4DH7A

Low temperature x-ray structure of camp dependent protein kinase a catalytic subunit with high mg2+, amp-pnp and ip20'
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
336
structure length
333
Chain Sequence
VKEFLAKAKEDFLKKWETPSQNTAQLDQFDRIKTLGTGSFGRVMLVKHKESGNHYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMVMEYVAGGEMFSHLRRIGRFEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGFAKRVKGRTWLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFATTDWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEEEIRVINEKCGKEFTEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Low- and room-temperature X-ray structures of protein kinase A ternary complexes shed new light on its activity.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transferase/transferase inhibitor
molecule keywords cAMP-dependent protein kinase catalytic subunit alpha
total genus 109
structure length 333
sequence length 336
ec nomenclature ec 2.7.11.11: cAMP-dependent protein kinase.
pdb deposition date 2012-01-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4dh7A01
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4dh7A02
2X7OA 5EFQA 1Q8UA 2PL0A 3RPOA 4AW2A 3P78A 2F7EE 5LVOA 3RAHA 3KVWA 3WE4A 3PY3A 1SMHA 2BDWA 1FMOE 3WF5A 4FKSA 3LE6A 5GINE 3DTWA 1WVXA 3R0TA 2YA9A 1Q3WA 5AMNA 2QOOA 2OIDA 2WMSA 4QYEA 5B2MA 4CVAA 3ID6C 2W0JA 4TXCA 3PFQA 3THBA 1IR3A 3TN8A 3C0IA 2FH9A 2BUJA 4MH7A 1PMNA 2IN6A 3VULA 3LCDA 5EI6A 3FJQE 3ZCLA 4BC6A 3QF9A 3ZBFA 1RJBA 2W1IA 5IISA 3CEKA 3AD5A 3MH1A 3QKKA 3VBWA 2QLUA 3AT3A 4RX7A 3ANQA 1NT2A 3S2PA 4I4FA 4OGRA 2GDOA 3V51A 1GNGA 1PMVA 5HNGA 4D2RA 3F3WA 4IEBA 2BRGA 3O8PA 5EHLA 4BI1A 3RGFA 4R3RA 5TR6A 1Z9XA 5KZ0A 5CEPA 4O7RA 4ID7A 4JRVA 4FKVA 1L3RE 5FEQA 3PWYA 4FV9A 4RZVA 4QYGA 4EOKA 3HX4A 2WQOA 3KU2A 3BU5A 4IH8A 3UTOA 1J7UA 4U43A 2E9UA 5DFPA 2WTCA 2ONLA 3CTQA 2PUUA 3L8VA 3BWFA 1GJOA 2BILB 4KINA 4RLLA 5KZIA 4XV9A 2KULA 2YACA 2ZM1A 4WRSA 3UPXA 3VQUA 2RFDA 4J97A 4CG9A 5FBNC 4AF3A 5BYLA 4JR7A 2ETRA 3LAUA 4QPMA 2B52A 4XG3A 4EH9A 3MFSA 5DT3A 4IQ6A 5D9HA 2PYWA 3VS5A 4FK3A 3S4QA 1JKSA 4FKRA 5HX8A 2BALA 3V6SA 4CTCA 2HXQA 3OW3A 3QZHA 1CKIA 4O7ZA 2YAAA 2C3JA 4X6QC 4AFEA 5HLNA 5I0BA 4MNEA 4RJ4A 4V0GA 4USEA 2XRUA 3MW1A 3Q5IA 5DEYA 1XH5A 2C5OA 5DRDA 3VIDA 4EHVA 3A4PA 5AX3A 4DTKA 3LQ3A 4RQKA 5HZNA 3AMAA 4O0TA 3WZUA 3LW0A 1ZZ2A 3W55A 3LVPA 3ORLA 2JEDA 3CD3A 2HYYA 3F7ZA 1Q62A 5KCVA 4R5SA 3OMVA 1B38A 2YZLA 3R1SA 3RJCA 4M14A 1HOWA 4ZTNA 2UW4A 4FT7A 2QOHA 4JAIA 4CCBA 2GNGA 4KAOA 1J7IA 5HEZA 4E8AA 3HGKA 5CVGA 4BKYA 2VV9A 2W17A 4TNDA 3PY0A 1YOJA 2JDSA 3NYXA 5ETCA 5A4TA 2E2BA 3QC4A 4QYFA 2J2IB 5LQFA 2CPKE 3UP2A 3ZYAA 1GIJA 3A7GA 2IVSA 4BCFA 1H8FA 4FG7A 5A4QA 3KK8A 4H1JA 3ZZWA 3AC1A 2XIYA 2CGVA 4AGWA 3OTVA 2VD5A 4I5MA 4UWBA 3PZHA 1YWRA 3S00A 2XCKA 4EYMA 1X8BA 5M55A 4G16A 4D9UA 5JQ8A 4C2VA 4GFMA 1JKTA 4IWQA 1ZYSA 2VU3A 4I5PA 4YZMA 1W84A 1XJDA 3Q32A 5AAGA 1PF8A 1FGIA 4OTWA 4UMPA 5HTIA 2W5AA 2B9FA 3IK3A 3SW4A 4EHEA 1FBNA 4LI5A 2XK8A 4FF8A 4NKAA 4P4CA 4PPCA 5FP5A 3IONA 4A9TA 5EW3A 5BUJA 2R3RA 3A60A 2OZAA 2R9SA 1IA8A 1PXKA 2RF9A 2YZAA 4UMTA 2Y4IC 4XV1A 1YXVA 4CMUA 4IB0A 3U54A 3LFNA 1M2QA 5D41A 4C62A 4DT9A 1SNUA 5ANKA 1TKIA 2QONA 3GFWA 4MWHA 3NCGA 2Z7LA 3OCGA 1GY3A 3MFRA 3EQPA 3G0EA 5E1EA 4Z16A 4FT9A 5EDPA 5B2LA 5FUTA 3CBLA 4MF0A 3GT8A 4HGTA 4IZAA 3A4OX 5CAQA 4DE4A 4C8BA 2B7AA 5LVNA 5IMXA 4E7WA 3UODA 3NW6A 4R7IA 1JQHA 5K3YA 2QR8A 3FHRA 4RX5A 3W32A 4G3GA 3C0GA 4F9BA 3ORXA 3UOLA 3G33A 4CFFA 4B0GA 1KV1A 5EDQA 3KCFA 3DXPA 5CNNA 4MAOA 3VJOA 4IWPA 4I21A 4I5CA 2J0IA 5L8KA 3QD4A 2QOCA 4X2FA 2UW7A 3KXXA 4C0TA 4D0WA 3NNVA 4ZTLA 5JZJA 4BIDA 1YKRA 3KMMA 3VNTA 4ZSAA 5CANA 1APME 4C37A 3MI9A 5AP6A 4R8QA 1ZMVA 3PSCA 1ATPE 3QCXA 4FTQA 4NM5A 3ULIA 3OCTA 4RIYA 3EMGA 3CY2A 1YHVA 2YM8A 3LQ5A 4FNYA 4AE9A 4BDAA 3EQCA 4TYHA 3DLZA 3DBCA 4P7EA 4IX4A 3DDQA 4PMPA 5M4FA 4DYMA 3NEWA 1YDSE 3OUKA 4XOYA 4HCTA 2IZSA 2W5HA 5FM3A 4X3FA 1MQBA 2PVKA 4QMYA 5GZ9A 3OD6X 2XIRA 5CXZA 3DT1A 3VS1A 5JGAA 2BAQA 3BE2A 4YJRA 3CKXA 2QG7A 5ICPA 3RMFA 2OICA 1PHKA 5E8VA 4FYNA 5HX6A 4E6DA 3LXLA 4N0SA 4FSUA 2W99B 2YERA 3H9FA 4YHTA 1YXTA 1BYGA 3OXZA 4UYNA 3PWDA 2QC6A 4UEUA 4IB5A 5FD2A 4BTKA 1WVWA 3U6IA 4PL3A 3ODZX 2X2MA 2W1ZA 1YI6A 4XEYA 3VBXA 4KIPA 4YBJA 5CU0A 1H4LA 5CAUA 2UZNA 3QRUA 5E7RA 2BFYA 4KS8A 3FWQA 3BYSA 3TUBA 5AR2A 2BRMA 1JKLA 5HE0A 3CTHA 5T6KA 1XHAA 2JBOA 4ALWA 4OLIA 3SW7A 5FQDC 2QURA 3R02A 4QP3A 2XNBA 5DYJA 5JQ5A 2ITYA 3IGGA 3Q9YA 4PL5A 4Y83A 2XH5A 4G6OA 1YXXA 2WOUA 4FZDB 4FL3A 5DH3A 2ERKA 2JGZA 4WNKA 3NSZA 1JBPE 2DYLA 4A4LA 2VAGA 3GP0A 4MD8E 4OT5A 5JGBA 1K2PA 4HCUA 5A4LA 3QWJA 5BNJA 2X7GA 2UZLA 4KABA 2ITWA 3TKIA 3R22A 5I9XA 1H08A 3E87A 3U55A 3DS6A 3KVXA 4KRDA 1ZARA 2UZDA 4TWPA 2ITVA 5DR6A 5JRSA 2BAJA 3QQUA 3OROA 1GAGA 1FOTA 4EBWA 4M3QA 3FLYA 1BUHA 2OG8A 4IAFA 2QHMA 3L9PA 4DFUA 3AC5A 4FSNA 3EH9A 4C36A 1H25A 4O38A 4I6FA 2GFCA 4CLJA 3I1AA 3ODYX 4DBXA 1BI8A 5TKDA 2VTPA 2F4JA 1J1BA 4DGMA 4ZMEA 4FKJA 4EQUA 4XRLA 5ETAA 3M2WA 2ITXA 4JNWA 2VWYA 2VTTA 2Z02A 3GQIA 5AFVA 4FIJA 3TZ7A 3E3PA 3FHIA 3NPCA 2P33A 4HVDA 4EH8A 2WMBA 1MUOA 3R7IA 1SVHA 2WD1A 3EQRA 3HL7A 4IFCA 3MY0A 3KMUA 1M7NA 4KSQA 3G5DA 4XOZA 4AFJA 5FXRA 2OF2A 1PMEA 4BCMA 4CQGA 1OPLA 1SNXA 5E8XA 5IMEA 5KKRB 1Q8TA 4DH7A 3MH0A 5ETFA 2J6MA 2W4OA 5AR7A 5FTQA 1NXKA 3TI1A 3W2SA 4BF2A 4BCIA 5L2IA 2YWVA 4JS8A 5L8JA 4EEVA 2PU8A 4DN5A 3D9VA 2YN8A 2WEVA 3DOGA 3H30A 3QALE 5C9CA 3KN6A 4J71A 3PVGA 2C6EA 4UMRA 5JGDA 5D7AA 3FMNA 4PY1A 3FQHA 2C6MA 2YLEA 4UWCA 2PVRA 2CN8A 4G6NA 5DWRA 4ZJIA 4A7CA 4FUXA 4B7TA 3I0QA 2XIXA 3WILA 3HAMA 3HA8A 3QLFA 4U80A 4G9RA 2OLCA 5HQ0A 2X4ZA 4EZ7A 4QTAA 3R01A 4XH6A 5CAVA 4JBQA 3VRZA 5L2WA 3D94A 3KF4A 3VW6A 3QQFA 1UNLA 2VX0A 1KUTA 4O7VA 4RLKA 5IKWA 3ULZA 3BRBA 3RK5A 3DKFA 4BIEA 3JXWA 5C8KA 5FXQA 2ZMCA 4FVQA 3VUIA 4Z3VA 3GBZA 2IG7A 3H10A 4ZEGA 4IVAA 3HMNA 5M44A 2X0GA 4BTMA 3UMXA 3TZMA 3DK6A 4GYGA 4QRCA 3NVMB 1V1KA 3VW8A 4WNMA 3ZTXA 4AGDA 3CR0A 3QKLA 1XWSA 4TNBA 4EI4A 3IW7A 1ND4A 4YTIA 3GU7A 1Y6AA 4YJVA 3V5LA 4D0XA 3RPRA 1XBBA 3V8WA 2UUEA 3BU3A 3HV3A 1UA2A 3F5UA 4O0UA 3PLSA 1IAJA 1Y8YA 4IADA 3MA3A 1NA7A 2AC5A 3D5VA 1WFCA 3DFAA 2WQNA 1KOAA 2GQGA 4H39A 1CM8A 4ITHA 2LAVA 4EKLA 4CT2A 4CFMA 4FVRA 3UVQA 5B0XA 3MTLA 3PG3A 2PVMA 2YIYA 3EQDA 3PTGA 3QHWA 3UIUA 4AXAA 4GSBA 3SDJA 3V5TA 3I81A 4TYHB 3SOAA 3AMYA 2E9OA 4CD0A 3QYWA 2IWIA 5HCZA 2A27A 2OFUA 1Y91A 2VN9A 3VS4A 2R3HA 3QFVA 4F08A 4R7BA 5HE3A 3B8QA 3FLWA 2Z7SA 1FVRA 3OWPA 4YJPA 5M4CA 4O7TA 3FLZA 5AA9A 3QTWA 4S31A 2XJ0A 3IGOA 2H96A 2QR7A 3A8XA 3DPKA 4YU2A 3GU5A 5AP7A 1Q3DA 5DBXA 4BZDA 2ZOQA 4FTIA 1UV5A 3R21A 4FSZA 2VX1A 1Q97A 1QL6A 4GK2A 3ROCA 4FZFB 3O23A 4GRBA 4DC2A 4J96A 3JVRA 4CMOA 1Q8WA 4ZZNA 3BV2A 1PXPA 1QPEA 3QRIA 5DPVA 4K33A 5FGKA 3UC4A 3PLAE 3DKCA 2X8IA 2JLDA 4MNEB 5CVFA 4F1MA 4U42A 3R71A 4D4SA 2WQMA 4L3LA 4QNAA 3EN6A 3UO5A 3G9NA 5BMMA 5CEOA 2EXMA 4N57A 3TKHA 2F9GA 4BYJA 3L9NA 1JSUA 2JC6A 4CSVA 2YM6A 4WRGA 1TQMA 3KGAA 4E6AA 2OGVA 3CXWA 4ERWA 4TRLA 4W9WA 3REPA 5AV3A 5IEVA 4RC3A 3SX9A 5F20A 5AM7A 3T3VA 2W5BA 4AE6A 4EOOA 4D5HA 3Q53A 5IH4A 4O91A 3SA0A 3LFBA 3OWKA 1TQIA 4EC9A 4OTDA 4XX9A 2XNEA 5A54A 2IVVA 2R3JA 2IO6A 3ELJA 2J0LA 3AT2A 4GL9A 3QWKA 4O0XA 3SV0A 5F94A 5KMNA 2B9JA 3IO7A 5EQPA 3U4UA 3WYYA 4F6SA 2X4FA 3BCEA 4J98A 3QTXA 4S33A 3SG9A 2HOGA 4ZTSA 2XK4A 5J8IA 4MXCA 3FMDA 2WXVA 3QQKA 4C02A 1H1QA 4XG2A 2PMOX 2IW8A 4EZ5A 4RJ6A 4R1VA 1RQQA 4D9TA 4NWMA 4BGGA 4L46A 4FI1A 1LR4A 2W1DA 3R8UA 1B6CB 3EQHA 3PA3A 2FYSA 4EL9A 3VS6A 4EQMA 2XIZA 3KRXA 4I22A 4O6LA 1ZY4A 3RI1A 2OO8X 2XMYA 2QO9A 4GVAA 3D7TB 4AX8A 2BTRA 4BVUA 4DFLA 2R3FA 3R63A 4APPA 3ZRMA 4LV8A 3KFAA 4EOJA 4I94A 3IDPA 2QVSE 2BAKA 3B2WA 3C5IA 5CZHA 3FAAA 3C50A 3DBDA 3MJ1A 4RWKA 5HD7A 4CGAA 4MEDA 3SQQA 4J99A 5BVWA 2Y7JA 3FE3A 4FV2A 5ACKA 3BE9A 4TYEA 4XV3A 4GV1A 4EOMA 1F5QA 2WHBA 2F49A 4GEOA 5LXMA 4X2JA 3W2OA 4GUEA 4TT7A 4GW8A 5JMSA 3GCPA 3FMKA 5LMBA 2XJ1A 2BRHA 4YJNA 5BUIA 3O50A 3V5WA 1SVGA 4ARKA 4EC8A 4KBKA 3BHVA 4FV1A 5D7VA 3GVUA 2IZRA 4JDJA 3ORMA 3HV5A 3I79A 5LMAA 3QRKA 4RA4A 3ZLSA 3ZU7A 2R3MA 3CC6A 4C61A 4BBFA 4YZBA 1PXLA 4DH8A 3DV3A 3PA4A 3O17A 4L9IA 1U5RA 3ATSA 5AUZA 3TJDA 3DQWA 5GJDA 3E8EA 3DB6A 1T46A 4FV7A 4DEBA 2CNQA 4QOXA 4J8NA 2QO2A 3D5WA 3VBVA 3FEGA 4O84A 3CY3A 3PIYA 4TY1A 3PRIA 4G34A 5EYCA 4MD9E 3TTIA 2V0DA 3RZFA 2CKPA 3BLHA 5FTOA 5HCYA 5KNJA 4WG5A 4O22A 4DG3E 5EM5A 3NAYA 2BIKB 3ZEWA 2J5FA 5HE2A 1ZY5A 1H07A 3SRVA 2FB8A 3E7OA 3WOWA 4ACCA 3AQVA 4F70A 1NVSA 2PVHA 2QODA 4XBRA 2CNUA 4QQCA 5C1QB 2W06A 4CFVA 2C6IA 1OBGA 3Q4UA 4YJOA 4FGBA 4YUQA 4WO5A 1PXOA 4D1ZA 4NYEA 1NVRA 2B0QA 1ZOGA 3C4ZA 4ASEA 5HU9A 4GVJA 5AP5A 4G5JA 4BCPA 2UW9A 3B2TA 4EBVA 4BR3A 3BGZA 3R7VA 3ZFXA 3RNYA 4B9DA 3SXSA 4L43A 2PK9A 4OW8A 3CCNA 4E5WA 3TV6A 4QNYA 3WARA 4GG5A 2FUMA 4BTFA 3D2IA 4V0GB 2GNJA 4AOIA 3MV5A 3KXHA 4A9YA 4AZEA 2A0CX 3VF8A 4QMUA 3GXLA 4CZTA 2B9HA 2R3KA 4RC2A 2HWOA 3K3IA 5HG5A 3DY7A 5KE0A 5JFSA 4PTEA 3BYMA 4TWCA 4PUZA 4YTFA 4FKPA 2WQEA 5AX9A 5H8EA 3MN3A 4PF4A 3OT3A 5IA3A 1OL5A 5GJGA 4X3JA 4MQ1A 4C4JA 4EONA 4M12A 3EOCA 4M13A 3V5PA 3GCUA 1YVJA 4DTAA 4GH2A 4I92A 4FL1A 3NW7A 3DXQA 4XJ0A 3BZ3A 2YJRA 3MFTA 1ERKA 4O7NA 2QOQA 2YDJA 3QQHA 3VS2A 4EUTA 3UG1A 4QP8A 3P5KA 2UW3A 1M17A 1JLUE 2E9PA 4X7QA 4B6LA 1H24A 4V04A 4IXPA 4QP2A 5C4KA 2HXLA 3E62A 3F6XA 5D1JA 5DOSA 4IAKA 2C30A 2R3QA 2ZDUA 4JBPA 4S34A 3QTUA 3F88A 3R8ZA 2HW6A 1JSTA 1BKXA 3MSSA 4RIXB 1CMKE 3QL8A 4RT7A 1GOLA 3RAKA 4BWXA 2F7ZE 3MDYA 5G1XA 1CKJA 1R0EA 3HV7A 2XIKA 3FL4A 3VUTA 3G6GA 2BTSA 4ITJA 3ZDIA 2VTQA 1YQJA 5LVMA 3EN7A 3LCTA 2HWPA 1XBCA 3NLBA 3OS3A 4ZLZA 1Q99A 3FUPA 4AZTA 2CMWA 3LFAA 5KHWA 4AT5A 3EN4A 2E9VA 4FG8A 4D55A 1IG1A 3TV4A 3EWHA 2I6LA 2WMWA 3EQFA 3FMLA 3TWJA 4W8DA 2GPHA 2G2FA 4O0RA 3FBVA 3G6HA 3WYXA 4BZOA 4EJNA 4QMPA 5M56A 3EZVA 5CF8A 2VRXA 5KBRA 1YDRE 3F69A 4IJPA 4OBQA 5LARA 3S1HA 2HCKA 1K3AA 1R0PA 2ZMDA 1KE7A 1M52A 3P1AA 5M07A 3QYZA 3MGYA 3RCDA 3N9XA 3OCBA 5AP1A 3RK9A 3R30A 4NM0A 3V04A 2CLXA 4IW0A 5IQCA 2Y6MA 3QTQA 3LJ2A 2W1HA 4QMWA 4LUDA 4QMQA 4O7YA 3H0ZA 3BEGA 4CTBA 2GCDA 4PMTA 4ZLYA 1LUFA 1H0WA 3QC9A 5C01A 4BCGA 4QO9A 5T68A 2A4LA 5HLWA 4DA5A 4QTBA 3NWWA 4RIXA 3DFCB 3DKGA 2GTNA 2KTYA 3TKUA 2YM7A 5H2UA 3TNIA 5DI1A 3AGMA 5BVOA 3CKWA 3O7LB 4QYHA 5BVKA 4U81A 2EWAA 3PE2A 2V55A 2GHGA 5FP6A 2ITOA 3Q6UA 3NRMA 2WMQA 3R28A 2VO3A 5CWZA 3JY0A 5AUVA 3OT8A 3W8QA 3A2CA 4HGSA 2P2HA 4FIFA 3UZRA 2G15A 3VS7A 2ZJWA 2GS7A 4UXLA 5FXSA 5IA4A 2JAVA 3L9LA 4H36A 4NFMA 3UIXA 3EKKA 3HUBA 2UVZA 2HELA 4V01A 5CT7A 2WQBA 3MPTA 5D11A 4ANBA 3ZZEA 3HVCA 4RIOA 5KMJA 2BRBA 4FVPA 4M0ZA 4AA5A 4FG9A 2BKZA 4LG4A 4F9WA 5AUWA 4TPTA 5EG3A 5KKRC 3KULB 4XG4A 1OL2A 3TEIA 2Y9QA 4U97A 3VBYA 4Z55A 4I24A 2C5VA 5CQUA 1DAYA 3LJ0A 4BDJA 4YNEA 3VUDA 2A19B 2CJMA 4F09A 3WZEA 4IANA 2ERZE 4K1BA 2J51A 4FZ7A 3L8SA 2C1AA 5GIPE 2UZBA 2VTLA 2QOFA 3LM5A 4IE9A 4PWNA 4A06A 3B8RA 5E90A 1AD5A 4ZTQA 2O5KA 4IB3A 4XUFA 4YZCA 3COMA 5I9VA 2VO7A 5IF1A 4JQ8A 4PPAA 5HIEA 4U40A 4CYJA 1LPUA 4ZZMA 4NL0A 1NY3A 3LFSA 4BYIA 4D4YA 4F9YA 3TIZA 4FNWA 4QQ5A 5FM2A 1DI8A 3PP0A 2X9EA 2C6OA 4M68A 3LOKA 3V8TA 4FKWA 5LWMA 4GCJA 3LHJA 3BGQA 4QYYA 2PUPA 1OKYA 5KBQA 4E26A 3BEAA 3FKOA 4TZRA 4S32A 3FZRA 3EYGA 4ZSLA 5GHVA 2HK5A 4HNIA 3ZSIA 4PX6A 4AW1A 1H26A 3C7QA 3QBNA 3KK9A 4H3QA 5E8YA 3A7FA 4B8LA 3BPRA 4XP3A 5FG8A 3RINA 3WF6A 4EWQA 4NM7A 5ANDA 5JH6A 5K0XA 4FKGA 5TO8A 3QQJA 2XRWA 4GUBA 3ENMA 3U9CA 4N70A 3BELA 3I7BA 4FKTA 2ACXA 2YIRA 2C6TA 2YIWA 4IX6A 3RAIA 4EHGA 4MBIA 3MVLA 2I0HA 3GNIB 5IG1A 5I9WA 3WF8A 4X6RA 3EQGA 4FV4A 3MVJA 2R7BA 3QKMA 3D0EA 4IC8A 3AG9A 4R3CA 3AC8A 2FSOX 4QP4A 1REJA 2C0TA 5IQAA 2QG5A 5IPJA 2C0OA 2JKQA 2XNGA 5CEQA 4JLCA 4C3PA 5DGZA 2PWLA 4EH2A 3ET7A 4BDFA 5HTBA 4L68A 5CENA 1XH4A 3KC3A 5AV2A 4WG4A 3UO4A 1H1WA 4PTCA 3GC0A 3NUNA 3CE3A 5IQEA 5J87A 1WBOA 3BHYA 2PZRA 3D5XA 2JKKA 3LFCA 3M1SA 3F2RA 3HDMA 3IW8A 4AP7A 3H9OA 4QP1A 3F61A 3HA6A 4L53A 3A61A 1RW8A 3VUKA 4DG0E 5K4JA 3CJGA 4NIFB 2P3GX 3U51A 4D2PA 3ORKA 1OM1A 3Q2MA 4F65A 5ETIA 5IQFA 5BVFA 3UE4A 2OJIA 4QTEA 2EB3A 3R7EA 4A07A 2C68A 2CLQA 4R7HA 5IA2A 3CQUA 4JOAA 2EXEA 4F4PA 4G1WA 4D4VA 1FVTA 4N4SA 5BMSA 3DAKA 4JG8A 4E3CA 2A1AB 5CSVA 4I6BA 4LMUA 3CPBA 3E7VA 4ZSEA 4FTOA 2GQRA 3QLGA 4BDDA 1HCKA 4ZS0A 3IS5A 3C51A 5EKOA 1BI7A 1G5SA 5CAPA 3UPZA 5M09A 5HVKA 4F7SA 2RG5A 3OVVA 2C6LA 2PMNX 4RSSA 4RWLA 4D1SA 3VBTA 4Q2AA 3F3UA 5IUGA 1W98A 2XK6A 1HCLA 4L67A 3LIJA 4H1MA 1PRYA 4ANMA 1M7QA 3R73A 5AJQA 2XNNA 3ZO4A 3CQWA 4BBEA 2W05A 4JX7A 4AN9A 2QO7A 4FV3A 5AR5A 2VGPA 3D4QA 3QD2B 4O21A 4L3PA 1W8CA 4JJRA 2XKEA 4FIEA 3RP9A 1GZOA 4EJ7A 4LOPA 3MVMA 4OT6A 3Q9XA 2OXYA 3GCVA 3VC4A 5EM8A 1KE8A 3QRTA 4KIKA 4CFNA 4E4LA 5ITAA 4AZSA 4XG8A 4Y85A 3UMWA 3WZKA 3BBTB 2BDJA 4QD6A 4YO4A 3ALNA 4FV5A 3DJ7A 5CS6A 3R7UA 4PP9A 2X81A 4FV8A 4I3ZA 2PMIA 2DS1A 2YITA 4YR8A 3TJCA 4ZY4A 4R5YA 1YW2A 2BZIB 5CASA 2C0IA 5HICA 2C47A 2IZUA 4G31A 4U45A 3WI6A 3LMIA 4PMSA 4DGNA 4JRNA 5DHJA 5CSXA 3NYOA 1Q61A 1CDKA 2ESMA 2R3GA 3OCSA 3FPQA 4FIGA 5HO6A 4O7LA 2PMLX 5IA1A 5DT0A 4N6ZA 3UZPA 4F1OA 4USDA 3R2YA 4WA9A 5F9EA 1H00A 3COIA 3WZDA 3F66A 4O0VA 4F0IA 2OJJA 4OTFA 2B55A 5DR9A 3HAVA 3P9JA 3HECA 4U5JA 4A4OA 3OC1A 3WIGA 4MQ2A 2JDRA 2PVJA 2C4GA 3CQEA 2XKDA 3KF7A 1OZ1A 4BICA 5M57A 2VZ6A 3S95A 4MCVA 3AOXA 3ZDUA 1JSVA 3FMEA 4KD1A 4W4XA 1SZMA 4NFNA 4HVSA 3C5UA 3I6UA 3EFLA 3OW4A 4O96A 5FRIA 2A2AA 3ZXZA 2EB2A 3LXNA 4FIHA 4JG6A 4EK4A 5KO1A 2JIUA 3MIYA 1YXUA 2OJFE 3FDNA 2WMRA 4E4XA 3TV7A 5E8TA 1KE5A 1P4OA 2V7OA 5CU2A 5IDPA 2WTIA 1O6KA 4MBLA 1Z57A 4I1ZA 3BYUA 3JVSA 3TUDA 1LP4A 1LEWA 5BX0A 3UOHA 3JS2A 3NUPA 1YHWA 2YABA 4FE2A 2QQ7A 3ORTA 3UYTA 5GZ8A 3IKAA 3IECA 4MXAA 4D4RA 2G1TA 3PJ2A 2Y8OA 4RX9A 1OPJA 2Q0BA 3PXFA 3E8DA 3ZHPC 2Y0AA 2HZNA 5EW8A 3RPYA 5J7BA 4MXZA 3BQRA 3DJ5A 4UB7A 2RIOA 4KSPA 4AG8A 2ZDTA 4ZY6A 1V0BA 3PJCA 4IIRA 5AIKA 4EZ3A 5C8NA 1V0OA 4D2SA 5IH6A 3IDCA 4FOBA 5CLPA 1YHSA 3PE1A 1XH8A 2PSQA 1FVVA 2QHNA 3CGOA 5F95A 5FTGA 4ZSJA 3ZFMA 2XP2A 1PYXA 3ORZA 2DWBA 2VTAA 4KA3A 3QCYA 4JAJA 4P2KA 5DVRA 1NVQA 4FK6A 4L7FA 3ROYA 2UZOA 3PPJA 4FIIA 3FLNC 4I4EA 3VUMA 4AOTA 4EH4A 3F2NA 4OUCA 2C6KA 4FSTA 3A62A 4WUNA 4I41A 2NO3A 3O51A 4BDGA 4FTJA 2YCRA 2CKOA 2XKFA 3TXOA 3NR9A 2WEIA 3AXWA 3LM0A 4H58A 4LFIA 5B2KA 4EUUA 4Z7GA 4O82A 4GT4A 1ZAOA 4FZ6A 5HG7A 2GU8A 3LLAA 3AC3A 4FSWA 3E92A 4RFYA 4E6QA 2HENA 2W4JA 3DBFA 2P55A 4CFWA 5JFXA 1I09A 3R7OA 2FA2A 4FUYA 4AZFA 1AGWA 1S9JA 1UWHA 4YBKA 2OF4A 5LVPA 2WMUA 4ZIMA 3EN9A 3MS9A 4MKCA 4BTJA 3KREA 4FX3A 5EYDA 3VQHA 4AN3A 1ZZLA 3HV4A 3I0OA 5EW9A 4LRJA 2RL5A 4ZXTA 2W96B 3BLRA 4XG7A 4JXFA 3DTCA 2XK3A 4EH6A 2R0UA 3O8UA 1IEPA 3VVHA 3PJ3A 4NCTC 2WU7A 4NKSA 4TN6A 1R39A 3UDBA 4O2PA 2WNTA 4ZTHA 1WZYA 4K6ZA 2ZV2A 3F2AA 4UBAA 3L9MA 3E64A 1Q8YA 3T3UA 4BDHA 5HORA 1FQ1B 4XMOA 3ZFYA 2YJSA 3UIBA 2JIVA 2UW6A 3GC7A 3LLTA 3ZLXA 3OOMA 3CP9A 4PRJA 2XCHA 2YEXA 4FSQA 5KMKA 5IQHA 3OFMA 5CYIA 1FINA 2UZEA 1OL7A 3MVHA 1YOMA 3NX8A 1WAKA 2B9IA 5ANOA 5IEXA 4O2ZA 4G3CA 3R8LA 3C13A 4TYIA 4QMNA 2YM4A 1WBVA 4GKHA 4LGDA 5ACBC 3O71A 2PVFA 4ANQA 2QOKA 4FICA 4XG6A 5G6VA 4BWKA 4RQVA 4HJOA 5HIDA 1GZKA 4E5AX 4DCEA 4FTUA 3FZOA 3PUPA 4IX3A 4K2RA 3EZRA 5DT4A 2SRCA 5LMKC 3G15A 2PTKA 5CY3A 3NNXA 1OECA 3MH2A 1YRPA 5AR3A 3QD3A 4B99A 4QP7A 4O6EA 4PMMA 3VO3A 3GOPA 3GQLA 4R1YA 4DEHA 4LM5A 5BVDA 4IAYA 4IZ5A 4IWDA 5M51A 4FGRA 4A9UA 2J90A 4RFMA 5A3XA 4WNPA 3I7CA 4GYIA 1KOBA 4CV8A 3T8OA 1JPAA 3FMMA 3QU0A 4PNIA 4AAAA 4B4LA 4IVCA 2IVTA 3GCQA 4KIKB 3H4JA 5DEWA 4WSQA 3C4XA 4QMLA 3DB8A 3PYYA 3QQGA 4KBAA 4LRKA 5AP3A 5M08A 4TYGA 1PY5A 4U6RA 3R1NA 4IAZA 3DJ6A 4ZJVA 5AA8A 1R3CA 5EOBA 5ANJA 3KULA 3ZXTA 4JQ7A 4XNEA 3HP5A 2IPXA 2I0YA 2YCSA 3ZMMA 3BHHA 5E9EA 3KRJA 3ZRKA 4BY9E 3OEFX 2YIXA 3PG1A 4L45A 4GIIA 4XHKB 4CFUA 3IW5A 4NW6A 1MRUA 4ZAUA 4L52A 3ORPA 4ANSA 2CKQA 1UNHA 1P2AA 4RX8A 3VUHA 4BFMA 2I0EA 5LOHA 2JBPA 5D12A 4GFOA 1A9UA 3IW6A 2YDIA 3BHTA 5CU6A 3TACA 4FTRA 4FTLA 2G2HA 3UVPA 5M06A 1JOWB 3TT0A 4R78A 4YJSA 5GJFA 3F3ZA 2OH4A 3EL7A 5AV4A 4WBOA 2CGXA 5F1ZA 3V6RA 4YJUA 4CRLA 4FT3A 2X6DA 4E4MA 3NCZA 4C3RA 2X8DA 3FYJX 4LOOA 1W83A 1OMWA 4XS2A 5TOZA 2RG6A 3HEGA 2X9FA 5DMZA 2I1MA 1R1WA 3QZGA 5A9UA 4LGGA 3LKMA 3HYHA 4FTMA 2WO6A 3RK7A 2XYUA 4LRMA 1U5QA 4X2GA 4AOJA 3F5XA 2OKRA 5DA3A 2ITPA 4UXQA 4ACHA 5CQWA 3R1QA 5FDPA 4NJ3A 4RIWA 4ACGA 2UVYA 3GUBA 5A46A 3RWPA 1UKIA 2CCIA 3RPVA 4MWIA 4PNKA 3O0GA 2AUHA 2CNVA 2R5TA 3UJGA 5EYMA 2VTHA 3JR1A 4HVIA 1VZOA 3LFDA 3NW5A 4O0YA 4C58A 1E9HA 1OL6A 5AADA 1H0VA 2WTWA 2XNMA 1OIQA 4CRSA 4OTIA 4ONAA 4R3PA 5CSWA 3W2CA 1H1RA 3KXZA 3MFUA 3RNIA 3DAEA 4DEEA 5IH5A 4K9YA 5E8ZA 2OJ9A 4O0SA 5D10A 4EORA 3C4FA 3DNEA 4M69A 1PXMA 4CYIA 2OW3A 3FY0A 4I93A 5J9YA 2HY0A 4FTNA 3R9NA 4GT3A 3KA0A 2CN5A 3EIDA 4FSMA 1M2PA 2JFMA 4WHZA 4L44A 1Q41A 2NRUA 4XCUA 4U3ZA 4USFA 5K9IA 3V01A 3DCVA 3JUHA 4FT0A 1Y6BA 1GIHA 1O6YA 2QLQA 3DKOA 4II5A 2XNPA 4O0WA 1ZXEA 4YJTA 4O7WA 1UU9A 3QTRA 2HW7A 3KY2A 4NIFA 5CNOA 5AR4A 4FTAA 4C4EA 3C0HA 4I0TA 3WF9A 1JKKA 3M11A 4JQEA 4BDKA 4ZTMA 4BGHA 5JEBA 5H8BA 3O8TA 2GS6A 5JFVA 2Z2WA 2YLFA 3FXZA 5E4HA 3OF0A 1DI9A 4DEIA 1O9UA 3HNGA 4X3FC 2BVAA 2X2LA 4I0RA 1I44A 5CVHA 3E8CA 3MIAA 4U8ZA 5TT7A 5CF6A 5J9LA 2YCQA 3EJ1A 3IW4A 2DQ7X 4MYGA 2W1EA 3WZJA 2B53A 5C27A 1WBTA 3GEQA 3LZBA 3TNWA 3DGKA 3FYKX 4XYFA 3ZONA 5CSHA 2NNWB 4Y5HA 5EQEA 2VNYA 3ZUTA 4QP6A 5JSMA 2YWPA 3GC8A 4DEGA 4UMQA 2PZYA 2UZVA 4QMTA 3RKBA 2VWWA 4EH3A 2JKMA 2ZV8A 3HMPA 3V8SA 2BIYA 1R78A 3VAPA 3RM7A 5DE2A 4E93A 3R83A 5ANEA 4AA0A 4EH5A 4RC4A 2JKOA 1PW2A 4AW0A 2O64A 2BZHB 2OJGA 2XYNA 4BB4A 2ETMA 3NYNA 1YXSA 3OUNB 4V05A 3GB2A 4AGUA 5IU2A 4K11A 3DK7A 3FLSA 5AIRA 2WFYA 4HW7A 4F9AA 3TDWA 4KBCA 2PVNA 5AR8A 4RJ7A 4IB1A 2QI8A 5IQBA 2JFLA 4KKEA 4QPAA 2OU7A 4RPVA 4BI2A 4CEGA 4XRJA 3UOKA 1GZ8A 4U0IA 4GU9A 3C9WA 5DR2A 4G9CA 3SOCA 4L7SA 3FV8A 5BUEA 2BHHA 3NNUA 4DG2E 4FTCA 2W1GA 4ENXA 4RGJA 3VS3A 1U4DA 2WKMA 4PL4A 4JDIA 3QA0A 5E8SA 2RFSA 2HZ4A 4GJ2A 3W18A 2JDVA 3FMHA 2R3LA 3ETAA 1XH6A 4ZP5A 1U59A 4BHNA 2H9VA 2ZM3A 3ACJA 3SVVA 1Y57A 3UNJA 2WTDA 3GCSA 5HBEA 4O81A 4I20A 2W1FA 4JDKA 4CZYB 2E9NA 3QUEA 2X7FA 5I5ZA 1WBNA 2W1CA 3SD0A 2BROA 3LCSA 2C6DA 4IJ9A 4ASZA 4DF3A 4JIAA 4BBMA 4NCTA 3DDPA 3KRLA 3BV3A 4HPUE 1UNGA 5HI2A 2QNJA 1OITA 1STCE 2IVUA 4O27B 3SKCA 4ZS4A 2I40A 4GT5A 2I0VA 5HU3A 3BX5A 5H8GA 4PP7A 3UZTA 2WMAA 1PXIA 3G90X 3PRFA 3ZLWA 4ASXA 5JN2A 4A4XA 5I9YA 3UG2A 2B4SB 3CD8A 3TL8A 3R8VA 1G3NA 1H27A 3UQFA 4DLIA 4ACDA 5J7HA 3OEZA 3CJFA 2FGIA 5CSPA 1FMKA 3C1XA 2C5XA 3DXNA 3MPMA 3COHA 4BL1A 2VWIA 2REIA 4UN0C 5JKGA 4M97A 5BYYA 4RG0A 1OKZA 3FY2A 4AWIA 2GTMA 2F7XE 2J9MA 3IDBA 3Q4TA 4RJ3A 4MNFA 2GNLA 4AW5A 4DFXE 4FKQA 3K5UA 4Q5EA 2WAJA 2R3IA 3QUPA 2R2PA 3D14A 3TDVA 4O1PA 1XBAA 5LJJA 2RFNA 4HYUA 3BKBA 2JIIA 3IPHA 4UALA 4GIHA 5L3AA 4L00A 1ZYCA 3ZH8A 5LVLA 3OXTA 1Q5KA 4QP9A 4I6HA 1OPKA 5F4NA 4C4IA 2XJ2A 3D83A 1DS5A 4DBNA 5J79A 3P08A 2FSTX 3CPCA 4LUEA 4F99A 4FV6A 3I4BA 3NS9A 3N4TA 2RFEA 4FSYA 4FSRA 3QGYA 1DM2A 4I0SA 4IVDA 4W9XA 3QAME 4DEAA 1ZYLA 2PPQA 3VS0A 2QKRA 3NIEA 5TE0A 5J9ZA 4RMZA 5HO8A 4NW5A 2X6EA 4GFGA 3SG8A 3OBJA 4AUAA 5J95A 4Q5HA 2ONLC 4C4GA 4BDBA 4CNHA 4D2VA 2PZ5A 1XH7A 4YTCA 2P0CA 2HIWA 2OZOA 3DK3A 2OZAB 5HVYA 2OI4X 3KXNA 3S0OA 1Z5MA 2LGCA 5FWKK 3P86A 4MXYA 3FSKA 2WTKC 5LMKA 4IHPA 1WCCA 4AS0A 4FZAB 4Y8DA 3SRVB 4G3EA 2XZSA 3IOKA 3PVWA 4UZDA 3GOKA 4CXAA 2ZVAA 1IRKA 3W2PA 3FKLA 4U41A 3QHRA 3BBWA 2R3PA 3JYAA 4EOLA 3ZLYA 2X39A 3Q52A 2VTJA 5AWMA 3D7TA 3DBQA 1PKDA 5L2TA 4KS7A 4F1TA 3TNQB 3DZOA 1WVYA 3HRFA 1YI3A 5HGIA 3R8PA 4DH3A 2F2CB 3PIZA 5JK3A 1VEBA 2GNIA 3P7BA 4LOQA 2X2KA 4FTTA 3MB7A 2OK1A 3BQCA 4JG7A 3U4WA 3A7HA 3P79A 3AMBA 3MBLA 3PXRA 4IX5A 2JDOA 5EI8A 3HLLA 5E92A 2VWXA 3LXKA 5E91A 5DLSA 3UQCA 2Q83A 1MP8A 3PXKA 3A8WA 3S3IA 3EQBA 2YM3A 3QX2A 4NM3A 5AV0A 4IMYA 1EH4A 4RVLA 5I9ZA 1A06A 2EU9A 3M42A 3C4CA 4FKLA 3GU4A 5T3QA 3RZBA 3C4WA 3QXOA 1XH9A 3CLYA 3MH3A 3QZFA 2WMVA 3RHKA 3WIKA 5GIOE 4BCJA 2VTOA 3POZA 3FPMA 4BCHA 3A7JA 3AGLA 1ZOHA 2Z60A 1OGUA 3ERKA 4YLKA 5E8UA 1MRYA 4F6WA 4IAAA 4BDCA 3MA6A 2PE0A 2BKKA 3PVBA 4H3PA 4O83A 3FLQA 3DQXA 3MPAA 4YNOA 3OTUA 3HUCA 4WSYA 3ACKA 3ZBXA 2Z7RA 4BDIA 3LPBA 3PSBA 2ZV7A 4UZHA 5A4EA 1J91A 2OXDA 2F57A 3EYHA 3KN5A 5IUIA 2G2IA 4FEWA 2J5EA 4I23A 3KKVA 4MHAA 3KMWA 5K5XA 2XK9A 3L8PA 2JDTA 3HMOA 1ZYJA 3PXQA 1YWVA 1MQ4A 2CKEA 4IM3A 4EK5A 4F9CA 5J1WA 4Z7HA 1E1VA 5IQIA 4QTCA 2OFVA 3UGCA 1ZRZA 3PA5A 1H01A 3PXZA 1URWA 2XKCA 4TWNA 4TL0A 1T45A 5L2SA 4ZK5A 4I6QA 4F7LA 4XP2A 5L6OA 4DAWA 4X0MA 2QD9A 3HDNA 3NNWA 4AN2A 4AQCA 2DUVA 1XKKA 1OKWA 3V5QA 1JWHA 3R9RA 3P23A 1SVEA 4IM2A 2RKUA 4IM0A 3PIXA 4R6VA 1W82A 2XBJA 1NW1A 3P0MA 4BCQA 5ANIA 1QPDA 2ZM4A 3VRYA 1WBSA 4H3BA 4UY9A 4LYNA 3WBLA 4U79A 2BZJA 3F7WA 3LXPA 5AUUA 4NUSA 4MTAA 1OIUA 4ALVA 3D7ZA 4HVHA 3CGFA 5KMLA 5FEEA 4UMUA 4QMSA 4QQJA 3Q2JA 4TYJA 3FI4A 3W2RA 1QCFA 4EK3A 1V0PA 3HKOA 3GU8A 5H3QA 4Y46A 5JZNA 3RCJA 3PPZA 4P90A 2H34A 2WTJA 3EFKA 3OY3A 4IZ7A 4M69B 3OP5A 2X1NA 4ITIA 2V7AA 5EI2A 2QKWB 5FLFA 5JRQA 5K0KA 4BGQA 4C34A 2W7XA 3E93A 1M14A 3GGFA 5L6WL 5HCXA 4F0FA 1XR1A 4LQMA 3DU8A 2O63A 2GFSA 4M15A 3UP7A 4W8EA 1ZMUA 3KB7A 2J0KA 2Z8CA 4YP8A 2YAKA 2QOBA 2XM9A 3UBDA 3ANRA 2BR1A 4HGLA 1ZMWA 3LJ1A 5A6OA 5IDNA 2C3IB 5K5NA 4J52A 3TNPC 4F7NA 2CSNA 4RZWA 3FI8A 4EYJA 4DGLC 1A48A 2GMXA 3Q6WA 5HHWA 2W9ZB 3QQLA 4DITA 5CF5A 1UU8A 2ITUA 2WPAA 1OUKA 4FV0A 4IC7A 5EHYA 4DH1A 4EKKA 4BZNA 5HNBA 5H9BA 4YURA 3KXGA 4CKJA 3TG1A 2AYPA 2ZAZA 4JIKA 2ITZA 2NRYA 4QMZA 5IA0A 4P5ZA 2O3PA 2O8YA 2PY3A 2YFXA 4EOQA 5AUTA 2UVXA 4FEQA 4MX9A 4ZSGA 4MBJA 3TCPA 2WU6A 3FMJA 3OBGA 3CS9A 4AGCA 4LMNA 4N6YA 2NPQA 3D2KA 3NYVA 3UOJA 4FOCA 1MRVA 4WKQA 3G0FA 5I4NA 1VJYA 1SM2A 4OTRA 3VWAA 4EHZA 4BRXA 4J1RA 4KIQA 5M4UA 3JY9A 4OBPA 4DHFA 4OBOA 3SGCA 3LQ8A 5CEMA 3MWUA 4R77A 2FO0A 2ZV9A 2GNFA 3UVRA 3F9NA 4L42A 1DAWA 4F63A 4C3FA 2JAMA 3TTJA 2Y4PA 3II5A 4YC3A 4DGOA 2EUFB 3KRWA 3R1YA 4M67A 4E4NA 2JD5A 5HNIX 4S30A 5AP2A 2WZJA 4EOIA 5C03A 3NUAA 5HBHA 2UZWE 4W4YA 2Y6OA 5BVEA 1OIRA 3KEXA 5HG8A 2QCSA 3ZC6A 2ITTA 2ZYBA 3Q9WA 2YDKA 3EFWA 2IJMA 3F3VA 3HMMA 4EK8A 4FTKA 1UU3A 2QOIA 1JNKA 1IA9A 2V62A 2WB8A 2WELA 2VO6A 5EKNA 4DINA 3AC2A 5CXHA 1Q8ZA 4WNOA 3ZOSA 2HAKA 4QT1A 4NTTA 3MYGA 4ZTRA 4XLIA 4NJDA 1FPUA 5LCKA 1OVEA 1UKHA 1OKVA 2BMCA 2UZUE 3O7LD 5E8WA 4BN1A 4FBXA 3T9IA 4FKOA 4F6UA 1RE8A 5CU4A 2PZIA 3VJNA 2WTKB 3BLQA 4RJ8A 4MVFA 4MF1A 2BPMA 3NUSA 3OZ6A 3Q5ZA 1XO2B 4HZSA 4K77A 4TTHB 4Y5QA 5HLPA 4BKZA 3H9RA 4EWHA 3AD4A 3K54A 5HO7A 2G01A 2ITNA 4FKIA 3SHEA 2OBJA 5KMMA 3G2FA 4BCOA 5CI7A 3OWJA 1H1PA 2IW6A 3H0YA 4AZVA 5A6NA 4ANNA 2GNHA 2O65A 5KHXA 1CTPE 3SXRA 2I7QA 3PXYA 4OTHA 1P4FA 4TWOA 2J4ZA 3N4VA 3AC4A 4ERKA 4CLIA 3QUDA 2FVDA 4TW9A 3OG7A 3D15A 5DRBA 3QTZA 4HGEA 2W9FB 1J3HA 4HVGA 2EVAA 4GK4A 4PQNA 4D28A 3ALOA 1YI4A 4HPTE 4X2NA 3UO6A 3SLSA 3FI2A 1J1CA 3ZO2A 4G3DA 4YTHA 3HP2A 2OWBA 4Y72A 4EK6A 3UNKA 3Q60A 3L1SA 1KSWA 5IUHA 3ZSGA 3VBQA 3ZEPA 3DNDA 4LL0A 4FEUA 3W16A 5CALA 3K5VA 4DCAA 5I3OA 4NTSA 2BCJA 3F3TA 3OXIA 4KUJA 4NU1A 5C4LA 3KRRA 2PUNA 4L8MA 5E1SA 3MY1A 1Q24A 3E5AA 5HTCA 4M84A 3BHUA 3QA8A 5HBJA 3GENA 4MXOA 2Y4IB 2VTRA 4BI0A 3QX4A 3I5NA 3C4EA 1JVPP 4BWPA 4M8TA 3IOPA 4CT1A 2XK7A 3VF9A 4C4FA 4Y73A 3OWLA 4PPBA 1OIYA 1L8TA 2FSMX 2ZB0A 3DBEA 4G3FA 3I6WA 2B1PA 3Q96A 4FA2A 3NUYA 4E73A 3OOGA 3JPVA 2O0UA 2VWVA 4AT3A 3DAJA 4J7BA 1M2RA 3QZIA 4JVGA 3PPKA 3EL8A 4RBLA 4C4HA 3R7YA 5L8LA 4YZNA 3SAYA 4FNXA 3NVKI 3ZC5A 3T9TA 4MK0A 4U9AA 3R9OA 3BGPA 3ITZA 2GSFA 3NUXA 4KRCA 4ASDA 1S9IA 3NMUF 2GHLA 5DIAA 2VWBA 1PMUA 1O6LA 3FZPA 4GJ3A 5J5TA 3RTPA 2XB7A 4FEVA 3G9LX 3FKNA 5FEDA 2VTIA 4FC0A 1Y8GA 4IVBA 4BCKA 1U54A 3KCKA 1PXNA 5HVJA 4CZUA 4GKIA 1URCA 5CF4A 4X3FB 4QMOA 3ZS5A 3U6HA 3QCQA 4JDHA 4HOKA 4AACA 2HY81 2UV2A 3NIZA 1W0XC 4GG7A 3QRJA 4PTGA 4DFNA 2WMXA 2C1BA 3PJ8A 5CEIA 3LFQA 3UC3A 2OH0E 4FKUA 3LMGA 1KV2A 3LCKA 2XNOA 4YLJA 3FC2A 5LCJA 4M7IA 3FXXA 5CX9A 3G51A 3LCOA 5EM6A 4J8MA 4UYAA 3V3VA 2PVLA 4E5BA 3TUCA 3P7AA 4RWIA 3TZ9A 4FEXA 4RRVA 1OI9A 5EH0A 4ENYA 4UWYA 3E3BX 4YO6A 4OAUC 2P4IA 4OAVB 4GK3A 4NT4A 1E1XA 4QMMA 4WUAA 4F64A 3ATTA 2XM8A 3K2LA 5I9UA 4ANOA 4DFYA 1WMKA 4BCNA 4U7ZA 3R04A 3SC1A 1GIIA 3FQEA 5HE1A 4MXXA 5AAFA 1PJKA 5I3RA 5IQDA 4JR3A 5DN3A 3QXPA 4BHZA 1UWJA 4O86A 4XLVA 5CTPA 1U46A 5CT0A 3FQSA 5AP4A 2Z7QA 4AA4A 2R64A 4XG9A 4O7SA 3Q4CA 3RALA 3LMHA 3FZ1A 1PKGA 1VYZA 4NEUA 5BPYA 1IAHA 4WG3A 5CAOA 3ZSHA 2R4BA 5HIBA 1CSNA 4D5KA 3ORIA 4FNZA 2YHVA 3NZ0A 2J0MB 4WOVA 3F82A 2WGJA 4M0YA 5IEYA 3Q9ZA 5J1VA 3U6JA 1QPJA 3TZ8A 3TM0A 3U9NA 3EHAA 4ANLA 4FR4A 4KKHA 2J0JA 4HYSA 3RVGA 5HESA 4YSJA 2GS2A 1REKA 4GMYA 2QU6A 2CDZA 2HZ0A 2W4KA 2YIQA 4YGAA 3ZO1A 4CMTA 5B7VA 2H6DA 3LFFA 5JFWA 3DZQA 5KUPA 3PDTA 5L4QA 4C7TA 3F5PA 4XV2A 2Q0NA 3E63A 3N4UA 1SYKA 4CFXA 1YDTE 3KQ7A 2BRNA 1G8SA 3CSVA 5EYKA 1IASA 2O2UA 5AAEA 5AV1A 3NDMA 3VN9A 5FBOA 3UNZA 4D58A 3HMIA 5C26A 4PV0A 5JT2A 4HNFA 2UW5A 2XUUA 2VTNA 3BWJA 4DEDA 3R8MA 4IFGA 4AU8A 4ZLOA 4ZZOA 2WOTA 1OBDA 4OTGA 4Z9LA 2V22A 2HZIA 3Q4ZA 5GNKA 2XEYA 3KL8A 3RWQA 5BVNA 3FI3A 2WTVA 4E6CA 4DFBA 4OTQA 4CKRA 1K9AA 1TQPA 4C33A 3UYSA 3W10A 4EOSA 4C35A 4RVKA 5IA5A 1ZLTA 4KKGA 2GHMA 5AUXA 2CGUA 4QTDA 3FXWA 5AUYA 2OIQA 5BQ0A 2R3NA 3P4KA 5AP0A 1YOLA 4WBBB 4LL5A 4TKSA 4IDVA 4JX3A 2C69A 1FGKA 4FT5A 2VO0A 1H1SA 1B39A 4PDSA 3R9HA 5EHOA 4B8MA 4Y95A 4ALUA 3OY1A 2YISA 5HOAA 3QTIA 4EOPA 5K4IA 3BU6A 4ZMFA 3MB6A 4C38A 4W4VA 4JL9A 4RWJA 5J5SA 4CCUA 3EN5A 4HCVA 1QPCA 3DLSA 2XVDA 5LWNA 1H28A 3QGWA 2FSLX 3OHTA 3POOA 4G5PA 1LEZA 4U44A 3BYVA 3GI3A 4IZYA 3Q3BA 4FMQA 5EDRA 4OTPA 3FL5A 3BI6A 3A7IA 1UU7A 2YM5A 4FYOA 4G2FA 4K18A 5EM7A 4NSTA 4GU6A 4E1ZA 5M4IA 4PDOA 2P2IA 4K8AA 4QPSA 4RFZA 4HZRA 3EB0A 3COKA 2ITQA 5EQYA 2V5QA 2IW9A 1F3MC 3GC9A 1RDQE 4F0GA 4WIHA 1P5EA 4NZWB 5EOLA 2B54A 3HRBA 2VTMA 4FODA 4IAIA 2XBAA 4JBOA 4BKJA 4K0YA 3AT4A 3IG7A 4JI9A 4HYIA 4E20A 4Q9SA 2PE2A 3H3CA 1G8AA 4ORKA 5EK7A 4YLLA 4DH5A 3PY1A 3PVUA 1F0QA 2C3KA 3HRCA 3EKNA 1OL1A 1BL6A 3N51A 4YC6A 2C3LA 4IDTA 3ZRLA 1KE6A 3W1FA 4EQCA 4DT8A 2XF0A 3O2MA 2BZKB 4G6LA 5CI6A 1UVRA 2BDFA 4JT3A 4YMJA 1BX6A 3AD6A 1YWNA 4YHJA 2GQSA 4IACA 2WIHA 2X8EA 2C5NA 5DNRA 4ZJJA 5CU3A 4YPDA 5BYZA 3V5JA 2ZB1A 4X21A 3W33A 2RGPA 1ZYDA 4KB8A 4YSMA 3TIYA 3GU6A 1VYWA 5L2QA 3ZO3A 2XA4A 4D1XA 1WBWA 2H8HA 3K3JA 4RA5A 3QCSA 1BLXA 4YZ9A 3RHXA 1BL7A 4GS6A 4WD5A 1AQ1A 5FDXA 2R3OA 1W7HA 1CKPA 1BMKA 4CV9A 4BIBA 3I60A 3R7GA 3U8WA 5CZIA 3MY5A 3VHEA 3VUGA 3E88A 2R0IA 2JITA 2VNWA 4W4WA 4DGGA 3CIKA 1VR2A 1KWPA 1U54B 4BDEA 4X2KA 4NH1A 3MTFA 4M66A 2UW0A 3I5ZA 4LGHA 1XQZA 4KWPA 4QQTA 2VTSA 4UX9A 4OR5A 4C57A 4FL2A 3Q04A 1PYEA 3VHKA 2UW8A 3QD0A 3RM6A 5IQGA 5HD4A 3RPSA 1TVOA 3R00A 4YHFA 2J50A 3EFJA 1ZWSA 3FSFA 2QOLA 1WBPA 4IBMA 3NUUA 3F5GA 5L6PA 4D2TA 4KIOA 2PHKA 4EH7A 2PULA 5AM6A 5IZFA 4CQEA 2BHEA 4L3JA 2PZPA 2CHLA 2VGOA 2XEZA 3BYOA 1Q4LA 4RJ5A 4U3YA 2OXXA 4J95A 3UQGA 4D2WA 3ZM9A 4A9SA 4IWOA 2RSVA 3O96A 1JAMA 3MJ2A 2WMTA 3ZM4A 4RVMA 4XBUA 4L6QA 4Q9ZA 3FZSA 4LV5A 3ZUUA 1ZOEA 4L01A 5TF9A 1OUYA 3PZEA 3R9DA 2C5YA 5KMIA 2J7TA 4H05A 4G17A 3BIZA 4YJQA 3ORNA 4S2ZA 2PE1A 3WE8A 3UIMA 5KMOA 4RIWB 4C59A 3W8LA 4P5QA 3R2BA 3FC1X 3A99A 5AEPA 4QMXA 2PVYA 4MD7E 4HYHA 3E8NA 2PUIA 2CGWA 3PP1A 5HKMA 4F7JA 2VUWA 4NK9A 3MESA 3CTJA 4YC8A 4DTBA 3P7CA 2VX3A 4CKIA 2VWZA 1OB3A 2OSCA 1J7LA 3FZTA 3RBWA 4DFZE 4I5HA 2CCHA 1GZNA 3GFEA 3PJ1A 3R6XA 4ACMA 3WF7A 4ZOGA 3RAWA 3D5UA 2AC3A 2XS0A 5DG5A 2YCFA 5A4CA 1KE9A 2F2UA 3IQ7A 3LFEA 4YZDA 2IZTA 3PSDA 3EQIA 2OIBA 5ANGA 3HV6A 2UZTA 4PDYA 1PXJA 5HG9A 3ENHA 2G9XA 2EXCX 4RIYB 5A14A 2VWUA 4UV0A 4CG8A 3U87A 4J53A 3ZUVA 5CEKA 2QU5A 4QMVA 5GZAA 4AZWA 4YPSA 4APCA 2ETKA 3L8XA 3HZTA 4AT4A 4JBVA 1QMZA 3DA6A 3NAXA 4ZY5A 5KX8A 4DLJA 3QTSA 4XP0A 4C2WA 2BFXA 5M53A 4WT6A 5C8MA 3NGAA 3TNHA 2NP8A 4A9RA 1P14A 2WIPA 4O1OA 4PDPA 4RVTA 3KXMA 4KNBA 3W2QA 3SXFA 2R7IA
chains in the Genus database with same CATH superfamily
2X7OA 3W0OA 5EFQA 1Q8UA 2PL0A 3RPOA 4AW2A 3P78A 2F7EE 5LVOA 3RAHA 3KVWA 3WE4A 3PY3A 1SMHA 2BDWA 1FMOE 3WF5A 4FKSA 3LE6A 5GINE 3DTWA 1WVXA 3R0TA 2YA9A 1Q3WA 5AMNA 2QOOA 2OIDA 2WMSA 4QYEA 5B2MA 4CVAA 3ID6C 2W0JA 4TXCA 3PFQA 3THBA 1IR3A 3TN8A 3C0IA 2XAMA 2FH9A 2BUJA 4MH7A 1PMNA 2IN6A 3VULA 3LCDA 5EI6A 3FJQE 3ZCLA 4BC6A 3QF9A 3ZBFA 1RJBA 2W1IA 5IISA 3CEKA 3AD5A 3MH1A 3QKKA 3VBWA 2QLUA 3AT3A 4RX7A 3ANQA 1NT2A 3S2PA 4I4FA 4OGRA 2GDOA 3V51A 1GNGA 1PMVA 5HNGA 4D2RA 3F3WA 4IEBA 2BRGA 3O8PA 5EHLA 4BI1A 3RGFA 4R3RA 5TR6A 1Z9XA 5KZ0A 5CEPA 3VONA 4O7RA 4ID7A 4JRVA 4FKVA 3BL9A 1L3RE 5FEQA 3PWYA 4FV9A 4RZVA 4QYGA 4EOKA 3HX4A 2WQOA 3KU2A 3BU5A 4IH8A 3UTOA 1J7UA 4U43A 2E9UA 5DFPA 2WTCA 2ONLA 3CTQA 2PUUA 3L8VA 3BWFA 1GJOA 2BILB 4KINA 4RLLA 5KZIA 4XV9A 2KULA 2YACA 2ZM1A 4WRSA 3UPXA 3VQUA 2RFDA 4J97A 4CG9A 5FBNC 4AF3A 5BYLA 4JR7A 2ETRA 3LAUA 4QPMA 2B52A 4XG3A 4EH9A 3MFSA 5DT3A 4IQ6A 5D9HA 2PYWA 3VS5A 4FK3A 3S4QA 1JKSA 4FKRA 5HX8A 2BALA 3V6SA 4CTCA 2HXQA 3OW3A 3QZHA 1CKIA 4O7ZA 2YAAA 2C3JA 4X6QC 4AFEA 5HLNA 5I0BA 4MNEA 4RJ4A 4V0GA 4USEA 2XRUA 3MW1A 3Q5IA 5DEYA 1XH5A 2C5OA 5DRDA 3VIDA 4EHVA 3A4PA 5AX3A 4DTKA 3LQ3A 4RQKA 5HZNA 3AMAA 4O0TA 3WZUA 3LW0A 1ZZ2A 3W55A 3LVPA 3ORLA 2JEDA 3CD3A 2HYYA 3F7ZA 1Q62A 5KCVA 4R5SA 3OMVA 1B38A 2YZLA 3R1SA 3RJCA 4M14A 1HOWA 4ZTNA 2UW4A 4FT7A 2QOHA 4JAIA 4CCBA 2GNGA 4KAOA 1J7IA 5HEZA 4LV7A 4E8AA 3HGKA 5CVGA 4BKYA 2VV9A 2W17A 4TNDA 3PY0A 1YOJA 2JDSA 3NYXA 5ETCA 5A4TA 2E2BA 3QC4A 4QYFA 2J2IB 5LQFA 2CPKE 3UP2A 3ZYAA 1GIJA 3A7GA 3UDZA 2IVSA 4BCFA 1H8FA 4FG7A 5A4QA 3KK8A 4H1JA 3ZZWA 3AC1A 2XIYA 2CGVA 4AGWA 3OTVA 2VD5A 4I5MA 4UWBA 3PZHA 1YWRA 3S00A 3W0MA 2XCKA 4EYMA 1X8BA 5M55A 4G16A 4D9UA 5JQ8A 4C2VA 4GFMA 1JKTA 4IWQA 1ZYSA 2VU3A 4I5PA 4YZMA 1W84A 1XJDA 3Q32A 5AAGA 2IF8A 1PF8A 1FGIA 4OTWA 4UMPA 5HTIA 2W5AA 3NFGB 2B9FA 3IK3A 3SW4A 4EHEA 1FBNA 4LI5A 2XK8A 4FF8A 4NKAA 4P4CA 4PPCA 5FP5A 3IONA 4A9TA 5EW3A 5BUJA 2R3RA 3A60A 2OZAA 2R9SA 1IA8A 1PXKA 2RF9A 2YZAA 4UMTA 2Y4IC 4XV1A 1YXVA 4CMUA 4IB0A 3U54A 3LFNA 1M2QA 5D41A 4C62A 4DT9A 1SNUA 5ANKA 1TKIA 2QONA 3GFWA 4MWHA 3NCGA 2Z7LA 3OCGA 1GY3A 3MFRA 3EQPA 3G0EA 5E1EA 4Z16A 4FT9A 5EDPA 5B2LA 5FUTA 3CBLA 4MF0A 3GT8A 4HGTA 4IZAA 3A4OX 5CAQA 3TMOA 4DE4A 4C8BA 2B7AA 5LVNA 5IMXA 4E7WA 3UODA 3NW6A 4R7IA 1JQHA 5K3YA 2QR8A 3FHRA 4RX5A 3W32A 4G3GA 3C0GA 4F9BA 3ORXA 3UOLA 3G33A 4CFFA 4B0GA 1KV1A 5EDQA 3KCFA 3DXPA 5CNNA 4MAOA 3VJOA 4IWPA 4FRFA 4I21A 4I5CA 2J0IA 5L8KA 3QD4A 2QOCA 4X2FA 2UW7A 3KXXA 4C0TA 4D0WA 3NNVA 4ZTLA 5JZJA 4BIDA 1YKRA 3KMMA 3VNTA 4ZSAA 5CANA 1APME 4C37A 3MI9A 5AP6A 4R8QA 1ZMVA 3PSCA 1ATPE 3QCXA 4FTQA 4NM5A 3ULIA 3OCTA 4RIYA 3EMGA 3CY2A 1YHVA 2YM8A 3LQ5A 4FNYA 4AE9A 4BDAA 3EQCA 4TYHA 3DLZA 3DBCA 4P7EA 4IX4A 3DDQA 4PMPA 5M4FA 4DHJA 4DYMA 3NEWA 1YDSE 3OUKA 4XOYA 3AKJA 4HCTA 2IZSA 2W5HA 5FM3A 4X3FA 1MQBA 2PVKA 4QMYA 5GZ9A 3OD6X 2XIRA 5CXZA 3DT1A 3VS1A 5JGAA 4DDIA 2BAQA 3BE2A 4YJRA 3CKXA 2QG7A 5ICPA 3RMFA 2OICA 1PHKA 5E8VA 4FYNA 1TZDA 5HX6A 4E6DA 3LXLA 4N0SA 4FSUA 2W99B 2YERA 3H9FA 4YHTA 1YXTA 1BYGA 3OXZA 4UYNA 3PWDA 2QC6A 4UEUA 4IB5A 5FD2A 4BTKA 1WVWA 3U6IA 4PL3A 3ODZX 2X2MA 2W1ZA 1YI6A 4XEYA 3VBXA 4KIPA 4YBJA 5CU0A 1H4LA 5CAUA 2UZNA 3QRUA 5E7RA 2BFYA 4KS8A 3FWQA 3BYSA 3TUBA 5AR2A 2BRMA 1JKLA 4AXDA 5HE0A 3CTHA 5T6KA 1XHAA 2JBOA 4ALWA 4OLIA 3SW7A 5FQDC 2QURA 3R02A 4QP3A 2XNBA 5KUPA 5DYJA 5JQ5A 2ITYA 3IGGA 3Q9YA 4PL5A 4Y83A 2XH5A 4G6OA 1YXXA 2WOUA 4FZDB 4FL3A 5DH3A 2ERKA 2JGZA 4WNKA 3NSZA 1JBPE 2DYLA 4A4LA 2VAGA 3GP0A 4MD8E 4OT5A 5JGBA 1K2PA 4HCUA 5A4LA 3QWJA 5BNJA 2X7GA 2UZLA 4KABA 2ITWA 3TKIA 3R22A 5I9XA 1H08A 3E87A 3U55A 3DS6A 3KVXA 4KRDA 1ZARA 2UZDA 4TWPA 2ITVA 5DR6A 5JRSA 2BAJA 3QQUA 3OROA 1GAGA 1FOTA 4EBWA 4M3QA 3FLYA 1BUHA 2OG8A 4IAFA 2QHMA 3L9PA 4DFUA 3AC5A 4FSNA 3EH9A 4C36A 1H25A 4O38A 4I6FA 2GFCA 4CLJA 3I1AA 3ODYX 4DBXA 1BI8A 5TKDA 2NYAA 2VTPA 2F4JA 1J1BA 4DGMA 4ZMEA 4FKJA 4EQUA 4XRLA 5ETAA 3M2WA 2ITXA 4JNWA 2VWYA 2VTTA 2Z02A 3GQIA 5AFVA 4FIJA 3TZ7A 3E3PA 3FHIA 3NPCA 2P33A 4HVDA 4EH8A 2WMBA 1MUOA 3R7IA 1SVHA 2WD1A 3EQRA 3HL7A 4IFCA 3MY0A 3KMUA 1M7NA 4KSQA 3G5DA 4XOZA 4AFJA 5FXRA 2OF2A 1PMEA 4BCMA 4CQGA 1OPLA 1SNXA 5E8XA 5IMEA 5KKRB 1Q8TA 4DH7A 3MH0A 5ETFA 2J6MA 2W4OA 5AR7A 5FTQA 1NXKA 3TI1A 3W2SA 4BF2A 4BCIA 5L2IA 2YWVA 4JS8A 5L8JA 4EEVA 2PU8A 4DN5A 3D9VA 2YN8A 2WEVA 3DOGA 3H30A 3QALE 5C9CA 3KN6A 4J71A 3PVGA 2C6EA 4UMRA 5JGDA 5D7AA 3FMNA 4PY1A 3FQHA 2C6MA 2YLEA 4UWCA 2PVRA 3ML1A 2CN8A 4G6NA 5DWRA 4ZJIA 4A7CA 4FUXA 4B7TA 3I0QA 2XIXA 3WILA 3HAMA 3HA8A 3QLFA 4U80A 4G9RA 2OLCA 5HQ0A 2X4ZA 4EZ7A 4QTAA 3R01A 4XH6A 5CAVA 4JBQA 3VRZA 5L2WA 3D94A 3KF4A 3VW6A 3QQFA 1UNLA 2VX0A 1KUTA 4O7VA 4RLKA 5IKWA 3ULZA 3BRBA 3RK5A 3DKFA 4BIEA 3JXWA 5C8KA 5FXQA 2ZMCA 4FVQA 3VUIA 4Z3VA 3GBZA 2IG7A 3H10A 4ZEGA 4IVAA 3HMNA 5M44A 2X0GA 4BTMA 3UMXA 3TZMA 3DK6A 4GYGA 4QRCA 3NVMB 1V1KA 3VW8A 4WNMA 3ZTXA 4AGDA 3CR0A 3QKLA 1XWSA 4TNBA 4EI4A 3IW7A 1ND4A 4YTIA 3GU7A 1Y6AA 4YJVA 3V5LA 4D0XA 3RPRA 1XBBA 3V8WA 2UUEA 3BU3A 3HV3A 1UA2A 3F5UA 4O0UA 3PLSA 1IAJA 1Y8YA 4IADA 3AKKA 3MA3A 1NA7A 2AC5A 3D5VA 1WFCA 3DFAA 2WQNA 1KOAA 2GQGA 4H39A 1CM8A 4ITHA 2LAVA 4EKLA 4CT2A 4CFMA 4FVRA 3UVQA 5B0XA 4DDGA 3MTLA 3PG3A 2PVMA 2YIYA 3EQDA 3PTGA 3QHWA 3UIUA 4AXAA 4GSBA 3SDJA 3V5TA 3I81A 4TYHB 3SOAA 3AMYA 2E9OA 4CD0A 3QYWA 2IWIA 5HCZA 2A27A 2OFUA 1Y91A 2VN9A 3VS4A 2R3HA 3QFVA 4F08A 4R7BA 5HE3A 3B8QA 3FLWA 2Z7SA 1FVRA 3OWPA 4YJPA 5M4CA 4O7TA 3FLZA 5AA9A 3QTWA 4S31A 2XJ0A 3IGOA 2H96A 2QR7A 3A8XA 3DPKA 4YU2A 3GU5A 5AP7A 1Q3DA 5DBXA 4BZDA 2ZOQA 4FTIA 1UV5A 3R21A 4FSZA 2VX1A 1Q97A 1QL6A 4GK2A 3ROCA 4FZFB 3O23A 4GRBA 4DC2A 4J96A 3JVRA 4CMOA 1Q8WA 4ZZNA 3BV2A 1PXPA 1QPEA 3QRIA 5DPVA 4K33A 5FGKA 3UC4A 3PLAE 3DKCA 2X8IA 2JLDA 4MNEB 5CVFA 4F1MA 4QDVA 4U42A 3R71A 4D4SA 2WQMA 4L3LA 4QNAA 3EN6A 3UO5A 3G9NA 5BMMA 5CEOA 2EXMA 4N57A 3TKHA 2F9GA 4BYJA 1VLRA 3L9NA 1JSUA 2JC6A 4CSVA 2YM6A 4WRGA 1TQMA 3KGAA 4E6AA 2OGVA 3CXWA 4ERWA 3O5AA 4TRLA 4W9WA 3REPA 5AV3A 5IEVA 4RC3A 3SX9A 5F20A 5AM7A 3T3VA 2W5BA 4AE6A 4EOOA 4D5HA 1W2CA 3Q53A 5IH4A 4O91A 3SA0A 3LFBA 3OWKA 1TQIA 4EC9A 4OTDA 4XX9A 2XNEA 5A54A 2IVVA 2R3JA 2IO6A 3ELJA 2J0LA 3AT2A 4GL9A 3QWKA 4O0XA 3SV0A 5F94A 5KMNA 2B9JA 3IO7A 5EQPA 3U4UA 3WYYA 4F6SA 2X4FA 3BCEA 4J98A 3QTXA 4S33A 3SG9A 2HOGA 4ZTSA 2XK4A 5J8IA 4MXCA 3FMDA 2WXVA 3QQKA 4C02A 1H1QA 4XG2A 2PMOX 2IW8A 4EZ5A 4RJ6A 4R1VA 1RQQA 4D9TA 4NWMA 4BGGA 4L46A 4FI1A 1LR4A 2W1DA 3R8UA 1B6CB 3EQHA 3PA3A 2FYSA 4EL9A 5BV3A 3VS6A 4EQMA 2XIZA 3KRXA 4I22A 4O6LA 1ZY4A 3RI1A 2OO8X 2XMYA 2QO9A 4GVAA 3D7TB 4AX8A 2BTRA 4BVUA 4DFLA 2R3FA 3R63A 4APPA 3ZRMA 4LV8A 3KFAA 4EOJA 4I94A 3IDPA 2QVSE 2BAKA 3B2WA 3C5IA 5CZHA 3FAAA 3C50A 3DBDA 3MJ1A 4RWKA 5HD7A 1G8KA 4CGAA 4MEDA 3SQQA 4J99A 5BVWA 2Y7JA 3FE3A 4FV2A 5ACKA 3BE9A 4TYEA 4XV3A 4GV1A 4EOMA 1F5QA 2WHBA 2F49A 4GEOA 5LXMA 4X2JA 3W2OA 4GUEA 4TT7A 4GW8A 5JMSA 3GCPA 3FMKA 5LMBA 2XJ1A 2BRHA 4YJNA 5BUIA 3O50A 3V5WA 1SVGA 4ARKA 4EC8A 4KBKA 3BHVA 4FV1A 5D7VA 3GVUA 2IZRA 4JDJA 3AKLA 3ORMA 3HV5A 3I79A 5LMAA 3QRKA 4RA4A 3ZLSA 3ZU7A 2AEGA 2R3MA 3CC6A 4C61A 4BBFA 4YZBA 1PXLA 4DH8A 3DV3A 3PA4A 3O17A 4L9IA 1U5RA 3ATSA 5AUZA 3TJDA 3DQWA 5GJDA 3E8EA 3DB6A 1T46A 4FV7A 4DEBA 2CNQA 4QOXA 4J8NA 2QO2A 3D5WA 3VBVA 3FEGA 4O84A 3CY3A 3PIYA 4TY1A 3PRIA 4G34A 5EYCA 4MD9E 3TTIA 2V0DA 3RZFA 2CKPA 3BLHA 5FTOA 5HCYA 5KNJA 4WG5A 4O22A 4DG3E 5EM5A 3NAYA 2BIKB 3ZEWA 2J5FA 5HE2A 1ZY5A 1H07A 3SRVA 2FB8A 3E7OA 3WOWA 4ACCA 3AQVA 4F70A 1NVSA 2PVHA 2QODA 4XBRA 2CNUA 4QQCA 5C1QB 2W06A 4CFVA 2C6IA 1OBGA 3Q4UA 4YJOA 4FGBA 4YUQA 4WO5A 1PXOA 4D1ZA 4NYEA 1NVRA 2B0QA 1ZOGA 4JMQA 3C4ZA 4ASEA 5HU9A 4GVJA 5AP5A 4G5JA 4BCPA 2UW9A 3B2TA 4EBVA 1G8JA 3BGZA 4BR3A 3R7VA 3ZFXA 3RNYA 4B9DA 3SXSA 4L43A 2PK9A 4OW8A 3CCNA 4E5WA 3TV6A 4QNYA 3WARA 4GG5A 2FUMA 4BTFA 3D2IA 4V0GB 2GNJA 4AOIA 3MV5A 3KXHA 4A9YA 4AZEA 2A0CX 3VF8A 4QMUA 3GXLA 4CZTA 2B9HA 2R3KA 4RC2A 2HWOA 3K3IA 5HG5A 3DY7A 5KE0A 5JFSA 4PTEA 3BYMA 4TWCA 4PUZA 4YTFA 4FKPA 2WQEA 5AX9A 5H8EA 3MN3A 4PF4A 3OT3A 5IA3A 1OL5A 5GJGA 4X3JA 4MQ1A 4C4JA 4EONA 4M12A 3EOCA 4M13A 3V5PA 3GCUA 1YVJA 4DTAA 4GH2A 4I92A 4FL1A 3NW7A 3DXQA 4XJ0A 3BZ3A 2YJRA 2XAOA 3MFTA 1ERKA 4O7NA 2QOQA 2YDJA 3QQHA 3VS2A 4EUTA 3UG1A 4QP8A 3P5KA 2UW3A 1M17A 1JLUE 2E9PA 4X7QA 4B6LA 1H24A 4V04A 4IXPA 4QP2A 5C4KA 2HXLA 3E62A 3F6XA 5D1JA 5DOSA 4IAKA 2C30A 2R3QA 2ZDUA 4JBPA 4S34A 3QTUA 3F88A 3R8ZA 2HW6A 1JSTA 1BKXA 3MSSA 4RIXB 1CMKE 3QL8A 4RT7A 1GOLA 3RAKA 4BWXA 2F7ZE 3MDYA 5G1XA 1CKJA 1R0EA 3HV7A 2XIKA 3FL4A 3VUTA 3G6GA 2BTSA 4ITJA 3ZDIA 2VTQA 1YQJA 5LVMA 3EN7A 3LCTA 2HWPA 1XBCA 3NLBA 3OS3A 4ZLZA 1Q99A 3FUPA 4AZTA 2CMWA 3LFAA 5KHWA 4AT5A 3EN4A 2E9VA 4FG8A 4D55A 1IG1A 3TV4A 3EWHA 2I6LA 2WMWA 3EQFA 3FMLA 3TWJA 4O4FA 4W8DA 2GPHA 2G2FA 4O0RA 3FBVA 3G6HA 3WYXA 4BZOA 4EJNA 4QMPA 5M56A 3EZVA 5CF8A 2VRXA 5KBRA 1YDRE 3F69A 4IJPA 4OBQA 5LARA 3S1HA 2HCKA 1K3AA 1R0PA 2ZMDA 1KE7A 1M52A 3P1AA 5M07A 3QYZA 3MGYA 3RCDA 3N9XA 3OCBA 5AP1A 3RK9A 2X0OA 3R30A 4NM0A 3V04A 2CLXA 4IW0A 5IQCA 2Y6MA 3QTQA 3LJ2A 2W1HA 4QMWA 4LUDA 4QMQA 4O7YA 3H0ZA 3BEGA 4CTBA 2GCDA 4PMTA 4ZLYA 1LUFA 1H0WA 3QC9A 5C01A 4BCGA 4QO9A 5T68A 2A4LA 5HLWA 4DA5A 4QTBA 3NWWA 4RIXA 3DFCB 3DKGA 2GTNA 2KTYA 3TKUA 2YM7A 5H2UA 3TNIA 5DI1A 3AGMA 5BVOA 3CKWA 3O7LB 4QYHA 5BVKA 4U81A 2EWAA 3PE2A 2V55A 2GHGA 5FP6A 2ITOA 3Q6UA 3NRMA 2WMQA 3R28A 2VO3A 5CWZA 3JY0A 5AUVA 3OT8A 3W8QA 3A2CA 4HGSA 2P2HA 4FIFA 3UZRA 2G15A 3VS7A 2ZJWA 2GS7A 4UXLA 5FXSA 5IA4A 2JAVA 3L9LA 4H36A 4NFMA 3UIXA 3EKKA 3HUBA 2UVZA 2HELA 4V01A 5CT7A 2WQBA 3MPTA 5D11A 4ANBA 3ZZEA 3HVCA 4AXFA 4RIOA 5KMJA 2BRBA 4FVPA 4M0ZA 4AA5A 4FG9A 2BKZA 4LG4A 4F9WA 5AUWA 4TPTA 5EG3A 5KKRC 3KULB 4XG4A 1OL2A 3TEIA 2Y9QA 4U97A 3VBYA 4Z55A 4I24A 2C5VA 5CQUA 1DAYA 3LJ0A 4BDJA 4YNEA 3VUDA 2A19B 2CJMA 4F09A 3WZEA 4IANA 3W0PA 2ERZE 4K1BA 2J51A 4FZ7A 3L8SA 2C1AA 5GIPE 2UZBA 2VTLA 2QOFA 3LM5A 4IE9A 4PWNA 4A06A 3B8RA 2XARA 5E90A 1AD5A 4ZTQA 2O5KA 4IB3A 4XUFA 4YZCA 3COMA 5I9VA 2VO7A 5IF1A 1ST4A 4JQ8A 4PPAA 5HIEA 4U40A 4CYJA 1LPUA 4ZZMA 4NL0A 1NY3A 2AQXA 3LFSA 4BYIA 4D4YA 4F9YA 3TIZA 4FNWA 4QQ5A 5FM2A 1DI8A 3PP0A 2X9EA 2C6OA 4M68A 3LOKA 3V8TA 4FKWA 5LWMA 4GCJA 3LHJA 3BGQA 4QYYA 2PUPA 1OKYA 5KBQA 4E26A 3BEAA 3FKOA 4TZRA 4S32A 3FZRA 3EYGA 4ZSLA 5GHVA 2HK5A 4HNIA 3ZSIA 4PX6A 4AW1A 1H26A 3C7QA 3QBNA 3KK9A 4H3QA 5E8YA 3A7FA 4B8LA 3BPRA 4XP3A 5FG8A 3RINA 3WF6A 4EWQA 4NM7A 5ANDA 5JH6A 5K0XA 3NFFB 4FKGA 4F78A 5TO8A 3QQJA 2XRWA 4GUBA 3ENMA 3U9CA 4N70A 3BELA 3I7BA 4FKTA 2ACXA 2YIRA 2C6TA 2YIWA 4IX6A 3RAIA 4EHGA 4MBIA 3MVLA 2I0HA 3GNIB 5IG1A 5I9WA 3P5JC 3WF8A 4X6RA 3EQGA 4FV4A 3MVJA 2R7BA 3QKMA 3D0EA 4IC8A 3AG9A 4R3CA 3AC8A 2FSOX 4QP4A 1REJA 2C0TA 5IQAA 2QG5A 5IPJA 2C0OA 2JKQA 2XNGA 5CEQA 4JLCA 4C3PA 5DGZA 2PWLA 4EH2A 3ET7A 4BDFA 5HTBA 4L68A 5CENA 1XH4A 3KC3A 5AV2A 4WG4A 3UO4A 1H1WA 4PTCA 3GC0A 3NUNA 3CE3A 5IQEA 5J87A 1WBOA 3BHYA 2PZRA 3D5XA 2JKKA 3LFCA 3M1SA 3F2RA 3HDMA 3IW8A 4AP7A 3H9OA 4QP1A 3F61A 3HA6A 4L53A 3A61A 1RW8A 3VUKA 4DG0E 5K4JA 3CJGA 4NIFB 2P3GX 3U51A 4D2PA 3ORKA 1OM1A 3Q2MA 4F65A 5ETIA 5IQFA 5BVFA 3UE4A 2OJIA 4QTEA 2EB3A 3R7EA 4A07A 2C68A 2CLQA 4R7HA 5IA2A 3CQUA 4JOAA 2EXEA 4F4PA 4G1WA 4D4VA 1FVTA 4N4SA 5BMSA 3DAKA 4JG8A 4E3CA 2A1AB 5CSVA 4I6BA 4LMUA 3CPBA 3E7VA 4ZSEA 4FTOA 2GQRA 3QLGA 4BDDA 1HCKA 4ZS0A 3IS5A 3C51A 5EKOA 1BI7A 1G5SA 5CAPA 3UPZA 5M09A 5HVKA 4F7SA 2RG5A 3OVVA 2C6LA 2PMNX 4RSSA 4RWLA 4D1SA 3VBTA 4Q2AA 3F3UA 5IUGA 1W98A 2XK6A 1HCLA 4L67A 3LIJA 4H1MA 1PRYA 4ANMA 1M7QA 3R73A 5AJQA 2XNNA 3ZO4A 3CQWA 4BBEA 2W05A 4JX7A 4AN9A 2QO7A 4FV3A 5AR5A 2VGPA 3D4QA 3QD2B 4O21A 4L3PA 1W8CA 2IEWA 2XKEA 4FIEA 4JJRA 1GZOA 3RP9A 4LOPA 3MVMA 4OT6A 4EJ7A 3Q9XA 2OXYA 3GCVA 3VC4A 5EM8A 1KE8A 3QRTA 4KIKA 4CFNA 4E4LA 5ITAA 4AZSA 4XG8A 4Y85A 3UMWA 3WZKA 3BBTB 2BDJA 4QD6A 4YO4A 3ALNA 4FV5A 3DJ7A 5CS6A 3R7UA 4PP9A 2X81A 4FV8A 4I3ZA 2PMIA 2DS1A 2YITA 4YR8A 3TJCA 4ZY4A 4R5YA 1YW2A 2BZIB 5CASA 2C0IA 5HICA 2C47A 2IZUA 4G31A 4U45A 3WI6A 3LMIA 4PMSA 4DGNA 4JRNA 5DHJA 5CSXA 3UDTA 3NYOA 1Q61A 1CDKA 2ESMA 2R3GA 3OCSA 3FPQA 4FIGA 5HO6A 4O7LA 2PMLX 5IA1A 5DT0A 4N6ZA 3UZPA 4F1OA 4USDA 3R2YA 4WA9A 5F9EA 1H00A 3COIA 3WZDA 3F66A 4O0VA 4F0IA 2OJJA 4OTFA 2B55A 5DR9A 3HAVA 3P9JA 3HECA 4U5JA 4A4OA 3OC1A 3WIGA 4MQ2A 2JDRA 2PVJA 2C4GA 3CQEA 2XKDA 3KF7A 1OZ1A 4BICA 5M57A 2VZ6A 3S95A 4MCVA 3AOXA 3ZDUA 1JSVA 3FMEA 4KD1A 4W4XA 1SZMA 4NFNA 4HVSA 3C5UA 3I6UA 3EFLA 3OW4A 4O96A 5FRIA 2A2AA 3ZXZA 2EB2A 3LXNA 4FIHA 4JG6A 4EK4A 5KO1A 2JIUA 3MIYA 1YXUA 2OJFE 3FDNA 2WMRA 4E4XA 3TV7A 5E8TA 1KE5A 1P4OA 2V7OA 5CU2A 5IDPA 2WTIA 1O6KA 4MBLA 1Z57A 4I1ZA 3BYUA 3JVSA 3TUDA 1LP4A 1LEWA 5BX0A 3UOHA 3JS2A 3NUPA 1YHWA 2YABA 4FE2A 2QQ7A 3ORTA 3UYTA 5GZ8A 3IKAA 3IECA 4MXAA 4D4RA 2G1TA 3PJ2A 2Y8OA 4RX9A 1OPJA 2Q0BA 3PXFA 3E8DA 3ZHPC 2X0PA 2HZNA 2Y0AA 5EW8A 3RPYA 4MXZA 5J7BA 3BQRA 3DJ5A 4UB7A 2RIOA 4KSPA 4AG8A 2ZDTA 4ZY6A 1V0BA 3PJCA 4IIRA 5AIKA 4EZ3A 5C8NA 1V0OA 4D2SA 5IH6A 3IDCA 4FOBA 5CLPA 1YHSA 3PE1A 1XH8A 2PSQA 1FVVA 2QHNA 3CGOA 5F95A 5FTGA 4ZSJA 3ZFMA 2XP2A 1PYXA 3ORZA 2DWBA 2VTAA 4KA3A 3QCYA 4JAJA 4P2KA 5DVRA 1NVQA 4FK6A 4L7FA 3ROYA 2UZOA 3PPJA 4FIIA 3KIOC 3FLNC 4I4EA 3VUMA 4AOTA 4EH4A 3W0RA 3F2NA 4OUCA 2C6KA 4FSTA 3A62A 4WUNA 4I41A 2NO3A 3O51A 4BDGA 4FTJA 2YCRA 2CKOA 2XKFA 3TXOA 3NR9A 2WEIA 4O4CA 3AXWA 3LM0A 4H58A 4LFIA 5B2KA 4EUUA 4Z7GA 1W2FA 4GT4A 4O82A 1ZAOA 4FZ6A 5HG7A 2GU8A 3LLAA 3AC3A 4FSWA 3E92A 4RFYA 4E6QA 2HENA 2W4JA 3DBFA 2P55A 4CFWA 5JFXA 1I09A 3R7OA 2FA2A 4FUYA 4AZFA 1AGWA 1S9JA 1UWHA 4YBKA 2OF4A 5LVPA 2WMUA 4ZIMA 3EN9A 3MS9A 4MKCA 4BTJA 3KREA 4BJJB 4FX3A 5EYDA 3VQHA 4AN3A 2XALA 1ZZLA 3HV4A 3I0OA 5EW9A 4LRJA 2RL5A 4ZXTA 2W96B 3BLRA 4XG7A 4JXFA 3DTCA 2XK3A 4EH6A 2R0UA 3O8UA 1IEPA 3VVHA 3PJ3A 4NCTC 2WU7A 4NKSA