3A7GA

Human mst3 kinase
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
290
structure length
289
Chain Sequence
GLPGMQNLKADPEELFTKLEKIGKGSFGEVFKGIDNRTQKVVAIKIIDLEEAEDEIEDIQQEITVLSQCDSPYVTKYYGSYLKDTKLWIIMEYLGGGSALDLLEPGPLDETQIATILREILKGLDYLHSEKKIHRDIKAANVLLSEHGEVKLADFGVAGQLTDTQIKRNFVGTPFWMAPEVIKQSAYDSKADIWSLGITAIELARGEPPHSELHPMKVLFLIPKNNPPTLEGNYSKPLKEFVEACLNKEPSFRPTAKELLKHKFILRNAKKTSYLTELIDRYKRWKAEQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Serine/threonine kinase 24 (STE20 homolog, yeast)
publication title Structures of human MST3 kinase in complex with adenine, ADP and Mn2+.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 87
structure length 289
sequence length 290
chains with identical sequence B
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2009-09-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3a7gA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3a7gA01
1OKZA 3HRFA 4CZYB 5KBRA 3KEXA 1H07A 1JSVA 2BRHA 2GFCA 3PXFA 1W83A 3UTOA 4CFNA 3CQUA 4FL3A 1V0PA 4EOMA 5TOZA 4MCVA 4TWPA 2C30A 5HKMA 4G1WA 4PQNA 5TT7A 1Y6AA 2WEIA 1OKVA 3EZRA 2GU8A 3MH2A 4FTIA 4OAUC 5AUZA 3CKXA 4RIWA 5HE2A 1Q8WA 2X7FA 2WFYA 3IK3A 3P7BA 4QPMA 3L9MA 4QMTA 1VJYA 2XJ1A 3NNWA 4X0MA 5HIDA 2Q0BA 2PMIA 2VN9A 3R9HA 3RWQA 4A9YA 4R7IA 2RGPA 4JRVA 1DS5A 4FBXA 3ZLSA 5E1EA 1YKRA 3VJOA 4WUAA 5E9EA 3FY0A 3P79A 1Q61A 3MFRA 2ZV9A 3R8UA 4FKJA 3MVJA 5HOAA 3FZOA 2J5EA 3W8QA 1W98A 5ETAA 4FKSA 4E73A 3A61A 3LKMA 3SGCA 4FTCA 4KAOA 3UNJA 4LUEA 3NX8A 3UG1A 2B4SB 2XJ2A 4O38A 4YZMA 3QA0A 4NFNA 4GUBA 5AADA 1MRYA 3N9XA 3TNHA 4C4HA 2OZOA 4YNOA 5FXRA 3UODA 3SRVB 1JSUA 4U79A 3DLZA 3L8XA 4QRCA 5AR5A 3RPVA 2PE2A 3EOCA 4FKWA 5T3QA 3EKNA 3TTJA 3WIKA 3VF9A 4BCGA 4RFMA 3OD6X 1KE8A 3ZLYA 4R7HA 5IZFA 5C03A 2JFLA 5IA0A 5A54A 2C6TA 4E4XA 1J3HA 2W96B 5C26A 1Q41A 2G2IA 2WZJA 2XBJA 5EHLA 3LCKA 2HWOA 2XIZA 2WMXA 3AGLA 3IONA 4IX6A 2H96A 4PMSA 1M2QA 1NY3A 4AZFA 2C6KA 3PVUA 3BU5A 3EIDA 4GK2A 2HZ0A 4V0GB 3TUBA 5J1VA 5F9EA 3O7LD 2XKEA 1FPUA 3EQBA 3W55A 2CKQA 2I0HA 2IJMA 1ZYSA 3EN4A 3L9PA 3QF9A 4FSWA 4HOKA 4U3YA 4O0RA 1YHWA 5ACBC 2QOFA 3VS6A 4CTCA 4YMJA 4FL2A 2ITNA 3W16A 2F9GA 2O2UA 2WTVA 3IW8A 4KKEA 3HNGA 4KRCA 2X8IA 1PXOA 5IEYA 4ZY5A 5L6OA 3Q9YA 2XK9A 2C5XA 3ANQA 2WOTA 3P9JA 4FIJA 4HPUE 4MVFA 4X3FA 4TZRA 3W18A 1XKKA 4V05A 1SZMA 1CKPA 1R39A 3MJ2A 4W4XA 1S9JA 4E5BA 4FK3A 5AEPA 4WRGA 4ZY4A 2WTJA 1JQHA 1URWA 2QO7A 4O0UA 2OG8A 3CQEA 4CFFA 1CKJA 5CS6A 4K33A 2VO7A 3VUMA 3IW6A 4DTKA 2HWPA 5ITAA 4ASZA 3RNIA 1OL5A 2C5OA 4O0XA 4RJ5A 4ZLOA 5F4NA 5AIKA 4H39A 1Q24A 4FIFA 4F08A 3UIUA 4M67A 1H0WA 4L46A 4IH8A 2J0IA 4B8MA 1GIJA 3M11A 3MS9A 4ERWA 3O8UA 3DXQA 1UNGA 4GIIA 5CQWA 3OBJA 3UO6A 4UWYA 5HO8A 3BV2A 4D5HA 1H0VA 4USDA 3UNKA 2BAJA 4FC0A 2W4JA 4KNBA 2XB7A 3PFQA 2ITWA 4ITJA 3QC4A 1BL6A 2ITOA 2QHMA 4BCKA 4CTBA 1L3RE 3TT0A 4IB0A 3O23A 5CEMA 4QMMA 4EHZA 4Q9ZA 3W32A 4O7LA 5CZIA 3DS6A 3R8VA 1M7NA 1E1XA 1NA7A 4EI4A 1H4LA 4MHAA 3PY3A 4BDCA 2ZVAA 2C3JA 4EOOA 4H1MA 4FOBA 4M97A 4FEXA 3CGOA 4CQGA 5LWNA 3KRRA 4YPSA 5DPVA 1DM2A 4NCTC 2UZOA 3WILA 1ZOGA 3FQSA 4QTDA 3UOLA 4Q5EA 1R0PA 2CNQA 4IMYA 1CKIA 2LGCA 2XA4A 3TUDA 2YCSA 3DU8A 3EZVA 4QMYA 4ANSA 4G3DA 1R78A 3PA3A 4FODA 3W33A 4RWJA 2WTIA 5CT0A 5CQUA 4QP7A 2V55A 4YHFA 1ZMUA 2UZBA 4FUXA 5EI6A 2YCQA 2QI8A 2R3KA 2OLCA 5JGAA 1G3NA 5IQIA 4XV9A 1Q8ZA 2QKRA 4FV4A 3ANRA 4IZAA 4MTAA 4G3CA 1JNKA 2R5TA 3PSDA 4GG7A 4O0WA 4PWNA 5HO6A 4CG9A 2X9FA 1GZOA 3V3VA 5CEIA 3ZFXA 1UNHA 3LMIA 1YI4A 4K6ZA 3QUPA 2C47A 2X0GA 1OIQA 2Z8CA 5EHYA 2OW3A 1XH9A 4M0ZA 4AP7A 5BVKA 3KA0A 2PE1A 5FEEA 4JRNA 4BR3A 4F4PA 3QQGA 1X8BA 4HGSA 4QMUA 3C7QA 1XH5A 3D0EA 5CAQA 3V5TA 2HW7A 2IVVA 4IDVA 4JDJA 1W82A 3R0TA 5FUTA 2BIKB 5C01A 2WXVA 4IM3A 4G9CA 3TIYA 3QKMA 3R2BA 4MYGA 3PXZA 4A9TA 3F3UA 1G5SA 4YTIA 3PRFA 5CAOA 3E3BX 3L8VA 3I6UA 1KOAA 3R73A 4JG7A 3TI1A 4IFCA 1QPCA 4EBVA 4F99A 4PL3A 4QPSA 1CDKA 4XG3A 2CGWA 1YXXA 5KKRB 1OB3A 4NZWB 3D5VA 5HEZA 2VGOA 3K54A 3MTLA 1WZYA 3HAVA 1U54A 2BIYA 2EUFB 3G2FA 2YACA 2VGPA 4XCUA 5EQPA 4JIAA 2IO6A 1UKIA 5DMZA 4XG4A 3KF7A 2CNVA 2VWWA 4UALA 2ZM4A 1MRVA 3FHRA 4ANLA 3DBQA 4UMUA 4DG3E 5E7RA 3F82A 3WYXA 2FSOX 4CFUA 1P4FA 3GU6A 5EYMA 5HU3A 4KBAA 5K0XA 3I5NA 5M57A 4R3CA 4HVDA 4KS8A 3OTUA 3PJ1A 2OJGA 2QOHA 2XK6A 3QHRA 3NEWA 3PA5A 3O96A 3TNQB 3P5KA 3QWKA 5HCXA 4EHVA 4PMTA 4I21A 2XKCA 1Q62A 3QYZA 5ANGA 4CFXA 4DBXA 5AUXA 2DUVA 3P86A 5M51A 3MFSA 5IDNA 4FKLA 5H3QA 4Y5QA 1WCCA 4BB4A 1UV5A 4WG4A 5DIAA 4E4LA 3ZDIA 5LCKA 4IWDA 5L6WL 3TIZA 4X2KA 5DH3A 2XNNA 3DFCB 3O0GA 4XG9A 3OMVA 4FE2A 2B9HA 2CSNA 4EHEA 3RPSA 2C3KA 2FO0A 5BVFA 2YDJA 3AC5A 4C33A 3ZXTA 3DV3A 2W1DA 3HMNA 4LFIA 1QCFA 4D4RA 4FKQA 4LQMA 1FQ1B 2WMWA 4XLVA 4BFMA 2O64A 3GOPA 3PXKA 3NNXA 3OROA 2WB8A 5EOLA 3R9OA 1ZY5A 4OTRA 3EFKA 2ZV2A 4U80A 3R7GA 3BYMA 4NJ3A 5DG5A 3RAIA 4YZNA 3TNIA 3ZYAA 4QMQA 2C6EA 3E7VA 3MH0A 2PULA 1FOTA 2YZLA 3VS4A 5LVLA 2BAQA 5CEPA 4EWHA 3VVHA 4ERKA 5I9XA 4Y8DA 1GOLA 4GJ3A 2V0DA 4APCA 3GCPA 4NIFA 2XKDA 4X2FA 4DE4A 2OIDA 3BU6A 3NUPA 5CSXA 4EEVA 4HYHA 2FVDA 4JVGA 4UZDA 5M55A 3UOHA 4O84A 4CKJA 4UMPA 4CT1A 4FZDB 2G01A 3CE3A 3OT8A 3LXPA 3CP9A 2UW0A 5EM8A 3BHTA 4X3JA 3ZM9A 4EK8A 2XNOA 3NGAA 3AXWA 5KZ0A 3W10A 2CN5A 3GC9A 3PJ3A 3PPKA 1F5QA 3GB2A 3VS3A 4CVAA 3RPOA 3PDTA 4WG3A 3S95A 5GNKA 1JLUE 5IH5A 4XS2A 2BVAA 4U9AA 4NEUA 4E93A 4U7ZA 3V5PA 2W1GA 3KK9A 3EQDA 4RVMA 3U4UA 3AC1A 1AQ1A 4FV1A 4S32A 2QOBA 3NVMB 3HV7A 4LYNA 4QTCA 3W2QA 4BBMA 2GQGA 5JT2A 1J7IA 2UVZA 4FV0A 4AOIA 2CGUA 4N0SA 3ZRMA 4DINA 3LMGA 2ITQA 3LQ5A 1U5RA 4AUAA 3NW6A 3K5UA 4MF0A 3E8NA 2HZ4A 3BZ3A 3Q52A 3Q4ZA 4EKKA 5HTBA 2R7BA 3EN9A 3SC1A 3FI4A 3C50A 2J0KA 3QQLA 3W8LA 5L2WA 1FBNA 3F5PA 1JKLA 5AV3A 5EI2A 4BDFA 4USFA 2GNHA 2UVYA 3C1XA 3R8ZA 2XNBA 4JI9A 5KMKA 3UVQA 4F7NA 1Q3WA 3AC4A 3FLYA 1XJDA 4IACA 3E62A 3LM5A 4E4MA 4HZSA 4J97A 4HVGA 3JY0A 3Q2MA 3DAEA 1JOWB 5J95A 5LVPA 3G15A 2XNEA 4JDHA 4ZTHA 4FZFB 5AIRA 4D1ZA 2EB2A 3E92A 3PTGA 3DNDA 4FI1A 5CVFA 5BMMA 4DH5A 5AA9A 5F1ZA 4USEA 3LJ0A 4WNKA 4YJTA 5IQAA 5E8VA 4KBKA 3EQIA 3HV5A 4O27B 1AD5A 4DLIA 5E91A 4XG6A 2GSFA 4HPTE 3BE9A 3ET7A 4O82A 4NW5A 2PMOX 5JGBA 2QOOA 4ZSLA 3E63A 3H4JA 2UZVA 3RTPA 4BTJA 1SVGA 4QO9A 1ZLTA 5ANOA 5EM6A 4AN2A 4BHNA 1VYZA 3R22A 3JPVA 4MQ1A 2YIRA 4AG8A 4YSMA 3HZTA 3LXNA 2CKPA 4HGTA 4FYNA 4AFJA 4DG0E 3DBFA 3NRMA 3QRKA 3TUCA 4R5SA 4O1PA 4DG2E 2Y6OA 1WBNA 1K9AA 2X81A 2GHGA 4XEYA 4GMYA 5CENA 5IQFA 5KHWA 2I40A 4OW8A 4PDSA 5JRSA 2EVAA 3JVSA 3P1AA 3MPAA 4A9SA 3SOCA 2VO3A 4A4OA 4F1TA 3ZEWA 5D41A 4W8EA 4AW2A 3GT8A 5FBNC 4BDDA 1O6YA 3PVGA 1MQ4A 2BHHA 2R0IA 3E8EA 2HXLA 2ZDTA 4FKOA 4RG0A 4ZP5A 2BR1A 4FG9A 4FSRA 3O7LB 3G6HA 4C2WA 4F7SA 1ZY4A 4XBRA 3AC2A 3UO4A 3KULA 3DGKA 5FTQA 3DAKA 4YURA 3UOJA 2XBAA 3KREA 3VBVA 1P4OA 2X6EA 4EH3A 3ULIA 4WOVA 2YEXA 3PVWA 3NNUA 4EQMA 4QP3A 4FKRA 3NMUF 1J1CA 4M12A 4WBBB 3ZFYA 2CGXA 2YABA 4BCHA 4LMUA 1JPAA 4CGAA 1MUOA 5M06A 2E9PA 3O2MA 4MNFA 4NM3A 1IG1A 1OPJA 3OFMA 3QTXA 3RAKA 5KUPA 1OGUA 3CD8A 2X2LA 2GS7A 3NCZA 4A06A 4LV8A 3AG9A 5LMKA 4CFWA 5ANKA 3RZFA 3SVVA 3A7IA 3V6RA 3MY5A 1WBWA 4M13A 5EK7A 4IW0A 3FKLA 4BDKA 4PNKA 2XVDA 1G8SA 3ENMA 4CKRA 2E2BA 3DA6A 4O6LA 3TV4A 2PVLA 1XBAA 4ZJIA 3H9RA 4O7TA 4FIEA 2ITYA 5JK3A 2QURA 4AW5A 3MIAA 4L43A 2ONLA 2UW6A 3UGCA 5CEKA 3KC3A 2CMWA 2UZLA 1XH8A 4BCMA 2UZDA 3EH9A 4ZJVA 2REIA 3PXQA 5C8MA 3CCNA 3HUCA 3LXKA 1H27A 4L3LA 4DEIA 5CSVA 1YWRA 3EFLA 5DFPA 4G2FA 3ZU7A 3ITZA 4AN3A 2QO2A 4F6WA 2XEYA 5HIBA 5DR2A 5IQBA 4L45A 2XKFA 5AP0A 3ZO2A 5CSPA 3ROYA 2NP8A 3BHUA 3PXRA 2PZRA 1H28A 3GU5A 1FGIA 4PDOA 3FI2A 2YM8A 4M8TA 3A7HA 1PMVA 2QOLA 1OM1A 2B52A 1L8TA 4ZS4A 2YA9A 1Q97A 1M17A 5KNJA 4AS0A 3KMUA 3MI9A 2JKOA 2WEVA 5A4EA 5EH0A 3TXOA 5K9IA 4FSZA 2OFUA 2XJ0A 3PZEA 3LXLA 1OPKA 3WZKA 1KV2A 3EL7A 3BYOA 3O51A 5AUVA 3E8CA 4OUCA 4BYIA 5AR8A 2HY81 5CNOA 3VBWA 4KSQA 2VD5A 3GVUA 3R7VA 2WIHA 4DH1A 2PVHA 3DLSA 4C4GA 4IANA 3GI3A 4EOKA 3TEIA 2X4ZA 1ZYJA 4ZZMA 5AP4A 3MTFA 4FKIA 3RMFA 4EUTA 3OZ6A 3VW6A 2W5BA 4BCOA 5IH6A 4NYEA 1J7LA 3U4WA 2UZUE 3DDQA 3KQ7A 4FTNA 5AAFA 3SD0A 3RBWA 3SXRA 5HG9A 4DFYA 2J51A 4YTCA 2JGZA 5D7VA 4ACDA 3QZGA 4I5PA 4TYHA 3ORTA 4M69A 2GCDA 3AOXA 5EQEA 4FGBA 2QU5A 2CNUA 1IA8A 4GT3A 5I3RA 2J2IB 3II5A 2C6MA 2WMTA 4DFLA 4YTFA 3FPMA 3LPBA 5HTIA 4P5QA 3LAUA 3OUNB 2R3FA 3FHIA 4AZWA 5C8NA 5GJGA 4I3ZA 4AXAA 3DJ6A 2VTPA 5FP5A 1YHVA 4ANNA 1VZOA 4RIXA 3QRUA 5CTPA 2A27A 2AC5A 5HVJA 4PDPA 2JITA 4YBJA 5CZHA 4GT5A 4X3FC 4ASXA 5LMAA 2EXEA 3HRCA 4ACMA 4FV2A 3OCSA 3OXZA 4IX4A 4QMWA 3M2WA 5CX9A 1JBPE 4ZK5A 2ITVA 2O8YA 4RGJA 3NYOA 4AZVA 1NVSA 4I23A 4RVTA 5KHXA 5KBQA 3U6JA 4E7WA 3SG8A 5GIOE 2C6DA 4FKUA 3FI3A 3IGGA 2GNFA 3OWKA 4ARKA 2KULA 3NSZA 4FSQA 5JH6A 5H2UA 4FEVA 2EU9A 3LVPA 5C4KA 3CJGA 1IA9A 2BTRA 4IC7A 5G6VA 1OKWA 2G1TA 1KE6A 3HVCA 2ITZA 4LG4A 4YUQA 3QX2A 3L1SA 3JVRA 3GP0A 3GC8A 5A4QA 3TWJA 4S34A 1B38A 4DEGA 4AOJA 4FKVA 3R6XA 5E8UA 4PMPA 4QYYA 1YXVA 4BI0A 4J99A 3NIEA 3UNZA 5FGKA 5LVNA 3QBNA 3ZOSA 2CJMA 2UZEA 3A60A 2PVNA 3LZBA 2PTKA 4YZCA 3ZC6A 4D4SA 3VRZA 4ZTLA 2NNWB 5T6KA 2PE0A 4EOJA 3U54A 3VBTA 1RQQA 3POOA 3W2CA 3IDBA 3GNIB 4IAYA 2QR8A 1RJBA 3GFEA 5KX8A 1Z57A 4GEOA 2XRWA 4QP6A 4EWQA 3H30A 4XBUA 5TKDA 2V7OA 3MFUA 3NLBA 3ORMA 4FTKA 3R7YA 2VTTA 2PMLX 4ZXTA 3V5WA 3DNEA 4BF2A 4CCUA 2W1FA 2OKRA 3IOPA 4E6QA 5CALA 2VTAA 3MB7A 3PSBA 4BTKA 2A2AA 3HMIA 4TYIA 3QX4A 4GSBA 4H1JA 5K3YA 4MBIA 4NKSA 1B6CB 1J1BA 1OL7A 3DDPA 1ZOEA 2J5FA 4G5PA 1PHKA 4RA4A 2I0YA 2PVMA 4IX5A 1OECA 4RSSA 5CAVA 3QD2B 3MSSA 3QCQA 1HCLA 5DT0A 3EKKA 4N4SA 1HOWA 2AYPA 5TE0A 2F2UA 4WT6A 3ERKA 4FV6A 4H3PA 4JXFA 5HBHA 5DT4A 3FSKA 2IW6A 2XEZA 4FG7A 3G90X 1I44A 3FZPA 4PL4A 4C62A 1TQPA 3BE2A 5DGZA 5CSHA 3GXLA 4AGUA 4UWBA 2FA2A 5IKWA 2ETRA 4G17A 4H36A 1H25A 5J9ZA 4DTBA 5AUUA 3ALNA 3PP0A 1FMKA 4CMTA 4KWPA 4A4XA 4C37A 2EWAA 2R7IA 3QQUA 4EK3A 4RZWA 4EONA 3A7GA 4WKQA 5A6OA 5A14A 4CT2A 4YR8A 5A9UA 4EOIA 4Z16A 4GL9A 5CSWA 4AT5A 4D0XA 4OR5A 4QNAA 3MDYA 5I5ZA 4IDTA 4O0SA 1OL2A 3I60A 1MP8A 4FNZA 2BILB 2WELA 2XIRA 4ITHA 4CZUA 1E1VA 2YN8A 4GFGA 4O7VA 4O96A 5EM7A 3C9WA 4GH2A 3B8QA 5DLSA 1YRPA 3PIYA 5J79A 3KB7A 1IASA 4GYIA 2C6OA 3Q9ZA 2E9VA 4GT4A 4U43A 4C2VA 4C58A 4EUUA 4ZLYA 4PTGA 2WIPA 4ZSAA 2YM3A 4BL1A 4ZTMA 3HA6A 3SRVA 2VNWA 2VTSA 3HL7A 3MH1A 4I93A 3ZLXA 2R2PA 3Q60A 2GNGA 4ZJJA 3OF0A 3ORKA 4ZLZA 3MBLA 2Y0AA 2YERA 4U40A 4A4LA 2ZV7A 5KE0A 4G6NA 5CF5A 1A48A 4DA5A 4Y85A 4A07A 2WQNA 3R30A 4L9IA 3NWWA 3D2KA 4F63A 4GRBA 2Z7LA 2OXDA 1T46A 2YZAA 3FC1X 3E3PA 5HX8A 5IA5A 4NL0A 3LFQA 4R7BA 2GS2A 5DEWA 4WO5A 3SW7A 5JRQA 4YHTA 4WHZA 3VF8A 3VQHA 3LW0A 4BCJA 2OU7A 3QTUA 3SXFA 3ZZEA 2VTHA 4V0GA 4O21A 4M68A 2I7QA 4N70A 4O86A 3G9NA 2W0JA 3FQEA 1ZYLA 2ZM3A 4I20A 3JUHA 3OEFX 3JS2A 4FTJA 2WTKC 3QA8A 4IE9A 2O3PA 4GCJA 5B2MA 4FSMA 2P33A 1J7UA 3MB6A 2JKMA 2RKUA 2RFNA 3OY1A 3PE1A 4DFNA 4FEWA 3QKKA 2QG5A 3QZIA 4IWOA 4U42A 3OOMA 2WHBA 4IVDA 3Q5IA 5I4NA 3R00A 1F0QA 3Q96A 4L44A 1YDSE 3AMBA 1V1KA 3FC2A 3L9NA 4CLJA 1BUHA 4FIHA 4IZ5A 4WSYA 2X8EA 4YLLA 3RJCA 2PSQA 3SLSA 1WBSA 2CCIA 2IZUA 4X2NA 2YIXA 4F9CA 4I0RA 3FLSA 4X3FB 4CQEA 5DN3A 4D4VA 3DXNA 3UBDA 5DBXA 2WKMA 3HX4A 4DEDA 3S2PA 3WOWA 4EOSA 4AZEA 4FYOA 3QUDA 3MFTA 2E9NA 4P2KA 4D0WA 3FYJX 5FM2A 4JIKA 5LCJA 4ANBA 3N4TA 5HLWA 2OI4X 4O91A 5DNRA 5DWRA 5AP2A 3TZ7A 3VULA 4QMXA 2X7GA 4AF3A 4CD0A 1PMEA 3R8MA 3ZM4A 2OF4A 3LFCA 3MPTA 5BVDA 1YDRE 3QYWA 4CSVA 2VUWA 2J90A 4ASDA 3KU2A 2G2HA 4YC8A 4IZYA 3TTIA 4G31A 4KIKA 3FXWA 4BDHA 2YJRA 3UOKA 1REJA 1YQJA 2C1AA 3OG7A 3NUNA 2Y4IC 4LRKA 3VO3A 2IVSA 3LCSA 5CI7A 4E26A 4BY9E 4FSNA 2JFMA 3FMNA 4Z9LA 3TKHA 2YLEA 2X4FA 3QQKA 3QQHA 2QVSE 3RAHA 3QLGA 5IQDA 3CD3A 1YXSA 3EQHA 2OIBA 3WF9A 5L4QA 3MVMA 3D5UA 2DWBA 4BDBA 2C5VA 5K5XA 4FNWA 3P78A 2GS6A 3AT2A 5AWMA 2QONA 4BBEA 2ESMA 1KV1A 4LL5A 3DJ5A 3C4XA 4HGEA 4J7BA 3C4CA 4I6HA 2B1PA 4EL9A 3BBTB 5FEQA 3R83A 3K5VA 3DAJA 4O0VA 2R9SA 1XQZA 3MA3A 4RZVA 5M08A 2BDJA 2JD5A 3DJ7A 2Z2WA 3QTZA 4XYFA 5IEXA 4R5YA 4IHPA 4YJSA 2YJSA 3DBEA 4L00A 2JKKA 4AU8A 2VV9A 3IDPA 4G34A 4Z7GA 5L6PA 3U6IA 3NUUA 4YP8A 3TCPA 4DEHA 4Y46A 5C27A 3SW4A 3V8WA 3MY0A 4BTFA 3COKA 2WO6A 3KF4A 5E4HA 2W4KA 2C0TA 2R3GA 1SNXA 2V7AA 3F5GA 2R64A 3FLWA 2X9EA 3F69A 3PWYA 4FT0A 4WA9A 3KGAA 5AM6A 1ZOHA 2WU7A 2BKZA 4IX3A 4NUSA 3R21A 2PZ5A 1KSWA 4NM7A 2RL5A 3MVLA 3HMPA 4K9YA 2QO9A 4MNEB 4NH1A 4EHGA 5C4LA 1ZMVA 2G2FA 1KE9A 5L3AA 4BBFA 1PKDA 3CR0A 3VUKA 4YJQA 4EORA 4MXZA 3FQHA 2H8HA 1U46A 4RRVA 3R04A 4XG2A 4XG7A 5J87A 4PPAA 1QMZA 4UY9A 3UO5A 4DFZE 3VUGA 2JLDA 4HGLA 3HV4A 2QOQA 4EZ5A 4GIHA 3W2OA 3BGZA 2R3NA 2W99B 4WNMA 3R9DA 5A3XA 3COIA 3SV0A 5JQ8A 3IPHA 3T3UA 1IAJA 5LVOA 4FTLA 3KXHA 2VAGA 4TY1A 3F9NA 5HBJA 3D5XA 4HCVA 1GNGA 3CY3A 4LUDA 4I5HA 4EH5A 4QP9A 2XM9A 4AGDA 1T45A 1MRUA 3QL8A 2XNGA 1BKXA 5KMIA 4DH7A 1YOMA 2JBOA 4IM0A 5CF8A 5FEDA 3R8PA 3HDMA 3R9RA 2YIQA 3MN3A 3RWPA 1BI7A 2GHLA 2JDOA 4QQJA 1E9HA 5EYDA 3AC3A 2VTMA 4QNYA 4OTWA 3NVKI 3HECA 3EB0A 4U44A 3LJ1A 3VS5A 1JKKA 2CPKE 1UU9A 2XZSA 4MD7E 3QCSA 3Q4UA 2Y7JA 4QMOA 4CYIA 1FMOE 3E93A 3ULZA 1A06A 3ZHPC 1OIYA 4EC8A 4WNOA 4HVIA 2PVFA 3WF8A 2Y9QA 4DCAA 4W9WA 4RX5A 5LMKC 2OBJA 2RF9A 2VO6A 5E8ZA 5LQFA 5HGIA 3VWAA 1H00A 1Q8TA 4QQ5A 2UW7A 5JSMA 4ZEGA 3VS2A 2YITA 3BKBA 4YLKA 1Y8GA 5IUGA 4U6RA 4R78A 2C0IA 3TV7A 2HIWA 3R7IA 5FXQA 5FDPA 4RX9A 4GYGA 3PYYA 1WBPA 4Y72A 3A4PA 2OJIA 2B9JA 2CLXA 3DBDA 4JBVA 5ANJA 3UG2A 4GS6A 4NTSA 2JAMA 2IZTA 4BGHA 2ONLC 2IVUA 3OXTA 4OTPA 5IUIA 4EOLA 2XK7A 3E87A 3E88A 4E8AA 3HDNA 2VWZA 5B2KA 4BICA 2UZWE 2VTLA 5HNGA 4DF3A 2FYSA 2NRYA 3EFWA 2HELA 1SMHA 5M4CA 1O6KA 4M3QA 3P0MA 3QHWA 5H8GA 1IEPA 5E8XA 5EOBA 4B6LA 3PXYA 1H1QA 3UZRA 3POZA 3MV5A 2F2CB 3H10A 4JT3A 4U3ZA 5JMSA 5E8TA 5IEVA 4F65A 3SX9A 2ITPA 4LM5A 5HD4A 3SDJA 2OZAA 3VS0A 3OP5A 4BKJA 3C5IA 4IZ7A 4BYJA 5GZ9A 1XBCA 4KKGA 2HK5A 4MD9E 4FIIA 3UQFA 2X2KA 3RI1A 2W9FB 1TQMA 3K3JA 4C3PA 3ZONA 1H1RA 4DT8A 4XLIA 4ZSEA 4IAFA 4JDIA 3H9OA 4JNWA 4MWHA 5JEBA 2OH0E 3IW5A 1KOBA 1UKHA 3R1QA 4G3GA 4RX8A 4RIYB 3ZFMA 5HORA 2X2MA 3TV6A 5GJDA 3ZDUA 2NPQA 4F64A 3R71A 4KINA 1CTPE 4B99A 4G6OA 3CKWA 4KA3A 4I0TA 1ZYCA 3QRIA 4WRSA 4CFVA 5CU0A 3ZSGA 4AT3A 5CYIA 1W7HA 4U81A 4BDIA 2HENA 1HCKA 2R4BA 3MJ1A 2PZPA 4FL1A 4K18A 5IA2A 4XV3A 4MKCA 4MXYA 5BVEA 4QTEA 3DPKA 3D15A 3B2TA 3CPCA 3ID6C 3UZPA 4FTAA 3A7JA 4CV9A 3GQIA 2IWIA 2Y4IB 2VO0A 4X7QA 4YGAA 2HZNA 1VEBA 4LRMA 5FLFA 4BDEA 4QMSA 3NYXA 5HE3A 3I1AA 4ACGA 4C7TA 3AMYA 3KMMA 4E1ZA 4Z55A 2BZHB 2XYNA 4ID7A 3WZEA 5CAPA 5J7BA 4O7NA 5DYJA 2QG7A 2F57A 5BMSA 1TKIA 4OTHA 3ORXA 4KD1A 4QPAA 5HVKA 2W5AA 5AP6A 3VUDA 3QQFA 4J8MA 1JKTA 4JAJA 4RMZA 3CTHA 4YC6A 3MGYA 2RFDA 5BUJA 3CTQA 3GUBA 1RW8A 2C3LA 3BYVA 4ITIA 3DB6A 5AUWA 5ETIA 1YHSA 3QGYA 4JBOA 4TYEA 4CEGA 5IQHA 2XCKA 2P2HA 4XUFA 3FLZA 5JZJA 4LMNA 5C9CA 5EDQA 1JWHA 3W1FA 3F2RA 3F3TA 4U8ZA 2NO3A 1EH4A 3EN5A 3KVWA 2J4ZA 4HJOA 1TQIA 3EL8A 2X8DA 4M7IA 3EHAA 3ZUVA 3BPRA 4QQTA 1ZZLA 4YJNA 2VNYA 3IW7A 2GHMA 3LM0A 2IW9A 3UC4A 2WU6A 2IVTA 2JIVA 1PXMA 2JC6A 2EB3A 1OIRA 4F0IA 3FXZA 4BRXA 4OTQA 2GMXA 4PF4A 4DGMA 2PMNX 4FSYA 1QL6A 2RFEA 5BYZA 1I09A 1NVQA 4MAOA 1NVRA 4B7TA 4CYJA 3A62A 2YDIA 3I7BA 4NKAA 4W9XA 5JFXA 3PJ8A 2OXYA 4NTTA 5M07A 2BZJA 5EI8A 4HVSA 4LI5A 3PVBA 3O17A 5L2IA 4FA2A 1PY5A 4WBOA 4UMTA 5IG1A 2YHVA 3T9IA 3F2NA 2PPQA 1Z9XA 1RDQE 4C02A 2FB8A 4F9AA 2Q83A 3AD6A 3Q32A 5AUYA 2OWBA 2XCHA 2ZMCA 4TYGA 2VWYA 4L7SA 3GCUA 4FV8A 2QHNA 4XHKB 2G15A 3KK8A 4P5ZA 3DY7A 1PXPA 5H8EA 5HIEA 2IZSA 3NUXA 4HCTA 4RWKA 5HD7A 2JAVA 5AV2A 2IG7A 4OTIA 2W7XA 3BQCA 3EYGA 4RLLA 4BDGA 2HZIA 3CPBA 4RA5A 1M7QA 4RJ4A 4FKPA 4E5WA 1OMWA 4KBCA 4QP8A 4WUNA 3RCDA 4B4LA 4D2RA 5HZNA 3VUTA 3E5AA 4YZBA 1DI9A 3UE4A 4M84A 3ROCA 4GG5A 5E90A 4L52A 3VJNA 5FD2A 1A9UA 4KABA 3DQXA 4MEDA 1YWVA 4NK9A 1KE7A 2A4LA 3Q6UA 1WBOA 2PWLA 3UMWA 3JR1A 3UPZA 2R3MA 3R1NA 1JVPP 4TXCA 3S00A 3CGFA 2XK4A 4BCNA 5GINE 3RM6A 3CSVA 2HXQA 3HLLA 3KULB 4IAZA 4TWNA 3OS3A 5I9WA 3NUYA 2W9ZB 1JSTA 4MXOA 2GFSA 5BVOA 4AWIA 5HE1A 3LQ8A 2YM5A 4V04A 4E5AX 1BLXA 4B9DA 3C0IA 4FV9A 3RNYA 2Y8OA 4I6QA 4K1BA 1V0BA 4ORKA 2R3LA 3C0HA 2VTRA 4RQKA 4UEUA 3U9CA 3VHEA 3FWQA 5ANDA 2BAKA 4GKIA 3U6HA 3IGOA 3MYGA 4J1RA 2WQMA 3F5XA 3P7AA 4KB8A 5L2QA 4EBWA 4ZMEA 3RK5A 4K77A 4UYNA 4QMNA 4HZRA 3HEGA 3OWJA 3IW4A 1OI9A 3Q2JA 2OIQA 2QD9A 4IQ6A 2YM4A 4PTEA 3R01A 3TG1A 4KUJA 3A7FA 4NM0A 3T8OA 3VN9A 5IU2A 3Q04A 2ZYBA 2ZDUA 2PU8A 3RCJA 4AQCA 1PMUA 3VS1A 3UMXA 5CNNA 3A99A 3R1SA 2WTCA 3I6WA 3JXWA 4CMUA 4FNYA 2AC3A 5AP3A 5M09A 3QAME 3QLFA 4OBOA 1GY3A 5CT7A 2J6MA 3FZSA 3V6SA 2WMAA 4C3RA 5DVRA 5I9ZA 3TL8A 3PY1A 4AX8A 1FVRA 3KN6A 4H3BA 4JX3A 3ZTXA 5JFSA 2VWUA 3BLQA 3MPMA 2HOGA 3OOGA 3BYSA 4KS7A 5FG8A 2OXXA 3BWFA 3TNPC 1Q3DA 5LXMA 2GTNA 4MBJA 4IWPA 4GFOA 5JKGA 2BFYA 4FR4A 2ZB1A 5CI6A 2VTQA 4D1SA 3NW7A 3D7TB 4K11A 3DK6A 1XR1A 2FGIA 2CN8A 4LOOA 4OGRA 4XP2A 1STCE 1WVXA 2RIOA 2Z7RA 4G16A 1Y57A 3A2CA 3BEAA 4QOXA 4S2ZA 4C4IA 1R3CA 4GW8A 2UW5A 4IIRA 3W2PA 3QWJA 4QTBA 2YM6A 1UU7A 4EZ3A 3LQ3A 3PJ2A 3ETAA 4MBLA 2ZM1A 1MQBA 4TRLA 4S31A 3G6GA 1XO2B 5CU2A 4DBNA 4BWPA 4YJPA 5EHOA 2PUPA 3A8WA 2J9MA 3TKUA 2B53A 2GNJA 4QD6A 4FVPA 4XMOA 5ETFA 4BGQA 1NT2A 3PY0A 4RJ6A 3NYVA 5HX6A 1WFCA 1PF8A 3JY9A 4JLCA 4D2VA 4EK5A 3S0OA 3CC6A 3HV3A 5FTGA 4IAKA 2R3PA 4PY1A 2GDOA 4M69B 5EYKA 5FQDC 4FTUA 4C36A 2WPAA 5CEOA 1CMKE 4AACA 3R28A 5KMOA 3FBVA 5L8LA 2UZNA 3GGFA 4OLIA 4GK4A 1OL6A 4FK6A 3UVRA 3UVPA 5I9YA 3QD3A 1CSNA 1XBBA 1ATPE 5DR9A 1H1SA 2PUUA 4D9TA 2VU3A 3BLHA 4ZAUA 3F6XA 3FV8A 3DKOA 4XG8A 1GZNA 2WMSA 4FGRA 2QLQA 3WBLA 3L9LA 5CVGA 2YM7A 4TNBA 3U8WA 4RC4A 2CDZA 3VBXA 2OJ9A 5CVHA 4MXAA 3R02A 3FMJA 4E6CA 2J50A 2OF2A 3QUEA 4XP0A 3EYHA 4FT3A 3EN7A 3BIZA 3BHVA 4YJUA 5EW3A 3EQFA 4FTQA 4D58A 4R3RA 4TWCA 2YWPA 4IB3A 4PPBA 4AGCA 1OIUA 2Z7QA 3C5UA 2PYWA 3R63A 4RC3A 3U9NA 1WVYA 2UV2A 3OUKA 5BVNA 4YZDA 3DFAA 2OH4A 3MW1A 1OZ1A 3TJDA 5CU4A 4WG5A 4UX9A 5CY3A 4W8DA 3EFJA 4RJ3A 4IEBA 2ERKA 2IZRA 5ACKA 1URCA 4AOTA 4Y5HA 2WQBA 3R7EA 3UDBA 3V5QA 5J1WA 1OUYA 3E8DA 4C4FA 5D7AA 2JDRA 4P4CA 3LFSA 2XNPA 3GOKA 3PG1A 1Y8YA 3DZQA 3QTIA 4X2GA 3GC7A 4L68A 1XHAA 2JDVA 4LV5A 2OK1A 4OBQA 4UB7A 5EKOA 3V5JA 4YU2A 2I6LA 5IQGA 2YISA 3F3ZA 5A6NA 4FICA 5EDPA 5K5NA 1ZXEA 4X21A 2J0LA 3BHHA 5E1SA 3BGQA 5HU9A 3MH3A 4U45A 2H34A 3QRJA 4CKIA 1UU8A 3O71A 3LCOA 4JR7A 4GFMA 1ZAOA 3ORLA 1PXKA 5F94A 4U97A 1GZKA 3DOGA 3B2WA 3DKGA 2CKEA 4DGLC 1J91A 3FZRA 4XX9A 3LFAA 2BFXA 3IQ7A 5EQYA 2JDTA 4F7LA 3D9VA 1XWSA 1PJKA 4G5JA 2NRUA 4Z7HA 4XRLA 1YWNA 4K2RA 4RFYA 5I9UA 5DT3A 3AD5A 4PP7A 3OWPA 1FVTA 2F4JA 5E92A 3MA6A 3T3VA 5DOSA 2QU6A 3HYHA 2B55A 4AA5A 3REPA 1DAYA 3COMA 4O7WA 3W2RA 4PMMA 4NFMA 2ZMDA 1OVEA 4KIQA 4Q2AA 3VQUA 1YOJA 3WZJA 5IUHA 2QNJA 2C5NA 5EYCA 3VRYA 3W2SA 3LLAA 4EYMA 5M53A 4YJVA 4G9RA 5LJJA 4K8AA 5FDXA 1GIIA 1KE5A 5K4IA 3KRWA 4E6DA 4CLIA 3E64A 3QC9A 3NZ0A 5EW8A 4BIEA 1UNLA 5L8KA 4TNDA 5FP6A 3CLYA 5IPJA 2XK8A 4F1OA 3V04A 1XH6A 3HMMA 1VYWA 3U87A 1O6LA 4RIWB 4TT7A 4D1XA 1H1WA 3BYUA 3WIGA 3N4VA 2JIIA 4PDYA 4GK3A 2E9OA 3PJCA 5AV4A 4MXCA 4D2PA 1KUTA 3NIZA 2QOKA 2FSMX 3LJ2A 4A9RA 2UVXA 4N6YA 3RP9A 3K3IA 5E8WA 1GIHA 3RAWA 1LEZA 5GZ8A 4G3EA 5KKRC 4CFMA 3EQRA 3ZBFA 3NDMA 4MQ2A 5IDPA 5FBOA 3Q6WA 3DKFA 4XP3A 4D4YA 2YLFA 1R1WA 2PY3A 5IISA 2A19B 4JG6A 3ZSHA 2Z02A 3LFNA 3BLRA 5JZNA 2XYUA 2C3IB 3AT3A 5AR7A 4FG8A 1SVHA 1PYEA 1F3MC 2RFSA 2XH5A 5L2SA 2C1BA 1UWHA 2XUUA 4XOYA 4M14A 3LOKA 4RQVA 2BPMA 5LMBA 1IR3A 4XH6A 3FJQE 3VW8A 4IB1A 3IO7A 4ANMA 3OXIA 3UQCA 3OVVA 2HAKA 4B0GA 2WMUA 2PZIA 3PPJA 1YXUA 2WD1A 3BBWA 3LFBA 3SAYA 2W1IA 3G0FA 4D9UA 3G33A 5LVMA 4PNIA 2GNIA 5HICA 2WOUA 3G9LX 1PMNA 3OCGA 2JDSA 4AA4A 5ANEA 3KY2A 4G6LA 4QP4A 1KWPA 4YO4A 1PW2A 5AAGA 5AP1A 4FZ7A 4R77A 2P55A 2YIWA 2XMYA 5B0XA 2I1MA 3FKOA 3OY3A 2R3JA 2QKWB 2UW8A 4RWLA 3F2AA 4J95A 2B0QA 4TPTA 4F9YA 1GJOA 4FVQA 4H3QA 1AGWA 3F88A 3AGMA 2GPHA 4BDJA 1FVVA 4Z3VA 2C5YA 3KXZA 2OGVA 2VX0A 4XJ0A 3CBLA 4PX6A 5CXHA 4C0TA 3R2YA 3FSFA 2BHEA 3QCXA 3AMAA 3PLSA 4JR3A 4X6QC 3UPXA 3QZFA 2WMBA 2PUNA 3CXWA 3VUHA 3OW4A 4ENYA 1BMKA 2IW8A 5EFQA 3KXNA 2QODA 3WARA 2BRGA 2RSVA 4HW7A 2F7ZE 4HNIA 1PYXA 4WSQA 5CF6A 3BELA 1H8FA 3MIYA 5HG7A 4BIDA 4EH9A 4EOPA 3UYSA 4F7JA 4ALVA 3OT3A 3ATTA 1SNUA 4I0SA 5DHJA 5KMNA 1LPUA 3ORIA 1REKA 5HVYA 3I4BA 4DTAA 2OFVA 3CEKA 5D10A 4ZOGA 4EC9A 2I0EA 2C6LA 3LCDA 1Y6BA 4GVJA 2WTDA 2ZJWA 2C6IA 2EXCX 5CASA 4PUZA 2CGVA 4S30A 3RK9A 4O83A 2QOIA 3KRLA 4CG8A 4BWKA 3VNTA 3TKIA 3HP5A 4EJNA 5FRIA 3FZTA 3D14A 4QMPA 2W17A 4IWQA 5EKNA 3NYNA 3FL4A 3PA4A 5FWKK 2RG5A 1LUFA 4UYAA 4YC3A 3UQGA 4JL9A 4LGDA 3C4EA 4A7CA 4CMOA 5M56A 4O0YA 3SOAA 4JOAA 4QTAA 4XV1A 4L67A 3OHTA 5DE2A 3ZXZA 3KCFA 2YWVA 4AE9A 3ZS5A 2PVYA 2W1HA 3F7WA 3P4KA 4C4JA 4DFBA 1Q99A 2XM8A 4DN5A 4FKGA 3OCTA 5HQ0A 1WBVA 2UW9A 4CCBA 2H9VA 3DB8A 4BCPA 4KIKB 4MWIA 3UP2A 1SYKA 4R1VA 3ALOA 1NXKA 3NAYA 4CXAA 2Z60A 4CRSA 4AZTA 3GC0A 4F6SA 1B39A 1LP4A 5FM3A 2GQSA 4HYSA 5BUEA 3RM7A 4KRDA 1XH7A 4TYJA 4F09A 3C4WA 4C4EA 4C3FA 4I94A 2W1CA 4FSUA 3F5UA 4PPCA 5FXSA 4DEBA 3EQCA 1OKYA 5I3OA 5IQEA 1W84A 2WQOA 4I4FA 5AV0A 5C8KA 2E9UA 4S33A 4FMQA 4EK6A 2B7AA 3RHXA 2ZV8A 2QLUA 4J53A 4BDAA 4ACCA 4D2SA 2ZAZA 4BZDA 3D4QA 3VIDA 2ERZE 3COHA 2PUIA 5E8SA 5F95A 2I0VA 4L53A 3SKCA 4MF1A 3DXPA 4I24A 3NPCA 4FT7A 1U59A 5DR6A 4GKHA 2B54A 3LMHA 4C61A 5HLNA 4F70A 3IDCA 2ETKA 2G9XA 3HUBA 3UJGA 3PRIA 1WBTA 3WYYA 4JDKA 4BGGA 4J52A 5ETCA 4I5CA 3RVGA 4JAIA 5C1QB 4RLKA 3GCVA 5A46A 4MNEA 2CLQA 2ITUA 3C4ZA 3RPYA 4GVAA 2YDKA 3WI6A 2BZIB 4ASEA 4DHFA 2IN6A 4ZTRA 4CV8A 3VC4A 4ENXA 3ZMMA 4YLJA 3AT4A 3CJFA 5DRBA 2H6DA 4QYGA 1M52A 3UC3A 3ZC5A 4CRLA 1ND4A 4DITA 5DA3A 2FUMA 3FMHA 3D94A 5J7HA 4ZTSA 3SXSA 4D2WA 3EMGA 3UIMA 3I79A 1YI3A 2BTSA 4FZ6A 4YBKA 5HCYA 4HCUA 1Q5KA 4ZSGA 4QYEA 3FMMA 3ZZWA 5GIPE 4ZTQA 5CAUA 3T9TA 2F7XE 3Q53A 5K0KA 3MESA 3ZLWA 4O22A 2DQ7X 4NU1A 2R3OA 4DT9A 1APME 3IKAA 4DFXE 3TJCA 4E3CA 3KN5A 3U55A 5CU3A 3R7UA 3RZBA 3WF6A 4D5KA 4ZZNA 3KL8A 4O7YA 5BYLA 5HI2A 3EQPA 3RALA 1Y91A 3ZRLA 5DRDA 3P7CA 4APPA 2KTYA 4IVAA 4YJOA 3PP1A 4BN1A 3KCKA 3PLAE 3FY2A 4LOPA 2J7TA 3FMLA 4RBLA 4G3FA 4I6BA 2GNLA 1U54B 2P2IA 3ZUUA 1ZRZA 1W8CA 2Z7SA 2BCJA 4EYJA 3H0ZA 4BI1A 5EM5A 4L7FA 4BWXA 4DYMA 4C8BA 4UV0A 4UMRA 4O2PA 3H9FA 2BDWA 4PP9A 5AMNA 1K3AA 1BL7A 4DAWA 4AN9A 4TTHB 2V5QA 4O1OA 5AA8A 3AQVA 4DC2A 5J5SA 2XS0A 3PZHA 5GZAA 4R1YA 2WMQA 5D9HA 1WMKA 3ZEPA 1DI8A 3OEZA 3PSCA 3QD4A 4ALUA 4EH7A 4UN0C 4JBPA 5ICPA 3C13A 4FIGA 4Y83A 4I5MA 4RJ8A 4EH8A 3LFEA 4L42A 3NW5A 5DI1A 3D5WA 3QGWA 3QU0A 4FOCA 4OTGA 5CWZA 4KIOA 3ZO4A 1R0EA 3KXMA 4PRJA 4EQUA 2CCHA 3FEGA 3TM0A 5HBEA 1XH4A 2WTKB 3ORNA 4X2JA 1PXLA 4QYFA 4DGOA 4J96A 3GU4A 4E6AA 3TDVA 3KXGA 3SG9A 3AC8A 2W05A 3HV6A 4F1MA 4NWMA 1U5QA 4PV0A 1BYGA 2BUJA 1PXNA 3F61A 4RFZA 3RINA 4TL0A 5BUIA 4WNPA 3DK7A 3I7CA 4PTCA 3VBQA 2PZYA 1K2PA 4MK0A 5BVWA 4FEQA 3TN8A 2XNMA 5AAEA 3V51A 3BHYA 2C4GA 4WIHA 5A4TA 2PVRA 5JQ5A 3AD4A 4IVCA 1IRKA 1W0XC 2AUHA 1UA2A 3QD0A 3SHEA 3Q4CA 4U5JA 2WNTA 4E20A 3F66A 1UWJA 5D11A 3FXXA 4OT6A 5G1XA 1YI6A 2R3HA 3KVXA 5TR6A 3C4FA 1P5EA 4BVUA 5LOHA 3GEQA 2ETMA 1OL1A 2XP2A 3BV3A 3GCSA 4ZY6A 5KMJA 5GJFA 4U41A 1H24A 4TN6A 4ZS0A 2VZ6A 5AV1A 4C57A 4EQCA 1CM8A 5CANA 4FTOA 5IA4A 5J5TA 5JGDA 3S1HA 4O2ZA 3ACKA 3Q5ZA 4LRJA 4IVBA 4UBAA 2XIYA 4RIYA 5CEQA 1PRYA 5GHVA 3A4OX 5EDRA 1TVOA 4NIFB 5IH4A 2CKOA 2OZAB 2YIYA 5J8IA 3RHKA 2VTNA 4CNHA 1P2AA 2BZKB 2OJFE 3FMKA 4FUYA 4UXQA 3BQRA 4FNXA 5EG3A 4EOQA 2OSCA 5BYYA 4YSJA 3GQLA 3V8TA 3DTCA 4JG8A 4CZTA 4BCFA 4I6FA 1JAMA 2W1ZA 4HYUA 4KIPA 3RK7A 3WZDA 4FV3A 4ZIMA 1UVRA 2FH9A 4AA0A 4BZNA 5CXZA 4M15A 2C0OA 4K0YA 5A4CA 2VWBA 5HLPA 3UIBA 2BMCA 4AZSA 4II5A 3BCEA 4NCTA 4IAAA 3UYTA 3FL5A 1S9IA 2ITTA 3HA8A 3GENA 5M4IA 3I81A 3HGKA 5BX0A 3Q9WA 2PK9A 3DT1A 3A8XA 4L3JA 3PG3A 4RT7A 4DFUA 4UWCA 3FAAA 4FTRA 2UW3A 4GJ2A 4QMLA 3RKBA 4AW0A 4F0FA 2PL0A 3HMOA 2YAKA 3IOKA 4RJ7A 3F3VA 2X7OA 2W5HA 2Y6MA 3OTVA 4N6ZA 4QP1A 4C59A 3M1SA 2OO8X 5J9YA 5HE0A 4O7ZA 1NW1A 4NT4A 1G8AA 2GTMA 4JJRA 3KXXA 3LHJA 4I92A 4I1ZA 4JBQA 1GAGA 4QMZA 2R3RA 3I5ZA 4NW6A 3SQQA 5AR2A 2HY0A 3TNWA 5AUTA 1RE8A 3BI6A 3ZO1A 4N57A 4BI2A 5H9BA 4H05A 3FYKX 3KRJA 3QTQA 4L3PA 4ANQA 5BNJA 1ZWSA 3BEGA 2P3GX 4GU6A 1Q8UA 4MD8E 3DKCA 3ACJA 3RGFA 3QKLA 3D7ZA 3F3WA 2ITXA 4D28A 3DQWA 3OC1A 1WAKA 4XOZA 5FTOA 4A9UA 4BC6A 4IBMA 1UU3A 1QPDA 3CS9A 4RC2A 2WTWA 2X6DA 3B8RA 3L8PA 2ZB0A 4D55A 4O81A 3DK3A 5KCVA 5HESA 2W4OA 5BPYA 4J71A 4QMVA 3G5DA 3ZRKA 3KKVA 2WMRA 4OBPA 4DGNA 5KZIA 3OWLA 3CIKA 4NSTA 5ANIA 4ZTNA 1BX6A 2YCRA 2ZOQA 3QQJA 3TZ9A 4HVHA 5B7VA 4FSTA 4EJ7A 3VBYA 3E7OA 3EQGA 4RX7A 4BZOA 4EH6A 4TW9A 3M42A 5IA1A 2HYYA 4AE6A 2FSLX 5M44A 4I4EA 4O7RA 2VWIA 4KSPA 5D1JA 2PVJA 2RG6A 2JBPA 3FE3A 3PUPA 1O9UA 3QCYA 3O8PA 3IG7A 2QOCA 4FV5A 3WE8A 1M14A 3EWHA 4L01A 4QQCA 3V8SA 3WF7A 4P7EA 3QALE 4GV1A 4MXXA 1BI8A 2HCKA 2J0JA 4QP2A 4AW1A 3CY2A 3DZOA 3K2LA 4LOQA 5L2TA 4ZMFA 4MX9A 2YFXA 1ZZ2A 2VTIA 4L6QA 5HHWA 3QFVA 4FT9A 3TZ8A 3WZUA 4LGGA 3GBZA 5AFVA 2Q0NA 3N51A 1YOLA 5HNIX 4BHZA 5KMLA 2BRBA 3NCGA 3HKOA 3NS9A 5IMXA 3LIJA 2C68A 3NNVA 2DYLA 4EZ7A 3FLNC 5KMMA 3QTRA 4BTMA 1Q4LA 1Z5MA 2EXMA 1DAWA 2J0MB 3HP2A 2JEDA 4C35A 1OITA 1ERKA 3BWJA 4LGHA 5HG5A 3HAMA 1OPLA 4R8QA 3IS5A 5KO1A 5JN2A 4DEEA 4IB5A 5IA3A 4BCQA 4GU9A 3GU8A 4FTMA 3KRXA 3Q9XA 1LEWA 3LE6A 4W4YA 5I0BA 2XK3A 4KKHA 5AR4A 3R8LA 3FPQA 4FZAB 2P4IA 4RPVA 4EKLA 4FV7A 2O63A 4YZ9A 4YHJA 5AX3A 2PHKA 4DH8A 2JKQA 5DEYA 3ODYX 4R3PA 5EW9A 3TZMA 2WQEA 3EJ1A 3FZ1A 1Q8YA 5AP7A 4E4NA 5IQCA 4GUEA 4ZSJA 2BKKA 4IC8A 3S4QA 3WF5A 4J98A 3FDNA 1SM2A 3I0OA 2O65A 3EN6A 3ZUTA 4J8NA 2YCFA 3QTWA 3GFWA 4HYIA 3CTJA 3D83A 1PKGA 3HRBA 2QCSA 3UZTA 2WAJA 4UXLA 3LFFA 5JFVA 2SRCA 2W06A 4YO6A 5HCZA 3FUPA 4AAAA 2CHLA 3OCBA 2R3QA 5A4LA 4EH2A 3ELJA 3GU7A 5AX9A 4IADA 3V5LA 3WE4A 4F9WA 2GQRA 2UUEA 2R0UA 3F7ZA 4JQ8A 3OW3A 4TKSA 5LWMA 5CF4A 3ZCLA 3Q3BA 2DS1A 3D7TA 3R1YA 2XRUA 5AM7A 2IPXA 3UIXA 2BRNA 4IXPA 3V01A 4BCIA 4Q9SA 2P0CA 5TF9A 4IAIA 4BIBA 5HTCA 5IMEA 4JX7A 3DBCA 5H8BA 2R3IA 3BRBA 1YDTE 5HO7A 1YW2A 2VRXA 3NUAA 3CQWA 5HG8A 1H26A 1OBGA 4Y73A 4X6RA 4PL5A 2A1AB 3BX5A 4RVLA 1P14A 4BKZA 3QTSA 4XRJA 3PWDA 3PE2A 4JQ7A 4DEAA 5CLPA 2Y4PA 3PIXA 3VAPA 3P23A 2XIXA 2V62A 5D12A 3GCQA 1ZMWA 2VTOA 4RWIA 2XF0A 5AP5A 4C38A 3L8SA 3KFAA 4EK4A 2QR7A 4AFEA 1V0OA 2V22A 2VWVA 3VUIA 1YXTA 4B8LA 3KMWA 1IAHA 4NJDA 4OT5A 3LCTA 4M0YA 4RIOA 4TYHB 3G51A 3QXPA 2UZTA 4O7SA 4F0GA 4F9BA 4W4WA 1WVWA 5JFWA 3H0YA 5BQ0A 1QPEA 2VX3A 4HNFA 3LLTA 4IFGA 1LR4A 3MWUA 4FF8A 5K4JA 2BROA 4XV2A 3JYAA 4L8MA 3QZHA 3ZBXA 4V01A 4MH7A 1U4DA 4FTTA 5TO8A 2OICA 1M2PA 1VR2A 5M4FA 4RIXB 3LFDA 4Q5HA 2PVKA 3RPRA 2X1NA 4OAVB 3OBGA 4NM5A 2B9FA 4OTDA 2B9IA 5AR3A 4OTFA 3ORZA 4IM2A 3H3CA 3NR9A 2X39A 3VHKA 5F20A 2OJJA 2HW6A 2YAAA 3ODZX 3IECA 3BU3A 4IJPA 1OUKA 2C69A 5T68A 3G0EA 1H1PA 2JIUA 3N4UA 2BALA 1QPJA 3P08A 4BKYA 2QQ7A 5M4UA 2VX1A 4TWOA 4P90A 4ONAA 4C34A 4DCEA 2BDFA 4I41A 2UW4A 2QC6A 4U0IA 4D2TA 3FI8A 2F7EE 3R9NA 3FLQA 3PPZA 4O6EA 1PXIA 5AJQA 2A0CX 3FMEA 3C0GA 3D2IA 4FVRA 1ZYDA 4FX3A 3ZSIA 4O0TA 3NAXA 4DLJA 3ZH8A 3ENHA 4JS8A 3BGPA 3R7OA 3MY1A 3ZO3A 5B2LA 1H01A 5LARA 3U51A 3TACA 5I9VA 5E8YA 3ORPA 4H58A 4DH3A 4QT1A 4AT4A 3TDWA 4QYHA 1PXJA 4WD5A 5L8JA 4DGGA 3Q4TA 3S3IA 3O8TA 4XNEA 3MVHA 2XIKA 2WGJA 3PIZA 2FSTX 3C51A 4ANOA 3ATSA 3UP7A 3DTWA 4R6VA 2WMVA 4FEUA 4LL0A 1M2RA 3FKNA 4W4VA 3VS7A 4AGWA 2VTJA 4RVKA 1SVEA 2O5KA 1ZARA 5CU6A 4YPDA 3I0QA 4UZHA 5HNBA 2LAVA 4YTHA 3QRTA 4I22A 4ZZOA 1GZ8A 4FKTA 4JQEA 4F6UA 4EH4A 1H08A 2ACXA 4Y95A 3DCVA 3FMDA 2BRMA 3NUSA 3THBA 4FT5A 4ACHA 5J9LA 2W1EA 3SA0A 1FINA 4UMQA 1OBDA 2O0UA 4YJRA 1JKSA 4M66A 3QXOA 4ALWA 1YVJA 3O50A 2F49A 1FGKA 2VWXA 4IJ9A 4YNEA 5IF1A
chains in the Genus database with same CATH superfamily
1OKZA 3HRFA 4CZYB 5KBRA 3KEXA 1H07A 1JSVA 2BRHA 2GFCA 3PXFA 1W83A 3UTOA 4CFNA 3CQUA 4FL3A 1V0PA 4EOMA 4O4CA 4MCVA 5TOZA 4TWPA 2C30A 5HKMA 4G1WA 4PQNA 5TT7A 1Y6AA 2WEIA 1OKVA 3EZRA 2GU8A 3MH2A 4FTIA 4OAUC 5AUZA 3CKXA 4RIWA 5HE2A 1Q8WA 2X7FA 2WFYA 3IK3A 3P7BA 4QPMA 3L9MA 4QMTA 1VJYA 2XJ1A 3NNWA 4X0MA 5HIDA 2Q0BA 2PMIA 2VN9A 3R9HA 3RWQA 4A9YA 4R7IA 2RGPA 4JRVA 1DS5A 3BL7A 4FBXA 3ZLSA 5E1EA 1YKRA 3VJOA 4WUAA 5E9EA 3FY0A 3P79A 4FJVA 1Q61A 3MFRA 2ZV9A 4O4DA 3R8UA 4FKJA 3MVJA 5HOAA 3FZOA 2J5EA 3W8QA 1W98A 5ETAA 4FKSA 2XANA 4E73A 3A61A 3LKMA 3SGCA 4FTCA 4KAOA 3UNJA 4LUEA 3NX8A 3UG1A 2B4SB 2XJ2A 4O38A 4YZMA 3QA0A 4NFNA 4GUBA 5AADA 1MRYA 3N9XA 3TNHA 4C4HA 2OZOA 4YNOA 5FXRA 3UODA 3SRVB 1JSUA 4U79A 3DLZA 3L8XA 4QRCA 5AR5A 3RPVA 2PE2A 3EOCA 4FKWA 4AXFA 5T3QA 3EKNA 3TTJA 3WIKA 3VF9A 4BCGA 4RFMA 3OD6X 1KE8A 3ZLYA 4R7HA 5IZFA 5C03A 2JFLA 5IA0A 5A54A 2C6TA 4E4XA 1J3HA 2W96B 5C26A 1Q41A 2G2IA 2WZJA 2XBJA 5EHLA 3LCKA 2HWOA 2XIZA 2WMXA 3AGLA 3IONA 4IX6A 2H96A 4PMSA 1M2QA 1NY3A 4AZFA 2C6KA 3PVUA 3BU5A 3EIDA 4GK2A 2HZ0A 4V0GB 3TUBA 5J1VA 5F9EA 3O7LD 2XKEA 1FPUA 3EQBA 3W55A 2CKQA 2I0HA 2IJMA 1ZYSA 3EN4A 3L9PA 3QF9A 4FSWA 4HOKA 4U3YA 4O0RA 1YHWA 5ACBC 2QOFA 3VS6A 4CTCA 4YMJA 4FL2A 2ITNA 3W16A 2F9GA 2O2UA 2WTVA 3IW8A 4KKEA 3HNGA 4KRCA 2X8IA 1PXOA 5IEYA 4ZY5A 5L6OA 3Q9YA 2XK9A 2C5XA 3ANQA 2WOTA 3P9JA 4FIJA 4HPUE 4MVFA 4X3FA 4TZRA 3W18A 1XKKA 4V05A 1SZMA 1CKPA 1R39A 3MJ2A 4W4XA 1S9JA 4E5BA 4FK3A 5AEPA 4WRGA 4ZY4A 2WTJA 1JQHA 1URWA 2QO7A 4O0UA 2OG8A 3CQEA 4CFFA 1CKJA 5CS6A 4K33A 2VO7A 3VUMA 3IW6A 4DTKA 2HWPA 5ITAA 4ASZA 3RNIA 1OL5A 2C5OA 4O0XA 4RJ5A 4ZLOA 5F4NA 5AIKA 4H39A 1Q24A 4FIFA 4F08A 3UIUA 4M67A 1H0WA 4L46A 4IH8A 2J0IA 4B8MA 1GIJA 3M11A 3MS9A 4ERWA 3O8UA 3DXQA 3PFYA 1UNGA 4GIIA 5CQWA 3OBJA 3UO6A 4UWYA 5HO8A 3BV2A 4D5HA 1H0VA 4USDA 3UNKA 2BAJA 4FC0A 2W4JA 4KNBA 2XB7A 3PFQA 2ITWA 4ITJA 3QC4A 1BL6A 2ITOA 2QHMA 4BCKA 4CTBA 3O5AA 1L3RE 3TT0A 4IB0A 3O23A 5CEMA 4QMMA 4EHZA 4Q9ZA 3W32A 4O7LA 3ML1A 5CZIA 3DS6A 3R8VA 1M7NA 1E1XA 1NA7A 4EI4A 1H4LA 4MHAA 3PY3A 4BDCA 2ZVAA 2C3JA 4EOOA 4H1MA 4FOBA 4M97A 4FEXA 3CGOA 4CQGA 5LWNA 3UDSA 3KRRA 4YPSA 5DPVA 1DM2A 4NCTC 2UZOA 3WILA 1ZOGA 3FQSA 4QTDA 3UOLA 4Q5EA 1R0PA 2CNQA 4IMYA 1CKIA 2LGCA 2XA4A 3TUDA 1ST0A 2YCSA 3DU8A 3EZVA 4QMYA 4ANSA 4G3DA 1R78A 3PA3A 4FODA 3W33A 4RWJA 2WTIA 5CT0A 5CQUA 4QP7A 2V55A 4YHFA 1ZMUA 2UZBA 4FUXA 5EI6A 2YCQA 2QI8A 2R3KA 2OLCA 5JGAA 1G3NA 5IQIA 4XV9A 1Q8ZA 2QKRA 4FV4A 3ANRA 4IZAA 4MTAA 4G3CA 1JNKA 2R5TA 3PSDA 4GG7A 4O0WA 4PWNA 5HO6A 4CG9A 2X9FA 1GZOA 3V3VA 5CEIA 3ZFXA 1UNHA 3LMIA 1TZDA 1YI4A 4K6ZA 3QUPA 2C47A 2X0GA 4LV7A 1OIQA 2Z8CA 5EHYA 2OW3A 1XH9A 4M0ZA 4AP7A 5BVKA 3KA0A 2PE1A 5FEEA 4JRNA 4BR3A 4F4PA 3QQGA 1X8BA 4HGSA 4QMUA 3C7QA 1XH5A 3D0EA 5CAQA 3V5TA 2HW7A 2IVVA 4IDVA 4JDJA 1W82A 3R0TA 5FUTA 2BIKB 5C01A 2WXVA 4IM3A 4G9CA 3TIYA 3QKMA 3R2BA 4MYGA 3PXZA 4A9TA 3F3UA 1G5SA 4YTIA 3PRFA 5CAOA 3E3BX 3L8VA 3I6UA 1KOAA 3R73A 4JG7A 3TI1A 4IFCA 1QPCA 4EBVA 4F99A 1ST4A 4PL3A 4QPSA 1CDKA 4XG3A 2CGWA 1YXXA 5KKRB 1OB3A 4NZWB 3D5VA 5HEZA 2VGOA 3K54A 3MTLA 1WZYA 3HAVA 1U54A 2BIYA 2EUFB 3G2FA 2YACA 2VGPA 4XCUA 5EQPA 4JIAA 4I6LA 2IO6A 1UKIA 5DMZA 4XG4A 3KF7A 2CNVA 2VWWA 4UALA 2ZM4A 1MRVA 3FHRA 4ANLA 3DBQA 4UMUA 4DG3E 5E7RA 3F82A 3WYXA 2FSOX 4CFUA 1P4FA 3GU6A 5EYMA 5HU3A 4KBAA 5K0XA 3I5NA 5M57A 4R3CA 4HVDA 4KS8A 3OTUA 3PJ1A 4QEBA 2OJGA 2QOHA 2XK6A 3QHRA 3NEWA 3PA5A 3O96A 3TNQB 3P5KA 3QWKA 5HCXA 4EHVA 4PMTA 4I21A 2XKCA 1Q62A 3QYZA 5ANGA 4CFXA 4DBXA 5AUXA 2DUVA 3P86A 5M51A 3MFSA 5IDNA 4FKLA 5H3QA 4Y5QA 1WCCA 4BB4A 1UV5A 4WG4A 5DIAA 1W2FA 3ZDIA 4E4LA 5LCKA 4IWDA 5L6WL 3TIZA 4X2KA 5DH3A 2XNNA 3DFCB 3O0GA 4XG9A 3OMVA 4FE2A 2B9HA 2CSNA 4EHEA 3RPSA 2C3KA 2FO0A 5BVFA 2YDJA 3AC5A 4C33A 4DDGA 3ZXTA 3DV3A 2W1DA 3HMNA 4LFIA 1QCFA 4D4RA 4FKQA 4LQMA 1FQ1B 2WMWA 4XLVA 4BFMA 2O64A 3GOPA 3PXKA 3NNXA 2XARA 3OROA 2WB8A 5EOLA 3R9OA 1ZY5A 4OTRA 3EFKA 2ZV2A 4U80A 3R7GA 3BYMA 4NJ3A 5DG5A 3RAIA 4YZNA 3TNIA 3ZYAA 4QMQA 2C6EA 3E7VA 3MH0A 2PULA 1FOTA 2YZLA 3VS4A 5LVLA 2BAQA 5CEPA 4EWHA 3VVHA 4ERKA 5I9XA 4Y8DA 1GOLA 4GJ3A 2V0DA 4APCA 3GCPA 4NIFA 2XKDA 4X2FA 4DE4A 2OIDA 3BU6A 3NUPA 5CSXA 4EEVA 4HYHA 2FVDA 4JVGA 4UZDA 5M55A 3UOHA 4O84A 4CKJA 4UMPA 4CT1A 4FZDB 2G01A 3CE3A 3OT8A 3LXPA 3CP9A 2UW0A 3UDTA 5EM8A 3BHTA 4X3JA 3ZM9A 4EK8A 2XNOA 3NGAA 3AXWA 5KZ0A 3W10A 2CN5A 3GC9A 3PJ3A 3PPKA 1F5QA 3GB2A 3VS3A 4CVAA 3RPOA 3PDTA 4WG3A 3S95A 5GNKA 1JLUE 5IH5A 4XS2A 2BVAA 4U9AA 4NEUA 4E93A 4U7ZA 3V5PA 2W1GA 3KK9A 3EQDA 4RVMA 3U4UA 3AC1A 1AQ1A 4FV1A 4S32A 2QOBA 3NVMB 3HV7A 4LYNA 4QTCA 3W2QA 4BBMA 2GQGA 5JT2A 1J7IA 2UVZA 4FV0A 4AOIA 2CGUA 4N0SA 3ZRMA 4DINA 3LMGA 2ITQA 3LQ5A 1U5RA 4AUAA 3NW6A 3K5UA 4MF0A 3E8NA 2HZ4A 3BZ3A 3Q52A 3Q4ZA 4EKKA 5HTBA 2R7BA 3EN9A 3SC1A 3FI4A 3C50A 2J0KA 3QQLA 4DHIB 3W8LA 5L2WA 1FBNA 3F5PA 1JKLA 5AV3A 5EI2A 4BDFA 4USFA 1W2CA 2GNHA 2UVYA 3C1XA 3R8ZA 2XNBA 4JI9A 5KMKA 3UVQA 4F7NA 1Q3WA 3AC4A 3FLYA 1XJDA 4IACA 3E62A 3LM5A 4E4MA 4HZSA 4J97A 4HVGA 3JY0A 3Q2MA 3DAEA 1JOWB 5J95A 5LVPA 3G15A 2XNEA 4AQKA 4JDHA 4ZTHA 4FZFB 5AIRA 4D1ZA 2EB2A 3E92A 3PTGA 3DNDA 4FI1A 5CVFA 5BMMA 4DH5A 5AA9A 5F1ZA 4USEA 3LJ0A 4WNKA 4YJTA 5IQAA 5E8VA 4KBKA 3EQIA 3HV5A 4O27B 1AD5A 4DLIA 5E91A 4XG6A 2GSFA 4HPTE 3BE9A 3ET7A 4O82A 4NW5A 2PMOX 5JGBA 2QOOA 4ZSLA 3E63A 3H4JA 2UZVA 3RTPA 4BTJA 1SVGA 4QO9A 1ZLTA 5ANOA 5EM6A 4AN2A 4BHNA 1VYZA 3R22A 3JPVA 4MQ1A 2YIRA 4AG8A 4YSMA 3HZTA 3LXNA 2CKPA 4HGTA 4FYNA 4AFJA 4DG0E 3DBFA 3NRMA 3QRKA 3TUCA 4R5SA 4O1PA 4DG2E 2Y6OA 1WBNA 3NFFB 1K9AA 2X81A 2GHGA 4XEYA 4GMYA 5CENA 5IQFA 5KHWA 2I40A 4OW8A 4PDSA 5JRSA 2EVAA 3JVSA 3P1AA 3MPAA 4A9SA 3SOCA 2XAOA 2VO3A 4A4OA 4F1TA 3ZEWA 5D41A 4W8EA 4AW2A 3GT8A 5FBNC 4BDDA 1O6YA 3PVGA 1MQ4A 2BHHA 2R0IA 3E8EA 2HXLA 2ZDTA 4FKOA 4RG0A 4ZP5A 2BR1A 4FG9A 4FSRA 3O7LB 3G6HA 4C2WA 4F7SA 1ZY4A 4XBRA 3AC2A 3UO4A 3KULA 3DGKA 5FTQA 3DAKA 4YURA 3UOJA 2XBAA 3KREA 3VBVA 1P4OA 2X6EA 4EH3A 3ULIA 4WOVA 2YEXA 3PVWA 3NNUA 4EQMA 4QP3A 4FKRA 3NMUF 1J1CA 4M12A 4WBBB 3ZFYA 2CGXA 2YABA 4BCHA 4LMUA 1JPAA 4CGAA 1MUOA 3W0NA 5M06A 2E9PA 3O2MA 4MNFA 4NM3A 1IG1A 1OPJA 3OFMA 3QTXA 3RAKA 5KUPA 1OGUA 3CD8A 2X2LA 2GS7A 3NCZA 4A06A 4LV8A 3AG9A 5LMKA 4CFWA 5ANKA 3RZFA 3SVVA 3A7IA 3V6RA 3MY5A 1WBWA 4M13A 5EK7A 4IW0A 3FKLA 4BDKA 4PNKA 2XVDA 1G8SA 3ENMA 4CKRA 2E2BA 3DA6A 4O6LA 3TV4A 2PVLA 4O4BB 1XBAA 4ZJIA 3H9RA 4O7TA 4FIEA 2ITYA 5JK3A 2QURA 4AW5A 3MIAA 4L43A 2ONLA 2UW6A 3UGCA 5CEKA 3KC3A 2CMWA 2UZLA 1XH8A 4BCMA 2UZDA 3EH9A 4ZJVA 2REIA 3PXQA 5C8MA 3CCNA 3HUCA 3LXKA 1H27A 4L3LA 4DEIA 5CSVA 1YWRA 3EFLA 5DFPA 4G2FA 3ZU7A 3ITZA 4AN3A 2QO2A 4F6WA 2XEYA 5HIBA 5DR2A 5IQBA 4L45A 2XKFA 5AP0A 3ZO2A 5CSPA 3ROYA 2NP8A 3BHUA 3PXRA 2PZRA 1H28A 3GU5A 1FGIA 4PDOA 3FI2A 2YM8A 4M8TA 3A7HA 1PMVA 2QOLA 1OM1A 2B52A 1L8TA 4ZS4A 2YA9A 1Q97A 1M17A 5KNJA 4AS0A 3KMUA 3MI9A 2JKOA 2WEVA 5A4EA 5EH0A 3TXOA 5K9IA 4FSZA 2OFUA 2XJ0A 3PZEA 3LXLA 1OPKA 3WZKA 1KV2A 3EL7A 3BYOA 3O51A 5AUVA 3E8CA 4OUCA 4BYIA 5AR8A 2HY81 5CNOA 3VBWA 3UDZA 4KSQA 2VD5A 3GVUA 3R7VA 2WIHA 4DH1A 2PVHA 3DLSA 4C4GA 4IANA 1G8JA 3GI3A 4EOKA 3TEIA 2X4ZA 1ZYJA 4ZZMA 2IF8A 3MTFA 4FKIA 5AP4A 3RMFA 4EUTA 3OZ6A 3VW6A 2W5BA 4BCOA 5IH6A 4NYEA 1J7LA 3U4WA 2UZUE 3DDQA 3KQ7A 4FTNA 5AAFA 3SD0A 3RBWA 3SXRA 5HG9A 4DFYA 2J51A 4YTCA 2JGZA 5D7VA 4ACDA 3QZGA 4I5PA 4TYHA 3ORTA 4M69A 2GCDA 3AOXA 5EQEA 4FGBA 2QU5A 2CNUA 1IA8A 4GT3A 5I3RA 2J2IB 3II5A 4AXCA 2C6MA 2WMTA 4DFLA 4YTFA 3FPMA 3LPBA 5HTIA 4P5QA 3LAUA 3OUNB 2R3FA 3FHIA 4AZWA 5C8NA 5GJGA 4I3ZA 4AXAA 3DJ6A 2VTPA 5FP5A 1YHVA 4ANNA 1VZOA 4RIXA 3QRUA 5CTPA 2A27A 2AC5A 5HVJA 4PDPA 2JITA 4YBJA 5CZHA 4GT5A 4X3FC 4ASXA 5LMAA 2EXEA 3HRCA 4ACMA 4FV2A 3OCSA 3OXZA 4IX4A 4QMWA 3M2WA 5CX9A 1JBPE 4ZK5A 2ITVA 2O8YA 4RGJA 3NYOA 4AZVA 1NVSA 4I23A 4RVTA 5KHXA 5KBQA 3U6JA 4E7WA 3SG8A 5GIOE 2C6DA 4FKUA 3FI3A 3IGGA 2GNFA 3OWKA 4ARKA 2KULA 3NSZA 4FSQA 5JH6A 5H2UA 4FEVA 2EU9A 3LVPA 5C4KA 3CJGA 1IA9A 2BTRA 4IC7A 5G6VA 1OKWA 2G1TA 1KE6A 3HVCA 2ITZA 4LG4A 4YUQA 3QX2A 3L1SA 3JVRA 3GP0A 3GC8A 5A4QA 3TWJA 4S34A 1B38A 4DEGA 4AOJA 4FKVA 3R6XA 5E8UA 4PMPA 4QYYA 1YXVA 4BI0A 4J99A 3NIEA 3UNZA 5FGKA 5LVNA 3QBNA 3ZOSA 2CJMA 2UZEA 3A60A 2PVNA 3LZBA 2PTKA 4YZCA 3ZC6A 4D4SA 3VRZA 4ZTLA 2NNWB 5T6KA 2PE0A 4EOJA 3U54A 3VBTA 1RQQA 3POOA 3W2CA 3IDBA 3GNIB 4IAYA 2QR8A 1RJBA 3GFEA 5KX8A 1Z57A 4GEOA 2XRWA 4QP6A 4EWQA 3H30A 4XBUA 5TKDA 3P5JC 2V7OA 3MFUA 3NLBA 3ORMA 4FTKA 3R7YA 2VTTA 2PMLX 4ZXTA 3V5WA 3DNEA 4BF2A 4CCUA 2W1FA 2OKRA 3IOPA 4E6QA 5CALA 2VTAA 3MB7A 3PSBA 4BTKA 2A2AA 3HMIA 4TYIA 3QX4A 4GSBA 4H1JA 5K3YA 4MBIA 4NKSA 1B6CB 1J1BA 1OL7A 3DDPA 1ZOEA 2J5FA 4G5PA 1PHKA 4RA4A 2AEGA 2I0YA 2PVMA 4IX5A 1OECA 4RSSA 5CAVA 3QD2B 3MSSA 3QCQA 1HCLA 5DT0A 3EKKA 4N4SA 1HOWA 2AYPA 5TE0A 2F2UA 4WT6A 3ERKA 4FV6A 4H3PA 4JXFA 5HBHA 5DT4A 3FSKA 2IW6A 2XEZA 4FG7A 3G90X 1I44A 3FZPA 4PL4A 4C62A 1TQPA 3BE2A 5DGZA 5CSHA 3GXLA 4AGUA 4UWBA 2FA2A 5IKWA 2ETRA 4G17A 4H36A 1H25A 5J9ZA 4DTBA 5AUUA 3ALNA 3PP0A 1FMKA 4CMTA 4KWPA 4A4XA 4C37A 2EWAA 2R7IA 3QQUA 4EK3A 4RZWA 4EONA 3A7GA 4WKQA 5A6OA 5A14A 4CT2A 4YR8A 5A9UA 4EOIA 4Z16A 4GL9A 5CSWA 4AT5A 4D0XA 4OR5A 4QNAA 3MDYA 5I5ZA 2ZFYA 4IDTA 4O0SA 1OL2A 3I60A 1MP8A 4FNZA 2BILB 2WELA 2XIRA 4ITHA 4CZUA 1E1VA 2YN8A 4GFGA 4O7VA 4O96A 5EM7A 3C9WA 4GH2A 3B8QA 5DLSA 1YRPA 3PIYA 5J79A 3KB7A 1IASA 4GYIA 2C6OA 3Q9ZA 2E9VA 4GT4A 4U43A 4C2VA 4C58A 4EUUA 4ZLYA 4PTGA 2WIPA 4ZSAA 2YM3A 4BL1A 4F78A 4ZTMA 3HA6A 3W0OA 3SRVA 2VNWA 2VTSA 3HL7A 3MH1A 4I93A 3ZLXA 2R2PA 3Q60A 2GNGA 4ZJJA 3OF0A 3ORKA 4ZLZA 3MBLA 2Y0AA 2YERA 4U40A 4A4LA 2ZV7A 5KE0A 4G6NA 5CF5A 1A48A 4DA5A 4Y85A 4A07A 2WQNA 3R30A 4L9IA 3NWWA 3D2KA 4F63A 4GRBA 2Z7LA 2OXDA 1T46A 2YZAA 3FC1X 3E3PA 5HX8A 5IA5A 4NL0A 3LFQA 4R7BA 2GS2A 5DEWA 4WO5A 3SW7A 5JRQA 4YHTA 4WHZA 3VF8A 3VQHA 3LW0A 4BCJA 2OU7A 3QTUA 3SXFA 3ZZEA 2VTHA 4V0GA 4O21A 4M68A 4DDIA 2I7QA 4N70A 4O86A 3G9NA 2W0JA 3FQEA 1ZYLA 2ZM3A 4I20A 3JUHA 3OEFX 3JS2A 4FTJA 2WTKC 3QA8A 4IE9A 2O3PA 4GCJA 5B2MA 4FSMA 2X0OA 2P33A 1J7UA 3MB6A 2JKMA 2RKUA 2RFNA 3OY1A 3PE1A 4DFNA 4FEWA 3QKKA 2QG5A 3QZIA 4IWOA 4U42A 2XAMA 3OOMA 2WHBA 4IVDA 3Q5IA 5I4NA 3R00A 1F0QA 3Q96A 4L44A 1YDSE 3AMBA 1V1KA 3FC2A 3L9NA 4CLJA 1BUHA 4FIHA 4IZ5A 4WSYA 2X8EA 4YLLA 3RJCA 2PSQA 3SLSA 1WBSA 2CCIA 2IZUA 4X2NA 2YIXA 4F9CA 4I0RA 3FLSA 4X3FB 4CQEA 5DN3A 4D4VA 3DXNA 3UBDA 5DBXA 2WKMA 3HX4A 4DEDA 3S2PA 3WOWA 4EOSA 4AZEA 4FYOA 3QUDA 3MFTA 2E9NA 4P2KA 4D0WA 3FYJX 5FM2A 4JIKA 5LCJA 4ANBA 3N4TA 5HLWA 2OI4X 4O91A 5DNRA 5DWRA 5AP2A 3TZ7A 3VULA 4QMXA 2X7GA 4AF3A 4CD0A 1PMEA 3R8MA 3ZM4A 2OF4A 3LFCA 3MPTA 5BVDA 1YDRE 3QYWA 4CSVA 2VUWA 2J90A 4ASDA 3KU2A 2G2HA 4YC8A 4IZYA 3TTIA 4G31A 4KIKA 3FXWA 4BDHA 2YJRA 3UOKA 1REJA 1YQJA 2C1AA 3OG7A 3NUNA 2Y4IC 4LRKA 3VO3A 2IVSA 3LCSA 5CI7A 4E26A 4BY9E 4FSNA 2JFMA 3FMNA 4Z9LA 3TKHA 4O4EA 2YLEA 2X4FA 3QQKA 3QQHA 2QVSE 3RAHA 3QLGA 5IQDA 3CD3A 1YXSA 3EQHA 2OIBA 3WF9A 5L4QA 3MVMA 3D5UA 2DWBA 4BDBA 2C5VA 5K5XA 4FNWA 3P78A 2GS6A 3AT2A 5AWMA 2QONA 4BBEA 2ESMA 1KV1A 4LL5A 3DJ5A 3C4XA 4HGEA 3W0SA 4J7BA 3C4CA 4I6HA 2B1PA 4EL9A 3BBTB 5FEQA 4QDEA 3R83A 3K5VA 3DAJA 4O0VA 2R9SA 1XQZA 3MA3A 4RZVA 5M08A 2BDJA 2JD5A 3DJ7A 2Z2WA 3QTZA 4XYFA 5IEXA 4R5YA 4IHPA 4YJSA 2YJSA 3DBEA 4L00A 2JKKA 4AU8A 3AKKA 2VV9A 3IDPA 4G34A 4Z7GA 5L6PA 3U6IA 3NUUA 4YP8A 3TCPA 4DEHA 1G8KA 4Y46A 5C27A 3SW4A 3V8WA 3MY0A 4BTFA 3COKA 2WO6A 3KF4A 5E4HA 2W4KA 2C0TA 2R3GA 1SNXA 2V7AA 3F5GA 2R64A 3FLWA 2X9EA 3F69A 3PWYA 4FT0A 4WA9A 3KGAA 5AM6A 1ZOHA 2WU7A 2BKZA 4IX3A 4NUSA 3R21A 2PZ5A 1KSWA 4NM7A 2RL5A 3MVLA 3HMPA 4K9YA 2QO9A 4MNEB 4NH1A 4EHGA 5C4LA 1ZMVA 2G2FA 1KE9A 5L3AA 4BBFA 1PKDA 3CR0A 3VUKA 4YJQA 4EORA 4MXZA 3FQHA 2H8HA 1U46A 4RRVA 3R04A 4XG2A 4XG7A 5J87A 4PPAA 1QMZA 4UY9A 3UO5A 4DFZE 2IEWA 3VUGA 2JLDA 4HGLA 3HV4A 2QOQA 4EZ5A 4GIHA 3W2OA 3BGZA 2R3NA 2W99B 4WNMA 3R9DA 5A3XA 3COIA 3SV0A 5JQ8A 3IPHA 3T3UA 1IAJA 5LVOA 4FTLA 3KXHA 2VAGA 4TY1A 3F9NA 5HBJA 3D5XA 1OGYA 4HCVA 1GNGA 3CY3A 4LUDA 4I5HA 4EH5A 4QP9A 2XM9A 4AGDA 1T45A 1MRUA 3QL8A 2XNGA 1BKXA 5KMIA 4DH7A 1YOMA 2JBOA 4IM0A 5CF8A 5FEDA 3R8PA 3HDMA 3R9RA 2YIQA 3MN3A 3RWPA 1BI7A 2GHLA 2JDOA 4QQJA 1E9HA 5EYDA 3AC3A 2VTMA 4QNYA 4OTWA 3NVKI 3W0PA 3HECA 3EB0A 4U44A 3LJ1A 3VS5A 1JKKA 2CPKE 1UU9A 2XZSA 4MD7E 3QCSA 3Q4UA 2Y7JA 4QMOA 4CYIA 1FMOE 3E93A 3ULZA 1A06A 4BJJB 3ZHPC 1OIYA 4EC8A 4WNOA 4HVIA 2PVFA 3WF8A 2Y9QA 4DCAA 4W9WA 4RX5A 4LDTA 5LMKC 2OBJA 2RF9A 2VO6A 5E8ZA 5LQFA 5HGIA 3VWAA 1H00A 1Q8TA 4QQ5A 2UW7A 5JSMA 4ZEGA 3VS2A 2YITA 3BKBA 4YLKA 1Y8GA 5IUGA 4U6RA 4R78A 2C0IA 3TV7A 2HIWA 3R7IA 5FXQA 5FDPA 4RX9A 4GYGA 3PYYA 1WBPA 4Y72A 3A4PA 2OJIA 2B9JA 2CLXA 3DBDA 4JBVA 5ANJA 3UG2A 4GS6A 4NTSA 2JAMA 2IZTA 4BGHA 2ONLC 2IVUA 3OXTA 4OTPA 5IUIA 4EOLA 2XK7A 3E87A 3E88A 4E8AA 3HDNA 2VWZA 5B2KA 4BICA 2UZWE 2VTLA 5HNGA 4DF3A 2FYSA 2NRYA 3EFWA 2HELA 1SMHA 5M4CA 1O6KA 4M3QA 3P0MA 3QHWA 5H8GA 1IEPA 5E8XA 5EOBA 4B6LA 3PXYA 1H1QA 3UZRA 3POZA 3MV5A 2F2CB 3H10A 4JT3A 4U3ZA 5JMSA 5E8TA 5IEVA 4F65A 3SX9A 2ITPA 4LM5A 5HD4A 3SDJA 2OZAA 3VS0A 3OP5A 4BKJA 3C5IA 4IZ7A 4BYJA 4MUQA 5GZ9A 1XBCA 4KKGA 2HK5A 4MD9E 4FIIA 3UQFA 2X2KA 3RI1A 2W9FB 1TQMA 3K3JA 4C3PA 3ZONA 1H1RA 4DT8A 4XLIA 4ZSEA 4IAFA 4JDIA 3H9OA 4JNWA 4MWHA 5JEBA 2OH0E 3IW5A 1KOBA 1UKHA 3R1QA 4G3GA 4RX8A 4RIYB 3ZFMA 5HORA 2X2MA 3TV6A 5GJDA 3ZDUA 2NPQA 4F64A 3R71A 4KINA 1CTPE 4B99A 4G6OA 3CKWA 4KA3A 4I0TA 1ZYCA 3QRIA 4WRSA 4CFVA 5CU0A 3ZSGA 4AT3A 5CYIA 1W7HA 4U81A 4BDIA 2HENA 1HCKA 2R4BA 3MJ1A 2PZPA 4FL1A 4K18A 5IA2A 4XV3A 4MKCA 4MXYA 5BVEA 4QTEA 3DPKA 3D15A 3B2TA 3CPCA 3ID6C 3UZPA 4FTAA 3A7JA 4CV9A 3GQIA 2IWIA 2Y4IB 2VO0A 4X7QA 4YGAA 2HZNA 1VEBA 4LRMA 5FLFA 4BDEA 4QMSA 3NYXA 5HE3A 3I1AA 4ACGA 4C7TA 3AMYA 3KMMA 4E1ZA 4Z55A 2BZHB 2XYNA 4ID7A 3WZEA