3E3BX

Crystal structure of catalytic subunit of human protein kinase ck2alpha prime with a potent indazole-derivative inhibitor
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
334
structure length
334
Chain Sequence
MPGPAAGSRARVYAEVNSLRSREYWDYEAHVPSWGNQDDYQLVRKLGRGKYSEVFEAINITNNERVVVKILKPVKKKKIKREVKILENLRGGTNIIKLIDTVKDPVSKTPALVFEYINNTDFKQLYQILTDFDIRFYMYELLKALDYCHSKGIMHRDVKPHNVMIDHQQKKLRLIDWGLAEFYHPAQEYNVRVASRYFKGPELLVDYQMYDYSLDMWSLGCMLASMIFRREPFFHGQDNYDQLVRIAKVLGTEELYGYLKKYHIDLDPHFNDILGQHSRKRWENFIHSENRHLVSPEALDLLDKLLRYDHQQRLTAKEAMEHPYFYPVVKEQSQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Casein kinase II subunit alpha'
publication title Structure of human protein kinase CK2alpha2 with a potent indazole-derivative inhibitor
pubmed doi rcsb
source organism Homo sapiens
total genus 83
structure length 334
sequence length 334
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2008-08-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3e3bX01
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3e3bX02
2BZIB 4O7RA 3C0GA 4NEUA 4CEGA 2CNQA 1H1SA 4IHPA 2OJJA 2HAKA 4ZS4A 3H10A 4XYFA 3MFRA 2WO6A 4D1XA 1PXPA 4R7HA 4FV8A 4LG4A 2WGJA 3D2KA 3DAJA 3UQCA 1KUTA 4QT1A 1UVRA 1FQ1B 4FKUA 4X3FA 4C3RA 1PXNA 3OUKA 5C4LA 1UU8A 2E9PA 2YIWA 3GU8A 4FX3A 2YM6A 4HGTA 4N70A 4QNAA 4X2GA 5TT7A 4AA0A 5IUHA 1CSNA 4PL4A 3ROYA 2J5FA 3Q4TA 4R1YA 2GDOA 4AOTA 2PZPA 3KCFA 1KWPA 3WE8A 4FTKA 4WUAA 5K5NA 4LOQA 5CY3A 5E90A 5A4TA 2QOFA 1DI9A 4RZWA 4H58A 2XK6A 4DEBA 2R3PA 1G8SA 4XG2A 4GG5A 3EH9A 1E1VA 2X39A 4QPSA 3QTSA 4ZZMA 4CG9A 5FBNC 3QQLA 3O0GA 4FEVA 1PXLA 1KV2A 4XNEA 4LI5A 3C4CA 1YXUA 1KE5A 5ANDA 4XP2A 4UXQA 2R0IA 1GIIA 1O6LA 4KWPA 2YDIA 4M12A 3V3VA 4R77A 2FYSA 2W1EA 2QOBA 2GFSA 4N6YA 4CQGA 4EQMA 5HQ0A 1FVRA 2J0JA 3AT3A 4RJ8A 4N6ZA 3PIZA 4Q9ZA 1SMHA 4BIDA 3R00A 2QOIA 4J53A 2BRHA 3UYSA 3GBZA 3ODZX 4EH7A 3DTCA 3R1YA 3VJNA 3OD6X 4FTLA 2A0CX 4RFZA 4USFA 5BVEA 4M97A 3NMUF 3QHWA 2WTDA 4OTWA 3ACJA 4AFEA 3UIMA 1FVVA 4EBWA 4RIWB 3Q32A 4MQ1A 5AR7A 5DIAA 4FGBA 5FP6A 2YIYA 2X2MA 5H2UA 3THBA 5JFWA 1WZYA 1Y6BA 1S9JA 1NT2A 3OCTA 3BU3A 4C57A 1BUHA 4EKLA 3DA6A 4QPMA 2X81A 3AC1A 4EH4A 2BILB 3QF9A 3OEFX 3CPCA 3EQDA 5L6WL 2GQRA 4BCFA 2PVRA 5C27A 3R1SA 1CMKE 4S31A 2JBPA 4JQ8A 5KE0A 4O6EA 2X2KA 2HK5A 2WELA 2VTIA 3HMNA 4MD9E 3BHTA 5ICPA 5KZ0A 3UYTA 3I1AA 4GK3A 3DCVA 1UNHA 3L9MA 4HYHA 2XIRA 3BKBA 4O7NA 3NRMA 2G9XA 2J0MB 2PVKA 4BTFA 3AMYA 3P86A 4F64A 4NIFA 3S95A 4D5HA 3OWLA 2HZNA 4RPVA 5HORA 3QA8A 2CKPA 4C58A 4PV0A 4FVRA 5B0XA 4DCEA 5BX0A 5IMEA 3F6XA 2F57A 4RGJA 5DR6A 5HTIA 2ONLC 2IVTA 3G2FA 3LKMA 3VAPA 2P0CA 2BZKB 1JOWB 3NZ0A 3VJOA 4BTJA 3HZTA 3TKUA 5LMKC 5J1WA 4JG8A 3LCTA 3ZBXA 4F6WA 3RK7A 5FGKA 2PZRA 4H05A 3ZM9A 4FODA 4U44A 5DN3A 2RKUA 3AD4A 3KRJA 2ITQA 4HNIA 4ZK5A 4QMOA 3AG9A 4MK0A 4O7TA 3LE6A 5H8EA 3QALE 3EKKA 4DG0E 1PXIA 2XNBA 1DAYA 1XWSA 4KA3A 5HEZA 5F20A 3SGCA 3EL7A 3SXSA 1U54A 5I9WA 4FZ6A 4W8DA 2KULA 4M0YA 2P4IA 2XK8A 4EH3A 3DFCB 3K5UA 3VUTA 2W06A 4RG0A 4DT8A 3C4FA 4BYIA 3BV3A 4XG8A 1I09A 4AW5A 5AR8A 3FHIA 5GIOE 3OXZA 3DK6A 3LXLA 4DG2E 2NRYA 3G9LX 4BDBA 3PPJA 3TNQB 1YKRA 5AV0A 3GQIA 4I4FA 1Q8ZA 2GNJA 5EDQA 4ASZA 5A3XA 5E9EA 4IWDA 2ZM3A 4P4CA 1UU7A 2IZTA 1ZLTA 2WOUA 2XF0A 2XMYA 2YM7A 3QC4A 4Y72A 2PVLA 5IEYA 5FEEA 1B38A 2O0UA 3FMNA 5EQYA 3BCEA 3CKXA 3FMEA 3L9PA 3MS9A 1UU9A 4FTTA 4HGLA 4I0SA 3PY1A 3DY7A 4FV7A 4PUZA 4RSSA 4WD5A 3UJGA 4WSYA 1OPLA 1YQJA 5J8IA 4A4XA 1APME 2XIYA 2OJ9A 2V55A 2V62A 4JS8A 4R1VA 2ZDUA 4BR3A 4EWQA 4XBUA 1HCLA 5ETCA 3L8XA 1Q8YA 2CMWA 4Y95A 1QPJA 3AXWA 3CD3A 4TWCA 3MPMA 5E92A 2OIBA 1LP4A 4CFUA 2Y4IC 4BF2A 3AGLA 3R9OA 4ZMEA 2W1ZA 3CTHA 3JVSA 3QQGA 4F08A 1J7UA 2BMCA 3QXPA 4IFCA 4NKSA 5M55A 2UZDA 3R2YA 3VS3A 4L3PA 5K5XA 5M4UA 3KULA 1GY3A 1P2AA 4KIOA 4A06A 2A1AB 3KN6A 2OXDA 3IDPA 4EOQA 4E8AA 5EYMA 2OF2A 5IUGA 2QONA 1JBPE 3L8SA 2BTRA 1JVPP 4KSQA 5AWMA 4LGHA 4FMQA 4FKVA 3VRYA 4LMNA 3TXOA 2C5YA 4PP9A 2XK7A 4ARKA 5BMSA 3KL8A 2PE1A 2GU8A 4TNBA 4XMOA 3QAME 1Y8GA 4MQ2A 2ITUA 2RFEA 4P5ZA 4TYHA 5L2IA 4KUJA 3ET7A 2PL0A 2EB2A 3HV5A 4MWIA 1SVHA 4YBKA 4YNEA 3TNPC 3FY0A 4RT7A 2Y6OA 5BVNA 5AFVA 2JKMA 3R30A 3UP2A 2VWBA 3GENA 3QLGA 5LVNA 1A06A 3W1FA 5L2TA 3UG1A 4HZRA 4O0YA 2X7GA 5JFVA 4CMUA 4NM3A 2YWVA 1BYGA 1GZKA 2W17A 4PL5A 3FI4A 4FUYA 3DKFA 3E63A 3OBJA 5AAFA 3DS6A 4FT5A 2J6MA 2GHGA 2R3MA 3PE2A 4RA4A 3QYWA 3FMDA 3LFBA 3CS9A 3P1AA 4HYUA 2JDRA 3GCSA 3Q9XA 4DEEA 2W9ZB 3KVWA 4XG6A 2P2IA 2QR7A 3D7TB 4EK3A 3CD8A 4X6QC 4UMTA 4CCBA 5CENA 4YPSA 4BCHA 2WMVA 1Z5MA 4XBRA 3LJ1A 2OF4A 4JR7A 4AAAA 1YWVA 4IH8A 4YLLA 2JKKA 4KINA 5IA5A 4BFMA 4UV0A 3I5ZA 4C0TA 3A99A 3DV3A 4DF3A 2C5OA 2VTSA 4OUCA 3TT0A 5KKRC 3LFSA 2Z02A 4FSNA 3O8TA 3QA0A 5J87A 2ACXA 2XEYA 5F94A 4FTCA 4G6LA 5CAOA 4ANQA 3Q9YA 3VNTA 1J7LA 2VX1A 3ZBFA 4O0RA 1QPDA 4L6QA 3QZIA 4FSMA 3U9NA 5AAGA 5CT7A 3TZ9A 4TYEA 4YJRA 3PP1A 4GK2A 5J9LA 4HZSA 4BCNA 3CY3A 2KTYA 3LQ8A 4GK4A 4EOMA 2XIZA 3JY0A 3RVGA 1KE8A 3ZSIA 3O50A 4D2SA 3VUGA 4YHFA 1G5SA 3W2CA 4V04A 3NS9A 4IANA 3JPVA 4QP9A 3RALA 4MVFA 4OTDA 3P0MA 1H1RA 2FGIA 3ZSHA 5HX8A 3C4EA 1WMKA 3LCSA 3OTUA 4GT4A 2BZHB 4H3PA 1IG1A 5EHOA 4PQNA 4IWPA 4K9YA 2Q0BA 3GU5A 1W83A 5CU0A 3KRXA 4PP7A 2FO0A 3TNWA 3PIXA 3VIDA 5CAQA 2GTMA 1Q3WA 2W96B 3IDCA 4ANMA 2X2LA 2BZJA 4R7BA 4Z3VA 3MESA 4YZBA 3F9NA 3COIA 3BU6A 4CFXA 4MF0A 3KXXA 3HX4A 3UTOA 4KIPA 1PXOA 2EB3A 1U5QA 4FKQA 5CI7A 4RX9A 5BVOA 2EXEA 1BL7A 3VHEA 4FV6A 4FKLA 4MHAA 4DHFA 4C7TA 1ZMWA 2BFYA 4UEUA 2HIWA 4I0RA 4Z16A 1OBGA 1PYEA 2QOQA 3V5PA 3Q5ZA 4GSBA 1GZOA 3DBFA 3R9DA 5FQDC 5CF6A 1H1QA 2VWYA 2RFDA 2XJ1A 3FC1X 4F9BA 5DPVA 4ZP5A 3QQUA 5FEQA 4TYGA 1Q8WA 4Y5HA 4GU9A 2V7AA 2Y4PA 3IW6A 3NNXA 2R4BA 3PIYA 4Q5EA 2B9FA 5LWNA 3T9IA 3ORPA 1YDSE 1ZYDA 4PY1A 3IW4A 3QFVA 3OCGA 4IAKA 3MPAA 4ZY6A 2YFXA 1BMKA 3NUSA 4U8ZA 3BELA 5TR6A 3KRWA 4FTMA 3S2PA 4KB8A 2UVXA 3R22A 3DXNA 3E64A 4S32A 4O2ZA 2RG5A 4B4LA 4RJ3A 4MXZA 5CF5A 2OJIA 3AC5A 2B9HA 3EOCA 3HMOA 5CS6A 2GFCA 3EN4A 5HVYA 3CCNA 4FSZA 3CPBA 2BROA 4P7EA 1FPUA 3BQCA 4AGUA 3E8CA 4BIBA 5HGIA 5AP0A 3Q96A 4O82A 2J0IA 4E6QA 4FVQA 4FK3A 4O0XA 3SVVA 5IQGA 2YZLA 4K18A 2PY3A 2FSLX 2WTKC 3B2WA 4NWMA 4LGGA 4DAWA 3KXMA 4IX5A 2HZ0A 4ZSEA 2PUNA 5HG5A 4WO5A 4F0GA 4IB5A 3D5XA 4I3ZA 4PMSA 4ID7A 2CPKE 3FXZA 4YR8A 4KBAA 4OTHA 2XJ0A 4B8MA 4G3DA 4IEBA 1OUKA 3DQWA 4RX8A 4MEDA 4L45A 2CKQA 4J99A 4EH9A 5A14A 2ZV2A 5EI8A 3TNIA 4JAIA 4BC6A 4L67A 3IQ7A 3V5JA 4ACCA 3EYHA 4KNBA 4IBMA 2PVFA 3BGQA 4XH6A 1Z9XA 2GNFA 4FKTA 3IW7A 4F1TA 3O8PA 5EOLA 4EOSA 4Y46A 2BRNA 3FLYA 4U80A 4HGEA 3B2TA 4KIKB 4NW6A 4YSMA 5C26A 4JG7A 3Q3BA 3SG9A 2YM4A 3UBDA 4XV1A 5J1VA 2OH4A 1Z57A 4XV2A 3TIZA 3HVCA 4DEHA 3FZRA 5FDPA 4X2KA 5D11A 2Z7LA 3C4WA 3EWHA 2RF9A 2Y0AA 3E93A 3JR1A 2CCHA 4HVDA 3FMMA 2X8DA 3F3ZA 4QP3A 3DTWA 2X8IA 5M53A 5IH4A 4NM0A 4XOZA 2BAQA 5T3QA 3SQQA 2C3LA 2A2AA 2WQBA 4XP0A 3MA3A 4C8BA 1M2QA 1OMWA 5DEYA 2QHMA 3ZM4A 4AUAA 2ZVAA 3LQ3A 1J3HA 2OBJA 2WXVA 3POOA 4FKIA 3ZLXA 4ACMA 2X7FA 2XZSA 3Q2MA 4FT9A 2JEDA 5BYZA 5DYJA 4RWKA 3GC9A 4U79A 3MDYA 3OUNB 1E9HA 3ZUTA 4LRKA 4PDOA 3VUMA 3KULB 3IECA 2B55A 2QD9A 3Q6WA 4TPTA 2QQ7A 3UVRA 3OBGA 4M68A 4QQ5A 1ZMUA 4R5SA 4RIOA 1WAKA 3W10A 2QHNA 4FYOA 4FZ7A 2ETRA 1NVSA 2ITPA 4YJSA 1NXKA 2WMBA 2PSQA 4L46A 4IB1A 1YXVA 3U51A 3RM6A 2UZUE 3P9JA 4HYIA 3HMIA 3OCSA 2FSMX 4FTJA 4ZTSA 4G2FA 4EOPA 4MTAA 3HP2A 4AT4A 4EK8A 2BDJA 4JR3A 1XH6A 3RM7A 1DM2A 2GNIA 3COMA 3QL8A 3NAYA 2RG6A 1WBWA 1FMOE 3P79A 4X3FC 2WD1A 1SNXA 2BHHA 3A7IA 4GT3A 4JL9A 4RMZA 3CTQA 3K5VA 2IZSA 3R7YA 5AUUA 2OKRA 2R3KA 4P2KA 4FV5A 5GZAA 4I6HA 1ZMVA 4BTMA 1DI8A 4FKJA 4RIXA 3WF9A 3HMPA 4KRDA 3WIKA 1OL1A 5ANOA 3V04A 4KKEA 4DEDA 2VGPA 3ORLA 2HELA 2BDFA 1REJA 2XNEA 4JJRA 1W84A 4IZ7A 4FE2A 3LFDA 5HIEA 3AGMA 2A19B 3VS4A 4BZOA 3FMKA 4Y73A 5BYYA 1Q97A 3C4ZA 3E88A 3IOKA 3UIXA 1H27A 1YWNA 3Q4CA 3QX2A 2PVYA 3A4PA 4ZOGA 4IMYA 4U9AA 4PF4A 4G6NA 4G17A 1P5EA 4CNHA 1OVEA 3ZLYA 3DQXA 3CGFA 5M09A 4E6CA 3E92A 4G6OA 4NU1A 2UW8A 3KXZA 4C59A 4X3JA 1DS5A 1AD5A 3OHTA 5G1XA 4TWNA 3ZFYA 4YZDA 1QCFA 5A6OA 3E8NA 4WRSA 5LVOA 4K1BA 3HV3A 3R8MA 4ALVA 3H9RA 3WIGA 1OB3A 3LFCA 5AUTA 4F9CA 4JBOA 5CTPA 1XH5A 3QRIA 5L3AA 4XG7A 3QCYA 1H28A 4E93A 1KOAA 5KNJA 3MJ1A 4OTFA 3VQHA 3UIBA 4Z7HA 4Z55A 1HCKA 3IK3A 3TDVA 4FIFA 4QMWA 5A4CA 1JSVA 2B1PA 4NJ3A 4O7VA 2WOTA 2R2PA 4UALA 5AP1A 3FC2A 4BKYA 4F4PA 4FKOA 4FSWA 4L53A 4RC4A 4A7CA 2GNHA 3DZQA 1H01A 2QO9A 3F3TA 3ULIA 4R3RA 4RWLA 1PMUA 3I4BA 3EQCA 4F70A 2BUJA 3QCXA 5CYIA 3I0OA 3LFFA 3A7JA 4LV8A 3U9CA 3ZLWA 1UWHA 4F09A 4QYGA 4E6AA 4D2WA 4DH3A 1L8TA 3ALNA 1MUOA 1J1BA 4BDCA 3UO6A 2AC5A 3F5PA 5CU4A 3HL7A 4YTIA 1VYZA 2W5AA 2JC6A 4OTRA 5I0BA 4AT3A 4D0XA 4LOOA 5HTCA 3OWKA 4O0TA 2XYUA 3FZTA 4CRLA 3SC1A 1UKIA 2OW3A 3EIDA 4Y8DA 3N51A 4ASXA 1QL6A 2YABA 4LGDA 5ACBC 4FR4A 5EW9A 5DMZA 5M57A 2H34A 3NVMB 3JYAA 3VBXA 3NUNA 3LPBA 2OIDA 4ZTQA 1RW8A 4AACA 3EQRA 4BWPA 1ZYCA 2WIHA 3R02A 4A4LA 2CDZA 4YBJA 3V5LA 3ZONA 1OKYA 2R0UA 3EL8A 5KMJA 4ZLOA 3UQFA 4NTTA 4FKGA 2F4JA 1K2PA 3V01A 4L8MA 4MXCA 1JKLA 5HNGA 3TNHA 1TKIA 4XG3A 5CEIA 1U59A 5GJDA 3PYYA 2B54A 2AYPA 3GP0A 2DYLA 2YISA 3FYKX 1MP8A 3OZ6A 3PXYA 3ZXTA 3BHVA 5IDPA 3O23A 5GZ9A 3FLNC 2PZIA 1M2PA 3R73A 3UNJA 2I0VA 2YERA 2CGUA 4CZYB 3DXPA 2ZJWA 4GKIA 4IAIA 4L7FA 2C3JA 2O64A 1FINA 2VZ6A 5C1QB 4J96A 4CZTA 3N4UA 4LUDA 4BCIA 3PY3A 3DDQA 1YI3A 3DAKA 1YI6A 3NUUA 5M4FA 2OGVA 2XRUA 3QUEA 4XX9A 4G16A 2J50A 2YEXA 4NM7A 4FIGA 3FAAA 4KBCA 2HCKA 3GI3A 2IO6A 1OUYA 4PPAA 4YC3A 2OI4X 3PWDA 1WBNA 4Y5QA 3ULZA 2Y4IB 4RVKA 2YLFA 5CF8A 4DFUA 2WKMA 3FZOA 2JAMA 4MCVA 1H00A 2VX0A 3RAWA 5ETIA 4RFMA 5JGBA 2QOKA 1FGKA 4L68A 4O0VA 1SM2A 2YACA 4CLJA 3ACKA 2HWOA 4WNMA 4RQVA 3MIAA 1M2RA 2VU3A 3ORZA 3QTRA 4I92A 4DGMA 2UZNA 4TWOA 4U97A 3CQUA 1XHAA 4WG5A 3R04A 4UMQA 3DBCA 4YZNA 2XK4A 3E3PA 3VBVA 2JIVA 4BBFA 4O81A 4X6RA 2G2IA 3W2QA 5CLPA 4TN6A 4DTKA 1XBAA 4ZLZA 3CSVA 4AZEA 5CU2A 2HW6A 1RDQE 5HTBA 4FG8A 3RWQA 2PE0A 1PF8A 3NPCA 5I9ZA 3L9LA 3A7HA 4APPA 1TQMA 2WMWA 3HKOA 3OG7A 3QTXA 3EYGA 2VWUA 3QHRA 4M7IA 4USDA 2VRXA 3V5QA 3COKA 4V05A 5EHLA 3Q60A 2HZIA 4HCTA 2E9NA 4JNWA 4GL9A 4CRSA 5BUIA 5D41A 5JFSA 5IQBA 5AA8A 2UW7A 5KMIA 4KRCA 4LM5A 4BHZA 3VF9A 3DB8A 4OT5A 5AR4A 4FT0A 3DFAA 5JQ8A 4DBNA 4EUTA 1EH4A 3OF0A 3II5A 4L3LA 3OVVA 5FXQA 4ZSGA 2I7QA 1OBDA 3PA4A 4BCKA 1W98A 3QD4A 5FTQA 3P08A 4E1ZA 4H1JA 3DKGA 4NCTA 4O22A 5KX8A 3FE3A 5K4IA 2VN9A 1UWJA 4D2PA 4FYNA 4AZVA 1Y8YA 5HZNA 4E6DA 3OY1A 3PJ3A 2HWPA 2QO7A 3UC3A 3BLRA 5TKDA 4BZNA 1GAGA 4MKCA 3CLYA 4ENYA 4EOIA 3FSKA 2WMRA 2QLQA 2VTPA 2HY81 3PVUA 4FL3A 4TYJA 4EYJA 4ACHA 3F88A 4H3BA 2W5BA 5JFXA 3BLQA 4GUEA 3VS5A 1Q99A 4LOPA 3VUHA 2PHKA 5KKRB 2O2UA 4J8MA 5CEKA 3P23A 4WRGA 4IVBA 4RC3A 2PE2A 4O6LA 4D1SA 5AUXA 4FT3A 4BWKA 3BGPA 4C4JA 2ZB0A 3RGFA 3TKHA 2PK9A 3I6WA 3MSSA 5JGDA 3ZUVA 5CNNA 1T46A 2PULA 5EH0A 2UW5A 5CWZA 5C03A 3PG3A 4FOBA 4CSVA 3PLAE 5H9BA 3VUIA 2C68A 4ORKA 2DQ7X 3QUPA 2GCDA 3W18A 3C0HA 1ZAOA 2Z7SA 5IH5A 4D9UA 3DU8A 2CKEA 2F9GA 3M42A 4OBPA 3TUCA 2WTIA 2OFUA 3P7AA 2EXCX 4M3QA 5HO8A 4BVUA 5IA4A 4CMTA 4EBVA 2OO8X 5J9ZA 3DLSA 1GIHA 5EDRA 2NO3A 3MWUA 4M69A 4UMPA 2UZWE 4OW8A 5JMSA 5KBRA 3PJ1A 1VZOA 2QOHA 1L3RE 4YURA 1J7IA 4F65A 1PMNA 3VW6A 2HYYA 2UW3A 3F69A 1OM1A 3HEGA 3QD0A 3MY1A 4WUNA 5DLSA 5AIRA 4I5CA 1W0XC 4PMTA 2C1BA 3R8LA 2CGWA 5F4NA 3KK9A 4J95A 5D10A 2JDVA 4A4OA 2ITOA 4AN9A 2C6KA 2XNNA 2XA4A 2PVHA 5HG9A 4L7SA 1JLUE 3ZH8A 4BCGA 5J7HA 1QPEA 4L44A 1B39A 3AD6A 2B4SB 2QNJA 3GU6A 5EYCA 5I3OA 5AAEA 3FEGA 3E8EA 1IA9A 4LFIA 3ZYAA 3JUHA 4QYYA 5CVFA 1H0WA 2C3IB 3F7WA 1GZ8A 3Q04A 3Q52A 3D7ZA 3TEIA 5IPJA 4JX7A 3ZUUA 2B7AA 3ORMA 5FWKK 1ZY5A 2C6EA 1JKTA 4U3YA 3QD3A 4OR5A 2YIRA 4F63A 3MFUA 1UV5A 2VTJA 3LMGA 4QMTA 1CM8A 4WSQA 2XKDA 2XBAA 4J52A 2O5KA 4JDKA 3DNEA 3GCVA 4WT6A 4YZ9A 4F7LA 4RWIA 1YI4A 2C5XA 3PSCA 1M17A 2H6DA 3EQBA 4IX4A 4X2JA 4OAUC 2WZJA 2XNGA 3R28A 5ANEA 4CFNA 1YWRA 3REPA 2ZOQA 3R1NA 4RLKA 2UW4A 5J79A 4E5WA 1XBCA 4TXCA 1UNLA 4C4GA 2BRMA 4YU2A 3V51A 3MB6A 4O7WA 1ND4A 2WQMA 2WU7A 5CXHA 3EFWA 5E4HA 4F1MA 4M15A 4UYNA 3KMWA 4ITJA 3R1QA 4FTUA 3FPMA 1IR3A 2EUFB 3ENMA 4Y85A 4AGCA 3QKKA 4YZMA 5IQAA 5LARA 2OJGA 4YJOA 4D2VA 4TT7A 5A9UA 5L6PA 5E91A 3KA0A 4O1OA 3L9NA 4FIEA 4JBQA 4YO6A 2CGVA 3RNIA 1YHSA 4U40A 3SRVB 4JLCA 3NYOA 3R71A 4U0IA 4DTBA 5FXSA 3SAYA 3IONA 4PWNA 4J1RA 2WTKB 3V8SA 4TY1A 4AFJA 3KEXA 2BR1A 3I81A 3K54A 4D58A 3JVRA 5D7AA 4ZSJA 2E9VA 2QG7A 3FPQA 3HRBA 1P4OA 2FA2A 5EQEA 2H96A 5FBOA 2C47A 4RZVA 3ZZWA 4IM0A 2HENA 4GRBA 3FWQA 2R3JA 3MPTA 2JFMA 5F95A 3KK8A 3V6RA 5AP4A 3D5WA 3A2CA 4BCJA 4QTBA 3WARA 3GB2A 3ZHPC 3SW7A 3CJFA 3WF5A 3CXWA 3B8RA 3RBWA 4DGLC 1ZYLA 4AW1A 4UN0C 3RZBA 4H36A 4TZRA 3QWJA 5KMNA 3UVQA 3QYZA 2VAGA 3GT8A 3C1XA 3OWJA 5AV3A 3GGFA 3MTFA 3PZHA 4IVDA 5IA3A 1FGIA 2GMXA 5IUIA 2R3NA 2J90A 1U5RA 5GNKA 4Y83A 4RIYB 4AG8A 5CASA 2XUUA 1IAJA 5J95A 5DVRA 4HVSA 3BWJA 2Y9QA 4KS7A 4PRJA 5EKOA 3PVGA 3MVMA 2LGCA 4ANNA 2VWVA 4S2ZA 2VTRA 4DFLA 2Y6MA 3NW6A 3R0TA 4EEVA 3GCQA 4ASDA 5HLNA 2EU9A 2ZM1A 2WAJA 3BHYA 4QMXA 4I24A 3NEWA 2UW9A 4PTGA 4BCOA 5I9YA 3FYJX 5HE0A 2FSTX 4FL2A 3RHKA 2GPHA 3WBLA 5DI1A 1R0PA 1M7QA 1R78A 3T8OA 3F2RA 3PSDA 2VWZA 3BV2A 3PA3A 3QRTA 4RFYA 5HCXA 3TWJA 4YSJA 5AV2A 5B2LA 4PMPA 2C30A 4S30A 2OJFE 4E4MA 1TQIA 2XM9A 3D0EA 3V8WA 3DDPA 3LOKA 4QP1A 3S1HA 5LMAA 3EB0A 3IW8A 5IG1A 1ZOGA 5CX9A 3ZS5A 1H1WA 1ZWSA 4ZZOA 5KCVA 3DZOA 3RHXA 2YIXA 1TQPA 4FSRA 2XIXA 2B9JA 4GT5A 2GHLA 2R3GA 3AQVA 5HG8A 2OZAA 1LUFA 4NH1A 2PZ5A 5DEWA 4Q5HA 2IG7A 3QRUA 4BY9E 4QOXA 3MN3A 4ZTLA 3LCOA 5EM7A 4EC8A 2UZTA 4IAAA 1H24A 4Q2AA 3Q5IA 1KE9A 4YC8A 3LFQA 1YOMA 2WTVA 4MNEA 4ANBA 3LIJA 4FTIA 4FNZA 5LQFA 3JXWA 4R3CA 3BHHA 4BKZA 4X3FB 3W2SA 4USEA 3D4QA 3D2IA 1PXJA 5EM5A 4JAJA 4DN5A 3WI6A 1FOTA 4FTQA 2J7TA 4YO4A 4FSYA 3EJ1A 4GJ3A 4UWBA 5KMMA 3S00A 5IQDA 5CU3A 4MXOA 5KHWA 4R3PA 4D55A 4AZSA 3DGKA 4WKQA 4O84A 4NJDA 4XRLA 1PMVA 4YJTA 2XB7A 4I23A 4GVJA 2Z8CA 2F2CB 5FTOA 4IM3A 4C2VA 4GKHA 1SVGA 4E3CA 4D1ZA 4WHZA 3LFNA 5I9XA 4AA5A 2QVSE 4RJ7A 4CKJA 4DH8A 1UA2A 1H07A 1A9UA 4FZDB 2OSCA 4APCA 2OLCA 2BIKB 3KVXA 3T3UA 5D1JA 4FV9A 5HCYA 3QZGA 3MH0A 4ITHA 2VTTA 4ONAA 4C3PA 3FQHA 4ACGA 4EOOA 3IO7A 5DBXA 3SA0A 3GFEA 4FSUA 3NWWA 4O27B 4ZTHA 4BYJA 2UZBA 4QYHA 4NFMA 4ENXA 4D5KA 2NNWB 4I5MA 3UMWA 3GQLA 5CAUA 1YOJA 4JVGA 4QTCA 4D0WA 2GNGA 4XOYA 1OPKA 2JFLA 2IVVA 2B53A 2E9UA 4QMUA 4WBBB 3WF7A 4CXAA 5ETAA 1SVEA 2WU6A 5FTGA 1VEBA 2WQOA 4S33A 5L8KA 3K2LA 3ZDUA 5L2WA 2ITZA 5ACKA 4UX9A 4EQUA 2C1AA 2YCFA 3LHJA 2QCSA 3PXKA 4G3EA 4HOKA 3I79A 4AS0A 4JDJA 3FBVA 2CCIA 4UZDA 3KXNA 5AADA 3LCKA 4EL9A 3TM0A 1F3MC 4FL1A 1JKKA 2OU7A 3E3BX 2R9SA 3FL5A 1Y57A 5CNOA 3O51A 4J71A 3PY0A 3LW0A 3OEZA 4JQ7A 5JSMA 2J0LA 2NRUA 2WPAA 3DKOA 3CR0A 3QGYA 3FZPA 4ZY4A 2VWXA 3UODA 5EI2A 2PUIA 4L52A 4BCPA 3G6HA 4FG7A 1TVOA 4W4WA 4JIAA 2YLEA 3DNDA 3VW8A 4EZ3A 2HY0A 3KF4A 4O21A 4BDAA 4GMYA 5EYDA 3TG1A 3ZLSA 4IAZA 3MV5A 4NIFB 4FKSA 2VO7A 4MH7A 3R9HA 2WMXA 4BICA 1BI7A 3PSBA 4FTOA 3AD5A 4BBEA 1CKIA 4V01A 4O0WA 2CHLA 3NW7A 4H1MA 3PXFA 3UPXA 2Z7RA 4DGGA 4ALUA 3EZRA 3O7LD 1J91A 3QRJA 3TL8A 4HGSA 3A60A 3VC4A 5EHYA 4D2TA 2BCJA 3OS3A 1YHVA 5DWRA 1YXSA 3HUBA 4IX3A 4ERWA 1QPCA 3F3WA 2X8EA 4CFWA 3ORIA 3KMMA 5D9HA 2GS7A 4IXPA 1AGWA 3PVWA 4C35A 3RK5A 2R3OA 4XEYA 4QQJA 3RTPA 4CGAA 5E8XA 1H26A 5CZHA 3MA6A 5EW8A 5BVWA 2H8HA 3DK7A 2UZEA 4FNYA 3RAHA 5CEOA 1U54B 5H8GA 5EQPA 4BWXA 2YHVA 4CT2A 1F5QA 1R3CA 2WMSA 4JOAA 3AMBA 2G01A 4G5JA 3OOGA 1R39A 2J4ZA 4RLLA 4FEXA 3R7EA 2Z2WA 2WMUA 5CQUA 4Z7GA 5BUEA 4O86A 3ZO1A 2BKZA 2X9EA 4EUUA 1MQ4A 1W82A 2VNWA 1OIRA 4GFMA 4LMUA 2IPXA 3NLBA 3E7VA 5JRQA 3QQHA 3UO4A 4AZFA 2YCQA 2QOCA 1OL7A 4UBAA 1PXKA 3BYSA 3RAIA 2CNVA 1OKWA 3RWPA 4EZ5A 3PP0A 3KKVA 1Q8TA 1SZMA 3MI9A 3OY3A 5FDXA 4D2RA 4F6UA 4I1ZA 4CFFA 4DFZE 2X7OA 5ANKA 3R8ZA 3TV6A 5EK7A 3WYYA 4C34A 4D4RA 3OW4A 2AC3A 2VWIA 3HECA 1UU3A 4IACA 1OPJA 5DGZA 5EW3A 4HVHA 1WVXA 2YJSA 2PZYA 4UMUA 1PYXA 4ANLA 3ORXA 3ZCLA 4AA4A 4BDKA 2C0OA 2PTKA 3MB7A 4D4SA 4XLIA 2JBOA 4KAOA 4FGRA 1V1KA 2ITVA 2VTNA 2ITWA 2VV9A 1OIYA 3O71A 4AOIA 4O2PA 5DR2A 3MY5A 1MRYA 3TIYA 2V7OA 1ZOHA 3UC4A 3OWPA 3OW3A 4DEIA 4AF3A 2YITA 3FZ1A 4YHTA 4FT7A 2YAKA 2BPMA 2YCRA 3ENHA 5HX6A 4Z9LA 3D94A 2YM8A 3EQFA 4IQ6A 1WVYA 3NNWA 2XKFA 2P2HA 3F61A 5HIDA 4U42A 3ZFXA 5IQFA 3IS5A 5IKWA 1FMKA 4IZ5A 3KGAA 3HGKA 4YJUA 2J2IB 3VS6A 4BL1A 3HLLA 5AA9A 5H8BA 2FH9A 3R7UA 5AV4A 4YTCA 3D5VA 4NL0A 3ATTA 4L3JA 2ITYA 3O17A 4YPDA 4TYHB 4C2WA 3BYVA 2QODA 4QRCA 5BQ0A 5AV1A 4F7SA 2IJMA 4BIEA 4HNFA 5AUYA 2FSOX 4ACDA 3OXTA 4AQCA 4EOLA 2UW0A 3PVBA 4FKRA 3ZC6A 3ZRLA 1SYKA 4C3FA 3KFAA 3FV8A 5HU3A 3LM0A 4X0MA 3NUXA 2PMLX 4O0UA 3ROCA 1IEPA 5LWMA 3U6IA 1GIJA 1OKVA 1URWA 2WTWA 3VVHA 3FHRA 4EOKA 4MWHA 3PXQA 3KXGA 2WTJA 4F0IA 3WILA 3I7BA 4RQKA 3ZXZA 5BVKA 4NCTC 2VX3A 3BE2A 5KO1A 4K0YA 3BE9A 4EJ7A 5HOAA 4CTCA 5G6VA 2I0YA 1ATPE 3LXPA 3TN8A 2Z60A 2AUHA 3RPVA 4QP6A 3NUPA 3VBWA 4WNOA 5FG8A 2ITTA 3DBEA 3HA8A 4MNEB 4N4SA 5AIKA 2LAVA 3LMHA 5T6KA 3IOPA 3IW5A 4AW2A 1XKKA 4OBOA 3D5UA 3WZKA 5HLPA 4MD7E 4IAYA 4AT5A 1JQHA 1E1XA 3HDMA 4I94A 5AX3A 1RE8A 3C5IA 4BN1A 5HE3A 4O7LA 2F7XE 1GNGA 3OXIA 2O8YA 3I6UA 3EZVA 4BI0A 3EMGA 4LV5A 4IWQA 3GCPA 3MY0A 2P33A 3MVJA 4R6VA 3Q4UA 4CVAA 4YJQA 3R9RA 3NX8A 3B8QA 3DBDA 4DGOA 4IJPA 2QOOA 2V22A 2X4ZA 3FLSA 2WFYA 3QKLA 4RJ5A 2WMTA 4DLJA 4P5QA 3R7VA 3U55A 1Y6AA 2EVAA 2XH5A 3RK9A 3GU7A 3ZO2A 4F7NA 3POZA 4PTEA 4W4VA 4EJNA 1YVJA 2R3RA 3QTUA 2R5TA 4CMOA 2G2HA 1KE7A 3PZEA 4I21A 4BGHA 4WA9A 5A4LA 4CD0A 3ZDIA 3VS7A 3ZEPA 4EZ7A 1OKZA 4DYMA 2C6IA 2FB8A 2UZLA 4BRXA 5IQHA 5LVMA 5JEBA 3F7ZA 2ERKA 3U4UA 1CDKA 5GZ8A 1WFCA 2VNYA 4YGAA 3TZ7A 3HYHA 4F7JA 2F7ZE 2WQEA 3ANQA 4WNKA 3CIKA 4FG9A 2VO0A 2YZAA 3P7BA 4DG3E 2B9IA 2W1CA 4O0SA 3VHKA 4A9SA 4FZFB 4EC9A 3SXRA 2YDKA 5FP5A 3UPZA 4RVLA 3PDTA 4GEOA 5M08A 5LVLA 2WHBA 4UB7A 5AR5A 3U8WA 5HBEA 3PWYA 2IWIA 3HV6A 4J97A 4I4EA 4FIIA 5CXZA 3CGOA 1NVQA 2PMOX 1PXMA 2OIQA 1VR2A 5IDNA 4FV3A 3A62A 3ZTXA 4FUXA 5CAVA 2Y7JA 4O7YA 4EQCA 3FDNA 4KABA 2JDTA 3LJ2A 2XIKA 3MTLA 3QXOA 4GS6A 5A4EA 3R83A 5IU2A 1M7NA 5KBQA 3R21A 5IH6A 5J5SA 4QMMA 2FUMA 5DHJA 4IADA 1W8CA 3RINA 4YMJA 2ZV8A 3MW1A 3RAKA 3FUPA 1GOLA 2UW6A 3KRLA 4C61A 2DWBA 3ZO4A 2W4KA 5HE1A 3QD2B 3ZRMA 3U54A 3COHA 1MQBA 4G3FA 4GYGA 5TOZA 4FV0A 4TRLA 1STCE 5E8WA 3UG2A 3LFEA 3UZPA 5AJQA 5FRIA 3FI3A 4JRNA 5IF1A 4XG9A 3EN6A 5JZJA 3GU4A 3PJ8A 2C6MA 2XCHA 3RI1A 3ODYX 5CSVA 5KMKA 5HVJA 1JNKA 5M4CA 4D9TA 4G9CA 2GHMA 3H0ZA 1WBOA 3LAUA 1G8AA 3UZRA 4EYMA 5J9YA 3R8VA 2ZDTA 2QKRA 1Q3DA 3D9VA 4UWCA 5EG3A 5AEPA 3W8QA 3NR9A 4DBXA 2BRBA 4UWYA 5FM3A 3IPHA 4C37A 3EFJA 5KHXA 3WF6A 3ZO3A 3FMLA 4O7SA 4O7ZA 2C5NA 4QP4A 1V0BA 4GJ2A 2YM3A 2V0DA 3K3JA 4QTDA 4ERKA 4DFXE 4F99A 1JWHA 4U3ZA 4LRJA 4G34A 4F0FA 3GOPA 4FK6A 4PDPA 2GSFA 4QD6A 4BDFA 2Q83A 1U4DA 2OXXA 4EWHA 3M2WA 3ZEWA 2X6DA 2XRWA 4MXAA 4BBMA 4M67A 3BBWA 3W32A 3Q4ZA 1KOBA 2WNTA 2W99B 4AZWA 2RSVA 4OT6A 4JQEA 5LOHA 3ELJA 3RCJA 5AP3A 1ZYJA 4QP2A 4IVAA 4FVPA 2I0HA 3NGAA 4J98A 2XM8A 4MX9A 4IIRA 3OT3A 4DEGA 3GFWA 4BKJA 4C02A 3F66A 3D7TA 5JRSA 4D4VA 4TTHB 4F9YA 1W7HA 4TNDA 4BB4A 1YW2A 4MXYA 3MIYA 3Q6UA 4WOVA 4X7QA 4BI1A 5LXMA 4OTPA 1O9UA 4D4YA 3K3IA 5CANA 5FEDA 4HVIA 3QTZA 3FLWA 2O3PA 3M11A 3DLZA 1PHKA 3NW5A 3N9XA 3QTQA 4A9TA 5CEPA 1CKJA 4YJVA 1BLXA 5C01A 1O6KA 1WBPA 2CJMA 4JI9A 3UNZA 4K33A 5I3RA 3BX5A 2GS2A 4AE6A 1WBSA 4HCVA 3UZTA 4FOCA 3BU5A 4O96A 4NM5A 5DH3A 5LCKA 3VUDA 4W8EA 3MFSA 3CE3A 4YLJA 2XYNA 5HO6A 4NW5A 5AM6A 3UMXA 1K9AA 5GJGA 4YTHA 4B99A 1R1WA 3RJCA 1WVWA 5HG7A 5E1EA 4YNOA 3P7CA 4OTGA 4DITA 4HW7A 3ATSA 4NKAA 2HXLA 3S3IA 4FTRA 2Y8OA 4PTCA 4IWOA 3BLHA 2CKOA 4WIHA 1YRPA 4K2RA 2X6EA 3PTGA 3VQUA 2QOLA 2YIQA 3IG7A 3W16A 1PJKA 4ZJVA 5CU6A 4FKPA 2C0TA 4OTIA 4TYIA 1OIUA 2ETMA 5IQIA 3SKCA 1OI9A 2YCSA 3MBLA 4FEQA 3KXHA 4L42A 5CSXA 3SXFA 4G31A 4FSQA 3R6XA 2WQNA 5HD7A 3KQ7A 3LXNA 1KE6A 5AUWA 4YZCA 2V5QA 2XNMA 4RIXB 4MBIA 5CSHA 5CZIA 4QMYA 4M84A 3Q9WA 3G5DA 3HV7A 4FNXA 1Q24A 3GUBA 5E1SA 5K0KA 3HV4A 2XKEA 1GJOA 1OZ1A 1OL6A 3G90X 2BKKA 4FSTA 5HBJA 4GVAA 4A9RA 2OWBA 2ESMA 1Q5KA 5C8NA 3PXRA 5CEQA 4ALWA 4DFBA 3JS2A 3QQJA 3R8PA 2UV2A 4CZUA 4XJ0A 2W7XA 3I60A 3ANRA 4GG7A 4U43A 4YP8A 3TUBA 2YDJA 4GCJA 2JKQA 1Q41A 4GYIA 5EFQA 3ZOSA 3F3VA 4TWPA 3W55A 4ZEGA 3HAVA 3U6JA 3RKBA 4AN2A 4FEUA 4GW8A 3PPKA 4I93A 2OICA 4CFMA 1IASA 3OMVA 4AXAA 4OAVB 2A4LA 2JLDA 2BFXA 2XNPA 3C7QA 4BI2A 5HU9A 4EH6A 2GTNA 1GZNA 4E73A 5FXRA 4XV3A 1RJBA 3BYMA 4O1PA 4LYNA 3O8UA 4QMLA 1KSWA 3E87A 3HA6A 1SNUA 3R01A 4DLIA 4BDEA 5M07A 1HOWA 3A8WA 3BEAA 3Q53A 4IC7A 1IRKA 2VUWA 3VF8A 3H30A 3QX4A 2CSNA 5AP7A 5CSPA 5JN2A 5FM2A 4IE9A 1J1CA 4NK9A 2XNOA 4BHNA 5HIBA 3MGYA 5BVFA 4F9AA 3RPRA 1BX6A 5AM7A 4BGQA 1ERKA 4DFNA 3LMIA 4D28A 3KU2A 4O38A 2GNLA 3F82A 3LCDA 3TDWA 4GIIA 1YDRE 3PRIA 4BCMA 4CKRA 5GHVA 3BPRA 2YJRA 4B6LA 4E26A 2JDSA 3BGZA 3H3CA 4I6FA 4ITIA 3PFQA 4L01A 2X0GA 4DEAA 3KF7A 3TACA 1IAHA 2BAJA 3UQGA 3DXQA 2BAKA 3WZJA 2WTCA 2JKOA 3ORTA 2PUUA 5DT4A 3MH2A 4ZZNA 4DINA 3V6SA 3FMJA 3VBTA 3QQKA 3ID6C 3HRFA 4RX5A 3WZEA 3F5UA 5E8TA 1OGUA 3Q9ZA 3UOKA 3VS1A 5HD4A 3FLZA 3PPZA 4UXLA 3CJGA 3QGWA 4LL5A 3GC7A 4C4EA 2C6OA 4AX8A 2BTSA 3RPSA 3ZC5A 4KIKA 4CYIA 1XH8A 2ZAZA 3C13A 4YJNA 2XJ2A 2JD5A 1WBTA 3OOMA 3P78A 5M44A 5KZIA 3G33A 3G15A 3I7CA 4W4YA 3F5XA 4RX7A 4I6BA 2I1MA 4FF8A 3QLFA 4U41A 3BWFA 5J5TA 1JSUA 4ZXTA 4EH2A 3TCPA 4ANOA 4ZTMA 2JITA 3DOGA 4KKHA 4GH2A 2UZVA 3OFMA 4M13A 4KSPA 2P55A 4LRMA 2IW9A 1REKA 3NDMA 3OC1A 4QTAA 4CQEA 5IISA 2VTHA 3AC4A 4K8AA 3N4VA 3CP9A 3VBQA 4XRJA 3WOWA 4AGWA 1VJYA 3BQRA 4M14A 5IMXA 1OECA 4FBXA 3GEQA 4HPUE 5LVPA 1T45A 5FUTA 1PY5A 2C69A 5I9UA 2PUPA 3AC2A 4L43A 3EFKA 4S34A 2HZ4A 2C6TA 1VYWA 2R3FA 3CKWA 2QG5A 4U7ZA 3FKNA 4EONA 4BDGA 4BDIA 4EHEA 3LZBA 2VTQA 5BVDA 3FLQA 2VO6A 4XP3A 4OLIA 4BCQA 4U6RA 1ZXEA 4C33A 2VTLA 5LJJA 1M52A 1P14A 1IA8A 3QKMA 3H0YA 3EN7A 3QBNA 3V8TA 3UDBA 4QQTA 2CN5A 3DKCA 4YHJA 2XK9A 1OL5A 4ZLYA 4LUEA 4A9YA 1XBBA 3TKIA 4IFGA 2QLUA 3MFTA 4V0GA 2WMAA 4LQMA 4IAFA 3WZDA 5C4KA 3C50A 2B0QA 2OG8A 3BI6A 2JDOA 3HUCA 4IZYA 4A9UA 4KS8A 4EHZA 2GS6A 4MAOA 2QU6A 3U4WA 2XS0A 5IQCA 4E5BA 5ETFA 4DTAA 4FIHA 3KREA 5AP6A 4IB3A 4CG8A 3GVUA 2BRGA 4UYAA 3S0OA 1ZZ2A 4FIJA 4FA2A 4WG4A 5AX9A 4HPTE 5C8MA 2G1TA 3C0IA 2X9FA 3OP5A 1O6YA 2CGXA 2JGZA 2VTMA 1JAMA 5CAPA 2I40A 2QURA 3DPKA 1PKDA 4U45A 5DFPA 4AOJA 5L4QA 3TUDA 5CEMA 3TZ8A 3NYNA 3EHAA 3LXKA 4QO9A 4G9RA 3L1SA 3R7IA 2VD5A 4QYFA 1CKPA 3SDJA 3W33A 4AZTA 3GCUA 4I41A 5CQWA 5E8UA 3BEGA 3EN9A 4FV2A 3RP9A 3V5WA 5HKMA 1XO2B 4I6QA 5B7VA 5IEXA 1Y91A 4K6ZA 5JT2A 2R7IA 5EKNA 4CV8A 5K9IA 2VO3A 1H1PA 3VRZA 2I6LA 1V0OA 3VUKA 5B2MA 5M06A 3A8XA 1YXTA 5BMMA 4I22A 3DBQA 4KBKA 2HW7A 2UZOA 5E8SA 4CT1A 3F2AA 2XKCA 4IC8A 4ZS0A 4EK4A 5HVKA 4JG6A 4X2FA 4ANSA 4L9IA 5CI6A 4ZJJA 3ZZEA 4ZSAA 4PNIA 4BZDA 2W5HA 3LLTA 2OFVA 2UUEA 3NIZA 2R3IA 2W1DA 3H4JA 4RA5A 3KY2A 4FV4A 4P90A 4IX6A 2ZYBA 5TE0A 2IW8A 4FTAA 4CLIA 3U6HA 4UMRA 4ASEA 5IZFA 3CC6A 4IDVA 2QO2A 1ZRZA 4G5PA 4WG3A 2PMNX 3KCKA 4DE4A 3FJQE 5B2KA 4MNFA 5EI6A 3QUDA 4AP7A 5HNBA 2OK1A 2IVSA 4PX6A 1MRUA 4II5A 5HE2A 4B7TA 3TJCA 1MRVA 1WBVA 1A48A 3ORKA 3NNUA 5HESA 4JBPA 3QTIA 4BDDA 3BYUA 3A7FA 1JKSA 2QC6A 3W2OA 4R78A 4NZWB 2VWWA 4M69B 3SD0A 1JPAA 3SX9A 2ONLA 4HVGA 5JK3A 3SG8A 4MYGA 5LMKA 4C4IA 3O2MA 3WYXA 3EQPA 2E9OA 3L8PA 4QMNA 3NUAA 4H3QA 4MD8E 4QP7A 3QCQA 5E8ZA 1UNGA 2HOGA 3H9OA 3QCSA 4AW0A 4JIKA 4NYEA 2X1NA 2P3GX 3I0QA 3TV7A 4PL3A 5D7VA 3R7OA 4A07A 3DB6A 3ZU7A 3QQFA 4KIQA 1R0EA 4GU6A 4IW0A 2YA9A 2X4FA 4CTBA 1PMEA 3R2BA 1NA7A 3FI8A 4DC2A 3BYOA 5H3QA 5T68A 4U5JA 4AN3A 3IGOA 4JDHA 4WNPA 2ZV7A 4GUBA 3V5TA 3NCZA 3E7OA 3PA5A 3G6GA 3VS0A 2R7BA 1NVRA 1WCCA 3FQSA 4N0SA 5L8JA 4QMZA 4CKIA 3R9NA 3RPOA 5AP2A 4XCUA 3VULA 2C5VA 3FL4A 2RFNA 4AU8A 3D14A 3BZ3A 4HYSA 1F0QA 2QU5A 3NCGA 4QYEA 3ERKA 3HRCA 5EM6A 5EM8A 3VBYA 2E2BA 3SHEA 3UOLA 1BKXA 3UNKA 3QTWA 3M1SA 2PPQA 4PDSA 4BGGA 3ORNA 5CSWA 1NW1A 5FLFA 5J7BA 5JGAA 2J5EA 4LL0A 2W1IA 4YLKA 3BHUA 1ZZLA 5EDPA 5KMOA 5E8VA 2W4JA 4HCUA 5IQEA 2A27A 4R7IA 1CTPE 5A4QA 3QU0A 3FXXA 2C0IA 2CLXA 2JAVA 4QMSA 2YN8A 1PRYA 5F9EA 3ETAA 5CVHA 3FZSA 1BL6A 1YOLA 4QMPA 3H9FA 3R8UA 5HO7A 5CALA 1PKGA 3T3VA 2RIOA 3C4XA 4PMMA 3ALOA 4EH5A 2GQSA 4IM2A 3RPYA 4L00A 3EN5A 2IZRA 5CT0A 3A61A 5K3YA 2WEIA 3MH3A 3R63A 4YJPA 2ITXA 4DT9A 4ZY5A 5GIPE 2R64A 3W2RA 4J7BA 4XLVA 5AP5A 1JSTA 4PDYA 4GIHA 2RL5A 4IDTA 4UZHA 3UE4A 3LLAA 3CBLA 4FTNA 5DNRA 4XHKB 4E20A 2VGOA 4M66A 1FVTA 3VWAA 4E7WA 4C36A 5IA2A 2W9FB 4F9WA 3DJ7A 5AR2A 1G3NA 4EKKA 1Q4LA 2W0JA 4N57A 4RJ4A 4QMVA 5CF4A 4MBJA 4RWJA 1M14A 5HHWA 1S9IA 2J0KA 4GV1A 3DAEA 3SLSA 2NP8A 5IEVA 4C62A 4XS2A 2IVUA 3D15A 3EQGA 3G9NA 3MJ2A 4G1WA 4J8NA 3T9TA 2XEZA 4FICA 3UIUA 4RJ6A 4DCAA 2Z7QA 5DE2A 3L8VA 4FNWA 4DH5A 4OBQA 2QR8A 1LR4A 1ZARA 4MXXA 3E5AA 4EH8A 3G0EA 3OCBA 2ITNA 3UOHA 4DH1A 4E4NA 3HP5A 4XV9A 1H8FA 5JQ5A 4ZTNA 4M0ZA 3F2NA 4E4XA 5BUJA 3E8DA 3HDNA 3EQIA 2DS1A 4IB0A 3NYXA 3QZFA 1PW2A 5D12A 1OITA 4I20A 2IW6A 4DH7A 1Q8UA 1YDTE 5I5ZA 2BIYA 2F2UA 4IZAA 4PPBA 1FBNA 1NY3A 4AWIA 5HI2A 3I5NA 1LEWA 2G2FA 2PMIA 4O91A 3NYVA 3W8LA 4IJ9A 5AR3A 2VTAA 3AC3A 3SW4A 4EOJA 4JX3A 4RVMA 3CTJA 2OXYA 5JKGA 4U81A 5ANGA 3CY2A 2HXQA 2JIUA 4EHVA 5M56A 4FKWA 1KV1A 3KB7A 2G15A 3NSZA 4GFOA 4YC6A 1XQZA 4GFGA 3TV4A 4EK6A 5CVGA 3HMMA 5M4IA 3ZMMA 4I0TA 2OZOA 4TKSA 3O7LB 4I5PA 3GC8A 5AMNA 1LEZA 4NSTA 3RNYA 4MF1A 4BDHA 5IA1A 4FC0A 4PPCA 1UKHA 4RRVA 2C3KA 2OZAB 4RVTA 5EYKA 2XBJA 5A46A 1LPUA 4FV1A 2ZB1A 4I5HA 3UVPA 3P4KA 5L8LA 4V0GB 3ZSGA 3C51A 2WEVA 2PVJA 3KRRA 3PUPA 4RIWA 2PWLA 1H4LA 2R3QA 5L2QA 3UO5A 4R5YA 1YHWA 2PVMA 2BHEA 3FMHA 3EKNA 3S4QA 4CFVA 5M51A 4TW9A 1XH4A 2ZMDA 3CQWA 4Q9SA 5DRBA 2R3HA 5AUZA 3HAMA 1DAWA 3FKOA 5ANJA 3LVPA 5E7RA 3TZMA 4O83A 3FKLA 2UVZA 4YTFA 3A7GA 3VS2A 4F1OA 1H0VA 2O63A 1OL2A 2Q0NA 5DA3A 4K11A 3PE1A 1ZYSA 4NT4A 4JXFA 3RMFA 2OH0E 3PLSA 2XVDA 5DR9A 2EXMA 4FI1A 1H25A 2CN8A 3QRKA 5JZNA 3R7GA 1K3AA 5KUPA 4R8QA 3DJ6A 4XG4A 5I9VA 5DRDA 3C5UA 5ITAA 4QPAA 3U87A 2XCKA 4ZIMA 2YWPA 4MBLA 3TTIA 3VN9A 3ZFMA 2C4GA 3OT8A 5ANIA 4ZTRA 4B9DA 4BDJA 4EI4A 3JY9A 4F6SA 5DT3A 4AE9A 2W1GA 1Q61A 3P5KA 5BYLA 2WMQA 2I0EA 2JIIA 2XK3A 4ZAUA 3N4TA 1BI8A 4FEWA 2YAAA 3FI2A 1P4FA 3OTVA 5A6NA 3LFAA 4QP8A 5JH6A 5LMBA 5AUVA 3HNGA 3LJ0A 3MH1A 3D83A 2EWAA 3SOAA 2C6DA 2W05A 2YM5A 5DT0A 5HLWA 3PJ2A 4ZJIA 2ETKA 3AT2A 5L2SA 4H39A 3FY2A 3CEKA 4C38A 4DA5A 4JRVA 2ZM4A 4QQCA 1B6CB 1QMZA 5HICA 3PXZA 4E4LA 5K4JA 2F7EE 5C9CA 3C9WA 3RCDA 4EORA 2CNUA 1XR1A 3FQEA 4DGNA 3IDBA 2REIA 3PRFA 2UVYA 3QWKA 3GOKA 4NUSA 4ZMFA 5IA0A 1ZOEA 2W1FA 4G3CA 2PU8A 2VTOA 3NUYA 4W9XA 4KKGA 3SRVA 3WE4A 5HBHA 2ERZE 4JT3A 3RZFA 4C4HA 5A54A 2J9MA 4QNYA 2CLQA 3E62A 2RGPA 1I44A 4BTKA 5BPYA 5HNIX 3WZUA 2NPQA 4OTQA 4B8LA 3SV0A 3AC8A 4K77A 2BVAA 4NFNA 4EHGA 1RQQA 3ZRKA 4HJOA 3IKAA 3EQHA 1H08A 2DUVA 2ZV9A 3DT1A 3G0FA 3KC3A 3KN5A 4C4FA 3A4OX 1Q62A 5KMLA 3F5GA 3NIEA 4JDIA 4W9WA 2O65A 3FSFA 5BNJA 4UY9A 2XP2A 3MYGA 4X2NA 3BBTB 4RBLA 2IZUA 4OGRA 2ZMCA 4ZSLA 3ITZA 5K0XA 2RFSA 4NTSA 1V0PA 4W4XA 2WB8A 3AOXA 4DFYA 4EK5A 3OROA 3BIZA 3G51A 3LM5A 2BALA 4CCUA 3QC9A 3PG1A 4XUFA 1URCA 3AT4A 4YUQA 2QKWB 3VO3A 3F3UA 3GXLA 3KMUA 4RIYA 2PVNA 3DJ5A 1ZY4A 2WIPA 2F49A 4FZAB 5TO8A 3FXWA 4TL0A 1XJDA 5GJFA 2GQGA 3TI1A 4PNKA 4AGDA 4E5AX 3NVKI 2H9VA 3BRBA 4QTEA 4JBVA 2W4OA 3CQEA 2FVDA 3W2PA 1XH9A 2B52A 4RC2A 4X21A 1OIQA 4KD1A 3Q2JA 4CV9A 3PJCA 3EFLA 2SRCA 1U46A 3TJDA 3O96A 3UP7A 4WBOA 3MVLA 4B0GA 5C8KA 2PYWA 2BDWA 3NAXA 5TF9A 4CYJA 3LQ5A 1X8BA 4IVCA 2W1HA 2QI8A 4M8TA 5F1ZA 2R3LA 3WF8A 2C6LA 4QMQA 5E8YA 1XH7A 5HCZA 4G3GA 5LCJA 3MVHA 3GNIB 5FD2A 5DG5A 5L6OA 3IGGA 3AMAA 3NNVA 2IN6A 3QZHA 2J51A 3DK3A 3GC0A 3SOCA 5I4NA 3UGCA 1AQ1A 3TTJA 3UOJA 5DOSA 1YXXA 5EOBA 5GINE
chains in the Genus database with same CATH superfamily
2BZIB 4O7RA 3C0GA 4NEUA 4CEGA 2CNQA 1H1SA 4IHPA 4MUQA 2OJJA 2HAKA 4ZS4A 3H10A 4XYFA 3MFRA 2WO6A 4D1XA 1PXPA 4R7HA 4FV8A 4LG4A 2WGJA 3D2KA 3DAJA 3UQCA 1KUTA 4QT1A 1UVRA 1FQ1B 4FKUA 4X3FA 4C3RA 1PXNA 3OUKA 5C4LA 1UU8A 2E9PA 2YIWA 3GU8A 4FX3A 2YM6A 4HGTA 4N70A 4QNAA 4X2GA 5TT7A 4AA0A 5IUHA 1CSNA 4PL4A 3ROYA 2J5FA 3Q4TA 4R1YA 2GDOA 4AOTA 2PZPA 3KCFA 1KWPA 3WE8A 4FTKA 4WUAA 5K5NA 4LOQA 5CY3A 5E90A 5A4TA 2QOFA 1DI9A 4RZWA 4H58A 2XK6A 4DEBA 2R3PA 1G8SA 4XG2A 4GG5A 3EH9A 1E1VA 2X39A 4QPSA 3QTSA 4ZZMA 4CG9A 5FBNC 3QQLA 3O0GA 4FEVA 1PXLA 1KV2A 4XNEA 4LI5A 3C4CA 1YXUA 1KE5A 5ANDA 4XP2A 4UXQA 2R0IA 1GIIA 1O6LA 4KWPA 2YDIA 4M12A 3V3VA 3PUFC 2FYSA 2W1EA 2QOBA 4R77A 2GFSA 2XARA 4N6YA 4CQGA 4EQMA 5HQ0A 1FVRA 2J0JA 3AT3A 4RJ8A 4N6ZA 3PIZA 4Q9ZA 3ML1A 1SMHA 4BIDA 3R00A 2QOIA 4J53A 2BRHA 3UYSA 3GBZA 3ODZX 4EH7A 3DTCA 3R1YA 3VJNA 3OD6X 4FTLA 2A0CX 4RFZA 4USFA 5BVEA 4M97A 3NMUF 3QHWA 2WTDA 4OTWA 3ACJA 4AFEA 3UIMA 1FVVA 4EBWA 4RIWB 3Q32A 4MQ1A 5AR7A 5DIAA 4FGBA 5FP6A 2YIYA 2X2MA 5H2UA 3THBA 5JFWA 1WZYA 1Y6BA 1S9JA 1NT2A 3OCTA 3BU3A 4C57A 1BUHA 4EKLA 3DA6A 4QPMA 2X81A 3AC1A 4EH4A 2BILB 3QF9A 3OEFX 3CPCA 3EQDA 5L6WL 2GQRA 4BCFA 2PVRA 5C27A 3R1SA 1CMKE 4S31A 2JBPA 4JQ8A 5KE0A 4O6EA 2X2KA 2HK5A 2WELA 2VTIA 3HMNA 4MD9E 3BHTA 5ICPA 5KZ0A 3UYTA 3I1AA 4GK3A 3DCVA 1UNHA 3L9MA 4HYHA 2XIRA 3BKBA 4O7NA 3NRMA 4AXCA 2G9XA 2J0MB 2PVKA 4BTFA 3AMYA 3P86A 4F64A 4NIFA 3S95A 4D5HA 3OWLA 2HZNA 4RPVA 5HORA 3QA8A 2CKPA 4C58A 4PV0A 4FVRA 5B0XA 4DCEA 5BX0A 5IMEA 3F6XA 2F57A 4RGJA 5DR6A 5HTIA 2ONLC 2IVTA 3G2FA 3LKMA 3VAPA 2P0CA 2BZKB 1JOWB 3NZ0A 3VJOA 4BTJA 3HZTA 3TKUA 5LMKC 5J1WA 4JG8A 3LCTA 3ZBXA 4F6WA 3RK7A 5FGKA 2PZRA 4H05A 3ZM9A 4FODA 4U44A 5DN3A 2RKUA 3AD4A 3KRJA 2ITQA 4HNIA 4ZK5A 4QMOA 3AG9A 4MK0A 4O7TA 3LE6A 5H8EA 3QALE 3EKKA 4DG0E 1PXIA 2XNBA 1DAYA 1XWSA 4KA3A 5HEZA 5F20A 3SGCA 3EL7A 3SXSA 1U54A 5I9WA 4FZ6A 4W8DA 2KULA 4M0YA 2P4IA 2XK8A 4EH3A 4DHZA 3DFCB 3K5UA 3VUTA 2W06A 4RG0A 4DT8A 3C4FA 4BYIA 3BV3A 4XG8A 1I09A 4AW5A 5AR8A 3FHIA 5GIOE 3OXZA 3DK6A 3LXLA 4DG2E 2NRYA 3G9LX 4BDBA 3PPJA 3TNQB 1YKRA 5AV0A 3GQIA 4I4FA 1Q8ZA 2GNJA 5EDQA 4ASZA 5A3XA 5E9EA 3W0OA 4IWDA 2ZM3A 4P4CA 1UU7A 2IZTA 1ZLTA 2WOUA 2XF0A 2XMYA 2YM7A 3QC4A 4Y72A 2PVLA 5IEYA 5FEEA 1B38A 2O0UA 3FMNA 5EQYA 3BCEA 3CKXA 3FMEA 3L9PA 3MS9A 1UU9A 4FTTA 4HGLA 4I0SA 3PY1A 3DY7A 4FV7A 4PUZA 4RSSA 4WD5A 3UJGA 4WSYA 1OPLA 1YQJA 5J8IA 4A4XA 1APME 2XIYA 2OJ9A 2V55A 2V62A 4JS8A 4R1VA 2ZDUA 4BR3A 4EWQA 4XBUA 1HCLA 5ETCA 3L8XA 1Q8YA 2CMWA 4Y95A 1QPJA 3AXWA 3CD3A 4TWCA 3MPMA 5E92A 2OIBA 1LP4A 4CFUA 2Y4IC 3UDTA 4BF2A 3AGLA 3R9OA 4ZMEA 2W1ZA 3CTHA 3JVSA 3QQGA 4F08A 1J7UA 2BMCA 3QXPA 4IFCA 4NKSA 5M55A 2UZDA 3R2YA 3VS3A 4L3PA 5K5XA 5M4UA 3KULA 1GY3A 1P2AA 4KIOA 4A06A 2A1AB 3KN6A 2OXDA 3IDPA 4EOQA 4E8AA 5EYMA 2OF2A 5IUGA 2QONA 1JBPE 3L8SA 2BTRA 1JVPP 4KSQA 5AWMA 4LGHA 4FMQA 4FKVA 3VRYA 4LMNA 3TXOA 2C5YA 4PP9A 2XK7A 4ARKA 5BMSA 3KL8A 2PE1A 2GU8A 4TNBA 4XMOA 3QAME 1Y8GA 4MQ2A 2ITUA 2RFEA 4P5ZA 4TYHA 5L2IA 4KUJA 3ET7A 2PL0A 2EB2A 3HV5A 4MWIA 1SVHA 4YBKA 4YNEA 3TNPC 3FY0A 4RT7A 2Y6OA 5BVNA 5AFVA 2JKMA 3R30A 3UP2A 2VWBA 3GENA 3QLGA 5LVNA 1A06A 3W1FA 5L2TA 3UG1A 4HZRA 4O0YA 2X7GA 5JFVA 4CMUA 4NM3A 2YWVA 1BYGA 1GZKA 2W17A 4PL5A 3FI4A 4FUYA 3DKFA 3E63A 3OBJA 5AAFA 3DS6A 4FT5A 2J6MA 2GHGA 2R3MA 3PE2A 4RA4A 3QYWA 3FMDA 3LFBA 3CS9A 3P1AA 4HYUA 2JDRA 3GCSA 3Q9XA 4DEEA 2W9ZB 3KVWA 4XG6A 2P2IA 2QR7A 3D7TB 4EK3A 3CD8A 4X6QC 4UMTA 4CCBA 5CENA 4YPSA 4BCHA 2WMVA 1Z5MA 4XBRA 3LJ1A 2OF4A 4JR7A 4AAAA 1YWVA 4IH8A 4YLLA 2JKKA 4KINA 5IA5A 4BFMA 4UV0A 3I5ZA 4C0TA 3A99A 3DV3A 4DF3A 2C5OA 2VTSA 4OUCA 3TT0A 5KKRC 3LFSA 2Z02A 4FSNA 3O8TA 3QA0A 5J87A 2ACXA 2XEYA 5F94A 4FTCA 4G6LA 5CAOA 4ANQA 3Q9YA 2AEGA 3VNTA 1J7LA 2VX1A 3ZBFA 4O0RA 1QPDA 4L6QA 3QZIA 4FSMA 3U9NA 5AAGA 5CT7A 3TZ9A 4TYEA 4YJRA 3PP1A 4GK2A 5J9LA 4HZSA 4BCNA 3CY3A 2KTYA 3LQ8A 4GK4A 4EOMA 2XIZA 3JY0A 3RVGA 1KE8A 3ZSIA 3O50A 4D2SA 3VUGA 4YHFA 1G5SA 3W2CA 4V04A 3NS9A 4IANA 3JPVA 4QP9A 3RALA 4MVFA 4OTDA 3P0MA 1H1RA 2FGIA 3ZSHA 5HX8A 3C4EA 1WMKA 3LCSA 3OTUA 4GT4A 2BZHB 4H3PA 1IG1A 5EHOA 4PQNA 4IWPA 4K9YA 2Q0BA 3GU5A 1W83A 5CU0A 3KRXA 4PP7A 2FO0A 3TNWA 3PIXA 3VIDA 5CAQA 2GTMA 1Q3WA 2W96B 3IDCA 4ANMA 2X2LA 2BZJA 4R7BA 4Z3VA 3MESA 4YZBA 3F9NA 3COIA 3BU6A 4CFXA 4MF0A 3KXXA 3HX4A 3UTOA 4KIPA 1PXOA 2EB3A 1U5QA 4FKQA 5CI7A 4RX9A 5BVOA 2EXEA 1BL7A 3VHEA 4FV6A 4FKLA 4MHAA 4DHFA 4C7TA 3AKLA 1ZMWA 2BFYA 4UEUA 2HIWA 4I0RA 4Z16A 1OBGA 1PYEA 2QOQA 3V5PA 3Q5ZA 4GSBA 1GZOA 3DBFA 3R9DA 5FQDC 5CF6A 1H1QA 2VWYA 2RFDA 2XJ1A 3FC1X 4F9BA 5DPVA 4ZP5A 3QQUA 5FEQA 4TYGA 1Q8WA 4Y5HA 4GU9A 2V7AA 2Y4PA 3IW6A 3NNXA 2R4BA 3PIYA 4Q5EA 2B9FA 5LWNA 3T9IA 3ORPA 1YDSE 1ZYDA 4PY1A 3IW4A 3QFVA 3OCGA 4IAKA 3MPAA 4ZY6A 2YFXA 1BMKA 3NUSA 4U8ZA 3BELA 5TR6A 3KRWA 4FTMA 3S2PA 4KB8A 3P5JC 2UVXA 3R22A 3DXNA 3E64A 4S32A 4O2ZA 2RG5A 4B4LA 4RJ3A 4MXZA 5CF5A 2OJIA 3AC5A 2B9HA 3EOCA 3HMOA 5CS6A 2GFCA 3EN4A 5HVYA 3CCNA 4FSZA 3CPBA 2BROA 4P7EA 1FPUA 3BQCA 4AGUA 3E8CA 4BIBA 5HGIA 5AP0A 3Q96A 4O82A 2J0IA 4E6QA 4FVQA 4FK3A 4AXEA 4O0XA 3SVVA 5IQGA 2YZLA 4K18A 2PY3A 2FSLX 2WTKC 3B2WA 4NWMA 4LGGA 4DAWA 3KXMA 4IX5A 2HZ0A 4ZSEA 2PUNA 5HG5A 4WO5A 4F0GA 4IB5A 3D5XA 4I3ZA 4LV7A 4PMSA 4ID7A 2CPKE 3FXZA 4YR8A 4KBAA 4OTHA 2XJ0A 4B8MA 4G3DA 4IEBA 1OUKA 3DQWA 4RX8A 4MEDA 4L45A 2CKQA 4J99A 4EH9A 5A14A 2ZV2A 5EI8A 3TNIA 4JAIA 4BC6A 4L67A 3IQ7A 3V5JA 4JMQA 4ACCA 3EYHA 4KNBA 4IBMA 2PVFA 3BGQA 4XH6A 1Z9XA 2GNFA 4FKTA 3IW7A 4F1TA 3O8PA 5EOLA 4EOSA 4Y46A 2BRNA 3FLYA 4U80A 4HGEA 3B2TA 4KIKB 4NW6A 4YSMA 5C26A 4JG7A 3Q3BA 3SG9A 2YM4A 3UBDA 4XV1A 5J1VA 2OH4A 1Z57A 4XV2A 3TIZA 3HVCA 4DEHA 3FZRA 5FDPA 4X2KA 5D11A 2Z7LA 3C4WA 3EWHA 2RF9A 2Y0AA 3E93A 3JR1A 2CCHA 4HVDA 3FMMA 2X8DA 3F3ZA 4QP3A 3DTWA 2X8IA 5M53A 5IH4A 4NM0A 4XOZA 2BAQA 5T3QA 3SQQA 2C3LA 2A2AA 2WQBA 4XP0A 3MA3A 4C8BA 1M2QA 1OMWA 5DEYA 2QHMA 3ZM4A 4AUAA 2ZVAA 3LQ3A 1J3HA 2OBJA 2WXVA 3POOA 4FKIA 3ZLXA 4ACMA 2X7FA 2XZSA 3Q2MA 4FT9A 2JEDA 5BYZA 5DYJA 4RWKA 3GC9A 4U79A 3MDYA 3OUNB 1E9HA 3ZUTA 4LRKA 4PDOA 3VUMA 3KULB 3IECA 2B55A 2QD9A 3Q6WA 4TPTA 2QQ7A 3UVRA 3OBGA 4M68A 4QQ5A 1ZMUA 4R5SA 4RIOA 1WAKA 3W10A 2QHNA 4FYOA 4FZ7A 2ETRA 1NVSA 2ITPA 4YJSA 1NXKA 2WMBA 2PSQA 4L46A 4IB1A 1YXVA 3U51A 3RM6A 2UZUE 3P9JA 4HYIA 3HMIA 3OCSA 2FSMX 4FTJA 4ZTSA 4G2FA 4EOPA 4MTAA 3HP2A 4AT4A 4EK8A 2BDJA 4JR3A 1XH6A 3RM7A 1DM2A 2GNIA 4DHIB 3COMA 3QL8A 3NAYA 2RG6A 1WBWA 1FMOE 3P79A 4X3FC 2WD1A 1SNXA 2BHHA 3A7IA 4GT3A 4JL9A 4RMZA 3CTQA 3K5VA 2IZSA 3R7YA 5AUUA 2OKRA 2R3KA 4P2KA 4FV5A 3UDZA 5GZAA 4I6HA 1ZMVA 4BTMA 1DI8A 4FKJA 4RIXA 3WF9A 3HMPA 4KRDA 3WIKA 1OL1A 5ANOA 3V04A 4KKEA 4DEDA 2VGPA 3ORLA 2HELA 2BDFA 1REJA 2XNEA 4JJRA 1W84A 4IZ7A 4FE2A 3LFDA 5HIEA 3AGMA 2A19B 3VS4A 4BZOA 3FMKA 4Y73A 5BYYA 1Q97A 3C4ZA 3E88A 3IOKA 3UIXA 1H27A 1YWNA 3Q4CA 3QX2A 2PVYA 3A4PA 4ZOGA 4IMYA 4U9AA 4PF4A 4G6NA 4G17A 1P5EA 4CNHA 1OVEA 3ZLYA 3DQXA 3CGFA 5M09A 4E6CA 3E92A 4G6OA 4NU1A 2UW8A 3KXZA 4C59A 4X3JA 1DS5A 1AD5A 3OHTA 5G1XA 4TWNA 3ZFYA 4YZDA 1QCFA 5A6OA 3E8NA 4WRSA 5LVOA 4K1BA 3HV3A 3R8MA 4ALVA 3H9RA 3WIGA 1OB3A 1G8JA 3LFCA 5AUTA 4F9CA 4JBOA 5CTPA 1XH5A 3QRIA 5L3AA 4XG7A 3QCYA 1H28A 4E93A 1KOAA 5KNJA 3MJ1A 4OTFA 3VQHA 3UIBA 4Z7HA 4Z55A 1HCKA 3IK3A 3TDVA 4FIFA 4QMWA 5A4CA 1JSVA 2B1PA 4NJ3A 4O7VA 2WOTA 2R2PA 4UALA 5AP1A 3FC2A 4BKYA 4F4PA 4FKOA 4FSWA 4L53A 4RC4A 4A7CA 2GNHA 3DZQA 1H01A 2QO9A 3F3TA 3ULIA 4R3RA 4RWLA 1PMUA 3I4BA 3EQCA 4F70A 2BUJA 3QCXA 5CYIA 3I0OA 3LFFA 3A7JA 4LV8A 3U9CA 3ZLWA 1UWHA 4F09A 4QYGA 4E6AA 4D2WA 4DH3A 1L8TA 3ALNA 1MUOA 1J1BA 4BDCA 3UO6A 2AC5A 3F5PA 5CU4A 3HL7A 4YTIA 1VYZA 2W5AA 2JC6A 4OTRA 5I0BA 4AT3A 4D0XA 4LOOA 5HTCA 3OWKA 4O0TA 2XYUA 3FZTA 4CRLA 3SC1A 1UKIA 2OW3A 3EIDA 4Y8DA 3N51A 4ASXA 1QL6A 2YABA 4LGDA 5ACBC 4FR4A 5EW9A 5DMZA 5M57A 2H34A 3BL9A 3NVMB 3JYAA 3VBXA 3NUNA 3LPBA 2OIDA 4ZTQA 1RW8A 4AACA 3EQRA 4BWPA 1ZYCA 2WIHA 3R02A 4A4LA 2CDZA 3O5AA 4YBJA 3V5LA 3ZONA 1OKYA 2R0UA 3EL8A 5KMJA 4ZLOA 3UQFA 4NTTA 4FKGA 2F4JA 1K2PA 3V01A 4L8MA 4MXCA 1JKLA 5HNGA 3TNHA 1TKIA 4XG3A 5CEIA 1U59A 5GJDA 3PYYA 2B54A 2AYPA 3GP0A 2DYLA 2YISA 3FYKX 1MP8A 3OZ6A 3PXYA 3ZXTA 3BHVA 5IDPA 3O23A 5GZ9A 3FLNC 2PZIA 1M2PA 3R73A 3UNJA 2I0VA 2YERA 2CGUA 4CZYB 3DXPA 2ZJWA 4GKIA 4IAIA 4L7FA 2C3JA 2O64A 1FINA 2VZ6A 5C1QB 4J96A 4CZTA 3N4UA 4LUDA 4BCIA 3PY3A 3DDQA 1YI3A 3DAKA 1YI6A 3NUUA 5M4FA 2OGVA 2XRUA 3W0SA 3QUEA 4XX9A 4G16A 2J50A 2YEXA 4NM7A 4FIGA 4BJJA 3FAAA 4KBCA 2HCKA 3GI3A 2IO6A 1OUYA 4PPAA 4YC3A 2OI4X 3PWDA 1WBNA 4Y5QA 3ULZA 2Y4IB 4RVKA 2YLFA 5CF8A 4DFUA 2WKMA 3FZOA 2JAMA 4MCVA 1H00A 2VX0A 3RAWA 5ETIA 4RFMA 5JGBA 2QOKA 1FGKA 4L68A 4O0VA 1SM2A 2YACA 4CLJA 3ACKA 2HWOA 4WNMA 4RQVA 3MIAA 1M2RA 2VU3A 3ORZA 3QTRA 4I92A 4DGMA 2UZNA 4TWOA 4U97A 3CQUA 1XHAA 4WG5A 3R04A 4UMQA 3DBCA 4YZNA 2XK4A 3E3PA 3VBVA 2JIVA 4BBFA 4O81A 4X6RA 2G2IA 3W2QA 5CLPA 4TN6A 1XMLA 4DTKA 1XBAA 4ZLZA 3CSVA 4AZEA 5CU2A 2HW6A 1RDQE 5HTBA 4FG8A 3RWQA 2PE0A 1PF8A 3NPCA 5I9ZA 3L9LA 3A7HA 4APPA 1TQMA 2WMWA 3HKOA 3OG7A 3QTXA 3EYGA 2VWUA 3QHRA 4M7IA 4USDA 2VRXA 3V5QA 3COKA 4V05A 5EHLA 3Q60A 2HZIA 4HCTA 2E9NA 4JNWA 4GL9A 4CRSA 5BUIA 5D41A 5JFSA 5IQBA 5AA8A 2UW7A 5KMIA 4LDTA 4KRCA 4LM5A 4BHZA 3VF9A 3DB8A 4OT5A 5AR4A 4FT0A 3DFAA 5JQ8A 4DBNA 4EUTA 1EH4A 3OF0A 3II5A 4L3LA 3OVVA 5FXQA 4ZSGA 2I7QA 1OBDA 3PA4A 4BCKA 2NYAA 1W98A 3QD4A 5FTQA 3P08A 4E1ZA 4H1JA 3DKGA 4NCTA 4O22A 5KX8A 3FE3A 5K4IA 2VN9A 1UWJA 4D2PA 4FYNA 4AZVA 1Y8YA 5HZNA 4E6DA 3OY1A 3PJ3A 2HWPA 2QO7A 3UC3A 3BLRA 5TKDA 4BZNA 1GAGA 4MKCA 3CLYA 4ENYA 4EOIA 3FSKA 2WMRA 2QLQA 2VTPA 2HY81 3PVUA 4FL3A 4TYJA 4EYJA 4ACHA 3F88A 4H3BA 2W5BA 5JFXA 3BLQA 4GUEA 3VS5A 1Q99A 4LOPA 3VUHA 2PHKA 5KKRB 2O2UA 4J8MA 5CEKA 3P23A 4WRGA 4IVBA 4RC3A 2PE2A 4O6LA 4D1SA 5AUXA 4FT3A 4BWKA 3BGPA 4C4JA 2ZB0A 3RGFA 3TKHA 2PK9A 3I6WA 3MSSA 5JGDA 3ZUVA 5CNNA 1T46A 2PULA 5EH0A 2UW5A 5CWZA 5C03A 3PG3A 4FOBA 4CSVA 3PLAE 5H9BA 3VUIA 2C68A 4ORKA 2DQ7X 3QUPA 2GCDA 3W18A 3C0HA 1ZAOA 2Z7SA 5IH5A 4D9UA 3DU8A 2CKEA 2F9GA 3M42A 4OBPA 3TUCA 2WTIA 2OFUA 3P7AA 2EXCX 4M3QA 5HO8A 4BVUA 5IA4A 4CMTA 4EBVA 2OO8X 5J9ZA 3DLSA 1GIHA 5EDRA 2NO3A 3MWUA 4M69A 4UMPA 2UZWE 4OW8A 5JMSA 5KBRA 3PJ1A 1VZOA 2QOHA 1L3RE 4YURA 1J7IA 4F65A 1PMNA 3VW6A 2HYYA 2UW3A 3F69A 1OM1A 3HEGA 3QD0A 3MY1A 4WUNA 5DLSA 5AIRA 4I5CA 1W0XC 4PMTA 3VONA 2C1BA 3R8LA 2CGWA 5F4NA 3KK9A 4J95A 5D10A 2JDVA 4A4OA 2ITOA 4AN9A 2C6KA 2XNNA 2XA4A 2PVHA 5HG9A 4L7SA 1JLUE 3ZH8A 4BCGA 5J7HA 1QPEA 4L44A 1B39A 3AD6A 2B4SB 2QNJA 3GU6A 5EYCA 5I3OA 5AAEA 3FEGA 3E8EA 1IA9A 4LFIA 3ZYAA 3JUHA 4QYYA 5CVFA 1H0WA 2C3IB 3F7WA 1GZ8A 3Q04A 3Q52A 3D7ZA 3TEIA 5IPJA 4JX7A 3ZUUA 2B7AA 3ORMA 5FWKK 1ZY5A 2C6EA 1JKTA 4U3YA 3QD3A 4OR5A 2YIRA 4F63A 3MFUA 1UV5A 2VTJA 3LMGA 4QMTA 1CM8A 4WSQA 2XKDA 2XBAA 4J52A 2O5KA 4JDKA 3DNEA 3GCVA 4WT6A 4YZ9A 4F7LA 4RWIA 1YI4A 2C5XA 3PSCA 1M17A 2H6DA 3EQBA 4IX4A 4X2JA 4OAUC 2WZJA 2XNGA 3R28A 5ANEA 4CFNA 1YWRA 3REPA 2ZOQA 3R1NA 4RLKA 2UW4A 2X0OA 4E5WA 5J79A 1XBCA 4TXCA 1UNLA 4C4GA 2BRMA 4YU2A 3V51A 3MB6A 4O7WA 1ND4A 2WQMA 2WU7A 5CXHA 3EFWA 5E4HA 4F1MA 4M15A 4UYNA 3KMWA 4ITJA 3R1QA 4FTUA 3FPMA 1IR3A 2EUFB 3ENMA 4Y85A 4AGCA 3QKKA 4YZMA 5IQAA 5LARA 2OJGA 4YJOA 4D2VA 4TT7A 5A9UA 5L6PA 5E91A 3KA0A 4O1OA 3L9NA 4FIEA 4JBQA 4YO6A 2CGVA 3RNIA 1YHSA 4U40A 3SRVB 4JLCA 3NYOA 3R71A 4U0IA 4DTBA 5FXSA 3SAYA 3IONA 4PWNA 4J1RA 2WTKB 3V8SA 4TY1A 4AFJA 3KEXA 2BR1A 3I81A 3K54A 4D58A 3JVRA 5D7AA 4ZSJA 2E9VA 2QG7A 3FPQA 3HRBA 1P4OA 2FA2A 5EQEA 2H96A 5FBOA 2C47A 4RZVA 3ZZWA 4IM0A 2HENA 4GRBA 3FWQA 2R3JA 3MPTA 2JFMA 5F95A 3KK8A 3V6RA 5AP4A 3D5WA 3A2CA 4BCJA 4QTBA 3WARA 3W0MA 3GB2A 3ZHPC 3SW7A 3CJFA 3WF5A 3CXWA 3B8RA 3RBWA 4DGLC 1ZYLA 4AW1A 4UN0C 3RZBA 4H36A 4TZRA 3QWJA 5KMNA 3UVQA 3QYZA 2VAGA 3GT8A 3C1XA 3OWJA 5AV3A 3GGFA 3MTFA 3PZHA 4IVDA 5IA3A 1FGIA 2GMXA 5IUIA 2R3NA 2J90A 1U5RA 5GNKA 4Y83A 4RIYB 4AG8A 5CASA 2XUUA 1IAJA 5J95A 5DVRA 4HVSA 3BWJA 2Y9QA 4KS7A 4PRJA 5EKOA 3PVGA 3MVMA 2LGCA 4ANNA 2VWVA 4S2ZA 2VTRA 4DFLA 2Y6MA 3NW6A 3R0TA 4EEVA 3GCQA 4ASDA 5HLNA 2EU9A 2ZM1A 2WAJA 3BHYA 4QMXA 4I24A 3NEWA 2UW9A 4PTGA 4BCOA 5I9YA 3FYJX 5HE0A 2FSTX 4FL2A 3RHKA 2GPHA 3WBLA 5DI1A 1R0PA 1M7QA 1R78A 3T8OA 3F2RA 3PSDA 2VWZA 3BV2A 3PA3A 3QRTA 4RFYA 5HCXA 3TWJA 4YSJA 5AV2A 5B2LA 4PMPA 2C30A 4S30A 2OJFE 4E4MA 1TQIA 2XM9A 3D0EA 3V8WA 3DDPA 3LOKA 4QP1A 3S1HA 5LMAA 3EB0A 3IW8A 5IG1A 1ZOGA 5CX9A 3ZS5A 1H1WA 1ZWSA 4ZZOA 5KCVA 3DZOA 3RHXA 3BLAA 2YIXA 1TQPA 4FSRA 2XIXA 2B9JA 4GT5A 2GHLA 2R3GA 3AQVA 5HG8A 2OZAA 1LUFA 4NH1A 2PZ5A 5DEWA 4Q5HA 1TFFA 2IG7A 3QRUA 4BY9E 4QOXA 3MN3A 4ZTLA 3LCOA 5EM7A 4EC8A 2UZTA 4IAAA 1H24A 4Q2AA 3Q5IA 1KE9A 4YC8A 3LFQA 1YOMA 2WTVA 4MNEA 4ANBA 3LIJA 4FTIA 4FNZA 5LQFA 3JXWA 4R3CA 3BHHA 4BKZA 4X3FB 3W2SA 4USEA 3D4QA 3D2IA 1PXJA 5EM5A 4JAJA 4DN5A 3WI6A 1FOTA 4FTQA 2J7TA 4YO4A 4FSYA 3EJ1A 4GJ3A 4UWBA 5KMMA 3S00A 5IQDA 5CU3A 4MXOA 5KHWA 4R3PA 4D55A 4AZSA 3DGKA 4WKQA 4O84A 4NJDA 4XRLA 1PMVA 4YJTA 2XB7A 4I23A 4GVJA 2Z8CA 2F2CB 5FTOA 4IM3A 4C2VA 4GKHA 1SVGA 4E3CA 3W0QA 4D1ZA 4WHZA 3LFNA 5I9XA 4AA5A 2QVSE 4RJ7A 4CKJA 4DH8A 1UA2A 1H07A 1A9UA 4FZDB 2OSCA 4APCA 2OLCA 2BIKB 3KVXA 3T3UA 5D1JA 4FV9A 5HCYA 3QZGA 3MH0A 1W2FA 2VTTA 4ITHA 4ONAA 3FQHA 4C3PA 4ACGA 4EOOA 3IO7A 5DBXA 4O4DA 3SA0A 3GFEA 4FSUA 3NWWA 4O27B 4ZTHA 4BYJA 2UZBA 4QYHA 4NFMA 4ENXA 4D5KA 2NNWB 4I5MA 3UMWA 3GQLA 5CAUA 1YOJA 4JVGA 4QTCA 4D0WA 2GNGA 4XOYA 1OPKA 2JFLA 2IVVA 2B53A 2E9UA 4QMUA 4WBBB 3WF7A 4CXAA 5ETAA 1SVEA 2WU6A 5FTGA 1VEBA 2WQOA 4S33A 5L8KA 3K2LA 3ZDUA 5L2WA 2ITZA 5ACKA 4UX9A 4EQUA 2C1AA 2YCFA 3LHJA 2QCSA 3PXKA 4G3EA 4HOKA 3I79A 4AS0A 4JDJA 3FBVA 2CCIA 4UZDA 3KXNA 5AADA 3LCKA 4EL9A 3TM0A 1F3MC 4FL1A 1JKKA 2OU7A 3E3BX 2R9SA 3FL5A 1Y57A 5CNOA 3O51A 4J71A 3PY0A 3LW0A 3OEZA 4JQ7A 5JSMA