4A 3HYHA 4TNDA 4K8AA 2QG7A 3BI6A 3S2PA 5L6PA 1RW8A 3H9OA 5IKWA 3AD5A 3BELA 3A8XA 3GP0A 2WQBA 3ZZWA 4F7NA 5CYIA 2UZVA 4EOSA 5DHJA 3GCVA 4PTGA 4F0FA 1NA7A 2R3PA 5IQIA 4FUYA 3CJFA 2VWWA 5EG3A 4I6FA 4FI1A 4FKVA 2EUFB 3HV3A 5D7VA 3DBEA 5JH6A 3BZ3A 3G6HA 3KKVA 2PMLX 4ANOA 3OWLA 2E9OA 5AIRA 3S95A 1M52A 1Q8WA 2CGXA 4R3PA 3R9HA 4MKCA 3PPKA 4G9CA 3NCGA 3HRCA 4II5A 4N4SA 2BROA 2Z7RA 4DFXE 2C0IA 2JITA 2J0MB 5HG7A 1ZRZA 2NRYA 4AZFA 2YZLA 5M08A 4UEUA 4BCFA 4QP7A 3BLHA 2V7OA 4QPMA 3ENHA 4RPVA 1J7LA 2WTIA 4R77A 4YLKA 5KBRA 4I0SA 1XH4A 5AJQA 3R21A 2Z7SA 2UZWE 4CYIA 2PMIA 4OBOA 4PTCA 2ZOQA 4WSQA 4R3RA 5AP1A 3R9OA 4GFMA 4YTFA 3HUCA 3F5UA 1XH7A 3OCBA 4E4LA 4D2WA 3FMNA 3A61A 1H07A 1JAMA 5AEPA 5M44A 2XF0A 2H8HA 3R02A 4BBFA 5IZFA 3I4BA 5JGDA 3V01A 5LXMA 3D7TA 3SHEA 3OBJA 1L8TA 3HMPA 5CWZA 4WO5A 5I5ZA 3C4XA 4QPSA 4PL4A 4BZOA 2HW7A 4J8MA 4YU2A 4CVAA 4G3CA 3GU8A 3U6HA 4QP9A 4HZSA 3DU8A 3UIBA 3EFKA 5A4TA 2VTMA 4BI2A 3EMGA 4MYGA 4F0IA 4NM0A 3ZC6A 1DAYA 4D2PA 4FEUA 3Q6WA 4KBAA 3G15A 3IDPA 3V51A 2OH0E 1OKYA 3R1SA 4OUCA 4E1ZA 1YI3A 1IAJA 1TQIA 2C3IB 4DFYA 2PPQA 4V05A 3ZBXA 3OEZA 5BVNA 3SXSA 4IM0A 2BRGA 3QA0A 4EKKA 2BTRA 4S2ZA 5CT0A 5JSMA 4UX9A 3SOCA 3L9MA 3CQWA 5HHWA 4QMQA 1WBTA 3QQGA 4R78A 4BWXA 3VRZA 4FYNA 1MUOA 3ZH8A 4CKRA 5GHVA 1CM8A 1A06A 3EN5A 3PJ1A 2VX1A 3OT8A 3M11A 3OOGA 4AE6A 4WA9A 4BCOA 2W5AA 2E9PA 2RKUA 2UVYA 4XP0A 1STCE 4FT7A 3KXHA 3ZDIA 5JZJA 3I79A 4A4XA 5HVKA 4FOCA 3LM5A 3MYGA 1UU7A 3AMYA 3BHTA 3C5UA 3LXKA 4C4GA 3H0ZA 4P7EA 4DG0E 4BFMA 4B7TA 3I0OA 2FB8A 4I22A 2EWAA 2ITOA 1KUTA 3E8CA 5DYJA 2EVAA 2UZOA 4EC9A 3BLRA 3NW7A 4NM7A 2EXEA 4BIEA 3VHKA 4BWKA 4H39A 4BTKA 4RIWB 4B8MA 5I9VA 1H01A 3QRJA 3I1AA 5D11A 4G9RA 1YI4A 5DE2A 3FYJX 4C57A 3FZOA 2HENA 4FTRA 4Y95A 3VUKA 4B0GA 4CLJA 4V0GA 4D4RA 3KN5A 4ZTMA 3FEGA 4GSBA 3NNWA 5CQUA 5CF8A 4C2WA 2P0CA 3BEGA 4W4VA 2Y9QA 4MQ2A 4FV8A 4MXXA 3FSKA 3MJ2A 2WTVA 5BMMA 4WG4A 3VS4A 3VS7A 1AD5A 3PYYA 4BCHA 3ITZA 4F7LA 2CNUA 4OR5A 1U4DA 3PDTA 4A9RA 3MH0A 2UV2A 5ANDA 3UOJA 1NW1A 2DWBA 3NAYA 4XV3A 3GB2A 4RIWA 4K2RA 4FVQA 3UIUA 5HE2A 5J9ZA 4ZY5A 4Y73A 1U54B 1YKRA 3MPMA 4YZBA 4K11A 4ACGA 3QC4A 1UNGA 3R71A 4E5BA 4YPDA 4ENXA 4J97A 2YAKA 3VWAA 4QMUA 3QUEA 5DG5A 2VV9A 4DITA 1WBSA 5JFXA 3IECA 3P7AA 3R2BA 4QMXA 4QMOA 3QLGA 2UZUE 2ZV7A 3EB0A 4RJ4A 3V5LA 3TUBA 3LE6A 2E9VA 3DS6A 1OUYA 3BRBA 3FKOA 3GU7A 4HVDA 5HCYA 4FNYA 4E4MA 2C6KA 3KK8A 5EDPA 3SV0A 3R7VA 1GNGA 5HD7A 5EK7A 3A99A 4KABA 4M14A 4ANNA 3BGQA 4MAOA 4QMTA 4QMYA 4D9UA 4JDJA 3PJ8A 5EKOA 2P2HA 4JL9A 2QOFA 2V62A 5DFPA 1TQPA 2R7BA 4FSWA 5IA5A 4EBWA 3SW7A 3F7ZA 1OL5A 2W7XA 3ET7A 4G3DA 4JIAA 4RC4A 3ZRMA 4AS0A 3FMEA 4BGQA 4F1MA 3UO5A 2EXMA 2W9ZB 2GHMA 3H9RA 4RA4A 5IF1A 2H96A 3E5AA 5T68A 3KF4A 4MBJA 3UP2A 4PDOA 5HU3A 4ZIMA 4GT5A 2I6LA 3AMBA 3GC8A 5EQYA 2CKPA 4RT7A 2QU6A 5FD2A 4DBXA 3F2AA 1A48A 4PQNA 4EYJA 4BY9E 2XYNA 4MXCA 4ZLZA 4MNFA 4G16A 5I9UA 4FSRA 2XEZA 5IUIA 2RG5A 2RFDA 2YWPA 5A46A 2DUVA 3LFAA 3MVMA 4M7IA 3QZFA 1FOTA 4M66A 3WZDA 4IAIA 4R1YA 4AN3A 2CNVA 2WQNA 2X7OA 3RK7A 3BU5A 3UQGA 2R3HA 4WT6A 4AFEA 4FSYA 1KSWA 2YJSA 5TR6A 3MSSA 2R9SA 3DFAA 4LFIA 4YZNA 4ZSEA 4AAAA 1BX6A 1JSUA 2Q0BA 4APCA 5C8MA 4F65A 2FYSA 4TWOA 3EQIA 3PA4A 4DGLC 4OTPA 1L3RE 5ETFA 1URCA 4ASEA 4Q9SA 2F4JA 4FKRA 4H3QA 5AUVA 3FSFA 2XIXA 3TT0A 4BYIA 4QMSA 2XH5A 2IZUA 2JAMA 4QOXA 4NCTC 1MQBA 1MRUA 4AXAA 2IVUA 3LOKA 3O51A 3KREA 5H8GA 3BGZA 3ZO3A 4YJTA 4IJ9A 4EH9A 3OVVA 4IC8A 4XG7A 2R3QA 4H1JA 4LGHA 1Q5KA 3Q4UA 3ZMMA 3VIDA 1WBOA 4ZY4A 4O7NA 2FVDA 1MRYA 2OJGA 3KF7A 3NX8A 4P4CA 3LFNA 3BKBA 4HPTE 3FZRA 3MWUA 4LMUA 3FBVA 2BPMA 4QP8A 2XK3A 4KD1A 4WBBB 1Q3DA 1KOAA 1J1CA 3DK6A 1XBAA 4Z3VA 5BUEA 4RIYA 4FZ7A 1M17A 2J0JA 3P4KA 4J98A 4G5JA 2UW3A 3G5DA 3RCDA 3RINA 4R6VA 3TZ8A 5IEVA 3W1FA 4S33A 2R3FA 4LOQA 4KIKA 2VTHA 2FSTX 2UZLA 4HCUA 3R63A 2JEDA 4DEEA 5DT4A 3LJ2A 3BPRA 1FBNA 2HOGA 5JQ8A 4MXAA 4C3FA 1WFCA 5LVOA 2OSCA 3CS9A 1Q8ZA 3OUKA 5AFVA 3V6RA 2UW5A 3C0GA 4FTUA 3Q2MA 4ACHA 5IA2A 4YO4A 4XOYA 1HCLA 3E7OA 5GIOE 2XNGA 2OH4A 4M0ZA 4L52A 4GVAA 5FLFA 3LKMA 2EB2A 4BB4A 1O6YA 5F1ZA 5IQCA 4ZZMA 2PZIA 3JXWA 3GC7A 2CCHA 3R1NA 4IVCA 5ETAA 4NYEA 4EH2A 5IA4A 1H00A 2OICA 3CGFA 4O7YA 4IAYA 1JQHA 3WZUA 3H30A 4LOOA 1YWVA 4BCNA 4FR4A 3KFAA 4TYGA 3HKOA 3TDWA 4ANMA 1CKPA 4IAAA 4D58A 5D7AA 3EFWA 5EHYA 3ZEWA 3FLQA 1F0QA 4F64A 2QKRA 4O7RA 1OVEA 4JG6A 5AUYA 2YITA 2B9FA 5CS6A 5JRSA 3ZUTA 2VWYA 2CGUA 3OW4A 4KIOA 3IDCA 4BGGA 3QQJA 4FKQA 4KB8A 4FTAA 3SD0A 3NSZA 4DFBA 2WQEA 3D5UA 4AW1A 3F82A 3D5XA 4OW8A 5EW9A 2PTKA 4KBKA 3CY3A 1ND4A 3R2YA 4BICA 2XZSA 3KL8A 1PYEA 2XJ0A 3DAJA 4TN6A 3UGCA 3BHUA 4J96A 4ZTSA 4JAIA 5AP2A 3PWYA 4BDHA 2W05A 3PPJA 4IB3A 2OK1A 3TEIA 2C3LA 5FDPA 4V0GB 4L53A 3U87A 4AG8A 5LMKA 1KE5A 1OECA 4O0XA 3OUNB 1OIQA 5CAOA 5FXRA 4J7BA 4E3CA 4NCTA 4DCAA 3VUTA 5FQDC 2PE2A 2HAKA 1QPEA 3V3VA 4U3ZA 2WTCA 1PXOA 3HV6A 4CEGA 5DT0A 4CFWA 2HZ0A 2UVZA 4GU6A 4QYHA 5ANGA 3V6SA 4D2RA 4EQMA 3HAVA 5BMSA 4S34A 3DJ7A 3BEAA 3KULA 4IACA 2PL0A 4I5MA 5HO6A 3DCVA 4YTIA 3VRYA 2JDRA 2A19B 1H0WA 2QO2A 1G8AA 4O91A 4QO9A 4GH2A 3UNJA 3BBWA 5T3QA 1FVTA 5AUZA 3U54A 1KV1A 3VULA 3IW7A 4I6HA 4EOLA 2RFSA 4RMZA 2UW0A 3A7HA 4Z7HA 3O8UA 1GOLA 1RE8A 1P14A 3F61A 3UOHA 3UZTA 3ZLXA 4N70A 1ZYLA 4D4VA 1PXPA 2VWZA 3CKXA 5M4IA 4N57A 2BZJA 3LCDA 1KE7A 3HV4A 3NLBA 2RF9A 3OW3A 3QKLA 3ZLSA 3NVKI 2WEVA 4FTMA 4DH5A 5J8IA 3LMGA 4O27B 3KC3A 3QTQA 5J87A 3EKKA 5AR5A 3QRKA 5IU2A 4AACA 4ZMFA 5K5XA 3FXXA 3BQCA 3FQEA 1FGIA 4ITJA 4FSNA 4YTHA 4CD0A 2PY3A 5EM7A 3A7GA 4I21A 3CJGA 2QLUA 4GMYA 3DAKA 4EHEA 2QOCA 3JUHA 5CT7A 3SC1A 2JKOA 3WILA 4BKZA 3W18A 5HVYA 1QPCA 4YZMA 2KULA 1YDSE 2OW3A 2XIKA 3AC2A 2IO6A 5LMKC 3MIYA 3R04A 4XP2A 2J0LA 1OPKA 2C47A 4AX8A 3DNDA 5IUGA 3L8SA 4ONAA 2W1CA 4ZSGA 4BDCA 2C6LA 3NNUA 4PL5A 3N4VA 4WBOA 5HO8A 3S3IA 2HW6A 3O7LD 1JKTA 3Q5IA 1KOBA 4DA5A 5IUHA 4APPA 1VYZA 5BX0A 4A07A 3F2NA 5K4IA 2Z02A 3V5QA 4LQMA 5M55A 3CPBA 2UZNA 4CQEA 3C4WA 3BLQA 2QOLA 4YUQA 2HCKA 3R8VA 4RJ7A 5E8YA 4FOBA 4XX9A 5GJDA 2CHLA 4JJRA 3UYSA 4AP7A 1R39A 2VWUA 4AW0A 4C35A 4CFMA 3K5VA 4KBCA 1M2PA 5HBEA 3ZO2A 4EK8A 4F1OA 3R1QA 1ATPE 2ITUA 4ZEGA 5EYKA 3VBTA 5IA1A 2WTJA 3DQWA 4O83A 4YR8A 2VWXA 2QG5A 2VX0A 2GTMA 1YQJA 4FGBA 5HVJA 3RZFA 4AGWA 1UA2A 2PVRA 5HIEA 5EKNA 3OY1A 2IJMA 4GK4A 2WELA 3TL8A 3CIKA 3WF6A 3BE9A 4G31A 5FM3A 2W4OA 3AC5A 1YDRE 3A7IA 3MTLA 4KSQA 2G15A 3VJOA 3GEQA 3Q52A 4FUXA 1T45A 2W1FA 4HGLA 4OGRA 3ZXTA 1R78A 3FWQA 3K54A 3LMIA 2J0IA 5LMAA 4R7BA 5EM5A 1DAWA 2IVVA 2WTWA 3BYMA 3UZPA 4F1TA 3MIAA 1WVXA 5CZIA 3S1HA 3R00A 3KRXA 5IEYA 4B99A 3E8DA 5AV4A 2YA9A 4M67A 3FLZA 2QOIA 3Q53A 5K0KA 4D2SA 3EQDA 4Q2AA 2I0HA 1J7UA 3Q9WA 2XK7A 3TZ7A 4ZSJA 4DBNA 4FIEA 3P9JA 1W84A 1K9AA 4UYNA 3GQIA 4QQJA 4USEA
chains in the Genus database with same CATH superfamily
4KKEA 4WRSA 5DNRA 4LL5A 3WYYA 1DS5A 2QR7A 4JG7A 1OPJA 4GK3A 2O2UA 3COIA 4M69A 3PE2A 4I3ZA 4ZTNA 4BTMA 3TYKA 2VO6A 3V8TA 3H0YA 3UNZA 4EOJA 3ELJA 4FIJA 2XNBA 5A14A 1SNXA 2ZM1A 4RIOA 3TZMA 3QQLA 2PZPA 3E93A 1B6CB 3QCQA 4KRDA 4Z9LA 4U40A 1TKIA 4FVRA 4GFOA 4IMYA 3R7OA 1E9HA 3LCSA 3GT8A 4EUTA 4DGMA 3QALE 4PF4A 2BHEA 4X7QA 4ZTQA 1JKSA 3LPBA 5HD4A 5J79A 2YEXA 2QLQA 2HY0A 4AZWA 4QNAA 3MS9A 5A6OA 4W4XA 3BU3A 5HTIA 5EI8A 4G34A 3CLYA 3IGGA 4NM5A 3QBNA 2B9HA 4EH4A 5DGZA 4G3FA 3HP2A 3ID6C 3IDBA 2HXLA 5CAUA 4RJ3A 4YC6A 3BL9A 1P5EA 1G5SA 1XO2B 3NIEA 4FTCA 5ETCA 1VEBA 2AQXA 3BHVA 4BRXA 1U5RA 4AGUA 5CLPA 4K6ZA 2XJ1A 5CSHA 3OTVA 4B6LA 3IW6A 3R83A 5JFWA 3U4WA 3U6IA 4KINA 2OJ9A 1CMKE 4AW2A 4CV9A 5IH4A 4QTAA 2HWOA 3HMIA 4I24A 3C13A 3WARA 2VWVA 4AZVA 4AZEA 5ANIA 5CANA 5BUIA 2JDTA 1UU3A 4PMTA 4FKSA 3UE4A 1WBVA 3FXWA 5ANOA 4GT3A 2JBPA 2I7QA 4CZUA 2OGVA 2J51A 2YFXA 4FZAB 4MNEB 4FSMA 3NW5A 4MEDA 3F5GA 3G51A 4RIYB 3LXPA 3PFQA 4JOAA 3CQUA 3SRVB 1M7QA 3VO3A 4BDJA 3D7ZA 2Y4IC 4EKLA 3PXKA 2X39A 3PY1A 2OXDA 2OIBA 2JDOA 3NR9A 3KRRA 4DEAA 2JBOA 5F4NA 2WEIA 2PUIA 2B54A 3P7BA 4HJOA 5H2UA 3BX5A 4C4HA 4E6DA 4F9CA 5FTQA 2UW7A 1IR3A 3CR0A 4F7SA 1OL7A 4P5ZA 4OTFA 3VJNA 5HNBA 1QMZA 4NWMA 3QWJA 4P2KA 4M97A 3KGAA 2O8YA 4A9SA 4JIKA 4RG0A 3ZUVA 4WKQA 4M84A 4AZSA 1ZZLA 3TDVA 1FGKA 4S32A 1B39A 3IW8A 4I23A 3CC6A 5GJFA 3SRVA 1REKA 3OS3A 5E1EA 3ZDUA 5DH3A 2BZKB 2X2KA 3NAXA 3QTZA 4RVLA 5LOHA 1H4LA 4QQCA 3BYOA 3C50A 2F57A 2IN6A 3QRUA 5HTCA 3LZBA 4AAYA 4JX7A 3QXOA 4GJ3A 4CFXA 2YISA 3BYUA 3BBTB 2PE1A 1JBPE 2GSFA 5AR3A 5HGIA 2BIKB 5IISA 4JLCA 4TYHA 5ANEA 4YPSA 1H1PA 1XH6A 4O4BB 4KUJA 1O9UA 3O23A 4NTTA 3WE8A 3UMWA 1WMKA 4W9XA 3EQHA 4IB0A 3VQHA 1PMEA 2XAOA 1ZZ2A 3AOXA 3CTQA 2Y4IB 1Q3WA 3T8OA 3W10A 5EDQA 4BBMA 3UDTA 3FZTA 4LRJA 4HOKA 1OKZA 5DVRA 2W9FB 2XJ2A 2OZAB 4YJOA 3CQEA 4EOMA 2WIHA 1IA8A 4FKOA 1ERKA 3KU2A 3DBQA 5JK3A 5K9IA 4I5HA 1T46A 4GYIA 3HL7A 4FX3A 4UN0C 3CGOA 3TXOA 3I5ZA 5IH6A 5A9UA 4DN5A 1UVRA 2YLEA 4TRLA 4PNKA 2PVYA 4C2VA 2XK6A 1BUHA 4EOQA 2JDSA 1H26A 3GU6A 2Y8OA 1A9UA 2H9VA 3BE2A 4JVGA 3VUGA 4BTJA 4DCEA 4F9AA 5IPJA 3H3CA 3P08A 5CXHA 3SA0A 4Y5HA 4DFZE 1SMHA 4PMSA 4AXFA 5B0XA 5AV0A 3S4QA 4NU1A 2O3PA 3O0GA 4I93A 4PRJA 4U43A 5FBOA 2CJMA 3JVSA 3DAEA 3COHA 3UZRA 4ZZOA 4EQCA 3DXQA 3Q9ZA 4JDKA 3PXYA 4BCPA 5AM7A 5HTBA 4QMZA 4EBVA 3DK7A 2XK4A 3T9IA 4DINA 3D5VA 3O8TA 5IEXA 3QL8A 4FKTA 2PZ5A 2W17A 2RFNA 3HEGA 4ZTLA 4TT7A 5A4EA 5L6OA 2R0IA 3MBLA 3MPAA 3N4TA 2YZAA 1UWJA 4QQTA 1UU9A 2UZBA 2LAVA 1Z57A 3MGYA 5CU3A 4BTFA 4U7ZA 4C4FA 4RX8A 3HDNA 5HIBA 3PJ3A 3UDSA 3GU5A 2VGPA 2BDWA 3VS3A 3RK5A 3EQFA 4C4JA 2ITTA 3O96A 3FLNC 4O2PA 4RFZA 5EHLA 2DYLA 3OHTA 4IZ5A 4PX6A 2WMWA 2X4ZA 3PUFC 2ONLC 3AC4A 3LFBA 3TJCA 3RAKA 4QP6A 3SG8A 2ZMCA 4FTOA 4U41A 3CTHA 3NRMA 4FKLA 4DH7A 4L01A 2PZRA 3QUDA 4GIHA 3SQQA 4ANSA 3MESA 2P2IA 3QXPA 2VTLA 4NFNA 3RAHA 2R64A 3TTIA 2BR1A 3FUPA 4XLVA 4CKIA 4ANBA 2ZV8A 2VU3A 4LL0A 2WMRA 4MVFA 5GNKA 3ZSIA 4O22A 3II5A 4FTIA 5A6NA 3PA5A 5L2QA 5KZIA 3RPOA 2PVKA 1SVHA 1OI9A 2JIUA 3MFUA 4F78A 3W2RA 4ALWA 5ANJA 1FINA 1W83A 3HMNA 4LYNA 3B2TA 1KV2A 3T9TA 1GIHA 1W82A 2WMBA 3V5JA 5JFSA 5L2WA 4FV9A 4BCKA 3EYHA 4RSSA 5D41A 4D28A 4RVKA 4BF2A 3RVGA 4BN1A 3VF8A 3OBGA 3HAMA 3NNVA 1LR4A 5JMSA 3MJ1A 3ZFMA 3W0OA 5DT3A 2XK9A 5GJGA 1QCFA 3DQXA 1LUFA 3RM6A 1QL6A 1Y6BA 2BRNA 3ZBFA 1XBCA 4AGDA 1JOWB 4IC7A 3VS1A 5J1VA 1IAHA 4MQ1A 1APME 3A60A 4IVBA 5CF5A 2YM7A 2JD5A 2JKKA 3FPMA 2OFUA 4YHFA 3R8LA 3RI1A 2CKOA 4EH8A 3M42A 2I1MA 4XBRA 2WMQA 1OB3A 5EW8A 4BDKA 4HYHA 3NVMB 3E63A 4ANQA 3WYXA 4OAUC 1W2CA 2QONA 1P2AA 3ZRLA 4BCJA 1PRYA 4X0MA 2VTJA 4QMPA 4XRLA 1ZXEA 3ORKA 3ZSHA 4GUBA 3ZRKA 4BYJA 5E91A 3U8WA 4GU9A 5ETIA 3FMKA 3HNGA 4KA3A 4UBAA 4CRSA 5I9XA 2BILB 4MF1A 1LEZA 3ZOSA 1Q8TA 2X7FA 5CY3A 3NCZA 4JI9A 2GFCA 4EOOA 4OTQA 4FTNA 2O64A 2XBAA 3GCPA 4QMVA 2QOBA 4PPBA 2XYUA 5CNNA 4WNKA 2YDJA 1ZARA 2OZAA 3LQ5A 3RHKA 3TG1A 4V04A 3UC3A 3GI3A 3Q2JA 3COMA 4RC3A 3VBVA 2XBJA 3QTRA 5C27A 4L46A 4MX9A 4RWLA 2I40A 4GUEA 4IZ7A 2W1ZA 4QP4A 4G17A 4ZJVA 3F69A 3RPSA 4O7ZA 4NZWB 3Q04A 4AF3A 5AUUA 4ANLA 2SRCA 1S9IA 2AC5A 2XIYA 4TY1A 5CU4A 5L8JA 4IW0A 5HEZA 3PSDA 4FKGA 3PUPA 2EXCX 3QX2A 3HUBA 4PY1A 4MXYA 5CXZA 2WXVA 1MRVA 4TNBA 5CI7A 1XH9A 1XJDA 3QRTA 1IG1A 1SZMA 5AV3A 4HYSA 2JFMA 4LV7A 3FMMA 4C37A 5KHWA 2XUUA 3I7CA 2ZJWA 3ZM4A 3WF5A 4N6YA 2Z8CA 3AT3A 3H9FA 4PPCA 3LVPA 5DA3A 4IZYA 5HLWA 5DLSA 1YOMA 4LGGA 2CKEA 2YWVA 2NNWB 5K3YA 5FGKA 3LM0A 3ORZA 2XK8A 1SM2A 3NYOA 2WQMA 4QNYA 3VW8A 5LCJA 3WZJA 3QHWA 3SXRA 4C34A 1YRPA 3O7LB 3DOGA 3HVCA 3G9NA 3OCTA 5FXSA 5C26A 2GNHA 4JG8A 3UQCA 3ORTA 3OC1A 4J8NA 4PNIA 3FI4A 2ESMA 2IWIA 3L1SA 2NP8A 4UWCA 4FBXA 4EWHA 2CLQA 4LUEA 1EH4A 4RLKA 2XP2A 3EN6A 5FM2A 2VD5A 4HGTA 3EN4A 2PVHA 3OXTA 4L43A 4WHZA 3RBWA 4DLJA 3MB6A 4QMMA 5TO8A 3GCSA 1OUKA 3TKUA 4MCVA 4RRVA 2V5QA 2WMUA 1ST0A 1OL1A 3RPYA 4IE9A 4Y85A 2G9XA 4DGGA 4JRVA 3PIZA 2NRUA 4NT4A 3UOLA 4EZ3A 3GOKA 4WUNA 5H8EA 2WGJA 2OBJA 3VNTA 3QKMA 4GEOA 5LVLA 3V5PA 2O5KA 4IAKA 3CEKA 2UW9A 2QHMA 3FMHA 2JKQA 3OY3A 3ROYA 4CFFA 5M51A 1Z9XA 4GFGA 4CRLA 4AGCA 4DF3A 3EQGA 3ZFYA 2GNLA 2WFYA 5IQFA 4FKUA 3FYKX 3Q4ZA 2BALA 4FZFB 3MPTA 4KSPA 4C7TA 3ZONA 5CEKA 1TFFA 3ML1A 4ZLOA 4YZCA 4ID7A 2W1GA 5K5NA 4ASZA 3R9NA 5E1SA 3LAUA 3FDNA 4M12A 5BQ0A 5LVMA 4GG7A 2Q83A 2Y4PA 1R0EA 3LFCA 4YBJA 5CENA 2QOHA 3R30A 4H3BA 5CU2A 4O1OA 3TTJA 4O4EA 3UOKA 5FEEA 4FTKA 3PXRA 2CGVA 1PW2A 3ZO4A 5HKMA 4QYYA 2C5OA 4RVMA 5C1QB 2JIVA 3T3UA 3A7JA 5EH0A 4X2FA 3RMFA 4BI1A 5BVFA 2ACXA 2J5EA 4FG9A 3UIMA 4FC0A 4L3LA 3RCJA 4K0YA 4DC2A 2J6MA 4JMQA 4O0TA 2NO3A 4GG5A 5EDRA 1Q61A 4YJVA 5ITAA 1FMOE 4NM3A 1V0PA 4EI4A 4J95A 3L9PA 2O63A 2YN8A 3DXPA 3RWQA 3AD4A 3TNIA 4I6BA 3PXZA 4I6QA 4Y5QA 5CTPA 5FTGA 4DEDA 1HCKA 1G3NA 4IHPA 3TI1A 3ZCLA 4LDTA 3DKOA 1NT2A 2Y7JA 4TZRA 4EK4A 5KUPA 2ERZE 4HPUE 4DLIA 4GV1A 1H1RA 5F9EA 3UQFA 4O81A 3G6GA 3KVXA 3DKFA 1J91A 4EUUA 3CCNA 3VAPA 4G3GA 3BYSA 4XV9A 3ZYAA 4U5JA 5HLNA 5HCZA 4FL2A 3ACKA 4FZ6A 4QTEA 4OTIA 2R3KA 2YM6A 1PXMA 4OT6A 4XCUA 4ZP5A 4EK3A 4ITIA 4H05A 4C4EA 3FQSA 2GDOA 2IZRA 3NNXA 4QTBA 3AG9A 4TXCA 2H34A 4X21A 1RQQA 3VVHA 2BMCA 2J2IB 5HICA 5EQPA 1IA9A 1Q97A 5DR2A 4O1PA 2OU7A 3D2KA 4BCIA 3E87A 3PIXA 4I92A 4Q5EA 4O6EA 4BDFA 1WBPA 3GVUA 2JLDA 3HECA 3OWKA 3QKKA 4NK9A 3D83A 4O6LA 5CVGA 2WNTA 3EN9A 1OIUA 1PMUA 1XQZA 4XUFA 5HNIX 2BAQA 3R7GA 4Z7GA 5FWKK 2A0CX 5HBJA 4O82A 1XWSA 2YM5A 4KIQA 2C6OA 4O0RA 4RIXA 5HG8A 4L7FA 5KE0A 4C4IA 4YJPA 4HGEA 3FQHA 4GT4A 3W55A 4KIKB 4U42A 1H08A 3PP1A 4L8MA 2QKWB 2YM3A 3D7TB 3D5WA 3LLTA 4Q5HA 2ITPA 3DJ5A 4XYFA 5KMNA 1GZ8A 4PPAA 4XMOA 4EQUA 2JAVA 4IZAA 4TWNA 3SVVA 2W5HA 5AAGA 2WZJA 3MFRA 3UPXA 4M15A 4RX9A 4UMQA 4EL9A 2R3NA 2YIQA 5HX6A 4XP3A 5A3XA 5FUTA 2X8EA 3ANRA 2VTPA 4B8LA 3UNKA 5JGBA 1PKDA 4E20A 4RZVA 3GFEA 4UMUA 4JBPA 2B55A 4YNOA 5L4QA 2B7AA 3FKLA 4F9BA 3BHYA 3W32A 4EONA 3QZGA 4UXQA 4AU8A 4PMMA 3W0RA 3DLZA 1WBWA 1GZKA 2RIOA 4FSQA 3QA8A 4JR7A 3C4CA 3L8PA 4IWPA 4M3QA 5CSXA 2WO6A 4XG2A 4YHTA 3BWFA 4R3CA 3UP7A 1B38A 3ORPA 3QQFA 4ZZNA 4USFA 5M4UA 4E73A 1OIYA 4IANA 4C36A 1ZOEA 3JY9A 2PU8A 1R0PA 3E92A 4LGDA 2PUPA 4CXAA 5DI1A 4AA5A 3QTXA 3ZU7A 5I9ZA 3OT3A 4C3RA 2C3KA 2REIA 3SKCA 1M14A 2FGIA 4KKHA 3PFYA 4HYIA 4BDGA 3OCSA 3U9NA 2F2CB 3Q4TA 4K18A 1PXNA 2ZAZA 1UNHA 2WKMA 3Q9YA 4EK5A 4FIFA 4J1RA 3RK9A 2ZB1A 4KIPA 2ZMDA 4C38A 2O0UA 3TKIA 1U54A 5AA8A 2GMXA 3BQRA 2W99B 3LJ0A 4JX3A 4E8AA 4D1ZA 3IPHA 3I5NA 2XRWA 3ENMA 5EW3A 3LCTA 4ACCA 3BWJA 3ULIA 4OBPA 3UODA 3MI9A 5JN2A 3NGAA 3VUIA 4X2KA 5EFQA 5J5TA 2HY81 5AP3A 4IWOA 4QPAA 4FNWA 4ZTHA 4GKHA 4MH7A 4A06A 5I4NA 5C01A 5KMOA 4AZTA 5DR6A 3NW6A 2AEGA 3GBZA 3PWDA 5EOBA 2JFLA 1W98A 4IAFA 1V0BA 3F3VA 5C9CA 3W8QA 4FV3A 3UG1A 5AUTA 5LCKA 1J3HA 3DBCA 3FXZA 3GENA 5AR2A 4U8ZA 4GL9A 3R8MA 4B4LA 2UUEA 5F20A 2QU5A 4BBEA 1GZNA 2IZTA 4L9IA 4MK0A 1ZYSA 2WIPA 4NIFB 4Y83A 3TV4A 5AAFA 4CYJA 3HDMA 4NFMA 4F6SA 4AOIA 4K1BA 3ZLYA 3E62A 4XV2A 1YXTA 2VWIA 2EU9A 3TIYA 1ZLTA 1LPUA 1KE9A 4MHAA 4QD6A 3R7YA 4MNEA 2YDIA 2WAJA 3DGKA 5AR7A 4RX5A 1Q8YA 4PDPA 3CY2A 3K5UA 1PKGA 4XOZA 2JDVA 4EHVA 3V8SA 3MA6A 4C02A 3AC3A 1P4OA 2PWLA 4UWBA 2BAJA 3ATTA 3PP0A 2GPHA 1FPUA 3P79A 4W4YA 4FT3A 5ANKA 2BAKA 4QYEA 5BPYA 3REPA 2P4IA 3E7VA 5ACBC 3NYVA 3PJ2A 2X81A 5HG5A 4CG9A 1BLXA 2BKZA 2C4GA 3F5PA 5E8XA 3VC4A 4PL3A 5AP6A 3UO6A 3DT1A 4E26A 2E2BA 2R2PA 4LM5A 4X2JA 4E6QA 2Y6OA 3VQUA 3FLSA 3DKGA 3AC1A 4S31A 2IW6A 4MXZA 3PPZA 3R7EA 4BKJA 4BJJA 1SYKA 4CCBA 5M06A 1PXIA 3OWPA 3P86A 2XEYA 4IXPA 5J9YA 3VHEA 4YTCA 1YXSA 2OF2A 1YW2A 3DK3A 5EQEA 5C03A 5TKDA 3B8QA 5L2IA 5IG1A 4HCVA 4RZWA 3UIXA 3UPZA 3F66A 5HBHA 3I0QA 3F9NA 4F0GA 3HMOA 2BTSA 3AGMA 3GUBA 4NH1A 4IADA 5E90A 5ACKA 4O0VA 2GNIA 4AQCA 4FKJA 4BDAA 4BZDA 2JKMA 2F49A 3OD6X 4H36A 4O0UA 4YC3A 2BCJA 2R3MA 4R7HA 4QQ5A 2XKEA 4FNXA 4F99A 2CLXA 5DMZA 2XM9A 3IW4A 5E7RA 1OBGA 2PVFA 2ITZA 4ZXTA 3QTWA 4O2ZA 2FSMX 5GINE 4P90A 5IA3A 1E1XA 2QOKA 5HO7A 4J52A 3IONA 4AN9A 2BRBA 4FGRA 1PXJA 4Z16A 2YIYA 4FZDB 1YWNA 4K33A 5KKRB 5AV1A 4U0IA 3ALOA 3DB8A 2OWBA 3E64A 1YHWA 5LARA 3EN7A 3S00A 4XHKB 1PF8A 4W8DA 4IM3A 4TL0A 2WMVA 1OPLA 3V5TA 1CSNA 2J9MA 4K9YA 3DDQA 4U44A 4E4NA 4RJ6A 4IH8A 2C1AA 5CF6A 4ORKA 4F6WA 2VUWA 5BNJA 3LMHA 4G6NA 4OLIA 2W4JA 4YZ9A 3A62A 2BZIB 4D1SA 4BDBA 3WZEA 4JNWA 1CTPE 2VN9A 4FVPA 4PDSA 4WG3A 1Q4LA 3W2CA 5TF9A 5CSPA 2W96B 2GQSA 2ZFYA 2YCFA 3FLYA 3MY5A 2GNGA 4BKYA 1R1WA 3MA3A 3NIZA 4XG3A 3B8RA 4PUZA 4YURA 3IW5A 2G1TA 3DZOA 3EFJA 1BKXA 5LWMA 2CDZA 4A7CA 3SX9A 3RAWA 4LRKA 4IEBA 3R8UA 5EYDA 3FHRA 3NUUA 2ZYBA 3R1YA 2PVJA 4FSZA 3KVWA 5GZ9A 4O84A 5HE3A 2XNPA 4TW9A 5BVKA 4FV1A 1M2RA 5KZ0A 3QGYA 1KWPA 3V5WA 2XB7A 2QNJA 5KKRC 3Q60A 3VBYA 2BUJA 4QYGA 3KMMA 5AV2A 4NKAA 4TWPA 4WOVA 3P7CA 4TYIA 4CNHA 4HNIA 3V8WA 3E8EA 4OAVB 3BV2A 3A4OX 4IB1A 4O21A 5CU0A 4O0YA 4EOIA 4QMNA 2ZM4A 4FT0A 3MFTA 4BGHA 5JZNA 4BC6A 4EEVA 4JAJA 3C5IA 5C4KA 3DBDA 2X6DA 3DFCB 2F2UA 4OTRA 3NEWA 3U4UA 5A4LA 1DI8A 3FLWA 3POOA 4X3FC 2YIRA 4XG6A 3SDJA 1BI7A 1DI9A 2BHHA 4CQGA 4QMWA 4FG7A 4TYEA 4G2FA 5KMIA 1FQ1B 2C6TA 5DEYA 2B4SB 3TNPC 4LG4A 4PMPA 1H1SA 3L9NA 5FEDA 3ERKA 5T6KA 3RPRA 5M53A 4XG8A 3DZQA 2VRXA 4NW5A 3IOKA 3MY0A 4RC2A 2LGCA 5D9HA 1V0OA 2X2MA 2W5BA 4M13A 4YNEA 1YXVA 4Y72A 3TZ9A 4A4LA 2R7IA 5BUJA 2YACA 3NUXA 2XAMA 3AGLA 4ZS0A 1W0XC 5AUWA 3WOWA 3AKLA 1NVQA 3R73A 3RAIA 2WTKC 3MY1A 1JSTA 4YBKA 4FK6A 3F3TA 2DS1A 5JGAA 4TPTA 4XJ0A 4DTKA 4V01A 1REJA 2HELA 2DQ7X 5HG9A 4HNFA 1QPJA 3W2SA 4UMTA 3QX4A 2GS2A 2YLFA 2OZOA 3NUPA 3IKAA 2V22A 4MXOA 3EZVA 5H9BA 3CSVA 4MBIA 4FODA 3FL5A 4ERWA 5KHXA 3C9WA 1JPAA 4PP9A 4EH5A 2QO7A 2VO7A 4FG8A 2PYWA 4XLIA 4FK3A 2OJJA 5EI6A 4IX4A 4JBQA 4CFNA 5AR4A 4AOJA 5DPVA 1WCCA 4NUSA 5HE1A 4JR3A 5E8WA 1WZYA 2R0UA 3DTWA 4FICA 3U51A 4KKGA 3RNIA 4FT9A 2NYAA 3PE1A 1ZYCA 4LV5A 4E6CA 2X6EA 2ZDUA 4R5SA 5BYYA 3PVBA 4FKWA 5AP5A 1CKJA 3ZM9A 4HZRA 3R01A 4NW6A 5AP4A 4FV6A 4E5AX 3BLAA 5HX8A 2P33A 3HA8A 2GU8A 2YAAA 4IDVA 4QT1A 2PVLA 4ZLYA 2BFYA 1ZYJA 1NVSA 3HP5A 3KRWA 4DGOA 2CMWA 1FVRA 5E8VA 5IQDA 4L6QA 4RWJA 4UXLA 2VO3A 3F6XA 2GNJA 2G2FA 2ITNA 3VS0A 5E8TA 3WF7A 1VLRA 5BV3A 3DKCA 2AYPA 5FRIA 4ZJIA 4AXEA 1JNKA 3CP9A 4IX6A 4DHJA 1CDKA 4CV8A 3HRFA 3Q96A 5HQ0A 2XALA 3GCUA 4U80A 4DG2E 1VYWA 2C6MA 2V55A 3PLAE 1PMVA 4BCQA 4L3JA 3BHHA 3ACJA 4XV1A 2OKRA 4I94A 3QTUA 4A9UA 3JPVA 4BL1A 2XIRA 2VAGA 5LQFA 2J50A 4AA0A 4C59A 4D0XA 2C3JA 3F3UA 4X3FA 3ULZA 3UVRA 3ZHPC 4FV2A 3M2WA 1GJOA 4ZSAA 3QFVA 3Q6UA 1JKLA 3Q32A 3R7UA 2ZV9A 4ERKA 5J7BA 5CNOA 2WU6A 3DTCA 1K2PA 2XCKA 2XVDA 3G0EA 3NS9A 3LQ8A 2C6IA 4YJRA 4I5CA 1ZMWA 4FEWA 4BR3A 1I09A 3PRIA 4AFJA 2PVMA 5B7VA 3TUCA 4KS8A 5AAEA 4QDVA 2J90A 2GHLA 3EQBA 3KXGA 2GNFA 3G33A 4JQ7A 3TN8A 4E93A 2W06A 4DT8A 4C58A 3L8VA 1TQMA 2GHGA 3P0MA 5CAQA 5CI6A 2PK9A 1DM2A 4F7JA 2R3GA 4L67A 2YHVA 2VTNA 2G01A 2BIYA 2VTOA 4LMNA 4CMTA 4FTTA 4A9YA 4EZ5A 2I0YA 2F7ZE 3BU6A 3E3BX 4RJ8A 1GIJA 1Q99A 5HI2A 3VUDA 5AUXA 4GJ2A 4I41A 1H1QA 3C4EA 4ZSLA 3VS2A 3QAME 4D4SA 4EK6A 4DE4A 2ZV2A 1ZY4A 3D14A 2ZDTA 3GC0A 3QD0A 5DRDA 3ZEPA 4C0TA 3NMUF 2UZTA 1NXKA 4D1XA 4OTGA 5M09A 5CVHA 5BVEA 4FIGA 3KN6A 4EHZA 2UZEA 4LOPA 2QCSA 1NVRA 4D55A 4EWQA 5KMJA 4MD9E 2BDJA 3ORXA 3HV7A 5G1XA 1ZAOA 2BZHB 3R9DA 4H58A 3VUMA 4CCUA 1OKWA 2F9GA 5H3QA 3LJ1A 1WBNA 3NDMA 3LXNA 2VTQA 4FSTA 1LEWA 4L00A 4QP3A 5HNGA 2XNMA 3ZO1A 4CFUA 3EHAA 4L44A 5HESA 5FG8A 4QMLA 5GZ8A 5J1WA 3LXLA 2ETMA 4GW8A 1W2FA 3F3ZA 3I7BA 3O17A 3OWJA 4DFLA 4W9WA 2VZ6A 4ACMA 4E5WA 4RVTA 2QQ7A 5L8KA 4KWPA 4P5QA 4ASXA 2X4FA 3WIKA 4D5HA 3GGFA 3O2MA 4EJ7A 2BFXA 3KIOC 4A9TA 3I81A 2F7XE 3KEXA 5H8BA 4AW5A 4IJPA 1VZOA 5LMBA 3KK9A 1XH5A 5A4QA 3TM0A 3V04A 3RALA 2R4BA 2XCHA 1H28A 3D9VA 3FE3A 3VS5A 3QCYA 2G2IA 5AP7A 4EYMA 3S0OA 4MD8E 2I0EA 4N0SA 2WHBA 4FA2A 4QTDA 3RWPA 5ICPA 2PE0A 4WIHA 3I60A 2AUHA 5EYCA 4DYMA 4NL0A 1XR1A 5L2TA 2OFVA 3FC1X 2VWBA 4F70A 2VGOA 2X7GA 2XKCA 5KCVA 3HMMA 3PRFA 3IK3A 3GNIB 3E8NA 2ETKA 3MH2A 2HZ4A 5AX9A 5E92A 3ZTXA 4BDEA 5JEBA 2XKFA 5FEQA 1TVOA 4PP7A 3QGWA 2W1HA 4I5PA 5C8NA 3VF9A 3DPKA 2W4KA 3TNQB 5BVOA 3L9LA 3DNEA 4CMUA 4CT1A 3C0HA 2IW9A 4IFCA 5EYMA 5DEWA 3PZEA 4WNOA 2UZDA 1S9JA 4TYJA 2OJIA 3PY0A 2OIQA 5DIAA 4BWPA 3AC8A 2YCRA 3LFQA 2X1NA 3QUPA 1JVPP 4HVHA 3NYXA 4NTSA 1RDQE 5IQEA 2J4ZA 1IASA 4DEBA 3FZSA 2HYYA 4G6LA 2WTDA 3QD2B 4IQ6A 4W4WA 2ZB0A 4JDHA 1YXUA 4Y8DA 1U46A 5CQWA 4RQKA 2JIIA 3DLSA 1Q8UA 5HOAA 2YJRA 4LI5A 2B52A 3HGKA 5CX9A 4AA4A 4F9WA 1W7HA 3AMAA 3FI2A 3N4UA 3KMWA 3O50A 3P1AA 4HCTA 5L6WL 4RJ5A 3TIZA 4HVIA 3P5KA 4XH6A 3E3PA 3CD3A 3ODYX 3NUNA 1YDTE 1SVGA 4L7SA 4W8EA 3QQUA 5D1JA 2XA4A 2XMYA 2X9FA 1OKVA 5AWMA 2H6DA 4U97A 4BI0A 3C7QA 5CU6A 3BGPA 4MWIA 3MTFA 4RA5A 4RIXB 3L8XA 3EIDA 1OITA 5GZAA 1VJYA 2VNYA 2R3OA 5IQHA 3ODZX 3NUAA 1RJBA 3QWKA 5IQBA 3O71A 3RTPA 3UDZA 2FUMA 2QVSE 4FEQA 4DEHA 3W0NA 5LJJA