3A7GA

Human mst3 kinase
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
290
structure length
289
Chain Sequence
GLPGMQNLKADPEELFTKLEKIGKGSFGEVFKGIDNRTQKVVAIKIIDLEEAEDEIEDIQQEITVLSQCDSPYVTKYYGSYLKDTKLWIIMEYLGGGSALDLLEPGPLDETQIATILREILKGLDYLHSEKKIHRDIKAANVLLSEHGEVKLADFGVAGQLTDTQIKRNFVGTPFWMAPEVIKQSAYDSKADIWSLGITAIELARGEPPHSELHPMKVLFLIPKNNPPTLEGNYSKPLKEFVEACLNKEPSFRPTAKELLKHKFILRNAKKTSYLTELIDRYKRWKAEQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Serine/threonine kinase 24 (STE20 homolog, yeast)
publication title Structures of human MST3 kinase in complex with adenine, ADP and Mn2+.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 87
structure length 289
sequence length 290
chains with identical sequence B
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2009-09-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3a7gA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3a7gA01
3LFDA 4CGAA 3E8DA 5M56A 1OGUA 4QP7A 5FXSA 4C4EA 3G33A 3ZLXA 3VS3A 3N51A 5JGDA 2BKZA 2QG7A 3AGMA 1FOTA 2GS7A 3UC3A 2R3FA 2VWZA 5AR3A 3PLAE 5CQWA 2ITPA 1Q3WA 3GOKA 3SDJA 3FLNC 2YACA 5FBOA 3I5NA 4EK4A 5H8BA 4FTCA 5E91A 3WZEA 2OIBA 4FSQA 2OXXA 4Q5EA 3RVGA 3TJCA 1I44A 1T46A 4LG4A 4EUUA 4ASXA 4GEOA 4BI0A 3Q5IA 1PXOA 3NNWA 3VO3A 4AXAA 3MY1A 2X7FA 1KV1A 4JRVA 4U44A 5CS6A 3UIUA 1WBPA 3KMMA 2CDZA 3QZIA 4D9TA 4KIKA 4FEVA 3PPKA 1YDSE 4FKRA 2CKPA 4YJPA 4AT5A 3MBLA 2WIPA 4QQ5A 4EOLA 2HZIA 1KOBA 2UV2A 1OECA 4G1WA 2IW9A 3UPXA 2ITYA 3HMNA 3MV5A 4NU1A 5HG5A 3UJGA 5J87A 4X2FA 2BRHA 1ATPE 5E8SA 3FEGA 3NSZA 5HNBA 1YW2A 1OVEA 4AW5A 2HW6A 1SVHA 3CGFA 3MVMA 2O63A 3DXQA 3S95A 3QUEA 2A0CX 2X2MA 3AC2A 4IANA 4FOBA 3FZPA 4YTIA 3IO7A 3F5XA 2R3IA 2O64A 3CQWA 3V6RA 3UZPA 2W99B 3H0ZA 2R3LA 5A4TA 1ZMVA 2PMIA 2QKRA 4FG7A 4MQ1A 3GBZA 4QTCA 3R8PA 3KRXA 2YIRA 2X39A 3LJ1A 2OBJA 2UZBA 4UMTA 3DNDA 3K3IA 2XYNA 5ACBC 3ZRMA 1PMEA 2ETRA 1URWA 4UXQA 5E8WA 4EJNA 4QTEA 2LGCA 5I3RA 4FEUA 3TTIA 4L7SA 3DDQA 3LOKA 4ZSJA 2FGIA 3CSVA 3ZXZA 4L43A 2B55A 3MESA 2VNYA 4QP4A 4QQTA 2B53A 4H58A 4LGGA 3MIAA 5FEEA 4JVGA 4IBMA 4LOOA 1PW2A 3KFAA 2QOQA 4M67A 2FSMX 1OPKA 3RBWA 4BDFA 2ITOA 4NKAA 4TT7A 5HO6A 3FPMA 4QYYA 4G31A 3SOCA 3R2YA 5IZFA 2JKKA 4QYFA 4DEBA 3ANRA 4XS2A 2LAVA 5IF1A 1YI4A 5IQFA 3TCPA 5L8LA 1Q62A 5CENA 4KD1A 2VWUA 2UZWE 5DVRA 4BTKA 3C9WA 5JRSA 3TZMA 2IZTA 4ERWA 5LMKA 4F1TA 4C02A 4MF0A 1QPJA 2GDOA 5HVJA 3WF5A 5JGAA 4IWPA 3E3PA 4IAYA 1S9JA 2ACXA 4L45A 3MFUA 4ZSAA 3TNIA 2AYPA 2RFSA 4U9AA 1ZYSA 3W2CA 5KZ0A 4P5ZA 4BBMA 4LRMA 2R3QA 2ZDTA 5C8NA 1GIHA 3BZ3A 4IMYA 5GNKA 4Q9ZA 3ZLYA 4XH6A 3ZRLA 3A7HA 3QRKA 3MY5A 3S0OA 1K2PA 2XNNA 3QX4A 2OJ9A 3DU8A 4M13A 5EW8A 1WBNA 3ULZA 4G6OA 3DDPA 5BVWA 4AA4A 3OTVA 3PSDA 4LFIA 4NM3A 4EC9A 5HIDA 3F61A 3RALA 1VR2A 3DV3A 3ZSGA 4XP3A 5CAPA 3OMVA 4TTHB 3ZFMA 1OKZA 3FLSA 3MH2A 4FIHA 4RJ3A 5HNIX 2Z2WA 5B2LA 5KMIA 3R7GA 2OZOA 4JQEA 1H00A 3JUHA 3R28A 2H6DA 4I93A 4AG8A 5LVMA 4BDGA 4JBOA 4QP8A 5IQEA 4L68A 4RFMA 4O7LA 2GNIA 4ITIA 1DAWA 2J4ZA 4QPSA 4EHGA 2G2IA 4IH8A 1FMKA 3CEKA 2EXCX 4I5MA 1NA7A 3TNHA 3U54A 1SNXA 3C7QA 3EYGA 3FE3A 4L7FA 3PXKA 1W82A 3MJ2A 1R0PA 2VNWA 3COMA 4AT3A 3QTQA 4YC3A 4AGUA 1Z5MA 3L9PA 1J1CA 3MWUA 4EOQA 1UU9A 2XKEA 4M3QA 2RSVA 1H25A 3OW4A 4IB3A 2UZNA 4BHZA 4TWNA 1PHKA 4XOYA 3LHJA 2VTMA 3BV3A 3MPMA 3R02A 5HG7A 2ZAZA 2Z7SA 3I7CA 4QO9A 5C03A 4B8LA 4PL4A 5HICA 3H3CA 4E5BA 2W5BA 1O6YA 4U5JA 2PVKA 4YHJA 2YN8A 1FQ1B 3BLQA 3PIZA 3G15A 3IDCA 3OT8A 4ID7A 5I4NA 4RWIA 4M14A 3ZDUA 5LCKA 1H07A 5ANGA 2XCKA 2XK7A 3QLGA 2EVAA 3D7TB 1ZWSA 1P2AA 2X1NA 3IW7A 5F4NA 5AUXA 2W5HA 1DI8A 4I3ZA 5AP4A 4KIOA 4NJDA 1XBAA 3FSKA 4FTQA 4I22A 4ENYA 2W1CA 3A7JA 4DLJA 4FIJA 2XMYA 4AFEA 4BN1A 3U4WA 3E64A 5IKWA 3NCGA 2KULA 3LMGA 3D94A 5T6KA 4S31A 3LAUA 5EDRA 5A14A 3ORPA 4DEIA 4BBFA 2R3PA 4IB0A 4EH6A 5A54A 4U3ZA 3EWHA 3TNWA 1I09A 4DN5A 5DBXA 5C4LA 5HKMA 3SRVA 5CY3A 2GS2A 2H34A 2NO3A 2OH0E 4JXFA 2HELA 1YXXA 1U59A 3A8WA 5G6VA 3D9VA 1UWJA 3V51A 3R83A 2J9MA 1BI7A 3HMIA 2IZSA 2R3HA 3BEGA 3QTIA 3UC4A 3UO4A 5CU6A 5DA3A 4DCAA 5CEQA 2QOOA 4EZ7A 2QR7A 4AOJA 1OUYA 4APPA 2BZJA 2HWOA 4AN9A 4ZMFA 1KE8A 4FV7A 4K9YA 4FC0A 4LRJA 5DYJA 4QMTA 4APCA 4BTJA 1LR4A 5CANA 4BB4A 5JFXA 4C4FA 5M07A 3E3BX 4O1OA 4EI4A 2YLFA 2QLUA 4GJ3A 5DRDA 5M08A 4ZAUA 2JAMA 3NPCA 4C4JA 2R3GA 4BR3A 3BYOA 3UGCA 1OIRA 3V5QA 3O71A 5AV3A 3UOLA 2F2UA 3UIBA 4KS8A 5K4IA 4PNKA 3Q53A 3Q6UA 3Q9ZA 3QYWA 4O22A 5A4QA 2H96A 3QA0A 2YAAA 2BIKB 5M57A 2X8IA 3O8UA 4HGEA 3QGYA 2OG8A 4C4HA 1XH8A 5LCJA 2OLCA 1YOLA 4EHVA 2ITNA 1U54A 3BKBA 4OT5A 1WBOA 2YABA 4ZZNA 3HGKA 3KF4A 2W17A 4O0UA 2J5EA 2X6DA 4FNXA 5H8GA 2PPQA 2R9SA 4YC6A 3R8ZA 3VS5A 2XK3A 4AS0A 2EUFB 4NFNA 4MXCA 1ZZ2A 1ZOEA 2GNFA 4O2PA 4U7ZA 3OUNB 4AU8A 2UZDA 3S00A 3TUDA 3W2OA 3NVKI 1Y91A 3SRVB 3WIGA 4A4XA 4DFLA 2QONA 4AFJA 4MBIA 4FICA 3Q32A 2G01A 2BRGA 3A62A 4AGWA 4EL9A 1YWNA 3RTPA 4PTCA 4IVBA 2HOGA 4NM7A 5B0XA 1CKIA 4AAAA 4I4EA 4RIXA 3QF9A 2XVDA 4GH2A 2R4BA 3F3TA 3KCKA 2Y4PA 4M84A 5HG9A 5E90A 5IQIA 4CZUA 4GJ2A 2WTWA 4OBOA 4X6QC 1EH4A 3BYSA 4L6QA 2YWVA 2SRCA 5AFVA 4A9SA 2XA4A 2XK6A 4D28A 4RX7A 4Z16A 3BI6A 2XF0A 3KEXA 4X3FA 2JD5A 5IEYA 3MB6A 1PMUA 1U5QA 2REIA 3RPYA 4DT8A 3QGWA 3DJ5A 1ZMUA 4FBXA 5EKOA 1BKXA 4G6LA 3HRBA 4X2KA 3PY3A 4WG4A 4RJ8A 3QCSA 4AW2A 3C51A 3PE1A 4NH1A 3CKXA 2PK9A 1SYKA 2ZV9A 2BIYA 4D9UA 2C30A 4D4VA 4YJQA 3THBA 4F0GA 3G6HA 4IVAA 3GEQA 3UG2A 3RJCA 2EB3A 2YJRA 1H0VA 4S2ZA 4IZ7A 4JR3A 3ATSA 2ZV2A 5CZHA 4RMZA 2R3MA 4J1RA 5A6OA 3HMMA 4R3PA 3GC7A 1WVXA 1XHAA 3AMAA 3UO6A 3NS9A 5IMXA 2BUJA 3QQUA 2PE2A 3FBVA 4S34A 3GQIA 3R7UA 1JQHA 3NGAA 3HLLA 3NX8A 3QZHA 3IW5A 4IJPA 2XS0A 1MP8A 3V04A 3LCDA 3HAMA 3PJCA 4I23A 1IAJA 5LJJA 1P4FA 3EH9A 3AC1A 4C4GA 1ZOHA 2PUPA 5KHWA 5J9LA 1R1WA 4EK8A 2YAKA 2CNQA 3GU6A 2IJMA 2XKCA 2J51A 5E8TA 4N6ZA 4FZFB 1R3CA 4I6HA 4DH8A 3FI8A 2Y4IC 3I6WA 3KN6A 5K0XA 4M12A 4D1ZA 2CPKE 4CKIA 3OG7A 2CN5A 3RGFA 1PXMA 4NTSA 3UVPA 3ZHPC 2PE0A 3PJ8A 1JKTA 4I41A 5LARA 1DM2A 3AGLA 3QQKA 4JI9A 5FTQA 4RIXB 5LMAA 3W16A 4J97A 5JRQA 4ZOGA 4TYHB 2R7BA 3D2IA 5C9CA 1OKYA 2BALA 3R9HA 2GCDA 3ELJA 5C8MA 3QXPA 1ZXEA 4HVGA 4BDHA 4RIWB 4FKJA 3RM6A 2UZUE 4K0YA 5DMZA 1ZY4A 5AR2A 3JR1A 1JSVA 2FB8A 2R5TA 3P7AA 4H36A 3GT8A 2R3RA 2A19B 2WMWA 3NUUA 2C6EA 3DBCA 5CAUA 4OBQA 3AT2A 1OL6A 4I6FA 3P0MA 4V01A 5DOSA 4R7BA 4PV0A 5CAOA 3D5VA 4FI1A 5KMMA 4BIBA 4C58A 3BHUA 1Q8WA 4EH3A 1M14A 4HVDA 3DQXA 5EHYA 3DXPA 4FT5A 1ZYLA 3QA8A 1QMZA 4QMLA 2W1ZA 2R0IA 2QO9A 4L46A 4RGJA 4NJ3A 4ZLOA 4FG8A 4HYHA 4NT4A 2UZLA 3P08A 3VS4A 5EK7A 4D0WA 2VWVA 2EXEA 5KNJA 3COIA 1FGIA 2JFLA 1WVYA 4E4NA 3Q4CA 4MK0A 5EH0A 5CEPA 1XBCA 2VWIA 4LOPA 2AC5A 3D14A 3ORMA 3ACKA 3E8NA 4HYUA 4CMUA 4CVAA 3TUCA 5A46A 4D5KA 1GJOA 2WIHA 4O0XA 2R3JA 3NYXA 4JAJA 5J5SA 3QRJA 5DR9A 3DAJA 4GK3A 3BWFA 5EOBA 5E7RA 3CS9A 5ANDA 3W33A 3ZSHA 3BBWA 2BRNA 4G16A 3PG3A 4BZDA 2X8EA 3D4QA 5HI2A 2QU6A 2OI4X 2ZB1A 1J7UA 4RIOA 2IO6A 5DH3A 5CI7A 5I9VA 3MYGA 3ACJA 4EQUA 2P4IA 5AM6A 1YXTA 3A61A 3NYVA 4ALWA 4E26A 4PF4A 4DINA 2ERZE 4QP3A 4BCHA 5J8IA 3ZOSA 3FI4A 5I9YA 3ZEPA 2WTIA 2PZYA 4JL9A 3R0TA 1IR3A 2BTSA 3HAVA 3QTWA 3RMFA 3Q9YA 2QOIA 5HGIA 3MN3A 4DBXA 4FIGA 4PWNA 3IECA 4NYEA 4XG6A 5ANOA 3TG1A 4CLJA 2DYLA 4BIDA 3FY0A 4G9RA 5LVPA 4C2WA 3KY2A 3BYUA 2E9UA 2PZ5A 3GC9A 5T3QA 3O23A 5BVFA 5BUEA 1H1SA 4FK3A 4BCPA 4BHNA 4PDPA 3LFSA 5ANJA 3MA6A 3WBLA 4AW1A 5HU3A 3M42A 3KK8A 1Q61A 2Q0BA 2W1IA 4YC8A 3OCGA 4R1YA 3UOJA 4H3BA 3H9RA 5HBJA 4AN2A 1MQ4A 2XNOA 3JXWA 5FDPA 4XCUA 5HTIA 4FVRA 4CFMA 1DAYA 4XOZA 1G8SA 3MTFA 2JKOA 4IDTA 1KV2A 5E92A 2R3KA 4BKZA 5DR2A 3HECA 4XJ0A 3LCTA 5KMKA 4LMNA 3EMGA 4M15A 3SXFA 3P7CA 3OTUA 1FMOE 4UBAA 3BELA 5CTPA 4E3CA 3FXZA 2V7OA 5L8KA 2F57A 3TN8A 2C6KA 3SKCA 2GU8A 4ZSEA 4FV0A 1OI9A 3D7ZA 4AGDA 4E4XA 4XG9A 4TN6A 3COHA 3TACA 3PXFA 3VQHA 4BZOA 3NYOA 4XV3A 4R77A 3M1SA 4LMUA 1KE6A 2CKEA 3S4QA 4OTQA 3VUHA 3ID6C 1R0EA 1PRYA 4U43A 4P90A 2P2HA 4ASEA 3ORTA 4GU6A 3GU5A 4P2KA 3I81A 2BDFA 2OW3A 2FSOX 1H0WA 3AMBA 3QHWA 3DBFA 5EQYA 3ROYA 5AAGA 3H0YA 3BGPA 4UYAA 3PIYA 4ZS4A 4FSWA 4RWLA 4FYNA 2UW9A 3UNKA 4D2PA 5E8UA 2OO8X 4FTRA 5F1ZA 5C1QB 3HX4A 5HOAA 4GG5A 2CKOA 1KWPA 3CQEA 4IAKA 4RFYA 3RK7A 4FODA 2ITQA 4FK6A 1QCFA 3A60A 4FSYA 4ITHA 4J52A 1CSNA 5LMKC 2BRMA 3AG9A 4O83A 1IG1A 4IX6A 4PPBA 3DJ6A 4Q5HA 4DYMA 3SX9A 4O86A 4QRCA 2HK5A 2O0UA 3BU5A 5CEOA 2YCRA 5J7HA 2J0KA 2BHHA 4O0WA 4O7VA 1YI6A 4K11A 5I0BA 4RJ7A 2RFDA 3FI3A 3UG1A 1L8TA 4YTCA 1YHWA 5M4CA 4NW6A 3B8QA 4BCFA 3GVUA 2XNPA 3F5PA 4EH7A 3HNGA 4Z55A 2WO6A 3TM0A 2XKFA 3H9FA 3JS2A 4YJUA 1VYZA 1YOJA 3JY9A 4A06A 4BCNA 5CWZA 4E5AX 4JX7A 2OSCA 4LL0A 3FZ1A 4D4RA 2X81A 1OBDA 3AC3A 4JAIA 3KXNA 4FTLA 1UNHA 3HA8A 4BDKA 3W2QA 5EM6A 2X7GA 1W7HA 4BGQA 4CSVA 4LOQA 2QKWB 1OPLA 1UKIA 4CT2A 2O2UA 3MFSA 2FYSA 1JVPP 2XK8A 3EJ1A 1IRKA 5AUZA 4CCBA 3NUAA 4GK4A 3OCBA 2WQMA 3BLRA 5AA9A 5AV4A 1QPCA 1OL1A 3ERKA 4FMQA 1S9IA 3VAPA 4FVQA 3PVGA 5L6WL 2JKQA 1H1PA 4CFVA 3UQCA 2UZEA 3F2RA 5I9UA 4AZSA 3E62A 3QWJA 4RLKA 3DB6A 5TF9A 4F7NA 3MJ1A 1URCA 2PVJA 3CD3A 2X4ZA 4MXZA 2C5XA 3TKIA 5CALA 1GAGA 3OP5A 4MD8E 2JIIA 5BVOA 5L6PA 4DH3A 3ETAA 1Z9XA 3HYHA 3K5VA 3RAKA 4CFXA 2B9FA 4RVMA 5JZJA 5L3AA 3PVBA 4B9DA 3SGCA 2PVRA 3AXWA 4X3JA 5BVKA 5JH6A 3LFNA 4EWHA 1UVRA 4I24A 2PZRA 3G6GA 2XEZA 4X6RA 4RJ6A 4L42A 4L67A 3KVXA 4LGHA 4WNPA 3DLZA 2C68A 4I1ZA 3CTJA 3OFMA 5D1JA 1M52A 2PUNA 3OY1A 4LI5A 1JBPE 1WMKA 4EH4A 4F0FA 2X7OA 2B7AA 3WZJA 1BMKA 4H3PA 3BWJA 3BYMA 3U6IA 4JG6A 4FTMA 5HE2A 4YZCA 3OCSA 2BZHB 3ZXTA 3QUDA 5EQPA 1GOLA 1PXJA 2CCHA 3D5XA 3I5ZA 2X0GA 3Q9XA 4IW0A 5TKDA 4CZYB 4FGRA 2BVAA 4MTAA 3JPVA 3EQGA 1DI9A 5CT7A 3R21A 2WMTA 2ZV7A 3ORXA 3MGYA 4EC8A 4OAUC 4FKTA 5CXZA 2WMBA 5JK3A 5FTGA 4YZMA 4R1VA 3UOKA 3R8MA 3UOHA 3BBTB 3I0QA 5AADA 1YDRE 3ALOA 4OGRA 3TDVA 3ZONA 4QMYA 3RZFA 5IMEA 2BFXA 3NW6A 3GFWA 3LFCA 3VUMA 5AUTA 1BL7A 1PXIA 3LFEA 2IVVA 3E8CA 4FX3A 5BVEA 4EZ3A 4FOCA 1OL5A 3BRBA 3PJ1A 3R00A 2PUUA 4FZ6A 1U4DA 3F3VA 2P0CA 5DEWA 2Y4IB 1JKLA 3R7OA 3WI6A 3FLZA 5BNJA 3O8PA 2Z60A 3BPRA 3ZH8A 4O0VA 2GFCA 1BLXA 3F88A 4O7NA 3ZM4A 2XB7A 5AR7A 3FMNA 3L1SA 4M69A 2A1AB 1J91A 3UQFA 5AJQA 2W9ZB 4IAIA 3SLSA 1YHVA 3EFWA 4XG2A 4YJTA 2PL0A 3KRJA 3ZFYA 2C6DA 4N6YA 2YDIA 1TVOA 4EKKA 4CRLA 3HUCA 5AV0A 5AAEA 3I7BA 4NCTC 1A48A 1QPEA 4UB7A 2VO6A 4AUAA 4R5YA 4O84A 3R7YA 3W8QA 4B0GA 4DHFA 3U6HA 1YWRA 2VGOA 2XNGA 5DNRA 4D1SA 4FIEA 4TY1A 3VUIA 5ANIA 4HVSA 3C4CA 2ERKA 2C3IB 1ZAOA 3OXTA 3EOCA 4UZHA 3Q60A 2PYWA 3QHRA 2XBJA 3D15A 5EW9A 1Q3DA 2YM5A 5BVNA 4FZ7A 5HLPA 3IPHA 5EYCA 4CTCA 5HBEA 5GJGA 4DG2E 3QTXA 2ZJWA 4WUAA 2RFNA 4U41A 4Y73A 2BR1A 1AQ1A 3W18A 5HCYA 3FKOA 5I5ZA 3OWLA 4DAWA 2XP2A 3FL5A 4GT3A 3VUKA 4EK6A 2WMRA 4IB1A 5CVFA 4GUBA 4J96A 5HTBA 1PXPA 2G15A 4WD5A 3DXNA 1FPUA 4IM0A 1SMHA 2W4KA 4I94A 3VQUA 4ACCA 2C5YA 3PWDA 4FA2A 4LRKA 4GIHA 1TQIA 4FYOA 4DFNA 5TR6A 4DEGA 5FWKK 5IA2A 4Y5HA 3VBVA 4EQCA 3I1AA 2JAVA 5EI2A 2OU7A 1LEZA 2XK9A 3NZ0A 4DH5A 1ZOGA 5AIRA 4YZ9A 4YBJA 2QLQA 3GUBA 4ANNA 5CAVA 4ZY5A 4QD6A 4YUQA 3Q4ZA 4DEDA 4AZEA 4FT0A 5AP2A 4XV9A 4BI1A 1GIIA 2EXMA 4BFMA 5L4QA 2F7ZE 1XH7A 2JBOA 4C38A 4QMQA 5CSXA 4BWKA 4OUCA 2P3GX 3PPJA 3PP1A 3UQGA 2GHGA 4W8EA 4L9IA 3SW7A 3ZC6A 3RHXA 4QMPA 4KIKB 3EZVA 4FKVA 4EOSA 4O91A 3KK9A 4KSPA 3TWJA 2XIZA 3GP0A 3CQUA 4PPAA 4YJVA 5A3XA 3ZLWA 5CEIA 4CD0A 3ET7A 4DF3A 3OOGA 2CCIA 5DT3A 5LVOA 4M66A 4DGLC 4GCJA 2C6OA 2WMAA 5GIPE 2HW7A 2VWXA 4G17A 4YNOA 4WUNA 4A9RA 4YJOA 3HMOA 4I5HA 2VX1A 5KUPA 1PXLA 1XBBA 1LPUA 2HAKA 3GOPA 3PYYA 3BU3A 3EN7A 4BDIA 2OXYA 3UDBA 4FNZA 1JNKA 4O7YA 4K1BA 3RHKA 1BI8A 2IW6A 3EFLA 3CJGA 1CMKE 4BVUA 2PWLA 1Q4LA 2W1EA 3AT3A 3QQJA 4R6VA 2C3JA 3ZO2A 4AWIA 1OKVA 3W2RA 2YM7A 4TWCA 4CYIA 3WILA 3A4OX 2Z7RA 4FR4A 5CX9A 1NXKA 2AUHA 3WF7A 5KBRA 1PKDA 2C6IA 2BZKB 4RRVA 2ONLC 5AP1A 4J8NA 1LEWA 4R78A 2H9VA 3AD4A 3HMPA 4NM0A 5AP7A 4C0TA 3V01A 3ATTA 3QD0A 4B7TA 4CFNA 2QOCA 2F2CB 2XIKA 3NNXA 3O2MA 3PJ3A 3R9OA 3SXSA 5JGBA 2IN6A 3QTSA 4PDYA 2I1MA 4UY9A 4RX5A 2F9GA 5C26A 4MBJA 5H2UA 3SQQA 4F9BA 3LLAA 4BWPA 3OWPA 1SM2A 1VYWA 2PMOX 1IASA 5HEZA 4MXAA 3MB7A 2XK4A 5EG3A 4DGMA 4FUYA 3BU6A 3UO5A 5KCVA 4QYHA 2GTMA 4W8DA 3F2AA 4YPSA 5JT2A 3R8VA 3TNQB 4ZTRA 4PMTA 2YM3A 3ROCA 4CFUA 2I6LA 5HLNA 5AIKA 4W4YA 1A9UA 4NIFA 3QCXA 4GUEA 1X8BA 4IQ6A 4JNWA 5J5TA 1OITA 5K9IA 4R5SA 4RZVA 5HESA 3GENA 4RIYA 4KWPA 4CNHA 3D0EA 4GIIA 4KA3A 3Q5ZA 3MVJA 3PXQA 1H26A 2XZSA 3A4PA 1ZRZA 4LUDA 4DT9A 4KBAA 3LQ8A 3RCDA 3VS1A 2IWIA 3ORIA 3G0FA 3P78A 3L8PA 4GSBA 4P5QA 5A4EA 5DRBA 5I9XA 3KRWA 3VRZA 2BMCA 5HE0A 4ANMA 4F9WA 4V0GA 4F6WA 2ZM3A 3LLTA 5DEYA 2JDOA 3I60A 5AWMA 3LFAA 2X2KA 4EK5A 3FAAA 3CGOA 2J0JA 2FH9A 1PKGA 4HVHA 2WELA 4XNEA 2PTKA 3OZ6A 4YU2A 4D4YA 2XYUA 3QQGA 2Z7QA 3R71A 4L00A 5AP3A 2JDVA 4ACDA 4KUJA 1NVRA 5IA3A 3ZRKA 3H4JA 4IM2A 4AP7A 3NMUF 3GCSA 3Q4TA 5KO1A 2WKMA 3OY3A 3KCFA 3PUPA 3VF8A 4OTIA 3MVHA 4DG3E 2JIUA 3IGOA 3EN6A 4FTUA 4C2VA 4JT3A 1FVTA 2VRXA 4PUZA 1JSUA 3AC5A 3R9NA 1K3AA 4O6EA 4JDHA 4Y83A 4ZIMA 4ORKA 4KNBA 4RVKA 5CSWA 3NLBA 5BX0A 2HWPA 2OFUA 4EWQA 5D7AA 4W4XA 3B2WA 3NNUA 2HZ0A 5AP0A 4F6UA 5K5XA 3IQ7A 3FHRA 2C5VA 2OICA 2VU3A 1NW1A 4WNMA 2YIQA 3DBQA 4PL3A 3ENMA 4FKQA 2J6MA 4JR7A 4X21A 3FWQA 4IDVA 3E92A 4KKEA 4PP9A 3DKOA 3ORKA 3NVMB 2QR8A 5AM7A 1JWHA 2OJGA 3PXRA 3CIKA 1QL6A 3REPA 4MYGA 5C8KA 4MAOA 3FMDA 4KIPA 4BZNA 1HCKA 4FKLA 4FKOA 4GFOA 4A7CA 5CF8A 4JDJA 2WD1A 4C4IA 1WBTA 3HRCA 2C5OA 4E5WA 3PE2A 4A9TA 3PWYA 4MQ2A 4UALA 5EI8A 5HVKA 3FYKX 5ACKA 2ZMCA 5AR5A 4MH7A 4DLIA 1M7NA 4YNEA 1WBWA 4IZAA 2OWBA 4JLCA 4HW7A 5IQCA 2C0TA 2HXLA 3GU7A 5HG8A 3EN9A 4U8ZA 3L9MA 4BIEA 4EH9A 4FV4A 3TDWA 4OBPA 1CTPE 2WFYA 3VWAA 4RLLA 2WOTA 4F08A 3EQIA 4PRJA 3BHTA 4Z3VA 3V3VA 4L3LA 2YIXA 3SAYA 4RBLA 4J98A 4RQKA 1GZ8A 4AE6A 5IH5A 3TV6A 1OMWA 4BYJA 5CF5A 2G9XA 4L44A 4AF3A 5CF4A 4UZDA 4ZTHA 1V1KA 1RW8A 5KHXA 1CKJA 3Q96A 4NFMA 2QU5A 3SG8A 5EKNA 2WMSA 5EDPA 3DNEA 2C5NA 3WYYA 2F49A 3QUPA 1PYEA 3NEWA 4F7JA 4TNDA 4EYJA 5FRIA 2CN8A 2GNHA 2RFEA 1MQBA 4YSMA 4O7WA 3NAYA 4WO5A 3TNPC 3DK3A 2H8HA 3MFRA 3QTZA 5FEDA 3OEZA 4DH7A 3C4XA 3R7EA 3K5UA 2YEXA 4F1MA 4DCEA 4RWKA 3VUTA 4QMNA 1XWSA 3SV0A 3BE9A 4G5PA 3FXWA 4U0IA 3TJDA 3ZO4A 4G3DA 4BICA 4BKJA 4MCVA 1SVGA 4I21A 4U6RA 1YOMA 4TWPA 2GSFA 3NDMA 4USEA 2B1PA 4D5HA 4MNEA 4MBLA 3VRYA 3E87A 3N4UA 1H1WA 3LJ2A 2YERA 5AUYA 2BILB 4BDAA 4CV8A 1DS5A 3I6UA 4BL1A 2VX3A 2PVNA 3G9LX 5DHJA 5L8JA 5AR8A 5J9ZA 5L2TA 5K0KA 2ETKA 4G3FA 1U54B 4KKGA 3RK9A 2E9OA 4ACHA 4ASZA 4MXOA 2OFVA 3PXZA 3WARA 1GZOA 4GKHA 2CGXA 3ORNA 2B9HA 4QMZA 1OB3A 4KRDA 3BV2A 4GVAA 2C47A 5B2MA 4TRLA 5FUTA 4A4LA 4UWYA 2QG5A 2HXQA 2I40A 3R1QA 4GYIA 2C1AA 4DFUA 2BFYA 4YTHA 3ZUUA 4MKCA 5AX9A 2C6MA 4DGOA 5I9WA 3Q2JA 2JITA 1Q24A 1YXVA 3L8SA 4QYGA 1M17A 2CLXA 3N9XA 5CT0A 1ZZLA 2XRWA 3LE6A 3KC3A 4I0RA 4NZWB 5GJFA 3PLSA 4MVFA 3BGZA 3RM7A 3U87A 3R63A 3P4KA 3FV8A 3QCQA 4X0MA 1WBSA 2UW0A 1HCLA 4CV9A 4RJ5A 3WZUA 4E6CA 2Y9QA 3LZBA 2PY3A 2UZTA 1L3RE 3G5DA 3EL8A 1O9UA 3KA0A 4G34A 1P5EA 3TIZA 4B4LA 4IFGA 4X3FB 5FXQA 3LFFA 1JAMA 3O17A 2RF9A 2VTOA 4PNIA 2XUUA 4EOKA 2FUMA 2ITUA 4E6QA 2O8YA 3SOAA 3R7IA 2C0OA 5M4UA 4UWBA 1XQZA 1FVVA 2DWBA 1APME 3AT4A 4YBKA 3UVQA 3WIKA 2WQBA 5A4CA 3FZOA 2BKKA 1UNLA 2EWAA 2QOKA 3V8TA 3TKHA 2PMNX 3DKCA 4OW8A 1Q8ZA 3DFAA 4OR5A 2VGPA 4HPUE 4QMUA 4QMSA 4C8BA 1ZARA 3CPCA 5BPYA 4BBEA 3QRUA 3UYTA 1TKIA 3WZDA 4XV1A 3CTHA 3KRRA 4E1ZA 3P23A 3KL8A 2YJSA 3TZ9A 4DTBA 3LM0A 3ZU7A 2WTJA 2EU9A 3W2SA 4M0ZA 4CKJA 2WMUA 4D55A 2GQGA 3EN5A 2F7EE 2QC6A 3MPTA 3U8WA 3UBDA 4F70A 5FXRA 5IUGA 3QLFA 1VJYA 2V0DA 3WF6A 1XO2B 1YDTE 3QC4A 3OWKA 3QWKA 5HZNA 2PVLA 4KABA 2R2PA 2W05A 3QZGA 4XRLA 4FKUA 5IISA 2GQSA 2BCJA 3RK5A 4O0YA 4DE4A 4FZDB 3F3UA 4JX3A 4Q2AA 4U42A 5KBQA 2J0MB 4D2VA 1SZMA 3D83A 4N57A 4PQNA 2HCKA 4E4LA 4CMOA 4O21A 5HIEA 1PJKA 4BCQA 2X8DA 4UWCA 4A4OA 1WVWA 3FC2A 5K5NA 4BDEA 3DBEA 3MY0A 3CR0A 3VJOA 4QTBA 3MH1A 2OJFE 2W1HA 3D2KA 3FMLA 3LXNA 2B4SB 4C37A 3QBNA 4UMQA 5DFPA 5CEMA 1UWHA 1OL7A 4U79A 5ITAA 4XG3A 3G9NA 2W1DA 1T45A 3C4FA 4WBBB 3T9IA 4ACMA 5IQAA 5HBHA 5BYZA 3T8OA 2OJJA 5EHOA 4EORA 3IDBA 3OUKA 3NUNA 4O0SA 2C0IA 5KE0A 4IWQA 4EONA 2GQRA 3KREA 3TIYA 4N0SA 4DFBA 2IVSA 4R7IA 4ZZMA 3UVRA 3LXPA 3S1HA 4ZP5A 4JRNA 4H3QA 4H1MA 4X2NA 5F94A 3HP2A 2YCFA 3VF9A 2AC3A 4CG9A 3CTQA 2VTTA 2A4LA 5KMLA 2QOHA 4L8MA 4AX8A 4D2TA 4AZFA 1Q41A 2YIWA 3EFJA 3FYJX 4JJRA 4TYJA 3KKVA 4WOVA 5DWRA 2WAJA 2P2IA 3EQBA 4XLVA 4IADA 3P7BA 3W8LA 2PSQA 1KE7A 5FQDC 4QYEA 5A4LA 5DI1A 3N4VA 2YM6A 1E1XA 4R3CA 3CJFA 4E93A 1UA2A 4HZRA 3NIEA 4DFZE 5IDNA 2XNMA 3ODYX 3PXYA 3D5UA 1K9AA 3IDPA 3ZO1A 4QPMA 2BROA 3W10A 4O7ZA 3CC6A 4FV2A 4L3PA 4C34A 2WOUA 4NTTA 4QQCA 4EH5A 4WBOA 3VS6A 2WEVA 3RNIA 3BX5A 1JPAA 1H4LA 3EFKA 3F6XA 3V5JA 1XH5A 3TKUA 4H05A 4WSYA 5D10A 5TE0A 2WPAA 3ENHA 4FKSA 2UVXA 3AC8A 3N4TA 3II5A 3LFBA 2O3PA 2P55A 4U45A 1O6KA 2WHBA 3Q3BA 2I0VA 4F63A 5C4KA 3F7ZA 4O82A 3ZM9A 4JG7A 4E4MA 4XP2A 2RL5A 2XM9A 2GHLA 4WT6A 4JBPA 5DN3A 3UIMA 4YR8A 3F66A 3O50A 4NEUA 5J7BA 3RPVA 2DUVA 3PZEA 3C4WA 3VS0A 4XG7A 5D9HA 4XMOA 1LP4A 2PVYA 3R22A 4Y95A 4USFA 4U3YA 4BCIA 3PPZA 4V05A 3U6JA 1Q8UA 2JDSA 3R6XA 5BMMA 2BRBA 3FMMA 4YZBA 3ORLA 3ZCLA 1NY3A 3S2PA 5IU2A 2RKUA 4PX6A 5FP5A 4F7LA 3LPBA 1RQQA 3UYSA 5D11A 1STCE 3WZKA 3QALE 3OROA 4AACA 4DEAA 3EB0A 4JQ8A 3PA4A 3F5UA 3UNJA 1RE8A 3ODZX 3V5WA 1ND4A 2YM4A 4G6NA 5IQBA 5JQ8A 5HLWA 3ZBXA 3UP2A 3HV4A 3NIZA 1Y57A 4P4CA 2QODA 3WYXA 4QP1A 2J5FA 4YLJA 2J2IB 1PF8A 2FVDA 1REKA 3UODA 3LJ0A 4EHZA 1KE9A 4DITA 3R8LA 4C36A 3BGQA 3ZUVA 4UMPA 2GNJA 4YGAA 4W4WA 1Q5KA 4UEUA 4CQEA 5AP6A 3OBGA 3ZFXA 3NW5A 1J3HA 2QHMA 2BAKA 1MUOA 4RA4A 4MWHA 3NW7A 3L8VA 3EKKA 4GG7A 4QTDA 2CNUA 3ZMMA 2BDJA 3FLQA 3L9LA 4M7IA 3IOPA 4IACA 3SXRA 5J79A 1PY5A 4FSZA 2F7XE 3EQCA 5B7VA 5L2SA 2E2BA 4XBUA 1J1BA 1UU8A 5TOZA 2VZ6A 4PTEA 1ZYDA 3NUPA 2ETMA 2IVUA 4E8AA 3AMYA 5IQHA 1OPJA 3U4UA 4HCUA 2CSNA 3U9CA 3A99A 3VHEA 2HZNA 5F9EA 1FBNA 3SHEA 1HOWA 1Q8TA 3FKLA 4AZWA 1JLUE 3M2WA 2WQOA 3PP0A 4R3RA 2YIYA 2VTPA 2CKQA 3DT1A 2X2LA 5IH6A 3FPQA 5ICPA 1UKHA 2JEDA 3DAKA 2WMQA 3F9NA 4KSQA 4IIRA 5E1SA 4C3PA 5LWNA 3RNYA 4XG4A 3DZQA 4BCMA 5EFQA 4YTFA 3L9NA 3O7LD 4WG3A 4FT9A 3FLYA 4CZTA 3LQ5A 5IEXA 1MRUA 3A8XA 2R64A 2IPXA 1TQMA 4CMTA 4QT1A 5CZIA 3MPAA 2XH5A 3TI1A 4WNKA 3SVVA 2GPHA 3H10A 4UXLA 4F6SA 3IG7A 3OXZA 3QD3A 1XH6A 2RIOA 3R1SA 2HY0A 5I9ZA 3CY2A 4FEXA 3E93A 4HGTA 2GMXA 2YDKA 2IVTA 2JFMA 4O7SA 4RJ4A 4ZSLA 3P86A 3KU2A 3OVVA 3ZZWA 2G2HA 2Y0AA 4NWMA 5JQ5A 2E9PA 2PVFA 3QC9A 2ESMA 3DOGA 4R8QA 4O2ZA 2Y6MA 4QMOA 2NRYA 4EK3A 5KMNA 1UV5A 4FIIA 5M4FA 4PMPA 3FC1X 5E8YA 3TZ7A 4ZTNA 3FUPA 2IG7A 3UP7A 1OIYA 5D12A 2VX0A 2W7XA 1XJDA 5FM3A 4JOAA 1LUFA 5H3QA 1UU3A 3BCEA 2V55A 3HZTA 3PY1A 3FLWA 3QRIA 1ZMWA 2GTNA 5EI6A 5M55A 4BWXA 3OS3A 5DPVA 5FGKA 1M7QA 2GHMA 5IA0A 2YFXA 3UMWA 3V8WA 4AE9A 1Y8GA 4Z7GA 5IQDA 3V5PA 4XBRA 2W5AA 4O7TA 4QMMA 5DLSA 4QP2A 3O51A 3ZSIA 4B99A 2WTKC 3F69A 4FSNA 3QQHA 4C59A 4DG0E 2WMXA 4Y8DA 3KN5A 4RX9A 5HD4A 4IZYA 4ZTLA 3KXXA 4CRSA 3VUGA 4Y85A 3C0IA 2W06A 4KINA 4I0TA 4O96A 4RVTA 3W55A 4AT4A 1YXSA 5JEBA 4GS6A 3CBLA 1ZYCA 4FL1A 2PE1A 4HVIA 4O81A 2XNEA 2YISA 5CASA 3DFCB 1M2RA 4F9CA 5L2IA 3VNTA 3PJ2A 5EDQA 2YA9A 4BY9E 2VO3A 1BX6A 2YITA 3DK6A 1GZKA 5CSPA 1YXUA 1P14A 4OTFA 3QTRA 3DGKA 3OHTA 4G3GA 2OH4A 5BVDA 2DQ7X 4FTKA 4F0IA 3IS5A 4IAZA 4YPDA 5F95A 5HVYA 1H28A 3EN4A 3VC4A 5M53A 4IJ9A 3W2PA 1F5QA 2EB2A 4C3FA 1B39A 3QQFA 4WRGA 4ERKA 4TZRA 4EQMA 5JKGA 3OD6X 3MVLA 3NUXA 5ETFA 4ANOA 3MTLA 5IDPA 4ALUA 4EH8A 3EQPA 2XJ2A 3EYHA 2UUEA 4EYMA 3LMIA 3PRIA 2CGWA 2XIXA 4FTOA 2PZPA 3NWWA 4U97A 1XH9A 3HV7A 4RC4A 1GNGA 2UW5A 4EOJA 2OIQA 4FKWA 4J8MA 3V6SA 3VHKA 1JKSA 5HX6A 4CCUA 4GYGA 3U51A 2WTDA 5A9UA 3HKOA 1VZOA 4M69B 4W9WA 3ZO3A 2XRUA 1IAHA 4F65A 5L2WA 3QD4A 4X3FC 4FEQA 4G3EA 1Q99A 4I20A 5BUIA 1W84A 2OGVA 3BYVA 3P5KA 2C6LA 5CU3A 3HV6A 3RI1A 5LVLA 4I6QA 5CF6A 2JGZA 3VW8A 3AOXA 4F64A 1PYXA 2WTCA 4A9UA 3FQSA 3G2FA 2XCHA 3QKMA 1M2QA 4NL0A 4FSRA 3HDMA 4RSSA 4WHZA 4HGSA 5DR6A 4ASDA 3F3WA 3B2TA 4YHFA 3GB2A 3MDYA 4NKSA 4ARKA 4EEVA 4EJ7A 3DK7A 2VTIA 5DT4A 5AV2A 4QNAA 3WF8A 3F3ZA 1NVSA 2W96B 5CXHA 5JMSA 2OZAA 2J50A 3FL4A 3G51A 3I4BA 1W0XC 4L3JA 2P33A 2CGUA 4EOPA 4CYJA 4AOTA 3FMKA 4PY1A 5HQ0A 2W1GA 3QYZA 4PDOA 4YZDA 3RPSA 3CLYA 3V8SA 2VTJA 1JOWB 1O6LA 2BPMA 1KOAA 3GQLA 4FVPA 4JDIA 3ZEWA 3COKA 1H1QA 3IW6A 4Y46A 1Q97A 5E8VA 3GCVA 2PVHA 3O96A 3NR9A 2YLEA 3ALNA 3TEIA 4ZJIA 5J9YA 2WU7A 3PY0A 3NAXA 2CMWA 4OTHA 4GFMA 4TYGA 3GCPA 2GNGA 4FL3A 4KS7A 1Y6AA 3H30A 1BUHA 3HA6A 3R73A 4K6ZA 5LVNA 4AN3A 1QPDA 2VTSA 3D7TA 3Q2MA 2J0IA 3C13A 1V0OA 1IA8A 2JC6A 4LUEA 2HENA 4ANLA 4YO4A 4NK9A 3GFEA 4N4SA 4PPCA 2PZIA 2WMVA 3U55A 3QKKA 3POZA 4O38A 4OTGA 3CY3A 5ETIA 5L2QA 1JSTA 3DPKA 4RQVA 4FG9A 3R30A 4RZWA 4BCOA 2BHEA 4WSQA 4FNYA 4I4FA 4JBVA 3LM5A 4FEWA 2I7QA 1MRYA 3E7OA 5DE2A 2QI8A 4L52A 4NM5A 4L01A 4KBCA 3OF0A 5CI6A 3F5GA 5IA4A 4FF8A 4C3RA 1WZYA 3NCZA 3BLHA 3IW8A 4FKIA 2XKDA 3CPBA 3Q6WA 3WE8A 5EM8A 4F7SA 4DA5A 3TV4A 2X9FA 4JDKA 3TXOA 3CXWA 4D0XA 2C4GA 2RG6A 3QQLA 5KKRC 1BYGA 2HY81 3GU4A 2OZAB 2BAJA 3HRFA 2QCSA 3HL7A 2UVYA 3OEFX 3HVCA 5CQUA 3E7VA 1XKKA 5IEVA 5D7VA 1U46A 2RG5A 4FTAA 2NNWB 1KUTA 4UMRA 1W98A 4OTPA 4UX9A 4IVDA 4J99A 4J95A 3RAIA 3FZTA 4BCKA 4BKYA 4X7QA 2B52A 1OIUA 1OL2A 3C0HA 3U9NA 5HNGA 5KZIA 3JVRA 5HTCA 4LGDA 2XJ1A 2UW3A 4JBQA 4L53A 5DGZA 4FSMA 4FSTA 5CAQA 2BZIB 2KTYA 3F7WA 4TWOA 2VTRA 4ALVA 3P79A 2PUIA 3A7GA 2VN9A 4DEHA 1G5SA 5DIAA 4ZSGA 2GS6A 2VO7A 3OC1A 4FKPA 4IC7A 3TTJA 3E5AA 1OZ1A 2OF2A 3DJ7A 5HCZA 3FDNA 4FE2A 2V5QA 2R3OA 2HZ4A 4ZLYA 1V0BA 4DTAA 2YM8A 4PP7A 3O8TA 3QU0A 5GIOE 3G90X 3ULIA 3IK3A 4GKIA 3MH0A 5C01A 3TL8A 5HX8A 1FGKA 3OWJA 4OTWA 2C1BA 4C62A 3BHYA 3SW4A 5K4JA 3BIZA 3RCJA 3ZZEA 3A2CA 3F2NA 4UYNA 4BDBA 1MRVA 1SNUA 4QMVA 3PFQA 3KXMA 2QO2A 3UZTA 4FUXA 5FDXA 4RT7A 3T3VA 4DEEA 2FSTX 4JQ7A 4BCGA 4IC8A 4YMJA 3KB7A 3E8EA 4ENXA 4AQCA 3VUDA 4RC2A 4NIFB 4EOMA 4BC6A 3QX2A 2OIDA 4EUTA 4DC2A 4OLIA 3C4EA 4EZ5A 5KX8A 5C27A 4B6LA 3GCQA 3DTWA 3VULA 4RIYB 4QPAA 4FT7A 4O0RA 4F09A 4EBVA 1PMVA 1CM8A 3EL7A 4MHAA 4NUSA 2JDTA 3FY2A 1KE5A 3LQ3A 4K18A 1WFCA 4GU9A 1OM1A 3DBDA 4O1PA 4TNBA 1M2PA 3FQHA 3EKNA 3K54A 4NCTA 2C69A 3LCKA 4V0GB 2JIVA 4TPTA 5HIBA 5EYMA 2QHNA 4GT4A 4C33A 2QURA 4K2RA 4BGGA 3R9RA 1G3NA 2X9EA 3C5UA 5CLPA 4DFYA 4QNYA 2WTVA 3ORZA 5JFVA 3UIXA 3KRLA 2CGVA 4KBKA 5LQFA 1Y8YA 2B54A 2ZOQA 3QXOA 4M0YA 4YO6A 1B38A 4HYSA 1YI3A 3QCYA 5BQ0A 3CD8A 3FI2A 3VVHA 4F9AA 2W0JA 4FSUA 4UMUA 4IZ5A 1H24A 3BQRA 3UMXA 3WE4A 5E4HA 5E1EA 4LV5A 4IWOA 2QVSE 1OBGA 2XIRA 4DBNA 4QOXA 1CDKA 4FNWA 2WEIA 2WXVA 3IOKA 3EQFA 3OT3A 4IWDA 4GVJA 3VBTA 4TW9A 2V22A 4IM3A 3JVSA 5BYLA 3SG9A 5CNOA 4MD7E 1H27A 4JS8A 5CU4A 3IW4A 4FV3A 4ANSA 2ITZA 4ZY4A 3ZBFA 5J1VA 3IKAA 4RX8A 5IH4A 5IQGA 3HV5A 2XM8A 4C35A 3GC0A 4DGGA 4OAVB 1UNGA 3R8UA 2VD5A 3C0GA 4IXPA 4HPTE 1PMNA 1E9HA 4HYIA 3MFTA 4GK2A 3FHIA 5AMNA 5IA5A 2ITVA 4ZJJA 3R7VA 3W1FA 3FXXA 4WNOA 3HEGA 2QD9A 2W1FA 2C3LA 1IEPA 1ZY5A 2PU8A 2WTKB 3Q04A 2NRUA 4CTBA 4TYHA 3AC4A 2BTRA 5E8XA 2GNLA 3HDNA 3PG1A 4D2WA 2J0LA 1E1VA 4RIWA 5GZ9A 5JFSA 5ETCA 3RZBA 3DKGA 4EOIA 3GCUA 5CU0A 4GRBA 2E9NA 4NW5A 5L6OA 5KMJA 5AX3A 1F3MC 4Z9LA 3TT0A 1GZNA 3RPRA 4W9XA 4YLKA 2A27A 3ZDIA 3GGFA 4A9YA 4ZJVA 2VWWA 5HHWA 1PXKA 5HD7A 2UZVA 4WIHA 4IX3A 4EBWA 3CE3A 4J53A 3SD0A 1YQJA 1W8CA 5CSHA 3MA3A 2O5KA 4BRXA 4AOIA 2I0YA 4BDJA 5LXMA 3VBYA 5HE3A 4N70A 5EYKA 3DQWA 4JG8A 4Z7HA 4YJNA 2UZOA 4HOKA 4X2GA 5CEKA 5IG1A 2R0UA 3PDTA 2J90A 4S30A 4O7RA 3UZRA 4CG8A 4IFCA 1XR1A 2B0QA 2Z02A 2A2AA 5EOLA 1YVJA 5CYIA 4GV1A 4GW8A 4TXCA 3JYAA 4GMYA 4C7TA 1GIJA 4FV1A 4LV8A 3T9TA 4MWIA 4KB8A 5G1XA 3SC1A 4IEBA 2ZMDA 1RDQE 4O0TA 3R01A 2QQ7A 3KXZA 4WKQA 4G3CA 3TZ8A 3IGGA 2VV9A 3OW3A 4RFZA 4AA0A 5LWMA 4QTAA 4ANQA 4X2JA 4ANBA 4XHKB 3QL8A 3E88A 4I92A 3RWQA 4DTKA 2ZV8A 3KMWA 4JIKA 4LQMA 2GFSA 4YJSA 4I5PA 3MSSA 4K8AA 4FT3A 2VTQA 4USDA 2I0EA 4TKSA 1R78A 3NRMA 3QD2B 1H01A 2O65A 2ONLA 3PIXA 4E6DA 4ZTMA 3EHAA 2HIWA 2WGJA 4CKRA 5E9EA 1FVRA 3DCVA 4FZAB 4F9YA 2UW8A 4I0SA 4Y72A 4BTMA 1IA9A 4MNEB 3MIYA 5HU9A 5IA1A 3VS2A 3DLSA 3LFQA 4CLIA 4PL5A 3L8XA 3MI9A 2WU6A 2NPQA 3R1YA 3PVWA 3O7LB 4F1OA 4UN0C 2VO0A 4XX9A 4D1XA 4AZTA 3Q4UA 1F0QA 4MEDA 4RA5A 2WQNA 3R04A 1YHSA 2NP8A 4CQGA 4FTTA 5GZAA 1Y6BA 4ITJA 3V5TA 5J95A 4O27B 2YCQA 4MX9A 2VTAA 3HUBA 1WAKA 2IZUA 3LCOA 3QKLA 1R39A 4TYEA 2Z8CA 4FKGA 3DS6A 4RC3A 5H9BA 5E8ZA 5HO8A 4EOOA 4V04A 3DTCA 5DT0A 5JFWA 4ZMEA 1YWVA 3PSCA 4U80A 3ZS5A 4J71A 3GI3A 2WQEA 2VWYA 4ZLZA 2CHLA 2ZYBA 5B2KA 2G2FA 2Y8OA 3P9JA 4CFWA 4YURA 1YRPA 1B6CB 5D41A 2R3NA 4LL5A 2QOBA 2R7IA 4FTNA 3M11A 4IX4A 4ZTQA 2X6EA 4DH1A 2ITWA 2DS1A 3MW1A 3KMUA 2QOLA 4FV8A 2QO7A 3DB8A 5IPJA 2QOFA 3CKWA 3IONA 4HCTA 4PTGA 3RKBA 3TUBA 5F20A 4H39A 2V62A 4BF2A 2W9FB 3DZOA 1RJBA 2C6TA 4UV0A 2ZM4A 4OTDA 2JBPA 2CLQA 4PMMA 4RVLA 2ZVAA 3ZTXA 3PRFA 1NT2A 1KSWA 4TYIA 3KQ7A 1OIQA 1P4OA 3OBJA 4G5JA 2JKMA 2VTLA 5ETAA 4ZZOA 3A7IA 5EM5A 5M51A 4II5A 3H9OA 5EYDA 3OCTA 1ZLTA 3VBWA 3LXLA 1G8AA 2VAGA 4IB5A 4J7BA 4OTRA 1J7LA 3KXGA 4K33A 5FEQA 2YWPA 3RWPA 4D2RA 3BHVA 4JIAA 4ONAA 4YP8A 3ZUTA 2W4OA 1OUKA 2UW7A 4BYIA 5BUJA 5KKRB 4BGHA 4DGNA 1SVEA 2PVMA 4TL0A 3PSBA 3DAEA 4FTJA 3QFVA 5CU2A 4HNFA 4AA5A 2Y7JA 2XBAA 2X4FA 2ZB0A 4MF1A 3FZRA 1Z57A 5T68A 4CT1A 2PHKA 4O6LA 3VIDA 4RWJA 5HO7A 5JN2A 5GINE 2PMLX 2YZLA 2UW6A 2IW8A 3VN9A 2XNBA 2FA2A 4G9CA 3LIJA 4PDSA 3Q52A 3RP9A 4D2SA 3RINA 2E9VA 4FL2A 2VWBA 4XYFA 5EW3A 3K2LA 5K3YA 4IE9A 4MXXA 4BDDA 3RAHA 4E7WA 2B9JA 3K3JA 5CNNA 2Q0NA 3I79A 5J1WA 2YDJA 3PA5A 4XV2A 5AUVA 4FIFA 3EQHA 5IUIA 3ZC5A 4YSJA 3EQRA 2ITTA 5AAFA 3DY7A 3E63A 1U5RA 3DA6A 3QTUA 4KKHA 3NUSA 3W32A 3R1NA 4M97A 1AGWA 2FSLX 3A7FA 4KAOA 4ZY6A 5M4IA 5M06A 4XUFA 4XG8A 1PXNA 3FMEA 2ZM1A 1JKKA 3VJNA 3VS7A 3BEAA 5EQEA 5AA8A 4ZTSA 5TO8A 3FQEA 3QZFA 5BMSA 4LYNA 5JSMA 5JZNA 2I0HA 4G2FA 3UE4A 2YZAA 4RG0A 3RAWA 4R7HA 4YJRA 4AW0A 3C4ZA 3B8RA 3EQDA 3GC8A 3FMHA 5A6NA 3QRTA 2XIYA 5AUUA 4ZK5A 3PZHA 4WG5A 4YZNA 4HJOA 5GJDA 3NYNA 3R2BA 4K77A 3ITZA 4QMWA 3KVWA 4QP9A 4U40A 3AD5A 3I0OA 3VBQA 1FINA 2WB8A 3AD6A 5M09A 4OT6A 3V5LA 3WF9A 2CJMA 3FSFA 4S32A 1H1RA 3KGAA 3LVPA 3PTGA 1J7IA 4C57A 4Y5QA 3D5WA 2HYYA 2JDRA 1XH4A 5AEPA 2G1TA 2WNTA 5FTOA 2UVZA 4DFXE 3PA3A 4CFFA 5ANEA 3ZLSA 3NUYA 3LCSA 3KF7A 2BDWA 2Y6OA 4IX5A 1AD5A 3MH3A 3PVUA 4M68A 5AV1A 4BCJA 5IUHA 2BAQA 3KULA 4HGLA 2RGPA 4ACGA 4C61A 2C3KA 3S3IA 5EM7A 5AUWA 3NNVA 3CP9A 3FMJA 1BL6A 2J7TA 5HORA 3G0EA 3GXLA 4LM5A 4CEGA 1W83A 4BDCA 4H1JA 5FD2A 2PULA 3WOWA 1NVQA 5BYYA 1VEBA 3JY0A 4IAAA 3LKMA 4I6BA 5M44A 1WCCA 2OF4A 2XEYA 4E6AA 5GZ8A 4IAFA 3DKFA 5KMOA 2V7AA 3FJQE 4NSTA 5FM2A 5LOHA 4F99A 1YKRA 3VBXA 4GL9A 4XLIA 5FG8A 3C5IA 5CVGA 1REJA 3LW0A 4KRCA 5FBNC 2OJIA 4IVCA 3CCNA 1A06A 4XRJA 4ZS0A 1CKPA 2W4JA 3OOMA 2VTHA 5CSVA 4D4SA 1OKWA 3EZRA 3UNZA 4HNIA 1ZYJA 3O0GA 3F82A 5AP5A 4E20A 4FV5A 4XEYA 5AR4A 5FLFA 5TT7A 4BI2A 4AZVA 1WBVA 3KXHA 5LMBA 3ZYAA 3BE2A 3GNIB 4YLLA 2VTNA 4PMSA 4ZEGA 4EHEA 2OKRA 1H8FA 4F4PA 2FO0A 1UU7A 3EIDA 4MD9E 4D58A 4FGBA 4Q9SA 3FZSA 3BHHA 4FTIA 2B9IA 2UW4A 5EHLA 3T3UA 3POOA 4GFGA 4IHPA 4FV9A 3QAME 3FKNA 4E73A 4MNFA 2VUWA 5GHVA 4ZXTA 2CNVA 4CXAA 3RPOA 4QP6A 3VW6A 1Q8YA 3MS9A 2WZJA 4M8TA 1H08A 3C1XA 4YHTA 3SA0A 5HE1A 3TV7A 4WA9A 4WRSA 4QQJA 4FV6A 2OXDA 4EH2A 4MXYA 1TQPA 4AGCA 1ERKA 2OK1A 5DG5A 4EKLA 2JLDA 5CVHA 4B8MA 2F4JA 1GY3A 3UTOA 4A07A 2XJ0A 2ITXA 3BQCA 3KULB 4RPVA 5HCXA 3R9DA 2Z7LA 3HV3A 4GT5A 2IZRA 2QNJA 3Q9WA 4HZSA 3OXIA 3UPZA 1V0PA 3LMHA 3GU8A 4W4VA 2YCSA 2YHVA 5ANKA 4HCVA 4I5CA 3C50A 2Q83A 4U81A 5FP6A 3P1AA 4BTFA 3LXKA 3ANQA 3AQVA 4P7EA 4XP0A 5H8EA 5I3OA 2ZDUA 4KIQA 4S33A 3HP5A 4QMXA
chains in the Genus database with same CATH superfamily
3LFDA 4CGAA 3E8DA 5M56A 1OGUA 4QP7A 5FXSA 4C4EA 3G33A 3ZLXA 3VS3A 3N51A 5JGDA 2BKZA 2QG7A 3AGMA 1FOTA 2GS7A 3UC3A 2R3FA 2VWZA 5AR3A 3PLAE 2NYAA 5CQWA 2ITPA 1Q3WA 3GOKA 3SDJA 3FLNC 2YACA 5FBOA 3I5NA 4EK4A 5H8BA 4FTCA 5E91A 3WZEA 2OIBA 4FSQA 2OXXA 4Q5EA 3RVGA 3TJCA 1I44A 1T46A 4LG4A 4EUUA 4ASXA 4GEOA 4BI0A 3Q5IA 1PXOA 3NNWA 3VO3A 4AXAA 3MY1A 2X7FA 1KV1A 4JRVA 4U44A 5CS6A 3UIUA 1WBPA 3W0RA 3KMMA 2CDZA 3QZIA 4D9TA 4KIKA 4FEVA 3PPKA 1YDSE 4FKRA 2CKPA 4YJPA 4AT5A 3MBLA 2WIPA 4QQ5A 4EOLA 2HZIA 1KOBA 2UV2A 1OECA 4G1WA 2IW9A 3UPXA 2ITYA 3HMNA 3MV5A 4NU1A 5HG5A 3UJGA 5J87A 4X2FA 2BRHA 1ATPE 5E8SA 3FEGA 3NSZA 5HNBA 1YW2A 1OVEA 4AW5A 2HW6A 1SVHA 3CGFA 3MVMA 2O63A 3DXQA 3S95A 3QUEA 2A0CX 2X2MA 3AC2A 4IANA 4FOBA 3FZPA 4YTIA 3IO7A 3F5XA 2R3IA 2O64A 3CQWA 3V6RA 3UZPA 2W99B 3H0ZA 2R3LA 5A4TA 1ZMVA 2PMIA 2QKRA 4FG7A 4MQ1A 3GBZA 4QTCA 3R8PA 3KRXA 2YIRA 2X39A 3LJ1A 2OBJA 2UZBA 4UMTA 3DNDA 3K3IA 2XYNA 5ACBC 3ZRMA 1PMEA 2ETRA 1URWA 4UXQA 5E8WA 4EJNA 4QTEA 2LGCA 5I3RA 4FEUA 3TTIA 4L7SA 3DDQA 3LOKA 4ZSJA 2FGIA 3CSVA 3ZXZA 4L43A 2B55A 3MESA 2VNYA 4QP4A 4QQTA 2B53A 4H58A 4LGGA 3MIAA 5FEEA 4JVGA 4IBMA 4LOOA 1PW2A 3KFAA 2QOQA 4M67A 2FSMX 1OPKA 3RBWA 4BDFA 2ITOA 4NKAA 4TT7A 5HO6A 3FPMA 4QYYA 4G31A 3SOCA 3R2YA 5IZFA 2JKKA 4QYFA 4DEBA 3ANRA 4XS2A 2LAVA 5IF1A 1YI4A 5IQFA 3TCPA 5L8LA 1Q62A 5CENA 4KD1A 2VWUA 2UZWE 5DVRA 4BTKA 3C9WA 5JRSA 3TZMA 2IZTA 4ERWA 5LMKA 4F1TA 4C02A 4MF0A 1QPJA 2GDOA 5HVJA 3WF5A 5JGAA 4IWPA 3E3PA 4IAYA 1S9JA 2ACXA 4L45A 3MFUA 4ZSAA 3TNIA 2AYPA 2RFSA 4U9AA 1ZYSA 3W2CA 5KZ0A 4P5ZA 4BBMA 4LRMA 2R3QA 2ZDTA 5C8NA 1GIHA 3BZ3A 4IMYA 5GNKA 4Q9ZA 3ZLYA 4XH6A 3ZRLA 3A7HA 3QRKA 3MY5A 3S0OA 1K2PA 2XNNA 3QX4A 2OJ9A 3DU8A 4M13A 5EW8A 1WBNA 3ULZA 4G6OA 3DDPA 5BVWA 4AA4A 3OTVA 3PSDA 4LFIA 4NM3A 4EC9A 5HIDA 3F61A 3RALA 1VR2A 3DV3A 3ZSGA 4XP3A 5CAPA 3OMVA 4TTHB 3ZFMA 1OKZA 3FLSA 3MH2A 4FIHA 4RJ3A 5HNIX 2Z2WA 5B2LA 5KMIA 3R7GA 2OZOA 4JQEA 1H00A 3JUHA 3R28A 2H6DA 4I93A 4AG8A 5LVMA 4BDGA 4JBOA 4QP8A 5IQEA 4L68A 4RFMA 4O7LA 2GNIA 4ITIA 1DAWA 2J4ZA 4QPSA 4EHGA 2G2IA 4IH8A 1FMKA 3CEKA 4AXEA 2EXCX 4I5MA 1NA7A 3TNHA 3U54A 1SNXA 3C7QA 3EYGA 3FE3A 4L7FA 3PXKA 1W82A 3MJ2A 1R0PA 2VNWA 3COMA 4AT3A 3QTQA 4YC3A 4AGUA 1Z5MA 3L9PA 1J1CA 2IEWA 3MWUA 4EOQA 1UU9A 2XKEA 4M3QA 2RSVA 1H25A 3OW4A 4IB3A 2UZNA 4BHZA 4DDGA 4TWNA 1PHKA 4XOYA 3LHJA 2VTMA 3BV3A 3MPMA 3R02A 5HG7A 2ZAZA 2Z7SA 3I7CA 4QO9A 5C03A 4B8LA 4PL4A 5HICA 3H3CA 4E5BA 2W5BA 1O6YA 4U5JA 2PVKA 4YHJA 2YN8A 1FQ1B 3BLQA 3PIZA 3G15A 3IDCA 3OT8A 4ID7A 5I4NA 4RWIA 4M14A 3ZDUA 5LCKA 1H07A 5ANGA 2XCKA 2XK7A 3QLGA 2EVAA 3D7TB 1ZWSA 1P2AA 2X1NA 3IW7A 5F4NA 5AUXA 2W5HA 1DI8A 4I3ZA 5AP4A 4KIOA 4NJDA 1XBAA 3FSKA 4FTQA 4I22A 4ENYA 2W1CA 3A7JA 4DLJA 4FIJA 2XMYA 4AFEA 4BN1A 3U4WA 3E64A 5IKWA 3NCGA 2KULA 3LMGA 3D94A 5T6KA 4S31A 3LAUA 5EDRA 5A14A 3ORPA 4DEIA 4BBFA 2R3PA 4IB0A 4EH6A 5A54A 4U3ZA 2X0OA 3EWHA 1I09A 3TNWA 4DN5A 5DBXA 5C4LA 5HKMA 3SRVA 5CY3A 2GS2A 2H34A 2NO3A 2OH0E 4JXFA 2HELA 1YXXA 1U59A 3A8WA 5G6VA 3D9VA 1UWJA 3V51A 3R83A 2J9MA 1BI7A 3HMIA 2IZSA 2R3HA 3BEGA 3QTIA 3UC4A 3UO4A 5CU6A 5DA3A 4DCAA 5CEQA 2QOOA 4EZ7A 2QR7A 4AOJA 1OUYA 4APPA 2BZJA 2HWOA 4AN9A 4ZMFA 1KE8A 4FV7A 4K9YA 4FC0A 4LRJA 5DYJA 4QMTA 4APCA 4BTJA 1LR4A 5CANA 4BB4A 5JFXA 4C4FA 5M07A 3E3BX 4O1OA 4EI4A 2YLFA 2QLUA 4GJ3A 5DRDA 5M08A 4ZAUA 2JAMA 3NPCA 4C4JA 2R3GA 4BR3A 3BYOA 3UGCA 1OIRA 3V5QA 3O71A 5AV3A 3UOLA 2F2UA 3UIBA 4KS8A 5K4IA 4PNKA 3Q53A 3Q6UA 3Q9ZA 3QYWA 4O22A 5A4QA 2H96A 3QA0A 2YAAA 2BIKB 5M57A 2X8IA 3O8UA 4HGEA 3QGYA 2OG8A 4C4HA 1XH8A 5LCJA 2OLCA 1YOLA 4EHVA 2ITNA 1U54A 3BKBA 4OT5A 1WBOA 2YABA 4ZZNA 3HGKA 3KF4A 3NFFB 2W17A 4O0UA 2J5EA 2X6DA 4FNXA 5H8GA 2PPQA 2R9SA 4YC6A 3R8ZA 3VS5A 2XK3A 4AS0A 2EUFB 4NFNA 4MXCA 1ZZ2A 1ZOEA 2GNFA 4O2PA 4U7ZA 3OUNB 4AU8A 2UZDA 3S00A 3TUDA 3W2OA 3NVKI 1Y91A 3SRVB 3WIGA 4A4XA 4DFLA 2QONA 4AFJA 4MBIA 4FICA 3Q32A 2G01A 2BRGA 3A62A 4AGWA 4EL9A 1YWNA 3RTPA 4PTCA 4IVBA 2HOGA 4NM7A 5B0XA 1CKIA 4AAAA 4I4EA 4RIXA 3QF9A 2XVDA 4GH2A 2R4BA 3F3TA 3KCKA 2Y4PA 4M84A 5HG9A 5E90A 5IQIA 4CZUA 4GJ2A 2WTWA 3W0SA 4OBOA 4X6QC 1EH4A 3BYSA 4L6QA 2YWVA 2SRCA 5AFVA 4A9SA 2XA4A 2XK6A 4D28A 4RX7A 4Z16A 3BI6A 2XF0A 3KEXA 4X3FA 2JD5A 5IEYA 3MB6A 1PMUA 1U5QA 2REIA 3RPYA 4DT8A 3QGWA 3DJ5A 1ZMUA 4FBXA 5EKOA 1BKXA 4G6LA 3HRBA 4X2KA 3PY3A 4WG4A 4RJ8A 3QCSA 4AW2A 3C51A 3PE1A 4NH1A 3CKXA 2PK9A 1SYKA 2ZV9A 2BIYA 4D9UA 2C30A 4D4VA 4YJQA 3THBA 4F0GA 3G6HA 4IVAA 3GEQA 3UG2A 3RJCA 2EB3A 2YJRA 1H0VA 4S2ZA 4IZ7A 4JR3A 3ATSA 2ZV2A 5CZHA 4RMZA 2R3MA 1TFFA 4J1RA 5A6OA 3HMMA 4R3PA 3GC7A 1WVXA 1XHAA 3AMAA 3UO6A 3NS9A 5IMXA 2BUJA 3QQUA 2PE2A 3FBVA 4S34A 3GQIA 3R7UA 1JQHA 3NGAA 3HLLA 3NX8A 3QZHA 3IW5A 4IJPA 2XS0A 1MP8A 3V04A 3LCDA 3HAMA 3PJCA 4I23A 1IAJA 5LJJA 1P4FA 3EH9A 3AC1A 4C4GA 1ZOHA 2PUPA 5KHWA 5J9LA 1R1WA 4EK8A 2YAKA 2CNQA 3GU6A 2IJMA 2XKCA 2J51A 5E8TA 3O5AA 4N6ZA 4FZFB 1R3CA 4I6HA 4DH8A 3FI8A 2Y4IC 3I6WA 3KN6A 5K0XA 4M12A 4D1ZA 2CPKE 4CKIA 3OG7A 2CN5A 3RGFA 1PXMA 4NTSA 3UVPA 3ZHPC 2PE0A 3PJ8A 1JKTA 4I41A 5LARA 1DM2A 3AGLA 3QQKA 4JI9A 5FTQA 4RIXB 5LMAA 3W16A 4J97A 5JRQA 4ZOGA 4TYHB 2R7BA 3D2IA 5C9CA 1OKYA 2BALA 3R9HA 2GCDA 3ELJA 5C8MA 3QXPA 1ZXEA 4HVGA 4BDHA 4RIWB 4FKJA 3RM6A 2UZUE 4K0YA 5DMZA 1ZY4A 5AR2A 3JR1A 1JSVA 2FB8A 2R5TA 3P7AA 4H36A 3GT8A 2R3RA 2A19B 2WMWA 3NUUA 2C6EA 3DBCA 5CAUA 4OBQA 3AT2A 1OL6A 4I6FA 3P0MA 4V01A 5DOSA 4R7BA 4PV0A 5CAOA 3D5VA 4FI1A 5KMMA 4BIBA 4C58A 3BHUA 1Q8WA 4EH3A 1M14A 4HVDA 3DQXA 5EHYA 3DXPA 4FT5A 1ZYLA 3QA8A 1QMZA 4QMLA 2W1ZA 2R0IA 2QO9A 4L46A 4RGJA 3W0QA 4NJ3A 4ZLOA 4FG8A 4HYHA 4NT4A 2UZLA 3P08A 3VS4A 5EK7A 4D0WA 2VWVA 2EXEA 5KNJA 3COIA 1FGIA 2JFLA 1WVYA 4E4NA 3Q4CA 4MK0A 5EH0A 5CEPA 1XBCA 2VWIA 4LOPA 2AC5A 3D14A 3ORMA 3ACKA 3E8NA 4HYUA 4CMUA 4CVAA 3TUCA 5A46A 4D5KA 1GJOA 2WIHA 4O0XA 2R3JA 3NYXA 4JAJA 5J5SA 3QRJA 5DR9A 2XARA 3DAJA 4GK3A 3BWFA 5EOBA 5E7RA 3CS9A 5ANDA 3W33A 3ZSHA 3BBWA 2BRNA 4G16A 3PG3A 4BZDA 2X8EA 3D4QA 5HI2A 2QU6A 2OI4X 2ZB1A 1J7UA 4RIOA 2IO6A 5DH3A 5CI7A 5I9VA 3MYGA 3ACJA 4EQUA 2P4IA 5AM6A 1YXTA 3A61A 3NYVA 4ALWA 4E26A 4PF4A 4DINA 2ERZE 4QP3A 4BCHA 5J8IA 3ZOSA 3FI4A 5I9YA 3ZEPA 2WTIA 2PZYA 4JL9A 3R0TA 1IR3A 2BTSA 3HAVA 3QTWA 3RMFA 3Q9YA 2QOIA 5HGIA 3MN3A 4DBXA 4FIGA 4PWNA 3IECA 4NYEA 4XG6A 5ANOA 3TG1A 4CLJA 2DYLA 4BIDA 3FY0A 4G9RA 5LVPA 4C2WA 3KY2A 3BYUA 2E9UA 2PZ5A 3GC9A 5T3QA 3O23A 5BVFA 5BUEA 1H1SA 4FK3A 4BCPA 4BHNA 4PDPA 3LFSA 5ANJA 3MA6A 3WBLA 4AW1A 5HU3A 3M42A 3KK8A 4AQKA 1Q61A 2Q0BA 2W1IA 4YC8A 3OCGA 4R1YA 3UOJA 4H3BA 3H9RA 5HBJA 4AN2A 1MQ4A 2XNOA 3JXWA 5FDPA 4XCUA 5HTIA 4FVRA 4CFMA 1DAYA 4XOZA 1G8SA 3MTFA 2JKOA 4IDTA 1KV2A 5E92A 2R3KA 4BKZA 5DR2A 3HECA 4XJ0A 3LCTA 5KMKA 4LMNA 3EMGA 4M15A 2AEGA 3AKLA 3SXFA 3P7CA 3OTUA 1FMOE 4UBAA 3BELA 5CTPA 4E3CA 3FXZA 2V7OA 5L8KA 2F57A 3TN8A 2C6KA 3SKCA 2GU8A 4ZSEA 4FV0A 1OI9A 3D7ZA 4AGDA 4E4XA 4XG9A 4TN6A 3COHA 3TACA 3PXFA 3VQHA 4BZOA 3NYOA 4XV3A 4R77A 3M1SA 4LMUA 1KE6A 2CKEA 3S4QA 4OTQA 3VUHA 3ID6C 1R0EA 1PRYA 3PFYA 4U43A 4P90A 2P2HA 4ASEA 3ORTA 4GU6A 3GU5A 4P2KA 3I81A 2BDFA 2OW3A 2FSOX 1H0WA 3AMBA 3QHWA 3DBFA 5EQYA 3ROYA 5AAGA 3H0YA 3BGPA 4UYAA 3PIYA 4ZS4A 4FSWA 4RWLA 4FYNA 2UW9A 3UNKA 4D2PA 5E8UA 2OO8X 4FTRA 5F1ZA 5C1QB 3HX4A 5HOAA 4GG5A 2CKOA 1KWPA 3CQEA 4IAKA 4RFYA 3RK7A 4FODA 2ITQA 4FK6A 1QCFA 3A60A 4FSYA 4ITHA 4J52A 1CSNA 5LMKC 2BRMA 3AG9A 4O83A 1IG1A 4IX6A 4PPBA 3DJ6A 4Q5HA 4DYMA 3SX9A 4O86A 4QRCA 2HK5A 2O0UA 3BU5A 5CEOA 2YCRA 5J7HA 2J0KA 2BHHA 4O0WA 4O7VA 4MUQA 1YI6A 4K11A 5I0BA 4RJ7A 2RFDA 3FI3A 3UG1A 1L8TA 4YTCA 1YHWA 5M4CA 4NW6A 3B8QA 4BCFA 3GVUA 2XNPA 3F5PA 4EH7A 3HNGA 4Z55A 2WO6A 3TM0A 2XKFA 3H9FA 3JS2A 4YJUA 1VYZA 1YOJA 3JY9A 4A06A 4BCNA 5CWZA 4E5AX 4JX7A 2OSCA 4LL0A 3FZ1A 4D4RA 2X81A 1OBDA 3AC3A 4JAIA 3KXNA 4FTLA 1UNHA 3HA8A 4BDKA 3W2QA 5EM6A 2X7GA 1W7HA 4BGQA 4CSVA 4LOQA 2QKWB 1OPLA 1UKIA 4CT2A 2O2UA 3MFSA 2FYSA 1JVPP 2XK8A 3EJ1A 1IRKA 5AUZA 4CCBA 3NUAA 4GK4A 3OCBA 2WQMA 3BLRA 5AA9A 5AV4A 1QPCA 1OL1A 3ERKA 4FMQA 3UDSA 1S9IA 3VAPA 4FVQA 3PVGA 5L6WL 2JKQA 1H1PA 4CFVA 3UQCA 2UZEA 3F2RA 5I9UA 4AZSA 3E62A 3QWJA 4RLKA 4F78A 3DB6A 5TF9A 4F7NA 3MJ1A 1URCA 2PVJA 3CD3A 2X4ZA 4MXZA 2C5XA 3TKIA 5CALA 1GAGA 3OP5A 4MD8E 2JIIA 5BVOA 5L6PA 4DH3A 3ETAA 1Z9XA 3HYHA 3K5VA 3RAKA 4CFXA 2B9FA 4RVMA 5JZJA 5L3AA 3PVBA 4B9DA 3SGCA 2PVRA 3AXWA 4X3JA 5BVKA 5JH6A 3LFNA 4EWHA 1UVRA 4I24A 2PZRA 3G6GA 2XEZA 4X6RA 4RJ6A 4L42A 4L67A 3KVXA 4LGHA 4WNPA 3DLZA 2C68A 4I1ZA 3CTJA 3OFMA 5D1JA 1M52A 2PUNA 3OY1A 4LI5A 1JBPE 1WMKA 4EH4A 4F0FA 2X7OA 2B7AA 3WZJA 1BMKA 4H3PA 3BWJA 3BYMA 3U6IA 4JG6A 4FTMA 5HE2A 4YZCA 3OCSA 3PUFC 2BZHB 3ZXTA 3QUDA 5EQPA 1GOLA 1PXJA 2CCHA 3D5XA 3I5ZA 2AQXA 2X0GA 3Q9XA 4IW0A 5TKDA 4CZYB 4FGRA 4DHJA 2BVAA 4MTAA 3JPVA 3EQGA 1DI9A 5CT7A 3R21A 2WMTA 2ZV7A 3ORXA 3MGYA 4EC8A 4OAUC 4FKTA 5CXZA 2WMBA 5JK3A 5FTGA 4YZMA 4R1VA 3UOKA 3R8MA 3UOHA 3BBTB 3I0QA 5AADA 1YDRE 3ALOA 4OGRA 3TDVA 3ZONA 4QMYA 3RZFA 5IMEA 2BFXA 3NW6A 3GFWA 3LFCA 3VUMA 5AUTA 1BL7A 1PXIA 3LFEA 2IVVA 3E8CA 4FX3A 5BVEA 4EZ3A 4FOCA 1OL5A 3BRBA 3PJ1A 3R00A 2PUUA 4FZ6A 1U4DA 3F3VA 3VONA 2P0CA 5DEWA 2Y4IB 1JKLA 3R7OA 3WI6A 3FLZA 5BNJA 3O8PA 2Z60A 3BPRA 3ZH8A 4O0VA 2GFCA 1BLXA 3F88A 4O7NA 3ZM4A 2XB7A 5AR7A 3FMNA 3L1SA 4M69A 2A1AB 1J91A 3UQFA 5AJQA 2W9ZB 4IAIA 3SLSA 1XMLA 1YHVA 3EFWA 4XG2A 4YJTA 2PL0A 3KRJA 3ZFYA 2C6DA 4N6YA 2YDIA 1TVOA 4EKKA 4CRLA 3HUCA 5AV0A 5AAEA 3I7BA 4NCTC 1A48A 1QPEA 4UB7A 2VO6A 4AUAA 4R5YA 4O84A 3R7YA 3W8QA 4B0GA 4DHFA 3U6HA 1YWRA 2VGOA 2XNGA 5DNRA 4D1SA 4FIEA 2XANA 4TY1A 3VUIA 5ANIA 4HVSA 3C4CA 2ERKA 2C3IB 1ZAOA 3OXTA 3EOCA 4UZHA 3Q60A 2PYWA 3QHRA 2XBJA 3D15A 5EW9A 1Q3DA 2YM5A 5BVNA 4FZ7A 5HLPA 3IPHA 5EYCA 4CTCA 5HBEA 5GJGA 4DG2E 3QTXA 4AXDA 2ZJWA 4WUAA 2RFNA 4U41A 4Y73A 2BR1A 1AQ1A 3W18A 5HCYA 3FKOA 5I5ZA 3OWLA 4DAWA 2XP2A 3FL5A 4GT3A 3VUKA 3P5JC 4EK6A 2WMRA 4IB1A 5CVFA 4GUBA 4J96A 5HTBA 1PXPA 2G15A 4WD5A 3DXNA 1FPUA 4IM0A 1SMHA 2W4KA 4I94A 3VQUA 4ACCA 2C5YA 3PWDA 4FA2A 4LRKA 4GIHA 1TQIA 4FYOA 4DFNA 5TR6A 4DEGA 5FWKK 5IA2A 4Y5HA 3VBVA 4EQCA 3I1AA 2JAVA 5EI2A 2OU7A 1LEZA 2XK9A 3NZ0A 4DH5A 1ZOGA 5AIRA 4YZ9A 4YBJA 2QLQA 3GUBA 4ANNA 5CAVA 4ZY5A 4QD6A 4YUQA 3Q4ZA 4DEDA 4QDVA 4AZEA 4FT0A 5AP2A 4XV9A 4BI1A 1GIIA 2EXMA 4BFMA 5L4QA 2F7ZE 1XH7A 2JBOA 4C38A 4QMQA 5CSXA 4BWKA 4OUCA 2P3GX 3PPJA 3PP1A 3UQGA 2GHGA 4W8EA 4L9IA 3SW7A 3ZC6A 3RHXA 4QMPA 4KIKB 3EZVA 4FKVA 4EOSA 4O91A 3KK9A 4KSPA 3TWJA 2XIZA 3GP0A 3CQUA 4PPAA 4YJVA 5A3XA 3ZLWA 5CEIA 4CD0A 3ET7A 4DF3A 3OOGA 2CCIA 5DT3A 5LVOA 4M66A 4DGLC 4GCJA 2C6OA 2WMAA 5GIPE 2HW7A 2VWXA 4G17A 4O4EA 4WUNA 4YNOA 4A9RA 4YJOA 3HMOA 4I5HA 2VX1A 5KUPA 1PXLA 1XBBA 1LPUA 2HAKA 3GOPA 3PYYA 3BU3A 3EN7A 4BDIA 2OXYA 3UDBA 4FNZA 1JNKA 4O7YA 4K1BA 3RHKA 1BI8A 2IW6A 3EFLA 3CJGA 1CMKE 4BVUA 2PWLA 1Q4LA 2W1EA 3AT3A 3QQJA 4R6VA 2C3JA 3ZO2A 4AWIA 1OKVA 3W2RA 2YM7A 4TWCA 4CYIA 3WILA 3A4OX 2Z7RA 4FR4A 5CX9A 1NXKA 2AUHA 3WF7A 5KBRA 1PKDA 2C6IA 2BZKB 4RRVA 2ONLC 5AP1A 4J8NA 1LEWA 4R78A 2H9VA 3AD4A 3HMPA 4NM0A 5AP7A 4C0TA 3V01A 3ATTA 3QD0A 4B7TA 4CFNA 2QOCA 2F2CB 2XIKA 3NNXA 3O2MA 3PJ3A 3R9OA 3SXSA 5JGBA 2IN6A 3QTSA 4PDYA 2I1MA 4UY9A 4RX5A 2F9GA 5C26A 4MBJA 5H2UA 3SQQA 4F9BA 3LLAA 4BWPA 3OWPA 1SM2A 1VYWA 2PMOX 1IASA 5HEZA 4MXAA 3MB7A 2XK4A 5EG3A 4DGMA 4FUYA 3BU6A 3UO5A 5KCVA 4QYHA 2GTMA 4W8DA 3F2AA 4YPSA 5JT2A 3R8VA 3TNQB 4ZTRA 4PMTA 2YM3A 3ROCA 4CFUA 2I6LA 5HLNA 4FJVA 5AIKA 4W4YA 1A9UA 4NIFA 3QCXA 4GUEA 1X8BA 4IQ6A 4JNWA 5J5TA 1OITA 5K9IA 4R5SA 4RZVA 5HESA 3GENA 4RIYA 4KWPA 4CNHA 3D0EA 4GIIA 4KA3A 3Q5ZA 3MVJA 3PXQA 1H26A 2XZSA 3A4PA 1ZRZA 4LUDA 4DT9A 4KBAA 3LQ8A 4LV7A 3RCDA 3VS1A 2IWIA 3ORIA 3G0FA 3P78A 3L8PA 4GSBA 4P5QA 5A4EA 5DRBA 5I9XA 2XAMA 3KRWA 3VRZA 2BMCA 5HE0A 4ANMA 4F9WA 4V0GA 4F6WA 2ZM3A 3LLTA 5DEYA 2JDOA 3I60A 5AWMA 3LFAA 2X2KA 4EK5A 3FAAA 3CGOA 2J0JA 2FH9A 1PKGA 4HVHA 2WELA 4XNEA 2PTKA 3OZ6A 4YU2A 4D4YA 2XYUA 3QQGA 2Z7QA 3R71A 4L00A 5AP3A 2JDVA 4ACDA 4KUJA 1NVRA 5IA3A 4I6LA 3ZRKA 3H4JA 4IM2A 4AP7A 3NMUF 3GCSA 3Q4TA 3W0PA 5KO1A 2WKMA 3OY3A 3KCFA 3PUPA 3VF8A 4OTIA 3MVHA 4DG3E 2JIUA 3IGOA 3EN6A 4FTUA 4C2VA 4JT3A 1FVTA 2VRXA 4PUZA 1JSUA 3AC5A 3R9NA 1K3AA 4O6EA 4JDHA 4Y83A 4ZIMA 4ORKA 4KNBA 4RVKA 5CSWA 3NLBA 5BX0A 2HWPA 2OFUA 4EWQA 5D7AA 4W4XA 3B2WA 3NNUA 2HZ0A 5AP0A 4F6UA 5K5XA 3IQ7A 3FHRA 2C5VA 2OICA 2VU3A 1NW1A 4WNMA 2YIQA 3DBQA 2X0QA 4PL3A 3ENMA 4FKQA 2J6MA 4JR7A 4X21A 3FWQA 4IDVA 3E92A 4KKEA 4PP9A 3DKOA 3ORKA 3NVMB 2QR8A 5AM7A 2XALA 1JWHA 2OJGA 3PXRA 3CIKA 1QL6A 1ST0A 4QDEA 3REPA 4MYGA 5C8KA 4MAOA 3FMDA 4KIPA 4BZNA 1HCKA 4FKLA 4FKOA 4GFOA 4A7CA 5CF8A 4JDJA 2WD1A 4C4IA 1WBTA 3HRCA 2C5OA 4E5WA 3PE2A 4A9TA 3PWYA 4MQ2A 4UALA 5EI8A 5HVKA 3FYKX 5ACKA 2ZMCA 3KIOC 5AR5A 4MH7A 4DLIA 1M7NA 4YNEA 1WBWA 4IZAA 2OWBA 4JLCA 4HW7A 5IQCA 2C0TA 2HXLA 3GU7A 5HG8A 3EN9A 4U8ZA 3L9MA 4BIEA 4EH9A 4FV4A 3TDWA 4OBPA 1CTPE 2WFYA 3VWAA 4RLLA 2WOTA 4F08A 3EQIA 4PRJA 3BHTA 4Z3VA 3V3VA 4L3LA 2YIXA 3SAYA 4RBLA 4J98A 4RQKA 1GZ8A 4AE6A 5IH5A 3TV6A 1OMWA 4BYJA 5CF5A 2G9XA 4L44A 4AF3A 5CF4A 4UZDA 4ZTHA 1V1KA 1RW8A 5KHXA 1CKJA 3Q96A 4NFMA 2QU5A 3SG8A 5EKNA 2WMSA 5EDPA 3DNEA 2C5NA 3WYYA 2F49A 3QUPA 1PYEA 4FRFA 3NEWA 4F7JA 4TNDA 4EYJA 5FRIA 2CN8A 2GNHA 2RFEA 1MQBA 4YSMA 4O7WA 3NAYA 4WO5A 3TNPC 3DK3A 2H8HA 3MFRA 3QTZA 5FEDA 3OEZA 4DH7A 3C4XA 3R7EA 3K5UA 2YEXA 4F1MA 4DCEA 4RWKA 3VUTA 4QMNA 1XWSA 3SV0A 3BE9A 4G5PA 3FXWA 4U0IA 3TJDA 3ZO4A 4G3DA 4BICA 4BKJA 4MCVA 1SVGA 4I21A 4U6RA 1YOMA 4TWPA 2GSFA 3NDMA 4USEA 2B1PA 4D5HA 3UDZA 4MNEA 4MBLA 3VRYA 3E87A 3N4UA 1H1WA 3LJ2A 2YERA 5AUYA 2BILB 4BDAA 4CV8A 1DS5A 3I6UA 4BL1A 2VX3A 2PVNA 3G9LX 5DHJA 5L8JA 5AR8A 5J9ZA 5L2TA 5K0KA 2ETKA 4G3FA 1U54B 4KKGA 3RK9A 2E9OA 4ACHA 4ASZA 4MXOA 2OFVA 3PXZA 3WARA 3W0NA 1GZOA 4GKHA 2CGXA 3ORNA 2B9HA 4QMZA