3A7GA

Human mst3 kinase
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
290
structure length
289
Chain Sequence
GLPGMQNLKADPEELFTKLEKIGKGSFGEVFKGIDNRTQKVVAIKIIDLEEAEDEIEDIQQEITVLSQCDSPYVTKYYGSYLKDTKLWIIMEYLGGGSALDLLEPGPLDETQIATILREILKGLDYLHSEKKIHRDIKAANVLLSEHGEVKLADFGVAGQLTDTQIKRNFVGTPFWMAPEVIKQSAYDSKADIWSLGITAIELARGEPPHSELHPMKVLFLIPKNNPPTLEGNYSKPLKEFVEACLNKEPSFRPTAKELLKHKFILRNAKKTSYLTELIDRYKRWKAEQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Serine/threonine kinase 24 (STE20 homolog, yeast)
publication title Structures of human MST3 kinase in complex with adenine, ADP and Mn2+.
pubmed doi rcsb
source organism Homo sapiens
total genus 87
structure length 289
sequence length 290
chains with identical sequence B
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2009-09-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3a7gA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3a7gA01
4GH2A 4N6YA 3FAAA 2WD1A 2J6MA 2ITVA 3A8WA 1R0PA 2R3JA 5HLNA 4O7VA 4OTQA 5IQGA 4FG8A 3CJGA 3UMXA 4ACGA 4ZSJA 5HIBA 2Y4IB 3UTOA 3NUUA 3HVCA 4JG6A 4QTEA 4E4NA 3PLSA 4O7ZA 4CRSA 4AGWA 4MAOA 2X4ZA 3SW4A 2ITZA 1LPUA 3EYGA 2XIKA 3GVUA 3LE6A 2X4FA 2EB3A 4R1VA 4WG3A 3OTUA 5HE1A 3CR0A 3SKCA 5TF9A 4L3LA 3I0QA 4U44A 4PF4A 4QPSA 4WT6A 5D12A 3R1QA 2DUVA 4F9AA 4TL0A 3JY0A 3R0TA 4HGEA 4IDVA 1MRVA 4QP3A 1V1KA 2O0UA 5AWMA 2R3PA 5HX6A 4DYMA 3UO6A 2ETKA 1RDQE 2ZB1A 1Q61A 2WTIA 4MYGA 4ZLZA 4F63A 4DEGA 3D7TB 3ODZX 4WG5A 1XBCA 3DDPA 4YNEA 5BVWA 4CV8A 2BZIB 3HX4A 1VYZA 4JR7A 3R00A 2OK1A 4CZYB 1OKVA 1Z9XA 4MH7A 5L4QA 1KWPA 4GUBA 4P7EA 5LXMA 3W8LA 3WZDA 5CANA 4CSVA 4R3CA 4LRJA 2QO9A 4BTMA 3F61A 3HUCA 3K5VA 4DEHA 4E5WA 3ANQA 3R63A 2ZV9A 3Q04A 4YJRA 1YXUA 4HNIA 3OCSA 2FSLX 4Y8DA 2F57A 3SQQA 3P7CA 3OS3A 3HKOA 4DG3E 2XRWA 1JKLA 2YEXA 1ZRZA 2XNNA 4XYFA 2UZOA 3E3PA 1Z5MA 3WF9A 1H01A 3TV4A 1NT2A 3OOGA 4ZIMA 2OWBA 4JJRA 2PUUA 4PRJA 3TZ8A 3ZC5A 3E62A 3R04A 5FRIA 4F0FA 2ZJWA 3I7BA 4Q5EA 4UWYA 2CGWA 4Y95A 3KXMA 3MIAA 3Q2JA 5CI7A 4GCJA 3R2BA 4AN3A 2CKOA 2PUIA 4ZTLA 4E20A 1ZY5A 1Q8TA 3NIEA 5IKWA 3KF7A 3R1NA 2BAQA 5CLPA 2R4BA 1FGKA 3BLQA 2PTKA 5EW3A 3LXLA 4OBOA 4TWCA 1XH6A 2W1DA 3DV3A 3PY1A 4TYJA 3R8LA 3BELA 3RINA 4FTTA 3TUDA 4GSBA 4HVGA 4QTAA 3FPQA 1JNKA 4TPTA 3V6SA 4XNEA 3ZHPC 4GVAA 2J5EA 1YXSA 3N51A 3E8CA 3R2YA 1ZWSA 4F9BA 2BFYA 4RC4A 4FTIA 3Q9XA 3D5XA 2WOUA 5HEZA 4IZYA 4MXZA 3SD0A 4FKPA 2WFYA 3ZM9A 4KD1A 5I9VA 3ATSA 5LVNA 3NZ0A 3DB6A 4FKOA 4FR4A 4Y5HA 3JUHA 3S0OA 3ENHA 4R3RA 2A1AB 4FEXA 5HVKA 3CPCA 3GENA 5FM3A 3RHKA 3EZRA 5IQBA 5M08A 2RG6A 2PL0A 2XNGA 5JQ8A 3KRRA 4EI4A 5KKRB 4XG3A 5DVRA 4LGHA 4NKSA 5EYKA 1FVVA 1Q24A 4FC0A 4HPTE 1Q8ZA 3F82A 4I0SA 3TJDA 3NUPA 3RGFA 1XQZA 4V04A 3TWJA 3HLLA 4PMPA 1SNXA 4EHVA 5AV2A 2C6IA 5AIRA 3ZUVA 4ZTNA 3MESA 3QCYA 3W16A 3GI3A 4NFMA 4HYSA 3FC1X 5HQ0A 4IVBA 4ZZNA 5CU0A 4XG6A 1IAHA 4Y5QA 3UNZA 4PUZA 5AUVA 1IASA 1PKDA 3ZTXA 3GEQA 3M1SA 4YC6A 3VUKA 1R3CA 2OZAA 4DEIA 4L00A 5IG1A 3FZ1A 3NWWA 3D9VA 3VUHA 2RIOA 5AFVA 5E8YA 2PVFA 3ANRA 4LL0A 3JY9A 3Q53A 5M4FA 4MXAA 3NS9A 5TT7A 1FMKA 3HYHA 3LHJA 4FKLA 3AC3A 2ZM1A 4ZTRA 3LFDA 1U54B 3R28A 4CQGA 4F0IA 4W4YA 3O96A 4FTJA 3QUPA 1XHAA 4RIWA 1HCKA 4D4RA 3MH0A 4B9DA 1URWA 3TI1A 2UW0A 4AG8A 4DFYA 2VTOA 4L67A 3ACKA 2EVAA 4G6LA 4F6SA 4IWDA 4M84A 2GNJA 5ICPA 4HVSA 3VN9A 3GQIA 2NRUA 4U7ZA 1PY5A 4C36A 4H3BA 4I5CA 2GPHA 5KMOA 1J7UA 2FSOX 2GHGA 3HUBA 5K4JA 3IDPA 3QZIA 4Y46A 5DG5A 5D1JA 4RRVA 2ZDTA 1BI7A 4AA0A 4R77A 2BTRA 3W18A 1WBTA 3EH9A 4YZ9A 4ZTHA 1OIUA 2JKMA 1FGIA 2J2IB 4FT3A 4L44A 5DWRA 2OZOA 4TYIA 2C6OA 5CSHA 4WBOA 4BCFA 2BILB 5DR9A 5BVEA 4O7RA 1WFCA 2X6DA 4JXFA 2FO0A 3ZYAA 3B2TA 4GUEA 4ACCA 3SG8A 4TN6A 5L2SA 4IADA 5CENA 4UMUA 1OKWA 3NAYA 2Z2WA 2R5TA 3EKNA 4WUAA 3V6RA 2C6LA 4YUQA 4GKIA 5AIKA 1XKKA 3V01A 4OT5A 5BVNA 3FMKA 4YJQA 2QU6A 3QQKA 3U51A 2YFXA 4EOLA 5M06A 4NSTA 1S9IA 3TIZA 3PZEA 2BVAA 4KBKA 4NM7A 4ONAA 3AGLA 2EXEA 3IDCA 1H00A 3HA6A 3AC2A 3LFAA 4IDTA 2OJ9A 2BDFA 3FC2A 3WF8A 2Y7JA 4FZ6A 2XKCA 3PE2A 1YHWA 3C0IA 3F88A 4J99A 4F7SA 4N57A 2WKMA 2W17A 1KE9A 3LCDA 4IANA 5D11A 4O91A 2QU5A 2W4JA 4C8BA 4BCIA 4EORA 4TWOA 4IX5A 5KX8A 2OJIA 4E6AA 4EYMA 3DQWA 4TY1A 4EHGA 4E1ZA 5C26A 2G15A 2G2FA 2QOQA 3BGQA 3VO3A 4BCMA 3ROYA 2GFSA 1ZYLA 3DFAA 3AD4A 5IQAA 4FTMA 3DAKA 4NCTC 3G51A 4C4GA 4CTBA 4F65A 5FBNC 3U8WA 2WQOA 2QOIA 4JQ7A 5HTIA 2WTCA 3NX8A 1M7QA 4UXQA 1OPLA 3RPVA 3ATTA 4BHNA 3MW1A 1Z57A 4LMNA 2YCFA 5KCVA 3CGFA 2CJMA 4JG8A 5A14A 4N0SA 3G5DA 4DFUA 3UBDA 4I5MA 2I0YA 5FTOA 3R9DA 4C02A 3IDBA 1ZOEA 3D83A 4PTCA 2WU7A 4A9UA 4AW2A 4E3CA 3N4VA 3RAKA 5AA9A 3P86A 5AJQA 2VX0A 3D14A 3G0FA 3ORTA 4XOYA 3L1SA 4HVIA 3OXIA 3Q96A 2PULA 2UZUE 1OECA 5FXSA 4BDBA 4MD7E 3O7LD 4GIHA 3WZKA 4BIDA 4O7WA 4UEUA 2HW6A 4BCNA 3TM0A 4HYHA 5CEQA 4Z7GA 5IEVA 3BBWA 5IISA 2C30A 2UW3A 4RFMA 4FSNA 2R7IA 4O0SA 2NPQA 4YTIA 2H9VA 5K5XA 5HG9A 5M4IA 4DAWA 2W1CA 4ANOA 2I0VA 4O81A 1MUOA 4O0XA 1K2PA 5EYCA 1FVRA 3LJ1A 1DI8A 4L6QA 3DXPA 2W7XA 2JLDA 4BIEA 3IONA 3E64A 3TUBA 2VTRA 3QA0A 4FGRA 4YJSA 2VU3A 4XHKB 4F9WA 2IVSA 3ZBFA 4CMUA 4QMPA 1OM1A 4FF8A 5EOLA 5HBEA 5M56A 4MX9A 4FSYA 2W5AA 3BYMA 4CZTA 3KREA 5E9EA 1KUTA 2OIDA 3R9RA 4OBPA 2HZ4A 4R8QA 4RX8A 4CKJA 5LOHA 4ZS0A 3Q4ZA 1K3AA 2R0IA 5DE2A 3ET7A 3KXZA 3NNUA 3UQGA 3UPXA 3QRUA 4YHFA 3ROCA 3QCXA 4GFGA 4XH6A 2G2IA 5C27A 1UWHA 5KMJA 4IC8A 4QMNA 1UKIA 3QQHA 2Y6OA 4CFWA 3S95A 4RX5A 5JQ5A 2P2IA 4RX7A 3R7IA 2AC3A 4YGAA 1ZY4A 2W99B 5A4TA 2YABA 3VBXA 4U9AA 4GJ3A 2O2UA 4NTTA 4IAYA 5KZIA 4GL9A 3UJGA 4DTKA 5JGDA 4GU6A 2PVKA 2PZPA 3ZEPA 4O96A 4D9UA 5F9EA 4F6UA 1GZ8A 2GTNA 3EL8A 2BMCA 3HGKA 1O6YA 4DEBA 5M57A 2B0QA 1U59A 3O50A 3E5AA 2X81A 1MQBA 3RAIA 1P2AA 3TIYA 4D2TA 5F1ZA 2WMSA 3C4WA 3TZMA 4DCEA 4H3PA 1PXJA 3PY3A 1CKIA 4IQ6A 4I21A 5L3AA 5BMMA 4H36A 3V5LA 4M13A 3NIZA 3ZCLA 2XNBA 3PFQA 3QZFA 2P33A 1OMWA 3THBA 5A9UA 3GU5A 3QTUA 2YDJA 5AP1A 2XM8A 4QQTA 3KU2A 5DHJA 3C4XA 1UV5A 5KO1A 3MTFA 3CTQA 1GJOA 3DFCB 4MXCA 5AADA 2F49A 2WTDA 4ANSA 3PSCA 4GVJA 3C9WA 3R7GA 4FI1A 4ZTMA 5GNKA 5HG8A 3WF5A 4ZSGA 5EFQA 3VF9A 4N6ZA 3UIMA 4OAUC 2HAKA 2VWIA 4S30A 5E91A 3BGPA 4EK4A 2Y0AA 4WHZA 2A4LA 4BTKA 4BDKA 5DH3A 1P5EA 1PKGA 1OIRA 3CBLA 4RVMA 4RA4A 4HCUA 1R1WA 3EQHA 3KGAA 3MVHA 5BQ0A 4M14A 5HBHA 4W4VA 5E8XA 3CIKA 4NT4A 4O7NA 3QQGA 4QP9A 2PE2A 4HZRA 5CSPA 3TZ9A 4QMSA 3CLYA 2VTMA 2HWPA 1BKXA 3Q5IA 4IHPA 3HAVA 3H9OA 3E93A 3P7BA 4OGRA 5E8TA 4BIBA 4PX6A 3QRKA 3DPKA 4QT1A 4CLIA 3FPMA 3Q9WA 1KE5A 2JDOA 5AP2A 3ZZWA 4CD0A 2F9GA 2QLUA 5HO8A 1S9JA 3FKNA 3Q5ZA 4EH7A 3NSZA 2Z7LA 1LR4A 3ZLWA 1ZZLA 4Q9SA 1NXKA 3DS6A 3Q32A 2QG5A 2IW6A 3E63A 2ONLA 3FMLA 3PRIA 4F4PA 5JGAA 1H08A 2QC6A 4A9TA 5C9CA 3KB7A 2VWUA 3EFJA 2ITWA 2JBOA 3PZHA 4D4SA 2OXXA 4LRMA 3O8TA 3RK7A 4O7LA 2FGIA 3BHYA 3POZA 2UW9A 4TKSA 1I44A 5K3YA 1KE7A 1WVYA 4FNWA 3ZM4A 2AYPA 3I5ZA 3IOPA 3MTLA 5T6KA 2C6EA 1URCA 4YTCA 2VTHA 4U79A 4ASEA 4CQEA 4ZY5A 1YXTA 2SRCA 4L8MA 5AA8A 3BWFA 4DLJA 3UP2A 3EJ1A 1YKRA 4YJOA 3UE4A 2PVJA 3UG1A 3DXQA 3MBLA 3BX5A 4GT3A 2J0LA 4QQ5A 3LFFA 5CSVA 5AX3A 3V5QA 1PJKA 5KUPA 3U54A 1XWSA 1H1RA 1UU7A 1VZOA 1WBPA 5DYJA 4BDJA 3L9PA 3FHIA 2XS0A 4A9RA 2J7TA 3DJ6A 3MY5A 4EEVA 2YWPA 5GZ9A 3WE8A 5HOAA 2F2UA 2C6DA 4TXCA 2GS7A 5B0XA 4C3FA 4D1SA 3M2WA 2Z7QA 2WQBA 4S32A 5G1XA 4NU1A 5E1SA 3BYOA 3NDMA 4XCUA 3SXSA 5HTCA 4GW8A 5A3XA 3FMHA 4CRLA 1JBPE 1XO2B 3QKKA 4F6WA 4UMPA 4S2ZA 1E1XA 2XJ0A 4TYGA 4RG0A 2F7EE 1WBWA 1GIIA 3D15A 3LQ3A 5C4LA 2QR8A 2PMLX 5J9LA 5D41A 4FTOA 4ZOGA 3U9NA 3SXFA 2GTMA 2PVYA 2PVNA 3KXHA 3P1AA 3KKVA 5EI6A 3ORXA 2QOOA 4AOIA 4X0MA 4IZ7A 3DQXA 5I9XA 3CD8A 4RLLA 4XG4A 4R7HA 4YPSA 4JR3A 4H05A 4O0RA 2BCJA 4J8NA 1YDRE 2WNTA 5E7RA 4ANMA 3O51A 1H1WA 4D28A 2HXLA 5CT7A 3OC1A 1M2QA 4XP0A 4RLKA 5AP0A 4AP7A 3FDNA 1SZMA 2OG8A 4KS8A 2HZNA 4X3JA 3W2SA 4NIFB 4A9YA 3DZQA 2VGOA 4YJVA 5AP6A 1Q8YA 4EONA 4DTBA 3L8VA 4OR5A 3MGYA 3NYOA 4LGDA 4J1RA 2PUNA 4EC9A 5BNJA 2IPXA 4BCOA 5J1WA 4IB3A 5FXQA 2YJRA 3MJ2A 1E9HA 3PUPA 4YHJA 2J0MB 1CSNA 1H1PA 1WBVA 2C1AA 2QOBA 5B7VA 5JEBA 2PSQA 4O7TA 4GK2A 3VW8A 5CAUA 4TYHA 2GU8A 5I9YA 3RWPA 3PRFA 4FKGA 2HY81 4I92A 3SC1A 4CCBA 4EH8A 3ORMA 5DEWA 2QOFA 5CXZA 3E3BX 5I3RA 4FVPA 5IPJA 5JRQA 1OITA 3NGAA 4I5PA 4KKHA 1M52A 3GCVA 4RZWA 5GHVA 3OW4A 3QQJA 3SRVB 4DH7A 4F7JA 5BUJA 2XBAA 2JKQA 3KRLA 2CGVA 2VWBA 3Q3BA 5EQEA 2OI4X 2VO6A 1TVOA 3VS3A 5DT3A 3CJFA 4MWIA 4ANLA 5CEOA 5GJFA 4TWNA 4XBUA 3MDYA 3FXXA 3ZLSA 4G3EA 2YM3A 3OBGA 4O2PA 4Z3VA 4KKEA 5A4QA 5IA0A 4EKKA 2YM5A 5IMEA 4YR8A 1Y91A 3EMGA 5HIEA 3U55A 3PXQA 2B4SB 4PMMA 2A2AA 4ENXA 3DA6A 2BIKB 5TR6A 3NUYA 3S00A 2E9PA 4RC3A 1QPCA 1WMKA 2B1PA 5CNOA 1ATPE 1IG1A 2VAGA 3C51A 4EC8A 3FLYA 4UXLA 5FUTA 1PXMA 3COHA 2BFXA 3UP7A 4C4HA 2XIYA 3CKWA 5FG8A 5L8LA 3OFMA 3WARA 3DNDA 4QQJA 1WBNA 3WIKA 3WZJA 3NAXA 5E8UA 3C7QA 3EQDA 4CYIA 3TTJA 2R3GA 3F3VA 2V7OA 4X6RA 3QTRA 1JVPP 4FZFB 4U80A 4DFBA 3QCSA 2GNLA 1R39A 4JG7A 1GNGA 5JK3A 3SXRA 2YLEA 3C4EA 3IOKA 3D7TA 5L2TA 4PTEA 2UZTA 5M53A 4FV5A 3PPKA 4RIXB 3DTCA 4MTAA 4FZ7A 4ZJIA 2UW7A 4KSQA 3BHVA 3W2QA 3QUDA 5AAGA 1W8CA 4G9CA 4E26A 4U5JA 3DZOA 5FLFA 3O8UA 4U97A 3A4PA 3WI6A 2IO6A 2VN9A 4IB0A 4UALA 4I94A 3DB8A 4ANBA 3I7CA 3MVLA 3QRTA 4AT4A 4KBAA 4AE6A 3UOJA 4FVQA 5I5ZA 3UZPA 3PY0A 2P4IA 5CAQA 4FV0A 3OCTA 5HNBA 4EUUA 4V0GB 4DEAA 4IH8A 4R5SA 4JRNA 1JKKA 4AZTA 4EL9A 1QPEA 4I22A 4M68A 5J79A 2Q0NA 2OO8X 1WBSA 3FZSA 3NUSA 3PXKA 2ZV8A 3QQLA 3BV2A 3SW7A 1YHSA 4MBJA 4W4XA 5HTBA 2OGVA 2JGZA 2IZRA 2QCSA 2QLQA 2GDOA 3AT4A 4AGCA 5ANKA 5LWMA 2Y4PA 4R7BA 4XRLA 4RJ5A 4I5HA 3H9FA 4L9IA 5AUWA 2VTSA 5ANGA 3RNIA 3GCUA 3W1FA 4OW8A 3QUEA 2C0OA 5HLPA 2QOLA 4XX9A 3VIDA 5CU2A 4V05A 3R8PA 3ZH8A 5M4CA 3TEIA 3I0OA 2PZ5A 3PXZA 3K2LA 5KNJA 3LKMA 2UW8A 3OUKA 2NNWB 2XNOA 4BWKA 4E73A 3R1SA 4JAJA 4I3ZA 4L45A 3RCJA 4FYOA 2PVMA 4NM0A 3PXRA 4XG7A 2WIHA 1X8BA 3FI2A 2YDKA 4IEBA 2O63A 4EWHA 3QKMA 2XNMA 3AMBA 4QO9A 3GFWA 3KXNA 4QMUA 1YHVA 4FIFA 3P4KA 3QQFA 3LJ0A 3ORKA 4FKIA 3QTQA 3QALE 4IIRA 2C3KA 5LVOA 4G6OA 4FSUA 3UG2A 3HP2A 4FK3A 4JDHA 2JAVA 5FEEA 3NCGA 4XV9A 3SDJA 3JR1A 3KMMA 1IR3A 3LW0A 3OWPA 4HCTA 4CMOA 1GIHA 1ZOGA 5L8KA 3BGZA 2YITA 5FD2A 4XLVA 4UB7A 4RWJA 4R5YA 4BKYA 4FV6A 3PSDA 4GIIA 3F2RA 3R21A 3WBLA 3ZEWA 1ZAOA 4ID7A 4Y72A 4PWNA 4EH6A 3NYNA 3W32A 1CKPA 2IVUA 5H8BA 3OWKA 4IVCA 2R3LA 3KRWA 2ZAZA 2XIZA 2X7FA 4IX3A 4IB5A 4TNBA 4F99A 4AN9A 4QMTA 4CFVA 5CU4A 2YZAA 5H3QA 3NR9A 3U6HA 3EQPA 3QWKA 2XBJA 2VTTA 3D2KA 4BWXA 4FSRA 4MNFA 2AUHA 1U54A 1BX6A 4GG5A 2GMXA 2WMBA 5DGZA 5E90A 5EDPA 5IH6A 1Q41A 1L8TA 3II5A 4LV8A 4GFOA 3JVRA 2F7ZE 4APPA 3FV8A 2KTYA 3P9JA 5I9ZA 4BTJA 4EZ3A 5HZNA 4BY9E 4FV7A 3B8RA 1VJYA 2WU6A 2XUUA 1DAWA 3C4FA 3KVXA 2CNVA 5A4LA 4MD9E 3KMUA 3OEZA 1IEPA 3LAUA 4BHZA 1DI9A 2YM8A 2QG7A 4D2SA 5M09A 1GZKA 3ZDUA 3VJNA 2XMYA 4NYEA 3I4BA 2J51A 1UVRA 2W5BA 3OMVA 4U41A 2IZTA 3E8DA 4OLIA 4Z55A 3FL4A 4RJ8A 5IA3A 4DT8A 3H4JA 2GHMA 4BICA 5IEYA 4O22A 4WSYA 3ZS5A 2ITPA 3DBFA 4P4CA 4PDOA 4M69B 1FVTA 3REPA 5L8JA 3COMA 3DKOA 4QTDA 2HENA 3NW6A 5HCYA 3OY3A 3UIBA 5LVMA 3ZO3A 1PMUA 3GOPA 2Q83A 5CNNA 3FL5A 4E6CA 3FMMA 3QD3A 2QO7A 4DH5A 1XH4A 1O6LA 2C3JA 3F5GA 5HVJA 5JN2A 4XMOA 5IDPA 4NW6A 4BZNA 4AACA 4K1BA 2V5QA 4K0YA 2VUWA 1SYKA 1CKJA 3G6GA 5J1VA 2CLQA 3AD5A 3JVSA 4K18A 2GQSA 3FLZA 4FIEA 4ZLOA 4TYEA 5I9WA 4D0WA 4D1XA 5K0XA 5EHLA 1CTPE 2JFLA 1Y6AA 5AR5A 4LV5A 4QP1A 4RA5A 1YDTE 5HE0A 2JKOA 4LRKA 3V3VA 2XJ1A 3AC8A 3PLAE 3DAEA 3D2IA 5M51A 2BAKA 4UV0A 3CE3A 5A54A 1J3HA 1B6CB 4LM5A 5EW8A 4YO4A 5DRBA 4ZXTA 3QTWA 2VTNA 3V5WA 4DGNA 4EH5A 1NY3A 1TKIA 4Z16A 1OBDA 4F09A 3G9LX 3IGGA 4D5HA 4JLCA 3KC3A 3RWQA 5LJJA 3AC1A 2O8YA 3DK7A 5HCZA 3WF6A 4AX8A 3WYYA 4YLKA 4RJ3A 5ITAA 3NNXA 1W0XC 2QVSE 4KIQA 3ZONA 4FEUA 4MEDA 4FIIA 5FGKA 4DBXA 5D7AA 2UZBA 3TT0A 4U3ZA 4C3PA 5HNIX 2BTSA 4AN2A 5IMXA 2BRHA 3AOXA 3MPAA 3F5UA 3ORIA 4ZZMA 5CU6A 3N9XA 3KQ7A 2J0IA 3QAME 3U4UA 4BDIA 4EOKA 4YBJA 5CS6A 2OH4A 4PPAA 4P90A 5HI2A 2WTVA 4D4VA 2VNWA 4XUFA 3DNEA 5ACKA 4APCA 4EQMA 3LMIA 3LMHA 4IVAA 2X0GA 3BI6A 3HA8A 4FSZA 3FMDA 3HV3A 4BDCA 2Z7RA 3UVQA 1UNLA 3LFQA 5CXHA 4DITA 4M97A 4U81A 4LGGA 4G2FA 3PYYA 4PY1A 3FLWA 4KWPA 4ITIA 5DR2A 4PPCA 2DYLA 3E8NA 2CLXA 4IWOA 4ZTSA 3TDWA 3F3ZA 4M0ZA 5TKDA 3UOHA 4KS7A 4R1YA 3NVKI 3TKHA 1SMHA 4G34A 3F5XA 4C4EA 4J53A 4G1WA 4CG9A 4BZDA 4HVDA 2WPAA 3QC9A 4KIOA 3F3UA 1YOLA 5F94A 4BVUA 2QI8A 2ITXA 3Q6UA 2GS6A 3SAYA 2ZV7A 4HGLA 2ITNA 4ZSLA 5DMZA 4H1MA 2BZHB 5IEXA 3VS2A 2UZVA 4WIHA 1XH5A 4MF1A 2HZ0A 3D5UA 1RQQA 2WELA 4FGBA 3ZMMA 4C4FA 1SVHA 2XCHA 3FQSA 4G5PA 2VO7A 4KB8A 2KULA 4X2JA 1Q99A 4YJPA 3GBZA 2ZYBA 2Z8CA 4AGUA 4EUTA 4DBNA 3GCPA 1UA2A 4XS2A 3L8XA 2ESMA 3BYSA 5K0KA 3WZEA 2PE0A 3BIZA 4QP2A 3RKBA 4F0GA 3RTPA 2UZWE 5FP6A 3VW6A 1XJDA 3G33A 3OF0A 3L9MA 3G0EA 2Q0BA 3R9OA 4O0WA 3D5WA 5LMKC 4QP7A 3KEXA 4ITJA 2XNEA 2VWXA 3R8MA 3AGMA 3MH1A 3GP0A 3TNIA 3OZ6A 5LQFA 4JX3A 2XKFA 4O38A 5J95A 4RZVA 3KN6A 4G3GA 3E87A 3POOA 4D58A 4TW9A 4O2ZA 2CSNA 3P78A 3ERKA 5L6OA 4ARKA 5A6NA 5FDPA 1YRPA 5BPYA 3CTHA 3ZC6A 2W96B 3KVWA 4E4XA 1BLXA 5KE0A 4FV1A 3S4QA 2VWZA 1PXOA 4C62A 4CCUA 1WAKA 4RFZA 2WTWA 2XYUA 4MNEB 3ORNA 1F3MC 3AD6A 4W9XA 2X6EA 4AF3A 5IQCA 4NFNA 3H10A 1XH8A 4FUYA 2I0HA 4QNYA 4GK3A 1REKA 3BQCA 3AT2A 5CSWA 2OXYA 3R7VA 3RMFA 4ZJVA 5C8KA 4FKUA 5IQIA 2RF9A 1UU9A 3O23A 2OIBA 3VBWA 4BCJA 2XKDA 5C1QB 4DEDA 2V22A 4D2VA 4XV1A 1AQ1A 5E8SA 4O84A 4O21A 4DINA 4UWBA 3L8SA 4ZMEA 3U9CA 3PIYA 1KE6A 4TT7A 3FZRA 2R0UA 2PWLA 4CFUA 3DDQA 3HRCA 4BGQA 1OGUA 4XRJA 5ETFA 4C58A 1STCE 2R3QA 4FTCA 2YAKA 2HW7A 3QTXA 4RWIA 1Y8GA 3NVMB 4RX9A 5AUXA 4M67A 1LEWA 3BE2A 4AW0A 3EQFA 2WMVA 4AA5A 1DS5A 3U6JA 2HY0A 4IFGA 3TG1A 3CXWA 3FI8A 3CQEA 1ZMWA 3GNIB 3PG3A 2JDRA 4MK0A 4U6RA 3LXPA 4LUDA 5CVFA 3PVBA 2I1MA 4BL1A 2F4JA 4EH4A 2RSVA 3ZXTA 4A06A 1YI4A 2QQ7A 3ID6C 2B9JA 5EW9A 3MIYA 4NUSA 3TNHA 5EM5A 4EBWA 3GC7A 4YZNA 3T9IA 4EJ7A 2XP2A 3LCSA 4IZ5A 4RSSA 4FA2A 5FBOA 4LOPA 1FBNA 1MRUA 3IW8A 2JKKA 5EG3A 1PHKA 3LOKA 5KMKA 3C5IA 3TKIA 4CGAA 4BYIA 3FEGA 5JFWA 4DGGA 2JFMA 5AR7A 4QTCA 2IW8A 2C3LA 4A4OA 4BTFA 1TQMA 2FYSA 4DN5A 4C37A 4EK6A 5AEPA 1NVSA 1R0EA 4ACMA 4ZK5A 2BRNA 5J9ZA 2C5NA 2VTQA 4IAIA 4F08A 3KY2A 4YP8A 4IM3A 4NZWB 3UO5A 4FIHA 4O7SA 4M12A 1KSWA 4MBLA 3PP1A 3A2CA 3ACJA 3BWJA 4X21A 4ERWA 4HJOA 3UIUA 4RPVA 3FXZA 5JMSA 4ZS4A 5DA3A 3QXOA 3VUGA 3TN8A 2EXCX 2R7BA 3MVMA 1BL6A 1OL6A 3ZZEA 4TRLA 5ANIA 5L2QA 2ZM4A 3KF4A 5IZFA 3EOCA 1BMKA 2RFDA 1FINA 4C0TA 2UW5A 4W4WA 5AAEA 4NJDA 4WNKA 1JSVA 4YO6A 4G9RA 3DBQA 3DT1A 3GC0A 3MWUA 4S33A 4J52A 4JL9A 2PMOX 2B54A 5BUEA 2BHHA 2YHVA 3K5UA 3UVPA 5E1EA 4O7YA 5D9HA 1OL7A 4FG9A 4X2FA 3NW7A 5B2KA 3LCTA 5DT0A 5J87A 3RI1A 3LM0A 4Z7HA 4J95A 3FMEA 2JITA 3KULB 2XIXA 5E92A 5AR2A 4Q9ZA 5IUGA 4LFIA 4ZZOA 5FEQA 3VHEA 3DAJA 1Q8WA 3H0ZA 4G3CA 3OXZA 3OVVA 2C6MA 5HORA 4X3FC 1DM2A 4FKVA 2WB8A 4JDIA 5BYZA 5AV4A 3AXWA 4ZEGA 4PL4A 2ITTA 4RIOA 3R7UA 3G15A 4KRDA 2VNYA 3QX2A 4QMXA 3OWJA 4FIJA 4WKQA 5CEIA 2ERZE 1PMVA 3ALNA 3G9NA 4FT7A 2IW9A 2OLCA 4TWPA 4NWMA 2C5OA 4RC2A 3VBVA 1QL6A 2GNHA 4HNFA 4LI5A 3T8OA 3FQHA 3PA4A 2VD5A 3QKLA 1OBGA 3F7ZA 5EHOA 1YOMA 4RVTA 3RPYA 4FSQA 3PDTA 2QO2A 4FV2A 4U8ZA 3JPVA 3V8TA 4MHAA 2WQEA 2J9MA 2PMIA 3G90X 1H0VA 3MFTA 4BYJA 3VF8A 3SV0A 5L2IA 4D9TA 3LFNA 5CSXA 3C0GA 4GRBA 4L52A 4FOCA 1A06A 4ASZA 2WGJA 2GNFA 4U3YA 5FQDC 4C3RA 5K5NA 5L6PA 1Q3WA 2XIRA 4MQ2A 3I79A 3MPTA 2CHLA 3MH3A 3OG7A 2IZUA 4L3PA 1OL5A 4NCTA 4YMJA 3VQHA 2BKKA 4NIFA 2BZKB 4JIKA 1KV1A 4W9WA 4AT5A 1ZYDA 4WD5A 3IKAA 3LVPA 3QHWA 2QONA 3DXNA 3HAMA 4KNBA 4X2NA 5IQHA 3FYJX 2JBPA 5ANOA 5J9YA 1G8SA 1PF8A 2YERA 4N70A 1P14A 3LM5A 3SA0A 2PUPA 4ENYA 1JLUE 4S34A 3QQUA 3VVHA 3FKLA 4AFEA 2CKQA 3HECA 3P7AA 4I1ZA 2BRMA 4AS0A 3RVGA 3KL8A 5HG7A 3WILA 4JT3A 1V0PA 1QMZA 5HGIA 3HRFA 5AV1A 2C47A 4AZEA 4DLIA 3TZ7A 4ZY6A 3SRVA 4FKRA 2YCRA 3ZRMA 4BZOA 4I93A 4CMTA 2ETMA 2YCQA 5CAOA 5KMIA 3GU8A 4PDSA 3A7FA 3ZLXA 5CZHA 5IUIA 4YTFA 3AG9A 2A19B 3OCBA 2BKZA 2ERKA 4QP8A 4KA3A 4EOOA 4K2RA 3UVRA 4WG4A 3BU5A 2VWVA 3FZTA 3PA5A 5F20A 2XRUA 5BVDA 2E2BA 4JDKA 4USFA 3EZVA 5EDRA 4YURA 2I7QA 5AR4A 1Q97A 4G31A 4FNXA 4FYNA 4PDPA 5JFSA 1T45A 2J0KA 4AU8A 4F9YA 3PWYA 1W7HA 4MD8E 1BUHA 3RJCA 3O2MA 3RPOA 3TCPA 3BEGA 4E4MA 4IWPA 5J5TA 2W1ZA 3ZRLA 4CFNA 4KIKB 2YDIA 3AC5A 4BR3A 5GIPE 3R73A 3MY0A 4U42A 5AP3A 4IAKA 2R64A 4GKHA 1W98A 2OFUA 4DGOA 3HEGA 1VYWA 5AUTA 3I6UA 3WE4A 4A4XA 5TE0A 4FTQA 3Q4TA 4HCVA 3S2PA 4D5KA 3MH2A 4ALVA 4IJPA 4AZWA 4HOKA 5IA1A 5EM6A 5EM7A 4LG4A 4WNPA 2X8EA 4AOTA 3Q4CA 5AV3A 4MXXA 5JZJA 3QTIA 2WIPA 2W1HA 4J7BA 1ERKA 4M66A 1OVEA 2WMUA 3FQEA 3MA3A 1Q3DA 5DOSA 3VUDA 5AUYA 3W10A 1G5SA 1XR1A 2PYWA 5JSMA 4H3QA 5HNGA 3OY1A 3DU8A 3A7IA 5HD7A 4BKZA 4O0UA 5I3OA 3CPBA 1YI3A 4WUNA 5HIDA 4N4SA 3QGYA 2B7AA 3EQBA 4I24A 3ULZA 1OKZA 4FTLA 3DLSA 3G2FA 3GC9A 3OHTA 3FXWA 4IE9A 4L01A 4V0GA 4HPUE 3IS5A 3JXWA 3AT3A 1NA7A 3FE3A 3HDMA 4JAIA 4Q2AA 2XK3A 3UODA 1I09A 4PP7A 4F1OA 3VC4A 1TQIA 5AV0A 3CSVA 3N4UA 1UU3A 4CFMA 3RCDA 2XK7A 4D1ZA 5ANJA 2R3HA 3BE9A 3VS7A 4I23A 4Z9LA 4LUEA 4QMZA 1H25A 2WMWA 5EK7A 4BBFA 4GMYA 3LMGA 3CQUA 3SGCA 1ZZ2A 2HOGA 2UW4A 4EOSA 4GK4A 4AGDA 4E5BA 4FKQA 3DK3A 2VRXA 2RFEA 4WSQA 3RHXA 4IFCA 4EOJA 3NRMA 3F5PA 2X2MA 1H8FA 4BF2A 2QOHA 3VRYA 2PPQA 2W9FB 4JBPA 1FMOE 3UGCA 5M44A 4FIGA 2C6KA 3UMWA 3NW5A 3NNWA 1JSTA 4YNOA 3PJCA 4Q5HA 4AOJA 1JKTA 1J7LA 4C61A 2OKRA 5B2MA 2UZEA 4PNIA 3CS9A 4JI9A 4KABA 3VRZA 4BBEA 4YZDA 4C34A 4PNKA 2WXVA 5LCKA 3IQ7A 3C5UA 4FT9A 4ZP5A 3O7LB 4C59A 4M15A 2HK5A 3DLZA 4G6NA 4YSMA 4TZRA 5HBJA 4NL0A 5B2LA 4PL5A 2CCIA 5EQYA 1J91A 4F7NA 4QYEA 1F0QA 4F64A 4BCQA 2ZVAA 5GZ8A 3LCKA 3M42A 3LCOA 5GINE 5ANDA 2OSCA 2VO3A 3DY7A 4O0VA 1BYGA 2P2HA 4E4LA 3BBTB 3HMPA 2LGCA 3IPHA 2EU9A 4JNWA 4WA9A 4MWHA 1WVXA 4J98A 3Q9YA 3NYXA 1APME 5AM7A 5FTQA 5CF4A 5H2UA 4D2RA 4G16A 4MXOA 2BR1A 2PVLA 2JC6A 1SVGA 3CY2A 4BCKA 3LIJA 4DG0E 2J4ZA 2UVXA 3R6XA 5M55A 3FHRA 2PHKA 2IN6A 3HZTA 5HU3A 4M7IA 2RG5A 4YTHA 3MSSA 2C5XA 3FBVA 4ZSEA 3RK5A 5CALA 2P0CA 5GJDA 2B9IA 2DWBA 2HIWA 3R8ZA 3NMUF 2CGXA 2R3OA 4P2KA 2WTKC 4X7QA 2GNIA 3ZU7A 5LVPA 1W84A 1WBOA 3MFUA 5KMMA 5CF6A 4FTNA 3GQLA 2BIYA 4LQMA 4EBVA 5CVHA 4GT4A 3A60A 2ACXA 1Y6BA 4WNOA 4M3QA 2UVYA 4AWIA 3D94A 4U40A 1PXIA 1R78A 2WZJA 3BKBA 3MFRA 3B2WA 4KIPA 3F9NA 4B0GA 1AGWA 1Q8UA 2BUJA 4G17A 5BVFA 3L9NA 5DN3A 4OT6A 4UYAA 4YLLA 1ZYSA 5H8GA 3TV7A 2C1BA 3R7EA 5IQDA 3SLSA 4FL1A 3A4OX 2NRYA 3W2CA 5EH0A 4MBIA 3PPJA 2WOTA 4GT5A 5KHWA 1J1CA 2IWIA 3MPMA 3T3UA 3P5KA 3C1XA 4RBLA 5ANEA 2CGUA 4CZUA 2GQGA 4M69A 4U43A 4WRSA 2CKEA 3LFSA 5JH6A 1Q5KA 4JBQA 4R6VA 4CEGA 4X3FB 2P3GX 1BL7A 2WMXA 3QYWA 4LOQA 4E93A 3L8PA 3EWHA 2YM4A 4RGJA 2JDTA 2FB8A 4QP4A 5EI8A 3F2NA 3H9RA 5HO7A 3BLRA 3FZOA 5EHYA 1UNHA 4I0TA 4IAFA 4QMWA 4JQ8A 4EHZA 4K8AA 5HHWA 4PMTA 2DS1A 2OF2A 3A7GA 4RIYB 4KKGA 1YOJA 2H34A 2XEZA 3VUMA 5GJGA 4UMRA 3H3CA 3QD2B 2X7OA 2EB2A 3F66A 3K54A 1OPJA 3SG9A 3PVUA 4IJ9A 3PSBA 3W8QA 2FA2A 2ZM3A 4NTSA 3TXOA 3ZOSA 4FEWA 3NCZA 2G01A 4DH3A 1LUFA 3EIDA 3W2RA 2XK9A 2WMRA 3QHRA 4AW5A 1H1SA 1ZYCA 5CT0A 4O0YA 5C8MA 3JYAA 3DKCA 3R1YA 4C57A 4O6LA 2PVHA 3NNVA 5DPVA 3R9NA 2X9FA 3BHTA 2YM6A 2JEDA 1PYEA 2B52A 3CKXA 3NUAA 5CQWA 3RPSA 1OL1A 1XH7A 4UY9A 1SNUA 4MF0A 2BROA 3E7VA 2CN5A 4GS6A 1WVWA 1AD5A 2YIYA 5TO8A 1YI6A 3BEAA 4G3FA 4IAZA 4QQCA 4DC2A 3A8XA 3IW4A 4IXPA 4YPDA 5D7VA 2BDJA 4RQKA 2OW3A 3CCNA 3HV6A 3I60A 4BI1A 4BI0A 3W55A 5FWKK 3ZUTA 5IUHA 1ZLTA 4PP9A 5CY3A 3BYUA 3QLGA 4FSTA 5CYIA 1K9AA 4C33A 5A4CA 3FWQA 4FK6A 4NEUA 4JIAA 2XF0A 5FTGA 3DGKA 4NM5A 3A61A 4C2VA 4A07A 2BZJA 2X1NA 2ZMDA 3KXGA 4FBXA 5DLSA 3V5PA 2Y8OA 2W1FA 4FKSA 2H6DA 2XZSA 4IWQA 4ALWA 4EH9A 5AR3A 3F69A 5HVYA 4IC7A 3VBYA 2WMTA 4BI2A 5CAPA 1H24A 4USEA 3ORZA 4GU9A 1UU8A 2WAJA 3LPBA 4NW5A 4NK9A 3MN3A 3ZO2A 5AX9A 4BDDA 2IG7A 3ZO1A 4MCVA 3OT3A 4E6DA 5AM6A 4WNMA 3I6WA 5ETCA 5A4EA 4AW1A 5HX8A 4FZDB 4I41A 4AT3A 4L68A 2RKUA 3QF9A 4B8MA 5CEKA 4S31A 3S1HA 3V51A 5KMNA 2HYYA 3E88A 3MV5A 4I0RA 3QC4A 2FUMA 5IQFA 5KMLA 5M07A 1CM8A 2QODA 2QOKA 2W4KA 5CQUA 2P55A 4IACA 4AQCA 4I6BA 2C6TA 2R9SA 3QX4A 5I4NA 3PJ3A 3LXNA 3V8WA 1JAMA 4DFZE 2VZ6A 2R3MA 3Q4UA 3U4WA 2FSTX 4FVRA 4IMYA 3OT8A 3S3IA 4DTAA 2O64A 4FEQA 3A62A 4XG9A 4YJNA 3V8SA 5HESA 5AUUA 4JX7A 2WMAA 3D5VA 1CDKA 4UWCA 3K3IA 5HO6A 1M14A 3VS6A 4QYFA 2VTPA 3F2AA 4XV2A 1OI9A 1OPKA 4D4YA 2Z60A 3NUXA 5IF1A 3GFEA 5CVGA 2O5KA 4F1MA 2W06A 3BZ3A 4EOPA 5E4HA 2WO6A 2YAAA 2GS2A 1GOLA 4HYIA 2GQRA 2BPMA 2WEVA 3FMNA 3R30A 2VWWA 3LFCA 4FV3A 4BDHA 2G2HA 1H07A 5KZ0A 3WIGA 2QOCA 2XM9A 4JRVA 2YCSA 5FXRA 4BCGA 4JBVA 3RPRA 4BGHA 2C5YA 3GGFA 4QOXA 2YIWA 4IX6A 3OBJA 3VWAA 2C4GA 1OL2A 4W8DA 3PA3A 3PXFA 1ND4A 3AMYA 2HCKA 2HZIA 5C03A 3SOCA 1UWJA 3COKA 2XYNA 4H58A 4J8MA 1O9UA 4I4FA 3OXTA 5GIOE 5EKNA 4PTGA 5AR8A 4FNZA 3ZRKA 5EYMA 4CNHA 4ZSAA 2QD9A 1T46A 4MNEA 3RALA 5FEDA 3RZBA 4FTKA 4IZAA 3KK9A 4UYNA 4ALUA 3DTWA 3F3TA 4RVKA 2QKWB 5E8VA 3ULIA 4EWQA 3CTJA 1YDSE 3GUBA 5IDNA 3KFAA 1CMKE 2J0JA 3C0HA 5HE2A 1PW2A 4P5ZA 3PVGA 2PE1A 4B7TA 4FZAB 5ETIA 4YZMA 1L3RE 3FY2A 3R7OA 2C3IB 2PK9A 3D7ZA 3DJ7A 3O8PA 2UZLA 4IX4A 3RK9A 3FLNC 4GEOA 5CTPA 5HD4A 1VR2A 3O0GA 1LEZA 4ZJJA 4RQVA 3VBQA 4AFJA 5DI1A 1KOBA 4UMTA 2IVVA 3CD3A 3WZUA 1IRKA 3UOKA 4CG8A 5GZAA 4HYUA 4ACHA 3EQCA 4A9SA 1JQHA 3G6HA 4XP2A 3RM7A 2I6LA 4FX3A 4Y85A 2OU7A 3F7WA 4CTCA 3DCVA 3AC4A 2B53A 4EH3A 2J50A 3LZBA 4J71A 4O0TA 4OTRA 4LOOA 2GNGA 4QP6A 3V5TA 5DIAA 1NW1A 5FP5A 4H1JA 2X8DA 2PZYA 2J5FA 3HMOA 4ZTQA 1G3NA 5BYLA 4RT7A 4G5JA 1ZMVA 2V7AA 3DOGA 4C7TA 5JKGA 1V0OA 3VJOA 4FNYA 5JT2A 4V01A 4AAAA 3QFVA 2XVDA 1V0BA 2W4OA 3PJ2A 4FT0A 4B4LA 1W83A 4AZSA 4G3DA 5F4NA 5LVLA 4FSWA 3AMAA 4XBRA 5BYYA 2E9OA 2HELA 3UZRA 4DA5A 3UPZA 2W0JA 1KOAA 4EQCA 2WTKB 3EYHA 1M2RA 3Q9ZA 4QNAA 3HMMA 5FM2A 3ZSHA 5T3QA 4A7CA 5BVOA 1J7IA 2ZMCA 3GCSA 5T68A 2WEIA 4EOQA 4K77A 5AAFA 2CNUA 3ORPA 4PPBA 3UQCA 3TNQB 4OTPA 2C69A 2X8IA 3IK3A 3WOWA 4DFLA 3GC8A 2G1TA 5AUZA 4MKCA 4AUAA 4FV9A 3R9HA 2F7XE 2UUEA 5IA4A 3QZGA 2JDVA 4UZHA 4OTHA 4LYNA 4X2GA 4MQ1A 3COIA 3TKUA 2X2KA 4FKJA 4XJ0A 5AMNA 5E8ZA 3U87A 5KBQA 3QTSA 4L43A 3UC3A 3DBCA 2C5VA 5KHXA 4E8AA 3ITZA 4BRXA 1E1VA 5J7BA 1P4OA 2E9VA 3IO7A 2W1EA 5DR6A 2HWOA 2VTAA 4PDYA 2OZAB 4X6QC 2E9UA 5LMBA 3KCKA 3VQUA 1BI8A 2R3RA 3IW6A 3M11A 2QR7A 3HDNA 2PVRA 4CFFA 3GT8A 1F5QA 2C0IA 2RGPA 3PVWA 1JOWB 3KULA 4AZVA 2ONLC 2BDWA 2ITUA 2GCDA 3VUIA 4BDFA 2BAJA 4ZMFA 2XEYA 2B9FA 2RL5A 3E8EA 3OCGA 4FG7A 4RIWB 5TOZA 5CAVA 5DEYA 1OUKA 1J1BA 2YACA 3F6XA 4O6EA 5HICA 4DT9A 2W5HA 4GG7A 1PXLA 4PL3A 5LARA 3RP9A 2OJFE 3TACA 5LWNA 1JWHA 2R3NA 4QRCA 4WOVA 1PRYA 3HV4A 5EDQA 5CEPA 5HU9A 4B99A 4DHFA 4R78A 2OBJA 4L42A 3MVJA 5EKOA 2CKPA 2VGPA 1H27A 2BHEA 1OZ1A 1U5QA 4K33A 3FUPA 4XG2A 1Y8YA 1HCLA 1H4LA 3W2OA 2UV2A 4YC8A 4KSPA 5F95A 4B8LA 3HL7A 2ZB0A 4EHEA 4ZLYA 3MB7A 3TUCA 2W1GA 4DH8A 4M8TA 2JIVA 3W2PA 4BBMA 3KRXA 4PMSA 3LLAA 5IU2A 4F1TA 4K9YA 3VNTA 3PIXA 4ZY4A 4XOZA 2EXMA 3KA0A 3ZFXA 2BALA 4UBAA 2VV9A 3D0EA 4EZ5A 1OIQA 5KBRA 3CY3A 2Z7SA 3EFWA 4QYHA 3U6IA 3ETAA 3OD6X 3R01A 4TTHB 4QPMA 2OFVA 3MFSA 2EWAA 1YW2A 5HCXA 2B55A 4ORKA 4P5QA 4C4JA 4RWLA 5HG5A 2PZRA 2I0EA 1RE8A 3OEFX 2YM7A 3QU0A 4FODA 3LQ8A 3FSKA 2V55A 4HGSA 2B9HA 1QPDA 4JQEA 5CX9A 5AP7A 2XB7A 3FI4A 4IM2A 4AXAA 3ZSGA 5IQEA 4BGGA 5AP4A 4ACDA 4BCHA 3EN7A 2CDZA 1PXKA 1NVQA 2IZSA 5BMSA 2XK6A 1PMEA 1ZOHA 4F7LA 5J7HA 4RJ6A 1A9UA 4DF3A 3W33A 2JD5A 4ITHA 2ZOQA 3GU7A 4EOIA 3OUNB 3BQRA 4YZBA 2PU8A 3EQIA 3GB2A 4FTAA 2ZV2A 2W1IA 3GU6A 3HV7A 4CXAA 5IH4A 3EKKA 3CEKA 4EZ7A 5A46A 5DRDA 2VTJA 1YWRA 2PZIA 3QL8A 3P08A 4FL3A 5JRSA 4QD6A 3UYTA 3FJQE 3CC6A 3EQRA 3NPCA 4RJ7A 3T9TA 3TNPC 2I40A 3FMJA 3QYZA 1XBBA 4FT5A 1FQ1B 4IB1A 2X9EA 3ORLA 3ZLYA 1XBAA 5LCJA 3QTZA 4CKRA 2FSMX 2V0DA 1XH9A 4O82A 2XCKA 3MI9A 5JFXA 2A27A 4KIKA 2F2CB 4YC3A 4M0YA 5FDXA 5HE3A 4FV8A 1JSUA 2VTLA 3LXKA 3R22A 1VEBA 3T3VA 2ITYA 4O27B 3E7OA 2QKRA 3OP5A 4HGTA 5ETAA 1OUYA 4NH1A 4L7FA 3BHUA 4NKAA 3TV6A 3PG1A 3ZUUA 3EFLA 1JPAA 1U5RA 2IJMA 3CP9A 2AC5A 5BX0A 4KAOA 4RMZA 5LMKA 2Y4IC 4E7WA 3C4CA 3JS2A 3QZHA 4OTDA 3K3JA 3UIXA 4XLIA 3DJ5A 3HV5A 3R02A 1HOWA 4D2WA 4CLJA 2EUFB 5HLWA 2C0TA 3VS0A 3ZSIA 2O65A 3PE1A 4EQUA 3MJ1A 4H39A 5I0BA 1IAJA 1YWNA 1PXPA 3IW7A 4QMVA 5JZNA 3A7JA 1YQJA 2HXQA 4BC6A 3ELJA 3TDVA 3H0YA 1WCCA 3ALOA 4PV0A 3IG7A 1EH4A 1JKSA 5IA5A 3UOLA 4FOBA 5IH5A 3IECA 5CZIA 3WYXA 3ZFYA 5L2WA 3UC4A 3UNKA 3CGOA 4WRGA 1FOTA 3ZBXA 2CNQA 4OTIA 1REJA 3TNWA 3IGOA 4ZAUA 1Q62A 4CKIA 5LMAA 4KINA 4LL5A 4CVAA 4USDA 3KCFA 4QMQA 3GXLA 4QYYA 2YWVA 1PMNA 2IVTA 3OTVA 4XV3A 3FY0A 3HRBA 4JOAA 4YLJA 1PXNA 3RAHA 1DAYA 3HMNA 1U46A 3FSFA 4L7SA 3DBEA 5A6OA 2JAMA 4TNDA 4R7IA 4ASDA 3QA8A 4YJUA 3P0MA 5AP5A 4Y73A 3R8UA 4DG2E 4E6QA 4F70A 3FI3A 4QTBA 3C50A 5D10A 2XJ2A 4UX9A 3LJ2A 2OJJA 1GY3A 3EB0A 1H26A 4BCPA 3VS1A 4RVLA 2ITQA 4RJ4A 1ZXEA 4O1PA 5E8WA 3TL8A 2BRGA 1OB3A 4JVGA 2R3IA 4II5A 5EI2A 1H1QA 1WZYA 1ZYJA 4L46A 2OF4A 4JS8A 1U4DA 4IM0A 5EYDA 5K4IA 3ZXZA 2UZDA 3LQ5A 5J8IA 4U45A 4EJNA 3QD4A 4GYGA 4DFNA 2XA4A 5DT4A 3SVVA 4FV4A 2DQ7X 3BU3A 1GZOA 3PP0A 3PTGA 4YBKA 2WHBA 1W82A 4FMQA 3LFEA 4X2KA 3V5JA 4IBMA 2RFSA 1GIJA 4I20A 4HZSA 1ZMUA 3PWDA 4ANNA 2RFNA 4QMLA 3UNJA 4DE4A 4ASXA 2QNJA 3ENMA 3C4ZA 5EQPA 4FUXA 4CFXA 4EK8A 4C35A 2WTJA 2H8HA 3OOMA 4I6HA 4DGLC 4HW7A 1YXVA 3MA6A 4JBOA 4HVHA 3Q52A 2ITOA 4IW0A 1YVJA 4OTFA 3LFBA 3NLBA 4EK3A 2QHNA 2X2LA 4FTRA 4RIXA 1GAGA 4XG8A 3SOAA 4K11A 2YIQA 2OH0E 3EN6A 4WO5A 3CQWA 5IA2A 3H30A 3KN5A 3Q2MA 1NVRA 3GU4A 2YJSA 4Y83A 3TTIA 2BRBA 2X7GA 3VHKA 3R83A 5CI6A 3Q6WA 4JDJA 4FL2A 4U0IA 2Y9QA 4FKWA 4WBBB 3P23A 2GFCA 1SVEA 2C68A 4GV1A 4OBQA 5M4UA 3QWJA 4ERKA 4EYJA 5KKRC 3VUTA 4MVFA 4F9CA 2LAVA 5JGBA 2YIXA 2NO3A 4B6LA 5BVKA 4QYGA 4FICA 2Z02A 3AQVA 3KRJA 4GFMA 4OAVB 5CASA 1GZNA 2UZNA 2V62A 4OTWA 4O83A 4L3JA 1MP8A 3VULA 3O17A 5K9IA 4YJTA 1YWVA 4QPAA 4ANQA 2Y6MA 3NEWA 3ODYX 2J90A 1PYXA 2JIIA 5EM8A 3LLTA 1LP4A 4BFMA 2CMWA 4GYIA 5G6VA 3TJCA 2R3FA 2OJGA 4W8EA 3UQFA 3SX9A 4PQNA 3ZO4A 4D0XA 3BRBA 2JIUA 5C8NA 3BLHA 3QRJA 2WQNA 5EOBA 3VS4A 4YU2A 2YLFA 3HNGA 2G9XA 3DKFA 1B38A 1QCFA 4LMUA 3BCEA 3A99A 3I1AA 3I81A 3PJ1A 4L53A 4X3FA 3FLSA 3PJ8A 3A7HA 3DBDA 3UO4A 2W9ZB 4D2PA 3RNYA 3EQGA 2VO0A 3FYKX 3PXYA 4I6FA 1M17A 1OKYA 3EFKA 3VS5A 3WF7A 4CT2A 2A0CX 3EL7A 2ZDUA 3HP5A 4BWPA 3MB6A 4BKJA 3EN4A 2VX1A 2R2PA 3FLQA 1Y57A 4A4LA 2CN8A 2FVDA 2CPKE 3MYGA 4RIYA 3EHAA 5BUIA 5C4KA 1MRYA 1H28A 4AA4A 3BYVA 2E9NA 1B39A 4K6ZA 4NJ3A 3FKOA 2JDSA 3OROA 4FSMA 5H8EA 3PPZA 3QGWA 4C2WA 5DBXA 4CV9A 4E5AX 3QBNA 4BDEA 1M7NA 3RZFA 2YIRA 5DNRA 3FZPA 3R7YA 2XH5A 1TQPA 2XK8A 1YXXA 5L6WL 4DEEA 1IA9A 1RW8A 2FH9A 4RWKA 4DCAA 4EH2A 1KE8A 2WQMA 4YSJA 2YA9A 3KMWA 4XP3A 3OWLA 2PY3A 1UNGA 2GSFA 3GOKA 5CWZA 1ZARA 2UW6A 4OTGA 5DFPA 4AZFA 2OIQA 3QCQA 3C13A 3I5NA 4UMQA 4DH1A 4NM3A 3EN5A 3QD0A 4QMMA 2ETRA 5CU3A 3R8VA 3BV3A 3NYVA 4BDAA 3MS9A 4CT1A 1SM2A 3VAPA 1M2PA 4FKTA 4BDGA 2NP8A 5C01A 2YZLA 3KK8A 3DKGA 2OXDA 2W05A 5H9BA 3GCQA 3QLFA 2O3PA 4R3PA 4J97A 2XK4A 3PIZA 3MY1A 4C4IA 2OICA 4CYJA 4I4EA 5HKMA 2REIA 4XEYA 1FPUA 2GHLA 3RAWA 4FE2A 1OIYA 3EN9A 3HMIA 2PMNX 4UN0C 4QMYA 5ACBC 3D4QA 5CF8A 2CCHA 4OUCA 4UZDA 4BB4A 3BU6A 1MQ4A 3BPRA 1QPJA 1O6KA 3N4TA 3R71A 1P4FA 4O86A 4IAAA 4BN1A 5JFVA 1IA8A 3Q60A 1H0WA 2WMQA 4D55A 3KXXA 2VTIA 4GJ2A 4C38A 2X39A 4DGMA 3QXPA 3F3WA 3E92A 4QMOA 5I9UA 3RM6A 5CEMA 3ZDIA 5J5SA 1G8AA 3O71A 3UZTA 2R3KA 4MXYA 3SHEA 4FTUA 3RBWA 4EOMA 4EK5A 2YN8A 3IW5A 2YISA 2XNPA 3UYSA 2VWYA 3V04A 3P79A 3UDBA 3VBTA 3BHHA 1A48A 4IVDA 4AE9A 4TYHB 4YHTA 4KRCA 4EKLA 4FEVA 3OW3A 3QRIA 2QHMA 5CF5A 4J96A 2XKEA 1Q4LA 2QURA 1KV2A 3B8QA 3NUNA 4I6QA 4KBCA 4RFYA 1UKHA 1RJBA 3DK6A 3L9LA 2H96A 4O1OA 4KUJA 3ZFMA 4DFXE 2UVZA 4YZCA 2VX3A
chains in the Genus database with same CATH superfamily
4GH2A 4N6YA 3FAAA 2WD1A 2J6MA 2ITVA 3A8WA 1R0PA 2R3JA 5HLNA 4O7VA 4OTQA 5IQGA 4FG8A 3CJGA 3UMXA 4ACGA 4ZSJA 5HIBA 2Y4IB 3UTOA 3NUUA 3HVCA 4JG6A 4QTEA 4E4NA 3PLSA 4O7ZA 4CRSA 4AGWA 4MAOA 2X4ZA 3SW4A 2ITZA 1LPUA 3EYGA 2XIKA 3GVUA 3LE6A 2X4FA 2EB3A 4R1VA 4WG3A 3OTUA 5HE1A 3CR0A 3SKCA 5TF9A 4L3LA 3I0QA 4U44A 4PF4A 4QPSA 4WT6A 5D12A 3R1QA 2DUVA 4F9AA 4TL0A 3JY0A 3R0TA 4HGEA 4IDVA 1MRVA 4QP3A 1V1KA 2O0UA 5AWMA 2R3PA 5HX6A 4DYMA 3UO6A 2ETKA 1RDQE 2ZB1A 1Q61A 2WTIA 4MYGA 4ZLZA 4F63A 4DEGA 3D7TB 3ODZX 4WG5A 1XBCA 3DDPA 4YNEA 5BVWA 4CV8A 2BZIB 3HX4A 1VYZA 4JR7A 3R00A 2OK1A 4CZYB 1OKVA 1Z9XA 4MH7A 5L4QA 1KWPA 4GUBA 4P7EA 5LXMA 3W8LA 3WZDA 5CANA 4CSVA 4R3CA 4LRJA 2QO9A 4BTMA 3F61A 3HUCA 3K5VA 4DEHA 4E5WA 3ANQA 3R63A 2ZV9A 3Q04A 4YJRA 1YXUA 4HNIA 3OCSA 2FSLX 4Y8DA 2F57A 3SQQA 3P7CA 3OS3A 3HKOA 4DG3E 2XRWA 1JKLA 2YEXA 1ZRZA 2XNNA 4XYFA 2UZOA 3E3PA 1Z5MA 3WF9A 1H01A 3TV4A 1NT2A 3OOGA 4ZIMA 2OWBA 4JJRA 2PUUA 4PRJA 3TZ8A 3ZC5A 3E62A 3R04A 4O4FA 5FRIA 2ZJWA 3I7BA 4F0FA 4Q5EA 4UWYA 2CGWA 4Y95A 3KXMA 3MIAA 3Q2JA 5CI7A 4GCJA 3R2BA 4AN3A 2CKOA 2PUIA 4ZTLA 4E20A 1ZY5A 4MUQA 1Q8TA 3NIEA 5IKWA 3KF7A 3R1NA 2BAQA 5CLPA 2R4BA 1FGKA 3BLQA 2PTKA 5EW3A 3LXLA 4OBOA 4TWCA 1XH6A 2W1DA 3DV3A 3PY1A 4TYJA 3R8LA 3BELA 3RINA 4FTTA 3TUDA 4GSBA 4HVGA 4QTAA 3FPQA 1JNKA 4TPTA 3V6SA 4XNEA 3ZHPC 4GVAA 2J5EA 1YXSA 3N51A 3E8CA 3R2YA 1ZWSA 4F9BA 2BFYA 4RC4A 4FTIA 3Q9XA 3D5XA 2WOUA 5HEZA 2X0OA 4IZYA 4MXZA 3SD0A 4FKPA 2WFYA 3ZM9A 4KD1A 5I9VA 3ATSA 5LVNA 3NZ0A 3DB6A 4FKOA 4FR4A 4Y5HA 3JUHA 3S0OA 3ENHA 4R3RA 2A1AB 4FEXA 5HVKA 3CPCA 3GENA 5FM3A 3RHKA 3EZRA 5IQBA 5M08A 2RG6A 2PL0A 2XNGA 5JQ8A 3KRRA 4EI4A 5KKRB 4XG3A 5DVRA 4LGHA 4NKSA 5EYKA 1FVVA 1Q24A 4FC0A 4HPTE 1Q8ZA 3F82A 4I0SA 3TJDA 3NUPA 3RGFA 1XQZA 4V04A 3TWJA 3HLLA 4PMPA 1SNXA 4EHVA 5AV2A 2C6IA 5AIRA 3ZUVA 4ZTNA 3MESA 3QCYA 3W16A 3GI3A 4NFMA 4HYSA 3FC1X 5HQ0A 4IVBA 4ZZNA 5CU0A 4XG6A 1IAHA 4Y5QA 3UNZA 4PUZA 5AUVA 1IASA 1PKDA 3ZTXA 3GEQA 3M1SA 4YC6A 3VUKA 1R3CA 2OZAA 4DEIA 4L00A 5IG1A 3FZ1A 3NWWA 3D9VA 3VUHA 2RIOA 5AFVA 5E8YA 2PVFA 3ANRA 4LL0A 3JY9A 4O4CA 3Q53A 5M4FA 4MXAA 3NS9A 5TT7A 1FMKA 3HYHA 3LHJA 4FKLA 3AC3A 2ZM1A 4ZTRA 3LFDA 1U54B 3R28A 4CQGA 4F0IA 4W4YA 3O96A 4FTJA 3QUPA 1XHAA 4RIWA 1HCKA 4D4RA 3MH0A 4B9DA 1URWA 3TI1A 2UW0A 4AG8A 4DFYA 2VTOA 4L67A 3ACKA 2EVAA 4G6LA 4F6SA 4IWDA 4M84A 2GNJA 5ICPA 4HVSA 3VN9A 3GQIA 2NRUA 4U7ZA 1PY5A 4C36A 4H3BA 4I5CA 2GPHA 5KMOA 1J7UA 3TYKA 2FSOX 2GHGA 3HUBA 5K4JA 3IDPA 3QZIA 4Y46A 5DG5A 5D1JA 4RRVA 2ZDTA 1BI7A 4AA0A 4R77A 3W0QA 2BTRA 3W18A 1WBTA 3EH9A 4YZ9A 4ZTHA 1OIUA 2JKMA 1FGIA 2J2IB 4FT3A 4L44A 5DWRA 2OZOA 4TYIA 2C6OA 5CSHA 4WBOA 4BCFA 2BILB 5DR9A 5BVEA 4O7RA 1WFCA 2X6DA 4JXFA 2FO0A 3ZYAA 3B2TA 4GUEA 4ACCA 3SG8A 4TN6A 5L2SA 4IADA 5CENA 4UMUA 1OKWA 3NAYA 2Z2WA 2R5TA 3EKNA 4WUAA 3V6RA 2C6LA 4YUQA 4GKIA 5AIKA 1XKKA 3V01A 4OT5A 5BVNA 3FMKA 4YJQA 2QU6A 3QQKA 3U51A 2YFXA 4EOLA 5M06A 4NSTA 1S9IA 3TIZA 3PZEA 2BVAA 4KBKA 4NM7A 4ONAA 3AGLA 3BLAA 2EXEA 3IDCA 1H00A 3HA6A 3AC2A 3LFAA 4IDTA 2OJ9A 2BDFA 3FC2A 3WF8A 2Y7JA 4FZ6A 3PUFC 2XKCA 3PE2A 1YHWA 3C0IA 3F88A 4J99A 4F7SA 4N57A 2WKMA 2W17A 1KE9A 3LCDA 4IANA 5D11A 4O91A 2QU5A 2W4JA 4C8BA 4BCIA 4EORA 4TWOA 4IX5A 5KX8A 2OJIA 4E6AA 4EYMA 3DQWA 4TY1A 4EHGA 4E1ZA 5C26A 2G15A 2G2FA 2QOQA 3BGQA 3VO3A 4BCMA 3ROYA 2GFSA 1ZYLA 3DFAA 3AD4A 5IQAA 4FTMA 3DAKA 4NCTC 3G51A 4C4GA 4CTBA 4F65A 5FBNC 3U8WA 2WQOA 2QOIA 4JQ7A 5HTIA 2WTCA 2X0QA 3NX8A 1M7QA 4UXQA 1OPLA 3RPVA 3ATTA 4BHNA 3MW1A 1Z57A 4LMNA 2YCFA 5KCVA 3CGFA 2CJMA 4JG8A 5A14A 4N0SA 3G5DA 4DFUA 3UBDA 4I5MA 2I0YA 5FTOA 3R9DA 4C02A 3IDBA 1ZOEA 3D83A 4PTCA 2WU7A 4A9UA 4AW2A 4E3CA 3N4VA 3RAKA 5AA9A 3P86A 5AJQA 2VX0A 3D14A 3G0FA 3ORTA 4XOYA 3L1SA 4HVIA 3OXIA 3Q96A 2PULA 2UZUE 1OECA 5FXSA 4BDBA 4MD7E 3O7LD 4GIHA 3WZKA 4BIDA 4O7WA 4UEUA 2HW6A 4BCNA 3TM0A 4HYHA 5CEQA 4Z7GA 5IEVA 2AQXA 3BBWA 5IISA 2C30A 2UW3A 4RFMA 4FSNA 2R7IA 4O0SA 3UDSA 2NPQA 4YTIA 2H9VA 5K5XA 5HG9A 5M4IA 4DAWA 2W1CA 4ANOA 2I0VA 4O81A 1MUOA 4O0XA 1K2PA 5EYCA 1FVRA 3LJ1A 1DI8A 4L6QA 3DXPA 2W7XA 2JLDA 4BIEA 3IONA 3E64A 4O4BB 3TUBA 2VTRA 3QA0A 4FGRA 4YJSA 2VU3A 4XHKB 4F9WA 2IVSA 3ZBFA 4CMUA 4QMPA 1OM1A 4FF8A 5EOLA 5HBEA 5M56A 4MX9A 4FSYA 2W5AA 3BYMA 4CZTA 3KREA 5E9EA 1KUTA 2OIDA 3R9RA 4OBPA 2HZ4A 4R8QA 4RX8A 4CKJA 5LOHA 4ZS0A 3Q4ZA 1K3AA 2R0IA 5DE2A 3ET7A 3KXZA 3NNUA 3UQGA 3UPXA 3QRUA 4YHFA 3ROCA 3QCXA 4GFGA 4XH6A 2G2IA 5C27A 1UWHA 5KMJA 4IC8A 4QMNA 1UKIA 3QQHA 2Y6OA 4CFWA 3S95A 4RX5A 5JQ5A 2P2IA 4RX7A 3R7IA 2AC3A 4YGAA 1ZY4A 2W99B 5A4TA 2YABA 3VBXA 4U9AA 4GJ3A 2O2UA 4NTTA 4IAYA 5KZIA 4GL9A 3UJGA 4DTKA 5JGDA 4GU6A 2PVKA 2PZPA 3ZEPA 4O96A 4D9UA 5F9EA 4F6UA 1GZ8A 2GTNA 3EL8A 2BMCA 3HGKA 1O6YA 4DEBA 5M57A 2B0QA 1U59A 3O50A 3E5AA 2X81A 1MQBA 4JMQA 3RAIA 1P2AA 3TIYA 4D2TA 5F1ZA 2WMSA 3C4WA 3TZMA 4DCEA 4H3PA 1PXJA 3PY3A 1CKIA 4IQ6A 4I21A 5L3AA 5BMMA 4H36A 3V5LA 4M13A 3NIZA 3ZCLA 2XNBA 3PFQA 3QZFA 2P33A 1OMWA 3THBA 5A9UA 3GU5A 3QTUA 2YDJA 5AP1A 2XM8A 4QQTA 3KU2A 5DHJA 3C4XA 1UV5A 5KO1A 3MTFA 3CTQA 1GJOA 3DFCB 4MXCA 5AADA 2F49A 2WTDA 4ANSA 3PSCA 4GVJA 3C9WA 3R7GA 4FI1A 4ZTMA 5GNKA 5HG8A 3WF5A 4ZSGA 5EFQA 3VF9A 4N6ZA 3UIMA 4OAUC 2HAKA 2VWIA 4S30A 5E91A 3BGPA 4EK4A 2Y0AA 4WHZA 4FJVA 4AXDA 3NFFB 2A4LA 4BTKA 4BDKA 5DH3A 1P5EA 1PKGA 1OIRA 3CBLA 4RVMA 4RA4A 4HCUA 1R1WA 3EQHA 3KGAA 3MVHA 5BQ0A 4M14A 5HBHA 4W4VA 5E8XA 3CIKA 4NT4A 4O7NA 3QQGA 4QP9A 2PE2A 4HZRA 5CSPA 3TZ9A 4QMSA 3CLYA 2VTMA 3NFGB 2HWPA 1BKXA 3Q5IA 4IHPA 3HAVA 3H9OA 3E93A 3P7BA 4OGRA 5E8TA 4BIBA 4PX6A 3QRKA 3DPKA 4QT1A 4CLIA 3FPMA 3Q9WA 1KE5A 2JDOA 2XAMA 5AP2A 3ZZWA 4CD0A 2F9GA 2QLUA 5HO8A 1S9JA 3FKNA 3Q5ZA 4EH7A 3NSZA 2Z7LA 1LR4A 3ZLWA 1ZZLA 4Q9SA 1NXKA 3DS6A 3Q32A 2QG5A 2IW6A 3E63A 2ONLA 3FMLA 3PRIA 4F4PA 1ST0A 5JGAA 1H08A 2QC6A 4A9TA 5C9CA 3KB7A 2VWUA 3EFJA 2ITWA 2JBOA 3PZHA 4D4SA 2OXXA 4LRMA 3O8TA 3RK7A 4O7LA 2FGIA 3BHYA 3POZA 2UW9A 4TKSA 1I44A 5K3YA 1KE7A 1WVYA 4FNWA 3ZM4A 2AYPA 3I5ZA 3IOPA 3MTLA 5T6KA 2C6EA 1URCA 4YTCA 2VTHA 4U79A 4ASEA 4CQEA 4ZY5A 1YXTA 2SRCA 4L8MA 5AA8A 3BWFA 4DLJA 3UP2A 3EJ1A 1YKRA 4YJOA 3UE4A 2PVJA 3UG1A 3DXQA 3MBLA 3BX5A 4GT3A 2J0LA 4QQ5A 3LFFA 5CSVA 5AX3A 3V5QA 1PJKA 5KUPA 3U54A 1XWSA 1H1RA 1UU7A 1VZOA 1WBPA 2X0PA 4BDJA 1OGYA 3L9PA 5DYJA 3FHIA 2XS0A 4A9RA 2J7TA 3DJ6A 3MY5A 4EEVA 2YWPA 5GZ9A 3WE8A 5HOAA 2F2UA 2C6DA 4TXCA 2GS7A 5B0XA 4C3FA 4D1SA 3M2WA 2Z7QA 2WQBA 4S32A 2IEWA 5G1XA 4NU1A 5E1SA 3BYOA 3NDMA 4XCUA 3SXSA 5HTCA 4GW8A 4LV7A 5A3XA 3FMHA 4CRLA 1JBPE 1XO2B 3QKKA 4F6WA 4UMPA 4S2ZA 1E1XA 2XJ0A 4TYGA 4RG0A 2F7EE 1WBWA 1GIIA 3D15A 3LQ3A 5C4LA 2QR8A 2PMLX 5J9LA 5D41A 4FTOA 4ZOGA 3U9NA 3SXFA 2GTMA 2PVYA 2PVNA 3KXHA 3P1AA 3KKVA 5EI6A 3ORXA 2QOOA 4AOIA 4X0MA 4IZ7A 3DQXA 5I9XA 3CD8A 4RLLA 4XG4A 4R7HA 4YPSA 4JR3A 4H05A 4O0RA 2BCJA 4J8NA 1YDRE 2WNTA 5E7RA 4ANMA 3O51A 1H1WA 4D28A 2HXLA 5CT7A 3OC1A 1M2QA 4XP0A 4RLKA 5AP0A 4AP7A 3FDNA 1SZMA 2OG8A 4KS8A 2HZNA 4X3JA 3W2SA 4NIFB 4A9YA 3DZQA 2VGOA 4YJVA 5AP6A 1Q8YA 4EONA 4DTBA 3L8VA 4OR5A 3MGYA 3NYOA 4LGDA 4J1RA 2PUNA 4EC9A 5BNJA 2IPXA 4BCOA 5J1WA 4IB3A 5FXQA 2YJRA 3MJ2A 1E9HA 3PUPA 4YHJA 2J0MB 1CSNA 1H1PA 1WBVA 2C1AA 2QOBA 5B7VA 5JEBA 2PSQA 4O7TA 4GK2A 3VW8A 5CAUA 4TYHA 2GU8A 5I9YA 3RWPA 3PRFA 4FKGA 2HY81 4I92A 3SC1A 4CCBA 4EH8A 3ORMA 5DEWA 2QOFA 5CXZA 3E3BX 5I3RA 4FVPA 5IPJA 5JRQA 1OITA 3NGAA 4I5PA 4KKHA 1M52A 3GCVA 4RZWA 5GHVA 3OW4A 3QQJA 3SRVB 4DH7A 4F7JA 5BUJA 2XBAA 2JKQA 3KRLA 2CGVA 2VWBA 3Q3BA 5EQEA 2OI4X 2VO6A 1TVOA 3VS3A 5DT3A 3CJFA 4MWIA 4ANLA 5CEOA 5GJFA 4TWNA 4XBUA 3MDYA 3FXXA 3ZLSA 4G3EA 2YM3A 3OBGA 4O2PA 4Z3VA 4KKEA 5A4QA 5IA0A 4EKKA 2YM5A 5IMEA 4YR8A 1Y91A 3EMGA 5HIEA 3U55A 3PXQA 2B4SB 4PMMA 2A2AA 4ENXA 3DA6A 2BIKB 5TR6A 3NUYA 3S00A 2E9PA 4RC3A 1QPCA 1WMKA 2B1PA 5CNOA 1ATPE 1IG1A 2VAGA 3C51A 4EC8A 3FLYA 4UXLA 5FUTA 1PXMA 3COHA 2BFXA 3UP7A 4C4HA 2XIYA 3CKWA 5FG8A 5L8LA 3OFMA 3WARA 3DNDA 4QQJA 1WBNA 3WIKA 3WZJA 3NAXA 5E8UA 3C7QA 3EQDA 4CYIA 3TTJA 2R3GA 3F3VA 2V7OA 4X6RA 3QTRA 1JVPP 4FZFB 4U80A 4DFBA 3QCSA 2GNLA 1R39A 4JG7A 1GNGA 5JK3A 3SXRA 2YLEA 3C4EA 3IOKA 3D7TA 5L2TA 4PTEA 2UZTA 5M53A 4FV5A 3PPKA 4RIXB 3DTCA 4MTAA 4FZ7A 4ZJIA 2UW7A 4KSQA 3BHVA 3W2QA 3QUDA 5AAGA 1W8CA 4G9CA 4E26A 4U5JA 3DZOA 5FLFA 3O8UA 4U97A 3A4PA 3WI6A 2IO6A 2VN9A 4IB0A 4UALA 4I94A 3DB8A 4ANBA 3I7CA 3MVLA 3QRTA 4AT4A 4KBAA 4AE6A 3UOJA 4FVQA 5I5ZA 3UZPA 4I6LA 3PY0A 2P4IA 5CAQA 4FV0A 3OCTA 5HNBA 4EUUA 4V0GB 2IF8A 4DEAA 4IH8A 4R5SA 4JRNA 1JKKA 3BL9A 4AZTA 4EL9A 1QPEA 4I22A 4M68A 5J79A 2Q0NA 2OO8X 1WBSA 3FZSA 3NUSA 3PXKA 2ZV8A 3QQLA 3BV2A 3SW7A 1YHSA 4MBJA 4W4XA 5HTBA 2OGVA 2JGZA 2IZRA 2QCSA 2QLQA 2GDOA 3AT4A 4AGCA 5ANKA 5LWMA 2Y4PA 4R7BA 4XRLA 4RJ5A 4I5HA 3H9FA 4L9IA 5AUWA 2VTSA 5ANGA 3RNIA 3GCUA 3W1FA 4OW8A 3QUEA 2C0OA 5HLPA 2QOLA 4XX9A 3VIDA 5CU2A 4V05A 3R8PA 3ZH8A 5M4CA 1VLRA 3TEIA 3I0OA 3W0NA 2PZ5A 3PXZA 3K2LA 5KNJA 3LKMA 2UW8A 3OUKA 2NNWB 2XNOA 4BWKA 4E73A 3R1SA 4JAJA 4I3ZA 4L45A 3RCJA 4FYOA 2PVMA 4NM0A 3PXRA 4XG7A 2WIHA 1X8BA 3FI2A 2YDKA 4IEBA 2O63A 4EWHA 3QKMA 2XNMA 3AMBA 4QO9A 3GFWA 3KXNA 4QMUA 1YHVA 4FIFA 3P4KA 3QQFA 3LJ0A 3ORKA 4FKIA 3QTQA 3QALE 4IIRA 2C3KA 5LVOA 4G6OA 4FSUA 3UG2A 3HP2A 4FK3A 4JDHA 2JAVA 5FEEA 3NCGA 4XV9A 3SDJA 3JR1A 3KMMA 1IR3A 3LW0A 3OWPA 4HCTA 4CMOA 1GIHA 1ZOGA 5L8KA 3BGZA 2YITA 5FD2A 4XLVA 4UB7A 4RWJA 4R5YA 4BKYA 4FV6A 3PSDA 4GIIA 3F2RA 3R21A 3WBLA 3ZEWA 1ZAOA 4ID7A 4Y72A 4PWNA 4EH6A 3NYNA 3W32A 1CKPA 2IVUA 5H8BA 3OWKA 4IVCA 2R3LA 3KRWA 2ZAZA 2XIZA 2X7FA 4IX3A 4IB5A 4TNBA 4F99A 4AN9A 4QMTA 4CFVA 5CU4A 2YZAA 5H3QA 3NR9A 3U6HA 3EQPA 3QWKA 2XBJA 2VTTA 3D2KA 4BWXA 4FSRA 4MNFA 2AUHA 1U54A 1BX6A 4GG5A 2GMXA 2WMBA 5DGZA 5E90A 5EDPA 5IH6A 1Q41A 1L8TA 3II5A 4LV8A 4GFOA 3JVRA 2F7ZE 4APPA 3FV8A 2KTYA 3P9JA 5I9ZA 4BTJA 4EZ3A 5HZNA 4BY9E 4FV7A 3B8RA 1VJYA 2WU6A 2XUUA 1DAWA 3C4FA 3KVXA 2CNVA 5A4LA 4MD9E 3KMUA 3OEZA 1IEPA 3LAUA 4BHZA 1DI9A 2YM8A 2QG7A 4D2SA 5M09A 1GZKA 3ZDUA 3VJNA 2XMYA 3AKLA 4NYEA 3I4BA 2J51A 1UVRA 2W5BA 3OMVA 4U41A 2IZTA 3E8DA 4OLIA 4Z55A 3FL4A 4RJ8A 5IA3A 4DT8A 3H4JA 2GHMA 4BICA 5IEYA 4O22A 4WSYA 3ZS5A 2ITPA 3DBFA 4P4CA 4PDOA 4DDIA 4M69B 1FVTA 3REPA 5L8JA 3COMA 3DKOA 4QTDA 2HENA 3NW6A 5HCYA 3OY3A 3UIBA 5LVMA 3ZO3A 1PMUA 3GOPA 2Q83A 5CNNA 3FL5A 4E6CA 3FMMA 3QD3A 2QO7A 4DH5A 1XH4A 1O6LA 2C3JA 3F5GA 5HVJA 5JN2A 4XMOA 5IDPA 4NW6A 4BZNA 4AACA 4K1BA 4DHZA 2V5QA 4K0YA 2VUWA 1SYKA 1CKJA 3G6GA 5J1VA 2CLQA 3AD5A 3JVSA 4K18A 2GQSA 3FLZA 4FIEA 4ZLOA 4TYEA 5I9WA 4D0WA 4D1XA 5K0XA 5EHLA 1CTPE 2JFLA 1Y6AA 5AR5A 4LV5A 4QP1A 4RA5A 1YDTE 5HE0A 2JKOA 4LRKA 3V3VA 2XJ1A 3AC8A 3PLAE 3DAEA 3D2IA 5M51A 2BAKA 4UV0A 3CE3A 5A54A 1J3HA 1B6CB 4LM5A 5EW8A 4YO4A 5DRBA 4AQKA 4ZXTA 3QTWA 2VTNA 3V5WA 4DGNA 4EH5A 1NY3A 1TKIA 4Z16A 1OBDA 4F09A 3G9LX 3IGGA 4D5HA 4JLCA 3KC3A 3RWQA 5LJJA 3AC1A 2O8YA 3DK7A 5HCZA 3WF6A 4AX8A 3WYYA 4YLKA 3AKJA 4RJ3A 5ITAA 3NNXA 1W0XC 2QVSE 4KIQA 3ZONA 4FEUA 4MEDA 4FIIA 5FGKA 4DBXA 5D7AA 2UZBA 3TT0A 4U3ZA 4C3PA 5HNIX 2BTSA 4AN2A 5IMXA 2BRHA 3AOXA 3MPAA 3F5UA 3ORIA 4ZZMA 5CU6A 3N9XA 3KQ7A 2J0IA 3QAME 3U4UA 4BDIA 4EOKA 4YBJA 5CS6A 2OH4A 4PPAA 4P90A 5HI2A 2WTVA 4D4VA 3UDTA 2VNWA 4XUFA 3DNEA 5ACKA 4QDEA 4APCA 4EQMA 3LMIA 3ML1A 3LMHA 4IVAA 2X0GA 3BI6A 3HA8A 4FSZA 3FMDA 3HV3A 4BDCA 2Z7RA 3UVQA 1UNLA 3LFQA 5CXHA 4DITA 4M97A 4U81A 4LGGA 4G2FA 3PYYA 4PY1A 3FLWA 4KWPA 4ITIA 5DR2A 4PPCA 2DYLA 3E8NA 2CLXA 4IWOA 4ZTSA 3TDWA 3F3ZA 4M0ZA 5TKDA 3UOHA 4KS7A 4R1YA 3NVKI 3TKHA 1SMHA 4G34A 3F5XA 4C4EA 4J53A 4G1WA 4CG9A 4BZDA 1W2FA 4HVDA 2WPAA 3QC9A 4KIOA 3F3UA 1YOLA 5F94A 4BVUA 2QI8A 2ITXA 3Q6UA 2GS6A 3SAYA 2ZV7A 4HGLA 2ITNA 4ZSLA 5DMZA 4H1MA 2BZHB 5IEXA 3VS2A 2UZVA 4WIHA 1XH5A 4MF1A 2HZ0A 3D5UA 1RQQA 2WELA 4FGBA 3ZMMA 4C4FA 1SVHA 2XCHA 3FQSA 4G5PA 2VO7A 4KB8A 2KULA 4X2JA 3VONA 1Q99A 4YJPA 3GBZA 2ZYBA 2Z8CA 4AGUA 4EUTA 4DBNA 3GCPA 1UA2A 4XS2A 3L8XA 2ESMA 3BYSA 5K0KA 3WZEA 2PE0A 3BIZA 4QP2A 3RKBA 4F0GA 3RTPA 2UZWE 5FP6A 3VW6A 1XJDA 3P5JC 3G33A 3OF0A 3L9MA 3G0EA 2Q0BA 3R9OA 4O0WA 3D5WA 5LMKC 4QP7A 3KEXA 4ITJA 2XNEA 2VWXA 3R8MA 3AGMA 3MH1A 3GP0A 3TNIA 3OZ6A 5LQFA 4JX3A 2XKFA 4O38A 5J95A 4RZVA 1XMLA 3KN6A 4G3GA 3E87A 3POOA 4D58A 4TW9A 4O2ZA 2CSNA 3P78A 3ERKA 5L6OA 4YBKA 4ARKA 5A6NA 5FDPA 2NYAA 3BL7A 1YRPA 5BPYA 3CTHA 3ZC6A 2W96B 3KVWA 4E4XA 1BLXA 5KE0A 4FV1A 3S4QA 2VWZA 1PXOA 4C62A 4CCUA 4DHIB 1WAKA 4RFZA 2WTWA 2XYUA 4MNEB 3ORNA 1F3MC 3AD6A 4W9XA 2X6EA 4AF3A 5IQCA 4NFNA 3H10A 1XH8A 4FUYA 2I0HA 4QNYA 4GK3A 1REKA 3BQCA 3AT2A 5CSWA 2OXYA 3R7VA 3RMFA 4ZJVA 5C8KA 4FKUA 5IQIA 2RF9A 1UU9A 3O23A 2OIBA 3VBWA 4BCJA 2XKDA 5C1QB 1G8KA 4DEDA 2V22A 4D2VA 4XV1A 1AQ1A 5E8SA 4O84A 4O21A 4DINA 4UWBA 3L8SA 4ZMEA 3U9CA 3PIYA 4AXEA 1KE6A 4TT7A 3FZRA 2R0UA 2PWLA 4CFUA 3DDQA 3HRCA 4BGQA 1OGUA 4XRJA 5ETFA 4C58A 1STCE 2R3QA 4FTCA 2YAKA 2HW7A 3QTXA 4RWIA 1Y8GA 3NVMB 4RX9A 5AUXA 4M67A 1LEWA 3BE2A 4AW0A 4QDVA 3EQFA 2WMVA 4AA5A 1DS5A 3U6JA 2HY0A 4IFGA 3TG1A 3CXWA 3FI8A 3CQEA 1ZMWA 3GNIB 3PG3A 2JDRA 4MK0A 4U6RA 3LXPA 4LUDA 5CVFA 3PVBA 2I1MA 4BL1A 2F4JA 4EH4A 2RSVA 3ZXTA 4A06A 1YI4A 2QQ7A 3ID6C 2B9JA 5EW9A 3MIYA 4NUSA 3TNHA 5EM5A 4EBWA 3GC7A 4YZNA 3T9IA 4EJ7A 2XP2A 3LCSA 4IZ5A 4RSSA 4FA2A 5FBOA 4LOPA 1FBNA 1MRUA 3IW8A 2JKKA 5EG3A 1PHKA 3LOKA 5KMKA 3C5IA 3TKIA 4CGAA 4BYIA 3FEGA 5JFWA 4DGGA 2JFMA 5AR7A 4QTCA 2IW8A 2C3LA 4A4OA 4BTFA 1TQMA 2FYSA 4DN5A 4C37A 4EK6A 5AEPA 1NVSA 1R0EA 4ACMA 4ZK5A 2BRNA 5J9ZA 2C5NA 2VTQA 4IAIA 4F08A 3KY2A 4YP8A 4IM3A 4NZWB 3UO5A 4FIHA 4O7SA 4M12A 1KSWA 4MBLA 3PP1A 3A2CA 3ACJA 3BWJA 4X21A 4ERWA 4HJOA 3UIUA 4RPVA 3FXZA 5JMSA 4ZS4A 5DA3A 3QXOA 3VUGA 3TN8A 2EXCX 2R7BA 3MVMA 1BL6A 1OL6A 3ZZEA 4TRLA 5ANIA 5L2QA 3W0OA 2ZM4A 3KF4A 5IZFA 3EOCA 1BMKA 2RFDA 1FINA 4C0TA 2UW5A 4W4WA 5AAEA 4NJDA 4WNKA 1JSVA 4YO6A 4G9RA 3DBQA 3DT1A 3GC0A