4DH7A

Low temperature x-ray structure of camp dependent protein kinase a catalytic subunit with high mg2+, amp-pnp and ip20'
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
336
structure length
333
Chain Sequence
VKEFLAKAKEDFLKKWETPSQNTAQLDQFDRIKTLGTGSFGRVMLVKHKESGNHYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMVMEYVAGGEMFSHLRRIGRFEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGFAKRVKGRTWLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFATTDWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEEEIRVINEKCGKEFTEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/transferase inhibitor
molecule keywords cAMP-dependent protein kinase catalytic subunit alpha
publication title Low- and room-temperature X-ray structures of protein kinase A ternary complexes shed new light on its activity.
pubmed doi rcsb
source organism Mus musculus
total genus 109
structure length 333
sequence length 336
ec nomenclature ec 2.7.11.11: cAMP-dependent protein kinase.
pdb deposition date 2012-01-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4dh7A01
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4dh7A02
2IZSA 3NLBA 3FI4A 3AT3A 3RK5A 2VWIA 4NKAA 2QG5A 4G6LA 5JGDA 5EQPA 1OIUA 2FB8A 4ACDA 3P7AA 5FBOA 4PPBA 3KN5A 2CLQA 1OZ1A 3RKBA 2J7TA 4D2VA 5C1QB 2VWXA 4G6OA 3F3ZA 4F9AA 5EKNA 3OT3A 1NVQA 1OI9A 4YJPA 5E8VA 4L8MA 3EKNA 5H9BA 1XH7A 4BDEA 5FD2A 2H6DA 4Z9LA 5I9ZA 1XKKA 3KCFA 3V5WA 4FOBA 1H1RA 2C3IB 2JBPA 4WNPA 2PVRA 4DINA 2BFYA 4LV5A 4HVGA 4YURA 2BR1A 3LCTA 2XM8A 3V04A 3MVJA 3QTXA 2PZPA 3Q5ZA 1OKZA 4PNIA 2HW7A 3SRVA 4CRSA 3TDWA 5J1WA 4O2PA 4X6RA 4AGCA 4DH3A 3U51A 2YCSA 3HAMA 4PQNA 2WTWA 4C3RA 5L6PA 1ZMVA 5AUVA 3R7EA 4FI1A 4X3FC 1Y57A 3SXFA 4EH6A 4L68A 2PMNX 3QX4A 3E63A 2QC6A 4FSZA 4FUYA 1OIRA 2YN8A 4RWIA 4WSQA 2IW9A 3VUDA 3O50A 3W2PA 3FLQA 4CFUA 4DFUA 4AW2A 4H1JA 3ZZWA 3NUUA 4F0GA 3S0OA 4TYEA 3VQHA 5CY3A 5HBEA 3ZUTA 4RWLA 4EH8A 2W96B 3QZGA 1GNGA 1U46A 4HW7A 2UVYA 4FICA 4R7HA 3VBWA 2AYPA 1IRKA 4IVBA 1NY3A 4QP7A 3QRIA 5CQUA 5H8EA 5DRDA 4BVUA 3KRXA 4C7TA 4O83A 2IVVA 5HX8A 3FPMA 2XCHA 5I9XA 1U5RA 5BUEA 5AP2A 4ANBA 3VS7A 3WZKA 4B8LA 4NCTA 3RAIA 4D0XA 4RIWB 2HELA 4GFGA 5KKRC 3DBEA 3GU4A 2NO3A 1A06A 3F5UA 3TZ8A 2VWZA 2OIDA 3NVMB 2RIOA 3D5XA 4O0XA 2BDFA 4NTSA 3IG7A 2E9PA 4K9YA 3EWHA 4RWJA 3BYSA 5TE0A 4G31A 1H4LA 3DB8A 1R39A 1Q8TA 1FMOE 3IW6A 4IAAA 4DTKA 2J0LA 4D4YA 4UN0C 5IZFA 2F49A 2ZMDA 4OTIA 4MQ1A 5LMBA 4JI9A 4M97A 5LWNA 3NW5A 1Q97A 1Z9XA 3UQGA 2FSOX 3ATTA 2NRYA 4BR3A 2WZJA 1P5EA 4V0GB 1PXPA 4CT2A 4AXAA 4AOIA 3VS4A 2O0UA 1PKDA 5ANEA 4C62A 2OGVA 2IVSA 3GP0A 3OUNB 2XK8A 4NKSA 4QT1A 4K6ZA 3W8LA 4I3ZA 1V0BA 3ROCA 2C6DA 3W2RA 4D2PA 4EK4A 3MY1A 4AACA 3G5DA 3TJCA 2X81A 3BYVA 3QD3A 5A54A 5LXMA 4I6QA 3HV4A 5C27A 4GK3A 1I09A 4GFOA 4NW6A 4X2KA 4QTEA 4QMVA 3BU5A 2WQMA 3DXPA 4JDJA 1QPDA 1QPEA 3OMVA 4GG7A 1YI6A 4FKRA 2BKKA 1YHVA 2OJGA 3VRZA 5FXRA 1KE9A 3V5LA 4YNEA 4FTIA 4KIKB 4D4SA 5L3AA 2PL0A 3Q4ZA 1IA8A 4QMTA 4Q9SA 3UOHA 5EG3A 4A07A 3FQSA 4GK2A 4PRJA 5CAVA 4MQ2A 4EBWA 3GT8A 3KU2A 4OTFA 5D7AA 3ZBXA 4QP9A 3F5PA 3GB2A 4KKGA 4RLLA 4O7YA 4U43A 3ZO4A 1ZMWA 2PY3A 5F9EA 4TPTA 4EH4A 1SVEA 2VTTA 3GGFA 4ZTNA 5CT0A 4EHGA 3MSSA 4KSPA 4DFBA 3C13A 1PXKA 4KBAA 4BN1A 5IUHA 2PWLA 1BL6A 1HCKA 2XRUA 2BZHB 3DAJA 4XCUA 3R04A 4F6WA 1QMZA 2UW8A 1B39A 4I4EA 4KBCA 3DTWA 3OWJA 1YW2A 4AGDA 4FTAA 3EL7A 3HV3A 2UW7A 3PJ8A 5ACKA 4Q9ZA 2C1AA 3UQCA 5EM5A 4LQMA 3NUSA 3FI8A 2UZUE 5HE2A 3VN9A 3I4BA 4BRXA 3MI9A 4ZLZA 3VS2A 5M4FA 4X0MA 4LM5A 1H0VA 5D12A 3EQBA 1W7HA 3EYHA 5EW3A 3OZ6A 4CZUA 3RCJA 4G5PA 3R1QA 4TZRA 5IA2A 4WOVA 2QVSE 5E7RA 3NZ0A 3PIZA 3R28A 1WBPA 2BMCA 2WQBA 3OCBA 3A62A 4MWHA 4NM5A 4WSYA 4RSSA 5TR6A 2I6LA 4MAOA 4JJRA 5IEVA 3Q9YA 4L7FA 2C6MA 3FDNA 3TZ7A 3PVUA 4QYHA 1U54B 5HO7A 5AIKA 3JVRA 3R2YA 3PIXA 1Y6AA 3UVQA 5IMEA 4TN6A 5FEDA 2BIYA 3PLSA 3QGWA 3BHYA 2WTCA 2P33A 4IADA 5LCKA 2ZV9A 2REIA 2W1ZA 4KIOA 3WOWA 4AA0A 3TNWA 3LMIA 4FV9A 4N70A 2UZBA 3PVWA 3K2LA 1W0XC 2XYNA 3UO5A 3Q4UA 4FIGA 3KXZA 4AFJA 2QHMA 4EH2A 5HI2A 4F09A 4E6DA 2OKRA 3CD8A 2J2IB 3FI3A 3QL8A 4RFMA 4EQUA 4FZFB 5JGBA 5I9YA 4K18A 3TUCA 3ACJA 4R7IA 5HLPA 1XJDA 3Q53A 2PK9A 4RRVA 5I5ZA 3N9XA 2Q83A 1MRVA 4EJ7A 3C5IA 3GOPA 3DQWA 3ORZA 3FI2A 3E7OA 2OO8X 1H00A 4EOIA 3LFAA 2O64A 1XBCA 3VUTA 1PMUA 4H3QA 5IQCA 1FGKA 3RNYA 3FHRA 2OFVA 3RHXA 2R3RA 5HZNA 1OPKA 3A7JA 4M0YA 4MXYA 2R3IA 1YOMA 4XUFA 2CNQA 2GNGA 4BF2A 2WMXA 2IWIA 3BV3A 3FZ1A 4WUAA 3K3IA 2YM8A 3KRRA 4FKPA 4E6AA 5HTBA 1OL2A 4NTTA 3CP9A 3V8WA 4D1SA 4FEWA 4EHZA 4U45A 5GZ8A 4C4HA 4HCUA 1XHAA 4IC7A 2G01A 2R3NA 3B2TA 4MF0A 4O2ZA 4V0GA 4M14A 4ASZA 3DLSA 4R3CA 4H1MA 2VTLA 4BDCA 3FLYA 1YVJA 3LFNA 3FLZA 2VO6A 2XK3A 3FXXA 4GT3A 5FRIA 5TO8A 4TW9A 2X0GA 2I0HA 5K0KA 3TKIA 3LM5A 5AUXA 4A4OA 2VX0A 1BUHA 2HK5A 4O0RA 2GHLA 3LW0A 4JOAA 3ZZEA 3TKHA 4EOJA 2HXLA 2YA9A 1CM8A 5DRBA 1CTPE 5DE2A 4WO5A 2X8DA 5IDNA 4L46A 1PF8A 2C3KA 4XRJA 2CMWA 4CQGA 4JAIA 4R3PA 2Z2WA 1W8CA 3HMOA 3LQ8A 4OTQA 1TQMA 2FGIA 1YHSA 2JKMA 4MX9A 2GTNA 3D5VA 4USFA 2A27A 1YWNA 1F3MC 4XLVA 2X2LA 4G3CA 4KIKA 5EQYA 1M7QA 2J0IA 4LYNA 4NK9A 4V05A 4E26A 4F7JA 1OVEA 3B2WA 3OF0A 4ANNA 3RWQA 4C57A 4RZWA 1Z57A 3VF8A 3QUEA 4NIFB 3UDBA 4UXQA 3W2CA 4OBPA 4C35A 1M52A 4U5JA 5E90A 1S9JA 4DH7A 2YDKA 2XRWA 3ZUUA 2ZV7A 5CF6A 4YLJA 4L6QA 4YC3A 1YRPA 4FV0A 4YJQA 4O0VA 5G6VA 4HCVA 3BGZA 3ACKA 2GQRA 3P7BA 1SVHA 2BRHA 4FKUA 1Q5KA 2R3OA 4TYHA 4CVAA 3UP2A 4QYFA 2CHLA 3A2CA 4LGGA 4FTTA 5TKDA 3UIMA 4TY1A 3WYXA 3WZEA 2ZDUA 3V6SA 4ZSAA 3HX4A 5IA5A 1UVRA 4IJ9A 4ZLOA 4KUJA 2GPHA 2QR7A 4CYJA 5C4LA 3AD5A 5CTPA 4O82A 3R8MA 3ZXTA 2WTKB 4TWCA 4QRCA 3G0FA 3PY3A 4UBAA 3R8ZA 4XBRA 3TI1A 2XIRA 4IMYA 4U9AA 1YQJA 4KAOA 3BELA 1ATPE 2I1MA 3F5XA 1U54A 3I6UA 5BMMA 3KC3A 1XR1A 4QMZA 2RFEA 4ACHA 2OU7A 3MVMA 4ZS0A 5CWZA 2HXQA 4A4LA 2ITXA 2DS1A 2JAVA 4EOLA 2PU8A 3R83A 3KVWA 1REKA 2XKCA 5E92A 5FTQA 4BTMA 5HNBA 4GS6A 3RBWA 5FEQA 2R0UA 4CMOA 1YXSA 3LE6A 2C5XA 2PE2A 4XV2A 3QHRA 5DT3A 2UV2A 2W1GA 3EQFA 5KX8A 1M2RA 4A06A 4NEUA 2XB7A 4BYIA 1I44A 4D5HA 2R3QA 5EHYA 4O84A 1OL7A 3QUPA 1MP8A 2X7GA 2WTIA 4EK8A 4FZ6A 5CSXA 3HMMA 4IM2A 2BKZA 4AZSA 3QU0A 4HGSA 4FTLA 3TV7A 3MFTA 2ETRA 2RGPA 3GXLA 5ETIA 2B52A 3LLTA 5CAQA 4JRNA 2NNWB 3D14A 2OIQA 3LQ5A 5EDPA 4BCFA 2PULA 4QP1A 4MH7A 4E5AX 4PDYA 1PW2A 2VTQA 4MXAA 3ROYA 3UQFA 2B9IA 2QOFA 1BI7A 4K1BA 4HNIA 4YSMA 3AXWA 3GCVA 5J7HA 4RX7A 5E8XA 5J87A 1NT2A 4M84A 3S00A 4JLCA 4ZTMA 4HZSA 3C9WA 5HIDA 1P4OA 3VAPA 2W1DA 4E93A 3UIBA 3QD2B 4YHTA 5IU2A 5L2WA 4QQJA 1E1XA 3P9JA 3PWDA 5CU0A 2C68A 4ZAUA 3ZO2A 2CNUA 4L00A 1XH8A 3TM0A 1Q8ZA 1YKRA 3MH3A 4YGAA 5AX3A 4D9UA 1CKPA 4IAFA 5ETAA 3ZH8A 3IDCA 1U5QA 4QNAA 2Y8OA 1ZYCA 4W8EA 4FV2A 5CNOA 4R5SA 4AT4A 4EYMA 2VRXA 4FSTA 3VUKA 3RCDA 3C0IA 4KA3A 1Q24A 1NVSA 1PY5A 4J97A 2XF0A 4KINA 4FIEA 2R9SA 2A0CX 3PWYA 3FJQE 4IM0A 4FTOA 4E4MA 4NFNA 5LCJA 3CTQA 4JQEA 2HENA 4NW5A 2UVZA 1WAKA 4BHNA 2UW5A 4ZY5A 5JRQA 4RA4A 1JPAA 1YDTE 3MA3A 3MTLA 3OROA 1CKJA 5FWKK 4PPAA 5E8TA 1LEWA 4OTGA 2C30A 4XYFA 2ITWA 3E3PA 3SOAA 4R78A 3F3VA 4DGNA 4P7EA 4QOXA 3EFWA 3FSKA 4E7WA 5AUUA 2R3LA 4EH7A 5DG5A 2WFYA 4F6SA 4L7SA 3TACA 3L8XA 4CV9A 5E4HA 2X9EA 4NJDA 4X21A 2B53A 2WMQA 3AC8A 3V01A 1GAGA 3WZJA 3N4UA 1F0QA 4LMNA 3TXOA 1GZ8A 4XP0A 4EWHA 3FMNA 4GYGA 4JIKA 3NIZA 4PDSA 5EM6A 4O0TA 5JGAA 2QG7A 1Y6BA 2WMSA 3VBQA 1H25A 5CALA 1R0EA 2PVYA 2I0VA 4ASEA 4DITA 4IWDA 2BZIB 4ARKA 2R3PA 2QOQA 4FNZA 4FSNA 3ZDIA 2Z7LA 4RVKA 2BDWA 2R5TA 5EDRA 4BBEA 4PP7A 5GJDA 4FEUA 3HGKA 3H30A 4EOKA 4M66A 2YABA 3WF5A 4W9WA 3U6HA 3ZEWA 2Q0NA 5IA3A 4FBXA 3JYAA 1YHWA 2XJ0A 2YAKA 1WVWA 4ZJJA 1U59A 4L53A 1P2AA 4BWKA 4XG4A 3DXNA 3S95A 4C4JA 3F3WA 3LCKA 4YJSA 3CS9A 3PRFA 4AZTA 4CCUA 1WFCA 3POZA 4XG9A 2OG8A 2WIPA 3IDPA 1VR2A 4FG8A 1PYXA 3A4PA 3PXQA 1CSNA 5A4LA 4F1TA 5L8LA 2YWPA 3MWUA 3BLQA 4UYAA 4AT5A 2I0EA 5AWMA 4OAUC 3BE2A 3N4VA 2J0JA 3R0TA 2O2UA 1Y91A 2ZJWA 1PXNA 2ITOA 3DV3A 4G3GA 3QCXA 3W2OA 4BDHA 4RT7A 4F9WA 3MIYA 2W1HA 2WNTA 2VU3A 1YOLA 1UKIA 3FLNC 1UWJA 2X8IA 4BC6A 4D4RA 4YO4A 1FVRA 2JAMA 4JS8A 3OCSA 3D5WA 4I22A 1BX6A 4QP6A 4YMJA 2HZNA 3RVGA 4EKKA 1PXIA 3OEFX 3A61A 4YJOA 5AEPA 3ORNA 4LL0A 4BI2A 4F08A 4BI1A 2E9VA 3UNKA 2WKMA 2B54A 3IW5A 3KMWA 3L8SA 5EDQA 2VWUA 2ZMCA 3VS6A 3KXGA 4UZHA 4QP8A 2E2BA 4R6VA 5DR6A 5BNJA 3QYZA 3LCSA 4BZOA 3MV5A 1P14A 1LP4A 1L3RE 2PVFA 4J53A 5HNIX 5H2UA 1OMWA 5LQFA 1RJBA 2GS7A 1ZXEA 1OL6A 5JK3A 1JSVA 3ZM9A 1JLUE 3LFEA 3G6HA 3RP9A 2BHEA 4I41A 4IHPA 4LGHA 4RX8A 4C37A 1XO2B 2BRMA 2OXYA 4UX9A 1ZY5A 4IFCA 5KE0A 4JX7A 5AFVA 1PKGA 5AUTA 3ZU7A 1JVPP 1Q99A 4PTGA 4AZEA 3DK6A 4GVJA 1J91A 2V22A 2UW4A 5HLWA 1URWA 4IFGA 3B8QA 4KIPA 3MFSA 5BPYA 4U40A 2B7AA 4II5A 4BTKA 1CDKA 5E1EA 3UOKA 3KXMA 5D10A 2P55A 2YIQA 4R3RA 3SG9A 2EB3A 1Q8WA 4MHAA 4XBUA 4C58A 2OLCA 4RJ4A 3CY2A 3D2KA 4OUCA 2F7EE 3R8LA 2BUJA 2JKKA 2Z60A 3QKKA 3OUKA 1TQPA 1P4FA 3R7YA 4D0WA 3QTWA 4O96A 3VS5A 2NP8A 4JDHA 2BTSA 4WG5A 5AM7A 5AP6A 3EQRA 4GH2A 3FKOA 2VTRA 2Z8CA 3PG1A 5JMSA 5IISA 1GIIA 1RW8A 3DFCB 4ITJA 4L3JA 3MS9A 4X3FA 4XS2A 3HDNA 2WTKC 4AN2A 3MJ1A 5AA9A 1H1QA 4IH8A 5EKOA 3G6GA 5HQ0A 1L8TA 2EXMA 3F6XA 2O8YA 4I21A 4K33A 3OCTA 3COHA 2JDOA 2J90A 3H10A 2GSFA 3BYMA 3F88A 1AD5A 2VGOA 4BGHA 4PV0A 5CANA 2HY81 1HCLA 4FTJA 3RALA 5BVWA 5CX9A 4G5JA 4W4YA 3OY1A 4FL1A 3R71A 2YISA 4C2WA 3GCSA 3EHAA 4YTCA 2F4JA 1GOLA 4J71A 2J5EA 2PUNA 2HWOA 3EN4A 2J4ZA 2W5BA 4AF3A 4CLJA 4LV8A 1JKLA 3FV8A 3BHTA 1BMKA 1FMKA 2OBJA 3HMNA 4RZVA 2GDOA 4B6LA 4O6LA 4PMSA 3PYYA 4CEGA 1G3NA 3A7IA 4U79A 4XX9A 3KRLA 2WEVA 2YIXA 3EQHA 2FO0A 4QMPA 2GNLA 4F4PA 2XIYA 5HCXA 2UZVA 4HNFA 3P1AA 5AUZA 5LOHA 4AG8A 3OBGA 4OTRA 4O7SA 4MKCA 4ZSEA 1FVVA 2QOCA 3UVRA 3NNVA 2OICA 4QMSA 3LXPA 5CAOA 3ZO1A 2V5QA 3SXRA 4IC8A 4QPAA 5K5XA 3DBDA 4DFZE 4FR4A 4FMQA 3BQRA 4ZSGA 2PVMA 3F7WA 5K4IA 4FKVA 4C02A 3BE9A 4BFMA 4BCQA 1W98A 5JZJA 5IUGA 4FTUA 1ZZLA 2IVUA 2VO0A 3PSCA 3LXLA 4RQVA 4RVLA 1PXLA 5AP7A 5KUPA 2QU5A 4DH5A 4AA5A 4ZSJA 3HZTA 2R2PA 3D15A 3F61A 3G33A 3KXNA 3VJOA 2OF4A 4GL9A 3R1YA 3V5TA 1JNKA 2R7BA 4DGMA 3LMGA 3FZTA 2R3KA 3TJDA 3ALOA 1UU3A 4BB4A 4DEGA 4U41A 1Q4LA 4A9TA 5L8KA 3AOXA 4IZAA 2CGUA 4HYUA 5JFXA 4MF1A 3RPSA 3JVSA 3VO3A 2W17A 2YJSA 3L8PA 3DB6A 5CXZA 2F7XE 2KULA 2W1FA 2CLXA 4PL3A 3COIA 4AS0A 2F2CB 2ITTA 4K0YA 2UZWE 3KF4A 3QWJA 2IW8A 3F7ZA 5CASA 2HOGA 4NT4A 4DYMA 3P0MA 3UVPA 1JOWB 3IDBA 4JIAA 5CZHA 4EH5A 3FY0A 4FV4A 1LPUA 2JIIA 3EKKA 4C36A 3JXWA 3NW6A 4BBMA 3CSVA 2BAJA 2XH5A 5A4QA 3ULIA 3B8RA 4OT6A 4XJ0A 5IH6A 1SMHA 3BWFA 4D2TA 1ZYDA 2QU6A 4GK4A 5E1SA 3NNXA 4FTKA 4BWXA 1GZOA 3CPBA 1KUTA 4RJ8A 3V5PA 2Y4PA 3LPBA 4YHFA 3KK8A 4EYJA 1OECA 5HICA 1Y8YA 1EH4A 2OK1A 2OXXA 3G9LX 3I7CA 2PHKA 4C4FA 3ORLA 4MXCA 4JVGA 5EFQA 4O7ZA 4O22A 4YZNA 2QCSA 2AUHA 3CY3A 1PRYA 1FINA 2HCKA 2HZIA 4GJ2A 4EUUA 3ZFXA 3KN6A 4GT4A 4OBOA 2VV9A 4JRVA 3UZRA 4IAYA 3II5A 2P2IA 3BX5A 3LXNA 2WMUA 4IAIA 3CGFA 5HE3A 1WCCA 2ZV8A 3RPVA 2WAJA 4I6HA 2VTPA 2EVAA 4C61A 3ZFYA 3VULA 2JC6A 1VYZA 2JEDA 4EBVA 5C01A 3DBQA 3Q2MA 5A6NA 3SGCA 4U3YA 5A4TA 3SVVA 5BMSA 3VWAA 1DAWA 1FVTA 5AM6A 2W1CA 5DOSA 2E9NA 3LOKA 3QX2A 2QNJA 3QC9A 4BDKA 3KQ7A 4QMYA 5FXQA 3GENA 5CVGA 4BIDA 2G1TA 2R3HA 3RAKA 4Z16A 2EU9A 3LFSA 1AGWA 4YTFA 3MB6A 3QQHA 3FEGA 4RIYB 3I6WA 3PY0A 3Q04A 4KS8A 4JDKA 4P4CA 4RIOA 3TNIA 3P78A 4WT6A 4YC6A 3U8WA 5AAGA 3ODZX 3P5KA 4ZOGA 5HO8A 4LI5A 4D55A 3HLLA 1QL6A 4D2RA 4JT3A 2HYYA 4HGLA 4TT7A 2XP2A 3E92A 2B1PA 3O8TA 3DQXA 5DR9A 4BCGA 4EKLA 4YSJA 4BY9E 4NYEA 3V5QA 3SAYA 3MH0A 3PJCA 4QP2A 2FA2A 1IG1A 3BKBA 3UZTA 1UA2A 1SNUA 3E8DA 3R01A 5EW9A 5IPJA 4X2GA 5DIAA 3Q3BA 3EQDA 4KNBA 4JDIA 4M12A 3AG9A 4YPDA 3S1HA 4MD8E 3LKMA 2QOBA 3ITZA 2PVJA 3ID6C 4YLKA 4CMUA 3AT4A 3EIDA 4FTCA 4AZVA 4YJUA 3REPA 4IX6A 2ZAZA 1J7IA 3OFMA 3HDMA 4IVAA 3UJGA 2BIKB 3FWQA 4DEBA 4H3BA 4FX3A 2WIHA 4AE6A 3ZBFA 4U8ZA 4OAVB 2VNYA 5IQEA 1IASA 3M1SA 2EUFB 4X2FA 2GCDA 4CLIA 4CGAA 4FL3A 1OUKA 2C6EA 3FUPA 1DI8A 1A9UA 2UW0A 3ORIA 4RJ3A 3ZS5A 5CENA 2W4OA 4F70A 4FT5A 5BX0A 5JN2A 1Q3WA 3NAXA 3KXHA 4JQ7A 5CEPA 4DHFA 3I5ZA 4FEQA 3AGMA 4MNEB 5EOLA 5JKGA 3BWJA 3VS0A 4RFZA 4QTBA 5EI2A 4BKJA 2I40A 4TWNA 4MVFA 4CFFA 5M55A 3KREA 3SX9A 3R9DA 2ETKA 3OEZA 4JX3A 2C0OA 4P2KA 4O0WA 4ITIA 4P5ZA 5DR2A 1QPJA 5J79A 4NSTA 4AW1A 3ZLXA 5HTIA 3KCKA 2V7AA 2OJIA 5L6WL 4F64A 1DI9A 4WG4A 4CG9A 5LMKC 2RFSA 2ZVAA 2YACA 3D4QA 5B7VA 5BVOA 4O7TA 4QYGA 2BTRA 3LHJA 4K2RA 5ANIA 4FGRA 5AAEA 2XKFA 3IONA 3BEAA 4S31A 1G8AA 3AC2A 4EOQA 2X2KA 3WYYA 3CC6A 5HIEA 3ELJA 5EM7A 3HMPA 1PMNA 1ZOHA 3E8EA 3F5GA 1KE8A 3FHIA 3O8PA 3V8TA 4APPA 5LVNA 4JL9A 2YJRA 3HP5A 1URCA 2GS2A 5AV1A 3CPCA 2IVTA 3PIYA 5AP3A 1RQQA 2YAAA 3V8SA 1G8SA 2HZ4A 2RFDA 4L3LA 3VHKA 5CU6A 3IW4A 3UE4A 2HZ0A 3DOGA 4YNOA 4UMUA 4XG8A 3D7TB 4I1ZA 4QQ5A 3SLSA 3A99A 4BCHA 4DF3A 4FTQA 5HG9A 4CT1A 3R7GA 3M2WA 5DEYA 3DKGA 3R2BA 5FDXA 3UG2A 4I92A 4A4XA 1K3AA 4KWPA 1ZY4A 5AR3A 4NH1A 4FVQA 2ZM1A 4DT9A 3NYOA 3KMUA 3DK7A 4GEOA 2IPXA 2YDJA 1J1CA 4D4VA 3HRCA 4ERKA 2VWVA 3SDJA 4JG6A 4UMTA 4BWPA 4RIWA 5KMOA 4FT9A 3NUNA 4HVDA 4U42A 4C4GA 1ZYJA 3CQUA 3LFBA 2VX1A 3WI6A 1GZNA 1A48A 2YIWA 5D9HA 5JRSA 2ITNA 2IZUA 2Y0AA 2EWAA 1Q41A 2PUPA 3QD4A 4CZYB 3O51A 3U6IA 3LAUA 2V55A 3P7CA 3QTQA 5DH3A 4DGOA 1M14A 3COMA 3N51A 4W8DA 3NCZA 4XP2A 2BAQA 5HO6A 3EMGA 4HJOA 4M13A 4BDFA 3UP7A 3C50A 5DA3A 3DK3A 2FSLX 4FL2A 3VBVA 3AC4A 5K0XA 3D2IA 2LGCA 4DCEA 3NUAA 4HVIA 2PTKA 2XIZA 3DNDA 3ORPA 1SM2A 4IB1A 4JBPA 5FM3A 3TKUA 3V3VA 5HESA 2ZM4A 3PP0A 4QP4A 4X2JA 3QZHA 5I9WA 5JEBA 3HAVA 1STCE 1XH5A 2EXCX 1NXKA 3QQUA 3HEGA 4IX5A 5HX6A 3SQQA 4KRCA 3UGCA 3COKA 5ICPA 4J98A 3FL4A 5CF4A 2WOTA 3LVPA 2BZKB 4MD9E 2XM9A 4OW8A 1DM2A 3N4TA 5HCZA 5I9VA 2Z02A 3UMXA 5HVKA 3LM0A 3CBLA 3CIKA 3FLSA 3NS9A 4FYOA 5L2TA 1O6KA 3H3CA 2B9HA 5BVNA 3EN7A 4GKHA 2WMRA 2R4BA 2X7OA 3FE3A 4XV1A 5EHLA 5HCYA 4E5WA 3NDMA 2IJMA 4ENXA 1ND4A 5FUTA 3C0HA 2QOIA 4PY1A 5DYJA 3CTHA 2VGPA 1KE5A 2C6IA 4J99A 4LFIA 4ZTRA 3W10A 1ZZ2A 2PVLA 3JY9A 5D7VA 4BICA 3FMJA 2YERA 2IO6A 2X2MA 2OH4A 5FP5A 3KRJA 3UG1A 4F63A 3IQ7A 5CVFA 5E8WA 2OI4X 3QKLA 5DGZA 2OW3A 2W1IA 3BGQA 4HCTA 2DQ7X 2YLFA 3FC2A 3EOCA 5HD4A 3LMHA 2W05A 4CCBA 3GFWA 3BEGA 3EJ1A 2ITUA 2VZ6A 1ZMUA 2XK4A 3NPCA 3UMWA 4FT0A 4FSMA 4NFMA 3QUDA 2YM5A 3NWWA 4MBJA 4E20A 4YZCA 5C8KA 3F2NA 3P23A 2VUWA 3AC5A 4QQTA 3TIYA 2CNVA 2W5AA 3WF7A 5ETCA 4M15A 4RC4A 1R0PA 5CU3A 3V51A 4Q5HA 2GFSA 4Y5QA 1OKWA 4ZJVA 5HU9A 5IF1A 4WA9A 4IAZA 4DTAA 3MIAA 4PUZA 4EK6A 1KOBA 3CGOA 2YZAA 3ZCLA 3DDPA 3ZHPC 2R7IA 2C69A 2OIBA 2R0IA 3PZEA 4AW0A 4WHZA 3OXIA 4TYGA 3L9LA 3UIXA 4A7CA 2IG7A 3PRIA 3DA6A 3D7TA 4DH8A 5KZIA 2F7ZE 3C4XA 3QXOA 4IDTA 2PE1A 3AC1A 4L42A 5J95A 5H8GA 5L6OA 4UWBA 2YM7A 3O23A 2FSMX 4N0SA 5F94A 5HHWA 5FTOA 4IJPA 4ALVA 5HG8A 4FNWA 5TF9A 4RX9A 5IQFA 4OBQA 5LVMA 1OPJA 2XJ2A 5A6OA 3F2AA 2VTAA 2JDSA 3NSZA 5F4NA 1Q61A 3PSBA 4DGGA 3O96A 3W32A 4EHVA 4LUEA 5ITAA 1WBWA 1CMKE 2P3GX 3EN9A 2A1AB 2YM6A 3RI1A 1LEZA 4MTAA 3R7UA 4A9RA 1KV2A 4BCNA 4Y95A 3CLYA 4UALA 1FQ1B 3PJ2A 2EXEA 3BYUA 4BDDA 2J6MA 4RJ5A 1Z5MA 4I5MA 3I5NA 4N4SA 5ACBC 2GQGA 4WBOA 1FPUA 4A9YA 5HORA 1ZAOA 5FM2A 1IA9A 4U3ZA 2QOKA 4PMTA 4OT5A 3VRYA 2A2AA 3ERKA 1OBDA 2IZTA 3QCYA 2XS0A 5E9EA 4ZEGA 3T3VA 3EQGA 5M4CA 2WXVA 1PXJA 3FMHA 2C5OA 2B9JA 2GU8A 4JXFA 2QONA 3O7LB 5DVRA 3JS2A 4I0RA 4S34A 5CEMA 2P0CA 3MH1A 3VS3A 4EHEA 3FPQA 4ERWA 3V6RA 4LGDA 4W4XA 2WEIA 4O1OA 3HRBA 4PMMA 5IKWA 4RMZA 4AGUA 2R3MA 1S9IA 5BUIA 3IKAA 3P4KA 2XK9A 4GU9A 4EEVA 1PYEA 4ORKA 3G2FA 4DE4A 3WZDA 5AR4A 4JNWA 3HECA 4M67A 3L9PA 1ZLTA 2WPAA 3BHHA 1W82A 3QALE 4YBKA 3WIGA 4IZ5A 1YOJA 2YEXA 4FEVA 2OF2A 4YJRA 4FV8A 4PL4A 5HOAA 3PPKA 4N6YA 1H01A 1Q8UA 4DEHA 2BVAA 5CEIA 4D5KA 2O65A 5CAPA 3KMMA 1IAHA 2ETMA 3DY7A 5EYKA 5I3RA 2VNWA 4FG9A 5M4IA 4QMXA 5DI1A 3RWPA 3SG8A 3G51A 2VTMA 4BCMA 4NIFA 3EZRA 5M44A 2CKEA 3FQHA 4M69B 3E87A 3W33A 4CKJA 4RC3A 3MESA 4OTDA 4IX4A 3KFAA 3PA3A 4C33A 5KZ0A 3T9TA 3NYNA 3VW8A 5H8BA 3UC3A 4GT5A 4ONAA 4XMOA 1H24A 3BYOA 3L9NA 4ALUA 5FTGA 4J1RA 2XA4A 4NU1A 1ZYSA 3ANRA 3TNHA 3FSFA 4ANLA 3ENHA 4DG3E 4MXZA 1VYWA 3ZONA 4EOOA 3P08A 3FMMA 3NRMA 1T45A 1O9UA 4FSQA 4ZP5A 4C59A 4E6CA 2QOLA 4FTNA 2BCJA 2VTHA 3L9MA 4O38A 4WG3A 5AIRA 4FF8A 2OZAB 3PVGA 4QP3A 3SHEA 3LFQA 3C4WA 4PNKA 4G17A 2X8EA 3E7VA 4G16A 5AV4A 4MYGA 4FYNA 4GIHA 3ZUVA 3GU5A 4E4NA 2W9FB 2UZLA 3LJ1A 1H26A 5IQBA 2YFXA 3JY0A 4ACCA 3ZLWA 3IOPA 5IH4A 4DT8A 3FL5A 3AC3A 2GHGA 4FTMA 4M8TA 2W4JA 4IWQA 1XH6A 4YHJA 4AOTA 4U80A 2CJMA 2V0DA 5AP5A 1TKIA 5CF5A 2BILB 4DEIA 5AV3A 1YXVA 4FEXA 3D5UA 2XBJA 3VQUA 4W4VA 2QD9A 3HNGA 2X6EA 3PJ1A 3BBTB 3R22A 3HV6A 2GTMA 1R78A 3U87A 3DAKA 4BKZA 2F57A 4QYEA 1RE8A 4EWQA 4WKQA 1QCFA 2YWVA 4QO9A 4FNXA 4LOPA 3GCUA 4NJ3A 1YWRA 3PDTA 2PZRA 4FSYA 5FXSA 2QOOA 2VX3A 2XKEA 3DZQA 3K5UA 3K3JA 3Q9XA 5IQIA 3P86A 4I93A 4GRBA 3C51A 4UMQA 3M11A 4YPSA 2B4SB 2XNEA 4E6QA 2OJJA 1YXTA 2GNHA 2JKOA 3FXZA 2FSTX 4GG5A 3U9CA 2CKQA 3E62A 4EQCA 1QPCA 3MVLA 3ETAA 2C6LA 3UOLA 4RJ7A 3WE8A 3EN5A 1KWPA 2NPQA 3FAAA 3QQGA 1LUFA 3THBA 3MVHA 3E3BX 3NUPA 4RA5A 1FOTA 1OKYA 3ZYAA 4ANOA 2XJ1A 3PXFA 4AW5A 4CG8A 4GFMA 4PL5A 4EC9A 5AADA 4O91A 4FKTA 2BROA 3QXPA 5F20A 4ACGA 5CT7A 3TUDA 3MPMA 1KSWA 4FSUA 4RQKA 4S2ZA 3C4ZA 4LOQA 4EORA 2JKQA 5KMNA 4FTRA 2CGXA 4IE9A 3VW6A 2BRBA 2Y7JA 3F9NA 1SYKA 2WMTA 5FBNC 3C4EA 1UNGA 4BTJA 4USEA 2PPQA 2OFUA 4K11A 3RNIA 1B6CB 2C5YA 3DS6A 3EQPA 3MTFA 3NIEA 3NUXA 4FUXA 4RC2A 4BGQA 5AR7A 3AGLA 4O6EA 5HD7A 4CFXA 4D2WA 4PMPA 3UPZA 5JFVA 4UMPA 4O7RA 3QTIA 3UYSA 4J96A 2UW6A 3PA4A 4YZ9A 3IW7A 2XNBA 4XH6A 4EK5A 3SRVB 2C0TA 3BPRA 2XNMA 3FBVA 4D1ZA 2W9ZB 2J0KA 1WBOA 5EYDA 2RF9A 1Q3DA 1XBAA 5FDPA 5M08A 4XP3A 4KSQA 5GIPE 4FIHA 2C3LA 3WIKA 2ITZA 3FMEA 3ZC6A 4P90A 3DCVA 2B9FA 3MPTA 5EYMA 4QD6A 2QI8A 4E73A 3PXRA 5HEZA 3UYTA 4FE2A 1YWVA 1YDRE 4ASXA 1BYGA 2JGZA 2P4IA 4BDIA 4GU6A 3NX8A 4ZTHA 4BIBA 1REJA 3OTVA 4LRJA 4TWPA 4YO6A 2C6KA 3BLRA 4R77A 1R1WA 1MQBA 2W1EA 3AD4A 3R9OA 4KIQA 3C4CA 3AD6A 5CU2A 5IQDA 2FYSA 4X3JA 2NRUA 4AWIA 4MXOA 3UODA 4EZ5A 3RMFA 3R21A 5BQ0A 3KL8A 5GIOE 1OIYA 3MFRA 2VTNA 4L44A 5I0BA 2BHHA 5AP4A 5B0XA 3MH2A 2ITYA 3FMLA 2O63A 3QCQA 4GMYA 3OP5A 4UEUA 3ZM4A 1XQZA 1UKHA 3QQFA 4ALWA 1FBNA 2W4KA 5DEWA 5IEXA 3MN3A 3WZUA 1OIQA 4L01A 1GIJA 4TNDA 2YM3A 2JFMA 4YTHA 4F1MA 3R8PA 3NGAA 3Q4CA 4Z7GA 3IGOA 4ITHA 4M7IA 3ORMA 4R8QA 4YR8A 3QF9A 3A60A 4UY9A 4PWNA 1WMKA 3KA0A 3C1XA 3KXXA 3OWPA 4C3PA 1Q8YA 3E8NA 5CSHA 4I24A 4JG8A 3ZRMA 4IACA 3R9RA 3TT0A 2WELA 3S3IA 4KRDA 3U4UA 3BV2A 3RTPA 4KD1A 5J9ZA 5EM8A 3CQEA 2ACXA 4U0IA 5CEQA 3UIUA 4JBVA 1CKIA 2QKWB 1JKSA 3GVUA 5DWRA 5L8JA 2G15A 3OBJA 1WBTA 4G2FA 4EQMA 5M53A 4YP8A 4PPCA 5EK7A 3UNZA 5IH5A 5M57A 3FMDA 3JUHA 4FV1A 4U97A 3OVVA 4A9UA 2H9VA 3ANQA 3Q6WA 3QRTA 1VEBA 4G6NA 4CMTA 3TTJA 2QURA 1M17A 2FH9A 3HYHA 3O7LD 4GSBA 5GZ9A 4HYIA 2QO9A 4ZZMA 3ZFMA 3CJFA 1UU7A 2BRNA 2WO6A 2WTDA 2ZDTA 3A7FA 3UC4A 3UZPA 3O8UA 3Q9ZA 2HAKA 4ZY6A 4MXXA 3R63A 4WD5A 2C5NA 4RJ6A 4YC8A 4CFMA 4EK3A 3LJ0A 3GU6A 3NEWA 5HGIA 4WRSA 1IAJA 4H36A 4C3FA 4ZS4A 3EL8A 5IDPA 5JFWA 2XUUA 4YZBA 4RVMA 1WBVA 1YXXA 3D9VA 2QODA 3HL7A 5E8UA 3GQIA 3GU7A 3A4OX 5DPVA 5HVJA 5M51A 2YLEA 4I5PA 3VNTA 2BALA 4AZFA 2GMXA 2Y9QA 2DYLA 3R6XA 5E8YA 4ZTSA 4BDJA 4RLKA 4FV3A 2KTYA 2WHBA 3QYWA 2G2FA 4YU2A 1GZKA 4ZTLA 2Y6OA 2BPMA 5ETFA 2JFLA 4EUTA 1ZYLA 2R64A 2EB2A 3E8CA 5AV0A 3FLWA 3NNUA 3VJNA 2IZRA 5AX9A 2CKPA 4HPUE 4LRMA 4I6BA 3DBFA 2XBAA 3D94A 3G15A 2CCHA 4H05A 4J95A 5J8IA 5CQWA 1PHKA 3TEIA 5LVPA 3HUCA 3OC1A 4QYYA 4DCAA 2R3GA 4O0UA 5CYIA 3RJCA 2F2UA 4GVAA 4ZMEA 5BYLA 4FK6A 2XMYA 3UBDA 2B55A 2OJ9A 4HYSA 4USDA 3H0ZA 4X7QA 4D1XA 3OW3A 5LMKA 5I9UA 4OR5A 5AUWA 1U4DA 1H28A 2YIYA 3LXKA 2A4LA 5EH0A 5ANJA 5EQEA 3Q32A 2Y4IB 1WBSA 4CZTA 3SC1A 3OWKA 5J5SA 5B2MA 2XNPA 3HVCA 2PUUA 4D9TA 4ZY4A 2B0QA 3NNWA 3NR9A 5K3YA 4AU8A 4F0IA 3TCPA 3DAEA 2CGWA 1J1BA 3R73A 5KO1A 4HGEA 1BL7A 2X4FA 2C47A 2WD1A 3AMAA 3DFAA 2WQOA 3KKVA 3R7IA 4B9DA 4IX3A 2PVHA 4CNHA 4IZYA 2OXDA 5HG7A 4QPMA 4ENYA 1PXMA 4BCIA 5C8MA 3I0QA 2I0YA 3I60A 3EQCA 3VBTA 5DT4A 4JQ8A 3ZDUA 3W8QA 2J0MB 4WNMA 3Q5IA 2CN8A 1IR3A 4YTIA 5CEKA 1LR4A 1JKKA 3UO6A 2WGJA 4ZZNA 3LCDA 1APME 2QLUA 4TWOA 3V5JA 1BLXA 4D2SA 3IPHA 3KB7A 4FK3A 1K9AA 1J7UA 3HA6A 3D0EA 3R00A 4Z3VA 5KCVA 4DG2E 2GS6A 3WF9A 4R5YA 1ZARA 2ITVA 2XZSA 5IA4A 2YHVA 5AR2A 3SW4A 4I6FA 3QZFA 1MUOA 4F9BA 3QLGA 4BCKA 3OOGA 3FKNA 1OM1A 5CXHA 3HV5A 4S33A 1VJYA 3HKOA 3PFQA 3PP1A 2ONLC 2UZTA 5CZIA 3GEQA 2XEZA 4W4WA 1GJOA 4J8MA 4L3PA 3ZMMA 3BHUA 4D28A 4E4LA 5M07A 4FKQA 4WRGA 4QQCA 1PJKA 1R3CA 5BVKA 3EZVA 3ZXZA 4I5HA 4QMNA 2WTVA 5E91A 3MYGA 3OOMA 3UPXA 1OUYA 4NZWB 3WF8A 2VO3A 3P79A 4F65A 4YJVA 2H8HA 2VTOA 5M4UA 3TNPC 3RGFA 3F3UA 5HU3A 4WBBB 5JT2A 3VBYA 3IECA 3S2PA 4OTHA 3ZTXA 4TKSA 3A8WA 4H3PA 4AN9A 4F9CA 5IQAA 2UW3A 4XOZA 3H9OA 3C0GA 3QTZA 4BBFA 4UZDA 4XHKB 4FZ7A 4YZDA 1OL5A 4H58A 5AR8A 3RHKA 4BZNA 3I0OA 2YIRA 5FP6A 3SA0A 3FYKX 2HW6A 3VIDA 5HBJA 3GCPA 3CJGA 3DKFA 1O6YA 3O17A 4V04A 4BZDA 2YITA 3O0GA 2R3JA 4G9CA 3OCGA 5HBHA 2PE0A 3ZRKA 3DJ6A 5JH6A 2ZOQA 2X9FA 1H1SA 3F3TA 5T3QA 3VBXA 3NUYA 4Z55A 1JQHA 3I7BA 4FT7A 4ID7A 4RWKA 5LMAA 4YUQA 3GCQA 3VS1A 1BI8A 3VUHA 3TZMA 4C4EA 4IEBA 4L52A 5A9UA 2OH0E 3LLAA 3Q6UA 4C34A 4XG3A 2ZYBA 4IIRA 5D11A 4AA4A 2BZJA 4UWCA 4O7NA 3ZSGA 3GI3A 3ZRLA 3LZBA 3DJ7A 3ATSA 1J3HA 3QA8A 1M2PA 4BKYA 1F5QA 3MY5A 1KE7A 3QKMA 4DFLA 3U55A 4AGWA 2XVDA 3PUPA 2YM4A 4DEAA 5IQGA 4QMMA 1RDQE 3O2MA 5AJQA 4FIIA 5AP1A 3QRJA 4BHZA 5C4KA 5JFSA 1WBNA 1M2QA 3U6JA 2FUMA 4TYHB 3QZIA 1V1KA 2JDRA 2ITQA 4E8AA 4UYNA 3TWJA 4J52A 4LG4A 3H9FA 4GJ3A 4Y8DA 4C4IA 3W2SA 3QRUA 2RG5A 2PZ5A 3R1SA 3R1NA 1H8FA 3OD6X 4I4FA 4NM0A 3ORKA 4RIXB 4UWYA 4WIHA 3SKCA 3F82A 3PLAE 1UU8A 1NW1A 4DLJA 1W84A 3D83A 2W99B 4K77A 3I81A 5DFPA 5JQ5A 2QR8A 3FC1X 3VUMA 4NCTC 3KY2A 3DDQA 4FVPA 2WTJA 3QD0A 3PXYA 3O71A 4MEDA 3EB0A 3VC4A 4GKIA 4AN3A 4FOCA 3DBCA 3PZHA 5K9IA 4LOOA 1GIHA 5BYYA 2JLDA 4QNYA 2IW6A 4JG7A 4JR7A 3SXSA 4F7LA 3AMYA 3MJ2A 2VD5A 1UWHA 3OHTA 1WVXA 2XNGA 2HY0A 3R30A 4FSRA 2GQSA 5DBXA 1IEPA 4G1WA 4XV9A 4OTPA 4I0TA 1YXUA 3CXWA 4G3DA 4O0YA 4RIYA 2C6OA 2YCQA 1ZOEA 4FIFA 4RBLA 5CSWA 4ZTQA 4BTFA 5KHWA 2PYWA 2XIXA 3IS5A 3HMIA 4KBKA 4MWIA 3ZSHA 2OZOA 2XNOA 2VWBA 2UVXA 4O1PA 1UNLA 3A7GA 1BKXA 2PZYA 5M06A 4UB7A 4HYHA 3Q2JA 2JBOA 2PZIA 4ZIMA 5HLNA 5J1VA 3HUBA 4O7VA 2ZM3A 3KVXA 3KEXA 1KE6A 3NYXA 3LCOA 2JIVA 4MBIA 3UO4A 4AX8A 4D58A 5CU4A 3FZOA 3VF9A 3Q4TA 4RVTA 4XNEA 3KULB 3QBNA 4M0ZA 3S4QA 5BVFA 4NL0A 3IK3A 1UV5A 1UU9A 2BDJA 2VWWA 3QAME 1KOAA 3QRKA 4ANQA 4IVDA 2G9XA 3GOKA 2OWBA 2UW9A 4FKWA 4Y72A 5HIBA 3HP2A 3QTSA 3PG3A 1OB3A 1V0OA 4CFWA 4CTBA 4EC8A 4J8NA 4RGJA 4YBJA 5GZAA 3RPRA 3TL8A 3QTRA 4RPVA 1ZWSA 3NAYA 5J5TA 3WBLA 3ET7A 4O7WA 1H1PA 4EH9A 1V0PA 3G9NA 3DKOA 4DGLC 2XNNA 4TXCA 3BIZA 5LJJA 3OS3A 2WU7A 4MD7E 2QKRA 4IM3A 3RINA 4I5CA 2C4GA 2ITPA 2V7OA 3ORXA 4I0SA 4W9XA 4EONA 3DXQA 4MNEA 4FV6A 5HG5A 5BUJA 3C4FA 4CXAA 3GU8A 4MNFA 4CV8A 4ZMFA 3GNIB 2ZB0A 4EL9A 5DMZA 3EQIA 5EHOA 5CF8A 2Q0BA 1TVOA 2LAVA 3RK7A 5KMKA 2ERKA 2CN5A 3R9HA 4GYIA 4HOKA 5C03A 3F69A 4IANA 2JDVA 4IB3A 4RG0A 4O81A 4HZRA 4C2VA 3A7HA 3E5AA 3H9RA 4EH3A 2VAGA 4U7ZA 3OY3A 3FY2A 4MK0A 3BI6A 3NVKI 2Y4IC 4FA2A 2ERZE 5EW8A 4CFNA 3I79A 3QQJA 5KMMA 4CTCA 3GFEA 1PXOA 3BLHA 4OTWA 5L2QA 4DEDA 4IDVA 2X6DA 5IG1A 2CDZA 3GBZA 3EFLA 2C0IA 2DUVA 3VUGA 3C7QA 1J7LA 4F7SA 3DZOA 5C9CA 2O3PA 1MQ4A 5DHJA 3DPKA 2X7FA 4FZDB 3TTIA 4ZLYA 4AFEA 4FGBA 4QMLA 3FZSA 3R8UA 3ULZA 4BCOA 4QTAA 5B2LA 3WF6A 1SVGA 1OKVA 2UUEA 5I3OA 3BU3A 3HA8A 3OXZA 4XLIA 3ZC5A 4B99A 4DFYA 4DFNA 2WMAA 3K54A 4BI0A 3K5VA 4RIXA 2AC5A 2BRGA 3POOA 3MW1A 3QC4A 3PE1A 3RM6A 4O7LA 5EOBA 1T46A 4B0GA 3BHVA 3FMKA 3LFCA 4BCPA 3KRWA 3ZEPA 3OWLA 4IVCA 3CE3A 3PXZA 3CEKA 2UZOA 5AAFA 3W1FA 4JR3A 3QCSA 4V01A 5AA8A 2QQ7A 2W7XA 5CI7A 4NUSA 2BAKA 4E3CA 2ZB1A 2C3JA 2XYUA 5BVEA 3NYVA 3JR1A 4AUAA 5T68A 4TNBA 3BZ3A 3OT8A 3F2RA 4Q2AA 5J9YA 2Z7SA 3ORTA 2P2HA 3R9NA 4FSWA 3VVHA 3EFJA 1PMEA 2H34A 3OW4A 2W5HA 3ZLYA 2PMOX 3QA0A 4L9IA 2XK6A 3T8OA 1XH4A 5L2IA 3TG1A 2QOHA 4AP7A 3UTOA 1VZOA 4M3QA 4NM7A 3SW7A 2E9UA 4P5QA 4Y83A 3Q60A 4KS7A 2VN9A 1OL1A 4C0TA 3RPOA 3IO7A 2W06A 4QMWA 4YLLA 3IOKA 5ANGA 3U54A 3MB7A 5DNRA 1H07A 4WNKA 4XV3A 3W18A 5D1JA 3GC8A 5AR5A 3ODYX 5KMJA 3EN6A 2AC3A 4ASDA 1JKTA 2CGVA 1JAMA 4DTBA 2QO2A 3DKCA 4YJTA 3ZSIA 4EJNA 3KF7A 3KULA 4TYJA 5F95A 4DC2A 4HVSA 4U6RA 5A14A 3DGKA 3SV0A 4PTEA 4B7TA 5BYZA 2Y6MA 3CQWA 3FYJX 5D41A 4AT3A 4MCVA 3TZ9A 4DLIA 1B38A 3MY0A 4IB5A 2H96A 4K8AA 4E1ZA 1UNHA 5I4NA 2WQEA 5CLPA 5C8NA 5ANKA 1NA7A 3ALNA 3MGYA 1JBPE 3RM7A 3RAWA 5GJFA 3IW8A 5IMXA 2C6TA 2JIUA 4JAJA 3E64A 2J51A 4H39A 4HPTE 5B2KA 4FVRA 4X2NA 5HTCA 1ZRZA 3I1AA 4WUNA 4XRLA 3PE2A 3OTUA 4QMOA 4EZ7A 4F7NA 4XG7A 2OSCA 4S30A 4WNOA 1NVRA 4L43A 3W55A 2RSVA 2ZV2A 5M09A 1XWSA 4OGRA 4ZSLA 2I7QA 3OXTA 4TL0A 3Q9WA 2XCKA 3GC0A 3CKXA 4FKIA 4G9RA 5A46A 4R7BA 4UMRA 5L4QA 4QMQA 3CKWA 4DFXE 4LUDA 3A8XA 4GW8A 4GUEA 1AQ1A 5E8ZA 2F9GA 4GIIA 5A3XA 5CEOA 3TUBA 4Y85A 1DS5A 2XK7A 4X3FB 3R7VA 1H1WA 3VHEA 2YCRA 4TRLA 5GHVA 3SD0A 3TNQB 2VO7A 5C26A 1WZYA 5EI8A 4LRKA 4EOPA 3BCEA 2PUIA 3DLZA 5LARA 5KMLA 4FODA 3QTUA 3W2QA 4O86A 5KNJA 2WMWA 4BDBA 3NW7A 4LL5A 2VTSA 3WE4A 4Z7HA 1MRUA 1GY3A 3IGGA 2WOUA 2CPKE 4CFVA 1E9HA 4ACMA 3JPVA 2RKUA 4FKGA 5IA0A 2VWYA 3PPJA 4KKEA 4IB0A 4B4LA 4CD0A 5CVHA 5JQ8A 4XG2A 4LMUA 3H0YA 3AMBA 4BIEA 4J7BA 3WARA 2RFNA 1YI4A 5K4JA 3OG7A 5ANOA 3CCNA 5KKRB 3MDYA 2FVDA 2GHMA 5EI6A 3T3UA 4DAWA 1ERKA 3AQVA 4BGGA 4DA5A 5T6KA 2QLQA 5BVDA 1Q62A 5K5NA 2GFCA 4QTCA 3RAHA 5TOZA 3R8VA 4FT3A 4AOJA 4YZMA 5HVYA 4XG6A 1E1VA 4N57A 3PJ3A 4AQCA 4PX6A 4FC0A 3KGAA 1FGIA 2PMIA 3EYGA 3HRFA 4UXLA 3UOJA 3G0EA 3ZO3A 3GQLA 4HGTA 4Y5HA 4C38A 4YJNA 3RK9A 3MA6A 3TV4A 4FKJA 5FEEA 5CAUA 5CNNA 3QQKA 5F1ZA 1H27A 4L45A 4F6UA 4APCA 3DJ5A 4F9YA 4Y46A 2G2HA 4G34A 3LFFA 4PDPA 1XH9A 4UV0A 3U4WA 3NMUF 4DN5A 4BDAA 2E9OA 4DEEA 4DH1A 5GINE 4GUBA 4QMUA 3VUIA 5CSVA 5A4CA 1X8BA 3CTJA 4IBMA 5FLFA 4B8MA 5CSPA 4R1VA 1SZMA 4FZAB 2X4ZA 3DNEA 3SOCA 3RZFA 5A4EA 4O27B 2W0JA 2UZNA 5DN3A 2GNJA 3TN8A 4CKIA 4BCJA 4O21A 4O0SA 4HVHA 4ANMA 1YI3A 5FGKA 3G90X 3RZBA 3TV6A 4BL1A 4IQ6A 3BRBA 3M42A 4S32A 1H0WA 3U9NA 2PVNA 5LVOA 2PMLX 2RL5A 4TYIA 4FNYA 2G2IA 2GNIA 1PMVA 3KK9A 5AUYA 2JITA 4FIJA 3UNJA 3RPYA 5KMIA 3PY1A 2XKDA 4IAKA 3MFUA 4FV5A 1OPLA 3FKLA 3CD3A 3H4JA 2UZEA 4FKLA 3BQCA 3PA5A 2SRCA 4I20A 3F66A 5TT7A 4TTHB 4KABA 4NM3A 3QHWA 3DTCA 4BDGA 4DBNA 4KB8A 1TQIA 4IW0A 3W16A 1DAYA 4EOSA 2PSQA 5J9LA 2QHNA 3DT1A 4G3EA 5IQHA 1JSUA 3L1SA 4PTCA 4RFYA 5KBQA 5IA1A 2VTIA 4JBOA 3TIZA 4EZ3A 2HIWA 4Y73A 4M69A 2YDIA 4CYIA 3LQ3A 2GNFA 4IXPA 4OLIA 3QQLA 2X1NA 3GC9A 1YDSE 2WMBA 4GCJA 4RX5A 1OBGA 3BU6A 3Q96A 5AMNA 2PVKA 4ZXTA 5JSMA 5L2SA 4FKSA 4FV7A 2YCFA 2ESMA 4IZ7A 4ANSA 2VTJA 4F1OA 2WB8A 2Z7RA 3EH9A 4CSVA 3L8VA 4QPSA 2CSNA 3NCGA 1OGUA 3FQEA 3PTGA 4A9SA 1H08A 3PSDA 4L67A 2IN6A 3FZRA 3WILA 3QWKA 4I94A 4U81A 5KBRA 3HV7A 3Q52A 1HOWA 3LFDA 2XIKA 3R7OA 5KHXA 1W83A 2OZAA 2V62A 4KKHA 5HNGA 4AZWA 4ZZOA 4AE9A 2J9MA 4F99A 5EYCA 3QGYA 4R1YA 2C5VA 4QTDA 2C1BA 2Z7QA 2A19B 5HE0A 3CR0A 5FQDC 1KV1A 2JDTA 3MPAA 4GV1A 4E5BA 5AP0A 3PVBA 5M56A 3GC7A 3R02A 1SNXA 4E4XA 2CCIA 3DU8A 3LIJA 4U44A 5LWMA 1JWHA 4DG0E 3E93A 3FXWA 5CS6A 1OITA 4JBQA 4F0FA 1ZOGA 3C5UA 4ZJIA 4EOMA 5FG8A 5IEYA 2CKOA 4I23A 2J50A 4ZK5A 4N6ZA 5LVLA 3QFVA 4C8BA 2RG6A 3TDVA 1JSTA 3LJ2A 5E8SA 2O5KA 3PXKA 1G5SA 3MBLA 4XEYA 2XEYA 4FG7A 2UZDA 4CRLA 5HE1A 3D7ZA 1WVYA 4BYJA 2JD5A 4G3FA 4PDOA 5GNKA 4IWPA 2HWPA 4FKOA 3BGPA 3PPZA 4CQEA 3EFKA 2ONLA 4Q5EA 5CI6A 3E88A 1K2PA 2DWBA 2X39A 3GUBA 4MBLA 4PF4A 4EI4A 2YZLA 4CKRA 2R3FA 4M68A 2BFXA 1MRYA 5ANDA 1Y8GA 5J7BA 5HKMA 1O6LA 2J5FA 5IUIA 2QO7A 4IWOA 5DT0A 5JZNA 3ZLSA 3ZOSA 5AV2A 4XOYA 3ENMA 3FZPA 2OJFE 4X6QC 1M7NA 2WQNA 4PP9A 5DLSA 3T9IA 2WU6A 4DBXA 2WMVA 5G1XA 3AT2A 4NWMA 5GJGA 5H3QA 3QLFA 1XBBA 3BBWA 4AAAA
chains in the Genus database with same CATH superfamily
2IZSA 3NLBA 3FI4A 3AT3A 3RK5A 2VWIA 4NKAA 2QG5A 4G6LA 5JGDA 5EQPA 1OIUA 2FB8A 4ACDA 3P7AA 5FBOA 4PPBA 3KN5A 2CLQA 1OZ1A 3RKBA 2J7TA 4D2VA 5C1QB 2VWXA 4G6OA 3F3ZA 4F9AA 5EKNA 3OT3A 1NVQA 1OI9A 4YJPA 5E8VA 4L8MA 3EKNA 5H9BA 1XH7A 4BDEA 5FD2A 1ST0A 2H6DA 4Z9LA 5I9ZA 1XKKA 3KCFA 3V5WA 4FOBA 1H1RA 2C3IB 2JBPA 4WNPA 2PVRA 4DINA 2BFYA 4LV5A 4HVGA 4YURA 2BR1A 3LCTA 2XM8A 3V04A 3MVJA 3QTXA 4DHZA 2PZPA 3Q5ZA 1OKZA 4PNIA 2HW7A 3SRVA 4CRSA 3TDWA 5J1WA 4O2PA 4X6RA 4AGCA 4DH3A 3U51A 2YCSA 3HAMA 4PQNA 2WTWA 4C3RA 5L6PA 1ZMVA 5AUVA 3R7EA 4FI1A 4X3FC 1Y57A 3SXFA 4EH6A 4L68A 2PMNX 3QX4A 3E63A 2QC6A 4FSZA 4FUYA 1OIRA 2YN8A 4RWIA 4WSQA 2IW9A 3VUDA 3O50A 3W2PA 3FLQA 4CFUA 4DFUA 4AW2A 4H1JA 3ZZWA 3W0QA 3NUUA 4F0GA 3S0OA 4TYEA 3VQHA 5CY3A 5HBEA 3ZUTA 4RWLA 4EH8A 2W96B 3QZGA 1GNGA 1U46A 4HW7A 2UVYA 4FICA 4R7HA 3VBWA 2AYPA 1IRKA 4IVBA 1NY3A 4QP7A 3QRIA 5CQUA 5H8EA 5DRDA 4BVUA 3KRXA 4C7TA 4O83A 2IVVA 5HX8A 3FPMA 2XCHA 5I9XA 1U5RA 5BUEA 5AP2A 4ANBA 3VS7A 3WZKA 4B8LA 4NCTA 3RAIA 4D0XA 4RIWB 2HELA 4GFGA 5KKRC 3DBEA 3GU4A 2NO3A 1A06A 3F5UA 3TZ8A 2VWZA 2OIDA 3NVMB 2RIOA 3D5XA 4O0XA 2BDFA 4NTSA 3IG7A 2E9PA 4K9YA 3EWHA 4RWJA 3BYSA 5TE0A 4G31A 1H4LA 3DB8A 1R39A 1Q8TA 1FMOE 3IW6A 4IAAA 4DTKA 2J0LA 4D4YA 4UN0C 5IZFA 2F49A 2ZMDA 4OTIA 4MQ1A 5LMBA 4JI9A 4M97A 5LWNA 3NW5A 1Q97A 1Z9XA 3UQGA 2FSOX 3ATTA 2NRYA 4BR3A 2WZJA 1P5EA 4V0GB 1PXPA 4CT2A 4AXAA 4AOIA 3VS4A 2O0UA 1PKDA 5ANEA 4C62A 2OGVA 2IVSA 3GP0A 3OUNB 2XK8A 4NKSA 4QT1A 4K6ZA 3W8LA 4I3ZA 1V0BA 3ROCA 2C6DA 3W2RA 4D2PA 4EK4A 3MY1A 4AACA 3G5DA 3TJCA 2X81A 3BYVA 3QD3A 5A54A 5LXMA 4I6QA 3HV4A 5C27A 4GK3A 1I09A 4GFOA 4NW6A 4X2KA 4QTEA 4QMVA 3BU5A 2WQMA 3DXPA 4JDJA 1QPDA 3BL9A 1QPEA 3OMVA 4GG7A 1YI6A 4FKRA 2BKKA 1YHVA 2OJGA 3VRZA 5FXRA 1KE9A 3V5LA 4YNEA 4FTIA 4KIKB 4D4SA 5L3AA 2PL0A 3Q4ZA 1IA8A 4QMTA 4Q9SA 3UOHA 5EG3A 4A07A 3FQSA 4GK2A 4PRJA 5CAVA 4MQ2A 4EBWA 3GT8A 3KU2A 4OTFA 5D7AA 3ZBXA 4QP9A 3F5PA 3GB2A 4KKGA 4RLLA 4O7YA 4U43A 3ZO4A 1ZMWA 2PY3A 5F9EA 4TPTA 4EH4A 1SVEA 2VTTA 3GGFA 4ZTNA 5CT0A 4EHGA 3MSSA 4KSPA 4DFBA 3C13A 1PXKA 4KBAA 4BN1A 5IUHA 2PWLA 1BL6A 1HCKA 2XRUA 2BZHB 3DAJA 4XCUA 3R04A 4F6WA 1QMZA 2UW8A 1B39A 4I4EA 4KBCA 3DTWA 3OWJA 1YW2A 4AGDA 4FTAA 3EL7A 3HV3A 2UW7A 3PJ8A 5ACKA 4Q9ZA 2C1AA 3UQCA 5EM5A 4LQMA 3NUSA 3FI8A 2UZUE 5HE2A 3VN9A 3I4BA 4BRXA 3MI9A 4ZLZA 3VS2A 5M4FA 4X0MA 4LM5A 1H0VA 5D12A 3EQBA 1W7HA 3EYHA 5EW3A 3OZ6A 4CZUA 3RCJA 4G5PA 3R1QA 4TZRA 5IA2A 4WOVA 3PUFC 2QVSE 5E7RA 3NZ0A 3PIZA 3R28A 1WBPA 2BMCA 2WQBA 3OCBA 3A62A 4MWHA 4NM5A 4WSYA 4RSSA 5TR6A 2I6LA 4MAOA 4JJRA 5IEVA 3Q9YA 4L7FA 2C6MA 3FDNA 3TZ7A 3PVUA 4QYHA 1U54B 5HO7A 5AIKA 3JVRA 3R2YA 3PIXA 1Y6AA 3UVQA 5IMEA 4TN6A 5FEDA 2BIYA 3PLSA 3QGWA 3BHYA 2WTCA 2P33A 4IADA 5LCKA 2ZV9A 2REIA 2W1ZA 4KIOA 3WOWA 4AA0A 3TNWA 3LMIA 4FV9A 4N70A 2UZBA 3PVWA 3K2LA 1W0XC 2XYNA 3UO5A 3Q4UA 4FIGA 3KXZA 4AFJA 2QHMA 4EH2A 5HI2A 4F09A 4E6DA 2OKRA 3CD8A 2J2IB 3FI3A 3QL8A 4RFMA 4EQUA 4FZFB 5JGBA 5I9YA 4K18A 3TUCA 3ACJA 4R7IA 5HLPA 1XJDA 3Q53A 2PK9A 4RRVA 5I5ZA 3N9XA 2Q83A 1MRVA 3W0OA 3C5IA 4EJ7A 3GOPA 3DQWA 3ORZA 3FI2A 3E7OA 2OO8X 1H00A 4EOIA 3LFAA 2O64A 1XBCA 3VUTA 1PMUA 4H3QA 5IQCA 1FGKA 3RNYA 3FHRA 2OFVA 3RHXA 2R3RA 5HZNA 1OPKA 3A7JA 4M0YA 4MXYA 2R3IA 1YOMA 4XUFA 2CNQA 2GNGA 4BF2A 2WMXA 2IWIA 3BV3A 3FZ1A 4WUAA 3K3IA 2YM8A 3KRRA 4FKPA 4E6AA 5HTBA 1OL2A 4NTTA 3CP9A 3V8WA 4D1SA 4FEWA 4EHZA 4U45A 5GZ8A 4C4HA 4HCUA 1XHAA 4IC7A 2G01A 2R3NA 3B2TA 4MF0A 4O2ZA 4V0GA 4M14A 4ASZA 3DLSA 4R3CA 4H1MA 2VTLA 4BDCA 3FLYA 1YVJA 3LFNA 3FLZA 2VO6A 2XK3A 3FXXA 4GT3A 5FRIA 5TO8A 2AQXA 4TW9A 2X0GA 2I0HA 5K0KA 3TKIA 3LM5A 5AUXA 4A4OA 2NYAA 2VX0A 1BUHA 2HK5A 4O0RA 2GHLA 3LW0A 4JOAA 3ZZEA 3TKHA 4EOJA 2HXLA 2YA9A 1CM8A 5DRBA 1CTPE 5DE2A 4WO5A 2X8DA 5IDNA 4L46A 1PF8A 2C3KA 4XRJA 2CMWA 4CQGA 4JAIA 4R3PA 2Z2WA 1W8CA 3HMOA 3LQ8A 4OTQA 1TQMA 2FGIA 1YHSA 2JKMA 4MX9A 2GTNA 3D5VA 4USFA 2A27A 1YWNA 1F3MC 4XLVA 2X2LA 4G3CA 4KIKA 5EQYA 1M7QA 2J0IA 4LYNA 4NK9A 4V05A 4E26A 4F7JA 1OVEA 3B2WA 3OF0A 4ANNA 3RWQA 4C57A 4RZWA 1Z57A 3VF8A 3QUEA 4NIFB 3UDBA 4UXQA 3W2CA 4OBPA 4C35A 1M52A 4U5JA 5E90A 1S9JA 4DH7A 2YDKA 2XRWA 3ZUUA 2ZV7A 5CF6A 4YLJA 4L6QA 4YC3A 1YRPA 4FV0A 4YJQA 4O0VA 5G6VA 4HCVA 3BGZA 3ACKA 2GQRA 3P7BA 1XMLA 1SVHA 2BRHA 4FKUA 1Q5KA 2R3OA 4TYHA 4CVAA 3UP2A 4QYFA 2CHLA 3A2CA 4LGGA 4FTTA 4O4CA 5TKDA 4TY1A 3UIMA 3WYXA 2ZDUA 3V6SA 4ZSAA 3HX4A 5IA5A 1UVRA 4IJ9A 4ZLOA 4KUJA 2GPHA 2QR7A 4CYJA 5C4LA 3AD5A 5CTPA 4O82A 3R8MA 3ZXTA 2WTKB 4TWCA 4QRCA 3G0FA 3PY3A 4UBAA 3R8ZA 4XBRA 3TI1A 2XIRA 4IMYA 4U9AA 1YQJA 4KAOA 2X0OA 3BELA 1ATPE 2I1MA 3F5XA 1U54A 3I6UA 5BMMA 3KC3A 1XR1A 4QMZA 2RFEA 4ACHA 2OU7A 3MVMA 4ZS0A 3W0PA 5CWZA 2HXQA 4QDEA 4A4LA 2ITXA 2DS1A 2JAVA 4EOLA 2PU8A 3R83A 3KVWA 1REKA 2XKCA 5E92A 5FTQA 4BTMA 5HNBA 4GS6A 3RBWA 5FEQA 2R0UA 4CMOA 1YXSA 3LE6A 2C5XA 2PE2A 4XV2A 3QHRA 5DT3A 2UV2A 2W1GA 3EQFA 5KX8A 1M2RA 4A06A 4NEUA 2XB7A 4BYIA 1I44A 4D5HA 2R3QA 5EHYA 4O84A 1OL7A 3QUPA 1MP8A 2X7GA 2WTIA 4EK8A 4FZ6A 5CSXA 3HMMA 4IM2A 2BKZA 4AZSA 3QU0A 4HGSA 4FTLA 3TV7A 3MFTA 2ETRA 2RGPA 3GXLA 5ETIA 2B52A 3LLTA 5CAQA 4JRNA 2NNWB 3D14A 2OIQA 3LQ5A 5EDPA 2X0QA 4BCFA 2PULA 4QP1A 4MH7A 4E5AX 4PDYA 1PW2A 2VTQA 4MXAA 3ROYA 3UQFA 2B9IA 2QOFA 1BI7A 4K1BA 4HNIA 4YSMA 3AXWA 3GCVA 5J7HA 4RX7A 5E8XA 5J87A 1NT2A 4M84A 3S00A 4JLCA 4ZTMA 4HZSA 3C9WA 5HIDA 1P4OA 3VAPA 2W1DA 4E93A 3UIBA 3QD2B 4YHTA 5IU2A 5L2WA 4QQJA 1E1XA 3P9JA 3PWDA 5CU0A 2C68A 4ZAUA 3ZO2A 4MUQA 2CNUA 4L00A 1XH8A 3TM0A 1Q8ZA 1YKRA 3MH3A 4YGAA 5AX3A 4D9UA 1CKPA 4IAFA 5ETAA 3ZH8A 3IDCA 1U5QA 4QNAA 2Y8OA 1ZYCA 4DDIA 4W8EA 4FV2A 5CNOA 4R5SA 4AT4A 4EYMA 2VRXA 4FSTA 3VUKA 1G8KA 3RCDA 3C0IA 4KA3A 1Q24A 1NVSA 1PY5A 4J97A 2XF0A 4KINA 4FIEA 2R9SA 2A0CX 3PWYA 3FJQE 4IM0A 4FTOA 4E4MA 4NFNA 5LCJA 3CTQA 4JQEA 2HENA 4NW5A 2UVZA 1WAKA 4BHNA 2UW5A 4ZY5A 5JRQA 4RA4A 1JPAA 1YDTE 3MA3A 3MTLA 3OROA 1CKJA 5FWKK 4PPAA 5E8TA 1LEWA 4OTGA 2C30A 4XYFA 2ITWA 3E3PA 3SOAA 4R78A 3F3VA 4DGNA 4P7EA 4QOXA 3EFWA 3FSKA 4E7WA 5AUUA 4AQKA 2R3LA 4EH7A 5DG5A 2WFYA 4F6SA 4L7SA 3TACA 3L8XA 4CV9A 5E4HA 2X9EA 4NJDA 4X21A 2B53A 2WMQA 3AC8A 3V01A 1GAGA 3WZJA 3N4UA 1F0QA 4LMNA 3TXOA 1GZ8A 4DHJA 4XP0A 4EWHA 3FMNA 4GYGA 4JIKA 3NIZA 4PDSA 5EM6A 4O0TA 5JGAA 2QG7A 1Y6BA 2WMSA 3VBQA 1H25A 5CALA 1R0EA 2PVYA 2I0VA 4ASEA 4DITA 4IWDA 2BZIB 4ARKA 2R3PA 2QOQA 4FNZA 4FSNA 3ZDIA 2Z7LA 4RVKA 2BDWA 2R5TA 5EDRA 4BBEA 4PP7A 5GJDA 4FEUA 3HGKA 3H30A 4EOKA 4M66A 2YABA 3WF5A 4W9WA 3U6HA 3ZEWA 2Q0NA 5IA3A 4FBXA 3JYAA 1YHWA 2XJ0A 2YAKA 1WVWA 4ZJJA 1U59A 4L53A 1P2AA 4BWKA 4XG4A 3DXNA 3S95A 4C4JA 3F3WA 3LCKA 4YJSA 3CS9A 3PRFA 4AZTA 4CCUA 1WFCA 3POZA 4XG9A 1W2CA 2OG8A 2WIPA 3IDPA 1VR2A 4FG8A 1PYXA 3A4PA 3PXQA 1CSNA 5A4LA 4F1TA 5L8LA 2YWPA 3MWUA 3BLQA 4UYAA 4AT5A 2I0EA 5AWMA 4OAUC 3BE2A 3N4VA 2J0JA 3R0TA 2O2UA 1Y91A 2ZJWA 1PXNA 2ITOA 3DV3A 4G3GA 3QCXA 3W2OA 4BDHA 4RT7A 4F9WA 3MIYA 2W1HA 2WNTA 2VU3A 1YOLA 1UKIA 3FLNC 1UWJA 2X8IA 4BC6A 4D4RA 4YO4A 1FVRA 2JAMA 4JS8A 3OCSA 3D5WA 4I22A 1BX6A 4QP6A 4YMJA 2HZNA 3RVGA 4EKKA 1PXIA 3OEFX 3A61A 4YJOA 5AEPA 3ORNA 4LL0A 4BI2A 4F08A 4BI1A 2E9VA 3UNKA 2WKMA 2B54A 3IW5A 3KMWA 3L8SA 5EDQA 2VWUA 2ZMCA 3VS6A 3KXGA 4UZHA 4QP8A 2E2BA 4R6VA 5DR6A 5BNJA 3QYZA 3LCSA 4BZOA 3MV5A 3WZEA 1P14A 3TMOA 1LP4A 1L3RE 2PVFA 4J53A 5HNIX 3UDSA 5H2UA 1OMWA 5LQFA 1RJBA 2GS7A 1ZXEA 1OL6A 5JK3A 1JSVA 3ZM9A 1JLUE 3LFEA 3G6HA 3RP9A 2BHEA 4I41A 4IHPA 4LGHA 4RX8A 4C37A 1XO2B 2BRMA 2OXYA 4UX9A 1ZY5A 4IFCA 5KE0A 4JX7A 5AFVA 1PKGA 5AUTA 3ZU7A 1JVPP 1Q99A 4PTGA 4AZEA 3DK6A 4GVJA 1J91A 2V22A 2UW4A 5HLWA 1URWA 4IFGA 3B8QA 3KIOC 4KIPA 3MFSA 5BPYA 4U40A 2B7AA 4II5A 4BTKA 1CDKA 5E1EA 3UOKA 3KXMA 5D10A 2P55A 2YIQA 4R3RA 3SG9A 2EB3A 1Q8WA 4MHAA 4XBUA 4C58A 1W2DA 4RJ4A 2OLCA 3CY2A 3D2KA 4OUCA 2F7EE 3R8LA 2BUJA 2JKKA 2IEWA 2Z60A 3OUKA 1TQPA 3QKKA 1P4FA 3R7YA 4D0WA 3QTWA 4O96A 3VS5A 2NP8A 4JDHA 2BTSA 4WG5A 5AM7A 5AP6A 3EQRA 4GH2A 3FKOA 2VTRA 2Z8CA 3PG1A 5JMSA 5IISA 1GIIA 1RW8A 3DFCB 4ITJA 4L3JA 3MS9A 4X3FA 4XS2A 3HDNA 2WTKC 4AN2A 3MJ1A 5AA9A 1H1QA 4IH8A 5EKOA 3G6GA 5HQ0A 1L8TA 2EXMA 3F6XA 2O8YA 4I21A 4K33A 3OCTA 3COHA 2JDOA 2J90A 3H10A 2GSFA 3BYMA 3F88A 1AD5A 2VGOA 4BGHA 4PV0A 5CANA 3UDTA 2HY81 1HCLA 4FTJA 3RALA 5BVWA 5CX9A 4G5JA 4W4YA 3OY1A 4FL1A 3R71A 2YISA 4C2WA 3GCSA 3EHAA 4YTCA 2F4JA 1GOLA 4J71A 2J5EA 2PUNA 2HWOA 3EN4A 2J4ZA 2W5BA 4AF3A 4CLJA 4LV8A 1JKLA 3FV8A 3BHTA 1BMKA 1FMKA 2OBJA 3HMNA 4RZVA 2GDOA 4B6LA 4O6LA 4PMSA 3PYYA 4CEGA 1G3NA 3A7IA 4U79A 4XX9A 3KRLA 2WEVA 2YIXA 3EQHA 2FO0A 4QMPA 2GNLA 4F4PA 2XIYA 5HCXA 2UZVA 4HNFA 3P1AA 5AUZA 5LOHA 4AG8A 3OBGA 4OTRA 4O7SA 4MKCA 4ZSEA 1W2FA 1FVVA 2QOCA 3UVRA 3NNVA 2OICA 4QMSA 3LXPA 5CAOA 3ZO1A 2V5QA 3SXRA 4IC8A 4QPAA 5K5XA 3DBDA 4DFZE 4FR4A 4FMQA 3BQRA 4ZSGA 2PVMA 3F7WA 5K4IA 4FKVA 4C02A 3BE9A 4BFMA 4BCQA 1W98A 5JZJA 5IUGA 4FTUA 1ZZLA 2IVUA 2VO0A 3PSCA 3LXLA 4RQVA 4RVLA 1PXLA 5AP7A 5KUPA 2QU5A 4DH5A 4AA5A 2ZFYA 4ZSJA 3HZTA 2R2PA 3D15A 3F61A 3G33A 3KXNA 3VJOA 2OF4A 4GL9A 3R1YA 3V5TA 1JNKA 2R7BA 4DGMA 3LMGA 3FZTA 2R3KA 3AKKA 3TJDA 3ALOA 1UU3A 4BB4A 4DEGA 4U41A 1Q4LA 4A9TA 5L8KA 3AOXA 4IZAA 2CGUA 4HYUA 5JFXA 4MF1A 3RPSA 3JVSA 3VO3A 2W17A 2YJSA 3L8PA 3DB6A 5CXZA 2F7XE 2KULA 2W1FA 2CLXA 4PL3A 3COIA 4DDGA 4AS0A 2F2CB 2ITTA 4K0YA 2UZWE 3KF4A 3QWJA 3TYKA 2IW8A 3F7ZA 5CASA 2HOGA 4NT4A 4DYMA 3P0MA 3UVPA 1JOWB 4AXDA 3IDBA 4JIAA 5CZHA 4EH5A 3FY0A 4FV4A 1LPUA 2JIIA 3EKKA 4C36A 3JXWA 3NW6A 4BBMA 3CSVA 2BAJA 2XH5A 5A4QA 3ULIA 3B8RA 4OT6A 4XJ0A 5IH6A 1SMHA 3BWFA 4D2TA 1ZYDA 2QU6A 4GK4A 5E1SA 3NNXA 4FTKA 4BWXA 1GZOA 3CPBA 1KUTA 4RJ8A 3V5PA 2Y4PA 3LPBA 4YHFA 3KK8A 4EYJA 1OECA 5HICA 1Y8YA 1EH4A 2OK1A 2OXXA 3G9LX 3I7CA 2PHKA 4C4FA 3ORLA 4MXCA 4JVGA 5EFQA 4O7ZA 4O22A 4YZNA 2QCSA 2AUHA 3CY3A 1PRYA 1FINA 2HCKA 2HZIA 4GJ2A 4EUUA 3ZFXA 3KN6A 4GT4A 4OBOA 2VV9A 4JRVA 3UZRA 4IAYA 3II5A 2P2IA 3BX5A 3LXNA 2WMUA 4IAIA 3CGFA 5HE3A 1WCCA 2ZV8A 3RPVA 2WAJA 4I6HA 2VTPA 2EVAA 4C61A 3ZFYA 3VULA 2JC6A 1VYZA 2JEDA 4EBVA 5C01A 3DBQA 3Q2MA 5A6NA 3SGCA 4U3YA 5A4TA 3SVVA 5BMSA 3VWAA 1DAWA 1FVTA 5AM6A 2W1CA 5DOSA 2E9NA 3LOKA 3QX2A 2QNJA 3QC9A 4BDKA 3KQ7A 4QMYA 5FXQA 3GENA 5CVGA 4BIDA 2G1TA 2R3HA 3RAKA 4Z16A 2EU9A 3LFSA 1AGWA 4YTFA 3MB6A 3QQHA 3FEGA 4RIYB 1TZDA 3I6WA 3PY0A 3Q04A 4KS8A 4JDKA 4P4CA 4RIOA 3TNIA 3P78A 4WT6A 4YC6A 3U8WA 5AAGA 3ODZX 3P5KA 4ZOGA 5HO8A 4LI5A 4D55A 3HLLA 1QL6A 4D2RA 4JT3A 2HYYA 4HGLA 4TT7A 2XP2A 3E92A 2B1PA 3O8TA 3DQXA 5DR9A 4BCGA 4EKLA 4YSJA 4BY9E 4NYEA 3V5QA 3SAYA 3MH0A 3PJCA 4QP2A 2FA2A 1IG1A 3BKBA 3UZTA 1UA2A 1SNUA 3E8DA 3R01A 5EW9A 5IPJA 4X2GA 5DIAA 3Q3BA 3EQDA 4KNBA 4JDIA 4M12A 3AG9A 4YPDA 3S1HA 4MD8E 3LKMA 2QOBA 3ITZA 2PVJA 3ID6C 4YLKA 4CMUA 3AT4A 3EIDA 4FTCA 4AZVA 4YJUA 3REPA 4IX6A 2ZAZA 1J7IA 3OFMA 3HDMA 1VLRA 4IVAA 3NFGB 3UJGA 2BIKB 3FWQA 4DEBA 4H3BA 4FX3A 2WIHA 4AE6A 3ZBFA 4U8ZA 4OAVB 2VNYA 5IQEA 1IASA 3M1SA 2EUFB 4X2FA 2GCDA 4CLIA 4CGAA 4FL3A 1OUKA 2C6EA 3FUPA 1DI8A 1A9UA 2UW0A 3ORIA 4RJ3A 3ZS5A 5CENA 2W4OA 4F70A 4FT5A 5BX0A 5JN2A 1Q3WA 3NAXA 3KXHA 4JQ7A 5CEPA 4DHFA 3I5ZA 4FEQA 3AGMA 4MNEB 4O4EA 5EOLA 5JKGA 3BWJA 3VS0A 4RFZA 4QTBA 5EI2A 4BKJA 2I40A 4TWNA 2XALA 4MVFA 4CFFA 5M55A 3KREA 3SX9A 3R9DA 2ETKA 3OEZA 4JX3A 2C0OA 4P2KA 4O0WA 4ITIA 4P5ZA 5DR2A 1QPJA 5J79A 4NSTA 4AW1A 3ZLXA 5HTIA 3KCKA 2V7AA 2OJIA 5L6WL 4F64A 1DI9A 4WG4A 4CG9A 5LMKC 2RFSA 2ZVAA 2YACA 3D4QA 5B7VA 5BVOA 4O7TA 4QYGA 2BTRA 3LHJA 4K2RA 5ANIA 4FGRA 5AAEA 2XKFA 3IONA 3BEAA 4S31A 1G8AA 3AC2A 4EOQA 2X2KA 3WYYA 3CC6A 5HIEA 3ELJA 5EM7A 3HMPA 1PMNA 1ZOHA 3E8EA 3F5GA 1KE8A 3FHIA 3O8PA 3V8TA 4APPA 5LVNA 4JL9A 2YJRA 3HP5A 1URCA 2GS2A 5AV1A 3CPCA 2IVTA 3PIYA 5AP3A 1RQQA 2YAAA 3V8SA 1G8SA 2HZ4A 2RFDA 4L3LA 3VHKA 5CU6A 3IW4A 3UE4A 2HZ0A 3DOGA 4YNOA 4UMUA 4XG8A 3D7TB 4I1ZA 4QQ5A 3SLSA 3A99A 4BCHA 4DF3A 4FTQA 5HG9A 4CT1A 3R7GA 3M2WA 5DEYA 3DKGA 3R2BA 5FDXA 3UG2A 4I92A 4A4XA 1K3AA 4KWPA 1ZY4A 5AR3A 4NH1A 4FVQA 2ZM1A 4DT9A 3NYOA 3KMUA 3DK7A 4GEOA 2IPXA 2YDJA 1J1CA 4D4VA 3HRCA 4ERKA 2VWVA 3SDJA 4JG6A 4UMTA 4BWPA 4RIWA 5KMOA 4FT9A 3NUNA 4HVDA 4U42A 4C4GA 1ZYJA 3CQUA 3LFBA 2VX1A 3WI6A 1GZNA 1A48A 2YIWA 5D9HA 5JRSA 2ITNA 2IZUA 2Y0AA 2EWAA 1Q41A 2PUPA 3QD4A 4CZYB 3O51A 3U6IA 3LAUA 2V55A 3P7CA 3QTQA 5DH3A 4DGOA 1M14A 3COMA 3N51A 4W8DA 3NCZA 4XP2A 2BAQA 5HO6A 3EMGA 4HJOA 4M13A 4BDFA 3UP7A 3C50A 5DA3A 3DK3A 2FSLX 4FL2A 3VBVA 3AC4A 5K0XA 3D2IA 2LGCA 4DCEA 1TFFA 3NUAA 4HVIA 2PTKA 2XIZA 3DNDA 3ORPA 1SM2A 4IB1A 4JBPA 5FM3A 3TKUA 3V3VA 2AEGA 5HESA 2ZM4A 3PP0A 4QP4A 4X2JA 3QZHA 5I9WA 5JEBA 3HAVA 1STCE 1XH5A 2EXCX 1NXKA 3QQUA 3HEGA 4IX5A 5HX6A 3SQQA 4KRCA 3UGCA 3COKA 5ICPA 4J98A 3FL4A 5CF4A 2WOTA 3LVPA 2BZKB 4MD9E 2XM9A 4OW8A 1DM2A 3N4TA 5HCZA 5I9VA 2Z02A 3UMXA 5HVKA 3LM0A 3CBLA 3CIKA 3FLSA 3NS9A 4FYOA 5L2TA 1O6KA 3H3CA 2B9HA 5BVNA 3EN7A 3AKLA 4GKHA 4QDVA 2WMRA 2R4BA 2X7OA 3FE3A 4XV1A 5EHLA 5HCYA 4E5WA 3NDMA 2IJMA 4ENXA 1ND4A 5FUTA 3C0HA 2QOIA 4PY1A 5DYJA 3CTHA 2VGPA 1KE5A 2C6IA 4J99A 4LFIA 3ML1A 4ZTRA 3W10A 4JMQA 1ZZ2A 2PVLA 3JY9A 5D7VA 4BICA 3FMJA 2YERA 2IO6A 2X2MA 2OH4A 5FP5A 3KRJA 2IF8A 3UG1A 4F63A 3IQ7A 5CVFA 5E8WA 2OI4X 3QKLA 5DGZA 2OW3A 2W1IA 3BGQA 4HCTA 2DQ7X 2YLFA 3FC2A 3EOCA 5HD4A 3LMHA 2W05A 4CCBA 3GFWA 3BEGA 3EJ1A 2ITUA 2VZ6A 1ZMUA 2XK4A 3NPCA 3UMWA 4FT0A 4FSMA 4NFMA 3QUDA 2YM5A 3NWWA 4MBJA 4E20A 4YZCA 5C8KA 3F2NA 3P23A 2VUWA 3AC5A 4QQTA 3TIYA 2CNVA 2W5AA 3WF7A 5ETCA 4M15A 4RC4A 1R0PA 5CU3A 3V51A 4Q5HA 2GFSA 4Y5QA 1OKWA 4ZJVA 5HU9A 5IF1A 4WA9A 4IAZA 4DTAA 3MIAA 4PUZA 4EK6A 1KOBA 3CGOA 2YZAA 3ZCLA 3DDPA 3ZHPC 2R7IA 2C69A 2OIBA 2R0IA 3PZEA 4AW0A 4WHZA 3OXIA 4TYGA 3L9LA 3UIXA 4A7CA 2IG7A 3PRIA 3DA6A 3D7TA 4DH8A 5KZIA 2F7ZE 3C4XA 3QXOA 4IDTA 2PE1A 3AC1A 4L42A 5J95A 5H8GA 5L6OA 4UWBA 2YM7A 3O23A 2FSMX 4N0SA 5F94A 5HHWA 5FTOA 4IJPA 4ALVA 5HG8A