3E3BX

Crystal structure of catalytic subunit of human protein kinase ck2alpha prime with a potent indazole-derivative inhibitor
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
334
structure length
334
Chain Sequence
MPGPAAGSRARVYAEVNSLRSREYWDYEAHVPSWGNQDDYQLVRKLGRGKYSEVFEAINITNNERVVVKILKPVKKKKIKREVKILENLRGGTNIIKLIDTVKDPVSKTPALVFEYINNTDFKQLYQILTDFDIRFYMYELLKALDYCHSKGIMHRDVKPHNVMIDHQQKKLRLIDWGLAEFYHPAQEYNVRVASRYFKGPELLVDYQMYDYSLDMWSLGCMLASMIFRREPFFHGQDNYDQLVRIAKVLGTEELYGYLKKYHIDLDPHFNDILGQHSRKRWENFIHSENRHLVSPEALDLLDKLLRYDHQQRLTAKEAMEHPYFYPVVKEQSQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Casein kinase II subunit alpha'
publication title Structure of human protein kinase CK2alpha2 with a potent indazole-derivative inhibitor
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 83
structure length 334
sequence length 334
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2008-08-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3e3bX01
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3e3bX02
4EHVA 2W17A 2WTCA 1A9UA 4P5ZA 4BCPA 3OZ6A 3AMBA 1UNHA 5IH6A 1P4FA 4RWKA 3SG8A 1E1VA 2BRMA 3NAXA 2GDOA 1PW2A 2G15A 2XCKA 5EH0A 1OPJA 3VF8A 4LYNA 4M14A 3U9NA 2UUEA 4O0RA 1BL7A 3ORXA 4IFGA 3OP5A 4CQEA 2FGIA 3SXSA 5CF8A 4F7SA 2IN6A 5HZNA 1KV1A 4W4VA 3SKCA 2UVYA 2FH9A 5GINE 5IQIA 2GHGA 2B54A 2ZV8A 4L3PA 3QYZA 5HX8A 3EYHA 5AM7A 1OBDA 3FEGA 2PUUA 1E1XA 1OIYA 1U46A 4XV2A 3R7OA 2RFSA 4FKIA 4ERKA 4FTIA 5TF9A 3NUUA 1QPJA 2ITPA 4IANA 3QQJA 4XCUA 4IE9A 5KMMA 4MHAA 1ZRZA 5LCJA 3RHKA 3ZLWA 5IH4A 4EC8A 4EH4A 3ORPA 3QCYA 4XG9A 1WBWA 4FSNA 4CG9A 4FV6A 3WYXA 4DEBA 4U3YA 2E9NA 5CEQA 4GT3A 4BZOA 4LQMA 3EYGA 3BQCA 3QLGA 4RIXA 3TT0A 2A2AA 2P55A 2KTYA 1TQMA 2W4OA 4Y72A 1TQIA 3VO3A 1JLUE 2C5OA 3FQSA 3HMIA 3VUMA 3TM0A 2DUVA 2E9PA 3EQPA 1IASA 2UZWE 4JNWA 4MYGA 3AT3A 3LKMA 4G1WA 3T8OA 3UP2A 4HGLA 3ORNA 3ET7A 3FMJA 2XIRA 3E87A 3NCZA 4W8EA 5M55A 5HVKA 2WHBA 4PRJA 3O2MA 2H34A 3OVVA 3P4KA 4QMMA 5CEOA 4O84A 3ZM9A 1Y91A 3Q4ZA 2ITYA 4QPAA 4X3FC 4K77A 3IDPA 5E8VA 3S2PA 3TTJA 1OL2A 4GJ2A 5FUTA 2B9FA 3OOMA 4Y95A 3C5UA 3UDBA 3FHRA 3COIA 4FR4A 4I5CA 5IUHA 1QPEA 3NW6A 1O6LA 3DTWA 4DTKA 3N9XA 3S00A 4NU1A 3ALOA 4KKEA 4EZ5A 3HMOA 5CU6A 1U5QA 4K33A 4BWKA 2OXYA 3OMVA 5AR2A 2R3NA 4NJ3A 4L43A 4BI2A 5J9YA 2YCFA 2ZJWA 3FMKA 3A7HA 4EOQA 3RPRA 3UQGA 2NPQA 5JFVA 2JBPA 3QRTA 3DLSA 4RX9A 3WYYA 1G8AA 3QD0A 1H1PA 2BRNA 4FKSA 1JKLA 1Q8WA 1Q8YA 4ACGA 4JBPA 4BCKA 3FYJX 5E9EA 1M17A 2J90A 3H9FA 2AUHA 3O50A 4EONA 4O7VA 3V51A 3NUYA 5AP4A 4JT3A 5DBXA 3LQ5A 1DS5A 4IZ7A 4B7TA 4IJPA 1DM2A 4BDFA 3TUBA 4O0TA 4L7FA 1SM2A 2PVMA 3QA8A 2XRUA 3VHKA 4I22A 4II5A 3Q96A 4ZK5A 3ORTA 4HZSA 3RP9A 2CN5A 3EL7A 3BE2A 2LAVA 2H8HA 1UNLA 3FQHA 3NYXA 1W84A 2C6OA 2VX3A 3AMYA 4F6SA 2V62A 3BBWA 3OW4A 2ONLA 4C3RA 1KE9A 1VJYA 4JAIA 1JSTA 5CZIA 3EN7A 3UZRA 4D2PA 4ANBA 4AT5A 2YWVA 1GJOA 4RZVA 5B2MA 3SV0A 4IH8A 2GNJA 2F49A 1YWRA 4YBJA 3ZUVA 3DAKA 2BHEA 2PK9A 2W05A 4J1RA 4RSSA 4BDHA 3KCFA 5HTCA 2GHLA 5A54A 5EG3A 3Q9XA 3ZDIA 3BEGA 4QYGA 5KBQA 2UZBA 4OT5A 4DG0E 4IM2A 5HICA 2I0YA 4WKQA 5C8KA 1SVHA 4RIYB 1P14A 3TWJA 2VTIA 3UJGA 3W1FA 2A27A 3R8UA 3MPAA 2OXDA 4M15A 4R3PA 4D28A 5AUTA 2B7AA 2BKZA 5IA4A 3E3PA 2BRGA 2XM8A 2PTKA 4FG9A 5DRDA 5M06A 5DT0A 3PG3A 2FVDA 3G33A 4NKSA 4FTTA 4FVPA 2IPXA 5EM8A 1VR2A 4ACHA 2V22A 5IG1A 5JN2A 5CVFA 1ZXEA 5ITAA 4UZHA 4ZTLA 1KOBA 3BWFA 4MNFA 5LMBA 4XBUA 3CS9A 3WIGA 3PZHA 3Q3BA 3TEIA 2Y4IB 1GOLA 5IQCA 3I6WA 4FKJA 2BFYA 4FSTA 3U55A 3C5IA 5CSXA 4BI1A 3A8WA 2ZMCA 2C6DA 3F6XA 3TL8A 1FQ1B 1ZZLA 4FV9A 4O1OA 5FD2A 3CJFA 3H3CA 5CXHA 4AWIA 4B0GA 3FKLA 2HELA 5GIPE 3OBGA 2CGUA 5K4IA 2RFEA 2W1GA 3AC2A 2PE1A 3WILA 3A2CA 1YW2A 1KUTA 4AN9A 3PVUA 4MF0A 4U3ZA 2BTSA 2PMNX 4JX7A 3GU4A 5F4NA 1U4DA 2JIIA 3P23A 5DVRA 3LCKA 3OOGA 1Q8ZA 5H2UA 1PXPA 3R04A 4IB0A 3BV2A 3OROA 2I0HA 1QCFA 2PZYA 1JKSA 3UBDA 3UC4A 2R0UA 2C47A 2ZM4A 3FC1X 4HZRA 1PMVA 4MTAA 2OJFE 4APCA 4P7EA 4G3CA 2X9EA 5JZNA 3C4XA 5FEDA 3A62A 2A19B 1VYZA 2W7XA 3EN5A 4EHZA 4A9YA 5AV4A 2NO3A 2R5TA 5D10A 1I44A 3DBCA 3KCKA 5FM2A 4FSYA 4QOXA 2Z8CA 4G6NA 4F6WA 5GZ9A 3FJQE 5HO6A 3HYHA 4A9UA 3PJ8A 1OUKA 4FV7A 2C68A 4FBXA 5BUIA 2FYSA 5CI7A 3DBFA 4YJRA 3OXTA 4FL3A 4IW0A 4KNBA 3NLBA 1G3NA 1Q3DA 4LMNA 4JG8A 1IR3A 4UYAA 3WF5A 3HV3A 5L2QA 2X7OA 3LXKA 2WQEA 4D1XA 4C33A 2YLEA 5EI2A 3GP0A 4QTEA 1JSVA 3V5JA 2C3KA 3FI2A 1GY3A 4AFJA 3GFEA 3II5A 4E4MA 1X8BA 4QD6A 3TACA 3HRFA 4KSPA 4XV1A 4UMRA 5GZ8A 4C35A 1BKXA 3QQGA 4IZYA 2UW9A 4C62A 1Q4LA 4OBPA 2V7OA 4G9RA 5E8WA 4WOVA 5HIDA 3BV3A 1KE6A 2ZYBA 3HA8A 4F6UA 3NZ0A 2VGOA 2HW7A 4NEUA 1ZYLA 4CCBA 1RE8A 5JH6A 5HBHA 2R7IA 3TZ9A 1KE5A 3R8LA 5AR3A 2AC5A 3TTIA 4FODA 3E93A 3OCSA 4NW6A 1NA7A 4XOZA 3ZDUA 1GIHA 5IA1A 5CF6A 3ANRA 2UZLA 4RX7A 3BKBA 4QQCA 5D7VA 4HVIA 5BUEA 3PXZA 2X6DA 4GFGA 1WVXA 3NUXA 5EOLA 5IISA 1JNKA 1K3AA 3EZRA 3VAPA 2YM8A 4EBVA 4WUNA 3OUNB 3P78A 4JDIA 4FKGA 4FNWA 4RA4A 4X7QA 4LRJA 1CKIA 4RWIA 3DFCB 4U40A 4IAAA 1QL6A 2VO7A 4EZ7A 2IG7A 3OT3A 3SAYA 4FT7A 3NVKI 2VNWA 5IDNA 2P0CA 5D7AA 4BC6A 4E6DA 2EXCX 2CJMA 5DG5A 3FZPA 3P0MA 2O3PA 4AZSA 2YM5A 3V5TA 3D2IA 4OTIA 4AACA 3ORIA 1JKTA 3I5ZA 5CQWA 4E3CA 4CQGA 3E7OA 3U8WA 5LQFA 1S9IA 4HYIA 4BF2A 4QMTA 2BROA 3DV3A 3ZCLA 1XBAA 3HKOA 4HCTA 3ACJA 2R3QA 3OWKA 4HJOA 3O96A 4J98A 3W18A 4F9BA 3VUDA 3E8EA 4F0IA 4DF3A 3I1AA 4UYNA 4PL4A 2WZJA 5IQFA 3R8PA 4E4NA 4D58A 2W5BA 3KQ7A 3MSSA 4X3FA 5FXSA 4ARKA 3OF0A 3DQXA 2BILB 1SVEA 3RK9A 3ZUTA 5EYMA 4CYIA 3ZBFA 3VBYA 3TUCA 1L8TA 2HZ0A 2ITOA 4WRGA 4LRKA 4MBIA 4AOTA 5LARA 3DLZA 3DPKA 3D14A 3VNTA 2DQ7X 3UO5A 4NL0A 3CLYA 5AEPA 2C0TA 4C7TA 5JRSA 4BCHA 2C0OA 4H36A 3TZ7A 3VUGA 2VO0A 2WEIA 1URCA 2WMVA 4ZZNA 4MXAA 4A4OA 3DBDA 4U79A 5CANA 5IEYA 1UWHA 1YXVA 4Q9ZA 1SZMA 4ANOA 5DLSA 4RG0A 4I6FA 3TIYA 3O51A 3VBVA 2CDZA 5BUJA 2WEVA 4FV1A 3CTQA 4FTOA 3UGCA 4NFNA 3BHVA 2G2IA 5HE0A 4D0XA 3CY2A 3QA0A 2KULA 4GIHA 3HAVA 1VYWA 4BTJA 5I9ZA 4W4YA 2EUFB 1YI4A 2XK4A 2JC6A 3L9LA 1BMKA 2CCIA 2F2CB 2R3PA 2VX1A 3IPHA 2OGVA 5ANGA 5IQHA 4C3FA 4U97A 4ALUA 4ZEGA 3QKMA 4CMTA 2C6TA 3FLWA 3MVHA 5I5ZA 3HDNA 4CFXA 5IMEA 1MP8A 4RJ4A 3V8SA 4BYIA 4OTDA 2VRXA 4NK9A 5CLPA 5HU3A 3I7BA 3O7LD 1H27A 4E8AA 5K9IA 4EJNA 4WIHA 5E90A 4MH7A 4MKCA 4U8ZA 3Q4CA 3UG1A 3ZZEA 4R3CA 3M2WA 3C50A 2UZEA 4GYGA 4IX5A 5HVJA 4IVBA 3TNWA 4BZDA 5EK7A 3TV7A 3IDCA 4NWMA 2OZAB 4BKZA 1B38A 3BQRA 3L8XA 4J99A 2YABA 1KE7A 1TVOA 4BGHA 4PNIA 4BB4A 2Y7JA 4BCIA 3K5VA 4C02A 3QKLA 4C0TA 2GFSA 2X7GA 3NUPA 4P2KA 3RCJA 4MD7E 3QQHA 4IDTA 3P5KA 1BI7A 2B53A 4LV8A 4NJDA 4EOIA 4FF8A 4QTDA 4YC3A 2VWWA 4MXCA 3FE3A 1OKYA 2V0DA 4OUCA 3DJ7A 2YN8A 4NYEA 3GU8A 4DTAA 3O23A 4JIAA 3DGKA 3EJ1A 3CTHA 3EZVA 5BX0A 4CEGA 1T46A 4IACA 4F1OA 4FSUA 5CF5A 3AD5A 3EMGA 2QOFA 1J3HA 2YDKA 4D1SA 2E2BA 4RVTA 5B2KA 3ENHA 5A6NA 4PPCA 1V0OA 4AFEA 2YAAA 2GS6A 4R1VA 3R9NA 4R7BA 2PUIA 2PULA 4N70A 4BGGA 2F7ZE 3LCOA 4J52A 1H00A 3UVQA 3VS5A 3WIKA 4E4LA 4O38A 4F9YA 4PNKA 5C01A 5I9WA 3GC0A 3NUAA 4N57A 2RG5A 4R6VA 4IBMA 1L3RE 4TTHB 5AUZA 4L44A 4OTHA 4NIFB 2YITA 4FNYA 2W1IA 3Q9WA 3EFJA 2XB7A 3UNJA 5CU4A 4R77A 2ITUA 2W5AA 3RBWA 4MCVA 4FTNA 3TUDA 3FPMA 5CWZA 2W1ZA 3RPOA 3F3ZA 5E8ZA 3CE3A 2X81A 3U4UA 3W8QA 4D2WA 3QC4A 4EKKA 3PJCA 5AV2A 1M7QA 4IX3A 2C30A 5DT3A 4AGDA 4XG2A 3NW7A 4FKWA 3WZUA 2G01A 3QQLA 2RSVA 4OTFA 3KB7A 3C1XA 3D4QA 2HWOA 1WBOA 5EW9A 2OH4A 4JQ7A 3R8VA 1MRUA 2X39A 2B9JA 3GC7A 4EZ3A 2BZHB 5DR9A 5AAGA 1J1CA 3FMLA 3OS3A 3TV4A 3AT2A 4DGMA 3Q60A 4AN3A 3UOHA 3CJGA 1SNXA 2WMAA 2J5FA 4KWPA 4BDJA 4FKQA 4IAFA 4RJ3A 4S2ZA 2YERA 3ACKA 3R7GA 4O86A 3NYVA 4FIHA 2RFDA 1YXTA 3PA5A 3WZDA 3A7JA 4X2NA 2C1AA 4EK8A 3FZTA 4E6AA 1RW8A 4MNEB 5M4UA 1SVGA 3R63A 2PZRA 3IECA 2O5KA 5E8XA 1VEBA 5HE3A 4XRJA 3OHTA 4F65A 2EXEA 3L9NA 5CT7A 2H6DA 2ZV7A 3RTPA 3Q9ZA 3QQFA 4IVCA 2Q0BA 5CAUA 1WVYA 5C4LA 1STCE 3OEZA 4DA5A 2JFMA 3CPBA 1IG1A 2GFCA 4RVMA 4O7LA 1H1WA 2O64A 4I3ZA 4PP7A 3QX4A 4GKIA 2GNHA 2BIYA 4UMUA 2OSCA 2CGVA 2VTAA 5KZ0A 3HDMA 5DR6A 4KKHA 4TYHB 4QTAA 4BDKA 5M44A 3FWQA 4UZDA 2XIKA 1M52A 2C6MA 2G2FA 4ZLZA 4QMYA 2OZOA 3G0FA 3QGWA 4RPVA 4O21A 4PDSA 4S34A 5C27A 4F09A 3NVMB 3PPKA 2Z7RA 4ID7A 2Y4PA 4L45A 4LUEA 2XBJA 3L8PA 4XG4A 3CPCA 3VJOA 2ZAZA 1NW1A 3Q5IA 5KKRC 2JIVA 3PPZA 2BALA 2I40A 4QNAA 4R3RA 5EYKA 3RM7A 5A4CA 3MB6A 1OPKA 4JDHA 3EFWA 2HY0A 3SRVA 4P90A 4WBBB 3HUBA 3SXFA 4CKIA 4DFNA 3HP5A 2Z7LA 4ANQA 4YO4A 4USEA 4U44A 2CNUA 3DAJA 2HW6A 5E4HA 3S3IA 3BLRA 4EUTA 2QLUA 4IAYA 2BR1A 4FYNA 3WF6A 4X2GA 2ERZE 2Z7SA 5A3XA 4FNZA 2ITXA 3TV6A 3ODZX 4QP6A 4AU8A 4ZLYA 5CALA 3PPJA 2WTVA 4OR5A 3R1SA 1H07A 2X7FA 2J6MA 3GOKA 4BWPA 5DMZA 4I20A 4YLKA 3RALA 4O7RA 4LRMA 2HYYA 5GJGA 5IQGA 4R7HA 3BU5A 3ZH8A 3AC3A 4Q9SA 4MK0A 3GQIA 1Q8UA 4O7TA 1CKJA 2GNFA 4DCAA 3BX5A 4YZDA 5BVNA 3ZO3A 5GHVA 4Z9LA 3MI9A 3PVGA 1O6KA 4P4CA 4GCJA 4EWQA 3F3TA 3CXWA 3WF9A 3LFCA 3KREA 4FGBA 1UV5A 5KX8A 2ITZA 3QZHA 3G5DA 1YHSA 4RBLA 3S0OA 1Y8YA 2VTSA 4L42A 5FTGA 4DH8A 3OG7A 3ROYA 4JG7A 3FC2A 3Q5ZA 3SDJA 1WBVA 2PMLX 4YZBA 4XUFA 3UIXA 3KXHA 4YJSA 3C0HA 5AUVA 1CKPA 2GNLA 3PIYA 5IF1A 3ODYX 4E5BA 2W4JA 2YCQA 4JG6A 4AZWA 3QFVA 4GFMA 4KIPA 5FG8A 3ZO2A 4BFMA 1KE8A 2IWIA 2CLQA 4I23A 4FUYA 3RPYA 2J50A 4EH2A 4CGAA 4UALA 5L6OA 4Y5QA 2QKWB 2GS7A 3V5QA 1OIQA 4FZ7A 4FEQA 3NYOA 2XKEA 1UVRA 4B4LA 4HCUA 1WAKA 2HWPA 3HV5A 5G1XA 4PMTA 4UB7A 5D11A 4QMWA 5HTIA 4EK3A 3BYSA 3KF4A 3PJ1A 3FMNA 5FP6A 4GYIA 4H1MA 4IAZA 5F95A 5LOHA 2CNVA 2GCDA 3EOCA 2UW6A 3A4PA 5DFPA 5K0KA 5HVYA 5ETFA 4YURA 5ANKA 4YTIA 5K0XA 3AG9A 4E73A 2CGXA 4IIRA 1YI3A 4O0XA 4F0FA 4X2KA 2PVKA 2J51A 4X0MA 1Y8GA 2YDIA 2YWPA 5EW8A 5HE2A 5HG8A 3A60A 4DT9A 4YBKA 5AV1A 3QTIA 5H8EA 3D5WA 2DWBA 4LGGA 4QP9A 4RFMA 5BMMA 4D5KA 4QMXA 2W1FA 3A8XA 3LFEA 3R83A 2C3LA 1PRYA 2IJMA 3A7FA 3F88A 4QP4A 2H9VA 3PSCA 2X1NA 4O6EA 3ATSA 1JPAA 2GU8A 2OG8A 4XOYA 1FINA 4GVAA 4YGAA 5I9YA 3FV8A 4FL2A 2JIUA 4O7ZA 5EYDA 3M11A 3RPVA 4DFYA 5KHWA 4BIDA 2UVZA 4BCJA 4EH6A 4EC9A 1HCKA 4GW8A 1HOWA 4EEVA 4BI0A 3BGZA 4YJTA 4PMPA 3FZRA 4L6QA 4WNOA 4BY9E 3ZHPC 5IA3A 2I1MA 5ICPA 5JRQA 4YR8A 3VUHA 2C1BA 4K18A 4PP9A 4CVAA 2I7QA 3BCEA 2VTOA 4F7NA 5CAQA 4DTBA 4XLVA 4FE2A 1WZYA 5IEVA 3EQCA 4ONAA 5CEKA 5L6WL 5I9UA 4YPSA 1ZYJA 3I4BA 3ZZWA 4CG8A 3BLQA 4W9XA 1JOWB 2OI4X 4OBQA 4XLIA 4UXLA 4J8MA 3DNEA 4NM5A 5ANIA 1XH5A 4K9YA 4U41A 4EK5A 3R7EA 4N0SA 3KK9A 4AGUA 3CC6A 2UV2A 3PVBA 3R7VA 1PXOA 2QG5A 3V5PA 2W06A 4D2RA 5J79A 1IRKA 3GT8A 3H4JA 3NS9A 3KF7A 4U0IA 3VS0A 4BDCA 3DXQA 1S9JA 2QI8A 4JR3A 2FUMA 3R21A 4LOPA 3HRCA 1XQZA 1WVWA 5HD7A 1H24A 2OU7A 4BDGA 1WBPA 2WTJA 1UKIA 3A4OX 4K1BA 5DPVA 3DTCA 3MWUA 3EKKA 4LL0A 4QPMA 2W96B 5BVFA 5JGDA 3NIZA 4KIOA 1JSUA 3UTOA 3W33A 1QPDA 3TKHA 4MAOA 2Y4IC 3OCGA 5E91A 4CTBA 5J1VA 3W2CA 1Q62A 4YTCA 1W82A 2PWLA 3COMA 5HLPA 5M08A 4OTWA 2XK6A 3EFKA 1F0QA 3PIZA 4AE6A 3KK8A 3BYUA 2P4IA 5AR7A 4XX9A 2ITQA 3LJ0A 4YHFA 2FSMX 2YM4A 3MIAA 3QKKA 4CZTA 4E6CA 4YTHA 3H9OA 4FNXA 3MY1A 4MWIA 5TO8A 4BTKA 3O7LB 5DN3A 1XJDA 4F1TA 2C3JA 2IW6A 2PZIA 3CEKA 3FI8A 5CAPA 3B2WA 4YZNA 2VX0A 3F3UA 3CQEA 3PA4A 4M0ZA 2C6KA 3FPQA 5C26A 5FXRA 4NM0A 4KUJA 1LUFA 1RQQA 2C0IA 3SQQA 2PMOX 3LE6A 4DEGA 1APME 4XJ0A 4FG7A 3MJ1A 2B4SB 4RIOA 4TNDA 3Q2MA 1LR4A 2CKEA 4U80A 4AA5A 1W98A 4PDYA 4I24A 2F9GA 5M4FA 2HIWA 1YXXA 2CN8A 3R73A 4TXCA 3EWHA 4J8NA 4GS6A 4YLLA 4ZS0A 4RQKA 2ZV9A 4AT3A 1XH8A 4RJ8A 2ZV2A 2P3GX 2HK5A 3COKA 3TNPC 2XKCA 3D83A 1XR1A 4I92A 4BHZA 3C4WA 1VZOA 2YM3A 4QMZA 3VBWA 1YI6A 4CKRA 3Q4TA 3D5XA 4XH6A 5T3QA 3P1AA 3HEGA 4FT5A 2BTRA 4JJRA 2QR7A 4HVSA 3AOXA 2ZM3A 5B7VA 4L7SA 3W2SA 4AA4A 3KRRA 3IK3A 3QUEA 2CNQA 2WTKB 3BWJA 2XIYA 4RFZA 2YFXA 3MBLA 1KOAA 4G3EA 4N6ZA 2P2IA 3QRUA 3GCPA 2ESMA 5A4TA 4TYGA 5AUYA 3I5NA 3VQHA 4Y85A 4L46A 4D0WA 5HO7A 4ITIA 3TI1A 3LJ1A 2VZ6A 2C6IA 2BDWA 2RFNA 2GQGA 4N4SA 4UWBA 3UO4A 5L2TA 5EHYA 4CLJA 4L3LA 2NP8A 3F9NA 4ZZOA 4GKHA 5HBEA 2JITA 4YNEA 4TYJA 1JAMA 4A07A 4RVKA 4OAUC 4EH7A 2BVAA 4M12A 5ANJA 4ASEA 4BDIA 4NUSA 2REIA 4C4JA 3KEXA 4JBOA 4TWPA 4F1MA 5TE0A 4DG3E 4YZCA 2VTLA 3PIXA 1M7NA 4L53A 4WO5A 3JUHA 5IKWA 2JAMA 2EB2A 4D55A 3QWKA 3RGFA 5CS6A 5AR5A 1U54B 4KIKB 3Q32A 4QP3A 2VWZA 1R1WA 1PKDA 2XZSA 3IW8A 2VTQA 1P5EA 3PLSA 4FV8A 4AAAA 4B99A 2NNWB 3PZEA 2PVLA 4LI5A 4AF3A 4E5AX 3F5UA 3EH9A 2WPAA 5HTBA 2QOKA 4U5JA 3KKVA 3POZA 3MS9A 3Q6WA 4AS0A 3RI1A 4QT1A 4CT1A 4EBWA 1Q41A 1R39A 3QCQA 4L67A 5A14A 2ITWA 3KC3A 3QTRA 2XM9A 2V7AA 4OLIA 4A7CA 2OK1A 3VIDA 3FZSA 1DAYA 3ZFMA 1NVSA 1PXMA 3G6HA 3NR9A 3KA0A 3GGFA 4FIJA 4PTEA 1ZYSA 4ENXA 3QZIA 4HCVA 4ZJIA 4MD8E 2EB3A 2GNIA 5EYCA 3F7ZA 2VTTA 3I81A 2JAVA 1J7LA 2UW8A 3PVWA 5EI6A 2BIKB 4V0GB 1OL7A 3DXNA 3VS6A 1SNUA 4M97A 4LFIA 4KS7A 2ZOQA 4ITHA 4ZY6A 4ACMA 5IQBA 2BUJA 2R2PA 1ZARA 2VTJA 4NCTA 4O96A 4APPA 5CU2A 5IPJA 1GIIA 5ETCA 3A7IA 2P33A 5FTOA 3LXNA 3NNXA 1F3MC 5LWNA 4ZTMA 3LPBA 3VUTA 2OKRA 3PXQA 4C8BA 4ITJA 5KNJA 4EOMA 1UKHA 2J5EA 4JI9A 4KAOA 3RJCA 3QLFA 1MQBA 3F2RA 2XNNA 2VN9A 3C0IA 5TKDA 3W16A 2YZAA 3G2FA 1YKRA 5FP5A 4O7SA 4USDA 4U43A 1BL6A 3QRKA 2O0UA 4B8LA 2R64A 4I0SA 3DKGA 4JQEA 4ZSGA 4BDBA 4A9SA 1ZZ2A 3ORZA 3MV5A 3ZEPA 4U42A 4AW0A 4YTFA 1YDSE 5E8UA 3UNKA 3G51A 4D1ZA 3NWWA 2PY3A 1YXSA 2IW8A 4D4RA 3BYOA 3Q04A 4ZS4A 5M4IA 2WGJA 4ZSEA 2QODA 3EN4A 4G6LA 4LG4A 5FBOA 5BVKA 2BZJA 3I60A 1IAHA 3DB6A 3QD4A 3P7AA 2IZRA 5J95A 4H3BA 3QALE 3PXKA 2BRHA 1PY5A 4QQTA 3BIZA 2IVUA 4BR3A 3WBLA 1PXIA 3GI3A 4OTQA 1IAJA 5CI6A 1OGUA 4MF1A 4EQUA 4ORKA 3TJCA 2VGPA 5FWKK 4W9WA 4BCFA 3VUKA 4CRLA 5F94A 5HU9A 1UU3A 3ITZA 5A4QA 3V3VA 5EDQA 4C3PA 4DE4A 5FLFA 2WOTA 2XA4A 3DFAA 4FV4A 4GIIA 4RIYA 4C37A 4YZMA 4NKAA 1OITA 3HECA 4C2WA 4AOIA 2PE2A 5IA2A 3AC5A 4CFVA 5AMNA 4AZTA 2QHNA 1ZWSA 4RJ7A 5M57A 3WARA 3SD0A 3VS1A 4DGOA 3O17A 4BDEA 2J0LA 3NSZA 4KS8A 3F2AA 4LOQA 1NT2A 3UPXA 3LMIA 3OWLA 3ID6C 3I6UA 2A1AB 5BYZA 5GZAA 4S31A 1U54A 4AE9A 1FPUA 4YUQA 1Q99A 1UU8A 3LIJA 4TNBA 5DR2A 3TDVA 2OFUA 4EOPA 3N4UA 3NMUF 3SA0A 4S32A 2QO2A 5L3AA 2YIQA 2XRWA 2DYLA 4C4FA 5J5TA 4IDVA 3PXRA 1NVQA 4F70A 3U6IA 1SMHA 1XKKA 5AA8A 4QP1A 2WIPA 3QHWA 1ZLTA 2ZDUA 4GK4A 5EDRA 4J71A 4E93A 4H3QA 4FA2A 3PSBA 3R7YA 3FYKX 3LAUA 3LMGA 3MVMA 5E7RA 2R3HA 4C58A 3HX4A 4J96A 2XIXA 4EH9A 3POOA 3TZMA 4WA9A 5FRIA 2QU6A 1UU9A 4RLLA 1T45A 2CLXA 3I0QA 3JPVA 2VTHA 1PF8A 1YOLA 4ZTQA 2XNPA 2YLFA 3H0YA 3KMWA 4FEVA 4C4EA 3IGGA 3BHYA 3MW1A 2WMWA 3UOLA 1SYKA 4YSMA 4GV1A 2QVSE 2EVAA 1PMUA 5EDPA 3FMEA 5LMKC 3QF9A 4OTPA 3PYYA 2VTMA 4GUEA 5ANDA 3V8TA 1WCCA 4AA0A 3OWPA 4M3QA 3ZSGA 3Q52A 4F64A 3UIBA 3UYTA 5L8KA 4XP3A 3DBQA 5CY3A 5ETAA 1WBNA 1IA8A 2PVHA 5FEEA 4I5HA 5KCVA 4FEUA 1GAGA 3EKNA 4CZUA 4HGSA 3E88A 4FX3A 4JXFA 4MXXA 4AOJA 4BZNA 1LP4A 1J7UA 2J9MA 4WNKA 3QL8A 4AQCA 3BU6A 4NFMA 3UVRA 4AXAA 4V04A 4FV2A 4LV5A 4ALWA 2XNBA 2UW3A 2XJ2A 5HCZA 3OUKA 3MDYA 5L8JA 4ZTHA 4MXOA 5E8YA 5KZIA 1YOMA 4NSTA 5CAOA 2X2KA 3MFUA 3H30A 4I1ZA 3FSKA 2HENA 4O91A 1GIJA 1LPUA 3EHAA 2W9ZB 4FKVA 5DNRA 4OTGA 1CMKE 5EQYA 4IAKA 3KU2A 3ZXTA 3JS2A 2UZVA 2R7BA 4DEEA 3FHIA 1O9UA 2GNGA 4RJ6A 1OI9A 3DK3A 4TWOA 5JFWA 2PHKA 3E63A 5CAVA 3BI6A 3R1YA 2RKUA 4XV3A 3VRZA 3BHTA 4DEAA 5EFQA 4KABA 5JFSA 4FZDB 2JEDA 2W1EA 3HV7A 3OXZA 2F2UA 2YZLA 3SGCA 3LFAA 4HYSA 3VS3A 2A4LA 1Q5KA 4DGNA 3GCQA 1XH4A 1XH6A 2Y8OA 3FKNA 4O2ZA 4O0WA 4QMPA 3V01A 3VVHA 3S4QA 4EWHA 5CXZA 4TRLA 4Z55A 3KXNA 4KSQA 4PMMA 2I0VA 2J7TA 4QYFA 5KUPA 5KMLA 4W8DA 1MRYA 1Q24A 4V05A 3ALNA 4DFXE 3O71A 2WMUA 4CXAA 3PTGA 3UP7A 3ZUUA 3H10A 2JKQA 2WTDA 2PU8A 1Y57A 3BLHA 4G6OA 4QP8A 5CVHA 4ZOGA 2G9XA 4C38A 1Z5MA 1GNGA 1XH9A 2VWBA 3E92A 3BGPA 4GL9A 4KIQA 4AW2A 3DOGA 5HD4A 2GPHA 4GSBA 4O2PA 1OUYA 1PHKA 2QNJA 3UIMA 4UEUA 4W4XA 3E3BX 5BVWA 2Q83A 2IZSA 4YPDA 2XF0A 3KMUA 5ACKA 3UOKA 2BZIB 1AD5A 1PXLA 4OT6A 5FQDC 3DDQA 4RFYA 5AR4A 5AAFA 3TNHA 1FGIA 3KRXA 3FLQA 4EK6A 1DI8A 3KXXA 2OH0E 5AV0A 4JQ8A 2GTNA 2JLDA 3VN9A 2QU5A 2RL5A 5AX3A 3JXWA 1H4LA 5B2LA 5C9CA 4AN2A 4EOLA 3TJDA 3MH1A 2ITNA 4M13A 4IJ9A 4O7WA 5JQ5A 3G9NA 3C13A 3C9WA 3FXWA 4YJUA 4ZMEA 3OT8A 5HNGA 1OL5A 4ANLA 3LCSA 3C0GA 5KE0A 2YIRA 1M2PA 3WOWA 3UO6A 3MVJA 4PDOA 3O8TA 3RWQA 1YQJA 4BKJA 2QONA 2RGPA 4TPTA 3FLZA 5KMJA 5C8NA 3CGOA 1Q8TA 4IHPA 3NEWA 5I9XA 3IW6A 3AC4A 4L9IA 5AA9A 2YHVA 2BDFA 2PVNA 1REKA 3QX2A 4CLIA 3DJ6A 1EH4A 1M14A 4ZZMA 3I7CA 4DGGA 2OJGA 4BCMA 2VO3A 4MD9E 4FKUA 3EFLA 4JBQA 2QCSA 3IS5A 3SVVA 5I0BA 3MGYA 3ATTA 4BYJA 5K5XA 4KB8A 4CCUA 3LLAA 1ERKA 4R7IA 5CEPA 4FKTA 3S1HA 2CGWA 3PY3A 4ZXTA 3CSVA 1OMWA 4G16A 3ZC5A 1A06A 3O8UA 4FOCA 5FXQA 3WZKA 2LGCA 2WMTA 4I21A 3C4ZA 2BCJA 2C3IB 4EL9A 3ZFXA 3F61A 4JDJA 3BYVA 4G31A 4AX8A 4KRDA 5CT0A 4DLJA 3DKFA 3RM6A 3VUIA 5KMOA 5LVMA 3GCSA 4YJNA 5DEWA 3QRIA 5C03A 3TIZA 4EK4A 4IXPA 2OIQA 4A9RA 5J9ZA 3EN9A 3E8DA 2AC3A 3GOPA 2YDJA 3M1SA 2OZAA 4M69B 3UZPA 4CZYB 3E7VA 3TG1A 5F9EA 2C6EA 4FZFB 2J0MB 4U81A 3UMWA 5J5SA 4WD5A 4EYJA 1CM8A 4FVQA 4GVJA 3T3VA 5LWMA 2YACA 1ZOHA 3AGMA 3K54A 4DFBA 4KRCA 3ORMA 3AGLA 4LGHA 4MWHA 4UX9A 1PYXA 2QOHA 3QXOA 5DIAA 5KBRA 2CPKE 5F20A 5BPYA 3F5PA 3PY1A 4QTCA 3FLNC 5EQEA 3VWAA 2VWYA 3RZFA 4NTTA 3ETAA 4YNOA 4ERWA 5FDPA 3ROCA 1UU7A 3WF8A 4EOKA 2GSFA 2Y6MA 4QMVA 4UBAA 1H28A 4ZSJA 5LMAA 2R9SA 1XBCA 3MPTA 4ZTSA 2XEYA 3WI6A 4P5QA 4D5HA 3REPA 4G5JA 5JZJA 5DT4A 2X2MA 2XIZA 3RCDA 3KVWA 3LM5A 5FDXA 4I5MA 3KRJA 1G8SA 3TZ8A 4GK2A 4PL5A 4F99A 1FVTA 4I6QA 3F82A 2CKOA 4JS8A 5G6VA 5ETIA 2OXXA 3OEFX 5GIOE 3NRMA 4AGCA 4NIFA 3ZO1A 5JEBA 3AD4A 1U59A 3FMDA 5EKOA 2OW3A 4GEOA 4JR7A 1V0PA 4LUDA 5J87A 5LCKA 4FEWA 2DS1A 1K2PA 1NXKA 3HV6A 5HBJA 2UW5A 3QGYA 4ZTRA 5I3OA 4DN5A 2G2HA 3HA6A 4LL5A 4X21A 3GUBA 3UMXA 4RRVA 4BWXA 5A4EA 1A48A 3PUPA 3PE2A 4DINA 4Z7HA 3SW4A 4D4YA 1Q3WA 1FMKA 3KULB 4FSQA 4I4FA 4LM5A 4EKLA 3PP0A 4YJPA 4ZAUA 3OCTA 4IC7A 3FZ1A 4Q2AA 4RZWA 4TL0A 2B9IA 2XNEA 3IDBA 4IZAA 5LMKA 3GQLA 2BAQA 2HY81 4FI1A 4RIXB 3R8MA 4CMOA 3MA6A 3L9MA 1R3CA 1OVEA 4L68A 5C8MA 4EHGA 3MJ2A 3CD3A 2XMYA 3QWJA 2YA9A 4XP2A 5AP5A 5M4CA 5AFVA 5IQAA 3LQ3A 2QHMA 4NCTC 1TQPA 3MYGA 3FXZA 3LFDA 5E1SA 2HZIA 2W0JA 3R30A 4WNMA 4DCEA 2YIXA 3FLSA 3PRIA 4G34A 4OW8A 4TT7A 4DITA 4FGRA 3ZEWA 5EQPA 4MNEA 3HP2A 3EQRA 4FYOA 4IFCA 4ZSLA 3JYAA 2GS2A 5AJQA 4FIFA 2R3RA 5DI1A 3AMAA 4HVGA 2W9FB 5AP6A 3BE9A 3MH0A 4IADA 4YC6A 4PPAA 1E9HA 3OTUA 2W5HA 2PPQA 1REJA 4AUAA 2JDSA 5I3RA 3W10A 3GU6A 3MTLA 4PPBA 4AZEA 5LVNA 1J1BA 1ZYDA 4UWCA 5KMNA 1DI9A 1OIRA 5HG5A 1U5RA 3BBTB 3PXYA 1YXUA 4CSVA 2AYPA 3DKCA 4QQJA 3T9IA 3WE8A 4CMUA 5IMXA 4TYHA 1I09A 3FKOA 3ZYAA 2R3IA 4AZVA 2H96A 3UOJA 3CCNA 5LXMA 2XNOA 4G17A 1J7IA 3P79A 5JT2A 4D4VA 4M69A 1W7HA 2QOQA 2V5QA 5EM6A 2QG7A 2Z02A 3R71A 4EYMA 4BVUA 2VUWA 3C51A 4O0YA 4OGRA 3IQ7A 1YDRE 2OO8X 4HGTA 4PTCA 1H8FA 3R01A 5M09A 2WTKC 3N51A 2YCRA 3VC4A 3RNIA 5K4JA 2E9OA 2VWXA 3NPCA 4YJVA 4A06A 5JKGA 2R3KA 4R78A 3AC1A 5AX9A 4EI4A 1OKZA 4YHJA 3RNYA 3IW7A 1PXKA 4E6QA 1GZ8A 4Y73A 4C34A 4O82A 2E9UA 4KBCA 3GC9A 4ANMA 3UIUA 4RX5A 4K8AA 3RK7A 3GU7A 2Y9QA 3OD6X 1Q97A 4XP0A 4KINA 3ZONA 2CKQA 4O27B 3ZU7A 4L3JA 3RAIA 1FBNA 1W83A 3PWDA 1W8CA 1V1KA 5JGAA 2WU7A 4G3DA 3MB7A 4RC3A 4FKOA 3PY0A 2W1HA 5HNIX 4JL9A 3D9VA 1H25A 5HI2A 3UODA 4FSMA 5IH5A 4DH3A 2VO6A 4G9CA 2ITTA 1FOTA 3OCBA 4RGJA 4CV8A 3PFQA 2C5NA 3HLLA 5BYLA 3H9RA 1PMNA 3A7GA 4U7ZA 3MY0A 4QYHA 3HL7A 4LGDA 3O0GA 3QRJA 5AP0A 3EQGA 4QYYA 3SW7A 5M53A 4CTCA 3SLSA 2HOGA 5BVEA 3FZOA 1AQ1A 2IVTA 2WB8A 3M42A 4EJ7A 3QTWA 3PRFA 3D15A 4R8QA 3UVPA 5IQEA 5EW3A 3QTZA 2IVVA 2IZUA 3GVUA 2UZOA 4Y5HA 5CU0A 4OTRA 3CKWA 4FTAA 3EQBA 3Q4UA 4FSWA 3HZTA 3DU8A 3IKAA 5E8SA 4B9DA 1YWVA 2OF2A 3KULA 3OTVA 4RA5A 4BCQA 2XYNA 3ZRMA 3R9OA 4CKJA 1YVJA 4Z7GA 2ZM1A 2X4FA 4O0UA 4YSJA 4FTKA 5HIBA 5HX6A 3TDWA 3U6HA 4IB1A 1H1QA 4H58A 4EUUA 3D7TB 4GG5A 3QHRA 4DH5A 3BHUA 1ATPE 2ERKA 1ZOEA 3IW5A 4EH5A 2E9VA 3VHEA 3I0OA 3RKBA 4JAJA 2ETMA 4IB3A 3ZRKA 3ZS5A 4ACCA 4O83A 1URWA 4B6LA 3DQWA 5J9LA 2UW7A 2Z7QA 3LFBA 4RX8A 3RHXA 3U87A 4CRSA 3R0TA 3FAAA 3W32A 4DFLA 5IEXA 5M07A 2ZDTA 4A9TA 2F7EE 2UVXA 3UQFA 4O0SA 3BRBA 1R0PA 4QPSA 4XBRA 2ZMDA 3MH2A 4X2FA 5HHWA 1H0WA 3QAME 4DFZE 1AGWA 3OBJA 4J7BA 5IU2A 2PVJA 5TOZA 5A6OA 3NGAA 3A61A 3ORLA 3P7BA 3OXIA 2VWIA 3UE4A 2OLCA 2WMRA 3QCSA 2WQNA 4MX9A 4M8TA 5HCYA 1JKKA 2ETRA 3RPSA 5J7BA 4MEDA 2QO9A 4GUBA 5IQDA 3ERKA 3JY9A 3PXFA 3UC3A 4D2VA 2X8EA 4E1ZA 3LXPA 4WSQA 4HVHA 4MQ2A 3ZLSA 1KSWA 4ANNA 5AP2A 3LCTA 4HNIA 5GJDA 5CQUA 5M51A 5BQ0A 4M66A 3HMMA 4YLJA 5HNBA 3F5GA 4H39A 1ZYCA 5CU3A 5L2IA 2YM7A 4EOJA 3QQUA 4G3FA 5ANEA 3GNIB 5AP1A 3Q9YA 3T3UA 2VTNA 3MESA 2I6LA 3HUCA 2X2LA 1ZOGA 4MBJA 4QQ5A 4NM7A 4FTMA 2WQOA 2UW4A 4HGEA 5AP7A 2B55A 5CVGA 4ZTNA 2XKFA 1KV2A 2C5XA 3G90X 4XG6A 3VRYA 3HMNA 4FTJA 4MXZA 2W99B 3RAHA 4C57A 4RIWB 4FZAB 3EL8A 3BEAA 2OFVA 4Y83A 5ACBC 3LZBA 3P86A 4F0GA 4F63A 5CF4A 4GG7A 3FY2A 4IWDA 3R7UA 5CZHA 1OZ1A 4DBNA 3EQHA 2R3GA 2BKKA 3F3VA 3PJ2A 1BLXA 4QMQA 1H26A 2UZNA 2W1CA 4EH3A 4FEXA 4C59A 3BZ3A 2GTMA 3KXGA 4F4PA 5AP3A 5J8IA 2XH5A 1NY3A 2HCKA 4M68A 3D94A 4RWJA 2BZKB 2WELA 5HO8A 1W0XC 3MPMA 3VS2A 4X6RA 2W4KA 1FVVA 4I6BA 4Y8DA 3D5VA 3DS6A 2O65A 4FOBA 4GU6A 1CSNA 3E8NA 5IUGA 3DXPA 2XEZA 5H8GA 1GZKA 3R6XA 4TYIA 5T68A 3DKOA 4R5SA 4YMJA 3E8CA 3QD3A 5ANOA 3VW6A 4K2RA 4PF4A 4TZRA 4K11A 3OFMA 4RLKA 4S30A 5DHJA 5H3QA 3NYNA 3RK5A 5D1JA 3BELA 4G2FA 2GMXA 3JY0A 3BU3A 2CMWA 4FKRA 4WUAA 2HZNA 3QUPA 5IUIA 4CFNA 2VAGA 4IX4A 4MQ1A 5E8TA 3T9TA 3GEQA 3NUNA 3R2YA 4BIBA 2OJ9A 3C4CA 4QMSA 5I4NA 4F9CA 2QR8A 2YISA 4IC8A 4C61A 5CNNA 5L2SA 1YRPA 2XUUA 3ZRLA 4FIIA 3D7TA 1O6YA 3IW4A 3R28A 4FICA 4I5PA 3CP9A 4FL1A 3QTUA 4J95A 4R1YA 4PY1A 4BCOA 5TT7A 2C69A 4BKYA 2YIWA 4KA3A 3ZFYA 1NVRA 4X3FB 3R9RA 1FVRA 1WBSA 3CQWA 5DGZA 3PG1A 5L6PA 1GZOA 4IVDA 4C4HA 4GRBA 4XMOA 5E1EA 4EH8A 2HZ4A 2NRYA 4O0VA 2QOIA 3E5AA 5KHXA 4O6LA 3FXXA 2QURA 3GBZA 4QO9A 4FKPA 4DG2E 4I93A 3CR0A 1FGKA 3AD6A 3CQUA 3QQKA 4HPTE 3R8ZA 4TW9A 3KXMA 1TKIA 4FV3A 4JBVA 3WZEA 5BYYA 1H1SA 4J97A 3WE4A 1UWJA 1ZAOA 2A0CX 3QCXA 4RC4A 3UPZA 3PLAE 2XKDA 4XV9A 3NAYA 3ZSHA 2RIOA 3NDMA 1GZNA 3G6GA 2FO0A 2QD9A 4EOOA 1OL6A 2XK9A 2QC6A 4L8MA 3SX9A 4DEHA 1OB3A 3GFWA 5EM7A 3PE1A 4F9AA 2YEXA 5CEIA 5KO1A 4OBOA 3QZGA 5D12A 1OL1A 2XYUA 4BRXA 4TY1A 2J4ZA 1ND4A 1R0EA 2PSQA 4I94A 4HW7A 4AP7A 1F5QA 4DH1A 2OICA 2WU6A 4IX6A 5C1QB 3MFTA 3PA3A 4UV0A 3R2BA 4BTMA 3LFSA 2PUPA 3JR1A 4DYMA 3QC9A 3GU5A 2W1DA 3RINA 3UG2A 3ZC6A 2ZVAA 1H1RA 3ZM4A 4BICA 4DHFA 2WIHA 3W2QA 2WTIA 2XK3A 3U54A 4BL1A 3VS4A 5AUUA 3QBNA 1H01A 1Q61A 3U6JA 4TKSA 2X8DA 4KKGA 1OIUA 2WMXA 3FSFA 4M7IA 3W8LA 4H05A 3TNQB 3AQVA 4RIWA 5M56A 1PKGA 4ZY5A 4C4IA 5K3YA 1XBBA 3QTQA 3AC8A 2Q0NA 3LM0A 3F69A 3D5UA 4PX6A 2C4GA 3VJNA 2I0EA 1ZY5A 4TWNA 2VD5A 3BPRA 2OJJA 4WSYA 4X2JA 1M2QA 4XHKB 2WMBA 2FSTX 4ASDA 5C4KA 1YHVA 5TR6A 4IZ5A 4QMLA 3D0EA 1FMOE 4D9TA 4HVDA 4FK6A 4O81A 4X3JA 3RZBA 5EHOA 4DAWA 4KIKA 5EI8A 2QLQA 4C36A 4DC2A 3DAEA 3JVSA 2OJIA 3KXZA 3RWPA 4U6RA 2HXQA 4E7WA 4FT9A 2QOLA 2JDVA 3MY5A 1XH7A 3TKUA 4XS2A 3THBA 4ASXA 3KL8A 5A4LA 3LOKA 2QQ7A 3FQEA 4FIEA 3RVGA 3LVPA 3R9HA 4NTSA 3ZO4A 5HCXA 5GJFA 1PXJA 3LJ2A 5DYJA 5DEYA 2WFYA 1K9AA 4HYUA 4AW1A 4Z3VA 4UWYA 4R5YA 4BBMA 2JKMA 4CNHA 4ZSAA 5AADA 5LVLA 3MVLA 3CD8A 4IMYA 4V0GA 5IZFA 3B2TA 5LVOA 2J0KA 2CSNA 2JFLA 2XP2A 3KN6A 4NW5A 5AV3A 1IEPA 1YWNA 3VQUA 3GB2A 4G3GA 3LXLA 4IWOA 3ULZA 3HMPA 4CFWA 5JQ8A 3GXLA 2FSLX 1Z57A 5CSVA 3GCVA 4GK3A 2BFXA 3W2RA 4XG3A 2Z60A 2J0IA 3O8PA 1P4OA 4E20A 4EQMA 5L2WA 4GT4A 4PWNA 2RF9A 3ZLYA 3VW8A 3EQDA 4F9WA 1OM1A 4AG8A 1MUOA 4YP8A 4FUXA 4E5WA 1RDQE 2JD5A 3L8VA 5J7HA 4FMQA 3LLTA 2F57A 2QOOA 4GT5A 4HYHA 3W2PA 4BGQA 1G5SA 3CKXA 3QZFA 4MVFA 5E92A 3TNIA 3FUPA 4A4LA 4EORA 5CSPA 1V0BA 1CTPE 4JVGA 4XRLA 4OAVB 2B0QA 4IEBA 4BN1A 4GMYA 5FEQA 1BX6A 3GCUA 3Q2JA 3F7WA 4PDPA 4YO6A 3IOPA 3KFAA 2EXMA 2G1TA 3CGFA 5KMIA 4EOSA 2X9FA 4B8MA 2FA2A 3NCGA 4WBOA 2CCHA 4RC2A 1YDTE 4I0RA 4I4EA 3RAKA 3DB8A 2XVDA 3OW3A 3UYSA 3R7IA 4PQNA 3V6SA 3ZMMA 4AW5A 5JSMA 1DAWA 5B0XA 3EQIA 1UA2A 4HNFA 3E62A 4LMUA 2O8YA 4IB5A 4JOAA 3QUDA 2Y6OA 3MA3A 3HAMA 2C6LA 2X8IA 4DEDA 5A9UA 3UZTA 2JGZA 3MTFA 2XJ1A 1PXNA 3DNDA 3R02A 2BHHA 3R22A 4BBEA 1WMKA 4CT2A 4L00A 5HIEA 4K6ZA 4ZIMA 4CFFA 3FDNA 4Q5EA 2EWAA 2VU3A 4TWCA 5H9BA 2R3JA 4RVLA 4H1JA 2QO7A 1ZMUA 3K3JA 5DRBA 2F4JA 4JRVA 4XG7A 3OY1A 2F7XE 4S33A 4XYFA 5DA3A 4ASZA 5BVOA 3R1NA 2GQSA 5HLWA 2WO6A 3L8SA 1PYEA 4ACDA 4FZ6A 2HAKA 3C4FA 5AR8A 2XJ0A 2O2UA 3BYMA 1XWSA 2V55A 2VWUA 3E64A 5L8LA 4PV0A 3U4WA 3L1SA 4CV9A 2Z2WA 3U9CA 2YAKA 2JDTA 4FSRA 5HG7A 2VTRA 4HOKA 3SRVB 3C7QA 4FTUA 4C2VA 3W55A 4RWLA 4RMZA 2R0IA 4UMQA 3FY0A 3QYWA 4JRNA 4USFA 1OBGA 2R4BA 3IONA 4JIKA 2PE0A 1XO2B 3ZBXA 1H0VA 4XEYA 4CYJA 3R1QA 3QTSA 5BVDA 5KMKA 3DA6A 2ZB0A 1OPLA 4M67A 2OIDA 1PJKA 3LMHA 3VF9A 4ZP5A 4NM3A 4Y46A 3FMHA 4KBAA 4YJOA 3SC1A 4UXQA 2O63A 3DK7A 5DOSA 4DEIA 3B8RA 3PDTA 3FI3A 4BDDA 1JVPP 1YOJA 4WT6A 4WHZA 3K5UA 4D2SA 4E26A 4U45A 5IDPA 5JGBA 2UZUE 2X0GA 1HCLA 4NT4A 2YCSA 4CFMA 3LQ8A 3G0EA 3V04A 1IA9A 3Q6UA 3COHA 2PYWA 2J0JA 3WF7A 2IW9A 2GQRA 3B8QA 3Q53A 4DGLC 4MXYA 2XK8A 3EIDA 3L9PA 4FTLA 4IVAA 1ZMWA 3QTXA 3F3WA 3TKIA 4L52A 5IA0A 4L01A 4C4GA 5BMSA 2BPMA 4DBXA 3G9LX 3OWJA 1Y6BA 4FG8A 4KD1A 2VNYA 3FL4A 3LFNA 2R3LA 4NH1A 2PUNA 4FT0A 4UY9A 3CTJA 2ZB1A 4QP7A 4FVRA 5J1WA 3KVXA 5CTPA 3DJ5A 4BCNA 2BDJA 4WG4A 3VBTA 2X6EA 2YIYA 3S95A 5FBNC 3V6RA 5HG9A 3GC8A 3DBEA 3FL5A 5EOBA 2WMQA 5EKNA 4O7NA 4DT8A 4ZJVA 2OF4A 3RAWA 2XBAA 2CKPA 3ENMA 2XCHA 1OKVA 3ORKA 4HPUE 4M0YA 3F2NA 3P7CA 4GFOA 2P2HA 1CDKA 4IM3A 3W2OA 3SOAA 3V5WA 1H08A 4V01A 5FM3A 4BTFA 2R3FA 2VWVA 3DDPA 3KRWA 4YC8A 1J91A 3SG9A 2PZPA 3CIKA 4FIGA 3R00A 1B39A 1OKWA 3KY2A 4QP2A 5CYIA 2OIBA 1JBPE 4YZ9A 4ZJJA 4DLIA 3EQFA 2B1PA 1JWHA 3KMMA 3HVCA 3P08A 4N6YA 4Z16A 5AWMA 4GH2A 3BGQA 4UN0C 4ZMFA 3KRLA 2NRUA 2YM6A 1R78A 4QMOA 4D9UA 3NNWA 4BBFA 3NNUA 2YJSA 1QPCA 4DH7A 2B9HA 4QMNA 2WXVA 2WQBA 4FC0A 4FV5A 4TN6A 2C5YA 4FV0A 3SOCA 2FSOX 5CSHA 2UW0A 3UNZA 3QU0A 4NZWB 2WMSA 3DY7A 2C5VA 3MFRA 4EHEA 2IZTA 1PMEA 1XHAA 1YHWA 3WZJA 1BUHA 3K3IA 4XNEA 3HV4A 3TCPA 3ZSIA 3TN8A 1KWPA 5AAEA 1OECA 1MRVA 3CBLA 3ZTXA 4BCGA 1UNGA 3IGOA 4AZFA 4PUZA 4J53A 3VBQA 2WOUA 3I79A 3OY3A 4QTBA 5HQ0A 3N4TA 2CHLA 5FGKA 3P9JA 4MBLA 2BMCA 2GHMA 1RJBA 4CFUA 2ONLC 5EM5A 4X6QC 4IWQA 3EN6A 5DWRA 4ALVA 3DZQA 4FTRA 2ETKA 5I9VA 4IQ6A 3V5LA 3LW0A 3ZLXA 2PVRA 5LVPA 2WQMA 2XK7A 2ACXA 5CEMA 4F08A 1ZY4A 3ELJA 3NX8A 5CX9A 5HOAA 3DT1A 3TXOA 5HORA 1M2RA 4AT4A 4D4SA 2PVYA 2B52A 4IM0A 3RMFA 3ZXZA 4RJ5A 4Q5HA 4I6HA 3BHHA 3IO7A 2JKOA 3KGAA 2R3MA 3R9DA 5JMSA 3MIYA 4QYEA 4FT3A 3GENA 4IWPA 4QRCA 3IG7A 5AM6A 1JQHA 3MN3A 2BRBA 4YU2A 2PMIA 2QKRA 3VS7A 5AUWA 4IAIA 3MFSA 5H8BA 4D2TA 3VULA 4EQCA 4O1PA 3HGKA 2JDOA 4PL3A 3NIEA 4KBKA 3VBXA 1LEZA 4FTCA 2PL0A 2X4ZA 2ITVA 4YJQA 5AIKA 3H0ZA 4DFUA 5DH3A 3PJ3A 4U9AA 3OC1A 5D9HA 5T6KA 4ZLOA 4F7JA 4ENYA 3V8WA 5HEZA 2JDRA 1BYGA 4WG3A 2OWBA 5HKMA 4QNYA 3AXWA 3SHEA 5DE2A 5EHLA 4K0YA 4JLCA 1B6CB 3AT4A 5GNKA 5JK3A 5CSWA 1Z9XA 4AGWA 4YHTA 4JDKA 3DZOA 4ANSA 3FI4A 3JVRA 4G5PA 2FB8A 2SRCA 4ZY4A 2QOCA 5HESA 2XNGA 3ANQA 3G15A 3QD2B 1P2AA 2R3OA 1Y6AA 2IO6A 3C4EA 2UZDA 3EB0A 3ZOSA 3CY3A 4RQVA 2YJRA 2BAJA 4GJ3A 3DK6A 1LEWA 2JKKA 3LCDA 1ZMVA 3LFQA 4RT7A 2XS0A 3FLYA 3KN5A 3PP1A 4I41A 4QMUA 4FTQA 5HGIA 5HE1A 2WNTA 5L4QA 3SXRA 2PZ5A 5LJJA 3IOKA 4O22A 5CNOA 4BHNA 3N4VA 3MH3A 4W4WA 4UMTA 4A4XA 4F7LA 3FMMA 4PMSA 5AIRA 5BNJA 4I0TA 2VTPA 2WKMA 4FKLA 4GU9A 4M84A 2HXLA 2UZTA 3K2LA 4FK3A 5AUXA 1WFCA 4CD0A 2PVFA 3LFFA 2QOBA 2IVSA 2Y0AA 4BIEA 4WRSA 3DCVA 4JX3A 5JFXA 4LOOA 3UQCA 2VV9A 2JBOA 4E4XA 3HRBA 4XG8A 5A46A 4FSZA 4WG5A 3A99A 1WBTA 1BI8A 4UMPA 3QXPA 4O7YA 4WNPA 5K5NA 3F66A 2XNMA 3D2KA 3FBVA 2WAJA 5FTQA 3ULIA 5IA5A 3LHJA 3U51A 2OBJA 3PWYA 2RG6A 3PSDA 4BDAA 5HLNA 3NUSA 2J2IB 2WD1A 4H3PA 3HNGA 1QMZA 5CASA 4PTGA 4TYEA 5CENA 3NW5A 5F1ZA 5KKRB 3D7ZA 2EU9A 3F5XA 5D41A 2BAKA 2WTWA 1MQ4A 3NNVA
chains in the Genus database with same CATH superfamily
4EHVA 2W17A 2WTCA 1A9UA 4P5ZA 4BCPA 3OZ6A 3AMBA 1UNHA 5IH6A 1P4FA 4RWKA 3SG8A 1E1VA 2BRMA 3NAXA 2GDOA 1PW2A 2G15A 2XCKA 5EH0A 1OPJA 3VF8A 4LYNA 4M14A 3U9NA 2UUEA 4O0RA 1BL7A 3ORXA 4IFGA 3OP5A 4CQEA 2FGIA 3SXSA 5CF8A 4F7SA 2IN6A 5HZNA 1KV1A 4W4VA 3SKCA 2UVYA 2FH9A 5GINE 5IQIA 2GHGA 2B54A 2ZV8A 4L3PA 3QYZA 5HX8A 3EYHA 5AM7A 1OBDA 3FEGA 2PUUA 1E1XA 1OIYA 1U46A 4XV2A 3R7OA 2RFSA 4FKIA 4ERKA 4FTIA 5TF9A 3NUUA 1QPJA 2ITPA 4IANA 3QQJA 4XCUA 4IE9A 5KMMA 4MHAA 1ZRZA 5LCJA 3RHKA 3ZLWA 5IH4A 4EC8A 4EH4A 3ORPA 3QCYA 4XG9A 1WBWA 4FSNA 4CG9A 4FV6A 3WYXA 4DEBA 4U3YA 2E9NA 5CEQA 4GT3A 4BZOA 4LQMA 3EYGA 3BQCA 3QLGA 4RIXA 3TT0A 2A2AA 2P55A 2KTYA 1TQMA 2W4OA 4Y72A 1TQIA 3VO3A 1JLUE 2C5OA 3FQSA 3HMIA 3VUMA 3TM0A 2DUVA 2E9PA 3EQPA 1IASA 2UZWE 4JNWA 4MYGA 3AT3A 3LKMA 4G1WA 3T8OA 3UP2A 4HGLA 3ORNA 3ET7A 3FMJA 2XIRA 3E87A 3NCZA 4W8EA 5M55A 5HVKA 2WHBA 4PRJA 3O2MA 2H34A 3OVVA 3P4KA 4QMMA 5CEOA 4O84A 3ZM9A 1Y91A 3Q4ZA 1VLRA 3W0PA 2ITYA 4QPAA 4X3FC 4K77A 3IDPA 5E8VA 3S2PA 3TTJA 1OL2A 4GJ2A 5FUTA 2B9FA 3OOMA 4Y95A 3C5UA 3UDBA 3FHRA 3COIA 4FR4A 4I5CA 5IUHA 1QPEA 3NW6A 1O6LA 3DTWA 4DTKA 3N9XA 3S00A 4NU1A 3ALOA 4KKEA 4EZ5A 3HMOA 5CU6A 1U5QA 4K33A 4BWKA 2OXYA 3OMVA 5AR2A 2R3NA 4NJ3A 4L43A 4BI2A 5J9YA 2YCFA 2ZJWA 3FMKA 3A7HA 4EOQA 3RPRA 3UQGA 2NPQA 5JFVA 2JBPA 3QRTA 3DLSA 4RX9A 3WYYA 1G8AA 3QD0A 1H1PA 2BRNA 4FKSA 1JKLA 1Q8WA 1Q8YA 4ACGA 4DDIA 4JBPA 4BCKA 3FYJX 5E9EA 1M17A 2J90A 3H9FA 2AUHA 3O50A 4EONA 4O7VA 3V51A 3NUYA 5AP4A 4JT3A 5DBXA 3LQ5A 1DS5A 4IZ7A 4B7TA 4IJPA 1DM2A 4BDFA 3TUBA 4O0TA 4L7FA 1SM2A 2PVMA 1XMMA 3QA8A 2XRUA 3VHKA 4I22A 4II5A 3Q96A 4ZK5A 3ORTA 4HZSA 3RP9A 2CN5A 3EL7A 3BE2A 2LAVA 2H8HA 1UNLA 3FQHA 3NYXA 1W84A 2C6OA 2VX3A 3AMYA 4F6SA 2V62A 3BBWA 3OW4A 2ONLA 4C3RA 1KE9A 1VJYA 4JAIA 1JSTA 5CZIA 3EN7A 3UZRA 4D2PA 4ANBA 4AT5A 2YWVA 1GJOA 4RZVA 5B2MA 3SV0A 4IH8A 2GNJA 2F49A 1YWRA 4YBJA 3ZUVA 3DAKA 2BHEA 2PK9A 2W05A 4J1RA 4RSSA 4BDHA 3KCFA 5HTCA 2GHLA 5A54A 5EG3A 3Q9XA 3ZDIA 3BEGA 4QYGA 5KBQA 2UZBA 4OT5A 4DG0E 4IM2A 5HICA 2I0YA 4WKQA 5C8KA 1SVHA 4RIYB 1P14A 3TWJA 2VTIA 3UJGA 3W1FA 2A27A 3R8UA 3MPAA 2OXDA 4M15A 4R3PA 4D28A 5AUTA 2B7AA 2BKZA 5IA4A 3E3PA 2BRGA 2XM8A 2PTKA 4FG9A 5DRDA 5M06A 5DT0A 3PG3A 2FVDA 3G33A 4NKSA 4FTTA 4FVPA 2IPXA 5EM8A 1VR2A 4ACHA 2V22A 5IG1A 5JN2A 5CVFA 1ZXEA 5ITAA 4UZHA 4ZTLA 1KOBA 3BWFA 4MNFA 5LMBA 4XBUA 3CS9A 3WIGA 3PZHA 3Q3BA 3TEIA 2Y4IB 1GOLA 5IQCA 3I6WA 4FKJA 2BFYA 4FSTA 3U55A 3C5IA 5CSXA 4BI1A 3A8WA 2ZMCA 2C6DA 3F6XA 3TL8A 1FQ1B 1ZZLA 4FV9A 4O1OA 5FD2A 3CJFA 3H3CA 5CXHA 4AWIA 4B0GA 3FKLA 2HELA 5GIPE 3OBGA 2CGUA 5K4IA 2RFEA 2W1GA 3AC2A 2PE1A 3WILA 3A2CA 1YW2A 1KUTA 2AEGA 4AN9A 3PVUA 4MF0A 4U3ZA 2BTSA 2PMNX 4JX7A 3GU4A 5F4NA 1U4DA 2JIIA 3P23A 5DVRA 3LCKA 3OOGA 1Q8ZA 5H2UA 1PXPA 3R04A 4IB0A 3BV2A 3OROA 2I0HA 1QCFA 2PZYA 1JKSA 3UBDA 3UC4A 2R0UA 2C47A 2ZM4A 3FC1X 4HZRA 1PMVA 4MTAA 2OJFE 4APCA 4P7EA 4G3CA 2X9EA 5JZNA 3C4XA 5FEDA 3A62A 2A19B 1VYZA 2W7XA 3EN5A 4EHZA 4A9YA 5AV4A 2NO3A 2R5TA 5D10A 1I44A 3DBCA 3KCKA 5FM2A 4FSYA 4QOXA 2Z8CA 4LDTA 4G6NA 4F6WA 5GZ9A 3FJQE 5HO6A 3HYHA 4A9UA 3PJ8A 1OUKA 4FV7A 2C68A 4FBXA 5BUIA 2FYSA 5CI7A 3DBFA 4YJRA 3OXTA 4FL3A 4IW0A 4KNBA 3NLBA 1G3NA 1Q3DA 4LMNA 4JG8A 1IR3A 4UYAA 3WF5A 3HV3A 5L2QA 2X7OA 3LXKA 2WQEA 4D1XA 4C33A 2YLEA 5EI2A 3GP0A 4QTEA 1JSVA 3V5JA 2C3KA 3FI2A 1G8KA 4AXEA 1GY3A 4AFJA 3GFEA 3II5A 4E4MA 1X8BA 4QD6A 3TACA 3HRFA 4KSPA 4XV1A 4UMRA 5GZ8A 4C35A 1BKXA 3QQGA 4IZYA 2UW9A 4C62A 1Q4LA 4OBPA 2V7OA 4G9RA 5E8WA 4WOVA 5HIDA 3BV3A 1KE6A 2ZYBA 3HA8A 4F6UA 3NZ0A 2VGOA 2HW7A 4NEUA 1ZYLA 4CCBA 1RE8A 5JH6A 5HBHA 2R7IA 3TZ9A 1KE5A 3R8LA 5AR3A 2AC5A 3TTIA 4FODA 3E93A 3OCSA 4NW6A 1NA7A 4XOZA 3ZDUA 1GIHA 5IA1A 5CF6A 3ANRA 2UZLA 4RX7A 3BKBA 4QQCA 5D7VA 4HVIA 5BUEA 3PXZA 2X6DA 4GFGA 1WVXA 3NUXA 5EOLA 5IISA 1JNKA 1K3AA 3EZRA 3VAPA 2YM8A 4EBVA 4WUNA 3OUNB 3P78A 4JDIA 4FKGA 4FNWA 4RA4A 4X7QA 4LRJA 1CKIA 4RWIA 3DFCB 4U40A 4IAAA 1QL6A 2VO7A 4EZ7A 2IG7A 3OT3A 3SAYA 4FT7A 3NVKI 2VNWA 5IDNA 2P0CA 5D7AA 4BC6A 4E6DA 2EXCX 4FRFA 2CJMA 5DG5A 3FZPA 3P0MA 2O3PA 4AZSA 2YM5A 3V5TA 3D2IA 4OTIA 4AACA 3ORIA 1JKTA 3I5ZA 5CQWA 4E3CA 4CQGA 3E7OA 3U8WA 5LQFA 1S9IA 2AQXA 4HYIA 4QMTA 4BF2A 2BROA 3DV3A 3ZCLA 1XBAA 3HKOA 4HCTA 3ACJA 2R3QA 3OWKA 4HJOA 3O96A 4J98A 3W18A 4F9BA 3VUDA 3E8EA 4F0IA 4DF3A 3I1AA 4UYNA 4PL4A 2WZJA 5IQFA 3R8PA 4E4NA 4D58A 2W5BA 3KQ7A 3MSSA 4X3FA 5FXSA 4ARKA 3OF0A 3DQXA 2BILB 1SVEA 3RK9A 3ZUTA 5EYMA 4CYIA 3ZBFA 3VBYA 3TUCA 1L8TA 2HZ0A 2ITOA 4WRGA 4LRKA 4MBIA 4AOTA 5LARA 3DLZA 3DPKA 3D14A 3VNTA 2DQ7X 3UO5A 4NL0A 3CLYA 5AEPA 2C0TA 4C7TA 5JRSA 4BCHA 2C0OA 4H36A 3TZ7A 3VUGA 2VO0A 2WEIA 1URCA 2WMVA 4ZZNA 3W0NA 4MXAA 4A4OA 3DBDA 4U79A 5CANA 5IEYA 1UWHA 1YXVA 4Q9ZA 1SZMA 4ANOA 5DLSA 4RG0A 4I6FA 3TIYA 3O51A 4O4FA 3VBVA 2CDZA 5BUJA 2WEVA 4FV1A 3CTQA 4FTOA 3UGCA 4NFNA 3BHVA 2G2IA 5HE0A 4D0XA 3CY2A 3QA0A 2KULA 4GIHA 3HAVA 1VYWA 4BTJA 5I9ZA 4W4YA 2EUFB 1YI4A 2XK4A 2JC6A 3L9LA 1BMKA 2CCIA 2F2CB 2R3PA 2VX1A 3IPHA 2OGVA 5ANGA 5IQHA 4C3FA 4U97A 4ALUA 4ZEGA 3QKMA 4CMTA 2C6TA 3FLWA 3MVHA 5I5ZA 3HDNA 4CFXA 5IMEA 1MP8A 4RJ4A 3V8SA 4BYIA 4OTDA 2VRXA 4NK9A 5CLPA 5HU3A 3I7BA 3O7LD 1H27A 4E8AA 5K9IA 4EJNA 4WIHA 5E90A 4MH7A 4MKCA 4U8ZA 3Q4CA 3UG1A 3ZZEA 4R3CA 3M2WA 3C50A 2UZEA 4GYGA 4IX5A 5HVJA 4IVBA 3TNWA 4BZDA 5EK7A 3TV7A 3IDCA 4NWMA 2OZAB 4BKZA 1B38A 3BQRA 3L8XA 4J99A 2YABA 1KE7A 1TVOA 4BGHA 4AXFA 4PNIA 4BB4A 2Y7JA 4BCIA 3K5VA 4C02A 3QKLA 4C0TA 2GFSA 2X7GA 3NUPA 4P2KA 3RCJA 4MD7E 3QQHA 4IDTA 3P5KA 1BI7A 2B53A 4LV8A 4NJDA 4EOIA 4FF8A 4QTDA 4YC3A 2VWWA 4MXCA 3FE3A 1OKYA 2V0DA 4OUCA 3DJ7A 2YN8A 4NYEA 3GU8A 4DTAA 3O23A 4JIAA 3DGKA 3EJ1A 3CTHA 3EZVA 5BX0A 4CEGA 1T46A 4IACA 4F1OA 4FSUA 5CF5A 3AD5A 3EMGA 2QOFA 1J3HA 2YDKA 4D1SA 2E2BA 4RVTA 5B2KA 3ENHA 5A6NA 4PPCA 1V0OA 4AFEA 2YAAA 2GS6A 4O4BB 4R1VA 3R9NA 4R7BA 2PUIA 2PULA 4N70A 4BGGA 2F7ZE 3LCOA 4J52A 1H00A 3UVQA 3VS5A 3WIKA 4E4LA 4O38A 4F9YA 4PNKA 5C01A 5I9WA 3GC0A 3NUAA 4N57A 2RG5A 4R6VA 4IBMA 1L3RE 4TTHB 5AUZA 4L44A 4OTHA 4NIFB 2YITA 4FNYA 2W1IA 3Q9WA 3EFJA 2XB7A 3UNJA 5CU4A 4R77A 2ITUA 2W5AA 3RBWA 4MCVA 4FTNA 3TUDA 3FPMA 5CWZA 2W1ZA 3RPOA 3F3ZA 5E8ZA 3CE3A 2X81A 3U4UA 3W8QA 4D2WA 3QC4A 4EKKA 3PJCA 5AV2A 1M7QA 4IX3A 2C30A 5DT3A 4AGDA 4XG2A 3NW7A 4FKWA 4O4DA 2G01A 3WZUA 3QQLA 2RSVA 4OTFA 3KB7A 3C1XA 3D4QA 2HWOA 1WBOA 5EW9A 2OH4A 4JQ7A 3R8VA 1MRUA 2X39A 2B9JA 5BV3A 3GC7A 4EZ3A 2BZHB 5DR9A 5AAGA 1J1CA 3FMLA 3OS3A 3TV4A 3AT2A 4DGMA 3Q60A 4AN3A 3UOHA 3CJGA 1SNXA 2WMAA 2J5FA 4KWPA 4BDJA 4FKQA 4IAFA 4RJ3A 4S2ZA 2YERA 3ACKA 3R7GA 4O86A 3NYVA 4FIHA 2RFDA 1YXTA 3PA5A 3WZDA 3A7JA 4X2NA 2C1AA 4EK8A 3FZTA 4E6AA 1RW8A 4MNEB 5M4UA 1SVGA 3R63A 2PZRA 3IECA 2O5KA 5E8XA 1VEBA 5HE3A 4XRJA 3OHTA 4F65A 2EXEA 3L9NA 5CT7A 2H6DA 2ZV7A 3RTPA 3Q9ZA 3QQFA 4IVCA 2Q0BA 5CAUA 1WVYA 5C4LA 1STCE 3OEZA 4DA5A 2JFMA 3CPBA 1IG1A 2GFCA 4RVMA 4O7LA 1H1WA 2O64A 4I3ZA 4PP7A 3QX4A 4GKIA 2GNHA 2BIYA 4UMUA 2OSCA 2CGVA 2VTAA 5KZ0A 3HDMA 5DR6A 4KKHA 4TYHB 4QTAA 4BDKA 5M44A 3FWQA 4UZDA 2XIKA 1M52A 2C6MA 2G2FA 4ZLZA 3AKLA 4QMYA 2OZOA 3G0FA 3QGWA 4RPVA 4O21A 4PDSA 4S34A 5C27A 4F09A 3NVMB 3PPKA 2Z7RA 4ID7A 2Y4PA 4L45A 4LUEA 2XBJA 3L8PA 4XG4A 3CPCA 3VJOA 2ZAZA 1NW1A 3Q5IA 5KKRC 2JIVA 3PPZA 2BALA 2I40A 4QNAA 4R3RA 5EYKA 3RM7A 5A4CA 3MB6A 1OPKA 4JDHA 3EFWA 2HY0A 3SRVA 4P90A 4WBBB 3HUBA 3SXFA 4CKIA 4DFNA 3HP5A 2Z7LA 4ANQA 4YO4A 4USEA 4U44A 2CNUA 3DAJA 2HW6A 5E4HA 3S3IA 3BLRA 4EUTA 2QLUA 4IAYA 2BR1A 4FYNA 3WF6A 4X2GA 2ERZE 2Z7SA 5A3XA 4FNZA 2ITXA 3TV6A 3ODZX 4QP6A 4AU8A 4ZLYA 5CALA 3PPJA 2WTVA 4OR5A 3R1SA 1H07A 2X7FA 2J6MA 3GOKA 4BWPA 5DMZA 4I20A 4YLKA 3RALA 4O7RA 4LRMA 2HYYA 5GJGA 5IQGA 4R7HA 3BU5A 3ZH8A 3AC3A 4Q9SA 4MK0A 3GQIA 1Q8UA 4O7TA 1CKJA 2GNFA 4DCAA 3BX5A 4YZDA 5BVNA 3ZO3A 5GHVA 4Z9LA 3MI9A 3PVGA 1O6KA 4P4CA 4GCJA 4EWQA 3F3TA 3CXWA 3WF9A 3LFCA 3W0QA 3KREA 4FGBA 1UV5A 5KX8A 2ITZA 3QZHA 3G5DA 1YHSA 4RBLA 3S0OA 1Y8YA 2VTSA 4L42A 5FTGA 4DH8A 3OG7A 4MUQA 3ROYA 4JG7A 3FC2A 3Q5ZA 3SDJA 1WBVA 2PMLX 4YZBA 4XUFA 3UIXA 3KXHA 4YJSA 3C0HA 5AUVA 1CKPA 2GNLA 3PIYA 5IF1A 3ODYX 4E5BA 2W4JA 2YCQA 4JG6A 4AZWA 3QFVA 4GFMA 4KIPA 5FG8A 3ZO2A 4BFMA 1KE8A 2IWIA 2CLQA 4I23A 4FUYA 3RPYA 2J50A 4EH2A 4CGAA 4UALA 5L6OA 4Y5QA 2QKWB 2GS7A 3V5QA 1OIQA 4FZ7A 4FEQA 3NYOA 2XKEA 1UVRA 4B4LA 4HCUA 1WAKA 2HWPA 3HV5A 5G1XA 4PMTA 4UB7A 5D11A 4QMWA 5HTIA 4EK3A 3BYSA 3KF4A 3PJ1A 3FMNA 5FP6A 4GYIA 4H1MA 4IAZA 5F95A 5LOHA 2CNVA 2GCDA 3EOCA 2UW6A 3A4PA 5DFPA 5K0KA 5HVYA 5ETFA 4YURA 2ZFYA 5ANKA 2A98A 4YTIA 5K0XA 3AG9A 4E73A 2CGXA 4IIRA 1YI3A 4O0XA 4F0FA 4X2KA 2PVKA 2J51A 4X0MA 1Y8GA 2YDIA 2YWPA 5EW8A 5HE2A 5HG8A 3A60A 4DT9A 4YBKA 5AV1A 3QTIA 5H8EA 3D5WA 2DWBA 4LGGA 4QP9A 4RFMA 5BMMA 4D5KA 4QMXA 2W1FA 3A8XA 3LFEA 3R83A 2C3LA 1PRYA 2IJMA 3A7FA 3F88A 4QP4A 2H9VA 3PSCA 2X1NA 4O6EA 3ATSA 1JPAA 2GU8A 2OG8A 4XOYA 1FINA 4GVAA 4YGAA 5I9YA 3FV8A 4FL2A 2JIUA 4O7ZA 5EYDA 3M11A 3RPVA 4DFYA 5KHWA 4BIDA 2UVZA 4BCJA 4EH6A 4AXCA 4QEBA 4EC9A 1HCKA 4GW8A 1HOWA 4EEVA 4BI0A 3BGZA 4YJTA 4PMPA 3FZRA 4L6QA 4WNOA 4BY9E 3ZHPC 5IA3A 2I1MA 5ICPA 5JRQA 4YR8A 3VUHA 2C1BA 4K18A 4PP9A 4CVAA 2I7QA 3BCEA 2VTOA 4F7NA 5CAQA 4DTBA 4XLVA 4FE2A 1WZYA 5IEVA 3EQCA 4ONAA 5CEKA 5L6WL 5I9UA 4YPSA 1ZYJA 3I4BA 3ZZWA 4CG8A 3NFFB 3BLQA 4W9XA 1JOWB 2OI4X 4OBQA 4XLIA 4UXLA 4J8MA 3DNEA 4NM5A 5ANIA 1XH5A 4K9YA 4U41A 4EK5A 3R7EA 4N0SA 3KK9A 4AGUA 3CC6A 2UV2A 3PVBA 3R7VA 1PXOA 2QG5A 3V5PA 2W06A 4D2RA 5J79A 1IRKA 3GT8A 3H4JA 3NS9A 3KF7A 4U0IA 3VS0A 4BDCA 3DXQA 1S9JA 2QI8A 4JR3A 2FUMA 3R21A 4LOPA 3HRCA 1XQZA 1WVWA 5HD7A 1H24A 2OU7A 4BDGA 1WBPA 2WTJA 1UKIA 3A4OX 4K1BA 5DPVA 3DTCA 3MWUA 3EKKA 4LL0A 4QPMA 2W96B 5BVFA 5JGDA 3NIZA 4KIOA 1JSUA 3UTOA 3W33A 1QPDA 3TKHA 4MAOA 2Y4IC 3OCGA 5E91A 4CTBA 5J1VA 3W2CA 1Q62A 4YTCA 1W82A 2PWLA 3COMA 4LV7A 5HLPA 5M08A 4OTWA 2XK6A 3EFKA 1F0QA 3PIZA 4AE6A 3KK8A 3BYUA 2P4IA 5AR7A 4XX9A 2ITQA 3LJ0A 4YHFA 2FSMX 2YM4A 3MIAA 3QKKA 4CZTA 4E6CA 4YTHA 3H9OA 4FNXA 3MY1A 4MWIA 5TO8A 4BTKA 3O7LB 5DN3A 1XJDA 4F1TA 2C3JA 2IW6A 2PZIA 3CEKA 3FI8A 5CAPA 3B2WA 4YZNA 2VX0A 3F3UA 3CQEA 3PA4A 4M0ZA 2C6KA 3FPQA 5C26A 5FXRA 4BJJB 4NM0A 4KUJA 1LUFA 1RQQA 2C0IA 3SQQA 2PMOX 3LE6A 4DEGA 1APME 4XJ0A 4FG7A 3MJ1A 2B4SB 4RIOA 4TNDA 3Q2MA 1LR4A 2CKEA 4U80A 4AA5A 1W98A 4PDYA 4I24A 2F9GA 5M4FA 2HIWA 1YXXA 2CN8A 3R73A 4TXCA 3EWHA 4J8NA 4GS6A 4YLLA 4ZS0A 4RQKA 2ZV9A 4AT3A 1XH8A 4RJ8A 2ZV2A 2P3GX 2HK5A 3COKA 3TNPC 2XKCA 3D83A 1XR1A 4I92A 4BHZA 3C4WA 1VZOA 2YM3A 4QMZA 3VBWA 1YI6A 4CKRA 3Q4TA 3D5XA 4XH6A 5T3QA 3P1AA 3HEGA 4FT5A 2BTRA 4JJRA 2QR7A 4HVSA 3AOXA 2ZM3A 5B7VA 4L7SA 3W2SA 4AA4A 3KRRA 3IK3A 3QUEA 2CNQA 2WTKB 3BWJA 2XIYA 4RFZA 2YFXA 3MBLA 1KOAA 4G3EA 4N6ZA 2P2IA 3QRUA 3GCPA 2ESMA 5A4TA 4TYGA 5AUYA 3I5NA 3VQHA 4Y85A 4L46A 4D0WA 5HO7A 4ITIA 3TI1A 3LJ1A 2VZ6A 2C6IA 2BDWA 2RFNA 2GQGA 4N4SA 4UWBA 3UO4A 5L2TA 5EHYA 4CLJA 4L3LA 2NP8A 3F9NA 4ZZOA 4GKHA 5HBEA 2JITA 4YNEA 4TYJA 1JAMA 4A07A 4RVKA 4OAUC 4EH7A 2BVAA 4M12A 5ANJA 4ASEA 4BDIA 4NUSA 2REIA 4C4JA 3KEXA 4JBOA 4TWPA 4F1MA 5TE0A 4DG3E 4YZCA 2VTLA 3PIXA 1M7NA 4L53A 4WO5A 3JUHA 5IKWA 2JAMA 2EB2A 4D55A 3QWKA 3RGFA 5CS6A 5AR5A 1U54B 4KIKB 3Q32A 4QP3A 2VWZA 1R1WA 1PKDA 4F78A 2XZSA 3IW8A 2VTQA 1P5EA 3PLSA 4FV8A 4AAAA 4B99A 2NNWB 3PZEA 2PVLA 4LI5A 4AF3A 4E5AX 3F5UA 3EH9A 2WPAA 5HTBA 2QOKA 4U5JA 3KKVA 3POZA 3MS9A 3Q6WA 4AS0A 3RI1A 4QT1A 4CT1A 4EBWA 1Q41A 1R39A 3QCQA 4L67A 5A14A 2ITWA 3KC3A 3QTRA 2XM9A 2V7AA 4OLIA 4A7CA 2OK1A 3VIDA 3FZSA 1DAYA 3ZFMA 1NVSA 1PXMA 3G6HA 3NR9A 3KA0A 3GGFA 4FIJA 4PTEA 1ST0A 1ZYSA 4ENXA 3QZIA 4HCVA 4ZJIA 4MD8E 2EB3A 2GNIA 5EYCA 3F7ZA 2VTTA 3I81A 2JAVA 1J7LA 2UW8A 3PVWA 5EI6A 2BIKB 4V0GB 1OL7A 3DXNA 3VS6A 1SNUA 4M97A 4LFIA 4KS7A 2ZOQA 4ITHA 4ZY6A 4ACMA 5IQBA 2BUJA 2R2PA 1ZARA 2VTJA 4NCTA 4O96A 4APPA 4DDGA 5CU2A 5IPJA 1GIIA 5ETCA 3A7IA 2P33A 5FTOA 3LXNA 3NNXA 1F3MC 5LWNA 4ZTMA 3LPBA 3VUTA 2OKRA 3PXQA 4C8BA 4ITJA 5KNJA 4EOMA 1UKHA 2J5EA 4JI9A 4KAOA 3RJCA 3QLFA 1MQBA 3F2RA 2XNNA 2VN9A 3C0IA 5TKDA 3W16A 2YZAA 3G2FA 1YKRA 5FP5A 4O7SA 4USDA 4U43A 1BL6A 1G8JA 3QRKA 2O0UA 4B8LA 2R64A 4I0SA 3DKGA 4JQEA 4ZSGA 4BDBA 4A9SA 1ZZ2A 3ORZA 3MV5A 3ZEPA 4U42A 4AW0A 4YTFA 1YDSE 5E8UA 3UNKA 3G51A 4D1ZA 3NWWA 2PY3A 1YXSA 4I6LA 2IW8A 4D4RA 3BYOA 3Q04A 2NYAA 4ZS4A 5M4IA 2WGJA 4ZSEA 2QODA 3EN4A 4G6LA 4LG4A 5FBOA 5BVKA 2BZJA 3I60A 1IAHA 3DB6A 3QD4A 3P7AA 2IZRA 5J95A 4H3BA 3QALE 3PXKA 2BRHA 1PY5A 4QQTA 3BIZA 2IVUA 4BR3A 3WBLA 1PXIA 3GI3A 4OTQA 1IAJA 5CI6A 1OGUA 4MF1A 4EQUA 4ORKA 3TJCA 2VGPA 5FWKK 4W9WA 4BCFA 3VUKA 4CRLA 5F94A 5HU9A 1UU3A 3ITZA 5A4QA 3V3VA 5EDQA 4C3PA 4DE4A 5FLFA 2WOTA 2XA4A 3DFAA 4FV4A 4GIIA 4RIYA 4C37A 4YZMA 4NKAA 1OITA 3HECA 4C2WA 4AQKA 4AOIA 2PE2A 5IA2A 3AC5A 4CFVA 5AMNA 4AZTA 2QHNA 1ZWSA 4RJ7A 5M57A 3WARA 3SD0A 3VS1A 4DGOA 3O17A 4BDEA 2J0LA 3NSZA 4KS8A 3F2AA 4LOQA 1NT2A 3UPXA 3LMIA 3OWLA 3ID6C 3I6UA 2A1AB 5BYZA 5GZAA 4S31A 1U54A 4AE9A 1FPUA 4YUQA 1Q99A 1UU8A 3LIJA 4TNBA 5DR2A 3TDVA 2OFUA 4EOPA 3N4UA 3NMUF 3SA0A 4S32A 2QO2A 5L3AA 2YIQA 2XRWA 2DYLA 4C4FA 5J5TA 4IDVA 3PXRA 1NVQA 4F70A 3U6IA 1SMHA 1XKKA 5AA8A 4QP1A 2WIPA 3QHWA 1ZLTA 2ZDUA 4GK4A 5EDRA 4J71A 4E93A 4H3QA 4FA2A 3PSBA 3R7YA 3FYKX 3LAUA 3LMGA 3MVMA 5E7RA 2R3HA 4C58A 3HX4A 4J96A 2XIXA 4EH9A 3POOA 3TZMA 4WA9A 5FRIA 2QU6A 1UU9A 4RLLA 1T45A 2CLXA 2XANA 3I0QA 3JPVA 2VTHA 1PF8A 1YOLA 4ZTQA 2XNPA 2YLFA 3H0YA 3KMWA 4FEVA 4C4EA 3IGGA 3BHYA 3MW1A 2WMWA 3UOLA 1SYKA 4YSMA 4GV1A 2QVSE 2EVAA 1PMUA 5EDPA 3FMEA 5LMKC 3QF9A 4OTPA 3PYYA 2VTMA 4GUEA 5ANDA 3V8TA 1WCCA 4AA0A 3OWPA 4M3QA 3ZSGA 3Q52A 4F64A 3UIBA 3UYTA 5L8KA 4XP3A 3DBQA 5CY3A 5ETAA 1WBNA 1IA8A 2PVHA 5FEEA 4I5HA 3UDSA 3W0OA 5KCVA 4FEUA 1GAGA 3EKNA 4CZUA 4HGSA 3E88A 4FX3A 4JXFA 4MXXA 4AOJA 4BZNA 1LP4A 1J7UA 2J9MA 4WNKA 3QL8A 4AQCA 3BU6A 4NFMA 3UVRA