4P2KA

Structure of ephrin type-a receptor 2
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
277
structure length
259
Chain Sequence
AVLKFTTEIHPSCVTRQKVIGAGEFGEVYKGMLKEVPVAIKTLKAGYTEKQRVDFLGEAGIMGQFSHHNIIRLEGVISKYKPMMIITEYMENGALDKFLREKDGEFSVLQLVGMLRGIAAGMKYLANMNYVHRDLAARNILVNSNLVCKVSDFGLSRVLGKIPIRWTAPEAISYRKFTSASDVWSFGIVMWEVMTYGERPYWELSNHEVMKAINDGFRLPTPMDCPSAIYQLMMQCWQQERARRPKFADIVSILDKLIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords Ephrin type-A receptor 2
publication title Structure of Ephrin type-A receptor 2
rcsb
source organism Homo sapiens
total genus 81
structure length 259
sequence length 277
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2014-03-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4p2kA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4p2kA01
1OKWA 4FA2A 2J6MA 3ID6C 3HV4A 3BU3A 3LMIA 1MRVA 3SXRA 3KRLA 2VV9A 4FKGA 3V01A 3R1YA 5M4UA 1CKPA 2R3GA 2B55A 4L44A 2PVJA 3DB8A 4DTKA 2X2LA 5GZAA 4QP8A 1H0WA 2VUWA 3R7UA 1OPJA 3P1AA 2C5VA 5E92A 3IQ7A 2PU8A 2B9FA 3FQSA 3N4TA 3D5UA 5AUZA 4B9DA 4RIYB 2WQMA 1I44A 4O7SA 4IVAA 4IWQA 2LAVA 4PPBA 4N4SA 4FR4A 3EQPA 4TPTA 3UOKA 2BHEA 3C4CA 4RRVA 4WOVA 1LEZA 4C3PA 4Y83A 4F09A 4I92A 5CEPA 3TTIA 4GFMA 5BVFA 2W5AA 2BAKA 2CCHA 1MQBA 3QALE 4FV3A 2YIRA 2J0IA 2JEDA 3KKVA 1URCA 4OLIA 5EI2A 5BVKA 4XNEA 1XBCA 4IAAA 2OH4A 5A4LA 4E73A 2F7XE 1SVGA 1P14A 4C4JA 3SC1A 1FVTA 4JX3A 4IC8A 4YJVA 5I9XA 4Y5QA 3RNIA 4JG8A 4FK6A 4QMMA 3CGOA 4OBQA 4I22A 3TJCA 4CZTA 3Q32A 2QI8A 3TACA 4AZVA 2J0JA 3NYVA 4USDA 4IFCA 2XCHA 5CQWA 2OK1A 3WARA 3ZSHA 4IAFA 1H00A 3P23A 4O1OA 5HD4A 3QQLA 4EOJA 3NAYA 4Q5EA 5HE1A 2YCQA 1BUHA 3DK6A 2J51A 2E9UA 4RA5A 4IX5A 4BTJA 4FTNA 3FXWA 3SHEA 3VWAA 4QMQA 4C0TA 3KREA 2YM5A 3PVUA 4GCJA 3R7IA 1Q41A 5ACBC 1JNKA 3DB6A 5CI6A 3DBCA 1KOBA 3DDQA 1H1PA 4OT5A 2QOIA 4BCMA 4AW0A 4ASXA 4O81A 5AV1A 5IA1A 3AC5A 3FPMA 4C7TA 2VWBA 2XVDA 4XRLA 5C03A 3NUAA 3R7YA 4U7ZA 4TRLA 2X7OA 4I24A 3COKA 4LGHA 2G01A 2VWXA 3OXIA 4I5PA 5CSHA 2RKUA 4TWPA 4R8QA 4XG7A 4D9TA 4EOMA 4YZ9A 4YPSA 5CSPA 2HY81 3UO5A 3N9XA 2XIKA 4MF1A 2C5OA 2WMVA 3IDBA 3PJ8A 1SVEA 4OTDA 4ANNA 5HHWA 4EHEA 3AOXA 3GP0A 3UTOA 3MI9A 2NRUA 2QOFA 3E3BX 2WMSA 1M52A 1YI6A 1BKXA 5DMZA 3HUBA 3ORKA 4RZWA 3GENA 4FKJA 2OFUA 4O0SA 5AUYA 2WTKB 5EYKA 5A6NA 4TYGA 4F99A 5EDPA 4A4OA 1LPUA 2G1TA 2WIPA 3MYGA 4UYNA 4X2FA 4BCHA 3ZO4A 2BFXA 1QPCA 2YCFA 4R5YA 4UMQA 2W1GA 4F9WA 4H1MA 3F3VA 4RIOA 2XYNA 2WELA 3PJ1A 4FTLA 3QQJA 2GQGA 2W06A 3L1SA 2R64A 5JSMA 4IJPA 3WBLA 2W1HA 2X9FA 3S2PA 4AG8A 3I81A 4H05A 1YHSA 3ZYAA 4DYMA 4E3CA 2CGUA 2XM8A 3R30A 4JOAA 3T9TA 4HYUA 3CBLA 1PMEA 4J97A 4GU9A 3U9NA 4MXAA 4DINA 2J5FA 4L52A 2JKQA 3OXZA 4ERWA 3V6RA 2JLDA 2WPAA 3CP9A 2XNBA 2JGZA 5DE2A 3EFLA 4ANLA 4ASEA 4ASZA 5EFQA 3R1SA 3Q60A 4LRJA 2GDOA 4OT6A 1F0QA 4OTGA 3K3JA 4E8AA 5EYDA 3DK3A 4IB0A 4P90A 4JR7A 4NJDA 4ACMA 3I7CA 3UDBA 5ETAA 5HX8A 3C1XA 3BRBA 3AC1A 3NAXA 5HBEA 3M42A 3TNWA 4YP8A 3ZXZA 3ERKA 1NW1A 1TKIA 2QOCA 3JPVA 2JC6A 4DCAA 3O0GA 3RHXA 4U3ZA 4YC8A 4NM5A 4P4CA 5TKDA 3MH2A 4QMWA 4D4YA 5AV2A 5HNBA 2BUJA 2ITTA 4BYJA 3ZO2A 4RQKA 1H08A 3ZTXA 4O7WA 5CF4A 1WVXA 4HZRA 4Q9ZA 2ZV9A 4MNFA 4TWCA 4C35A 5D1JA 3DGKA 4XBUA 4DITA 4CFWA 3LXNA 3E7VA 1TQPA 3OVVA 3PXRA 3F5XA 4NSTA 4KRDA 3S95A 1IAJA 2CJMA 5M51A 4HPUE 4L53A 2ITYA 3C5IA 3OBJA 2FO0A 1M2QA 3MVMA 3BI6A 2J5EA 5T6KA 4DN5A 1G3NA 3COHA 4CZYB 3O96A 4Z7GA 4FSQA 3LJ2A 1Z5MA 5I0BA 2OJJA 4UX9A 2XBAA 5KKRC 1H1WA 3ELJA 3P5KA 3ROCA 2F7ZE 4RC3A 4AQCA 2YA9A 3ZRMA 4XLVA 3MSSA 4NIFA 4ZY5A 3VUTA 4EOOA 3R73A 5J9ZA 4MEDA 2X39A 3ZH8A 4PRJA 3ETAA 2Z60A 2VX3A 5ETIA 1PMVA 3TDWA 1T45A 4UV0A 3LFSA 1OITA 3WYXA 4ZY4A 4BY9E 3DZQA 3LCKA 4I6BA 1UKIA 3TI1A 3W16A 4OTFA 4O2ZA 5DEWA 3QA8A 4M0ZA 4PMSA 3SRVA 3FYKX 3S3IA 5IA2A 5EQEA 4XP0A 3BU5A 3EFWA 2WMQA 5AAEA 2YWVA 3EQBA 5J95A 3H0YA 4W4YA 3T8OA 4QNYA 1Y8GA 3VS3A 5KMJA 2HELA 2UW6A 4EYMA 4QMLA 5ANJA 4MD9E 1OBGA 4E5AX 2JKKA 3PG1A 2FUMA 3P78A 4APCA 4MD7E 2BAQA 4GS6A 4KBCA 5B7VA 3UNKA 5AR3A 3V51A 3ZLSA 4AGWA 4UYAA 3FZSA 4WNKA 4QYFA 5DBXA 5IQEA 4U8ZA 3A60A 4RJ3A 4MHAA 4A9SA 5JFWA 4GMYA 4NEUA 5G1XA 1TQMA 3QF9A 3UO4A 5B0XA 5HLWA 2QR7A 3R1QA 4NM7A 4X2JA 2PVHA 3POOA 5BVNA 5FGKA 5EOBA 1JQHA 3LZBA 3GB2A 3K3IA 3CQUA 5HI2A 4BTMA 3Q9XA 4BZNA 2BPMA 1DI9A 5CT0A 4FNZA 4ZTLA 4FX3A 1Q8UA 3AGLA 3QC9A 3DBEA 1K9AA 2C3JA 5BUEA 4QD6A 5AUTA 4N0SA 4FTQA 4IBMA 1PXOA 4YLJA 4WD5A 1QCFA 5GNKA 4LYNA 5CNNA 5GJGA 3CKXA 3RAKA 3NVKI 5IZFA 4Y85A 2X8IA 3EMGA 3QQKA 3IW7A 1W8CA 4ZMEA 2VGPA 3KK8A 2FYSA 4R3CA 2HAKA 4O22A 4R5SA 4DEIA 5IH4A 4R1VA 5K9IA 4F9BA 1CDKA 2W5BA 3SKCA 4EBWA 4AGCA 4L42A 2I0VA 4DH8A 5CAOA 5AUVA 4EH3A 3PZEA 2R3PA 3ENMA 4FGBA 1UNGA 1PXPA 1ZYCA 2DYLA 4I0RA 4EH2A 2XNOA 4ZLOA 1GIHA 3C0IA 2GS2A 2GNLA 4RIWA 2WMBA 4FG7A 1KSWA 3HMOA 2PZYA 3DQXA 4OGRA 2IVSA 2XIYA 4YJTA 1PXLA 2OFVA 3NUXA 4ANMA 4BDAA 3HV3A 3BWJA 4CMOA 4BDEA 2ITXA 2JFMA 3QAME 4NM0A 4GSBA 3D5XA 1OZ1A 3CS9A 3M1SA 4NK9A 5E90A 4AFJA 4CCUA 3OG7A 1VZOA 5DRDA 2GHGA 2HCKA 2XYUA 3Q4CA 4V0GA 5TR6A 3NUYA 2C4GA 2ETMA 4YHJA 3JR1A 1MRYA 4LI5A 2C69A 3AT4A 3IK3A 5FLFA 3TJDA 4DEAA 3W2CA 4N57A 4QP9A 5AR7A 3VBTA 1CKIA 4I4EA 2WKMA 1O6KA 2HYYA 3FMEA 3D9VA 1OL6A 3MPMA 4QTBA 3OOMA 5FM3A 4H39A 4WO5A 4J8NA 2E9VA 4YNEA 2C6OA 2W1CA 2BIKB 4RSSA 4EONA 2QLQA 5HICA 2VTTA 3RJCA 4ZTRA 2QG5A 3V8SA 4BDFA 2QURA 3NNXA 4NWMA 4YTIA 4UMTA 4IM3A 2YM8A 2R5TA 3AMBA 3TZMA 3UQFA 3EQGA 4JAJA 1OL7A 1ZOGA 1PW2A 2WMTA 4JBPA 2YISA 4O0RA 4TW9A 2CLQA 4IWOA 5IPJA 3JY9A 3OCBA 3DDPA 4YZMA 3RKBA 5HBJA 2YITA 5FEEA 4G17A 5CNOA 3MS9A 2R3HA 3L8SA 3IDPA 3VAPA 3CSVA 3POZA 1FMOE 1MUOA 5FBOA 2J4ZA 3CGFA 4F9YA 4L7FA 3ODYX 4G16A 3ZZWA 4BZDA 1DAWA 4O6LA 4F7NA 5EM7A 4TWNA 2C6LA 4S32A 5LMBA 4CD0A 2ZMDA 2FSMX 4FSNA 4JQ7A 5K0KA 5JZJA 5EQYA 4CRLA 3WF8A 2VN9A 4PDYA 1CTPE 2YIQA 3BHVA 3H9OA 4FZ6A 3QQUA 3Q3BA 3BHYA 2CHLA 3KB7A 3R00A 3F6XA 1PJKA 3NR9A 3PJ3A 3QZGA 3RM7A 4IXPA 4ALWA 4FKLA 4B7TA 4MNEA 3R83A 4O0YA 2JKMA 4DFBA 4BCFA 3K5UA 1JKLA 1JBPE 3LPBA 3ZLWA 2UZOA 2E9OA 1WBPA 2R3LA 4JG6A 5FXQA 3K5VA 3RI1A 1Q4LA 5J9YA 5EHYA 4USEA 1FOTA 1OL1A 2ACXA 3B8RA 3LFQA 4YPDA 3VF9A 3GCSA 5TE0A 2CGVA 3ALNA 4GT5A 4GW8A 4IAIA 3I4BA 3S4QA 5I4NA 3ZDIA 2H8HA 1J7UA 2BROA 4I41A 5IH6A 3KF4A 4M15A 3F2AA 4C02A 4BCOA 1OGUA 3LOKA 1OIQA 5J5TA 2CN8A 1YI3A 3EOCA 5J8IA 3V8WA 3FC2A 4E6QA 4DEHA 2PUIA 1XH6A 1ZY5A 4APPA 3FEGA 3E8CA 3HYHA 2WTCA 2XNNA 2YDKA 3VULA 1ZWSA 3SQQA 4IAZA 4QYYA 4FTMA 4DH3A 5AR8A 3HRBA 5IQCA 1ZZLA 3LFCA 1WMKA 2ZV2A 1O9UA 3UZPA 3II5A 4BN1A 3A61A 1DI8A 2PPQA 3C5UA 4JIKA 3CKWA 1IR3A 3EQDA 4MXCA 4NIFB 4YHFA 3GC0A 5HG5A 4OAUC 2CSNA 3PG3A 2VNWA 4D4VA 1OIYA 3F3ZA 3UIMA 4EH5A 2UZTA 3KXZA 3PLAE 2NPQA 5KHWA 4QPAA 2AUHA 2O5KA 1B38A 1WVWA 4CFXA 3HVCA 3MW1A 3BIZA 3F61A 3RPOA 5LVPA 4DT8A 2R7BA 5AP4A 3C9WA 3RBWA 3SRVB 5M4IA 5DEYA 1OUYA 3FY2A 4UMRA 1XBAA 4HOKA 4D0XA 2W4KA 5HE3A 5GHVA 4YTHA 4GG5A 2ZMCA 4A4LA 1IA9A 1PMUA 1KUTA 3OY3A 2RIOA 3PSCA 1H25A 4GFOA 1YDRE 5IA4A 1K3AA 4TZRA 4G3GA 4G3CA 4NM3A 5JK3A 3LFBA 2PMNX 4LL0A 1VEBA 2IG7A 4RWIA 3PYYA 5HQ0A 3OS3A 4LRKA 3SXFA 2RF9A 1OVEA 1WBWA 4JX7A 2O63A 3PPZA 4KIPA 4M68A 1JSVA 3OCGA 1YXTA 3F7WA 3ORZA 4DH1A 2GNGA 4HPTE 4A9YA 4DFUA 3S1HA 4GG7A 4MXZA 4JG7A 4UWCA 4L67A 3WE8A 5LVMA 3D7ZA 5HCXA 5IEXA 3FQEA 2QQ7A 5DNRA 3D15A 2UV2A 4EKKA 4YJPA 4A4XA 4UWBA 3GU7A 1OKVA 3NW7A 4YNOA 4CKRA 3NUUA 1HCKA 4L01A 4ANQA 3BELA 2C68A 4LL5A 3RINA 4PTEA 2A1AB 1J1BA 2BVAA 4RFMA 4ASDA 3W1FA 4C36A 3GOPA 4FV9A 3D7TA 5I9UA 3LFEA 4FSRA 4ENXA 4O7ZA 3PA4A 1FQ1B 2W1ZA 1VR2A 2VU3A 4FNYA 4FSZA 5FTOA 3VUMA 3E87A 4CEGA 1A9UA 2C3KA 3F3WA 4XG9A 3MWUA 4J52A 4EOQA 2QOKA 4WG5A 3KQ7A 4L3LA 2UW0A 3I6UA 3JVSA 3RMFA 3NPCA 4RT7A 3IOKA 4AGUA 2WMWA 3RTPA 4AT3A 2FB8A 1ZYDA 3FAAA 2PVFA 4JXFA 3QBNA 4MQ1A 4QP6A 3LFAA 3W8LA 4EUUA 1YWVA 4YO6A 5LCJA 5LVNA 4K11A 4BKYA 5EM6A 4UMPA 2VTLA 2X1NA 3R7GA 4RIWB 4FTUA 4EQCA 1REKA 3BEGA 4O0VA 5M44A 2XK9A 3PXYA 3QTSA 5E8YA 3D2IA 1VYZA 3ZZEA 4C2VA 3IOPA 3FZPA 4WNMA 4RC4A 1KE6A 1M17A 4ARKA 3EQRA 4DBNA 2Y9QA 1YDSE 4FNWA 1XBBA 2FGIA 2EB2A 2RFNA 5DR9A 5IQIA 4FMQA 2WIHA 5J87A 5CF5A 4MWHA 3Q52A 4FYNA 1YOJA 4IFGA 4V0GB 4XJ0A 3FLNC 4ZOGA 4C3FA 4KKGA 5L8LA 3B2TA 4FC0A 4UWYA 5F1ZA 4GEOA 3W8QA 4GKIA 1BI8A 3SD0A 4WBBB 4EQMA 4BWPA 1PXNA 3DBFA 2FVDA 3UMXA 2Y7JA 1RDQE 2O8YA 3MH3A 4BDCA 1Q3DA 4DG3E 4ZJVA 5BVDA 5AR5A 5IU2A 4QP2A 3AC2A 5IQHA 4CVAA 3MY1A 4J95A 1YI4A 3L9LA 4AZTA 4YJNA 2XNPA 2OZAA 3P79A 3W55A 1MP8A 5ETCA 3F2NA 3ATSA 4YURA 3GC9A 3Q53A 1KE8A 4FYOA 2Y4PA 4BGQA 5AUUA 4QTEA 4KBKA 2VD5A 2CLXA 3KRWA 2I7QA 4YHTA 4ITJA 5CSXA 2B9HA 3C4XA 2C5NA 3UNJA 4IC7A 2W7XA 5C9CA 3N51A 3FXZA 3PP0A 4M67A 3BYOA 4NH1A 4O38A 2R3FA 4Y72A 5H8BA 3R8LA 4XOZA 3LXPA 4D2SA 4EH4A 3UNZA 5D7VA 5CANA 3VS0A 4JL9A 4I6HA 4ZJIA 1OBDA 4PTGA 1V0PA 4OTIA 5HGIA 3R7VA 4Z7HA 5KMKA 3PIYA 4R7IA 3RPSA 4M69A 2B7AA 3NIZA 3FPQA 2H6DA 2PTKA 3QUEA 3OCSA 5CAVA 5CY3A 3FDNA 3C13A 2GTMA 4S33A 1ZYJA 2WB8A 2XK8A 1S9JA 3LIJA 3KRRA 2WU7A 5L8JA 3QUDA 4BYIA 4EHGA 5L2SA 2UW8A 1JKSA 5LMKC 3PUPA 2BKKA 3G0FA 4PUZA 4BTKA 4N6YA 4S31A 2GHLA 5EDRA 3ORNA 4FGRA 2GHMA 4BDBA 5JRQA 3T3VA 4ZEGA 3PA3A 5A4QA 1JSTA 5CEMA 1UKHA 5I9ZA 5K4JA 4MNEB 4AAAA 2UZBA 4JBVA 4MQ2A 3HMPA 5JMSA 3MPTA 1CM8A 1Q99A 2OJFE 5IQAA 5FTGA 4X2KA 2ITQA 3K2LA 4KKEA 3DK7A 3BX5A 3Q6UA 3E5AA 4TYHA 3R2BA 2YDIA 5A9UA 3FMHA 4FL2A 4QMYA 4Y73A 2XRUA 3CD8A 3DCVA 4I5HA 4M12A 3LHJA 3QRIA 3U87A 4UALA 2XKCA 5AEPA 4LQMA 5AV0A 3Q5IA 4CT2A 2OSCA 3BE2A 5BX0A 3IW4A 3R9HA 1E1VA 5IA3A 2PE0A 3Q9ZA 4PL3A 5HOAA 2YZAA 3UIXA 3AD5A 4FEXA 3SG8A 3VQHA 3TIZA 3KRXA 2CKEA 3L9NA 2H34A 1OUKA 4F63A 3FSFA 3V3VA 4FOCA 4CT1A 2GSFA 5B2KA 4O7RA 4FSYA 2QU6A 4QRCA 5JFVA 5KX8A 3IS5A 4TY1A 3UZRA 2W96B 3BYUA 4PTCA 1Q97A 4RMZA 3ZFXA 5IKWA 1Y6BA 5BYLA 3BZ3A 3NZ0A 5IUHA 4GRBA 3ZONA 4K33A 4F9AA 4L7SA 3LCOA 4Q9SA 4WG4A 4HW7A 5DI1A 3UODA 4FEVA 3NCZA 2YWPA 5KE0A 2VTOA 4FL3A 5HCYA 4K9YA 4LMNA 4J53A 4X7QA 4YBJA 4DGLC 2AYPA 1M7QA 2B9JA 4QNAA 3G6GA 3I7BA 4KIOA 2R0UA 2UZDA 3NYNA 1PXIA 4FI1A 4TTHB 2GNJA 5CZIA 3DAEA 5JZNA 2R3MA 2PVYA 4NFMA 5E8ZA 2E9NA 3IECA 3UQGA 4AN9A 3AGMA 2YLFA 4H58A 1YWNA 3V5PA 5EI6A 3RCJA 5CAUA 4RJ7A 4XEYA 4UB7A 1ZMUA 4B99A 4BKJA 5E8VA 3WI6A 4F1MA 4DA5A 3DBQA 1L3RE 2YIYA 5C27A 4LOPA 5BMSA 5ITAA 2Q0NA 3HECA 4KS7A 3FMLA 4BHZA 2YEXA 3WYYA 5IQFA 3G9LX 3GQLA 2Y4IC 1XH9A 3K54A 3AMYA 4FSMA 3RK9A 4E6DA 4GYIA 4TXCA 4DEGA 4IB1A 5BYZA 4C4FA 5HO6A 3QA0A 4J8MA 3MGYA 4EZ5A 2E9PA 3F7ZA 5F9EA 3DV3A 4QMXA 3NMUF 1BMKA 1NY3A 3I5ZA 4FKRA 5DG5A 1BL7A 4GU6A 3W33A 2Q83A 4XS2A 4O27B 5CLPA 3OEZA 5D9HA 2BRGA 4A9RA 3ITZA 2UW9A 3BV2A 5CU2A 5IDNA 3G9NA 3P7BA 3LKMA 2OLCA 1PXJA 3D7TB 2WTWA 5HZNA 4W4VA 3ZEWA 3MB6A 4N70A 3IPHA 1GIJA 4G2FA 1ZLTA 2OXYA 3TZ9A 3QTRA 4FT0A 3R8VA 3UOJA 5E8TA 3LQ3A 1R3CA 3BGQA 3PY3A 3OCTA 4I20A 4GK3A 3QKLA 1OECA 1Z9XA 3H3CA 3HUCA 2CMWA 1M14A 3EYHA 4KKHA 3FC1X 3N4UA 3KVWA 4C33A 4U44A 3U6IA 5AFVA 1R39A 3WF5A 4C37A 3VRYA 4EK3A 2PZRA 2P2HA 3AT2A 3QXPA 3HAMA 4LUDA 4QYHA 4FL1A 2EVAA 4XH6A 2X6EA 3DKFA 2ITVA 5GJFA 3A7FA 4I0TA 2YHVA 3R22A 4FNXA 4E93A 3AC8A 4KIQA 4PPCA 4AE6A 3MFRA 2BDJA 5A4CA 3A62A 3HL7A 4TL0A 4EH6A 2O0UA 3H30A 3E8EA 1B39A 2OXXA 3KRJA 5CS6A 4RG0A 4AF3A 2ZM1A 2VTQA 2BZJA 3F88A 2UVXA 3O7LD 4NW5A 4S34A 3ZOSA 4CCBA 3LMHA 3G0EA 4DT9A 3GT8A 4YJQA 5CAPA 1OKYA 4QP3A 4B6LA 2R4BA 4F9CA 4C8BA 2B4SB 4PY1A 4CFUA 4QMNA 2ETRA 3CTHA 4XG3A 3SDJA 5KKRB 4G3EA 5FTQA 4U43A 5C8NA 3EN7A 3LFDA 1PKGA 3CLYA 4DLIA 2IZSA 2PVNA 2OIBA 3R8ZA 2V55A 1CKJA 2OJGA 3MIAA 1ATPE 2RG5A 2V7OA 3P7CA 3IW5A 2V22A 2O2UA 4FTIA 4U40A 5FEQA 3KU2A 4RX9A 3Q2JA 2OZAB 2J2IB 3R28A 1Q5KA 4FV1A 4I5MA 5DT3A 3AG9A 1V0BA 3ZMMA 2PMIA 2C3LA 2C6IA 3QQHA 3SG9A 5IF1A 4O7YA 3C0HA 5A54A 4G6LA 4CNHA 2UZNA 1BYGA 3PXKA 4MWIA 4RQVA 3KMMA 5J79A 2QG7A 3QUPA 3KCKA 4JI9A 2XS0A 4IJ9A 2OG8A 1RE8A 4M84A 1OI9A 3ZRKA 4UMUA 2WMUA 4KIKA 3W2OA 3BQCA 5M06A 1YXVA 4QT1A 2XZSA 2C6DA 2WMRA 3UBDA 4QMPA 3QZHA 4AZEA 4IZAA 2J9MA 3V5QA 4QQJA 2WTIA 3HDMA 3BLRA 3ORIA 4D1SA 2VO0A 3CC6A 3FQHA 2P33A 2I40A 3W2PA 2UZWE 3MFTA 4M69B 5BUJA 2X2KA 2Y0AA 3MA6A 2SRCA 5DWRA 3T3UA 4FT7A 2XBJA 3PLSA 2BZKB 5LWNA 4X6QC 2Q0BA 4DEBA 3NRMA 4FV5A 3R6XA 2XNGA 4U5JA 1IAHA 1H1SA 4M97A 4QQTA 4ZTQA 2V0DA 2UUEA 2WAJA 3FMDA 5HKMA 5M4CA 3JVRA 2CCIA 3I60A 1ZYLA 2XCKA 4JDIA 2WHBA 2QKRA 5KBRA 3DAKA 4U80A 2J7TA 3HV5A 4RC2A 3MJ1A 4BI0A 3A7HA 5L6OA 4IM0A 3O8UA 2QOLA 5CEIA 4BKZA 2X2MA 2CNUA 1ERKA 3TDVA 4HYHA 4YSJA 3EJ1A 1G8SA 3TUDA 2H9VA 3FZ1A 3UJGA 3OW4A 4BICA 2JBPA 4RX7A 5M55A 4BIBA 2BRHA 4TYHB 3DFAA 2R3JA 3U54A 4IHPA 2CDZA 3GXLA 4ZZMA 4IDVA 1FVVA 4AACA 4CYJA 4DTBA 3GFEA 1Z57A 3PIXA 1TQIA 2WXVA 4QYGA 4O1PA 4ALUA 1XR1A 3KXNA 1SNUA 1XJDA 5DGZA 3C4ZA 1JSUA 3EFJA 2QLUA 5EW8A 4RBLA 3T9IA 4EK5A 2J50A 1YHWA 4R7HA 2ITOA 3ZBXA 1PMNA 3PXFA 3LLTA 5HBHA 4WT6A 4EOLA 4MD8E 4F0IA 1GOLA 1T46A 3EN9A 4KWPA 3CY3A 3KA0A 4KAOA 4U41A 4EJ7A 3RHKA 4IACA 4YMJA 1J1CA 5HEZA 4QMUA 2WQBA 4DFYA 4EZ3A 5L2IA 3M2WA 4E26A 4F0FA 1U54A 3DXNA 5AP6A 3DPKA 4H3BA 1YW2A 4V01A 3A4PA 5HTBA 2G2FA 1NXKA 2XIRA 4GYGA 3TNQB 4C61A 5AUXA 3QZIA 5CEKA 1QPJA 1A48A 3R04A 1IRKA 2PL0A 3OT8A 2RFSA 2YM7A 4D28A 2YN8A 5ETFA 5JGDA 4GKHA 3VN9A 3NIEA 4FKQA 3RZBA 2WQNA 3VS2A 5JEBA 2J0KA 2ZYBA 4EL9A 4ZIMA 2PULA 4AZSA 3Q9WA 2C1AA 2IWIA 3CTJA 3QD4A 4JBOA 4BVUA 5A14A 3W18A 4EI4A 4FTTA 4C58A 5DYJA 4YLLA 4D9UA 4OUCA 3HMMA 4EYJA 5CXZA 1ZYSA 4ONAA 5AR2A 1YXUA 5CEQA 2VTRA 4FV7A 4EEVA 2ZV8A 4A9UA 4ZTMA 3E88A 4YZDA 4DBXA 4WSYA 1JKTA 1Q61A 3DJ6A 3RK5A 2VTMA 2GTNA 3Q96A 5HE2A 5HD7A 2REIA 1H24A 4L8MA 4IVBA 5BUIA 3VO3A 4MYGA 2Z7RA 4ZSLA 1YWRA 2EU9A 2IN6A 3ACJA 3OUKA 1KOAA 4F1OA 3KK9A 5IISA 2JDSA 2JDVA 3A2CA 3NUSA 4E1ZA 4G34A 2GNIA 5BVOA 4B0GA 3DTCA 4EK8A 5TO8A 1QL6A 3QRJA 2XJ1A 4CQEA 3QTXA 2YM3A 3QWJA 2OF4A 3F5PA 3FWQA 2WOUA 3IONA 4PX6A 5DLSA 4R77A 3HX4A 4RLKA 1ZXEA 3WZUA 3TXOA 4R6VA 2UW4A 2HOGA 5E8WA 3DKOA 4ZZNA 4BCGA 1M2PA 3EN5A 3QQGA 3D83A 4FVPA 3QD2B 4PMMA 4AZWA 5AA9A 4NKSA 4RJ8A 3BQRA 2XJ2A 5DR2A 3QYWA 1IASA 4IM2A 5KCVA 5LMKA 3MJ2A 4K0YA 1GIIA 1OIRA 2OICA 5D10A 1ZARA 4ERKA 3FHRA 4JNWA 1Q8WA 3TG1A 5IQGA 4EC8A 2F2CB 2KTYA 3FI3A 3R0TA 4KSPA 3RWPA 4DH5A 5L4QA 3UIUA 2R3QA 4XUFA 3TV4A 3EHAA 4FSTA 4D2TA 5ANKA 1KV2A 1O6YA 4U0IA 3TKIA 4GV1A 3RALA 5HLNA 2GS6A 1ZOHA 4ZS4A 2B53A 4G6NA 3TNIA 3U4UA 4FVRA 3BHTA 1E1XA 3DZOA 4QMTA 4RX8A 3PVWA 2AC5A 5CASA 3BLQA 4AOIA 4CFFA 2R3NA 5F20A 5EOLA 3NEWA 5DIAA 4CLIA 3DQWA 3VUGA 2VO6A 5EKNA 2HZIA 4JR3A 5L2TA 2HIWA 4JLCA 5I9VA 5E4HA 3C4FA 2C6EA 2ZAZA 3LCTA 3ACKA 1Q3WA 4WG3A 3VS4A 5AR4A 3AC3A 5I3OA 4RJ4A 4DFLA 4KBAA 2YERA 4IZ7A 1YQJA 4J98A 4QTDA 3SW7A 3EQFA 3EZRA 3GVUA 4EHZA 3V5WA 2WEIA 3F5UA 3ZSIA 2OJIA 3OOGA 3UO6A 4KB8A 4DLJA 3S00A 4JRNA 2G2IA 3FE3A 3LMGA 4FT9A 4PL5A 4LUEA 4CV9A 4LOQA 2OXDA 2I0HA 3A8WA 2NP8A 4AW5A 1AD5A 2HY0A 4HVDA 4CG9A 1OM1A 4FTCA 3JYAA 4QP4A 4E4NA 3FUPA 1LP4A 3QTUA 5C4LA 5DR6A 3FI8A 2XP2A 3VNTA 3BBTB 3PY1A 2B54A 3UZTA 5C01A 3GCVA 3LCDA 3C51A 4D1XA 2WFYA 2JFLA 3DA6A 3QWKA 3F66A 3ZLYA 3PDTA 4PDOA 4BTFA 5HU9A 4QMZA 4A7CA 3C0GA 5F4NA 2ITZA 1ZOEA 4ITHA 4JRVA 4KIKB 3VC4A 2X0GA 1OPLA 4II5A 4Y95A 1OL5A 4GH2A 5G6VA 4AP7A 5M57A 2VWWA 3FBVA 3HKOA 3RVGA 4CKJA 3EZVA 4J1RA 3ORXA 2W1IA 4MK0A 4YR8A 2OWBA 4LMUA 4HGTA 2OGVA 1W7HA 3CY2A 3EQCA 5JGBA 3E8NA 3H0ZA 2BMCA 5FWKK 4ZSEA 4K8AA 4CTCA 5B2MA 4RWLA 2A4LA 2Y6MA 3IGOA 2IW8A 5CU0A 5KBQA 2JIUA 5AX3A 2R3IA 3VBQA 5ICPA 4XV1A 2ZDUA 5TT7A 4MBJA 2G2HA 4H1JA 4W8EA 4UXQA 1QPDA 2DWBA 2YM4A 3OWPA 4B8MA 2YAKA 4ZP5A 2VO7A 3F82A 3FMKA 2WO6A 3AQVA 1AQ1A 3OEFX 3NNUA 3OWKA 4NU1A 3B2WA 1H4LA 4TKSA 5GJDA 3PY0A 4E5BA 4W8DA 3FI4A 5GIPE 5BVEA 1U5QA 2OIDA 1NT2A 5KMNA 3NLBA 3DBDA 4BIDA 4MXOA 4C3RA 1H28A 3MA3A 5HTIA 2BRBA 2VWVA 3ZRLA 3JUHA 3JY0A 3V04A 2IPXA 1WBNA 3E8DA 5IA5A 4BR3A 5AUWA 5H8EA 3KXHA 5CZHA 1CMKE 4NZWB 5AM6A 3VBYA 3UG1A 2P0CA 4GK2A 2QHNA 4RIXA 3A99A 3MFUA 4PNKA 4WKQA 4D55A 1U46A 3EQIA 4CG8A 3DXQA 1JLUE 4FV6A 4IX6A 3MVJA 4O2PA 4MXXA 1H1QA 2QONA 4D2RA 3CTQA 4HVIA 4C4IA 4V04A 5AV4A 2Z7QA 4M0YA 3OROA 4IE9A 4ANBA 4FK3A 2QU5A 3LXKA 5EDQA 3ZUUA 5CAQA 2X7FA 4WRGA 3R9RA 5IEYA 5JKGA 1H1RA 2WOTA 3R1NA 3KMWA 1H26A 3ZFMA 4D1ZA 5BMMA 4NTTA 5HVJA 4M13A 2BAJA 3FLWA 4BDJA 5EM8A 3QD0A 5FM2A 2W1FA 5L8KA 3A7JA 3QTQA 1TVOA 5E1SA 1UU8A 1YDTE 1U54B 2J0MB 3KULA 1PRYA 4U81A 3CPCA 3TM0A 4HGEA 4RFYA 2XJ0A 1XH5A 3GCQA 1OB3A 4C57A 2YM6A 3IG7A 2QOOA 1M7NA 3M11A 3DOGA 4V05A 5E9EA 1W83A 4O0TA 1PHKA 5IMXA 2HWOA 3FKNA 3SOCA 4I4FA 4AOTA 3TUCA 4KD1A 4G1WA 2E2BA 4KS8A 5C4KA 3OMVA 4DGGA 4AFEA 4O82A 4G3FA 3BWFA 3GEQA 1RJBA 5CI7A 2KULA 1SNXA 4XG4A 2HXLA 1KV1A 3V5LA 4O83A 3SOAA 2UW5A 5E8UA 3QKKA 5A4EA 5L3AA 1GZOA 2C6TA 4L68A 4ZK5A 2B1PA 4D4SA 2VNYA 4WRSA 3EIDA 3QGYA 3VBVA 1BL6A 3TV6A 1WVYA 4BBEA 4I94A 3AT3A 3O17A 3OXTA 4AWIA 4Z9LA 5H9BA 3NS9A 4BCPA 4EOPA 1RQQA 3GOKA 5D11A 4B4LA 4BBMA 1HCLA 3Q4ZA 4FKVA 1ZMWA 3D5WA 5KZIA 3VIDA 3ORLA 3NCGA 3R63A 1WBSA 3QXOA 3FXXA 4FUXA 3GU8A 4JAIA 4JDJA 2UZEA 4FV0A 3UYTA 5LXMA 2JITA 4F7LA 5HORA 4O7TA 5IEVA 4K2RA 4PMTA 3V5TA 3QTZA 1OIUA 4IANA 5CENA 3U6HA 4FV4A 4OAVB 4X3FA 3DFCB 4FBXA 3UVRA 4KUJA 4UZDA 5M09A 3PRIA 4FKWA 2JIVA 4EWHA 1Q24A 2ESMA 1ZY4A 2FH9A 3NSZA 4G3DA 5DOSA 4O6EA 3U6JA 4OTRA 5AMNA 4EZ7A 2UW7A 2Y6OA 3L8XA 3D14A 3ET7A 4P7EA 4IAYA 2ERKA 4IQ6A 1UU7A 5E91A 3ZBFA 3BGPA 2O65A 1PKDA 4ZTSA 4AU8A 2PVRA 2ONLC 3LVPA 2BDFA 2W17A 2HWPA 4O7LA 3LW0A 3TZ8A 2VTHA 3QCQA 3QX2A 3NNWA 3I0OA 4TNDA 3WF6A 4ZLZA 2OF2A 3PSDA 1XH7A 4ZSAA 5JN2A 3KF7A 2YAAA 3LFNA 3MTLA 5M56A 1GJOA 1GZKA 3ZM4A 1PF8A 3UP7A 2P55A 3SVVA 2HZNA 4AE9A 2XUUA 3E63A 5LARA 2R0IA 3ORTA 3QL8A 4IWDA 4FEWA 3EQHA 2QKWB 3NYOA 4XRJA 2YIWA 4HZSA 5BQ0A 3ZXTA 2PZ5A 4AW1A 4F64A 3U51A 3ZLXA 5ACKA 5C1QB 4WUAA 4FKTA 5I5ZA 3ODZX 1LEWA 4DG0E 4X21A 4IEBA 4O21A 4TWOA 4I6FA 4CYIA 2XKFA 4AZFA 3TZ7A 1J7LA 2Y8OA 2RG6A 4GL9A 4DEDA 3ZEPA 2ITPA 2BRMA 5CVGA 1RW8A 2VO3A 4EC9A 3OT3A 2IZRA 3VBWA 3PPJA 1S9IA 2W99B 5EK7A 2C1BA 4GT3A 3OP5A 4MKCA 4L00A 4QMVA 4YJUA 4C59A 4TT7A 2OH0E 4AN3A 4D58A 4EOIA 4AX8A 2RFDA 4F6SA 3IGGA 3VUDA 3GC7A 1FPUA 2JDTA 3HV6A 4W4XA 2CN5A 4WNPA 3LFFA 5CEOA 3QYZA 2O64A 4PP9A 4X0MA 4JQEA 5A46A 4ORKA 1JKKA 4OTPA 4ZZOA 4FKIA 5K0XA 3FMMA 4QQCA 3RGFA 2BZHB 3MFSA 3FLZA 1WBVA 4F6UA 3COMA 3KXXA 2FSLX 4R7BA 4HGLA 4Z16A 2DQ7X 1HOWA 4E4XA 1ZAOA 3GBZA 4FZDB 2PVMA 3G33A 2YIXA 3Q4TA 3CEKA 2C6KA 3OBGA 4TYJA 3Q6WA 4IZYA 1U4DA 2XK3A 3TKUA 5A6OA 1NVQA 4FOBA 4GJ3A 3W10A 2IVTA 4PQNA 2XNMA 5LCKA 2A19B 5LMAA 1WZYA 1UVRA 1NVRA 5LWMA 2UZVA 1UU3A 4F7JA 3MPAA 4HVHA 4M7IA 1Q62A 5KO1A 4WIHA 3NUNA 2RFEA 3CE3A 4USFA 2EXMA 5L2WA 4WUNA 2VX1A 1ND4A 2PY3A 4D4RA 3CXWA 4AA4A 2PYWA 2V62A 2Y4IB 4JQ8A 5J1WA 2R2PA 4IDTA 1XO2B 5CSWA 4PWNA 5HG9A 1DAYA 2ITUA 4FIEA 2VTIA 5KMMA 1QPEA 2GCDA 3KY2A 4K18A 2WTDA 3MN3A 2HZ4A 4L43A 5H3QA 4U79A 2F49A 2WQEA 4PDSA 1Y8YA 2B0QA 2QCSA 3L8VA 2WTJA 3KVXA 4G9RA 5IQBA 4YSMA 1ZZ2A 5L6WL 3CD3A 5TOZA 4FODA 3TN8A 4XX9A 3W2RA 5EH0A 1V0OA 3FZRA 4FTAA 5JGAA 3HLLA 4AT5A 1UNHA 2FSTX 4B8LA 5J7BA 4BBFA 2OI4X 4OTQA 1KE9A 4RIXB 4IVDA 5M53A 5AADA 2GMXA 3O7LB 3UOLA 2CKPA 3FSKA 2HW6A 3FMJA 4AW2A 4ACGA 4L3PA 4ZLYA 2PUPA 2X8DA 4ITIA 3RAWA 3OUNB 2VX0A 3GUBA 4CV8A 4AXAA 3R7EA 4BC6A 4FVQA 3R7OA 2JAVA 3TWJA 4C62A 4XG2A 2PE1A 3HMIA 2QOBA 3PVGA 1NVSA 4RVTA 2P3GX 3GC8A 4JBQA 4OTHA 3G51A 5FDXA 4RJ5A 3UGCA 3ZCLA 2W4JA 3A7GA 4PP7A 2VWUA 5ANEA 1WBTA 4OTWA 3C7QA 4RVMA 3P9JA 2WNTA 4Q5HA 2BTSA 3A4OX 3R71A 3B8QA 3KULB 3NW5A 4DG2E 3JS2A 3A7IA 4AOJA 2QO2A 3ALOA 3ANQA 3AC4A 4HGSA 4FIFA 4BI2A 2H96A 3OWLA 2GU8A 4HCUA 3QKMA 4MCVA 1FINA 4D0WA 2A0CX 4BCKA 3BE9A 4CQGA 5FDPA 1CSNA 3DNEA 4HNIA 5CQUA 3VBXA 4QMOA 1W82A 4AS0A 3GU5A 4TNBA 5AAGA 3ANRA 4F08A 2J90A 4P5ZA 4MTAA 1F3MC 4EORA 1H27A 3R8MA 1GAGA 3FL5A 3VHEA 4RLLA 2IJMA 4YC6A 3VF8A 1A06A 1BX6A 1IA8A 1R0EA 3BV3A 3THBA 1IEPA 4FG8A 4PDPA 3BKBA 4CRSA 5CU3A 3SLSA 4R3PA 3DNDA 3I79A 4NFNA 1EH4A 1JWHA 2QOHA 3EN6A 5F95A 3RWQA 4Y5HA 4YO4A 4O86A 2PZPA 4RPVA 3FKLA 5H2UA 5HNGA 5HO8A 4RWJA 3WF9A 4W9XA 2OBJA 2PVLA 4NKAA 5FP5A 2DS1A 2CNQA 2BR1A 3PP1A 3O2MA 3TUBA 3IW6A 2ZDTA 3EL8A 3RK7A 3RPRA 2FSOX 3P7AA 3QRUA 1J91A 4HYIA 5DRBA 5HLPA 3WILA 3ZS5A 3UMWA 4XLIA 4U3YA 2W1EA 3H4JA 4DCEA 3OFMA 1BI7A 3QHRA 3VHKA 2BILB 3PJCA 5AP7A 3TNHA 3BYSA 5FRIA 2C30A 5AAFA 3BPRA 2PZIA 3H9RA 4GUEA 4X3FB 5D12A 5ANGA 4GVAA 4BF2A 3BLHA 2LGCA 4UBAA 1W84A 3UOHA 4FT5A 3WIKA 3CQEA 5B2LA 3TT0A 5J7HA 3MVHA 4R78A 3ORPA 5LQFA 3PWYA 3UG2A 1YXSA 4E6CA 3F9NA 5CU4A 4ANSA 4MH7A 4EH8A 4YTCA 5AWMA 4WHZA 2ZB0A 4DGNA 5JFSA 3EKKA 2QO9A 2JD5A 4IAKA 4LGGA 2VWZA 1J3HA 3MV5A 4J71A 2BDWA 1MQ4A 1P4FA 4DE4A 4D5HA 3VUIA 3ZO1A 4GUBA 2VZ6A 5EYCA 2QVSE 3O23A 4YLKA 4QTCA 1XHAA 3DLSA 5CVHA 3HP2A 2QR8A 5HNIX 4IZ5A 3MBLA 4C38A 3N4VA 4NTSA 4EBVA 2I0YA 4E4MA 5EW3A 5IDPA 3BGZA 4FV2A 4CSVA 2W9ZB 4UY9A 4X3JA 5CU6A 2F9GA 2HENA 4X6RA 2XRWA 3MDYA 2C5YA 4YJOA 3UP2A 4ZTNA 4RA4A 1JAMA 5BYYA 3S0OA 2JKOA 3UPXA 5A4TA 4I6QA 5HVYA 3VUKA 5IMEA 4FKSA 4MXYA 4F70A 5HE0A 3DKCA 4MAOA 5CVFA 4X3FC 3FHIA 3WIGA 3VJOA 1PYEA 4KINA 3HP5A 4ACHA 4M3QA 5IH5A 3RM6A 5HVKA 2IZUA 4MBIA 2WTKC 1L8TA 1WCCA 2OKRA 2VTJA 5ANIA 5IUIA 4FG9A 3EYGA 3F3TA 3OD6X 3UYSA 3R8PA 2R7IA 3HZTA 3LM5A 5AP0A 2PSQA 1UNLA 2ETKA 3AMAA 1GNGA 4S30A 1UA2A 1WBOA 2C0TA 4NJ3A 3MESA 5K5NA 1XWSA 4FIGA 3P4KA 4Y8DA 3W2SA 2XKEA 4FIJA 5T3QA 3OZ6A 4PMPA 4XOYA 3TNPC 3KXMA 5F94A 3V6SA 5CF6A 3HA6A 4ZJJA 4HVGA 3G15A 2XEZA 4PV0A 2J0LA 4XP2A 1O6LA 3CJFA 3L8PA 3A8XA 1OMWA 3HEGA 2UZLA 1Q8YA 3UVPA 4NCTC 5JFXA 4XV9A 3R8UA 5M4FA 5AP2A 2X4FA 2IO6A 1B6CB 4XCUA 3TV7A 4DAWA 5EW9A 2PE2A 2C0IA 1G8AA 3NVMB 3W2QA 4I21A 3O51A 4IX4A 4M8TA 3AD6A 3NX8A 5DFPA 5KMIA 3COIA 3FLQA 3I0QA 5AP1A 2A27A 3UVQA 4I93A 4YTFA 2XIXA 3Q9YA 4BWKA 4YU2A 4S2ZA 2QD9A 3GCPA 3DT1A 4CGAA 2PUUA 5EM5A 1SVHA 3DU8A 3GGFA 4BCJA 2YABA 4CTBA 3IO7A 4BHNA 4Z55A 4XV2A 3TTJA 3BCEA 1VJYA 5J5SA 5EI8A 5HESA 4BFMA 3V8TA 2I0EA 3VS7A 4RWKA 4H36A 4BWXA 3U55A 2CGWA 3QCSA 2GNFA 4CFMA 3QX4A 4DFNA 2VTNA 2W9FB 2XIZA 2HW7A 2W0JA 5AIKA 1YVJA 4KA3A 4ENYA 2Z8CA 3NW6A 1XH4A 4FZ7A 4FSUA 3HDNA 5JRSA 4FUYA 4ALVA 5LVOA 1U59A 3DJ5A 5HU3A 5L2QA 4EOSA 5JQ8A 3BU6A 5K5XA 5HCZA 4GVJA 1FMKA 4TYIA 2XK6A 3PA5A 4QYEA 2ONLA 3G5DA 2F57A 2JBOA 4G6OA 4LFIA 5JQ5A 1K2PA 1KE7A 4GIIA 5HO7A 4ACDA 4U97A 3Q2MA 3HNGA 5AM7A 4FTOA 1H01A 2WTVA 3PZHA 3HMNA 4GT4A 2Z7LA 2NRYA 5AP5A 1Q8TA 2YFXA 3QTIA 3VUHA 3ULZA 4CFVA 5DH3A 4U42A 3QLGA 2VGOA 2EB3A 2Z02A 1H07A 5DHJA 4C2WA 3KFAA 1ZRZA 2RL5A 4Q2AA 4BCIA 4CXAA 2VWIA 2VRXA 5DPVA 4H3PA 3QHWA 5KMOA 3I5NA 4IIRA 5BVWA 4ZTHA 2WMXA 3HAVA 5CTPA 4KRCA 2EXEA 3EN4A 4FIIA 2P2IA 1R1WA 3CIKA 3EB0A 3HGKA 4A06A 4O84A 4EK6A 2ZOQA 5H8GA 1MRUA 2PK9A 3PE1A 1XKKA 5KUPA 2X81A 3OY1A 4E5WA 5CALA 2YCSA 4I23A 4BGGA 2X8EA 4JDKA 3ZDUA 4FZAB 3LCSA 4FICA 3NYXA 4FE2A 1F5QA 2PMLX 5BPYA 4JDHA 4ZY6A 3TCPA 4F4PA 2IW6A 2X7GA 3KGAA 3WF7A 3FZOA 1X8BA 4Z3VA 4JT3A 3EH9A 4IX3A 2AC3A 3ENHA 5CXHA 2C3IB 4PNIA 2WZJA 4FT3A 5AIRA 5DA3A 5EYMA 5KMLA 3D2KA 3F2RA 4FEUA 3QU0A 4K6ZA 2NNWB 4BDGA 5LJJA 2OO8X 4YJSA 3IW8A 5A3XA 3C4WA 4EHVA 3GU4A 4TYEA 1ZMVA 5E1EA 5FBNC 3WZDA 4CLJA 1FGIA 3FYJX 3O8PA 2EWAA 2WMAA 3ORMA 4FTJA 4JS8A 1W0XC 2Z7SA 3P08A 5E8XA 4MX9A 2BRNA 4XG6A 2BHHA 2QOQA 4ZS0A 5DN3A 2QC6A 4WA9A 4O0XA 3CQWA 4D2WA 3D94A 5C8MA 3PRFA 2XK7A 2B52A 1SMHA 2XA4A 1QMZA 3FJQE 3PSBA 4QOXA 4U6RA 5KHXA 2OJ9A 4QP1A 4K77A 3LLAA 1YOLA 3LJ1A 2IZTA 4D5KA 3PE2A 1REJA 1LR4A 2X9EA 5I3RA 1DS5A 2R3OA 2V5QA 3F69A 3E7OA 4YZNA 3DXPA 3RZFA 4C4GA 3W32A 2ITWA 4UZHA 3KN5A 5EHOA 3PXQA 2YZLA 3QCYA 4H3QA 4OR5A 5D41A 3DAJA 2C0OA 4CMTA 4EQUA 2R3RA 2GFCA 3HRFA 4DEEA 4L3JA 5IG1A 2XMYA 3QC4A 3QTWA 3TKHA 4RGJA 5FG8A 4ZXTA 4MVFA 3LJ0A 1M2RA 2O3PA 3MB7A 1URWA 3QQFA 4PPAA 3UE4A 3QCXA 4LM5A 1P2AA 2C47A 2WQOA 4FIHA 4ZSJA 5FXSA 3ZSGA 4AUAA 4IMYA 3KN6A 3HRCA 4F0GA 4FKPA 3E93A 2NO3A 2EXCX 3CR0A 1YXXA 1KWPA 3BEAA 4I1ZA 4AN2A 2IVUA 3KC3A 4O96A 2GQSA 3R21A 4BB4A 2A2AA 3QFVA 3WE4A 3VRZA 3CPBA 4RZVA 2CKQA 3DTWA 4QQ5A 5GZ8A 3QRKA 1WAKA 3BYVA 3NNVA 4BZOA 1KE5A 2BZIB 1P5EA 4CFNA 3I6WA 4D2VA 4ACCA 5D7AA 2EUFB 2XKDA 3BYMA 3VW8A 4JJRA 3MH1A 4CMUA 4DGOA 3LQ5A 4FV8A 4TN6A 4J7BA 4AGDA 3VQUA 1DM2A 1R78A 4BIEA 4GK4A 2YLEA 5HIBA 4AT4A 4DC2A 1WFCA 3IKAA 2JDOA 4LV8A 2ERZE 2GQRA 4RVKA 3FI2A 1XQZA 3R9NA 4BI1A 4XV3A 2RSVA 4FEQA 3ZFYA 1XH8A 2JIIA 3QD3A 3BBWA 2VTAA 3GNIB 1UU9A 3OF0A 4EOKA 4QMSA 3LE6A 4XHKB 2DUVA 2IW9A 4WNOA 4AA0A 1YHVA 1R0PA 4JVGA 3KMUA 3FV8A 3GI3A 4QPMA 1VYWA 4DFZE 5IQDA 4YGAA 4DGMA 2YJRA 4IVCA 3OC1A 3RAHA 2CGXA 4F1TA 3QLFA 2W4OA 3R02A 4P2KA 4Y46A 3GFWA 4QP7A 2X6DA 4OW8A 3Q5ZA 3DS6A 4ZSGA 5TF9A 4YC3A 4FKOA 3SA0A 2ZM4A 2X4ZA 3MH0A 2GS7A 1OPKA 3MTFA 4XYFA 2JDRA 3VJNA 4BDKA 3PJ2A 4OBPA 5C26A 2BFYA 3KXGA 1FVRA 3D4QA 4RIYA 5FUTA 3WZKA 4J96A 2PWLA 4LGDA 2XNEA 1FBNA 4FTRA 3PPKA 5EHLA 3P0MA 1H0VA 4RFZA 2BIYA 2FA2A 1UV5A 5E7RA 2G15A 4EH7A 3L9MA 4DF3A 3DJ7A 3PTGA 2XB7A 3VW6A 4M66A 3KL8A 3PXZA 5AV3A 4FF8A 1JVPP 3VS1A 1AGWA 3O50A 4R1YA 1J7IA 4NYEA 4ANOA 5CWZA 1UWJA 5J9LA 5GZ9A 5M08A 4XP3A 2F4JA 3CCNA 4U45A 3O8TA 4RX5A 4FSWA 4IADA 1SYKA 4O0WA 2XM9A 4I3ZA 5HIDA 4BDHA 5LOHA 1SM2A 3H9FA 2PMOX 4ZAUA 3MVLA 5IA0A 4EJNA 2UVYA 2ITNA 3L9PA 5FEDA 2YJSA 3MY0A 4FZFB 2BKZA 3EKNA 3OHTA 4JIAA 4X2GA 3RAIA 2ZVAA 4AA5A 3R9DA 4BDDA 3FKOA 1UWHA 3GU6A 2R3KA 3AD4A 1JPAA 4R3RA 4YZCA 2OU7A 1PYXA 2OZOA 3P86A 5HG8A 4RJ6A 1YKRA 4U9AA 4QTAA 1W98A 2XK4A 3FL4A 4PL4A 3ZUVA 4DH7A 1V1KA 3QRTA 3R2YA 1STCE 3EL7A 2YCRA 2UW3A 4QPSA 4XBRA 5HTCA 1SZMA 1APME 2BALA 5CYIA 3C50A 4ZMFA 4OBOA 3SW4A 4N6ZA 3G2FA 3ZUTA 3QGWA 2F7EE 2YDJA 4C34A 4I0SA 1PXMA 4DFXE 2ZV7A 4LV5A 5T68A 4UN0C 3FLSA 4F7SA 4ID7A 5L6PA 1GY3A 5AX9A 4L46A 2GFSA 2V7AA 5JT2A 5JH6A 3DKGA 4EH9A 2PVKA 3F5GA 4F6WA 4X2NA 5EG3A 2CKOA 4E7WA 3C4EA 5AJQA 1Y91A 3OTUA 4CKIA 4L6QA 4W4WA 4C4EA 3E3PA 4WBOA 4HVSA 1H8FA 3HA8A 5CT7A 3RPVA 4GJ2A 2VWYA 1Y57A 2VTSA 4IW0A 4LRMA 3Q4UA 4M14A 4G5PA 2UZUE 4QO9A 4IB3A 5E8SA 3HV7A 2C5XA 5IUGA 3U4WA 3D5VA 4KSQA 1FGKA 4NW6A 5I9WA 4A9TA 3O71A 3U8WA 2BCJA 5EKOA 5DVRA 5EQPA 5CX9A 2QHMA 3LAUA 2OW3A 2R9SA 5CSVA 5FD2A 4RVLA 2CNVA 1BLXA 3NGAA 4O91A 3ROYA 4W9WA 4A07A 3OW3A 2PUNA 4IB5A 4LOOA 3VS5A 3FY0A 3EFKA 4XG8A 4PF4A 2C6MA 2UVZA 4YBKA 3NUPA 3RCDA 4KNBA 4NCTA 2VTPA 4E20A 2ZJWA 3PWDA 1IG1A 3ULIA 4FKUA 1JOWB 2I6LA 3RPYA 1Y6AA 4E4LA 3BHUA 4O7NA 3SV0A 4YZBA 4LG4A 4UXLA 1E9HA 1GZ8A 3R01A 4HCVA 4C4HA 3UPZA 4G5JA 2PHKA 4K1BA 3ZC5A 2W05A 2QODA 3ZU7A 5GIOE 1G5SA 3DY7A 4BRXA 2WD1A 2G9XA 2GPHA 1PY5A 4L45A 4FTKA 3E92A 2WGJA 3MIYA 4GFGA 5ANDA 5AA8A 5GINE 4HCTA 3ZM9A 1I09A 3TEIA 4IWPA 3TL8A 3KCFA 3U9CA 4F65A 5FQDC 3AXWA 4DTAA 2BTRA 4DHFA 2W5HA 2B9IA 3ZO3A 5KNJA 2Z2WA 3OTVA 3RNYA 3H10A 5AP3A 2WEVA 2QNJA 4P5QA 1OL2A 4YUQA 4NT4A 3E64A 5LVLA 3JXWA 4XMOA 2CPKE 5KZ0A 3SGCA 1YRPA 2WU6A 4L9IA 2QO7A 4EKLA 3QZFA 4YJRA 5ANOA 4CZUA 4EK4A 5J1VA 1P4OA 3SX9A 1GZNA 1PXKA 3CJGA 3F3UA 2IVVA 4HJOA 5FXRA 4E6AA 3UC4A 3G6HA 5CF8A 3R9OA 1LUFA 3FMNA 5DT4A 1NA7A 4EUTA 4O0UA 3PFQA 3ATTA 4HYSA 2XF0A 3G90X 3REPA 3FZTA 2JAMA 3KEXA 4GIHA 3LM0A 2XEYA 4I5CA 5K4IA 3SAYA 2GNHA 3UIBA 3ZHPC 1OKZA 4O7VA 2HK5A 3PIZA 4BDIA 4BGHA 2F2UA 3Q04A 3WOWA 3WZJA 5C8KA 4G31A 1YOMA 3D0EA 5BNJA 4NL0A 2I1MA 3UQCA 4NUSA 2RGPA 3RP9A 5HX6A 4BCNA 2P4IA 5K3YA 3ZC6A 3VS6A 3V5JA 3EWHA 4G9CA 4KABA 5HG7A 3MY5A 2OIQA 3TIYA 3LQ8A 3UC3A 3OWJA 4BL1A 5M07A 3NWWA 4J99A 4EWQA 4IH8A 1Q8ZA 3FLYA 2W1DA 2YACA 4HNFA 2HXQA 5DT0A 4D2PA 1U5RA 3NDMA 2ZB1A 4UEUA 3GQIA 3PVBA 4MBLA 5FP6A 2HZ0A 3E62A 2ZM3A 3VVHA 2VAGA 4BCQA 3SXSA 5I9YA 3I1AA 3GCUA 5HIEA 4MF0A 4WSQA 2XH5A 3LXLA 3BHHA 3WZEA 3IDCA 3DLZA
chains in the Genus database with same CATH superfamily
1OKWA 4FA2A 2J6MA 3ID6C 3HV4A 3BU3A 3LMIA 1MRVA 3SXRA 3KRLA 2VV9A 4FKGA 3V01A 3R1YA 5M4UA 1CKPA 2R3GA 2B55A 4L44A 2PVJA 3DB8A 4DTKA 3TMOA 2X2LA 5GZAA 4QP8A 1H0WA 2VUWA 3R7UA 1OPJA 3P1AA 2C5VA 5E92A 3IQ7A 2PU8A 2B9FA 3FQSA 3N4TA 3D5UA 5AUZA 4B9DA 4RIYB 2WQMA 1I44A 4O7SA 4IVAA 4IWQA 2LAVA 4PPBA 4N4SA 4FR4A 3EQPA 4TPTA 3UOKA 2BHEA 3C4CA 4RRVA 4WOVA 1LEZA 4C3PA 4Y83A 4F09A 4I92A 5CEPA 3TTIA 4GFMA 5BVFA 2W5AA 2BAKA 2CCHA 1MQBA 3QALE 4FV3A 2YIRA 2J0IA 2JEDA 3KKVA 1URCA 4OLIA 5EI2A 5BVKA 4XNEA 1XBCA 4IAAA 2OH4A 5A4LA 4E73A 2F7XE 1SVGA 1P14A 4C4JA 3SC1A 4DDIA 1FVTA 4JX3A 4IC8A 4YJVA 5I9XA 4Y5QA 3RNIA 4JG8A 4FK6A 4QMMA 3CGOA 4OBQA 4I22A 1ST4A 3TJCA 4CZTA 3Q32A 2QI8A 3TACA 4AZVA 2J0JA 3NYVA 4USDA 4IFCA 2XCHA 5CQWA 2OK1A 3WARA 3ZSHA 4IAFA 1H00A 3P23A 4O1OA 5HD4A 3QQLA 4EOJA 3NAYA 4Q5EA 5HE1A 2YCQA 1BUHA 3DK6A 2J51A 2E9UA 4RA5A 4IX5A 4BTJA 4FTNA 3FXWA 3SHEA 3VWAA 4QMQA 4C0TA 3KREA 2YM5A 3PVUA 4GCJA 3R7IA 1Q41A 5ACBC 1JNKA 3DB6A 5CI6A 3DBCA 1KOBA 3DDQA 1H1PA 4OT5A 2QOIA 4BCMA 4AW0A 4ASXA 4O81A 5AV1A 5IA1A 3AC5A 3FPMA 4C7TA 2VWBA 2XVDA 4XRLA 5C03A 3NUAA 3R7YA 4U7ZA 4TRLA 2X7OA 4I24A 3COKA 4LGHA 2G01A 2VWXA 3OXIA 4I5PA 5CSHA 2RKUA 4TWPA 4R8QA 4XG7A 4D9TA 4EOMA 4YZ9A 4YPSA 5CSPA 2HY81 3UO5A 3N9XA 2XIKA 4MF1A 2C5OA 2WMVA 3IDBA 3PJ8A 1SVEA 4OTDA 4ANNA 5HHWA 4EHEA 3AOXA 3GP0A 3UTOA 3MI9A 2NRUA 2QOFA 3E3BX 2WMSA 1M52A 1YI6A 1BKXA 5DMZA 3HUBA 3ORKA 4RZWA 3GENA 4FKJA 2OFUA 4O0SA 5AUYA 2WTKB 5EYKA 5A6NA 4TYGA 4F99A 5EDPA 4A4OA 1LPUA 2G1TA 2WIPA 3MYGA 4UYNA 4X2FA 4BCHA 3ZO4A 2BFXA 1QPCA 2YCFA 4R5YA 4UMQA 2W1GA 4F9WA 4H1MA 3F3VA 4AQKA 4RIOA 2XYNA 2WELA 3PJ1A 4FTLA 3QQJA 2GQGA 2W06A 3L1SA 2R64A 5JSMA 4IJPA 3WBLA 2W1HA 2X9FA 3S2PA 4AG8A 3I81A 4H05A 1YHSA 3ZYAA 4DYMA 4E3CA 2CGUA 2XM8A 3R30A 4JOAA 3T9TA 4LDTA 4HYUA 3CBLA 1PMEA 4J97A 4GU9A 3U9NA 4MXAA 4DINA 2J5FA 1XMMA 4L52A 4QDVA 2JKQA 3OXZA 4ERWA 3V6RA 2JLDA 2WPAA 3CP9A 2XNBA 2JGZA 5DE2A 3EFLA 4ANLA 4ASEA 4ASZA 5EFQA 3R1SA 4DDGA 3Q60A 4LRJA 2GDOA 4OT6A 1F0QA 4OTGA 3K3JA 4E8AA 5EYDA 3DK3A 4IB0A 4P90A 4JR7A 4NJDA 4ACMA 3I7CA 3UDBA 5ETAA 5HX8A 3C1XA 3BRBA 3AC1A 3NAXA 5HBEA 3M42A 3TNWA 4YP8A 3ZXZA 3ERKA 1NW1A 1TKIA 2QOCA 3JPVA 2JC6A 4DCAA 3O0GA 3RHXA 4U3ZA 4YC8A 4NM5A 4P4CA 5TKDA 3MH2A 4QMWA 4D4YA 5AV2A 5HNBA 2BUJA 2ITTA 4BYJA 3ZO2A 4RQKA 1H08A 3ZTXA 4O7WA 5CF4A 1WVXA 4HZRA 4Q9ZA 2ZV9A 4MNFA 4TWCA 4C35A 5D1JA 3DGKA 4XBUA 4DITA 4CFWA 3LXNA 3E7VA 1TQPA 3OVVA 3PXRA 3F5XA 4NSTA 4KRDA 3S95A 1IAJA 2CJMA 5M51A 4HPUE 4L53A 2ITYA 3C5IA 3OBJA 2FO0A 1M2QA 3MVMA 3BI6A 2J5EA 5T6KA 4DN5A 1G3NA 3COHA 4CZYB 3O96A 4Z7GA 4FSQA 3LJ2A 1Z5MA 5I0BA 2AQXA 2OJJA 4UX9A 2XBAA 5KKRC 1H1WA 3ELJA 3P5KA 3ROCA 2F7ZE 4RC3A 4AQCA 2YA9A 3ZRMA 4XLVA 3MSSA 4NIFA 4ZY5A 3VUTA 4EOOA 3R73A 5J9ZA 4MEDA 2X39A 3ZH8A 4PRJA 3ETAA 2Z60A 2VX3A 5ETIA 1PMVA 3TDWA 1T45A 4UV0A 3LFSA 1OITA 3WYXA 4ZY4A 4BY9E 3DZQA 3LCKA 4I6BA 1UKIA 4O4EA 3TI1A 4OTFA 4O2ZA 5DEWA 3W16A 3QA8A 4M0ZA 4PMSA 3SRVA 3FYKX 3S3IA 5IA2A 5EQEA 4XP0A 3BU5A 3EFWA 2WMQA 5AAEA 2YWVA 3EQBA 5J95A 3H0YA 4W4YA 3T8OA 4QNYA 1Y8GA 3VS3A 5KMJA 2HELA 2UW6A 4EYMA 3BL9A 4QMLA 5ANJA 4MD9E 1OBGA 4E5AX 2JKKA 3PG1A 2FUMA 3P78A 4APCA 4MD7E 2BAQA 4GS6A 4KBCA 5B7VA 3UNKA 5AR3A 3V51A 3ZLSA 4AGWA 4UYAA 3FZSA 4WNKA 4QYFA 5DBXA 5IQEA 4U8ZA 3A60A 4RJ3A 4MHAA 4A9SA 5JFWA 4GMYA 4NEUA 5G1XA 3W0RA 1TQMA 3QF9A 3UO4A 5B0XA 5HLWA 2QR7A 3R1QA 4NM7A 4X2JA 2PVHA 3POOA 5BVNA 5FGKA 5EOBA 1JQHA 3LZBA 3GB2A 3K3IA 3CQUA 5HI2A 4BTMA 3Q9XA 4BZNA 2BPMA 1DI9A 5CT0A 4FNZA 4ZTLA 4FX3A 1Q8UA 3AGLA 3QC9A 3DBEA 1K9AA 2C3JA 5BUEA 4QD6A 5AUTA 4N0SA 4FTQA 4IBMA 1PXOA 4YLJA 4WD5A 1QCFA 5GNKA 4LYNA 5CNNA 5GJGA 3CKXA 3RAKA 3AKJA 3NVKI 5IZFA 4Y85A 2X8IA 3EMGA 3QQKA 3IW7A 1W8CA 4ZMEA 2VGPA 3KK8A 2FYSA 4R3CA 2HAKA 4O22A 4R5SA 4DEIA 5IH4A 4R1VA 5K9IA 4F9BA 1CDKA 2W5BA 3SKCA 4EBWA 4AGCA 4L42A 2I0VA 4DH8A 5CAOA 5AUVA 4EH3A 3PZEA 2R3PA 3ENMA 4FGBA 1UNGA 1PXPA 1ZYCA 2DYLA 4I0RA 4EH2A 2XNOA 4ZLOA 1GIHA 3C0IA 2GS2A 2GNLA 4RIWA 2WMBA 4FG7A 1KSWA 3HMOA 2PZYA 3DQXA 4OGRA 2IVSA 2XIYA 4YJTA 1PXLA 2OFVA 3NUXA 4ANMA 4BDAA 3HV3A 3BWJA 4CMOA 4BDEA 2ITXA 2JFMA 3QAME 4NM0A 4GSBA 3D5XA 1OZ1A 3CS9A 3M1SA 4NK9A 5E90A 4AFJA 4CCUA 3OG7A 1VZOA 5DRDA 2GHGA 2HCKA 2XYUA 3Q4CA 4V0GA 5TR6A 3NUYA 2C4GA 2ETMA 4YHJA 3JR1A 1MRYA 4LI5A 2C69A 3AT4A 3IK3A 5FLFA 3TJDA 4DEAA 4F78A 3W2CA 4N57A 4QP9A 5AR7A 3VBTA 1CKIA 4I4EA 2WKMA 1O6KA 2HYYA 3FMEA 3D9VA 1OL6A 3MPMA 4QTBA 3OOMA 3BLAA 5FM3A 4H39A 4WO5A 4J8NA 2E9VA 4YNEA 2C6OA 2W1CA 2BIKB 4RSSA 4EONA 2QLQA 5HICA 2VTTA 3RJCA 4ZTRA 2QG5A 3V8SA 4BDFA 2QURA 3NNXA 4NWMA 4YTIA 4UMTA 4IM3A 2YM8A 1ST0A 2R5TA 3AMBA 3TZMA 3UQFA 3EQGA 4JAJA 1OL7A 1ZOGA 1PW2A 2WMTA 4JBPA 2YISA 4O0RA 4TW9A 2CLQA 4IWOA 5IPJA 3JY9A 3OCBA 3DDPA 4YZMA 3RKBA 5HBJA 2YITA 5FEEA 4G17A 5CNOA 3MS9A 2R3HA 3L8SA 3IDPA 3VAPA 3CSVA 3POZA 1FMOE 1MUOA 5FBOA 2J4ZA 3CGFA 4F9YA 4L7FA 3ODYX 4G16A 3ZZWA 4BZDA 1DAWA 1G8JA 4O6LA 4F7NA 4O4FA 5EM7A 4TWNA 2C6LA 4S32A 5LMBA 4CD0A 2ZMDA 2FSMX 4FSNA 4JQ7A 5K0KA 5JZJA 5EQYA 4CRLA 3WF8A 2VN9A 4PDYA 1CTPE 2YIQA 3BHVA 3AKKA 3H9OA 4FZ6A 3QQUA 3Q3BA 3BHYA 2CHLA 1OGYA 3KB7A 3R00A 4I6LA 3F6XA 1PJKA 3NR9A 3PJ3A 3QZGA 3RM7A 4IXPA 4ALWA 4FKLA 4B7TA 4MNEA 3R83A 4O0YA 2JKMA 4DFBA 4BCFA 3K5UA 1JKLA 1JBPE 3LPBA 3ZLWA 2UZOA 2E9OA 1WBPA 2R3LA 4JG6A 5FXQA 3K5VA 3RI1A 1Q4LA 5J9YA 5EHYA 4USEA 1FOTA 1OL1A 2ACXA 3B8RA 3LFQA 4YPDA 3VF9A 3GCSA 5TE0A 2CGVA 3ALNA 4GT5A 4GW8A 4IAIA 3I4BA 3S4QA 5I4NA 3ZDIA 2H8HA 1J7UA 2BROA 4I41A 5IH6A 3KF4A 4M15A 3F2AA 4C02A 4BCOA 1OGUA 3LOKA 1OIQA 5J5TA 2CN8A 3PUFC 1YI3A 3EOCA 5J8IA 3V8WA 3FC2A 4E6QA 4DEHA 2PUIA 1XH6A 1ZY5A 4APPA 3FEGA 3E8CA 3HYHA 2WTCA 2XNNA 2YDKA 3VULA 1ZWSA 3SQQA 4IAZA 4QYYA 4FTMA 4DH3A 5AR8A 3HRBA 5IQCA 1ZZLA 3LFCA 1WMKA 2ZV2A 1O9UA 3UZPA 3II5A 4BN1A 3A61A 1DI8A 2PPQA 3C5UA 4JIKA 3CKWA 1IR3A 3EQDA 4MXCA 4NIFB 4YHFA 3GC0A 5HG5A 4OAUC 2CSNA 3PG3A 2VNWA 4D4VA 1OIYA 3F3ZA 3UIMA 4EH5A 2UZTA 3KXZA 3PLAE 2NPQA 5KHWA 4QPAA 2AUHA 2O5KA 1B38A 1WVWA 4CFXA 3HVCA 3MW1A 3BIZA 3F61A 3RPOA 5LVPA 4DT8A 2R7BA 5AP4A 3C9WA 3RBWA 3SRVB 5M4IA 5DEYA 1OUYA 3FY2A 4UMRA 1XBAA 4HOKA 4D0XA 2W4KA 5HE3A 5GHVA 4YTHA 3UDTA 4GG5A 2ZMCA 4A4LA 1IA9A 1PMUA 1KUTA 3OY3A 2RIOA 3PSCA 1H25A 4GFOA 1YDRE 5IA4A 1K3AA 4TZRA 4G3GA 4G3CA 4NM3A 5JK3A 3LFBA 2PMNX 4LL0A 1VEBA 2IG7A 4RWIA 3PYYA 5HQ0A 3OS3A 4LRKA 3SXFA 2RF9A 1OVEA 1WBWA 4JX7A 2O63A 3PPZA 4KIPA 4M68A 1JSVA 3OCGA 1YXTA 3F7WA 3ORZA 4DH1A 2GNGA 4HPTE 4A9YA 4DFUA 3S1HA 4GG7A 4MXZA 4JG7A 4UWCA 4L67A 3WE8A 5LVMA 3D7ZA 5HCXA 5IEXA 3FQEA 2QQ7A 5DNRA 3D15A 2UV2A 4EKKA 4YJPA 4A4XA 4UWBA 3GU7A 1OKVA 3NW7A 4YNOA 4CKRA 3NUUA 1HCKA 4L01A 4ANQA 3BELA 2C68A 4LL5A 3RINA 4PTEA 2A1AB 1J1BA 2BVAA 4RFMA 4ASDA 3W1FA 4C36A 3GOPA 4FV9A 3D7TA 5I9UA 3LFEA 4FSRA 4ENXA 4O7ZA 3PA4A 1FQ1B 2W1ZA 1VR2A 2VU3A 4FNYA 4FSZA 5FTOA 3VUMA 3E87A 4CEGA 1A9UA 2C3KA 3F3WA 4XG9A 3MWUA 4J52A 4EOQA 2QOKA 4WG5A 3KQ7A 4L3LA 2UW0A 3I6UA 3JVSA 3RMFA 3NPCA 4RT7A 3IOKA 4AGUA 2WMWA 3RTPA 4AT3A 2FB8A 1ZYDA 3FAAA 2PVFA 4JXFA 3QBNA 4MQ1A 4QP6A 3LFAA 3W8LA 4EUUA 1YWVA 4YO6A 5LCJA 5LVNA 4K11A 4BKYA 5EM6A 4UMPA 2VTLA 2X1NA 3R7GA 4RIWB 4FTUA 4EQCA 1REKA 3BEGA 4O0VA 5M44A 2XK9A 3PXYA 3QTSA 5E8YA 3D2IA 1VYZA 3ZZEA 4C2VA 3IOPA 3FZPA 4WNMA 4RC4A 1KE6A 1M17A 4ARKA 3EQRA 4DBNA 2Y9QA 1YDSE 4FNWA 1XBBA 2FGIA 2EB2A 2RFNA 5DR9A 5IQIA 4FMQA 2WIHA 5J87A 5CF5A 4MWHA 3Q52A 4FYNA 1YOJA 4IFGA 4V0GB 4XJ0A 3FLNC 4ZOGA 4C3FA 4KKGA 5L8LA 3B2TA 4FC0A 4UWYA 5F1ZA 4GEOA 3W8QA 4GKIA 1BI8A 3SD0A 4WBBB 4EQMA 4BWPA 1PXNA 3DBFA 2FVDA 3UMXA 2Y7JA 1RDQE 2O8YA 3MH3A 4BDCA 1Q3DA 4DG3E 4ZJVA 5BVDA 5AR5A 5IU2A 4QP2A 3AC2A 5IQHA 4CVAA 3MY1A 4J95A 1YI4A 4AXEA 3L9LA 4AZTA 4YJNA 2XNPA 2OZAA 3P79A 3W55A 1MP8A 5ETCA 3F2NA 3ATSA 4YURA 3GC9A 3Q53A 1KE8A 4FYOA 2Y4PA 4BGQA 5AUUA 4QTEA 4KBKA 2VD5A 2CLXA 3KRWA 2I7QA 4YHTA 4ITJA 5CSXA 2B9HA 3C4XA 2C5NA 3UNJA 4IC7A 2W7XA 5C9CA 3N51A 3FXZA 3PP0A 4M67A 3BYOA 4NH1A 4O38A 2R3FA 4Y72A 5H8BA 3R8LA 4XOZA 3LXPA 4D2SA 4EH4A 3UNZA 5D7VA 5CANA 3VS0A 4JL9A 4I6HA 4ZJIA 1OBDA 4PTGA 1V0PA 4OTIA 5HGIA 3W0PA 3R7VA 4Z7HA 5KMKA 3PIYA 4R7IA 3RPSA 4M69A 2B7AA 3NIZA 3FPQA 2H6DA 2PTKA 3QUEA 2NYAA 3OCSA 5CAVA 5CY3A 3FDNA 3C13A 2GTMA 4S33A 1ZYJA 2WB8A 2XK8A 1S9JA 3LIJA 3KRRA 2WU7A 5L8JA 3QUDA 4BYIA 4EHGA 5L2SA 2UW8A 1JKSA 5LMKC 3PUPA 2BKKA 3G0FA 4PUZA 3ML1A 4BTKA 4N6YA 4S31A 2GHLA 5EDRA 3ORNA 4FGRA 2GHMA 4BDBA 5JRQA 3T3VA 4ZEGA 3PA3A 5A4QA 1JSTA 5CEMA 1UKHA 5I9ZA 5K4JA 4MNEB 4AAAA 2UZBA 4JBVA 4MQ2A 3HMPA 5JMSA 3MPTA 1CM8A 1Q99A 2OJFE 5IQAA 5FTGA 4X2KA 2ITQA 3K2LA 4KKEA 3DK7A 3BX5A 3Q6UA 3E5AA 4TYHA 3R2BA 2YDIA 5A9UA 3FMHA 4FL2A 4QMYA 4Y73A 2XRUA 3CD8A 3DCVA 4I5HA 4M12A 3LHJA 3QRIA 3U87A 4UALA 2XKCA 5AEPA 4LQMA 5AV0A 3Q5IA 4CT2A 2OSCA 3BE2A 5BX0A 3IW4A 3R9HA 1E1VA 5IA3A 2PE0A 3Q9ZA 4PL3A 5HOAA 2YZAA 3UIXA 3AD5A 4FEXA 3SG8A 3VQHA 3TIZA 3KRXA 2CKEA 3L9NA 2H34A 1OUKA 4F63A 3FSFA 3V3VA 4FOCA 4CT1A 2GSFA 5B2KA 4O7RA 4FSYA 2QU6A 4QRCA 5JFVA 5KX8A 3IS5A 4TY1A 3UZRA 2W96B 3BYUA 4PTCA 1Q97A 4RMZA 3ZFXA 3W0MA 5IKWA 1Y6BA 5BYLA 3BZ3A 3NZ0A 5IUHA 4GRBA 3ZONA 4K33A 4F9AA 4L7SA 3LCOA 4Q9SA 4WG4A 4HW7A 5DI1A 3UODA 4FEVA 3NCZA 2YWPA 5KE0A 2VTOA 4FL3A 5HCYA 4K9YA 4LMNA 4J53A 4X7QA 4YBJA 4DGLC 2AYPA 1M7QA 2B9JA 4QNAA 3G6GA 3I7BA 4KIOA 2R0UA 2UZDA 3NYNA 1PXIA 4FI1A 4TTHB 2GNJA 5CZIA 3DAEA 5JZNA 2R3MA 2PVYA 4NFMA 5E8ZA 2E9NA 3IECA 3UQGA 4AN9A 3AGMA 2YLFA 4H58A 1YWNA 3V5PA 5EI6A 3RCJA 5CAUA 4RJ7A 4XEYA 4UB7A 1ZMUA 4B99A 4BKJA 5E8VA 3WI6A 4F1MA 4DA5A 3DBQA 1L3RE 2YIYA 5C27A 4LOPA 5BMSA 5ITAA 2Q0NA 3HECA 4KS7A 3FMLA 4BHZA 2YEXA 3WYYA 5IQFA 3G9LX 1W2DA 3GQLA 2Y4IC 1XH9A 3K54A 3AMYA 4FSMA 3RK9A 4E6DA 4GYIA 4TXCA 4DEGA 4IB1A 5BYZA 4C4FA 5HO6A 3QA0A 4J8MA 3MGYA 4EZ5A 2E9PA 3F7ZA 5F9EA 3DV3A 4QMXA 3NMUF 1BMKA 1NY3A 3I5ZA 4FKRA 5DG5A 1BL7A 4GU6A 3W33A 2Q83A 4XS2A 4O27B 5CLPA 3OEZA 5D9HA 2BRGA 4A9RA 3ITZA 2UW9A 3BV2A 5CU2A 5IDNA 3G9NA 3P7BA 3LKMA 2OLCA 1PXJA 3D7TB 2WTWA 5HZNA 4W4VA 3ZEWA 3MB6A 4N70A 3IPHA 1GIJA 4G2FA 1ZLTA 2OXYA 3TZ9A 3QTRA 4FT0A 3R8VA 3UOJA 5E8TA 2X0QA 3LQ3A 1R3CA 3BGQA 3PY3A 3OCTA 4I20A 4GK3A 3QKLA 1OECA 1Z9XA 3H3CA 3HUCA 2CMWA 1M14A 3EYHA 4KKHA 3FC1X 3N4UA 3KVWA 4C33A 4U44A 3U6IA 5AFVA 1R39A 3WF5A 4C37A 3VRYA 4EK3A 2PZRA 2P2HA 2X0PA 3AT2A 3QXPA 3HAMA 4LUDA 4QYHA 4FL1A 2EVAA 4XH6A 2X6EA 3DKFA 2ITVA 5GJFA 3A7FA 4I0TA 2YHVA 3R22A 4FNXA 4E93A 3AC8A 4KIQA 4PPCA 4AE6A 3MFRA 2BDJA 5A4CA 3A62A 3HL7A 4TL0A 4EH6A 2O0UA 3H30A 3E8EA 1B39A 2OXXA 3KRJA 5CS6A 4RG0A 4AF3A 2ZM1A 2VTQA 2BZJA 3F88A 2UVXA 3O7LD 4NW5A 4S34A 3ZOSA 4CCBA 3LMHA 3G0EA 3UDSA 4DT9A 3GT8A 4YJQA 5CAPA 1OKYA 4QP3A 4B6LA 2R4BA 4F9CA 4C8BA 2B4SB 4PY1A 4CFUA 4QMNA 2ETRA 3CTHA 4XG3A 3SDJA 5KKRB 4G3EA 5FTQA 4U43A 5C8NA 3EN7A 3LFDA 1PKGA 3CLYA 4DLIA 2IZSA 2PVNA 2OIBA 3R8ZA 2V55A 1CKJA 2OJGA 3MIAA 1ATPE 2RG5A 2V7OA 3P7CA 3IW5A 2V22A 2O2UA 4FTIA 4U40A 5FEQA 3KU2A 4RX9A 3Q2JA 2OZAB 2J2IB 3R28A 1Q5KA 4FV1A 4I5MA 5DT3A 3AG9A 1V0BA 3ZMMA 2PMIA 2C3LA 2C6IA 3QQHA 3SG9A 5IF1A 4O7YA 3C0HA 5A54A 4G6LA 4CNHA 2UZNA 1BYGA 3PXKA 4MWIA 4RQVA 3KMMA 5J79A 2QG7A 3QUPA 3KCKA 4JI9A 2XS0A 4IJ9A 2OG8A 1RE8A 4M84A 1OI9A 3ZRKA 4UMUA 2WMUA 4KIKA 3W2OA 3BQCA 5M06A 1YXVA 3W0SA 4QT1A 2XZSA 2C6DA 2WMRA 3UBDA 4QMPA 3QZHA 4AZEA 4IZAA 2J9MA 3V5QA 4QQJA 2WTIA 3HDMA 3BLRA 3ORIA 4FRFA 4D1SA 2VO0A 3CC6A 3FQHA 2P33A 2I40A 3W2PA 2UZWE 3MFTA 4M69B 5BUJA 2X2KA 2Y0AA 3MA6A 2SRCA 5DWRA 3T3UA 4FT7A 2XBJA 3PLSA 2BZKB 5LWNA 4X6QC 2Q0BA 4DEBA 3NRMA 4FV5A 3R6XA 2XNGA 4U5JA 1IAHA 1H1SA 4M97A 4QQTA 4ZTQA 2V0DA 2UUEA 2WAJA 3FMDA 5HKMA 5M4CA 3JVRA 2CCIA 3I60A 2ZFYA 1ZYLA 2XCKA 4JDIA 2WHBA 3PFYA 2QKRA 5KBRA 3DAKA 4U80A 2J7TA 3HV5A 4RC2A 3MJ1A 4BI0A 3A7HA 4AAYA 5L6OA 4IM0A 3O8UA 2QOLA 5CEIA 4BKZA 2X2MA 2CNUA 1ERKA 3TDVA 4HYHA 4YSJA 3EJ1A 1G8SA 3TUDA 2H9VA 3FZ1A 3UJGA 3OW4A 4BICA 2JBPA 4RX7A 5M55A 4BIBA 4FJVA 2BRHA 4TYHB 3DFAA 2R3JA 3U54A 4IHPA 2CDZA 3GXLA 4ZZMA 4IDVA 1FVVA 4AACA 4CYJA 4DTBA 3GFEA 1Z57A 3PIXA 1TQIA 2WXVA 4QYGA 4O1PA 4ALUA 1XR1A 3KXNA 1SNUA 1XJDA 5DGZA 3C4ZA 1JSUA 3EFJA 2QLUA 5EW8A 4RBLA 3T9IA 4EK5A 2J50A 1YHWA 4R7HA 2ITOA 3ZBXA 1PMNA 3PXFA 3LLTA 5HBHA 4WT6A 4EOLA 4MD8E 4F0IA 1GOLA 1T46A 3EN9A 4KWPA 3CY3A 3KA0A 4KAOA 4U41A 4EJ7A 3RHKA 4IACA 4YMJA 1J1CA 5HEZA 4QMUA 2WQBA 4DFYA 4EZ3A 5L2IA 4BJJA 3M2WA 4E26A 4F0FA 1U54A 3DXNA 5AP6A 3DPKA 4H3BA 1YW2A 4V01A 3A4PA 5HTBA 2G2FA 1NXKA 2XIRA 4GYGA 3TNQB 4C61A 5AUXA 3QZIA 5CEKA 1QPJA 1A48A 3R04A 1IRKA 2PL0A 3OT8A 2RFSA 2YM7A 4D28A 2YN8A 5ETFA 5JGDA 4GKHA 3VN9A 3NIEA 4FKQA 3RZBA 2WQNA 3VS2A 5JEBA 2J0KA 2ZYBA 4EL9A 4ZIMA 2PULA 4AZSA 3Q9WA 2C1AA 2IWIA 3CTJA 3QD4A 4JBOA 4BVUA 5A14A 3W18A 4EI4A 4FTTA 4C58A 5DYJA 4YLLA 4D9UA 4OUCA 3HMMA 4EYJA 5CXZA 1ZYSA 4ONAA 5AR2A 1YXUA 5CEQA 2VTRA 4FV7A 4EEVA 2ZV8A 4A9UA 4ZTMA 3E88A 4YZDA 4DBXA 4WSYA 1JKTA 1Q61A 3DJ6A 3RK5A 2VTMA 2GTNA 3Q96A 5HE2A 5HD7A 2REIA 1H24A 4L8MA 4IVBA 5BUIA 3VO3A 4MYGA 2Z7RA 4ZSLA 1YWRA 2EU9A 2IN6A 3ACJA 3OUKA 1KOAA 4F1OA 3KK9A 5IISA 2JDSA 2JDVA 3A2CA 3NUSA 4E1ZA 4G34A 2GNIA 5BVOA 4B0GA 3DTCA 4EK8A 5TO8A 1QL6A 3QRJA 2XJ1A 4CQEA 3QTXA 2YM3A 3QWJA 2OF4A 3F5PA 3FWQA 2WOUA 3IONA 4PX6A 5DLSA 4R77A 3HX4A 4RLKA 1ZXEA 3WZUA 3TXOA 4R6VA 4O4DA 2UW4A 2HOGA 5E8WA 3DKOA 4ZZNA 4BCGA 1M2PA 3EN5A 3QQGA 3D83A 4FVPA 3QD2B 4PMMA 4AZWA 5AA9A 4NKSA 4RJ8A 3BQRA 2XJ2A 5DR2A 3QYWA 1IASA 4IM2A 5KCVA 5LMKA 3MJ2A 4K0YA 1GIIA 1OIRA 2OICA 1W2FA 1ZARA 5D10A 4ERKA 3FHRA 4JNWA 1Q8WA 3TG1A 5IQGA 4EC8A 2F2CB 2KTYA 3FI3A 3R0TA 4KSPA 3RWPA 4DH5A 5L4QA 3UIUA 2R3QA 4XUFA 3TV4A 3EHAA 4FSTA 4D2TA 5ANKA 1KV2A 1O6YA 4U0IA 3TKIA 4GV1A 3RALA 5HLNA 2GS6A 1ZOHA 4ZS4A 2B53A 4G6NA 3TNIA 3U4UA 4FVRA 3BHTA 1E1XA 3DZOA 4QMTA 4RX8A 3PVWA 2AC5A 5CASA 1G8KA 3BLQA 4AOIA 4CFFA 2R3NA 5F20A 5EOLA 3NEWA 5DIAA 4CLIA 3DQWA 3VUGA 2VO6A 5EKNA 2HZIA 4JR3A 5L2TA 2HIWA 4JLCA 5I9VA 5E4HA 3C4FA 2C6EA 2ZAZA 3LCTA 3ACKA 1Q3WA 4WG3A 3VS4A