4L01A

Crystal structure of the v658f apo jak1 pseudokinase domain
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
286
structure length
274
Chain Sequence
QPVYPMSQLSFDRILKKDLVQGEHLGRGTRTHIYSGTLMDKKIKVILKVLDPSHRDISLAFFEAASMMRQVSHKHIVYLYGVCFRDVENIMVEEFVEGGPLDLFMHRKSDVLTTPWKFKVAKQLASALSYLEDKDLVHGNVCTKNLLLAREGIDCGPFIKLSDPGIPITVLSRQECIERIPWIAPECVEDSKNLSVAADKWSFGTTLWEICYNGEIPLKDKTLIEKERFYESRCRPVTPSCKELADLMTRCMNYDPNQRPFFRAIMRDINKLEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords Tyrosine-protein kinase JAK1
publication title Structure of a pseudokinase-domain switch that controls oncogenic activation of Jak kinases.
pubmed doi rcsb
source organism Homo sapiens
total genus 94
structure length 274
sequence length 286
chains with identical sequence B
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2013-05-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4l01A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4l01A01
3WIGA 3OZ6A 5HNBA 4E7WA 3TCPA 3L9NA 1J1CA 4NTSA 4XH6A 4DEDA 3P86A 4CD0A 3PPKA 4D4VA 4IAFA 4FG7A 5FWKK 5F9EA 5I9VA 3D2IA 5GZ8A 4BTKA 2CKEA 3DKOA 2PUIA 4I6BA 2C0IA 4EWHA 4ZSAA 3MH2A 1R78A 3PJ2A 3VHEA 3ITZA 3ZLWA 1UVRA 5EYDA 1PF8A 2ZV9A 2UVYA 4FV7A 4R3CA 3UVRA 3DFAA 4A06A 4IVCA 5TE0A 3WZEA 4YZMA 3MVLA 3QD0A 3KF4A 5ETAA 5LCJA 2IO6A 5DGZA 4W4XA 2X7OA 4KS8A 5L2SA 4MXYA 4F09A 2PUPA 5FQDC 3MTFA 2CKOA 4FTMA 3ANRA 3DTWA 4JAIA 4RJ4A 4EZ7A 4FODA 3PG1A 4K2RA 4ZY4A 5DLSA 2UZTA 2VU3A 4R3PA 2J5FA 3V04A 2UW9A 3QQUA 4P4CA 3V5QA 3ERKA 2VO0A 2X6EA 2GNJA 3O0GA 3GCPA 4JBPA 4QYFA 5L6OA 3RK9A 3FZOA 3GC7A 3WI6A 2H6DA 1O6LA 4FNYA 4QMPA 4BCFA 4EUTA 4AT3A 4AF3A 5CS6A 4EOLA 3ZZWA 4L3JA 5H8EA 3VQHA 4DFUA 5CF8A 4ASDA 4PPAA 1A48A 4KNBA 2W1CA 3A7GA 4O82A 4F9CA 3F5XA 3A8WA 4I6QA 4M68A 2C3IB 3CY2A 3HMOA 2Z7RA 2OW3A 2GHGA 3GQIA 4FV3A 4CFWA 4FKQA 1SVHA 2QVSE 3R1QA 3SVVA 3MESA 3HUCA 4FG8A 3UOHA 3H9RA 3QCQA 1H4LA 5I5ZA 3EYGA 3BKBA 4E4XA 5IA5A 1E1VA 4TRLA 2YABA 4Q2AA 4PQNA 4EOMA 5GZ9A 2WQBA 5A3XA 4FSRA 2JDSA 3GCVA 4FZFB 4NTTA 3NW7A 4OTGA 4RWKA 5K0KA 3BLQA 4AN3A 3VBYA 3CTHA 4ZZNA 5A4CA 4XMOA 4BDEA 4JQ8A 3KGAA 2G15A 2J0LA 1J1BA 4O7NA 1RQQA 4YC8A 4DA5A 3FMMA 2UZNA 2BVAA 4MQ1A 2XIYA 4YC3A 3F7WA 4GIHA 2XM9A 4EBVA 1F3MC 2C47A 5AP7A 3EQPA 3L1SA 4HCUA 3TWJA 4GK3A 2VWWA 1Y57A 4J96A 5HE2A 2XUUA 4OBQA 3TTJA 5C8NA 2AUHA 2UZVA 5F4NA 3GEQA 4GT4A 4M15A 3KVXA 1PXOA 1REKA 2JITA 3G15A 4EOPA 3DXNA 4J1RA 1ZMUA 4JX3A 5IA2A 5KHWA 5HIEA 4EHEA 3KL8A 5JFXA 3KXGA 4QPMA 4BCGA 3H4JA 5KNJA 4JQ7A 3RPRA 3JUHA 3D5WA 3TZMA 2IJMA 4DH3A 4F7JA 3W2SA 2VWXA 3EN4A 1M14A 3QKLA 4RJ3A 3F61A 3TIZA 1OIUA 4C61A 2WMBA 4NIFA 5BVNA 3ZO1A 3ETAA 4JDIA 3ORLA 2C5VA 1B38A 4O6LA 4ACGA 4AUAA 1YQJA 3MPTA 4MNEA 3WYXA 4DGGA 2Y0AA 5TO8A 3LJ1A 3LLTA 4C2WA 2PSQA 3MVJA 4HNFA 3LCKA 2WTKC 4J71A 4QMVA 4CLJA 4QP1A 5AUUA 1AGWA 4DYMA 1ZMWA 4GMYA 4X21A 4EC8A 4LFIA 4UXLA 5AUZA 2XM8A 4FT3A 4FE2A 3G2FA 3C0HA 3HVCA 4DAWA 3TNIA 3C0GA 5AIKA 3FMHA 3C1XA 3KVWA 1OMWA 5DR2A 5FBNC 2NRYA 4W4VA 4FKPA 2WHBA 1P2AA 3FY2A 3LCSA 3P7CA 3Q04A 3IW7A 4IEBA 3GU8A 5ANGA 5EYKA 5IU2A 2ZB0A 3FBVA 1SVGA 2BZIB 2OK1A 2R9SA 5CASA 5JGAA 3COHA 1XWSA 5HQ0A 4J99A 5AP1A 4DLIA 1WMKA 4O83A 2G01A 3F5PA 2R3RA 5EW9A 4YP8A 4C37A 2PE1A 5IEYA 2QLUA 2R3IA 5CEMA 3UNKA 4RX5A 5GHVA 1HCLA 2XNOA 4PRJA 3F66A 4YZCA 1UNHA 3GCSA 2C3JA 3IONA 4UB7A 4OT5A 2C30A 3FDNA 3MGYA 4DFXE 3OOGA 3A4PA 3Q6UA 4C4FA 3E8NA 3LXPA 4S2ZA 5HE3A 4CT1A 4LV8A 4Y73A 2VN9A 5BUEA 1NXKA 2FVDA 3IW5A 3GU5A 2QU5A 4YGAA 4IB0A 2C6LA 3AMBA 2B55A 4DGLC 4TZRA 3MFTA 1JPAA 4QTCA 4O0RA 4YZBA 3R7YA 2XEYA 4AFJA 5BNJA 2HY81 3W2OA 3BV2A 2VX1A 2C6DA 1W98A 2GS2A 4DG3E 3DB8A 5IG1A 4QTDA 1JVPP 3PSCA 3ZXTA 4FTJA 1OI9A 2HZNA 3PIZA 1JBPE 2XNBA 4QQJA 5FTGA 5I9WA 4RIXA 5ETFA 3LFEA 4DFLA 3HUBA 4RFMA 4O84A 4ZZMA 5FBOA 5J1VA 3I79A 3H10A 3A60A 4HNIA 2VX0A 3V5WA 4AN9A 4C58A 2V22A 2BRGA 4JT3A 5IQHA 3GXLA 2YM5A 5B2LA 3BLHA 1U54B 4ZTNA 4RFYA 3NIEA 3TKHA 5JGDA 2E9VA 4RGJA 4DN5A 5CU3A 3ZDIA 5CT7A 1QMZA 3IDBA 2WMRA 3IW6A 3ATSA 3FXXA 1GZOA 2Y6OA 4XG8A 4YJNA 2E9OA 5HIDA 3UQCA 1ZAOA 4OTRA 4NW6A 4B9DA 3LFCA 2P3GX 2JAVA 2WMTA 4RIYB 5EYMA 3W10A 3FSFA 4FTKA 1KE9A 5C4KA 4FC0A 2GNGA 5J87A 4CGAA 4BDAA 3K3IA 5CF4A 4FIIA 4CQGA 4TKSA 4ZY5A 5KMNA 1GIIA 4UMTA 2QODA 5H2UA 2ACXA 2GHLA 3HL7A 4N6YA 4BCKA 3TNWA 4ZJIA 5AR7A 2UW8A 4M12A 5I3OA 3QQGA 3ZFYA 2YLEA 4K0YA 4OBOA 3PUPA 4FL2A 4QMLA 4UY9A 5D11A 3OHTA 4MXOA 3QD2B 4RBLA 3QRKA 5HVKA 4PMPA 4G5JA 4E1ZA 1ZOGA 3DA6A 3W1FA 3OCGA 4FKIA 4OT6A 3ORNA 4QTBA 4FF8A 5EHYA 4AW2A 2R3QA 3VO3A 3AT3A 4CV9A 2BKZA 2V0DA 4QQ5A 4JS8A 2I7QA 4BN1A 3IQ7A 5I9UA 2RSVA 1RW8A 4FTUA 4GIIA 3QALE 3UYSA 4CKIA 2X1NA 4JOAA 4RPVA 4EOOA 2BAKA 3SDJA 4DTBA 3BQRA 4J95A 5H8GA 1BI7A 3LXKA 4FEXA 4D2SA 5CVFA 5A46A 2CCIA 2X0GA 3GUBA 4EH3A 2YWVA 5HD7A 2ITOA 2VTNA 4H1JA 4W4YA 4ZSGA 2QR8A 3KK9A 3KRWA 5BMSA 4HZSA 4FTLA 3PFQA 5KMJA 3V8SA 1H1SA 5LVNA 4ZS4A 2OH0E 5AV2A 3PJ1A 3GOPA 5L4QA 5HE1A 4MNFA 1F5QA 3FMEA 5B2MA 3FZRA 4XHKB 3U6IA 1Q5KA 3DAEA 3EL8A 5KCVA 4APPA 5DT3A 3QRTA 4CTCA 3LCOA 2J4ZA 4LGHA 4P7EA 4PTGA 4C35A 2ITNA 1R39A 3PRIA 4LMNA 2C3KA 3MW1A 4PPBA 4QTEA 3S00A 4MEDA 3POZA 4MXZA 3ROYA 5HG8A 4I5PA 1BI8A 1WCCA 4U81A 2PMLX 5KE0A 3Q32A 3AQVA 4APCA 5JK3A 2QKRA 2YDIA 3W33A 4ITHA 2R2PA 2V62A 4NWMA 3PIXA 4BI0A 5BVOA 1WBWA 3EN9A 3KFAA 2YIXA 3NRMA 3R02A 2BTRA 5BUIA 5HU3A 5CSWA 2F7EE 5DRDA 3SD0A 3KRJA 5AM6A 4X3FB 5LCKA 1SNXA 2RIOA 4ITJA 4RVMA 2VO6A 3KN5A 2VTOA 4YTFA 4G16A 5IA3A 5JRSA 5CU6A 3QCSA 4BCNA 4RQVA 3HECA 4EI4A 2VTRA 4IANA 4XV3A 4AW1A 2F7XE 3ENHA 5HIBA 4RX9A 2VTSA 3ZXZA 4FIFA 3MS9A 4F6SA 5AAFA 4IB3A 2X2KA 3A4OX 2OFVA 3CGFA 3QD3A 3QGWA 4ALVA 1VEBA 2O3PA 4DF3A 1G8AA 2BRBA 3QYWA 4FIHA 3ZONA 4L6QA 4PWNA 4F7LA 3TM0A 2GTNA 2PVRA 3IDPA 4M7IA 4ITIA 3IKAA 3BU3A 3BE9A 1FVRA 4XP3A 4KB8A 3LMIA 4G9RA 2V5QA 4KIKA 1M17A 3IW8A 2FO0A 4JBQA 2FUMA 5C9CA 3AC3A 4YR8A 4M0ZA 3R7EA 3O8PA 3S3IA 2I0VA 3VC4A 2NPQA 4CZUA 3PVWA 3AMAA 4BTFA 4MBJA 2VTPA 3FC2A 2PWLA 2ZM1A 3OCSA 5AV1A 4EK8A 4A07A 3ZU7A 4AQCA 4AA5A 3H0ZA 1YHSA 1JOWB 1XH8A 3NIZA 3VUGA 1YWVA 2EWAA 5IKWA 1IA9A 4RC3A 5G1XA 3D94A 3OBGA 3EQIA 3PVGA 3TEIA 4AGWA 3UDBA 2ITWA 3K5VA 4XLVA 4L45A 4HOKA 5DA3A 3ZS5A 1IEPA 2OJGA 2W96B 3O23A 3PA5A 3QF9A 1QPCA 4G3EA 4JIKA 4W8DA 3WF6A 2W1IA 1FQ1B 2JBPA 4J97A 3ZH8A 3ZHPC 2ZYBA 4I4EA 4EC9A 4E6DA 4KSQA 3D5XA 4LV5A 2BFXA 4UALA 5FD2A 3CIKA 4QQCA 3QYZA 4K9YA 4AACA 4G6LA 3MDYA 4PDYA 2OGVA 3RAIA 3VQUA 5GIOE 5BYLA 2W7XA 1QCFA 2BRHA 3ZO4A 3VF9A 2QNJA 4UX9A 5HKMA 4Y46A 3OF0A 3OT8A 3EYHA 4OTIA 5FRIA 4AG8A 3BRBA 3I5ZA 4A9SA 3NNXA 1H1QA 5ANDA 4YNOA 3E5AA 2YJSA 4MF0A 4UYAA 3Q6WA 1YXUA 1U59A 2GPHA 2OXYA 4ASXA 4GSBA 4O7RA 3HMIA 3HV6A 5KKRB 1L3RE 2OXDA 4OTQA 4BDCA 2P55A 5IQCA 5C8KA 3SHEA 3NLBA 3NCZA 1Z5MA 2VWZA 4O1OA 2W4KA 2GQRA 2E9UA 3OMVA 5K5XA 4CT2A 4O7ZA 3U9NA 3EHAA 4MXCA 4CEGA 1BL6A 3HYHA 3D7TA 2H8HA 1URWA 2BAQA 4FSYA 1FVTA 4IZ5A 4AFEA 1KUTA 1A9UA 3AT4A 3D7ZA 3GB2A 2RFEA 3RVGA 3V3VA 4FNWA 1OKVA 4QMUA 4A4LA 5HBHA 4MBLA 2YM3A 1XQZA 4KRDA 3UQFA 4NM5A 3HV7A 4F1MA 4UMPA 4QMTA 4XYFA 3MA3A 1V0OA 2B7AA 3OXIA 5C03A 4RJ8A 1FMOE 2W0JA 5IMXA 3TUBA 2XRWA 2XJ1A 2JEDA 4YZ9A 4PY1A 5EQYA 3COMA 3FMNA 2PVNA 3FUPA 2J6MA 3G6GA 3HA6A 5D9HA 3N4UA 4CXAA 3G5DA 4JDHA 4F9WA 3O17A 1ZYCA 3A7IA 3MIYA 1IA8A 3PXKA 5IQAA 4GL9A 1TVOA 5AMNA 5IQDA 3OTUA 4YU2A 4IDVA 4M84A 4RVLA 4V05A 4ZLOA 5AR2A 4RLKA 2WMXA 5HI2A 3KY2A 2WU7A 3EB0A 4TYGA 5FM2A 4UMUA 2PVHA 5HGIA 3I0OA 5E90A 5KMKA 2UW5A 3KRLA 5AA9A 1Q24A 2Y8OA 5KZIA 1H28A 3PPJA 3TUDA 5FLFA 2QOKA 3HAVA 3UOLA 1YI3A 3F5GA 3LE6A 4U41A 3ORPA 3O7LB 4FTCA 2RFNA 3QLGA 4U43A 3VUIA 5E1EA 4JLCA 4QMXA 5HVJA 3CE3A 2PMIA 3IOKA 4Z9LA 4CQEA 4YUQA 3AD5A 3PA3A 3LFAA 2IW6A 4O0YA 4IH8A 1ZRZA 4WNKA 1FGIA 1Q3DA 3N51A 3R30A 4FK6A 3OOMA 4YHTA 3Q4ZA 4YJOA 5H3QA 5IDPA 4CKJA 1FMKA 2OJFE 4F9BA 4CG8A 3R7IA 4I24A 3CJGA 4F9YA 1NVRA 2IVUA 3U54A 2CHLA 4RWIA 2C5NA 2PE0A 2C6OA 1QPJA 4GK2A 4IFCA 3BIZA 3R1YA 3W2QA 4CYIA 3GC0A 4IWQA 3FI8A 3EZRA 3R2BA 2UUEA 4E6QA 1UKIA 3FMKA 3WF9A 3E88A 3LCTA 5EG3A 4Y8DA 5E1SA 2BDJA 4KIQA 5HORA 3MFUA 4XG3A 2Z60A 2BZKB 2BILB 4V0GA 3Q9WA 5L2QA 2A1AB 2ITXA 4RWLA 4DGNA 3PTGA 3A2CA 1H8FA 2JIUA 3DNEA 4O1PA 4D1XA 3C13A 4EH5A 4JJRA 2JC6A 3MB6A 2R3JA 3KN6A 5FEDA 4FTIA 3QGYA 4I0TA 3E63A 2PVYA 3RK5A 2WMWA 3RPOA 5CEKA 5LXMA 2WTVA 2OF2A 3FWQA 3OXTA 3VUMA 3MN3A 3RJCA 3LAUA 3W16A 4DEIA 4GS6A 2QHMA 1KE5A 3I7CA 4CFNA 2CGVA 3DV3A 4RJ6A 1KE7A 3QQHA 2XS0A 3ZBXA 3PZHA 2UW6A 4O7SA 2ERZE 3NYOA 5L2IA 3QWKA 3QKMA 4LG4A 2IZTA 4N6ZA 4S31A 4CFVA 5DR6A 3RPSA 4USFA 4LI5A 3QXOA 5ANIA 4FIGA 2XK9A 1O6YA 2IZRA 4GU6A 2OJIA 4X7QA 1Y91A 1ZY4A 3HDNA 4DH1A 4AE9A 2B9HA 3W8QA 2ZVAA 4XOYA 3UNJA 2VRXA 1KOAA 2G2IA 3T8OA 1K9AA 3SGCA 3PRFA 5IZFA 2XKDA 5CLPA 4CLIA 5JH6A 4X3JA 2XIRA 3C5UA 3BHVA 4IVBA 4FZDB 3DBFA 4WNPA 4RA5A 5FXSA 5CU2A 4PTEA 4WA9A 1K3AA 2ETKA 4YJVA 5IUIA 5TKDA 4LOPA 3DU8A 2XKCA 4GYIA 5CSPA 2C1BA 5E8TA 1H1RA 1JKLA 1WBNA 1YRPA 3VBQA 2PULA 4GUBA 5AAEA 3LFFA 3F2RA 3UVPA 4DFZE 4KWPA 3NUNA 3CGOA 3NNUA 5TF9A 1KSWA 4BKJA 3D4QA 5GZAA 4DFBA 2QOBA 2BRMA 4BWPA 3ENMA 3HP5A 2PUUA 3E64A 4AZTA 3KXNA 4WNMA 5CX9A 5AR3A 2QONA 4WG5A 3EZVA 3QQJA 3CBLA 5J9ZA 3OTVA 4ZMEA 2V7AA 2YHVA 4S30A 3V8TA 4FI1A 4I1ZA 3QHWA 4O22A 1WBTA 1YI6A 2H34A 1OUYA 3KXXA 4QP2A 4XBUA 3LQ3A 3C4FA 3TACA 3A99A 3RPVA 5J7HA 3ULZA 2YZAA 5CEIA 4ONAA 4IQ6A 4X3FC 4A4XA 4BDFA 4EKKA 2JDOA 1M2RA 2YCQA 2ZV7A 4M8TA 4MQ2A 4UWBA 3M11A 3W2CA 4QP8A 4AGCA 1UU9A 4P2KA 3S1HA 1OL1A 4EH9A 3EN6A 4FBXA 4GG7A 4C57A 3C7QA 4QT1A 1T45A 4YO4A 3W8LA 4RIWB 4ZEGA 5BUJA 3QA8A 4LOQA 3BE2A 2OF4A 2RGPA 3BEAA 2W06A 4GFGA 5C4LA 3R22A 4N4SA 4C0TA 4BCJA 4EYMA 2WZJA 2X8EA 3RWQA 1U54A 4XV2A 5IA0A 3PG3A 4X2FA 4KS7A 3FI3A 4K77A 2UVXA 3DLZA 2H9VA 4AZSA 4O7LA 4E20A 4R1YA 5CSXA 4ACHA 3PA4A 2YDJA 3TDVA 1Q8TA 3SXFA 1LEZA 5LWMA 4GKIA 4V01A 2HXQA 4IX5A 2IPXA 3NNVA 3GU7A 3DXQA 2B1PA 5I9XA 3PXFA 1ZZLA 1Q62A 4FSTA 3EWHA 3SXRA 4ERWA 4YPSA 3T9TA 3R63A 3TNQB 5L8JA 3VS1A 3D2KA 4ZTHA 4ZTLA 1RDQE 1ZWSA 4OW8A 5CENA 3LJ2A 5A4EA 5J79A 2W17A 3SG8A 4U3YA 4D2TA 3ZLSA 2XK6A 2F7ZE 2WTDA 2XYUA 4CMTA 4K18A 1RE8A 3BPRA 4FV2A 3UOKA 4Z7GA 1SYKA 3FQEA 4WG3A 5HU9A 4DBNA 2HXLA 3ZZEA 4JI9A 2DWBA 1PXLA 2I0HA 1OKYA 4FTTA 3R9OA 3FLYA 4YSJA 1OL2A 3C4XA 5J5TA 2CDZA 1Z57A 4YJSA 4LGDA 1YOMA 1YXSA 2EXMA 4JNWA 4ZSLA 1REJA 1JNKA 3U4UA 3ZTXA 3R8UA 1NVSA 3TKUA 4DCEA 4EZ5A 1PW2A 1Q41A 2R3NA 4YNEA 1IAJA 4DH7A 5KBQA 4F64A 2XBJA 3HDMA 5KKRC 1H27A 3DK7A 4FT9A 2KULA 2UZBA 3KRRA 3LW0A 4B0GA 3KU2A 2CGXA 3ORTA 5T6KA 4D5KA 3O71A 3QZIA 4RSSA 5C26A 4O27B 1GJOA 4G34A 1Y6BA 2YM7A 4CVAA 3I81A 4I93A 5L3AA 1GNGA 4ZTSA 5EI8A 2YFXA 4YTHA 1E1XA 1YDSE 2GS7A 5LVLA 5CANA 5HG9A 4J98A 4CCUA 3LIJA 3R9DA 1M52A 3KMWA 3BBTB 4YLJA 2C0TA 4GJ3A 2YCSA 5AUVA 1U5RA 3HMNA 2WMUA 4C62A 3VBVA 4F6WA 3FEGA 4EONA 3FHRA 2QD9A 3K54A 1T46A 3U87A 1O9UA 2QOOA 2YEXA 3ORIA 5BVEA 1R0EA 3QQKA 4IBMA 3TZ9A 1WVYA 2QC6A 2X6DA 4BY9E 4FKVA 4YJRA 3PP1A 2X2MA 1UWHA 5DEYA 4AWIA 4CKRA 5HNIX 3TI1A 4OR5A 4JRNA 3E93A 4I0SA 4E4MA 3PSDA 2QO9A 2I1MA 3CR0A 3D83A 2ZMDA 5KZ0A 3UO5A 4IE9A 3RPYA 4FTQA 4JRVA 1PMUA 3VHKA 2PZIA 2XB7A 2FSOX 3AGLA 1ERKA 4K1BA 1MUOA 3PWDA 5AUYA 3AC5A 5C27A 4U9AA 1R0PA 3C51A 1ATPE 3LMHA 5AV3A 3NNWA 4HYIA 1Y8YA 4OTDA 1MQ4A 3COIA 5HG7A 3SQQA 4F9AA 3R04A 2HENA 2ITUA 4FKUA 3BYVA 3TN8A 3A61A 3RWPA 3UIBA 3SW7A 4QOXA 4BKYA 2R3LA 2EVAA 1SM2A 2YAAA 5CSHA 2A19B 1U5QA 2R4BA 4YSMA 3TDWA 3NW6A 4HYSA 2QCSA 4AN2A 3QZFA 2O64A 2PTKA 3G9NA 5A54A 2F9GA 4FNZA 3VUDA 1PXMA 4IDTA 3DTCA 4YJPA 3MVMA 4AX8A 1UV5A 4NEUA 4KA3A 4C4IA 1KE8A 1OVEA 5IMEA 5LMKA 4HGTA 1PXNA 4OGRA 4TPTA 2WQEA 1QPDA 2J7TA 2YCFA 2J0MB 3Q9XA 3UMWA 3NPCA 3TJCA 1XBBA 2CPKE 4F6UA 3QTUA 2WOTA 4AOJA 1PY5A 2ITTA 2C1AA 4MXAA 5F95A 3H30A 5B0XA 5HCXA 4IMYA 3QXPA 4QMSA 3ZMMA 2C6MA 3BHTA 3PE1A 4I20A 3OWJA 5A14A 4NKAA 5AUWA 4MX9A 2UZDA 1OL5A 3VAPA 3UIXA 5FEEA 5BVKA 2VD5A 4UMQA 3G0EA 3GI3A 1APME 4R7BA 3QKKA 2DQ7X 4UMRA 4FL1A 4FZ7A 2RG5A 2CN5A 2UZEA 4WOVA 2J0IA 3L9PA 3PXQA 3LKMA 5EFQA 2YJRA 3C4WA 1XR1A 2HWPA 2Z7LA 3AT2A 4NJDA 2BZHB 2QLQA 4I92A 4D5HA 3W2RA 1ZYLA 4S34A 4FSMA 4CRLA 3ZM9A 4DT8A 3KKVA 2VWYA 4QYYA 3VS5A 2YITA 4LRMA 5D12A 2DUVA 4Y95A 3WZDA 3BZ3A 4MK0A 4C38A 5L6PA 2YWPA 3SXSA 2FYSA 4IAAA 5DBXA 5BQ0A 2O65A 4NFNA 3LFDA 3HNGA 2Y9QA 1J7UA 4EJ7A 3O2MA 2ITYA 4XUFA 3UPXA 4ANMA 4CZYB 4FVQA 5AUXA 3R9HA 4JDJA 5D7VA 4EK4A 3I5NA 4L3LA 4R7IA 3UIUA 2HAKA 2YZLA 3OROA 3G9LX 4IIRA 5IA1A 4O6EA 5E8UA 5HLNA 3NVMB 4FR4A 3BU5A 3FZ1A 5CEOA 3PY3A 1H26A 5A4QA 5M09A 3V5JA 5ACKA 4A4OA 4QO9A 5LVMA 3VBTA 2VWVA 3C0IA 2R3OA 2W1ZA 4U8ZA 5HO8A 4ACCA 4CV8A 4PDPA 3DQXA 2CJMA 4NM3A 5IEXA 3GCUA 3EKNA 3RP9A 4H3PA 3R9NA 4QYGA 5EQPA 2F2UA 4YBKA 4BDKA 2P2IA 4IJ9A 5A6NA 5LMBA 4GU9A 5LQFA 1XO2B 4LQMA 2R5TA 2XIZA 4JX7A 1MRYA 4IC8A 4E6AA 2CNQA 1XJDA 2QOQA 2XIKA 1H25A 1OL7A 4UZDA 3RHKA 4I0RA 3UNZA 1ZLTA 3NWWA 4Q9SA 3MSSA 1OPLA 4GT5A 4HYUA 4FGBA 3ATTA 3ZSGA 4TYHA 2YERA 2XP2A 4S32A 4C59A 5CZHA 1NW1A 1GIJA 3F7ZA 4K6ZA 1YXTA 4B8LA 4HVHA 2XJ0A 4I22A 4C4EA 2W1GA 2WIHA 2YLFA 5AWMA 1H00A 2OICA 2R7BA 5GJGA 5CU0A 3NUAA 4EH7A 3EFJA 5J8IA 4ANSA 4M0YA 1YWRA 3LFQA 5FGKA 4BCIA 3Q3BA 4HVSA 1YHVA 4FT0A 4F0IA 4W8EA 5AV0A 2X39A 5AM7A 3RAWA 2E2BA 3G90X 4GVJA 1HOWA 3HA8A 3MH3A 5M57A 2PZPA 2QURA 2JD5A 5JFWA 4NL0A 1Q8ZA 2UW4A 3BCEA 3OT3A 3CQEA 3LM0A 3PIYA 2F49A 4XEYA 2RKUA 3BGPA 4QMWA 5AX9A 4AZVA 4F4PA 5K5NA 1ZXEA 5JZJA 4B7TA 2OJ9A 2RL5A 4NK9A 4OAUC 4RJ7A 4M69B 2F57A 3F3WA 4BDHA 5IPJA 1VR2A 2JDVA 3Q9YA 4U7ZA 2BALA 3ULIA 2I40A 3NZ0A 1OIRA 4X2JA 4ZS0A 5HHWA 3FJQE 3KULB 1IAHA 4FKWA 4WIHA 4DH5A 4DEBA 1YXVA 3NCGA 1MQBA 4I6HA 4O2ZA 5DHJA 4OBPA 5T68A 2XKFA 3PY1A 4FEQA 2QU6A 2YISA 3DJ7A 4JG8A 1PXJA 4NKSA 5HO7A 4MAOA 4E6CA 4EEVA 3OY1A 5EM8A 3NAXA 3BHYA 3KXHA 4GFMA 2XEZA 5ETCA 5E7RA 3PJCA 3B2TA 3VS6A 5BPYA 3RK7A 3BV3A 4QMQA 3FPQA 4EH8A 2ITQA 2W5BA 3DNDA 3UP2A 1R3CA 1Q4LA 4ALWA 5FEQA 4QP9A 5EW8A 2B9FA 3DKFA 3UZPA 2VTJA 5GNKA 4FTNA 2RFSA 3E3BX 2ZV2A 4NM0A 3EQCA 3ET7A 2YA9A 3C9WA 4EOJA 3O96A 5F20A 3U55A 1JSUA 4U40A 2AYPA 1KE6A 4DINA 4QNYA 3SRVB 3QUPA 4HGLA 5DFPA 3CTJA 3AG9A 3PZEA 5HCYA 1Y6AA 4Z16A 3E92A 3U9CA 4I5CA 3FLSA 1NA7A 5CAOA 4U6RA 3UQGA 5HE0A 4XG7A 2CMWA 2YM4A 5IH4A 3ZUUA 2Z2WA 2WPAA 3PLAE 4WSYA 4YHJA 2Q83A 3QTZA 4ZTRA 4FL3A 4KBKA 4FKOA 2OBJA 5LARA 3HKOA 2YIRA 4P5QA 3QTSA 1FPUA 1M7NA 4D4RA 1UU7A 5EDQA 1CKIA 2WKMA 3I7BA 3KB7A 4YBJA 4ID7A 4CSVA 4N0SA 4IZAA 5HLWA 5JEBA 4EQCA 3Q2JA 4C8BA 2R3FA 2UZLA 2IVSA 4AW5A 4H39A 3BYOA 5KO1A 4O0XA 5L2WA 2W1HA 5JRQA 2J50A 5BVDA 2BAJA 5J95A 3QTQA 3P23A 2CNUA 4RRVA 3JVRA 4KAOA 3N4VA 3GENA 4I23A 3VUTA 1P5EA 3FV8A 4AE6A 1PMNA 2XVDA 4AOTA 2WTCA 2HZ0A 4E73A 5EW3A 4O86A 3TZ8A 3TUCA 4BI1A 3JXWA 4NJ3A 1XH9A 3ZFXA 4AZWA 5JZNA 4IVDA 4AT4A 5LVPA 4DT9A 2WQNA 3WE4A 1OIYA 1CM8A 3FLZA 4EQUA 4J8MA 4E93A 5JFSA 3HRBA 1OECA 4L52A 3F9NA 5L6WL 3REPA 4X2KA 1KWPA 3DFCB 4PP9A 3ACJA 3DBQA 5F94A 4QQTA 3VIDA 5TOZA 3OC1A 4E5AX 2ETMA 4G17A 3MVHA 3OCTA 3HLLA 4TYJA 3HV5A 2REIA 4RIWA 5L8KA 2BRNA 3FLWA 2VX3A 5H9BA 4Y72A 2R3KA 4YJUA 4FSQA 2NNWB 4LUDA 1FVVA 2Z8CA 3H0YA 4O38A 2UVZA 3QUEA 4IXPA 5D7AA 5K4JA 3DBDA 3QFVA 1G5SA 5DIAA 5M4CA 3NGAA 5HLPA 2O5KA 5HOAA 5KBRA 3KK8A 5JFVA 2XKEA 5L2TA 3PDTA 2HY0A 2R0IA 3DAJA 3R7VA 5DR9A 4ZSJA 2R3HA 3QAME 4NZWB 4KBAA 4NIFB 3WZUA 3JR1A 4LL0A 5E8SA 3V6RA 3ZC5A 2Y4IB 4M67A 5M44A 4MNEB 2FA2A 3VW8A 2VWUA 3S4QA 3NEWA 1JKKA 2VTIA 4L3PA 2XK8A 3E8DA 4HCTA 2BHEA 2WMVA 3GT8A 3PVUA 4U97A 3RAKA 5IUGA 3F6XA 4QNAA 4JAJA 3IOPA 1YDRE 3UO4A 4BIEA 1NT2A 3MY0A 2IZUA 2ZB1A 3CJFA 5CVGA 2BR1A 5D41A 4ZMFA 4EH6A 4F0FA 4NSTA 5B7VA 1SVEA 1S9IA 4DEGA 4YURA 3IGGA 5B2KA 4Z7HA 2WTJA 3PE2A 2FH9A 2HK5A 3ORMA 4FV4A 2R3GA 1WBPA 3F82A 1MP8A 4Q9ZA 5DPVA 3NVKI 1F0QA 1H0WA 3CKXA 3T3UA 2C69A 5I9YA 2OZAB 3V5PA 4YZNA 3M1SA 1JKTA 4B99A 2CN8A 3VW6A 4GH2A 2J0JA 4ANBA 5M06A 2GCDA 3LHJA 4BZNA 1KOBA 1FOTA 1Q3WA 4M97A 2XNMA 4H05A 4JXFA 1DM2A 3ACKA 2W5AA 3RAHA 3K3JA 2PMOX 3FMLA 4DITA 4IFGA 4J53A 1WVXA 4GYGA 3WBLA 4RC2A 2DS1A 3MFSA 4FUYA 5TT7A 4C33A 4HJOA 2HW7A 3OFMA 3L8XA 3RGFA 3MYGA 4EK5A 2XZSA 5CZIA 1B6CB 2ESMA 4XCUA 3FXZA 4XV9A 4EQMA 3QU0A 4G3GA 1W8CA 4PDSA 3SW4A 4EWQA 5IA4A 4AOIA 5CQWA 2FGIA 1OITA 4AA4A 1P4FA 5CAQA 4R5SA 5I0BA 3RZBA 4ZY6A 4KSPA 4RIXB 2QOHA 1V1KA 2UZUE 3CQWA 4C7TA 4BB4A 3HMPA 3R6XA 4M3QA 4FV6A 3VS3A 4I3ZA 2SRCA 3KXMA 1EH4A 3DPKA 5AFVA 4EZ3A 4O7YA 3GCQA 5HVYA 4BIDA 4L53A 5AUTA 5A4LA 1AD5A 2GNHA 2PHKA 3KCKA 4GFOA 4D9UA 2XJ2A 4DEEA 4D1ZA 4FUXA 3FY0A 4Y83A 4H3BA 5JGBA 3I60A 5AIRA 2P33A 2JKOA 4KBCA 3ZEPA 4D28A 3DT1A 4MF1A 4CZTA 5M08A 5CVHA 4EYJA 3FZTA 1JWHA 3IO7A 4O7TA 1ZYJA 4I94A 4DCAA 2PVLA 4HPUE 1GIHA 4GCJA 2R64A 3MJ2A 3MBLA 5D10A 4X2GA 3V01A 2HELA 3I6WA 5J9LA 5BYYA 4N57A 2C3LA 5E8XA 3QTXA 2HIWA 3NSZA 4G5PA 4L46A 1NY3A 4U5JA 3OUKA 4RX8A 4H1MA 4WT6A 3SKCA 4A7CA 2YDKA 3FQHA 3QWJA 4WUNA 2PVFA 2VGPA 1FINA 3ORZA 4IX6A 4BFMA 2EUFB 3ODZX 3UC3A 4FX3A 3AD6A 1OKWA 3GOKA 3IGOA 4TN6A 2JDTA 2FSTX 4YJQA 1I44A 5ITAA 3MV5A 3CEKA 4DTAA 1MRUA 1GZNA 4OTPA 4BF2A 2IVVA 1BL7A 1YHWA 4GKHA 1JLUE 3R8ZA 3TL8A 2GFSA 3B8QA 3EKKA 4UXQA 4UN0C 4PL4A 4D58A 3BWJA 4IAYA 4RWJA 3U51A 4U42A 3F3TA 4KKGA 5EI6A 4M66A 3D5UA 3GP0A 4IWOA 1DI8A 2WTIA 3FKNA 1STCE 3H9FA 4FEWA 3PVBA 4FYNA 4GVAA 3UZTA 2UZWE 5C01A 2BDFA 1OM1A 4C3PA 4DLJA 3KMUA 1CKJA 2XK7A 1LUFA 4BICA 5IH5A 4NYEA 4BDJA 1UU3A 1OZ1A 3VULA 3ORXA 3R0TA 1E9HA 1JSTA 2VUWA 4D55A 4G1WA 5CAUA 2PVJA 4KD1A 3DS6A 4TXCA 2UV2A 4IC7A 3THBA 4DEAA 2GSFA 4FOCA 5E8YA 4MD7E 1J91A 3LXNA 5HBJA 4QPAA 4D4SA 5HX6A 3EQDA 4LOOA 1Q8UA 5LWNA 4CNHA 3C4ZA 4U0IA 4TYEA 2JFLA 4FICA 4ZTMA 1YWNA 4BDBA 4FTAA 4C34A 2Y4PA 1UA2A 3DBCA 4C2VA 4LMUA 4ENYA 4DG0E 2WGJA 3UC4A 2Q0NA 3DZOA 4DG2E 4F99A 2P0CA 5DNRA 4BR3A 4ANNA 5EKNA 4OTHA 3QQFA 4FZAB 4TNDA 4WNOA 1KV1A 1WZYA 2HW6A 5CTPA 4D4YA 4CTBA 2OWBA 1YOJA 3SA0A 4IACA 4TTHB 2EB3A 2I0EA 3ALNA 3P78A 4XNEA 4ASZA 3ZM4A 3WZKA 3CD8A 1XH6A 4RVTA 3UTOA 3R71A 4EK3A 3II5A 3FHIA 5K3YA 5HESA 2XBAA 4FMQA 3HV3A 3RNIA 4BYIA 1PXKA 1RJBA 3RBWA 4EL9A 5M56A 4FZ6A 5CF5A 4RQKA 1PJKA 5CWZA 4FKJA 3TXOA 3F69A 3R2YA 4FSNA 3JY9A 2IW8A 5HBEA 4KIKB 2GNIA 1W0XC 2ITVA 4BWXA 4EH2A 5CNNA 3OWKA 3BGQA 4B4LA 3V6SA 3ALOA 2OIBA 5T3QA 5GJFA 2XYNA 3EQRA 3LPBA 4JBVA 4MKCA 2BROA 2PPQA 4MHAA 2C6TA 4CFXA 2AC3A 4FV5A 5TR6A 3C4CA 4NT4A 2UW7A 4FSUA 4YC6A 5E4HA 4O0SA 1ZOHA 4ANQA 2ZOQA 3DLSA 2PE2A 5DYJA 1M7QA 3E62A 5LVOA 3D5VA 4WO5A 2X7GA 4RIYA 3TG1A 3OXZA 4ARKA 3BLRA 3OCBA 1DI9A 3Q4TA 2BUJA 4IW0A 3R00A 4D2WA 3QLFA 3ANQA 3HGKA 2UW0A 2WFYA 3KXZA 2CLQA 4NM7A 4IZYA 2G1TA 4QMYA 3WIKA 3V8WA 5IQFA 5EHLA 1VYWA 3GQLA 3M42A 3NW5A 3O8UA 2QOFA 4M69A 5A9UA 4IWPA 2V7OA 1H0VA 2WELA 2UW3A 5CI6A 5D1JA 4XRJA 4H3QA 2WMQA 3FI4A 1J7IA 2WB8A 5AP2A 3P5KA 4EHGA 1GY3A 3CTQA 4GJ2A 2X2LA 1WAKA 5K0XA 2GHMA 2JBOA 2VTAA 2W99B 4A9TA 4BCHA 5JSMA 4L9IA 4WUAA 2BHHA 2XA4A 4E4LA 3RZFA 1CMKE 4BBFA 1OPKA 4ZJJA 2JLDA 2Y4IC 3UMXA 4BZOA 4D9TA 3FC1X 4QMOA 1G8SA 5JKGA 4BIBA 4FSWA 4BVUA 2GMXA 5M51A 3ELJA 1B39A 2VTLA 2WQOA 3FZPA 3PPZA 3EL7A 3NYVA 3QX4A 4PL3A 3DBEA 4YO6A 4BGQA 2JIIA 3Q2MA 4O21A 3ZSIA 4IWDA 1W83A 3D7TB 4GK4A 3RM6A 2OFUA 2CNVA 1ZYSA 1PXIA 3DKCA 1TQPA 5CU4A 4F70A 3SX9A 3H3CA 4BGHA 2W5HA 4G6OA 5E8WA 4BGGA 4ZLYA 3PLSA 3HV4A 3FE3A 3P7AA 3DK6A 5DVRA 5M4UA 2VO3A 2JKQA 4QP4A 3SRVA 3O7LD 1GAGA 3C4EA 4FG9A 4K8AA 4CCBA 2PZYA 4ACMA 3LFBA 1BLXA 4FVPA 3ZO2A 1OUKA 2YAKA 4ALUA 3LVPA 4DTKA 2XH5A 3R8MA 3IDCA 2VWBA 4F1TA 4G31A 3UBDA 4CMUA 5AP3A 4F1OA 3H9OA 2HZ4A 4YJTA 3ZLYA 3W18A 3TV4A 4D1SA 1XH5A 4QMNA 2VNYA 3G6HA 2YM6A 5HD4A 4H58A 2PUNA 4O7VA 4U80A 2JDRA 2CGWA 3I6UA 3OG7A 4NU1A 4X3FA 4BL1A 5HX8A 3TV6A 4QPSA 2XIXA 3QUDA 3BWFA 4EOSA 5AR4A 3ZUTA 2JKKA 4QMMA 4I5HA 2XNNA 2XNEA 5HEZA 3B2WA 3MIAA 3PYYA 3A7FA 2CKPA 3AOXA 3SC1A 4QMZA 2X9FA 5EI2A 5AJQA 4II5A 3VF8A 2ZM4A 3PP0A 1Q8WA 3KREA 3QRIA 5GINE 2XMYA 1GZ8A 3DQWA 3DAKA 4GRBA 2ZDUA 5F1ZA 2OIQA 3SG9A 1H24A 4AXAA 4BHZA 3MPAA 3DCVA 3ZC6A 3P79A 3OWLA 3ZUVA 3LQ5A 5CAVA 4AU8A 4C4JA 2QO7A 5IQIA 4IM0A 2NRUA 3VRZA 5EM7A 5ANEA 4MXXA 5AADA 2YCRA 5AP6A 5DN3A 4EORA 4P90A 2PZ5A 3G33A 1UNGA 4KKEA 5KX8A 4PUZA 1ZZ2A 3DKGA 1Q8YA 3VS4A 3VS2A 2XRUA 3QC4A 4BCQA 5IQEA 2IN6A 2I0YA 1PHKA 3ORKA 2VNWA 4YZDA 3QTRA 5BYZA 2X7FA 3QX2A 1YVJA 4V0GB 1HCKA 2A4LA 4FT7A 5AEPA 3ZO3A 2J51A 3DJ5A 2FSMX 4L44A 4A9RA 4D2PA 3UGCA 3BYMA 4O0WA 4CRSA 3CPBA 4F08A 2F4JA 1PKDA 4FKSA 3ZEWA 2BTSA 4WKQA 5HG5A 3R8LA 3UP7A 2WU6A 3MI9A 3HRFA 3R28A 3HEGA 3IK3A 3AC1A 2I6LA 3UJGA 4FKLA 4Y85A 5HTIA 4ZAUA 4BKZA 3FSKA 2O2UA 4FKTA 4MCVA 4RX7A 2IVTA 4ZTQA 4USEA 5EDRA 2XK3A 4Z55A 3KQ7A 3EFKA 4O0TA 4F0GA 1VJYA 1A06A 3FMJA 2W1EA 3BELA 3NUYA 3TZ7A 4XG9A 2XCKA 2BMCA 2X8IA 4RJ5A 2GNLA 1SMHA 5FXQA 1YDTE 3TIYA 4DE4A 1PRYA 3ZRLA 1URCA 2VAGA 2X4FA 4PMTA 2IWIA 2R3MA 3EJ1A 2P2HA 3KF7A 2QI8A 2OO8X 3IS5A 4KIOA 2WIPA 2YM8A 4ANLA 4BDGA 2A2AA 1CTPE 4K11A 4LGGA 3F2NA 3G51A 1P4OA 2BFYA 3K5UA 2OZOA 5C8MA 4YLLA 1H08A 1DS5A 3LMGA 2IW9A 3R8PA 3MY1A 4KINA 2C68A 4BTMA 3S2PA 4E26A 3TJDA 3EN7A 4Z3VA 3MH1A 3B8RA 3E7VA 2W9ZB 3AXWA 5G6VA 1W7HA 4MWHA 4IAZA 4ZZOA 2CSNA 4MYGA 4LRKA 3OS3A 3EIDA 3O51A 4TYIA 3R83A 3EFLA 4NUSA 5IISA 3AD4A 4JG6A 2ETRA 4QYEA 2OZAA 3KRXA 2XF0A 4HVDA 5FDXA 4D0XA 4ORKA 3JS2A 5CAPA 4QP7A 5FP5A 4ACDA 3R7OA 2WAJA 5AP5A 4L8MA 5EQEA 2YN8A 4NH1A 3VJOA 5CF6A 2PYWA 4TNBA 2BCJA 3GBZA 3I4BA 3RI1A 1XBAA 2BKKA 2CGUA 2RF9A 2IZSA 4RG0A 4W4WA 4MBIA 5EYCA 5AAGA 1G3NA 4UZHA 1OBGA 3NR9A 5M55A 1DAYA 3IW4A 5E92A 3O50A 2BPMA 3O8TA 4A9UA 3NYNA 3DB6A 1YXXA 2B0QA 5I3RA 1UWJA 2V55A 4CMOA 2ONLC 1PMEA 4G3CA 5E91A 4I21A 3GFWA 5DH3A 4FV1A 2CKQA 4G6NA 2O0UA 5KUPA 4JQEA 1IG1A 3VRYA 4PNKA 4EOQA 1VZOA 2GFCA 3R1SA 4JR3A 4R5YA 4BBEA 4R7HA 3WILA 5A4TA 1WBOA 5KHXA 4JIAA 2EB2A 3M2WA 4DHFA 5KMIA 3BU6A 4RIOA 4FT5A 5H8BA 3PXYA 4FTRA 2W1FA 3WYYA 4RC4A 3CC6A 5CNOA 3ROCA 3IECA 4WRSA 5C1QB 2OLCA 1H01A 3ZOSA 2OJJA 3FI2A 4CYJA 4TWCA 1GOLA 4XP0A 4KKHA 3PSBA 4L68A 3PY0A 2PMNX 4X0MA 2WQMA 3QHRA 1W82A 5BVFA 2ZV8A 4UYNA 3RKBA 4FEUA 2C5XA 2GNFA 3WF8A 3ZCLA 3ZRMA 3TKIA 1TQIA 1X8BA 2B54A 4UWYA 5BMMA 1ZOEA 4QTAA 3FL5A 4O81A 5HZNA 2VO7A 3COKA 4FEVA 4R3RA 1Q99A 5DT4A 3KMMA 4YMJA 4FA2A 4KABA 2R7IA 3L8VA 5FXRA 4YPDA 1U4DA 3P0MA 4LRJA 3EQBA 2B9IA 1CKPA 3NAYA 4U3ZA 3UYTA 2JKMA 5HO6A 5L8LA 4PTCA 3E3PA 4EJNA 1M2QA 3F2AA 4XG2A 3S95A 3VVHA 2C6EA 3HMMA 1OIQA 1CDKA 4L7SA 1Y8GA 1YW2A 4ZOGA 5EKOA 4IM2A 4AAAA 1YOLA 3GFEA 2O8YA 3CCNA 4NW5A 3QD4A 4EHVA 3E8CA 4R1VA 3DXPA 4PMSA 1R1WA 5AV4A 3AC2A 1BKXA 4M14A 4IJPA 4AGDA 4HCVA 3OVVA 3NUPA 3RHXA 5IH6A 2XNPA 2FB8A 4O91A 3FPMA 5CALA 3D15A 2NP8A 3VN9A 2QKWB 4TY1A 3TNPC 2X9EA 2GQSA 4RFZA 1CSNA 1NVQA 2X4ZA 4ZSEA 4USDA 2Z7SA 1JKSA 4HGEA 4JVGA 3VS7A 4MD9E 2QG5A 2JIVA 2WOUA 4Q5EA 3RALA 3N4TA 4QP6A 4W9XA 2WMAA 3WF5A 3I1AA 2ITZA 2JAMA 3RMFA 5HNGA 5E9EA 3DY7A 3G0FA 4MTAA 3LZBA 4F7NA 1OPJA 5CSVA 3QRUA 2CLXA 2EXEA 3OUNB 2BDWA 5AR8A 3UO6A 4JR7A 5AA8A 2GS6A 5DOSA 3U4WA 5E8VA 4IAKA 3C50A 2F2CB 1PXPA 1S9JA 1UU8A 3DDPA 4E8AA 3CPCA 2AC5A 3F3ZA 3L8PA 4HGSA 2Z7QA 3BGZA 3QL8A 4HPTE 5CEQA 3RINA 4BWKA 3MPMA 4Q5HA 4IADA 5CQUA 5ANOA 5HCZA 4C4GA 4U79A 4KUJA 2YIWA 1JSVA 2QO2A 4I6FA 3TT0A 4IHPA 2OG8A 4XLIA 5EM5A 4O0UA 1OL6A 3F3UA 4YTCA 2DYLA 4K33A 5FTOA 4ZXTA 3ODYX 4KIPA 1U46A 3BHHA 3L9MA 3P08A 5EHOA 3EN5A 5CXHA 5EM6A 4ENXA 4PV0A 1J7LA 3CLYA 4FTOA 3NUXA 1I09A 4C4HA 5IUHA 2J2IB 4OTFA 3LFSA 1ZYDA 3QCXA 3I0QA 2ONLA 5AP0A 2E9NA 4GW8A 3V51A 2C6KA 3V5LA 4UBAA 2YIQA 3OW4A 5ICPA 2HYYA 2G2HA 3E7OA 2Q0BA 5CI7A 5IEVA 3EQHA 4XJ0A 4W9WA 5EH0A 3BEGA 4J52A 1AQ1A 2VWIA 3N9XA 4TWNA 4NCTC 2IG7A 1IASA 3OY3A 2HWOA 4AS0A 4RMZA 2R3PA 2WTWA 4OUCA 4WSQA 5IF1A 4V04A 2BIKB 4XV1A 5A6OA 5KMMA 4G3FA 1FBNA 4O2PA 5I4NA 2YACA 4BZDA 4IZ7A 1V0BA 2UZOA 4RVKA 2J90A 4M13A 5E8ZA 3QBNA 4EK6A 2GU8A 4RT7A 3Q96A 5AX3A 5M4IA 3CKWA 2O63A 4WG4A 4XG4A 1XKKA 3F5UA 2VZ6A 3R21A 5EOLA 3QTIA 5BX0A 5J9YA 4UV0A 2B52A 3QA0A 3SLSA 2Y7JA 2H96A 1TKIA 3EOCA 4P5ZA 3OWPA 3LM5A 1XH7A 4GT3A 4TL0A 3P1AA 2C5YA 2GTMA 4FIEA 2B4SB 3BI6A 4BYJA 2P4IA 3OBJA 5BVWA 3CQUA 4N70A 4TW9A 1KV2A 3JVSA 4WRGA 5HTBA 3E87A 3KC3A 3ZSHA 2CCHA 3PXZA 1O6KA 2B9JA 4OTWA 4XRLA 2A0CX 2W1DA 2ZJWA 3RNYA 3GU6A 3DK3A 1Q97A 4I4FA 1JQHA 2OH4A 3R73A 2RG6A 3POOA 3P7BA 2HCKA 3Q5ZA 4IVAA 4FIJA 4OLIA 1OGUA 2OIDA 5DE2A 2X8DA 3UG1A 3VUHA 3W55A 1BMKA 4G3DA 2VTQA 3AC8A 2HOGA 4L7FA 5CEPA 4QP3A 5EDPA 2XCHA 4O7WA 2PVMA 4PNIA 4CG9A 5ACBC 2EXCX 2B53A 3MWUA 5FM3A 4LM5A 1QPEA 4WBOA 4NFMA 3VNTA 5M53A 1BYGA 5EOBA 3SOCA 5HTCA 3FYJX 4IAIA 3K2LA 4FKGA 3EFWA 3UPZA 3HX4A 5CT0A 3WE8A 3R9RA 3JYAA 3BBWA 2C0OA 2JFMA 2XNGA 3MJ1A 3U8WA 3Q4UA 1K2PA 3C5IA 4BHNA 2FSLX 4FYOA 3MH0A 2QOCA 2QOLA 3UODA 3ZDUA 4ZJVA 5DG5A 2NO3A 4XP2A 5LMAA 5KMOA 4JBOA 2QG7A 4BI2A 3A7HA 4WHZA 3ZRKA 5FDPA 3T3VA 4WBBB 4ANOA 4C02A 5I9ZA 3OW3A 1UNLA 3QCYA 2VTTA 2YIYA 3CD3A 3D0EA 3SOAA 3TTIA 3EQFA 4YLKA 1GZKA 4BCOA 4DBXA 4EH4A 2OU7A 2VGOA 3MY5A 2WEVA 4O96A 2Y6MA 3AGMA 1UKHA 1XHAA 4D0WA 4C3FA 4GEOA 4E5BA 2GDOA 4PX6A 3NMUF 1PKGA 4AZFA 3MA6A 5DT0A 5DMZA 3EMGA 3DDQA 4EBWA 1ZARA 2J5EA 2J0KA 4AGUA 3FL4A 4PL5A 1P14A 4FGRA 4AP7A 3NUSA 4FK3A 4TYHB 4CFFA 3DGKA 3QZGA 1V0PA 3CS9A 3UZRA 4WD5A 5FP6A 4HVIA 5CY3A 2HZIA 4YHFA 4A9YA 1BUHA 5JQ8A 2ZM3A 4RLLA 3DOGA 3Q60A 1JAMA 3BX5A 3LLAA 3P9JA 4B6LA 1OB3A 4NCTA 4J7BA 4R8QA 4E3CA 4QRCA 4HVGA 5K4IA 1ND4A 3NX8A 3R1NA 4ERKA 4GV1A 3OP5A 1XBCA 4IB5A 5JT2A 2WXVA 1PMVA 2C4GA 4R78A 1H07A 1IRKA 1WVWA 3CP9A 3GC9A 1SZMA 3QQLA 3GVUA 5DI1A 3IG7A 5ANKA 3Q53A 2PVKA 2WNTA 2WD1A 5J1WA 3D9VA 5GIPE 4G9CA 3CY3A 4QYHA 3PJ3A 3NYXA 2W05A 4H36A 4AZEA 4PP7A 5IQBA 3ZBFA 3RTPA 3QC9A 4I41A 2BZJA 4RA4A 3VUKA 3W2PA 5DRBA 3NDMA 1H1PA 4RZWA 3ZFMA 4MD8E 2OXXA 3GC8A 2J9MA 4FSZA 2QR7A 3QRJA 4PPCA 5M07A 4RZVA 5K9IA 3DZQA 3F88A 3L9LA 4XOZA 3A7JA 2C5OA 4ZP5A 4C36A 4F65A 3OEZA 4L43A 3AC4A 3WOWA 2VV9A 2WTKB 4L42A 2PU8A 2G9XA 4EOIA 2WO6A 1BX6A 4DFNA 4JL9A 1J3HA 4PDOA 4Y5QA 2PZRA 5DWRA 1PYEA 2GQGA 4L00A 3WZJA 3HRCA 3D14A 1OKZA 3OEFX 1ZMVA 3F3VA 2W9FB 4DH8A 4ZLZA 3UVQA 2WEIA 4EUUA 3ID6C 4D2RA 5FTQA 3UOJA 4C3RA 4PF4A 4AT5A 2VTMA 4TT7A 4LL5A 5IDNA 2XK4A 4FVRA 3VS0A 5GJDA 3RCJA 4BCMA 3LOKA 2C6IA 3FQSA 2KTYA 4BDDA 3GGFA 5FG8A 4R6VA 4O0VA 2QQ7A 5EK7A 3BQCA 4F63A 4FV0A 4JG7A 4U44A 4X6RA 4FKRA 1IR3A 3CSVA 3RCDA 2ERKA 3VBXA 3CXWA 5KMLA 1PYXA 2ZAZA 4PMMA 4E4NA 4QD6A 3P4KA 5LOHA 2RFDA 4F7SA 5J5SA 5JQ5A 5AP4A 3TV7A 1H1WA 3FXWA 3FLQA 3IPHA 2PK9A 4DGMA 4DGOA 4BRXA 3LCDA 3PWYA 3PXRA 1XH4A 4LYNA 2PL0A 3BYUA 3MTLA 3SV0A 3R7GA 4CFUA 2X81A 4IX4A 2JGZA 4HZRA 3R01A 4DEHA 3FLNC 1WBVA 3LFNA 1SNUA 4Y5HA 5ANJA 1VYZA 1YI4A 4FNXA 3WF7A 1YKRA 2OI4X 2R0UA 3E8EA 4GUEA 3HZTA 3JPVA 2QHNA 3T9IA 4CFMA 3R8VA 3LQ8A 4FV8A 4JDKA 3RM7A 4D2VA 2E9PA 3S0OA 2W4JA 3EQGA 3NS9A 2ZMCA 3R7UA 4UWCA 3GNIB 4TWOA 4X6QC 4GG5A 3FMDA 3Q5IA 2EU9A 4MWIA 4MVFA 5JN2A 4HW7A 1L8TA 3HAMA 3JY0A 3ZLXA 4IM3A 4IB1A 4TWPA 3LJ0A 3KA0A 1Q61A 4E5WA 3ZYAA 3W32A 4OAVB 2LAVA 3HP2A 1ZY5A 3AMYA 4XS2A 3OD6X 4J8NA 1DAWA 5AR5A 4FV9A 2LGCA 5DEWA 4UEUA 3FKLA 5CXZA 3Q52A 4YTIA 2OSCA 4B8MA 3MFRA 4KRCA 4DFYA 4L01A 3LXLA 2OKRA 4U45A 2Z02A 3U6HA 4ZIMA 4XX9A 3DJ6A 1LPUA 3FYKX 4L67A 1W84A 4EHZA 1WBSA 2ZDTA 3A8XA 5HICA 1TQMA 3L8SA 4FOBA 4MH7A 5J7BA 3V5TA 5CYIA 4BC6A 3QTWA 3EH9A 5M4FA 2PY3A 3VBWA 3VWAA 4XBRA 4AA0A 4G2FA 4ASEA 4DC2A 3NUUA 4R77A 3UIMA 3QZHA 1LEWA 1FGKA 3BHUA 3GU4A 4AW0A 3KCFA 5FUTA 5LMKC 3KULA 5IQGA 1WFCA 3FAAA 1LP4A 4EKLA 3Q9ZA 5ETIA 1M2PA 3PJ8A 2WMSA 3KEXA 4X2NA 4BTJA 5JMSA 5LJJA 4IX3A 4LUEA 4S33A 3VJNA 4EOKA 3Q4CA 3MB7A 1Z9XA 3A62A 3TNHA 2A27A 1QL6A 3UG2A 3U6JA 1LR4A 2ITPA 3SAYA 4BBMA 2QOIA 2BIYA 3FKOA 4XG6A 3WARA 2W4OA 3BYSA 4ZK5A 4BCPA 1OBDA 4I5MA 3UE4A 3FZSA 4BDIA 1MRVA 4HYHA 2G2FA 2VTHA
chains in the Genus database with same CATH superfamily
3WIGA 3OZ6A 5HNBA 4E7WA 3TCPA 3L9NA 1J1CA 4NTSA 4XH6A 4DEDA 3P86A 4CD0A 3PPKA 4D4VA 4IAFA 4FG7A 5FWKK 5F9EA 3AKJA 5I9VA 3D2IA 5GZ8A 4BTKA 2CKEA 3DKOA 2PUIA 4I6BA 2C0IA 4EWHA 4ZSAA 3MH2A 1R78A 3PJ2A 3VHEA 3ITZA 3ZLWA 1UVRA 5EYDA 1PF8A 2ZV9A 2UVYA 4FV7A 4R3CA 3UVRA 3DFAA 4A06A 4IVCA 5TE0A 3WZEA 4YZMA 3MVLA 3QD0A 3KF4A 5ETAA 5LCJA 2IO6A 5DGZA 4W4XA 2X7OA 4KS8A 2AEGA 5L2SA 4MXYA 4F09A 2PUPA 5FQDC 3MTFA 2CKOA 4FTMA 3ANRA 3DTWA 4JAIA 4RJ4A 4EZ7A 4FODA 3PG1A 4K2RA 4ZY4A 5DLSA 2UZTA 2VU3A 4R3PA 2J5FA 3V04A 2UW9A 3QQUA 4P4CA 3V5QA 3ERKA 2VO0A 2X6EA 2GNJA 3O0GA 3GCPA 4JBPA 4QYFA 5L6OA 3RK9A 3FZOA 3GC7A 3WI6A 2H6DA 1O6LA 4FNYA 4QMPA 4BCFA 4EUTA 4AT3A 4AF3A 5CS6A 4EOLA 3ZZWA 4L3JA 5H8EA 3VQHA 4DFUA 5CF8A 4ASDA 4PPAA 1A48A 4KNBA 2W1CA 3A7GA 4O82A 4F9CA 3F5XA 3A8WA 4I6QA 4M68A 2C3IB 3CY2A 3HMOA 2Z7RA 4AXCA 2OW3A 2GHGA 3GQIA 4FV3A 4CFWA 4FKQA 1SVHA 2QVSE 3R1QA 3SVVA 3MESA 3HUCA 4FG8A 3UOHA 3H9RA 3QCQA 1H4LA 5I5ZA 3EYGA 3BKBA 4E4XA 5IA5A 1E1VA 4TRLA 2YABA 4Q2AA 4PQNA 4EOMA 5GZ9A 2WQBA 5A3XA 4FSRA 2JDSA 3GCVA 4FZFB 4NTTA 3NW7A 4OTGA 4RWKA 5K0KA 3BLQA 4AN3A 3VBYA 3CTHA 4ZZNA 5A4CA 4XMOA 4BDEA 4JQ8A 3KGAA 2G15A 2J0LA 1J1BA 4O7NA 1RQQA 4YC8A 4DA5A 3FMMA 2UZNA 2BVAA 4MQ1A 2XIYA 4YC3A 3F7WA 4GIHA 2XM9A 4EBVA 1F3MC 2C47A 5AP7A 3EQPA 3L1SA 4HCUA 3TWJA 4GK3A 2VWWA 1Y57A 4J96A 5HE2A 2XUUA 4OBQA 3TTJA 5C8NA 3O5AA 2AUHA 4I6LA 2UZVA 5F4NA 3GEQA 4GT4A 4M15A 3KVXA 1PXOA 1REKA 2JITA 3G15A 4EOPA 3DXNA 4J1RA 1ZMUA 4JX3A 5IA2A 5KHWA 5HIEA 4EHEA 3KL8A 5JFXA 3KXGA 4QPMA 4BCGA 3H4JA 5KNJA 4JQ7A 3RPRA 3JUHA 3D5WA 3TZMA 2IJMA 4DH3A 4F7JA 3W2SA 2VWXA 3EN4A 1M14A 3QKLA 4RJ3A 3F61A 3TIZA 1OIUA 4C61A 2WMBA 4NIFA 5BVNA 3ZO1A 3ETAA 4JDIA 3ORLA 2C5VA 1B38A 4O6LA 4ACGA 4AUAA 1YQJA 3MPTA 4MNEA 3WYXA 4DGGA 2Y0AA 5TO8A 3LJ1A 3LLTA 4C2WA 2PSQA 3MVJA 4HNFA 3LCKA 2WTKC 4J71A 4QMVA 4CLJA 4QP1A 5AUUA 1AGWA 4DYMA 1ZMWA 4GMYA 4X21A 4EC8A 4LFIA 4UXLA 5AUZA 2XM8A 4FT3A 4FE2A 3G2FA 3C0HA 3HVCA 4DAWA 3TNIA 3C0GA 5AIKA 3FMHA 3C1XA 3KVWA 1OMWA 5DR2A 5FBNC 2NRYA 4W4VA 4FKPA 2WHBA 1P2AA 3FY2A 3LCSA 3P7CA 3Q04A 3IW7A 4IEBA 3GU8A 5ANGA 4BJJB 5EYKA 5IU2A 2ZB0A 3FBVA 1SVGA 2BZIB 2OK1A 2R9SA 5CASA 5JGAA 3COHA 1XWSA 5HQ0A 4J99A 5AP1A 4DLIA 1WMKA 4O83A 2G01A 3F5PA 2R3RA 5EW9A 4YP8A 4C37A 2PE1A 5IEYA 2QLUA 2R3IA 5CEMA 3UNKA 4RX5A 5GHVA 1HCLA 2XNOA 4PRJA 3F66A 4YZCA 1UNHA 3GCSA 2C3JA 3IONA 4UB7A 4OT5A 2C30A 3FDNA 3MGYA 3P5JC 4DFXE 3OOGA 3A4PA 3Q6UA 4C4FA 3E8NA 3LXPA 4S2ZA 5HE3A 4CT1A 4LV8A 4Y73A 2VN9A 5BUEA 1NXKA 2FVDA 3IW5A 3GU5A 2QU5A 4YGAA 4IB0A 2C6LA 3AMBA 2B55A 4DGLC 4TZRA 3MFTA 1JPAA 4QTCA 4O0RA 4YZBA 3R7YA 2XEYA 4AFJA 5BNJA 2XAMA 2HY81 3W2OA 3BV2A 2VX1A 2C6DA 1W98A 2GS2A 4DG3E 3DB8A 5IG1A 4QTDA 1JVPP 3PSCA 3ZXTA 3KIOC 4FTJA 1OI9A 2HZNA 3PIZA 1JBPE 2XNBA 4QQJA 5FTGA 5I9WA 4RIXA 5ETFA 3LFEA 4DFLA 3HUBA 4RFMA 4O84A 4ZZMA 5FBOA 5J1VA 3I79A 3H10A 3A60A 4HNIA 2VX0A 3V5WA 4AN9A 4C58A 2V22A 2BRGA 4JT3A 5IQHA 3GXLA 2YM5A 5B2LA 3BLHA 1U54B 4ZTNA 4RFYA 3NIEA 3TKHA 5JGDA 2E9VA 4RGJA 4DN5A 5CU3A 3ZDIA 5CT7A 1QMZA 3IDBA 2WMRA 3IW6A 2XARA 3ATSA 3FXXA 1GZOA 2Y6OA 4XG8A 4YJNA 2E9OA 5HIDA 3UQCA 1ZAOA 4OTRA 4NW6A 4B9DA 3LFCA 2P3GX 2JAVA 2WMTA 4RIYB 5EYMA 3W10A 3FSFA 4FTKA 1KE9A 5C4KA 4FC0A 2GNGA 5J87A 4CGAA 4BDAA 3K3IA 5CF4A 4FIIA 4CQGA 4TKSA 4ZY5A 5KMNA 1GIIA 4UMTA 2QODA 5H2UA 2ACXA 2GHLA 3HL7A 4N6YA 4BCKA 3TNWA 4ZJIA 5AR7A 2UW8A 4M12A 5I3OA 3QQGA 3ZFYA 2YLEA 4K0YA 4OBOA 3PUPA 4FL2A 4QMLA 4UY9A 5D11A 3OHTA 4MXOA 3QD2B 4RBLA 3QRKA 5HVKA 4PMPA 4G5JA 4E1ZA 1ZOGA 3DA6A 3W1FA 3OCGA 4FKIA 4OT6A 3ORNA 4QTBA 4FF8A 5EHYA 4AW2A 2R3QA 3VO3A 3AT3A 4CV9A 2BKZA 2V0DA 4QQ5A 4JS8A 2I7QA 4BN1A 3IQ7A 5I9UA 1G8KA 2RSVA 1RW8A 4FTUA 4GIIA 3QALE 3UYSA 4CKIA 2X1NA 4JOAA 4RPVA 4EOOA 2BAKA 3SDJA 4DTBA 3BQRA 4J95A 5H8GA 1BI7A 3LXKA 4FEXA 4D2SA 5CVFA 5A46A 2CCIA 3VONA 2X0GA 3GUBA 4EH3A 2YWVA 5HD7A 2ITOA 2VTNA 4H1JA 4W4YA 4ZSGA 2QR8A 3KK9A 3KRWA 5BMSA 4HZSA 4FTLA 3PFQA 5KMJA 3V8SA 4O4DA 1H1SA 5LVNA 4ZS4A 2OH0E 5AV2A 3PJ1A 3GOPA 5L4QA 5HE1A 4MNFA 1F5QA 3FMEA 5B2MA 3FZRA 4XHKB 3U6IA 1Q5KA 3DAEA 3EL8A 5KCVA 4APPA 5DT3A 3QRTA 4CTCA 3LCOA 2J4ZA 4LGHA 4P7EA 4PTGA 4C35A 2ITNA 1R39A 3PRIA 4LMNA 2C3KA 3MW1A 4PPBA 4QTEA 3S00A 4MEDA 3POZA 4MXZA 3ROYA 5HG8A 4I5PA 1BI8A 1WCCA 4U81A 2PMLX 5KE0A 3Q32A 3AQVA 4APCA 5JK3A 2QKRA 2YDIA 3W33A 4ITHA 2R2PA 2V62A 4NWMA 3PIXA 4BI0A 5BVOA 1WBWA 3EN9A 3KFAA 2YIXA 3NRMA 3R02A 2BTRA 5BUIA 5HU3A 5CSWA 2F7EE 5DRDA 3SD0A 3KRJA 5AM6A 4X3FB 5LCKA 1SNXA 4LDTA 2RIOA 4ITJA 4RVMA 2VO6A 3KN5A 2VTOA 4YTFA 4G16A 5IA3A 5JRSA 5CU6A 3QCSA 4BCNA 4RQVA 3HECA 4EI4A 2VTRA 4IANA 4XV3A 4AW1A 2F7XE 3ENHA 5HIBA 4RX9A 2VTSA 3ZXZA 4FIFA 3MS9A 4F6SA 5AAFA 3AKLA 4IB3A 2X2KA 3A4OX 2OFVA 3CGFA 3QD3A 3QGWA 4ALVA 1VEBA 2O3PA 4DF3A 1G8AA 2BRBA 3QYWA 4FIHA 3ZONA 4L6QA 4PWNA 4F7LA 3TM0A 2GTNA 2PVRA 3IDPA 4M7IA 4ITIA 3IKAA 3BU3A 3BE9A 1FVRA 4XP3A 4KB8A 3LMIA 4G9RA 2V5QA 4KIKA 1M17A 3IW8A 2FO0A 4JBQA 2FUMA 5C9CA 3AC3A 4YR8A 4M0ZA 3R7EA 3O8PA 3S3IA 2I0VA 3VC4A 1G8JA 2NPQA 4CZUA 3PVWA 3AMAA 4BTFA 4MBJA 2VTPA 3FC2A 2PWLA 2ZM1A 3OCSA 5AV1A 4EK8A 4A07A 3ZU7A 4AQCA 4AA5A 3H0ZA 1YHSA 1JOWB 1XH8A 3NIZA 3VUGA 1YWVA 2EWAA 5IKWA 4DHZA 1IA9A 4RC3A 5G1XA 3D94A 3OBGA 3EQIA 3PVGA 3TEIA 4AGWA 3UDBA 2ITWA 3K5VA 4XLVA 4L45A 4HOKA 5DA3A 3ZS5A 1IEPA 2OJGA 2W96B 3O23A 3PA5A 3QF9A 1QPCA 4G3EA 4JIKA 4W8DA 3WF6A 2W1IA 1FQ1B 2JBPA 4J97A 3ZH8A 3ZHPC 2ZYBA 4I4EA 4EC9A 4E6DA 4KSQA 3D5XA 2IF8A 2BFXA 4LV5A 4UALA 5FD2A 3CIKA 4QQCA 3QYZA 4K9YA 4AACA 4G6LA 3MDYA 4PDYA 2OGVA 3RAIA 3VQUA 5GIOE 5BYLA 2W7XA 1QCFA 2BRHA 3ZO4A 3VF9A 2QNJA 4UX9A 5HKMA 4Y46A 3OF0A 3OT8A 3EYHA 4OTIA 5FRIA 4AG8A 3BRBA 2X0QA 3I5ZA 4A9SA 3NNXA 1H1QA 5ANDA 4YNOA 3E5AA 2YJSA 4MF0A 4UYAA 3Q6WA 1YXUA 1U59A 2GPHA 2OXYA 4ASXA 4GSBA 4O7RA 3HMIA 3HV6A 5KKRB 1L3RE 2OXDA 4OTQA 4BDCA 2P55A 5IQCA 5C8KA 3SHEA 3NLBA 3NCZA 1Z5MA 2VWZA 4O1OA 2W4KA 2GQRA 2E9UA 3OMVA 5K5XA 4CT2A 4O7ZA 3U9NA 3EHAA 4MXCA 4CEGA 1BL6A 3HYHA 3D7TA 2H8HA 1URWA 2BAQA 4FSYA 1FVTA 4IZ5A 4AFEA 1KUTA 1A9UA 3AT4A 3D7ZA 3GB2A 2RFEA 3RVGA 3V3VA 4FNWA 1OKVA 4QMUA 4A4LA 5HBHA 4MBLA 2YM3A 1XQZA 4KRDA 3UQFA 4NM5A 3HV7A 4F1MA 4UMPA 4QMTA 4XYFA 3MA3A 1V0OA 2B7AA 1W2CA 3OXIA 5C03A 4RJ8A 1FMOE 2W0JA 5IMXA 3TUBA 2XRWA 2XJ1A 2JEDA 4YZ9A 4PY1A 5EQYA 3COMA 3FMNA 2PVNA 3FUPA 2J6MA 3G6GA 3HA6A 5D9HA 3N4UA 4CXAA 2X0OA 3G5DA 4JDHA 4F9WA 3O17A 1ZYCA 3A7IA 3MIYA 1IA8A 3PXKA 5IQAA 4GL9A 1TVOA 5AMNA 5IQDA 3OTUA 4YU2A 4IDVA 4M84A 4RVLA 4V05A 4ZLOA 5AR2A 4RLKA 2WMXA 5HI2A 3KY2A 2WU7A 3EB0A 4TYGA 5FM2A 4UMUA 2XAOA 2PVHA 5HGIA 3I0OA 5E90A 5KMKA 2UW5A 3KRLA 5AA9A 1Q24A 2Y8OA 5KZIA 1H28A 3PPJA 3TUDA 5FLFA 2QOKA 3HAVA 3UOLA 1YI3A 3F5GA 3LE6A 4U41A 3ORPA 3O7LB 4FTCA 2RFNA 3QLGA 4U43A 3VUIA 5E1EA 4JLCA 4QMXA 5HVJA 3CE3A 2PMIA 3IOKA 4Z9LA 4CQEA 4YUQA 3AD5A 3PA3A 3LFAA 2IW6A 4O0YA 4IH8A 1ZRZA 4WNKA 1FGIA 1Q3DA 3N51A 3R30A 4FK6A 3OOMA 4YHTA 3Q4ZA 4YJOA 5H3QA 5IDPA 4CKJA 1FMKA 2OJFE 4F9BA 4CG8A 3R7IA 4I24A 3CJGA 4F9YA 1NVRA 2IVUA 3U54A 2CHLA 4RWIA 2C5NA 2PE0A 2C6OA 1QPJA 4GK2A 4IFCA 3BIZA 3R1YA 3W2QA 4CYIA 3GC0A 4IWQA 3FI8A 3EZRA 3R2BA 2UUEA 4E6QA 1UKIA 3FMKA 3WF9A 3E88A 3LCTA 5EG3A 4Y8DA 5E1SA 2BDJA 4KIQA 5HORA 3MFUA 3W0MA 4XG3A 2Z60A 2BZKB 2BILB 4V0GA 3Q9WA 5L2QA 2A1AB 2ITXA 4RWLA 4DGNA 3PTGA 4QDEA 3A2CA 1H8FA 2JIUA 3DNEA 4O1PA 4D1XA 3C13A 4DHJA 4EH5A 4JJRA 2JC6A 3MB6A 2R3JA 3KN6A 5FEDA 4FTIA 3W0QA 3QGYA 4I0TA 3E63A 2PVYA 3RK5A 2WMWA 3RPOA 5CEKA 5LXMA 2WTVA 2OF2A 3FWQA 3OXTA 3VUMA 3MN3A 3RJCA 3LAUA 3W16A 4DEIA 4GS6A 2QHMA 1KE5A 3I7CA 4CFNA 2CGVA 3DV3A 4RJ6A 1KE7A 3QQHA 2XS0A 3ZBXA 3PZHA 4AXEA 2UW6A 4AAYA 4O7SA 2ERZE 3NYOA 5L2IA 3QWKA 3QKMA 4LG4A 2IZTA 4N6ZA 4S31A 4CFVA 5DR6A 3RPSA 4USFA 4LI5A 3QXOA 5ANIA 4FIGA 2XK9A 1O6YA 2IZRA 4GU6A 2OJIA 4X7QA 1Y91A 1ZY4A 3HDNA 4DH1A 4AE9A 2B9HA 3W8QA 2ZVAA 4XOYA 3UNJA 2VRXA 1KOAA 2G2IA 3T8OA 1K9AA 3SGCA 3PRFA 5IZFA 2XKDA 5CLPA 4CLIA 5JH6A 4X3JA 2XIRA 3C5UA 3BHVA 4IVBA 4FZDB 3DBFA 4WNPA 4RA5A 5FXSA 5CU2A 4PTEA 4WA9A 1K3AA 2ETKA 4YJVA 5IUIA 5TKDA 4LOPA 3DU8A 2XKCA 4GYIA 5CSPA 2C1BA 5E8TA 1H1RA 1JKLA 1WBNA 1YRPA 3VBQA 2PULA 4GUBA 5AAEA 3LFFA 3F2RA 3UVPA 4DFZE 4KWPA 3NUNA 3CGOA 3NNUA 5TF9A 1KSWA 4BKJA 3D4QA 5GZAA 4DFBA 2QOBA 2BRMA 4BWPA 3ENMA 3HP5A 2PUUA 3E64A 4AZTA 3KXNA 4WNMA 5CX9A 5AR3A 2QONA 4WG5A 3EZVA 3QQJA 3CBLA 5J9ZA 3OTVA 4ZMEA 2V7AA 2YHVA 4S30A 3V8TA 4FI1A 4I1ZA 3QHWA 4O22A 1WBTA 1YI6A 2H34A 1OUYA 3KXXA 4QP2A 4XBUA 3LQ3A 3C4FA 3TACA 3A99A 3RPVA 5J7HA 2X0PA 3ULZA 2YZAA 5CEIA 4ONAA 4IQ6A 4X3FC 4A4XA 4BDFA 4EKKA 2JDOA 1M2RA 2YCQA 2ZV7A 4M8TA 4MQ2A 4UWBA 3M11A 3W2CA 4QP8A 4AGCA 1UU9A 4P2KA 3S1HA 1OL1A 4EH9A 3EN6A 4FBXA 4GG7A 4C57A 3C7QA 4QT1A 1T45A 4YO4A 3W8LA 4RIWB 4ZEGA 5BUJA 3QA8A 4LOQA 3BE2A 2OF4A 2RGPA 3BEAA 2W06A 4GFGA 5C4LA 3R22A 4N4SA 4C0TA 4BCJA 4EYMA 2WZJA 2X8EA 3RWQA 1U54A 4XV2A 5IA0A 3PG3A 4X2FA 4KS7A 3FI3A 4K77A 2UVXA 3DLZA 2H9VA 4AZSA 4O7LA 4E20A 4R1YA 5CSXA 4ACHA 3PA4A 2YDJA 3TDVA 1Q8TA 3SXFA 1LEZA 5LWMA 4GKIA 4V01A 2HXQA 4IX5A 2IPXA 3NNVA 3GU7A 3DXQA 2B1PA 5I9XA 3PXFA 1ZZLA 1Q62A 4FSTA 3EWHA 3SXRA 4ERWA 4YPSA 3T9TA 3R63A 3TNQB 5L8JA 3VS1A 3D2KA 4ZTHA 4ZTLA 1RDQE 4FRFA 1ZWSA 4OW8A 5CENA 3LJ2A 5A4EA 5J79A 2W17A 3SG8A 4U3YA 4D2TA 3ZLSA 2XK6A 2F7ZE 2WTDA 2XYUA 4CMTA 4K18A 1RE8A 3BPRA 4FV2A 3UOKA 4Z7GA 1SYKA 3FQEA 4WG3A 5HU9A 4DBNA 2HXLA 1ST0A 3ZZEA 4JI9A 2DWBA 1PXLA 2I0HA 1OKYA 4FTTA 3R9OA 3FLYA 4YSJA 1OL2A 3C4XA 5J5TA 2CDZA 1Z57A 4YJSA 4LGDA 1YOMA 1YXSA 2EXMA 4JNWA 4ZSLA 1REJA 1JNKA 3U4UA 3ZTXA 3R8UA 1NVSA 3TKUA 4DCEA 4EZ5A 1PW2A 1Q41A 2R3NA 4YNEA 4QDVA 1IAJA 4DH7A 5KBQA 3UDTA 4F64A 2XBJA 3HDMA 5KKRC 1H27A 3DK7A 4FT9A 2KULA 2UZBA 3KRRA 3LW0A 4B0GA 3KU2A 2CGXA 3ORTA 5T6KA 4D5KA 3O71A 3QZIA 4RSSA 5C26A 4O27B 1GJOA 4G34A 1Y6BA 2YM7A 4CVAA 3I81A 4I93A 5L3AA 1GNGA 4ZTSA 5EI8A 2YFXA 4YTHA 1E1XA 1YDSE 2GS7A 5LVLA 5CANA 5HG9A 4J98A 4CCUA 3LIJA 3R9DA 1M52A 3KMWA 3BBTB 4YLJA 2C0TA 4GJ3A 3TYKA 2YCSA 5AUVA 1U5RA 3HMNA 2WMUA 4C62A 3VBVA 4F6WA 3FEGA 4EONA 3FHRA 2QD9A 3K54A 1T46A 3U87A 1O9UA 2QOOA 2YEXA 3ORIA 5BVEA 1R0EA 3QQKA 4IBMA 3TZ9A 1WVYA 2QC6A 2X6DA 4BY9E 4FKVA 4YJRA 3PP1A 2X2MA 1UWHA 5DEYA 4AWIA 4CKRA 5HNIX 3TI1A 4OR5A 4JRNA 3E93A 4I0SA 4E4MA 3PSDA 2QO9A 2I1MA 3CR0A 3D83A 2ZMDA 5KZ0A 3UO5A 4IE9A 3RPYA 4FTQA 4JRVA 1PMUA 3VHKA 2PZIA 2XB7A 2FSOX 3AGLA 1ERKA 4K1BA 1MUOA 3PWDA 5AUYA 3AC5A 5C27A 4U9AA 1R0PA 3C51A 1ATPE 3LMHA 5AV3A 3NNWA 1W2FA 4HYIA 1Y8YA 4OTDA 1MQ4A 3COIA 4O4CA 5HG7A 3SQQA 3R04A 2HENA 4F9AA 2ITUA 4FKUA 4O4FA 3BYVA 3TN8A 3A61A 3RWPA 3UIBA 3SW7A 4QOXA 4BKYA 2R3LA 2EVAA 1SM2A 2YAAA 5CSHA 2A19B 1U5QA 2R4BA 4YSMA 3TDWA 3NW6A 4HYSA 2QCSA 4AN2A 3QZFA 2O64A 2PTKA 3G9NA 5A54A 2F9GA 4FNZA 3VUDA 1PXMA 4IDTA 3DTCA 4YJPA 3MVMA 4AX8A 1UV5A 4NEUA 4KA3A 4C4IA 1KE8A 1OVEA 5IMEA 5LMKA 4HGTA 1PXNA 4OGRA 4TPTA 2WQEA 1QPDA 2J7TA 2YCFA 2J0MB 3Q9XA 3UMWA 2XALA 3NPCA 3TJCA 1XBBA 2CPKE 4F6UA 3QTUA 2WOTA 4AOJA 1PY5A 2ITTA 2C1AA 4MXAA 5F95A 5BV3A 3H30A 5B0XA 5HCXA 4IMYA 3QXPA 4QMSA 3ZMMA 2C6MA 3BHTA 3PE1A 4I20A 3OWJA 5A14A 4NKAA 5AUWA 4MX9A 2UZDA 1OL5A 3VAPA 3UIXA 5FEEA 5BVKA 2VD5A 4UMQA 3G0EA 3GI3A 1APME 4R7BA 3QKKA 2DQ7X 4UMRA 4FL1A 4FZ7A 2RG5A 2CN5A 2UZEA 2NYAA 4WOVA 2J0IA 3L9PA 3PXQA 3LKMA 5EFQA 2YJRA 3C4WA 1XR1A 2HWPA 2Z7LA 3AT2A 4NJDA 2BZHB 2QLQA 4I92A 4D5HA 3W2RA 1ZYLA 4S34A 4FSMA 4CRLA 3ZM9A 4DT8A 3KKVA 2VWYA 4QYYA 3VS5A 2YITA 4LRMA 5D12A 4QEBA 2DUVA 4Y95A 3WZDA 3BZ3A 4MK0A 4C38A 5L6PA 2YWPA 3SXSA 2FYSA 4IAAA 5DBXA 5BQ0A 2O65A 4NFNA 3LFDA 3HNGA 2Y9QA 1J7UA 4EJ7A 3O2MA 2ITYA 4XUFA 3UPXA 4ANMA 4CZYB 4FVQA 5AUXA 3R9HA 4JDJA 5D7VA 4EK4A 3I5NA 4L3LA 4R7IA 3UIUA 2HAKA 2YZLA 3OROA 3G9LX 4IIRA 5IA1A 4O6EA 5E8UA 5HLNA 3NFGB 3NVMB 4FR4A 3BU5A 3FZ1A 5CEOA 3PY3A 1H26A 5A4QA 5M09A 3V5JA 5ACKA 4A4OA 4QO9A 5LVMA 3VBTA 2VWVA 3C0IA 2R3OA 2W1ZA 4U8ZA 5HO8A 4ACCA 4CV8A 4PDPA 3DQXA 2CJMA 4NM3A 5IEXA 3GCUA 3EKNA 3RP9A 1VLRA 4H3PA 3R9NA 4QYGA 5EQPA 2F2UA 4YBKA 4BDKA 2P2IA 4IJ9A 5A6NA 5LMBA 3BLAA 4GU9A 5LQFA 1XO2B 4LQMA 2R5TA 2XIZA 4JX7A 1MRYA 4IC8A 4E6AA 2CNQA 1XJDA 2QOQA 2XIKA 1H25A 1OL7A 4UZDA 3RHKA 4I0RA 3UNZA 1ZLTA 3NWWA 2XANA 4Q9SA 3MSSA 1OPLA 4GT5A 4HYUA 4FGBA 3ATTA 3ZSGA 4TYHA 2YERA 2XP2A 4S32A 4C59A 5CZHA 1NW1A 1GIJA 3F7ZA 4K6ZA 1YXTA 4B8LA 4HVHA 2XJ0A 4I22A 4C4EA 2W1GA 2WIHA 2YLFA 5AWMA 1H00A 2OICA 2R7BA 5GJGA 5CU0A 3NUAA 4EH7A 3EFJA 5J8IA 4ANSA 4M0YA 1YWRA 3LFQA 5FGKA 4BCIA 3Q3BA 4HVSA 1YHVA 4FT0A 4F0IA 4W8EA 5AV0A 2X39A 5AM7A 3RAWA 2E2BA 3G90X 4GVJA 1HOWA 3HA8A 3MH3A 5M57A 2PZPA 2QURA 2JD5A 5JFWA 4NL0A 1Q8ZA 2UW4A 3BCEA 3OT3A 3CQEA 3LM0A 3PIYA 2F49A 4XEYA 2RKUA 3BGPA 4QMWA 5AX9A 4AZVA 4F4PA 5K5NA 1ZXEA 5JZJA 4B7TA 2OJ9A 2RL5A 4NK9A 4OAUC 4RJ7A 4M69B 2F57A 3F3WA 4BDHA 5IPJA 1VR2A 2JDVA 3Q9YA 4U7ZA 2BALA 3ULIA 2I40A 3NZ0A 1OIRA 4X2JA 4ZS0A 5HHWA 3FJQE 3KULB 1IAHA 4FKWA 4WIHA 4DH5A 4DEBA 1YXVA 3NCGA 1MQBA 4I6HA 4O2ZA 5DHJA 4OBPA 5T68A 2XKFA 3PY1A 4FEQA 2QU6A 2YISA 3DJ7A 4JG8A 1PXJA 4NKSA 5HO7A 4MAOA 4E6CA 4EEVA 3OY1A 5EM8A 3NAXA 3BHYA 3KXHA 4GFMA 2XEZA 5ETCA 5E7RA 3PJCA 3B2TA 3VS6A 5BPYA 3RK7A 3TMOA 3BV3A 4QMQA 3FPQA 4EH8A 2ITQA 2W5BA 3DNDA 3UP2A 1R3CA 3AKKA 1Q4LA 4ALWA 5FEQA 4QP9A 5EW8A 2B9FA 3DKFA 3UZPA 2VTJA 5GNKA 4FTNA 2RFSA 3E3BX 2ZV2A 4NM0A 3EQCA 3ET7A 2YA9A 3C9WA 4EOJA 3O96A 5F20A 3U55A 1JSUA 4U40A 2AYPA 1KE6A 4DINA 4QNYA 3SRVB 3QUPA 4HGLA 5DFPA 3CTJA 3AG9A 3PZEA 5HCYA 1Y6AA 4Z16A 3E92A 3U9CA 4I5CA 3FLSA 1NA7A 5CAOA 4U6RA 3UQGA 5HE0A 4XG7A 2CMWA 2YM4A 5IH4A 3ZUUA 2Z2WA 2WPAA 3PLAE 4WSYA 4YHJA 2Q83A 3QTZA 4ZTRA 3W0RA 4FL3A 4KBKA 4FKOA 2OBJA 5LARA 3HKOA 2YIRA 4P5QA 3QTSA 1FPUA 1M7NA 4D4RA 1UU7A 5EDQA 1CKIA 2WKMA 3I7BA 3KB7A 4YBJA 4ID7A 4CSVA 4N0SA 4IZAA 5HLWA 5JEBA 4EQCA 3Q2JA 4C8BA 2R3FA 2UZLA 2IVSA 4AW5A 4H39A 3BYOA 5KO1A 4O0XA 5L2WA 2W1HA 5JRQA 2J50A 5BVDA 2BAJA 5J95A 3QTQA 3P23A 2CNUA 4RRVA 3JVRA 4KAOA