3A7GA

Human mst3 kinase
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
290
structure length
289
Chain Sequence
GLPGMQNLKADPEELFTKLEKIGKGSFGEVFKGIDNRTQKVVAIKIIDLEEAEDEIEDIQQEITVLSQCDSPYVTKYYGSYLKDTKLWIIMEYLGGGSALDLLEPGPLDETQIATILREILKGLDYLHSEKKIHRDIKAANVLLSEHGEVKLADFGVAGQLTDTQIKRNFVGTPFWMAPEVIKQSAYDSKADIWSLGITAIELARGEPPHSELHPMKVLFLIPKNNPPTLEGNYSKPLKEFVEACLNKEPSFRPTAKELLKHKFILRNAKKTSYLTELIDRYKRWKAEQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of human MST3 kinase in complex with adenine, ADP and Mn2+.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Serine/threonine kinase 24 (STE20 homolog, yeast)
total genus 87
structure length 289
sequence length 290
chains with identical sequence B
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2009-09-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3a7gA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3a7gA01
3R21A 5L8KA 3PLAE 3RM6A 3EN7A 3LFNA 4M97A 3QTUA 3UVQA 4XUFA 5EQPA 2XF0A 5ANKA 3BHHA 3F5PA 3DA6A 4NIFB 5F1ZA 1W8CA 2UZNA 5L2IA 3DCVA 5KKRC 3I7BA 3A7GA 4EC9A 3K5UA 4CFNA 5KUPA 3VBXA 4I6BA 1R1WA 1L3RE 4L01A 5EYCA 4CFWA 1OPKA 1RDQE 4U9AA 2PVRA 3OOGA 3P1AA 4KKHA 2O5KA 4N6YA 3PA3A 5IQAA 2YLEA 2C3IB 4TNDA 2NNWB 4V0GA 2XIKA 5DR2A 2OZAA 2R7IA 3TUDA 3V8WA 5M4FA 1V1KA 1MRUA 1OL6A 4FSTA 3QCSA 4RIWB 3FZPA 4NSTA 4RQKA 2GSFA 3C0HA 4R5SA 3DZOA 4YTFA 4O96A 5D11A 3GU5A 3BGZA 3BI6A 2QVSE 4Q5HA 5AM6A 2G1TA 3A60A 4L67A 4CTBA 4AN3A 2R3FA 2BIKB 4I3ZA 4RIOA 1UVRA 3ZM9A 3PA4A 3E64A 2W5HA 3QD0A 3FMNA 2X7OA 5ACKA 2CSNA 4RA4A 5IEVA 4QMLA 3D7TA 3QUDA 3MH2A 3R30A 1V0PA 2O8YA 4OLIA 4BCFA 4GT5A 1URCA 3ENHA 2YFXA 4RA5A 2OFVA 4O1OA 5KO1A 2HZIA 2BALA 3D7ZA 4IDVA 2ZVAA 3VW6A 5JH6A 2WHBA 1YWRA 2AYPA 5DMZA 4NL0A 1H24A 4FZ7A 2WQBA 4CMUA 3T9IA 1XH8A 1T46A 1OL7A 2PVYA 3D5WA 3BHUA 4U79A 5C03A 3NW6A 3WIGA 2V7AA 4EC8A 2BIYA 1JKKA 4EK8A 4UMPA 5KHWA 3UJGA 5CT0A 3LFEA 4FYOA 3FYKX 3VHKA 3FC1X 2WU7A 5CEKA 4O7VA 1F3MC 4HOKA 2C3JA 3DTWA 3T3VA 5CVFA 5IQBA 3AGLA 4PWNA 5FTGA 4TYHA 3K3IA 4DFYA 2YZAA 4ZLYA 5FP6A 4N70A 5LVNA 2OJIA 1J1CA 1VEBA 2ZDUA 2C6DA 4KIOA 4FEXA 3L8SA 3QTSA 4FX3A 3UBDA 4C3FA 3OVVA 4WUAA 2OFUA 5BUEA 1BL6A 4KSQA 1FVTA 2IVVA 4KINA 1UWJA 5JT2A 3UOJA 4ANOA 1UWHA 2OIQA 4FKQA 4R8QA 5ANDA 2J51A 3DZQA 3F3WA 2BAQA 3QALE 4GUBA 4UX9A 4FZDB 1M2QA 4BC6A 5M07A 2Y6MA 2W06A 5TE0A 4F9BA 1Y6BA 4JL9A 2GHLA 2WTKC 4GK4A 5A9UA 5FXRA 1OM1A 3ENMA 3TKUA 4H1MA 5JEBA 3G9LX 3DBDA 3E3BX 4O38A 2OJFE 3OEZA 3Q04A 5D10A 3RP9A 1ZMVA 4YLKA 2GHGA 1YOLA 5HKMA 3NS9A 4AU8A 2WMXA 5BVKA 1BL7A 5DBXA 4OT6A 5T3QA 4HVSA 4GSBA 3KK9A 3UOKA 5CSHA 5FDXA 5AAFA 1Y8YA 3TDWA 4I21A 4QP8A 4MF1A 3Q6WA 3KXGA 5GZAA 4YTIA 4UBAA 1K9AA 2OIBA 2QOHA 1YDTE 3OCSA 3PYYA 2VV9A 3RTPA 4HVDA 3UZRA 4Z7GA 5FEQA 2HOGA 4AZFA 4W4XA 3HDMA 1DI9A 4XG4A 3VUHA 4ZZOA 5AUUA 5FG8A 3R8LA 3RHKA 3KU2A 3TV7A 3R7UA 3R83A 3UO5A 2E2BA 2IW6A 3DQXA 3G2FA 2CKQA 1H1SA 4O2ZA 3DLSA 4RG0A 1UNGA 1OGUA 5JZNA 2IZUA 4FV7A 1UA2A 1YDSE 1M17A 2QOOA 3HX4A 3KVXA 3ROCA 3W2SA 4QYYA 3VN9A 4BDGA 5HQ0A 3PG3A 4FL2A 4MWIA 3OUNB 2A19B 3HRFA 5HE0A 3MN3A 4CRSA 5ICPA 4KUJA 2C0OA 2FSMX 3BWJA 3COKA 2IJMA 2V22A 3L8XA 5K0KA 4BDDA 4EWQA 1IAJA 4YZMA 2CNUA 5AP2A 4QQCA 4ZK5A 2YJRA 2OSCA 4FKLA 4QMUA 1OUYA 4ANMA 2JAVA 3SD0A 1W84A 1PXMA 2WPAA 4DTAA 4FNXA 1ZLTA 3LVPA 4RX7A 2BRHA 1ZOGA 3CKXA 2OZOA 1Z9XA 2EB2A 3PPJA 2YCFA 5L2TA 3CTHA 4IX5A 3V04A 4NKAA 2XK4A 3NNXA 5ETCA 2G2IA 4DH7A 2G9XA 1IG1A 3LFDA 4RVTA 4DEEA 4FTQA 3PLSA 4AA4A 3CE3A 2RGPA 4MD8E 4C4JA 2XYNA 2RIOA 3A61A 2WMQA 3W2OA 1RW8A 2OO8X 1SNUA 3DKGA 4IX4A 4L3PA 5E8SA 2X2KA 3NPCA 3PP1A 5E8XA 5BX0A 4NWMA 3R71A 3Q53A 4NEUA 1OIQA 1ZAOA 5BVOA 4XLIA 1Q8YA 2X2MA 3KGAA 4FTOA 2PVLA 3LCOA 2HW6A 3AD5A 3FKOA 2VWUA 2YAKA 1ZXEA 4HYHA 4QO9A 4RLLA 4K0YA 3RAKA 1ZRZA 4GFMA 4RC2A 4ZLOA 3ITZA 2VO6A 3BCEA 1PXJA 4ZY6A 5M44A 2I7QA 4S30A 4JQEA 4ZMEA 1ATPE 3DK3A 4EH8A 4F9AA 1W83A 4I93A 2F57A 5J1VA 1H1QA 3VQHA 4EHZA 4BDAA 3ORNA 1R0EA 4BDKA 5AR4A 4MXXA 3RKBA 2DUVA 2QC6A 3BE2A 3Q5IA 4TN6A 4KABA 2BDWA 3QF9A 5HBHA 2OGVA 3NAXA 3FLYA 3VRYA 4BCPA 2B1PA 2BHEA 5J9YA 3H9OA 5CI7A 4GEOA 3UMXA 2C6LA 4G6LA 2H6DA 4QNAA 3UP7A 3VS7A 4AZTA 5ETAA 4C4IA 5IQIA 3QQUA 5EM5A 4CGAA 3SRVA 4NIFA 3ORXA 5KX8A 2ITQA 4UMQA 3OY1A 5A46A 3FHRA 3AOXA 4LL0A 4YO6A 1J1BA 4EONA 4S2ZA 1H00A 4CLJA 1WBWA 1MRVA 4YLLA 2PULA 5ETFA 3OCGA 4V05A 2V5QA 4K6ZA 3HLLA 2IN6A 4EH6A 3PUPA 1IRKA 1XBCA 3ZUUA 2ZB0A 3WZJA 4AOIA 4O0YA 5L2WA 3BELA 4AT4A 3B2WA 1ZOHA 4DE4A 4I6FA 3KC3A 2F2UA 3KF7A 3MY0A 2VWYA 4RJ6A 4S33A 4TWCA 2P55A 2W99B 1Q8ZA 1PMNA 4XBUA 5L6WL 4PMPA 1ERKA 3V8SA 2J9MA 5DYJA 4JVGA 2C6TA 4MVFA 5E1EA 1H1WA 3RINA 4DFNA 3AD6A 2JGZA 3DB6A 3KRRA 4M0YA 3Q2MA 5E91A 2P4IA 3BYOA 1Q99A 4U97A 2E9NA 3P79A 2YJSA 4E6AA 4WBBB 4WG4A 3EFLA 2RFSA 4RFZA 3ATTA 2BKZA 3W1FA 2BKKA 2O2UA 2WFYA 3MY1A 1KUTA 3OMVA 4YBJA 2YIRA 5I9VA 3QAME 2VTPA 2JDTA 3LQ5A 4FIGA 4PMMA 4O83A 5JK3A 1SNXA 2O3PA 3FXWA 3G6GA 4F99A 2J0JA 5J7BA 5DWRA 3R04A 5CSPA 4FTRA 2FB8A 3ZDIA 3ZEPA 5F9EA 2I6LA 3F3TA 4FKTA 3REPA 3LJ1A 4NM0A 3F6XA 1FVVA 4U6RA 3G15A 3TXOA 2HZNA 3AT4A 4F4PA 3ZFYA 4YU2A 2W9ZB 3AC3A 3AD4A 3DKCA 2W1FA 3NYVA 4Y73A 5A6OA 4QP4A 2XKCA 5LARA 1G5SA 2BDJA 4FEUA 4O7RA 3QD3A 4I94A 1Q24A 2ITTA 4ACHA 3BU6A 4R7IA 4WG3A 3FQSA 1XR1A 3DK6A 3I6UA 4JI9A 3CKWA 2WQNA 3SC1A 4YUQA 5EKNA 1YXTA 3LFAA 2YIXA 4QMNA 5IZFA 5CYIA 1YHWA 2OJ9A 3TZMA 4USDA 4OT5A 4EJNA 2JFMA 3R7YA 4FKSA 3EQRA 4K1BA 4DH1A 1O6LA 1R0PA 2A0CX 2GNHA 4AA0A 4AZSA 1JKTA 4PUZA 4E4NA 2REIA 4GL9A 4WD5A 4ORKA 4LL5A 5CEPA 2Z7RA 4QMTA 5AV1A 3SOCA 4NJ3A 2GU8A 3LHJA 4TWNA 3KXMA 4FKJA 4FTNA 3MWUA 4U0IA 3VS3A 2GTMA 1Q62A 2C6KA 2E9UA 3EJ1A 4LQMA 4ZOGA 5AR2A 3RK5A 3EKNA 5CALA 4EQUA 3VAPA 3V5PA 3RK9A 4J98A 3HP2A 2WEVA 4FYNA 4LRKA 5EW8A 3WF6A 2XCKA 3NW7A 4YR8A 3A7IA 4AWIA 4C3RA 1W82A 5HD7A 3SRVB 3P23A 4WA9A 4BZNA 3ANQA 5J5TA 2R64A 1Z5MA 4XP2A 4FTLA 3ZFMA 2O65A 2CGWA 1ZZLA 2UV2A 1OECA 5J7HA 5L6PA 3Q4ZA 3ORPA 1YI6A 3E93A 4PDSA 5CS6A 4DEBA 4AS0A 4DGLC 4W4VA 4IEBA 4W8EA 1H26A 3GCSA 4FSNA 4RIXB 3E8EA 3FMJA 4AGDA 4U8ZA 1TVOA 2G2FA 5LWNA 2BUJA 1BKXA 4DTBA 3RZBA 2HWPA 4FTCA 2YWPA 4EHVA 2OI4X 5I4NA 2A27A 5EK7A 1O6KA 2VGPA 4D0XA 5I0BA 5H8GA 4FZAB 1DM2A 2EWAA 3HP5A 4JOAA 3R8ZA 4E20A 2IZRA 2YN8A 3DAJA 4M13A 1TKIA 3QRUA 2UUEA 5K3YA 2HW7A 4JG8A 2YHVA 2VTHA 4KA3A 3UG1A 2VWVA 1CKJA 1KSWA 3QQGA 3EIDA 4UY9A 1K3AA 2BRBA 5EHOA 1O6YA 3BLRA 3ZSIA 2WMTA 4E5WA 1GZOA 5GIPE 3TKIA 5AA9A 2YACA 4AQCA 4E5AX 5GIOE 2W1CA 2R3QA 5BNJA 4YJTA 3PZEA 3E7OA 1ZYSA 5DE2A 4NUSA 5B0XA 4K11A 1JSVA 4O91A 4PMSA 3UQGA 3ZCLA 4I92A 2PMOX 3EZRA 4M69B 2IW9A 4ARKA 2YWVA 3C5IA 3KMMA 4M8TA 1NW1A 4GJ3A 4G3EA 3U51A 2X4FA 3RCJA 4MXAA 4FGBA 4BI0A 4KNBA 3BBWA 2YITA 4R3RA 4ERKA 4HW7A 3QTXA 5IH5A 3UP2A 3VO3A 5KKRB 2XNMA 5CSVA 1URWA 2OU7A 3ACKA 4X2NA 3KRWA 4GRBA 5BVFA 1Y57A 4BDBA 2J0IA 4IB5A 3CLYA 3QWKA 3RVGA 3RWPA 2GNJA 1SVEA 2YDKA 3DBFA 3R9DA 2PMIA 3VVHA 4BBEA 1ZOEA 4DHFA 2DWBA 4BDIA 5HO7A 1REKA 2OXYA 3NYOA 1YHSA 4L46A 1IAHA 4IAAA 4I1ZA 5DRBA 5FM2A 1NA7A 3V5JA 5KMOA 5AAEA 1QPEA 2XA4A 4IANA 4YJQA 4O27B 4DITA 3OOMA 2VTSA 3O7LB 5EW9A 4F6WA 4CMTA 3GCVA 4IAYA 5M4UA 4YTCA 4O82A 4RVLA 2QONA 3NZ0A 3U55A 1BI8A 5IU2A 2PUNA 5DA3A 3RI1A 5KBRA 3R7GA 4FSWA 4D28A 4QPAA 4G31A 5IA0A 4GKIA 4JQ8A 2OKRA 4IMYA 3HAVA 5EH0A 5AAGA 4J8MA 1U5QA 4DN5A 2XP2A 5CY3A 4BDEA 3DNEA 5HNIX 3HZTA 4ZEGA 3QCXA 2XJ2A 3SGCA 3I5ZA 5CANA 3VS0A 1I44A 4KS8A 4J95A 4MH7A 4YJRA 3Q9ZA 4FKWA 5CQUA 3UNZA 4I0TA 5HO8A 2OF4A 4DBXA 3CD3A 4D1ZA 4M3QA 3C51A 4FTAA 5I3OA 3HGKA 4DLIA 4ASDA 3G0FA 4Y46A 5IA5A 3MVMA 5CU3A 3OP5A 4AW5A 1B39A 4GUEA 1CKIA 3C4FA 2RG6A 4AP7A 5AUYA 4G9CA 1PMUA 4BICA 1TQPA 1EH4A 1S9JA 2X1NA 2CDZA 2PZYA 3AGMA 4FV2A 4L3JA 5DR6A 1FGIA 4AT3A 4AT5A 2WTKB 3F66A 3BQCA 2FVDA 2UW7A 3QX4A 3EFWA 3TWJA 5DGZA 3SXFA 1Q61A 4KKEA 3LE6A 2UW6A 4JDIA 1GIHA 4E6CA 3DXQA 2BZHB 4YNOA 4R1YA 3IOKA 1CDKA 3SW4A 1H07A 4JIAA 4BTMA 4R78A 2FO0A 2C68A 2XK9A 4EZ3A 3OTUA 3BV3A 2BTSA 4PV0A 4YTHA 4NH1A 1OKYA 2PE1A 3EQCA 4NFMA 3VULA 2NPQA 4IWOA 3ZLYA 5BMMA 3QA0A 2H8HA 3QFVA 1BYGA 4KD1A 2PHKA 2GNLA 5K4IA 4FC0A 3POZA 2QOCA 4TYIA 4BRXA 2IPXA 2R0IA 3DJ7A 4FVPA 3LM5A 4EOOA 3LLAA 4ZJVA 2WTCA 5M53A 3C5UA 4K77A 4PF4A 4O7WA 4Z3VA 4O7TA 5AP0A 1R39A 2R0UA 2QOLA 4EH4A 4YO4A 5K4JA 3K2LA 5HGIA 4LV5A 4UB7A 4TKSA 2XVDA 3ZRKA 4IBMA 2RL5A 4IACA 4GW8A 1E9HA 1QCFA 4ANSA 1ND4A 3LKMA 4XEYA 3ATSA 3ALNA 3LJ0A 1H27A 2QO7A 2GPHA 3GCQA 4PP9A 4W9XA 5FQDC 3TI1A 4BVUA 4RWLA 5AA8A 5J79A 4FIFA 4PDPA 3IO7A 4FOCA 3MH3A 2EVAA 3OTVA 3TN8A 5LMKA 2B4SB 4GKHA 4K33A 3NMUF 2PUIA 4FV9A 2ZV2A 4LOQA 4F70A 2AC5A 4ZTQA 4TT7A 3ZLWA 1GIIA 5LMKC 3MB6A 3F3VA 3LCSA 2CKEA 1WBOA 3F9NA 3PJCA 4FODA 5DT0A 2RFEA 3LXLA 3WIKA 3IW8A 3CPBA 4DG2E 2LGCA 5HU9A 3MTFA 4JG6A 5EM7A 1JKSA 3PXYA 3ZC6A 4EH9A 5AUWA 4KRDA 4X2JA 5DVRA 5BMSA 3UPZA 4QP2A 3MFTA 2E9OA 4M7IA 1Q97A 3G6HA 3H9RA 4UV0A 4EK3A 4KIKA 2UZUE 1T45A 3SOAA 2P2HA 3CQWA 2IG7A 3ROYA 5J95A 4ZMFA 1E1XA 3FMHA 3ZUVA 3PRFA 5EG3A 3ULIA 3S00A 4CZYB 4LI5A 2ZV9A 4BY9E 1YWVA 3O23A 2UW3A 3WF8A 2X9EA 5AP6A 3PVUA 5CNNA 4BYIA 4NCTC 4HYSA 5L2QA 2JKMA 5IA4A 2PPQA 2J5FA 4PRJA 2C5XA 3BX5A 2UW0A 4IE9A 3IW5A 3MBLA 1ZYDA 2HY0A 4E4XA 5L6OA 5LMBA 3UNKA 3CQUA 4IB3A 1YXXA 5JFXA 5I9ZA 4YJOA 1IR3A 3I4BA 3HA6A 4QMPA 1A48A 4RJ4A 5ETIA 4B9DA 4I5MA 2FUMA 5H2UA 1ZWSA 4CG9A 5IMEA 4FVQA 2H96A 2XBJA 4JBQA 4JQ7A 4HPTE 3DOGA 5CEQA 3GU8A 4JRNA 4R3PA 3LMHA 1RQQA 2PVKA 2F7ZE 2VTIA 3NCZA 5AWMA 2PUPA 3JR1A 4L7FA 2JKKA 5TOZA 3BYSA 2B52A 4Y8DA 4ZTSA 4ZTMA 1WAKA 3QTIA 3W33A 4TY1A 3LCDA 5D7AA 2PZPA 5JGAA 3B2TA 4FT7A 3UIBA 4DCEA 3BZ3A 3EYGA 4PNIA 4LFIA 2P0CA 4ANLA 4IVAA 5C9CA 3EQPA 3PSDA 1YW2A 2YEXA 4XHKB 4BF2A 3AT3A 3Q60A 5KMMA 4F08A 4OUCA 3ALOA 3TG1A 5CF5A 5M4IA 5AP1A 1HCKA 3FI2A 4QMXA 5TR6A 2BZIB 3ZC5A 4BGGA 3OT8A 3BGPA 3KULA 3SDJA 3FHIA 4FT0A 5KMNA 1NT2A 3QC4A 3POOA 4QMWA 4AACA 4OTQA 1OMWA 2QLQA 3I81A 2ZJWA 2GTNA 3A8WA 4IH8A 5IEYA 2VTMA 5AV4A 2V7OA 2CNQA 1M52A 4AN9A 5TKDA 4IVBA 5IQFA 2HY81 3IQ7A 1FQ1B 4RVKA 4TYJA 3UIMA 4NCTA 4ACGA 4F64A 3SLSA 4RJ5A 2VTAA 4M0ZA 2W1HA 3IG7A 2C6OA 2PZRA 3G33A 4ZIMA 5M09A 4G3GA 4XRLA 3EL8A 5A6NA 1BX6A 1PXOA 2DYLA 5DPVA 3SVVA 4QYFA 2XKFA 2W5BA 2ZV8A 5DRDA 4AFJA 2HIWA 3OXIA 4G6OA 4RFMA 5JSMA 3BLQA 3U4WA 1MP8A 4JDHA 4U44A 4X3JA 5FD2A 5G6VA 3WZUA 3CEKA 3HUBA 5JRSA 1Q3WA 2JC6A 3CC6A 3ZO2A 3ZU7A 4A4LA 5KZIA 3VJNA 5JN2A 2CN5A 1UNLA 3ZBXA 2V0DA 2B9IA 1JAMA 4D55A 5JFVA 2YM6A 3WF9A 4HGTA 2UZDA 4ZSAA 4EOLA 4ACMA 3MDYA 2ETMA 5DEYA 4E73A 3QXOA 2EB3A 5CVGA 2JDOA 4CFVA 2C4GA 3F7ZA 4FT3A 2RFNA 3HL7A 1U46A 2XIYA 2VX1A 3FMLA 1Q8WA 4U5JA 4HCUA 4J1RA 4XG7A 3QKMA 5CEMA 2O0UA 2VO7A 4QPMA 3VBTA 4C2VA 4L45A 4C4FA 4EK4A 3OCTA 3D2KA 5K0XA 3UVRA 3A8XA 3RPSA 2ITVA 3DAKA 5LQFA 1JKLA 3MGYA 4GT4A 4BCHA 2B0QA 2CGXA 3W2CA 5GZ8A 5G1XA 3OBJA 1PHKA 3EL7A 3CY2A 4F9WA 2WTVA 2VNYA 3F82A 4AGCA 4TL0A 3R7IA 3HRCA 4NM5A 4HYUA 4D1SA 1GIJA 4ASXA 2X6DA 2PVJA 2OXXA 5HVYA 4IM0A 3D14A 3ACJA 4F7SA 3S1HA 4I5PA 5C8KA 3EMGA 3OCBA 1ZMUA 3GU4A 4X3FB 4YJNA 3SG9A 3DLZA 4GH2A 1JNKA 4O7YA 2ERKA 4FEWA 3R00A 4WSYA 3S95A 4CZUA 2F4JA 3MYGA 4I5CA 4JXFA 3O71A 3M1SA 5D9HA 1ZYJA 2KTYA 4HCTA 4QMSA 2HZ4A 5HTBA 1XH4A 1JSTA 4JBPA 4NU1A 4AZWA 2R3HA 5A14A 5TO8A 4G3DA 4FSMA 4KBKA 5HCYA 4NJDA 4UXLA 3TACA 4LM5A 3PSBA 3TCPA 4C02A 3A7JA 4WO5A 2R3MA 3UYTA 4XG2A 4YHTA 3TEIA 4CYJA 3Q9YA 4M12A 2QOIA 3ZSGA 4CG8A 2CGVA 5HCZA 3ZO3A 5F4NA 5GJGA 3NWWA 4XOYA 2X9FA 4IQ6A 1G8SA 4FF8A 1U59A 4MTAA 4M84A 4TNBA 5JZJA 3OC1A 3SKCA 5HG7A 2YM3A 2X7GA 3Q52A 3MPMA 4PDOA 2WEIA 3UOHA 4F6SA 3P9JA 4EOSA 5C26A 4FE2A 2GQGA 3LFBA 5FBNC 5EM8A 2DS1A 3NUUA 3QCYA 3DB8A 5CTPA 1SYKA 5B2KA 5JQ8A 3GU6A 3OD6X 4D5KA 2F7XE 2VUWA 3LXPA 4BB4A 1OIRA 4TYGA 2VNWA 4WRSA 4UEUA 2WQOA 5EDRA 2J0LA 4G1WA 1A06A 5E8YA 4F7NA 1UV5A 3IK3A 5AUXA 3VBWA 4FSUA 3E7VA 2BR1A 4M69A 2CPKE 4XMOA 3FMEA 4UWCA 4FNZA 3FLZA 4AA5A 5BQ0A 4L68A 2VU3A 4GFOA 2NRUA 3IW4A 3O17A 2W9FB 4KS7A 4UMRA 3TZ9A 4H36A 3VS1A 3LW0A 3VUTA 4FOBA 3RHXA 1H0VA 1PKGA 1OB3A 4TWPA 3UDBA 3FZ1A 3VS4A 4ID7A 4TW9A 4UWBA 1RJBA 4I41A 4OTWA 2CN8A 5H8EA 3UZPA 3NNWA 4F1MA 4GG7A 4LRMA 4X6RA 4MYGA 3QHRA 3E87A 1UU7A 2F7EE 5BVWA 5C27A 3P08A 3RCDA 2C3LA 4FI1A 4DGMA 4F7JA 5BUJA 5IPJA 2XM8A 5E4HA 1W98A 4IXPA 4BTKA 4M14A 2BILB 1APME 4YC3A 3UVPA 4EH3A 2GHMA 4ALWA 3TNWA 3D9VA 3UG2A 4BDJA 5HX8A 3HMPA 3O8UA 3PJ2A 3ZLXA 5DFPA 3DDPA 3ZTXA 4A7CA 4BCMA 2ZOQA 2J6MA 5KMIA 2IZTA 3QKLA 4D2TA 1Y6AA 4DAWA 4Z16A 4CRLA 4O86A 2BTRA 4ZAUA 2LAVA 3KKVA 1LEWA 2H9VA 3HV6A 2GS6A 1NVRA 4FIEA 3GC7A 1NVSA 3ORTA 4FTKA 4G3CA 2VWXA 4RT7A 4WNKA 3WBLA 3ZMMA 2XKDA 2F49A 4XLVA 3A62A 4IWQA 4AUAA 3LZBA 3OUKA 4HYIA 4EZ7A 4FSYA 4XG6A 1YXVA 3ZUTA 4OTFA 3MH0A 3TNIA 4C62A 2VTQA 2VZ6A 4GS6A 3NR9A 4E8AA 2VAGA 3GFEA 3VBVA 3VHEA 4B4LA 3U9CA 3LCTA 4Q9SA 4RQVA 1CKPA 3GCUA 3S2PA 4ZXTA 4J53A 1AD5A 3FAAA 3FSFA 3KRLA 3RPVA 4IWDA 4BKJA 3O51A 3BHVA 4S32A 4MD7E 4MBIA 1LR4A 4BIDA 2NRYA 3CR0A 1W7HA 3NUSA 4QYGA 3Q3BA 4W9WA 4PPBA 2QQ7A 4F1OA 3NUPA 1MQ4A 2BFYA 5AIRA 4DEHA 4MQ1A 2WQEA 3D5XA 4NM3A 4GYIA 4R5YA 5EM6A 3W2PA 4O84A 5TF9A 3TIYA 2J7TA 4D58A 3N4VA 3WE4A 3CXWA 3SQQA 5I9XA 4O81A 3JS2A 4O0TA 3RMFA 4FSRA 3ERKA 2BROA 4W4WA 4EI4A 2XNNA 3IGOA 4UYNA 1PXPA 2ETKA 3R63A 4O6LA 3ZS5A 5LWMA 3F3ZA 1VZOA 4JRVA 1WBNA 3QCQA 2BFXA 2OK1A 4MWHA 5DG5A 3D2IA 5FGKA 3HAMA 2GCDA 2QOQA 2QR8A 3N9XA 4K18A 4QTEA 5AM7A 4KIQA 2EUFB 3R1YA 4F65A 1M14A 4H05A 4IAIA 5GHVA 4CEGA 3NVMB 4FL1A 2FSLX 4JLCA 2PYWA 2GNFA 4FSQA 1OBGA 4I0RA 4H3PA 4IW0A 1SVGA 5HLPA 5HVKA 3V5WA 3MTLA 4R77A 5IQCA 2QODA 3KF4A 3BQRA 4QP6A 2PVHA 3LPBA 3PXZA 3R73A 2GFCA 3FZTA 5D41A 4RWJA 3QLGA 4IZ5A 4B99A 3VJOA 3TNQB 5DH3A 3Q9XA 2ZAZA 3QTWA 4YGAA 1DI8A 4PDYA 2CJMA 2CGUA 2WXVA 3JVRA 4BI1A 4S34A 2P33A 3QQHA 3RWQA 2PE2A 5EFQA 4YZDA 1GJOA 4BDHA 1VYZA 1Y8GA 3EQFA 4FKUA 4FV6A 5CI6A 3R2BA 3R8PA 3NRMA 2W0JA 3PJ1A 4Y85A 2JKQA 5L2SA 1IEPA 4FZ6A 3PFQA 4MNEA 2X8EA 4NM7A 3LMIA 2ITYA 1AQ1A 5EKOA 2BHHA 4QPSA 4DCAA 3IOPA 2PZIA 3R22A 3DXPA 5IISA 5KMLA 4NTTA 3OFMA 5CSWA 4E26A 3QYWA 3NUNA 4OTPA 5AP4A 5IEXA 5K5XA 5K5NA 4EWHA 3OXZA 4CYIA 3R9RA 5J8IA 3DGKA 4NK9A 5EOBA 3NW5A 1S9IA 3A4OX 2W4JA 4P4CA 4IJPA 4M68A 4P90A 2O63A 2QHNA 4CQEA 3M42A 1PY5A 5JGDA 5HG9A 5HHWA 3R28A 1OKWA 4QMVA 3V3VA 1GAGA 5L4QA 4UYAA 3NUYA 4EYMA 3VS5A 4LOPA 5AX9A 3OROA 4EBWA 2Y9QA 2H34A 3P7AA 3KEXA 4XP0A 4QP1A 3PIXA 3HMIA 4ZY4A 1Q5KA 4KBAA 4NT4A 2Y8OA 3CJFA 4JR7A 2HXQA 5HE2A 2P2IA 5CENA 4D9TA 3WYYA 1JLUE 3THBA 3TZ8A 3E5AA 4U43A 4KIKB 3ZYAA 4M15A 4B7TA 2WIHA 3SHEA 3AQVA 4UZHA 4QTDA 1STCE 1DAYA 4FEQA 4C4EA 5CAPA 3ZM4A 1J3HA 4H39A 2B53A 1LP4A 2VD5A 4MNEB 4BWXA 4GK2A 3ANRA 5C8NA 1L8TA 2YM4A 3FV8A 3P0MA 3UMWA 5HE3A 3C4CA 3JXWA 3SV0A 4DH3A 3A7HA 5ANEA 5A3XA 3GOKA 3NX8A 2C30A 4QP7A 2IO6A 5EYDA 1ZY4A 4C57A 4HJOA 4IC7A 4CKIA 1V0BA 3QBNA 3DV3A 4IAKA 1DAWA 4XS2A 1BMKA 2XEYA 3DTCA 4EKKA 2ITUA 2Y4IC 3AC4A 5HBJA 1SZMA 4YBKA 3FMMA 5FBOA 4F7LA 3AC2A 2R3JA 4MD9E 5EHLA 3KN6A 3KQ7A 4GFGA 4AOJA 1NY3A 2ACXA 3A2CA 5JFWA 5EYKA 4RX8A 2XNPA 4FG9A 4D4RA 1Y91A 5AR3A 5FLFA 3A7FA 3CGOA 3FY2A 3LMGA 5IQEA 3DFCB 4FVRA 3HMOA 3WARA 4UMTA 4GT3A 3IKAA 1UU9A 2XB7A 1FINA 2XIRA 3BV2A 2HWOA 3MH1A 1Z57A 4FV5A 3O8PA 5D12A 3KREA 4JX7A 3BLHA 3P4KA 3BPRA 3FLQA 3ZHPC 4ANNA 5ACBC 5DI1A 5H8BA 3MA6A 3OWLA 5GNKA 3R8MA 5A4LA 3CIKA 3UZTA 1XO2B 2BZJA 1U54B 3F2RA 5HEZA 3GQLA 4HGSA 2UZWE 3FPMA 3PVBA 3OBGA 4OTHA 2HZ0A 2YCQA 4GV1A 5T68A 4ZY5A 4NKSA 4CLIA 1ZYLA 4RJ7A 4ZSEA 1OPJA 3R2YA 5CQWA 4MF0A 2QCSA 3D4QA 1TQMA 2CLQA 3N4TA 3L1SA 5BYLA 2C5YA 2VWIA 3ETAA 4PPCA 1KE7A 2VWWA 3D0EA 4BZDA 4A9UA 4QMOA 3CJGA 4EYJA 3QRJA 2XS0A 5BVDA 2WMSA 4ZSJA 1CSNA 3BRBA 4Z55A 4FTIA 4FGRA 5AP7A 4JAJA 1REJA 1LPUA 5CAQA 3H3CA 5CU4A 4CNHA 4FL3A 4JIKA 3R8VA 5HICA 4EOPA 2HENA 4HVIA 4XH6A 2W5AA 4IZYA 3EYHA 2VN9A 1G8AA 4BL1A 2QI8A 4BWKA 4FKGA 3FI4A 3NYNA 5EQEA 1KE5A 2C1AA 2QKRA 5A54A 2CKOA 2YCSA 3O0GA 3EQIA 3U87A 1A9UA 3FZOA 5E8ZA 4BGQA 4C2WA 3V6RA 4PL5A 4JBVA 3QA8A 4QOXA 3BYVA 2YDJA 1FGKA 3WZDA 4AE9A 1QL6A 3VBYA 2PTKA 3NIEA 2WZJA 3FLNC 4WNOA 3PG1A 3OWKA 2CCHA 2HK5A 2YIQA 3SA0A 4CQGA 3CD8A 3EN5A 1ZYCA 4KBCA 2OLCA 4JT3A 4RIYA 2WNTA 2WU6A 3RAIA 3L9LA 4JAIA 4EH5A 1UKHA 3A99A 3O96A 4IAZA 4L00A 3HA8A 3QRIA 3QWJA 4QT1A 3ZDUA 3NVKI 4ZTLA 5E8UA 5M51A 5GJFA 4EL9A 3SXSA 4WOVA 4YSMA 3QL8A 5CXHA 4G17A 3UQFA 3HV5A 3GOPA 4O0RA 4EOIA 3E8NA 4D1XA 4TYHB 5BYYA 5CLPA 4Q2AA 1H25A 3QLFA 4MHAA 4MXYA 5DHJA 3BHTA 3EFJA 3RPYA 5CF4A 3E88A 2R3PA 2RF9A 4AOTA 2HELA 2JDRA 2C1BA 1UKIA 2OW3A 3NEWA 2R3KA 3RAHA 2QOBA 2RSVA 2G15A 3UIUA 3ID6C 1YRPA 2XNOA 3C4XA 2XRUA 3W8QA 3EQGA 4L42A 3UPXA 2VX3A 3OF0A 4ZTHA 1M2RA 4LUDA 4C0TA 4Y83A 4YJPA 4DFXE 2GNGA 2ITWA 2BRNA 2J0MB 3IPHA 4DINA 4HVHA 5E9EA 3P7BA 3R7OA 5M57A 4FZFB 2BMCA 3AG9A 1OL1A 4K8AA 1XH7A 4FKPA 4JDKA 3WF7A 4HVGA 5E90A 1YXSA 4BBFA 4IVCA 1P4FA 3OW4A 2QU6A 1W0XC 4RC4A 5DLSA 4XOZA 2XUUA 3EQHA 4D2SA 3VUIA 4BCQA 4W4YA 3I60A 2ZB1A 2UVYA 4O6EA 2JLDA 1MUOA 2IZSA 5KE0A 1PYXA 5I3RA 4R1VA 2Z7QA 5EI8A 4ZZMA 2IVTA 2QURA 2X81A 1UU8A 3GEQA 5M55A 4I4FA 1KE8A 3ORIA 1XHAA 3QRTA 5E92A 4O1PA 3UC4A 3WZEA 3BU5A 1YXUA 4OAVB 4HNIA 3DKFA 4I5HA 3RPRA 1KOAA 2PU8A 2JAMA 2KULA 4O0XA 4PTEA 3PXRA 4YZCA 4LGGA 4C8BA 4MEDA 4X0MA 4BCKA 4O7SA 4DF3A 5M08A 5I9UA 3COHA 4WIHA 3D83A 4IC8A 4RIWA 4BYJA 3AMYA 2OZAB 3FXXA 3SXRA 4TPTA 3PWDA 4C58A 4V0GB 4QYEA 4J52A 3HKOA 1P5EA 1WFCA 5HNBA 2OBJA 4L3LA 3W32A 1H8FA 3HV3A 3II5A 1WBVA 3D15A 3V5TA 3GP0A 4QP3A 2VO3A 4J8NA 4RZWA 3FXZA 4AXAA 4C61A 5CAOA 2ITZA 2WOUA 1MQBA 3F61A 4FT9A 4P5QA 3UYSA 3DBCA 3KVWA 4BI2A 2VTTA 5CU2A 4EUTA 5FUTA 1QMZA 3IW7A 3GCPA 2J2IB 3I7CA 3ORLA 4QTAA 5AR8A 4E4MA 4PL4A 5HVJA 2X8IA 1Q41A 2OH0E 3EN4A 4G16A 5CZHA 4IJ9A 4KIPA 3S3IA 1YI3A 2GQSA 4W8DA 4AX8A 4GVAA 3ZSHA 3D94A 4IHPA 4ANBA 4EKLA 4F0GA 3TUCA 5D1JA 3COIA 3FEGA 2B9HA 2A2AA 3EQDA 1XH9A 3TT0A 2XEZA 4FKIA 4C35A 1FPUA 3U8WA 3DKOA 4J97A 2E9PA 3K5VA 5J9LA 2J0KA 1WBPA 2J90A 3LFSA 3UODA 3ZXZA 4AN2A 3KMWA 1OIYA 4C4GA 1SM2A 5IMXA 1BI7A 2B54A 4FG7A 2WB8A 3GVUA 5IUIA 3HNGA 5CXZA 1RE8A 1IA8A 3VW8A 4YC6A 4C59A 3FY0A 4ONAA 2F2CB 1OL5A 2R3IA 3FLWA 1OITA 2VWZA 4Z7HA 1JBPE 2OJGA 5GINE 5AR5A 5F95A 4XV2A 1IASA 4Y5HA 4BHZA 2WGJA 3V5QA 4Z9LA 3E8CA 4RGJA 5CZIA 1PXNA 5ANJA 3FUPA 5FP5A 3UOLA 4I22A 4XCUA 4BCNA 2FH9A 2UW5A 5LJJA 4IADA 4DGNA 4DC2A 4N6ZA 3GB2A 3EWHA 4TRLA 4LUEA 4U45A 5EI6A 5AV3A 5FRIA 3DJ6A 5FWKK 4CT1A 4BTFA 4LV8A 2XH5A 4LOOA 1OUKA 4R6VA 4FIHA 2R5TA 5HCXA 1X8BA 2JFLA 5I9YA 2JIIA 3MY5A 4P7EA 2BAJA 1LEZA 4MNFA 3QHWA 2Z2WA 1KE6A 2RG5A 4RJ8A 4U40A 5E7RA 4MQ2A 3W10A 4EHEA 1O9UA 1XKKA 4U7ZA 4LRJA 5KMJA 3H9FA 4C4HA 4F09A 3V51A 3WYXA 5LVLA 4CFMA 3W16A 4RFYA 4YP8A 3C4WA 2C47A 3FL4A 5J1WA 4XNEA 4D2RA 3MB7A 2DQ7X 4EK6A 5LCKA 3GBZA 1CMKE 4XP3A 4TWOA 4A07A 4DFZE 2PMNX 1XWSA 2BAKA 2PE0A 2OJJA 3C0IA 4C38A 3CQEA 2Y0AA 3ZZWA 5LVPA 4JDJA 3LM0A 4FEVA 3EN6A 2XYUA 3H0YA 1FOTA 4USFA 4UWYA 3TDVA 1VYWA 4NW6A 2C5NA 3H10A 3OT3A 2QHMA 3F2NA 3HYHA 4J71A 1UNHA 3NLBA 5EDPA 3ZO1A 4WUNA 4BR3A 4XV3A 4L52A 3LJ2A 4UALA 4Y72A 4AW0A 5L8LA 2EXEA 5CEOA 5IF1A 1YWNA 5CAUA 2YDIA 3I0OA 4L43A 5IDNA 4J99A 3R0TA 1V0OA 3TM0A 4GIHA 4I0SA 3DBEA 1JPAA 3BHYA 4V01A 2CMWA 1F5QA 3VS2A 3EHAA 4MK0A 3FZRA 5CWZA 4K9YA 4XRJA 3ORZA 1GOLA 3F5GA 3WILA 4A4XA 4B8MA 4A06A 2VTJA 4ENYA 1YOMA 3N51A 3U6IA 2IWIA 3VIDA 3FMKA 3GC0A 2QG7A 3RZFA 2PSQA 2QR7A 4GCJA 5FM3A 2VTNA 2WIPA 4D4VA 3VF9A 1XH6A 1XJDA 4XG9A 2BRMA 3U4UA 5IDPA 3I79A 5AEPA 3DU8A 3PA5A 4QTCA 2WTDA 2UW4A 1PYEA 2XCHA 3CTQA 3LFCA 3R1NA 2GDOA 4A9TA 3NUXA 3N4UA 3LOKA 4RX5A 5FDPA 4ZSGA 1WZYA 3I0QA 4WNMA 2WD1A 2ZM4A 1NXKA 4YPSA 5HX6A 5B7VA 4IB0A 3CGFA 3PY0A 5CEIA 3CCNA 2F9GA 4Y5QA 4O7LA 3FBVA 4DH8A 5AIKA 2YISA 5EDQA 1YI4A 5C4KA 2W4OA 3AC8A 4D2WA 1PRYA 3MVJA 2R3OA 5EQYA 2G2HA 1YOJA 3QKKA 4U3YA 1P14A 5AUVA 3R02A 4Q9ZA 4BN1A 4F0FA 4G34A 3S4QA 2PVFA 4EHGA 2X4ZA 5J5SA 3DT1A 4LYNA 1J91A 4EEVA 1HCLA 4ASEA 3BYMA 1FMOE 2GNIA 1ZMWA 2RFDA 2UZEA 3QTRA 3RALA 4AFEA 1OPLA 3HV4A 5CAVA 5AUZA 3BIZA 3NGAA 4QMMA 3TNPC 2ZM1A 4H3BA 4Y95A 3ZLSA 5EI2A 3GU7A 5EW3A 2YLFA 2Z8CA 3HVCA 3WOWA 3M11A 3MW1A 4F9CA 3DQWA 4K2RA 3S0OA 3UQCA 2BRGA 2X7FA 3LFFA 4E7WA 1H01A 3FSKA 3GENA 4FV3A 5JQ5A 3PIYA 4ZLZA 3LQ8A 2XK7A 2ZMCA 3IDCA 2UZVA 3C4ZA 3PXKA 2XRWA 2Z7SA 3HECA 4CFXA 3TL8A 4L53A 4YSJA 2JITA 3QQFA 3GUBA 4UXQA 3RK7A 3MFSA 3TKHA 3MESA 2C5OA 4DT9A 4NYEA 3Q4TA 5HNGA 5ANIA 3C7QA 3DAEA 4GIIA 3OY3A 4RBLA 3P7CA 4O7NA 2W1EA 4EOJA 4CD0A 2JIVA 3WI6A 4O0SA 4D4YA 2YA9A 2PY3A 1LUFA 2AUHA 4EH7A 5AFVA 4PQNA 4ZTRA 4EOKA 5CF8A 2ONLC 3NUAA 3Q4CA 3FYJX 5FEDA 3C9WA 2R9SA 5LCJA 3IW6A 3FI8A 4G3FA 3Q2JA 4FBXA 1DS5A 2WMBA 3FI3A 2XK3A 3TZ7A 3PY1A 4KRCA 5E1SA 2Q0BA 4B6LA 4QMQA 2R3LA 3QXPA 1WVYA 4ITJA 4RRVA 3TUBA 4FUYA 5HBEA 3QGYA 2X8DA 3I5NA 3K3JA 3R9HA 1PXIA 3KN5A 1KOBA 4HNFA 5DEWA 5F94A 3JUHA 2JEDA 2G01A 4BCOA 2C3KA 2A1AB 2I1MA 3QZFA 3VNTA 4LG4A 3KRJA 5IQGA 3VBQA 5IUHA 5EYMA 3FC2A 2X0GA 3RNYA 3EZVA 2RKUA 3LLTA 1E1VA 3VUGA 4CFFA 3PY3A 5CVHA 1ZY5A 5J9ZA 2JBOA 3C4EA 1R3CA 4A9RA 3PWYA 3QUPA 4J7BA 3ZO4A 4X2KA 5F20A 4BIBA 2SRCA 5FEEA 1QPJA 3F5UA 2XJ1A 5ITAA 2WTWA 2R7BA 3CPCA 2NP8A 4XYFA 3QGWA 4HGEA 4BCGA 5KZ0A 4U80A 3RM7A 2IVSA 1WCCA 2EXMA 4O21A 1ZARA 5A4TA 3Q6UA 5CU6A 1I09A 4MCVA 5L8JA 2YIYA 2QD9A 1Q8UA 4G6NA 4AE6A 4QMZA 4RMZA 4I6QA 4QNYA 4IB1A 5IA1A 4CMOA 4A9SA 5KHXA 3DFAA 1M7NA 3PJ3A 4U81A 5IQDA 4CZTA 5JRQA 4MBLA 1WVWA 5M4CA 4EBVA 3TIZA 4G5JA 4KSPA 4YNEA 4L44A 4BBMA 4P5ZA 3EH9A 4ZSLA 3OHTA 5KCVA 3MS9A 5E8VA 4DYMA 1SVHA 3K54A 3QZIA 3BE9A 3QU0A 4GU9A 1PMEA 4BTJA 1Q4LA 4ACCA 4XG8A 5AADA 3W2QA 4WBOA 3DDQA 1PXLA 5CX9A 4BZOA 3LIJA 4YZ9A 3LXNA 5AP5A 4PNKA 4R7BA 4NZWB 4FG8A 3U6HA 1WVXA 3PE1A 1KE9A 3GC8A 3ZRLA 5KMKA 3NNUA 3P86A 4NW5A 1BLXA 2YIWA 4GK3A 4OTRA 1WBTA 2PK9A 3QTZA 4R3CA 4AF3A 4CSVA 4CXAA 3ELJA 3SX9A 3U6JA 4JS8A 2UZOA 4C33A 3G5DA 4O22A 2YERA 5HG8A 4I20A 1K2PA 2ITPA 5IKWA 3KY2A 3DS6A 5ANGA 2X6EA 4X2FA 3W2RA 3PIZA 4RLKA 5CNOA 3DBQA 3PRIA 4YHJA 4DBNA 2GS7A 2R3GA 5LVOA 4FR4A 3GFWA 3MPTA 3V8TA 4FTTA 1YQJA 2W1IA 2XZSA 3D5VA 3FQHA 4ZS4A 5BYZA 5JMSA 5C01A 4EORA 2CCIA 5IH6A 3OG7A 4AW2A 3H30A 5HD4A 2C5VA 4ERWA 1KWPA 4IX3A 3JYAA 2B7AA 3PE2A 5FXQA 5DOSA 5AX3A 2AC3A 5H9BA 2W1GA 3GC9A 4YC8A 2FGIA 3HEGA 5HE1A 2X39A 4P2KA 5HTCA 4ITIA 5C1QB 3D7TB 2VTOA 4MXCA 5E8TA 2Y4IB 2PVMA 2W1DA 4I6HA 2OXDA 2EU9A 3R8UA 4M67A 2QOFA 3ZXTA 3CBLA 3MJ2A 3KXZA 2W05A 4ACDA 3L8PA 5DR9A 2ETRA 4FTUA 4ZTNA 3WZKA 2CHLA 2CKPA 2Z60A 2QG5A 5EOLA 5M56A 3KCFA 3O50A 4C34A 3JY9A 3BGQA 2J4ZA 4XBRA 5HI2A 5EHYA 4WHZA 2HAKA 4FV8A 4HZRA 3RGFA 4M66A 5HLWA 3OEFX 4OBPA 2Q83A 3DJ5A 2BPMA 3R1QA 4OW8A 2C6IA 2J5EA 3L8VA 2WKMA 4TTHB 4XV9A 5JFSA 4JJRA 4TZRA 2XK8A 4PTCA 4FKOA 3KRXA 3DPKA 4PX6A 3ZEWA 4JR3A 4EZ5A 3R01A 3AXWA 4JNWA 4GMYA 4UZDA 4LMUA 4OGRA 4OBQA 2ERZE 3Q9WA 4O7ZA 2WOTA 4X3FA 3T3UA 3TTJA 4BKZA 2W7XA 2I0EA 3FE3A 3BEGA 2CNVA 2XM9A 4RWIA 3HRBA 2WELA 3PJ8A 4FKRA 4PY1A 2ITOA 4QTBA 4YJVA 1JWHA 4GU6A 4YMJA 4FNWA 3I1AA 2J50A 3PTGA 1H1RA 2VRXA 3OW3A 2WMUA 2PVNA 5KNJA 1YKRA 2BVAA 4WG5A 5CSXA 1WMKA 1CM8A 2YM8A 2HYYA 3DXNA 3VS6A 5K9IA 4EH2A 4D2PA 1NVQA 2WMWA 5A4CA 3FKNA 2UZLA 4ZP5A 3Q5ZA 3FLSA 2B55A 1OI9A 3G51A 1H08A 4FICA 3PZHA 3AMBA 4GVJA 5IUGA 4BCIA 3GT8A 2VTLA 4JX3A 3MPAA 3Q96A 5BVEA 4KAOA 4CCUA 3NAYA 2QLUA 4MX9A 5FTOA 1YVJA 4MXOA 4FV4A 2R3RA 5HORA 2OH4A 4E3CA 4YZBA 2HCKA 1B38A 4H1JA 4BHNA 1WBSA 3AT2A 5B2MA 2R3NA 4C36A 3NIZA 2FSOX 1B6CB 3U9NA 4FK3A 3CTJA 3UTOA 4D2VA 4BIEA 4EQMA 2VO0A 3IDPA 3UGCA 4CKRA 4RWKA 2UW9A 1OZ1A 1BUHA 3Q4UA 4HGLA 3TV4A 5HLNA 3T8OA 4DLJA 4BKYA 4I4EA 3TTIA 3BEAA 2W96B 3FMDA 3RPOA 3ZFXA 2VWBA 4DEDA 3BYUA 3MI9A 2B9FA 3L9PA 4YPDA 1GZNA 3QYZA 2XNBA 5AR7A 3R7VA 4D9UA 2X2LA 3E92A 4EOMA 4LGHA 2R2PA 4F6UA 4ITHA 1OIUA 3VWAA 3QUEA 5HOAA 3GGFA 4WT6A 3AC1A 4IVDA 3RJCA 3ZZEA 2NO3A 1OKVA 4E93A 2V62A 4OTDA 5CU0A 2Y6OA 3W8LA 3G0EA 4GG5A 4YHFA 4APPA 2JKOA 2ZMDA 4PTGA 4QYHA 3ZH8A 4DG0E 4QQ5A 2BZKB 4BFMA 3QTQA 2JDSA 3EKKA 3KULB 4ALUA 4AW1A 3OZ6A 3SW7A 3MSSA 4E6QA 3C0GA 3RBWA 4U41A 3MJ1A 4L6QA 2P3GX 3C13A 5TT7A 3TV6A 1J7UA 2VX0A 4MBJA 4AG8A 5DIAA 1Q8TA 4O0WA 4WKQA 4DFLA 3CS9A 4XX9A 5AUTA 3IS5A 3R9OA 3JVSA 2XIZA 4AZEA 2VGOA 3ORKA 1GY3A 4RJ3A 3DNDA 1JVPP 1SMHA 4DGGA 2OG8A 4YJUA 1U5RA 2QU5A 3F69A 4IFCA 3F2AA 1JQHA 2IW8A 4EOQA 2ZV7A 1JSUA 3UO4A 3ODZX 3UE4A 4A4OA 4FT5A 1FVRA 2IVUA 2XJ0A 3IGGA 5IG1A 4CTCA 3FL5A 2BDFA 4HCVA 5DN3A 1J7IA 1FBNA 3NNVA 1HOWA 2WO6A 2ITNA 3MVHA 2QNJA 2I0VA 4MKCA 2WMVA 2OWBA 3F5XA 2YM7A 4DEAA 4LGDA 2QO9A 4N0SA 5BUIA 1OBDA 2Y4PA 3QD4A 1GZKA 5D7VA 4FA2A 4IAFA 4E4LA 4O2PA 4BDCA 2Z7LA 1PXKA 2QKWB 5GJDA 2C0TA 3QC9A 4DT8A 2I0YA 3CY3A 3QZHA 5IA2A 4DGOA 1R78A 3W18A 5IH4A 2QO2A 2HXLA 5IA3A 2XIXA 4TYEA 4D4SA 2FA2A 1XBBA 3MFRA 5B2LA 4FKVA 3L9MA 5CT7A 2GQRA 4PMTA 4UMUA 2OF2A 4IWPA 4X2GA 3ZRMA 4AAAA 2W17A 2UW8A 3ZONA 2Q0NA 3ZBFA 2PL0A 5GZ9A 4RX9A 4ZJIA 3KL8A 5AJQA 3LXKA 3UC3A 4ZS0A 4JG7A 4EQCA 3ODYX 3UIXA 3R9NA 2XKEA 4O0VA 3NSZA 3DY7A 4AGWA 5JKGA 3PVGA 2PZ5A 4G9RA 2PUUA 4J96A 3VC4A 4AGUA 2C6MA 3FJQE 1PW2A 4FUXA 3WF5A 2XNGA 3QQLA 5HTIA 3Q32A 4L8MA 2CLXA 2I40A 4CKJA 4HZSA 4QD6A 4NFNA 2C0IA 2ZYBA 4FMQA 5DT3A 3R7EA 4D0WA 4OBOA 3KA0A 5FTQA 2YABA 3PSCA 4OR5A 3OWPA 4DEGA 1TQIA 4MAOA 4E6DA 2ZDTA 1PF8A 4IIRA 4U42A 4YZNA 4JBOA 2YZLA 4QQTA 2UVXA 3PP0A 2JDVA 5L3AA 3CSVA 3ET7A 2Z02A 2GFSA 4I23A 1QPCA 3COMA 1QPDA 2JD5A 1JOWB 4RPVA 5AMNA 1XBAA 2O64A 2OIDA 3TJCA 3OWJA 5T6KA 4EJ7A 3BBTB 4OAUC 2YM5A 4N4SA 4DFBA 5I5ZA 3VUDA 3KB7A 4V04A 4CVAA 3DK7A 3QZGA 1VJYA 3VUKA 3PXFA 2XK6A 4X21A 4KB8A 4IZAA 4B0GA 4ZZNA 1H1PA 4DEIA 5DT4A 5HIDA 3MIAA 4YJSA 2ITXA 1H28A 3V5LA 3O8TA 1PMVA 5C8MA 1GNGA 3CP9A 5LVMA 1VR2A 4APCA 5M06A 3FWQA 1P4OA 2JBPA 4I24A 4AZVA 4FTJA 3U54A 1UU3A 3HDNA 3EQBA 4CT2A 3KXHA 3W55A 3HMNA 4IZ7A 2UZTA 1P2AA 4FNYA 4RC3A 2W4KA 2C69A 2JIUA 4PPAA 4C37A 4RIYB 3H4JA 4ASZA 1OL2A 2ONLA 3GNIB 3ORMA 4RVMA 5HIEA 4N57A 3MFUA 1PJKA 3C1XA 3G90X 3FQEA 3KCKA 3QD2B 4RIXA 4C7TA 4CFUA 5BVNA 1U4DA 4Q5EA 4F1TA 5FXSA 3E63A 1H4LA 4WNPA 2WQMA 3PDTA 1F0QA 1PKDA 5A4EA 3ZOSA 4KWPA 2PWLA 4X3FC 3RNIA 4II5A 4FV0A 3IDBA 4BCJA 3KXNA 1XH5A 1OVEA 3T9TA 5CASA 4R7HA 4GYGA 3GI3A 3MVLA 3M2WA 3F88A 1KV1A 3F7WA 4DTKA 1M2PA 4F0IA 2Y7JA 1MRYA 5DNRA 3V6SA 3G9NA 5ANOA 3E8DA 4G5PA 4OTGA 3KK8A 3D5UA 3IONA 3JY0A 5JGBA 2YAAA 4IM3A 3PPKA 4IM2A 4XJ0A 4IX6A 4LMNA 1FMKA 1GZ8A 4IFGA 4FV1A 3PVWA 4FIJA 3VQUA 4L9IA 2OICA 2ESMA 4H58A 4QMYA 5HG5A 4H3QA 1OKZA 2XNEA 4NTSA 4C3PA 3PXQA 2WTIA 4YURA 5HZNA 4FTMA 5CF6A 2WMRA 1J7LA 4DA5A 3QQJA 5KBQA 4DG3E 1Q3DA 3UO6A 4EK5A 1U54A 2WMAA 4KKGA 4F63A 3LFQA 5HO6A 5LMAA 2UZBA 2W1ZA 3LAUA 3QX2A 4U3ZA 2C6EA 3ULZA 1YDRE 2EXCX 3KFAA 4TXCA 3HV7A 3V01A 2XMYA 3C50A 1M7QA 3E3PA 4FSZA 3VRZA 4A9YA 4DH5A 4USEA 1G3NA 2GMXA 3H0ZA 3KMUA 3WE8A 3SAYA 4DFUA 3GQIA 5H3QA 4X7QA 4QP9A 4MXZA 3FPQA 2UVZA 5AV2A 5I9WA 4ZJJA 2WAJA 5LXMA 4QRCA 4FIIA 4BWPA 4ENXA 4L7SA 5J87A 3JPVA 4E5BA 3KXXA 1KV2A 2I0HA 3L9NA 3O2MA 4ANQA 1IA9A 4OTIA 3R1SA 3HUCA 3BU3A 5IQHA 3NDMA 3AC5A 3UNJA 3RAWA 1ZZ2A 4ALVA 1CTPE 2PMLX 4FK6A 4EUUA 2ZM3A 5C4LA 3VF8A 4BGHA 3GXLA 3O7LD 4PP7A 2WTJA 1AGWA 3AMAA 3F3UA 3MIYA 3FKLA 4HPUE 3I6WA 3TNHA 2XBAA 3FDNA 3HMMA 3QQKA 3P78A 2FYSA 5HU3A 4CCBA 3A4PA 1H0WA 2YCRA 3B8QA 3OS3A 2BCJA 3B8RA 3BKBA 2GS2A 2R4BA 2FSTX 4X6QC 4CV9A 2B9JA 3NCGA 5HIBA 2A4LA 2VTRA 4RSSA 4B8LA 4CV8A 4XG3A 4D5HA 4F9YA 3P5KA 3PPZA 2V55A 3EOCA 3LCKA 4GJ2A 4O0UA 4XV1A 5A4QA 1YHVA 5HESA 3BWFA 3EB0A 4WRGA 3NYXA 3FZSA 4WSQA 4YLJA 4E1ZA 3QRKA 3EFKA 4BDFA 4RZVA 5AP3A 1XQZA 3EN9A 3OXTA 2QOKA 3MA3A 4IDTA 3VUMA 5LOHA 4PL3A 4UN0C 3MV5A 2E9VA 4S31A 5AV0A 5BPYA 3SG8A 3IECA 4QQJA 3R6XA 3TJDA 3E62A 3LQ3A 4G2FA 5E8WA
chains in the Genus database with same CATH superfamily
3R21A 5L8KA 3PLAE 3RM6A 3EN7A 3LFNA 4M97A 3QTUA 3UVQA 4XUFA 5EQPA 2XF0A 5ANKA 3BHHA 3F5PA 3DA6A 4NIFB 4BJJA 5F1ZA 1W8CA 2UZNA 5L2IA 3DCVA 5KKRC 3I7BA 3A7GA 4EC9A 3K5UA 4CFNA 5KUPA 3VBXA 4I6BA 1R1WA 1L3RE 4L01A 5EYCA 4CFWA 1OPKA 1RDQE 4U9AA 2PVRA 3OOGA 3P1AA 4KKHA 2O5KA 4N6YA 3PA3A 5IQAA 2YLEA 2C3IB 4TNDA 2NNWB 4V0GA 2XIKA 5DR2A 2OZAA 2R7IA 3TUDA 3V8WA 5M4FA 1V1KA 1MRUA 1OL6A 4FSTA 3QCSA 4RIWB 3FZPA 4NSTA 4RQKA 2GSFA 3C0HA 4R5SA 3DZOA 4YTFA 4O96A 5D11A 3GU5A 3BGZA 3BI6A 2QVSE 4Q5HA 5AM6A 2G1TA 3A60A 4L67A 4CTBA 4AN3A 2R3FA 2BIKB 4I3ZA 4RIOA 1UVRA 3W0SA 3ZM9A 3PA4A 3E64A 2W5HA 3QD0A 3FMNA 2X7OA 5ACKA 2CSNA 4RA4A 5IEVA 4QMLA 3D7TA 3QUDA 3MH2A 3R30A 1V0PA 2O8YA 4OLIA 4BCFA 4GT5A 1URCA 3ENHA 2YFXA 4RA5A 2OFVA 4O1OA 5KO1A 2HZIA 2BALA 3D7ZA 4IDVA 2ZVAA 3VW6A 5JH6A 2WHBA 1YWRA 2AYPA 5DMZA 4NL0A 1H24A 4FZ7A 2WQBA 4CMUA 3T9IA 1XH8A 1T46A 1OL7A 2PVYA 3D5WA 3BHUA 4U79A 5C03A 3NW6A 3WIGA 2V7AA 4EC8A 2BIYA 1JKKA 4EK8A 4UMPA 5KHWA 3UJGA 5CT0A 3LFEA 4FYOA 3FYKX 3VHKA 3FC1X 1W2DA 2WU7A 5CEKA 4O7VA 1F3MC 4HOKA 2C3JA 3DTWA 3T3VA 5CVFA 5IQBA 3AGLA 4PWNA 5FTGA 4TYHA 3K3IA 4DFYA 2YZAA 4ZLYA 5FP6A 4N70A 5LVNA 2OJIA 1J1CA 1VEBA 2ZDUA 2C6DA 4KIOA 4FEXA 3L8SA 3QTSA 4FX3A 3UBDA 4C3FA 4AAYA 3OVVA 4WUAA 2OFUA 5BUEA 1BL6A 4KSQA 1FVTA 2IVVA 4KINA 1UWJA 5JT2A 3UOJA 4ANOA 1UWHA 2OIQA 4FKQA 4R8QA 5ANDA 2J51A 3DZQA 3F3WA 2BAQA 3QALE 4GUBA 4UX9A 4FZDB 1M2QA 4BC6A 5M07A 2Y6MA 2W06A 5TE0A 4F9BA 1Y6BA 4JL9A 2GHLA 2WTKC 4GK4A 5A9UA 5FXRA 1OM1A 3ENMA 3TKUA 4H1MA 5JEBA 3G9LX 3DBDA 3E3BX 3UDTA 4O38A 2OJFE 3OEZA 3Q04A 5D10A 3RP9A 1ZMVA 4YLKA 2GHGA 1YOLA 5HKMA 3NS9A 4AU8A 2WMXA 5BVKA 1BL7A 5DBXA 4OT6A 5T3QA 4HVSA 4GSBA 3KK9A 3UOKA 5CSHA 5FDXA 5AAFA 1Y8YA 3TDWA 4I21A 4QP8A 4MF1A 3Q6WA 3KXGA 5GZAA 4YTIA 4UBAA 1K9AA 2OIBA 2QOHA 1YDTE 3OCSA 3PYYA 2VV9A 3RTPA 4HVDA 3UZRA 4Z7GA 5FEQA 2HOGA 4AZFA 4W4XA 3HDMA 1DI9A 4XG4A 3VUHA 4ZZOA 5AUUA 5FG8A 1TFFA 3R8LA 3RHKA 3KU2A 3TV7A 3R7UA 3R83A 3UO5A 2E2BA 2IW6A 3DQXA 3G2FA 2CKQA 1H1SA 4O2ZA 3DLSA 4RG0A 1UNGA 3O5AA 1OGUA 5JZNA 2IZUA 4FV7A 1UA2A 1YDSE 1M17A 2QOOA 3HX4A 3KVXA 3ROCA 3W2SA 4QYYA 3VN9A 4BDGA 5HQ0A 3PG3A 4FL2A 4MWIA 3OUNB 2A19B 3HRFA 5HE0A 3MN3A 4CRSA 5ICPA 4KUJA 2C0OA 2FSMX 3BWJA 3COKA 2IJMA 2V22A 3L8XA 5K0KA 4BDDA 4EWQA 1IAJA 4YZMA 2CNUA 5AP2A 4QQCA 4ZK5A 2YJRA 2OSCA 4FKLA 4QMUA 1OUYA 4ANMA 2JAVA 3SD0A 1W84A 1PXMA 2WPAA 4DTAA 4FNXA 1ZLTA 3LVPA 4RX7A 3UDSA 2BRHA 1ZOGA 3CKXA 2XAMA 2OZOA 1Z9XA 2EB2A 3PPJA 2YCFA 5L2TA 3CTHA 4IX5A 3V04A 4NKAA 2XK4A 3NNXA 5ETCA 2G2IA 4DH7A 2G9XA 1IG1A 3LFDA 4RVTA 4DEEA 4FTQA 3PLSA 4AA4A 3CE3A 2RGPA 4MD8E 4C4JA 2XYNA 2RIOA 3A61A 2WMQA 3W2OA 1RW8A 2OO8X 1SNUA 3DKGA 4IX4A 4L3PA 5E8SA 2X2KA 3NPCA 3PP1A 5E8XA 5BX0A 4NWMA 3R71A 3Q53A 4NEUA 1OIQA 1ZAOA 5BVOA 4XLIA 1Q8YA 2X2MA 3KGAA 4FTOA 2PVLA 3LCOA 2HW6A 3AD5A 3FKOA 2VWUA 2YAKA 1ZXEA 4HYHA 4QO9A 4RLLA 4K0YA 3RAKA 1ZRZA 4GFMA 4RC2A 4ZLOA 3ITZA 2VO6A 3BCEA 1PXJA 4ZY6A 5M44A 2I7QA 4S30A 4JQEA 4ZMEA 1ATPE 3DK3A 4EH8A 4F9AA 1W83A 4I93A 2F57A 5J1VA 1H1QA 3VQHA 4EHZA 4BDAA 3ORNA 1R0EA 4BDKA 5AR4A 4MXXA 3RKBA 2DUVA 2QC6A 3BE2A 3Q5IA 4TN6A 4KABA 2BDWA 3QF9A 5HBHA 2OGVA 3NAXA 3FLYA 3VRYA 4BCPA 2B1PA 2BHEA 5J9YA 3H9OA 5CI7A 4GEOA 3UMXA 2C6LA 4G6LA 2H6DA 4QNAA 3UP7A 3VS7A 4AZTA 5ETAA 4C4IA 5IQIA 3QQUA 5EM5A 4CGAA 3SRVA 4NIFA 3ORXA 5KX8A 2ITQA 4UMQA 3OY1A 5A46A 3FHRA 3AOXA 4LL0A 4YO6A 1J1BA 4EONA 4S2ZA 1H00A 4CLJA 1WBWA 1MRVA 4YLLA 2PULA 5ETFA 4I6LA 3OCGA 4V05A 2V5QA 4K6ZA 3HLLA 2IN6A 4EH6A 3PUPA 1IRKA 1XBCA 3ZUUA 2ZB0A 3WZJA 4AOIA 4O0YA 5L2WA 3BELA 4AT4A 3B2WA 1ZOHA 4DE4A 4I6FA 3KC3A 2F2UA 3KF7A 3MY0A 2VWYA 4RJ6A 4S33A 4TWCA 2P55A 2W99B 1Q8ZA 1PMNA 4XBUA 5L6WL 4PMPA 1ERKA 3V8SA 2J9MA 5DYJA 4JVGA 2C6TA 4MVFA 5E1EA 1H1WA 3RINA 4DFNA 3AD6A 2JGZA 3DB6A 3KRRA 4M0YA 3Q2MA 5E91A 2P4IA 3BYOA 1Q99A 4U97A 2E9NA 3P79A 2YJSA 4E6AA 4WBBB 4WG4A 3EFLA 2RFSA 4RFZA 3ATTA 2BKZA 3W1FA 2BKKA 2O2UA 2WFYA 3MY1A 1KUTA 3OMVA 4YBJA 2YIRA 5I9VA 3QAME 2VTPA 2JDTA 3LQ5A 4FIGA 4PMMA 4O83A 5JK3A 1SNXA 2O3PA 3FXWA 3G6GA 4F99A 2J0JA 5J7BA 5DWRA 3R04A 5CSPA 4FTRA 2FB8A 3ZDIA 3ZEPA 5F9EA 2I6LA 3F3TA 4FKTA 3REPA 3LJ1A 4NM0A 3F6XA 1FVVA 4U6RA 3G15A 3TXOA 2HZNA 3AT4A 4F4PA 3ZFYA 4YU2A 2W9ZB 3AC3A 3AD4A 3DKCA 2W1FA 3NYVA 4Y73A 5A6OA 4QP4A 2XKCA 5LARA 1G5SA 2BDJA 4FEUA 4O7RA 3QD3A 4I94A 1Q24A 2ITTA 4ACHA 3BU6A 4R7IA 4WG3A 3FQSA 1XR1A 3DK6A 3I6UA 4JI9A 3CKWA 2WQNA 3SC1A 4YUQA 5EKNA 1YXTA 3LFAA 2YIXA 4QMNA 5IZFA 5CYIA 1YHWA 2OJ9A 3TZMA 4USDA 4OT5A 4EJNA 2JFMA 3R7YA 4FKSA 3EQRA 4K1BA 4DH1A 1O6LA 1R0PA 2A0CX 2GNHA 4AA0A 4AZSA 1JKTA 4PUZA 4E4NA 2REIA 4GL9A 4WD5A 4ORKA 4LL5A 5CEPA 2Z7RA 4QMTA 5AV1A 3SOCA 4NJ3A 2GU8A 3LHJA 4TWNA 3KXMA 4FKJA 4FTNA 3MWUA 4U0IA 3VS3A 2GTMA 1Q62A 2C6KA 2E9UA 3EJ1A 4LQMA 4ZOGA 5AR2A 3RK5A 3EKNA 5CALA 4EQUA 3VAPA 3V5PA 3RK9A 4J98A 3HP2A 2WEVA 4FYNA 4LRKA 5EW8A 3WF6A 2XCKA 3NW7A 4YR8A 3A7IA 4AWIA 1TZDA 4C3RA 1W82A 5HD7A 3SRVB 3P23A 4WA9A 4BZNA 3ANQA 5J5TA 2R64A 1Z5MA 4XP2A 4FTLA 3ZFMA 2O65A 2CGWA 1ZZLA 2UV2A 1OECA 5J7HA 5L6PA 3Q4ZA 3ORPA 1YI6A 3E93A 4PDSA 5CS6A 4DEBA 4AS0A 4DGLC 4W4VA 4IEBA 4W8EA 1H26A 3GCSA 4FSNA 4RIXB 3E8EA 3FMJA 4AGDA 4U8ZA 1TVOA 2G2FA 5LWNA 2BUJA 1BKXA 4DTBA 3RZBA 2HWPA 4FTCA 2YWPA 4EHVA 2OI4X 5I4NA 2A27A 5EK7A 1O6KA 2VGPA 4D0XA 5I0BA 5H8GA 4FZAB 1DM2A 2EWAA 3HP5A 4JOAA 3R8ZA 4E20A 2IZRA 2YN8A 3DAJA 4M13A 1TKIA 3QRUA 2UUEA 5K3YA 2HW7A 4JG8A 2YHVA 2VTHA 4KA3A 3UG1A 2VWVA 3NFGB 1CKJA 1KSWA 3QQGA 3EIDA 4UY9A 1K3AA 2BRBA 5EHOA 1O6YA 3BLRA 3ZSIA 2WMTA 4E5WA 1GZOA 5GIPE 3TKIA 5AA9A 2YACA 4AQCA 4E5AX 5GIOE 2W1CA 2R3QA 5BNJA 4YJTA 3PZEA 3E7OA 1ZYSA 5DE2A 4NUSA 5B0XA 5BV3A 4K11A 1JSVA 4O91A 4PMSA 3UQGA 3ZCLA 4I92A 2PMOX 3EZRA 4M69B 2IW9A 4ARKA 2YWVA 3C5IA 3KMMA 4M8TA 1NW1A 4GJ3A 4G3EA 3U51A 2X4FA 3RCJA 4MXAA 4FGBA 4BI0A 4KNBA 3BBWA 2YITA 4R3RA 4ERKA 4HW7A 3QTXA 5IH5A 3UP2A 3VO3A 5KKRB 2XNMA 5CSVA 1URWA 2OU7A 3ACKA 4X2NA 2XANA 3KRWA 4GRBA 5BVFA 1Y57A 4BDBA 2J0IA 4IB5A 3CLYA 3QWKA 3RVGA 3RWPA 2GNJA 1SVEA 2YDKA 3DBFA 3R9DA 2PMIA 3VVHA 4BBEA 1ZOEA 4DHFA 2DWBA 4BDIA 5HO7A 1REKA 2OXYA 3NYOA 1YHSA 4L46A 1IAHA 4IAAA 4I1ZA 5DRBA 5FM2A 1NA7A 3V5JA 5KMOA 5AAEA 1QPEA 2XA4A 4IANA 4YJQA 4O27B 4DITA 3OOMA 2VTSA 3O7LB 5EW9A 4F6WA 4CMTA 3GCVA 4IAYA 5M4UA 4YTCA 4O82A 4RVLA 2QONA 3NZ0A 3U55A 1BI8A 5IU2A 2PUNA 5DA3A 3RI1A 5KBRA 3R7GA 4FSWA 4D28A 4QPAA 4G31A 2A98A 5IA0A 4JQ8A 4GKIA 4DDIA 2OKRA 4IMYA 3HAVA 5EH0A 5AAGA 4J8MA 1U5QA 4DN5A 2XP2A 5CY3A 4BDEA 3DNEA 5HNIX 3HZTA 4ZEGA 3QCXA 2XJ2A 3SGCA 3I5ZA 5CANA 3VS0A 1I44A 4KS8A 4J95A 4MH7A 4YJRA 3Q9ZA 4FKWA 5CQUA 3UNZA 4I0TA 5HO8A 2OF4A 4DBXA 3CD3A 4D1ZA 4M3QA 3C51A 4FTAA 5I3OA 3HGKA 4DLIA 4ASDA 3G0FA 4Y46A 5IA5A 3MVMA 5CU3A 3OP5A 4AW5A 1B39A 4GUEA 1CKIA 3C4FA 2RG6A 4AP7A 5AUYA 4G9CA 1PMUA 4BICA 1TQPA 1EH4A 1S9JA 2X1NA 2CDZA 2PZYA 3AGMA 4FV2A 4L3JA 5DR6A 1FGIA 4AT3A 4AT5A 2WTKB 3F66A 3BQCA 2FVDA 2UW7A 3QX4A 3EFWA 3TWJA 5DGZA 3SXFA 1Q61A 4KKEA 3LE6A 2UW6A 4JDIA 1GIHA 4E6CA 3DXQA 2BZHB 4YNOA 4R1YA 3IOKA 1CDKA 3SW4A 1H07A 4JIAA 4BTMA 4R78A 2FO0A 2C68A 2XK9A 4EZ3A 3OTUA 3BV3A 2BTSA 4PV0A 4YTHA 4NH1A 1OKYA 2PE1A 3EQCA 4NFMA 3VULA 2NPQA 4IWOA 3ZLYA 5BMMA 3QA0A 4AXEA 2H8HA 3QFVA 1BYGA 4KD1A 2PHKA 2GNLA 5K4IA 4FC0A 3POZA 2QOCA 4TYIA 4BRXA 2IPXA 2R0IA 3DJ7A 4FVPA 3LM5A 4EOOA 2AEGA 3LLAA 4ZJVA 2WTCA 5M53A 3C5UA 4K77A 4PF4A 4O7WA 4Z3VA 4O7TA 5AP0A 1R39A 2R0UA 2QOLA 4EH4A 4YO4A 5K4JA 3K2LA 5HGIA 4LV5A 4UB7A 3BL7A 4TKSA 2XVDA 3ZRKA 4IBMA 2RL5A 4IACA 4GW8A 1E9HA 1QCFA 4ANSA 1ND4A 3LKMA 4XEYA 3ATSA 3ALNA 3LJ0A 1H27A 2QO7A 2GPHA 3GCQA 4PP9A 4W9XA 5FQDC 3TI1A 4BVUA 4RWLA 5AA8A 5J79A 3PUFC 4FIFA 4PDPA 3IO7A 4FOCA 3MH3A 2EVAA 3OTVA 3TN8A 5LMKA 2B4SB 4GKHA 4K33A 3NMUF 2PUIA 4FV9A 2ZV2A 4LOQA 4F70A 2AC5A 4ZTQA 4TT7A 3ZLWA 1GIIA 5LMKC 3MB6A 3F3VA 3LCSA 3NFFB 2CKEA 1WBOA 3F9NA 3PJCA 4FODA 5DT0A 2RFEA 3LXLA 3WIKA 3IW8A 3CPBA 4DG2E 2LGCA 5HU9A 3MTFA 4JG6A 5EM7A 1JKSA 3PXYA 3ZC6A 4EH9A 5AUWA 4KRDA 4X2JA 5DVRA 5BMSA 3UPZA 4QP2A 3MFTA 2E9OA 4M7IA 1Q97A 3G6HA 3H9RA 4UV0A 4EK3A 4KIKA 2UZUE 1T45A 4O4FA 3SOAA 2P2HA 3CQWA 2IG7A 3ROYA 5J95A 4ZMFA 1E1XA 3FMHA 3ZUVA 3PRFA 5EG3A 3ULIA 3S00A 4CZYB 4LI5A 2ZV9A 4BY9E 1YWVA 3O23A 2UW3A 3WF8A 2X9EA 5AP6A 3PVUA 5CNNA 4BYIA 4NCTC 4HYSA 5L2QA 3ML1A 2JKMA 5IA4A 2PPQA 2J5FA 4PRJA 2C5XA 3BX5A 2UW0A 4IE9A 3IW5A 3MBLA 1ZYDA 2HY0A 4E4XA 5L6OA 5LMBA 3UNKA 3CQUA 4IB3A 1YXXA 5JFXA 5I9ZA 4YJOA 1IR3A 3I4BA 3HA6A 4QMPA 1A48A 4RJ4A 5ETIA 4B9DA 4I5MA 2FUMA 5H2UA 1ZWSA 4CG9A 1VLRA 5IMEA 4FVQA 2H96A 2XBJA 4JBQA 4JQ7A 4HPTE 3DOGA 5CEQA 3GU8A 4JRNA 4R3PA 3LMHA 1RQQA 2PVKA 2F7ZE 2VTIA 3NCZA 5AWMA 2PUPA 3JR1A 4L7FA 2JKKA 5TOZA 3BYSA 2B52A 4Y8DA 4ZTSA 4ZTMA 3KIOC 1WAKA 3QTIA 3W33A 4TY1A 3LCDA 5D7AA 2PZPA 5JGAA 3B2TA 4FT7A 3UIBA 4DCEA 3BZ3A 3EYGA 4PNIA 4LFIA 2P0CA 4ANLA 4IVAA 5C9CA 3EQPA 3PSDA 1YW2A 2YEXA 4XHKB 4BF2A 3AT3A 3Q60A 5KMMA 4F08A 4OUCA 3ALOA 1W2CA 3TG1A 5CF5A 5AP1A 1HCKA 3FI2A 4QMXA 5TR6A 2BZIB 3ZC5A 4BGGA 3OT8A 3BGPA 3KULA 3SDJA 3FHIA 4FT0A 5KMNA 1NT2A 3QC4A 3POOA 4QMWA 4AACA 4OTQA 1OMWA 2QLQA 3I81A 2ZJWA 2GTNA 3A8WA 4IH8A 5IEYA 2VTMA 5AV4A 2V7OA 2CNQA 1M52A 4AN9A 5TKDA 4IVBA 5IQFA 2HY81 3IQ7A 1FQ1B 4RVKA 4TYJA 3UIMA 4NCTA 4ACGA 4F64A 3SLSA 4DHZA 4RJ5A 2VTAA 4M0ZA 2W1HA 3IG7A 2C6OA 2PZRA 3G33A 4ZIMA 5M09A 4G3GA 4XRLA 4AXDA 3EL8A 5A6NA 1BX6A 1PXOA 2DYLA 5DPVA 3SVVA 4QYFA 2XKFA 2W5BA 2ZV8A 5DRDA 4AFJA 2HIWA 3OXIA 4G6OA 4RFMA 3AKKA 5JSMA 3BLQA 3U4WA 1MP8A 4JDHA 4U44A 4X3JA 5FD2A 5G6VA 3WZUA 3CEKA 3HUBA 5JRSA 1Q3WA 2JC6A 3CC6A 3ZO2A 3ZU7A 4O4BB 5KZIA 3VJNA 4A4LA 2CN5A 5JN2A 1UNLA 3ZBXA 2XARA 2V0DA 2B9IA 1JAMA 4D55A 5JFVA 2YM6A 3WF9A 4HGTA 2UZDA 4ZSAA 4EOLA 4ACMA 3MDYA 2ETMA 5DEYA 4E73A 3QXOA 2EB3A 5CVGA 2JDOA 4CFVA 2C4GA 3F7ZA 4FT3A 2RFNA 3HL7A 1U46A 2XIYA 2VX1A 3FMLA 1Q8WA 4U5JA 4HCUA 4J1RA 4XG7A 3QKMA 5CEMA 2O0UA 2VO7A 4QPMA 3VBTA 4C2VA 4L45A 4C4FA 4EK4A 3OCTA 3D2KA 5K0XA 3UVRA 3A8XA 3RPSA 2ITVA 3DAKA 5LQFA 1JKLA 3MGYA 4GT4A 4BCHA 2B0QA 2CGXA 3W2CA 5GZ8A 5G1XA 3OBJA 1PHKA 3EL7A 3CY2A 4F9WA 2WTVA 2VNYA 3F82A 4AGCA 4TL0A 3R7IA 3HRCA 4NM5A 4HYUA 4D1SA 1GIJA 4ASXA 2X6DA 2PVJA 2OXXA 5HVYA 4IM0A 3D14A 3ACJA 4F7SA 3S1HA 4I5PA 5C8KA 3EMGA 3OCBA 1ZMUA 3GU4A 4X3FB 4YJNA 3SG9A 3DLZA 4GH2A 1JNKA 4O7YA 2ERKA 4FEWA 3R00A 4WSYA 3S95A 4CZUA 2F4JA 3MYGA 4I5CA 4JXFA 3O71A 3M1SA 5D9HA 1ZYJA 2KTYA 4HCTA 4QMSA 2HZ4A 5HTBA 1XH4A 1JSTA 4JBPA 4NU1A 4AZWA 2R3HA 5A14A 5TO8A 4G3DA 4FSMA 4KBKA 5HCYA 4NJDA 4UXLA 3TACA 4LM5A 3PSBA 3TCPA 4C02A 3A7JA 4WO5A 2R3MA 3UYTA 4XG2A 4YHTA 3TEIA 4CYJA 3Q9YA 4M12A 2QOIA 3ZSGA 4CG8A 2CGVA 5HCZA 3ZO3A 5F4NA 5GJGA 3NWWA 4XOYA 2X9FA 4IQ6A 1G8SA 4FF8A 1U59A 4MTAA 4M84A 4TNBA 5JZJA 3OC1A 3SKCA 5HG7A 2YM3A 2X7GA 3Q52A 3MPMA 4PDOA 2WEIA 3UOHA 4F6SA 3P9JA 4EOSA 5C26A 2ZFYA 4FE2A 2GQGA 3LFBA 5FBNC 5EM8A 2DS1A 3NUUA 3QCYA 3DB8A 5CTPA 1SYKA 5B2KA 5JQ8A 3GU6A 3OD6X 4D5KA 2F7XE 2VUWA 3LXPA 4BB4A 1OIRA 4TYGA 2VNWA 4WRSA 4UEUA 2WQOA 5EDRA 2J0LA 4G1WA 1A06A 5E8YA 4F7NA 1UV5A 3IK3A 5AUXA 3VBWA 4FSUA 3E7VA 2BR1A 4M69A 2CPKE 4XMOA 3FMEA 4UWCA 4FNZA 3FLZA 4AA5A 5BQ0A 4L68A 2VU3A 4GFOA 2NRUA 3IW4A 3O17A 2W9FB 4KS7A 4UMRA 3TZ9A 4H36A 3VS1A 3LW0A 3VUTA 4FOBA 3RHXA 1H0VA 1PKGA 1OB3A 4TWPA 3UDBA 3FZ1A 3VS4A 4ID7A 4TW9A 4UWBA 1RJBA 4I41A 4OTWA 2CN8A 5H8EA 3UZPA 3NNWA 4F1MA 4GG7A 4LRMA 4X6RA 4MYGA 3QHRA 3E87A 1UU7A 2F7EE 5BVWA 5C27A 3P08A 3RCDA 2C3LA 4FI1A 4DGMA 4F7JA 5BUJA 5IPJA 2XM8A 5E4HA 1W98A 4IXPA 4BTKA 4M14A 2BILB 1APME 4YC3A 3UVPA 4EH3A 2GHMA 4ALWA 3TNWA 3D9VA 3UG2A 4BDJA 5HX8A 3HMPA 3O8UA 3PJ2A 3ZLXA 5DFPA 3DDPA 3ZTXA 4A7CA 4BCMA 2ZOQA 2J6MA 1XMLA 5KMIA 2IZTA 3QKLA 4D2TA 1Y6AA 4DAWA 4Z16A 4CRLA 4O86A 2BTRA 4ZAUA 2LAVA 3KKVA 1LEWA 2H9VA 3HV6A 2GS6A 1NVRA 4FIEA 3GC7A 1NVSA 3ORTA 4FTKA 4G3CA 2VWXA 4RT7A 4WNKA 3WBLA 3ZMMA 2XKDA 2F49A 4XLVA 3A62A 4IWQA 4AUAA 3LZBA 3OUKA 4HYIA 4EZ7A 4FSYA 4XG6A 1YXVA 3ZUTA 4OTFA 3MH0A 3TNIA 4C62A 2VTQA 2VZ6A 4GS6A 3NR9A 4E8AA 2VAGA 3GFEA 3VBVA 3VHEA 4B4LA 3U9CA 3LCTA 4Q9SA 4RQVA 1CKPA 3GCUA 3S2PA 4ZXTA 4J53A 1AD5A 3FAAA 3FSFA 3KRLA 3RPVA 4IWDA 4BKJA 3W0PA 3O51A 3BHVA 4S32A 4MD7E 4MBIA 1LR4A 4BIDA 2NRYA 3CR0A 1W7HA 3NUSA 4QYGA 3Q3BA 4W9WA 4PPBA 2QQ7A 4F1OA 3NUPA 1MQ4A 2BFYA 5AIRA 4DEHA 4MQ1A 2WQEA 3D5XA 4NM3A 4GYIA 4R5YA 5EM6A 3W2PA 4O84A 5TF9A 3TIYA 2J7TA 4D58A 3N4VA 3WE4A 3CXWA 3SQQA 5I9XA 4O81A 3JS2A 4O0TA 3RMFA 4FSRA 3ERKA 2BROA 4W4WA 4EI4A 2XNNA 3IGOA 4UYNA 1PXPA 2ETKA 3R63A 4O6LA 3ZS5A 5LWMA 3F3ZA 1VZOA 4JRVA 1WBNA 3QCQA 2BFXA 2OK1A 4DHJA 4MWHA 5DG5A 3D2IA 5FGKA 3HAMA 2GCDA 2QOQA 2QR8A 3N9XA 4K18A 4QTEA 5AM7A 4KIQA 2EUFB 3R1YA 4F65A 1M14A 4H05A 4IAIA 5GHVA 4CEGA 3NVMB 4FL1A 2FSLX 4JLCA 2PYWA 2GNFA 4FSQA 1OBGA 4I0RA 4H3PA 4IW0A 1SVGA 5HLPA 5HVKA 3V5WA 3MTLA 4R77A 5IQCA 2QODA 3KF4A 3BQRA 4QP6A 2PVHA 3LPBA 3PXZA 3R73A 2GFCA 3FZTA 5D41A 4RWJA 3QLGA 4IZ5A 4B99A 3VJOA 3TNQB 5DH3A 3Q9XA 2ZAZA 3QTWA 4YGAA 1DI8A 4PDYA 2CJMA 2CGUA 2WXVA 3JVRA 4BI1A 4S34A 2P33A 2IF8A 3QQHA 3RWQA 2PE2A 5EFQA 4YZDA 1GJOA 4BDHA 1VYZA 1Y8GA 3EQFA 4FKUA 4FV6A 5CI6A 3R2BA 3R8PA 3NRMA 2W0JA 3PJ1A 4Y85A 2JKQA 5L2SA 1IEPA 4FZ6A 3PFQA 4MNEA 2X8EA 4NM7A 3LMIA 2ITYA 1AQ1A 5EKOA 2BHHA 4QPSA 4DCAA 3IOPA 2PZIA 4LV7A 3R22A 3DXPA 5IISA 5KMLA 4NTTA 3OFMA 5CSWA 4E26A 3QYWA 3NUNA 4OTPA 5AP4A 5IEXA 5K5XA 5K5NA 4EWHA 3OXZA 4CYIA 3R9RA 5J8IA 3DGKA 4NK9A 5EOBA 3NW5A 1S9IA 3A4OX 2W4JA 4P4CA 4IJPA 4M68A 4P90A 2O63A 2QHNA 4CQEA 3M42A 1PY5A 5JGDA 5HG9A 5HHWA 3R28A 1OKWA 4QMVA 3V3VA 1GAGA 5L4QA 4UYAA 3NUYA 4EYMA 3VS5A 4LOPA 5AX9A 3OROA 4EBWA 2Y9QA 4BJJB 2H34A 3P7AA 3KEXA 4XP0A 4QP1A 4QDVA 3PIXA 3HMIA 4ZY4A 1Q5KA 4KBAA 4NT4A 2Y8OA 3CJFA 4JR7A 2HXQA 5HE2A 2P2IA 5CENA 4D9TA 3WYYA 1JLUE 3THBA 3TZ8A 3E5AA 4U43A 4KIKB 3ZYAA 4M15A 4B7TA 2WIHA 3SHEA 3AQVA 4UZHA